5H2FH

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 15
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5h2fH01
3A0BH 5KAIH 5TISH 4IL6H 4UB6H 3JCUH 5KAFH 2AXTH 3KZIH 5B5EH 5B66H 5E79H 4UB8H 5H2FH 4PJ0H 1S5LH 3A0HH 5GTIH 3WU2H 5GTHH
chains in the Genus database with same CATH superfamily
3AEBC 5KLIC 1VQMP 1RH5B 2ZT9D 1PL5A 2V4HA 1SQQE 3FX0A 1LGHB 2GUSA 3RK2C 2XNXA 3KPEA 2IBZG 1RF1C 3GMAA 2ZXXA 4K3AA 4D6TG 2CPSA 3TGUD 2CK3H 1BE3E 2QJYB 5KTBA 2Q7CA 3C9IA 2QM8A 5AW3B 2OGUA 3Q1MA 1VF5D 2P67A 2Z5IA 1ZN5A 2NPSB 1KB9E 1HTLC 3FGAD 5BU8B 1NH4A 3GG2A 5CJ4A 3L74E 3RBZA 2W83C 1NU1E 2V7QH 2WSFJ 3R4YA 5AW5B 3KZIE 4GOEA 1NKZB 3TK1A 1KYOI 2YNYA 3GW6A 3L72D 1GDTA 1M90Q 1GW3A 3AE7C 2J59M 1DD3A 3L36A 2D2CD 2J5UA 3VMXA 2QJYC 2C9NY 1HF9A 3RL0B 4ZNCA 1T3JA 4MN4C 2WQYC 3RBXA 4I2LC 3RL0g 2LR2A 2H89C 1LTAC 2FYUG 1VQ9P 1P84I 5AW8B 1ZMEC 1JY2N 2M3EA 1Z56A 1T6AA 3C1LA 4IL6X 2ZFCA 5CCGD 3A0HE 4U3FJ 4IFFA 2K1AA 5KAFH 1SLQA 3M9HA 1IFNA 2UWJE 4N78D 1SQPE 4PD4H 4H0LD 2BCCG 1OVRA 1E79H 3ABVC 3HE4A 5APTA 5L8RJ 1SQQD 3L35A 4CPGA 1EZVG 1IO4A 3H1HG 1NTZJ 3B4SA 3AE8C 1EXIA 2FKWB 1AQ5A 1SQBG 3VMAA 2YIUB 3CC7P 2XKMA 1JY2O 4ZKPA 1NTKD 1M8OB 1XTCC 1OW7A 1M7LA 2W90A 3VN0A 1ZRTE 1VQ5P 1IFIA 1OVVA 1JEKA 5BU5A 2JDIH 1JY3P 4NPEA 3M9BA 4WY4D 1S5LH 1GU5A 2ZT9C 2QA4P 1VQOP 3H1KG 3Q5SA 2KOGA 3EWKA 3L74D 2ZAEB 1M1KQ 3SWFA 3CLQA 1PZQA 3L75D 3HRNA 2OQQA 1SQXG 4GOFA 2PFXA 4IOIH 2P7JA 2FYNB 2D2CB 2JR8A 3CCRP 1KORA 5CCGA 5AVUB 2H88C 1PFIA 2JEEA 4I7ZB 4LGDE 1YITP 3L70J 5K5GB 1PP9G 1JMMA 1SS1A 4C7NA 3CWBJ 1VF5C 2POHA 2K88A 1GL2D 3AEDC 2QE7H 1MKMA 4AQRD 3MZWB 5KKZB 2AEJA 4ZKUA 4NPDA 1URQD 3NXSA 4DZOA 2GM4A 1N7SD 2JP3A 1SQQJ 2XV5A 1LTJA 3CC2P 3CPWO 1USDA 5GTIH 1NTME 4DCKA 3H1IE 2O1JA 2FBWC 2WSEJ 1EDLA 3D6YA 1E5WA 2H8PD 3L71E 3EQ2A 2D2CC 2J58A 2QJKB 3L73G 4YPCA 1PGJA 5APQA 4WY4A 5APUA 1A02F 3CCUP 1R5SA 3CMEP 1BE3J 4PJ0H 2C0XA 3U1AA 3VTPC 1FBMA 3I56P 2WSCJ 4OVNF 5AVTB 1LTJB 1QGKB 4EIJA 1AFOA 2WSFH 2FFDA 5H2FE 2QRXA 4PV1B 1SQQK 3IF4A 3CX5E 5GTIE 3WUTA 2K9JA 2P10A 3OJAB 2B9BA 5KLVD 4WY4B 4UB8H 1AVOA 5CCGC 1J1DB 3L74J 4U7JA 4PD4D 5KKZC 1HJBA 1RF0A 1DX7A 1NU1J 1L0NG 3H1JD 1KMIZ 4IFMA 4PJ0E 2A45I 4H0LC 2FFDB 1HBWA 1L0LD 1LJ2A 1JB0J 4W80A 3M91A 1GL2A 4WBAA 2R3CA 1L4AD 1PGOA 1OIPA 2E43A 5CBOA 2IBZE 2KLVA 1URQA 3RK2D 2N1TD 4D6TE 1N7SA 5CBNA 2B87A 2MJZA 1SQVD 1OMIA 1LTJC 1GL2B 1OVUA 1YI2P 3MD0A 2P1JA 1Y47A 3CXHH 2YO3A 4GKGA 1HJ0A 3OW2O 3G71P 2PRRA 3W68A 1URQB 4WY4C 1SVFA 2KYVA 5GTHE 1MUUA 4B86A 1Q7YQ 4WWIA 2FFDC 1SQPJ 3WMM0 3N4XA 1VQ7P 3I5CA 3V6IA 1LT9B 1EZVI 2AEFA 3FXEA 3CXHE 2ZVOB 4H13D 1RF0C 2OTLP 5CCHD 3RK3B 1X0TA 2RH0A 3IN6A 1K9MQ 1FOSF 3PHLA 1LTIC 1EDIA 1J2JB 1GL2C 1SQPK 1L4AA 1GK6A 1DD4A 3H32A 3AE9C 3H1JJ 4I1LA 4K35A 1USEA 4W7YA 2KSEA 2SPZA 1LT1A 2W6AA 1YJNP 1PGQA 2FYUE 1URQC 1PIXA 3H1LG 3PRJA 2N1TA 1N7SC 1X22A 5TISH 1NOHA 3LIEA 1KILE 1L4AB 5KLVK 1WMKA 5KLIB 3H32B 2BEQD 2BCCE 1A02J 3V2RA 3RK2B 2N1TB 2C0WA 3PTZA 1RF1B 3AEFC 1VDFA 1IJDB 3GHGA 4JQ0D 1EZVE 1EDKA 3D71A 3H1HE 3CC4P 1SQBE 5CHXA 3CCSP 1DEBA 3IAOA 2Q1KA 1S9KE 1IZNB 2W8ZA 3VYIA 3G9RA 3ITKA 2M0BA 2QVAA 5AW2B 2R44A 3P8CE 3FXDA 2WSEH 5CCHA 1NAYA 1HGZA 2O1KA 1NO4A 1G2CA 3H1KE 2Y0CA 3HE5A 2WSCH 1L4AC 1BGYG 4JYBA 1N73A 3H1IJ 1JY3N 4H13B 3L71J 1SQXE 3JC22 4U3FD 1KB9H 2N1TC 5TJHA 2M5AA 3E1RA 3P32A 3CXHD 2KSJA 3HE5B 2ZVNB 4XFJA 1PP9E 3KZIH 3O8ZA 1S1CX 4IL6E 3CL3D 1NTZD 3V2QA 3AE6C 3GHGC 3G4SP 2JJLA 2QG4A 4N6JA 1S3JA 3USSA 1LTGC 1RQUA 3AE2C 2FYZA 1VQ4P 5E79E 1PPJD 4H13C 1GK4A 1Y8AA 2A45G 3BCCG 5CCHC 2M3BA 2JWDA 1FE6A 2HFED 3MHVA 4D6TJ 3L73E 2Q6QA 5DJUB 3KQGA 1CSBA 2ZYDA 3A0HH 5APYA 2A06D 1YJ9P 1N73C 2QJPC 3M9QA 3TGUG 5C39A 2H43A 2JWAA 3IR9A 1J1EB 3GLMA 3L70D 2Q3IA 5AW4B 4PD4I 3CWBD 1KQLA 1L0NE 3HTKA 3FWLA 2ZT9B 1IK7A 1FZFA 2ZJSE 2RKLA 3BRVB 5AVZB 1G1JA 3AE4C 3CCJP 3F89A 5DJTB 2WZ7A 2KB7P 1T8ZA 4TT3H 3U1CA 3PLNA 3HTKB 2WT7A 4XA4A 2RN0A 1KQSO 4W7ZA 1OW6A 2OTKE 4Y99C 3H25A 2KUBA 1D7MA 1HH0A 2O01J 3A0BE 1KYOE 3L72G 1S2EA 1IFDA 5AVSB 2W6BA 1VF5B 5APXA 1BE3D 1RE4A 4AYCA 2FYUJ 3HE4B 3RK3E 3ZDMA 1J1EC 1EQ7A 1VL2A 1AV1A 3VMYA 1KB9D 1RHZB 1NTZK 5APSA 1P84E 2BCCJ 3CCLP 1MV8A 3A7OA 2PP6A 2YKOA 4R4LA 1NU1D 1OFCX 4AUWA 2FYUK 1HVVA 5KAIE 4OGQD 2HR3A 3SFDC 3H1HJ 3KXDA 2AXTE 1Q90D 1SQBJ 2L91A 1ZLLA 3CCQP 4RESB 2OYOA 4OWFA 2QM7A 2IZ1A 3SWYA 1GZLA 5EFWB 2E75D 5AVXB 3BASA 2KLUA 3H1LE 1BCCE 1NTKG 4YXDC 3H1KJ 2WPQA 1YYCA 2YKPA 2RMZA 1SQBK 1KILC 4H0LB 4C7NB 5H2FH 1RQVA 1FU1A 2E76C 1SQXJ 3CX5H 1RE4C 1X79B 3S4RA 2FXPA 1Q2NA 3P8MC 5AW9B 1SQPD 2P2UA 3L75G 1DEEG 1HUCA 4GODA 1PP9J 2QSIA 3KYQA 1ZXGA 1YTZI 1Q82Q 1FZCA 1K8AQ 1W2BO 3BATA 4H44D 5CMZA 1M56D 4JF7A 2KXPB 3CMAP 3CD6P 1H0TA 1CI6A 2IYPA 1ZRTD 4EDFA 4L73A 3K5BA 4EI2A 3PH0A 2IYOA 1BGYE 4OH8B 1FDIA 1S5LX 1HGVA 4OGQB 3GF3A 3MGNA 1OZHA 3SSUA 1EXJA 2K9JB 1T2KD 3L73J 1H0TB 1NJIQ 4L74A 1CI6B 3WUVA 5GTHH 3M06A 1FOSE 1S72P 1AJYA 1NU1K 2L5GB 1JUNA 3QWOC 2MKVA 2E75B 3B5NC 1QEXA 2I8DA 1T3UA 3HD7D 1PGPA 2A45H 4GDOA 2ZYGA 3F5HA 1Q86Q 1QLED 1BSHA 1QVGO 1L0NJ 2K37A 3PP5A 2JKVA 1IK9A 2WSSH 1N7SB 2B87B 3H1LD 5KLVG 2HODA 2O01H 3PJSK 5AW0B 3GF7A 1FZCC 3LIDA 3H1JG 4OGQC 1FJKA 1VQLP 1W2EA 1NAFA 1BDDA 3BCCE 3WUUA 3VOPA 1L0LG 1CZQA 3TYYA 4NPFX 2Q3EA 5AW1B 1NTMD 3KHUA 3MUDA 2R5BA 1L0NK 3AE3C 2Y9ZA 2KIKA 3H1ID 1JM0A 3L71D 1KFNA 2XU6A 1UIIA 4WB4A 1GMJA 1AVYA 1OW8A 2ZYAA 2E75C 2KP8A 4H44B 3WU2E 2XDJA 3FWNA 3TGUE 2OYHA 2IFNA 2WPVB 1QX8A 1SQVG 3SFEC 3CX5D 3KDPB 2NZ2A 2WMMA 1BCCG 2W6JH 1GU4A 1FJPA 2B89A 2FY8A 1M1JA 1M57D 5AVVB 4EOTA 3G3ZA 3HD7A 2KZJA 2OYHB 3JCUE 5AVWB 3SWKA 1R5LA 3U59A 5B5EE 2NPSD 2C9LY 4O9BA 2YXQB 2IBZD 4GT1A 2ITAA 4ASVA 3LW5J 3L72E 4GIFA 1NYHA 1R8EA 4D6TD 1MFTA 4H44C 1ZR2A 2JO1A 3H1LJ 1NKNA 3MUDC 3N7NA 3GHGB 1U7MA 1YQ4C 1LWUA 2E74D 3AE1C 1KB9I 1ZP0C 1YIJP 5AVRB 1IC2A 1N7LA 1NTMJ 2NRGA 4IL6H 1T2KC 4JBZA 2OYHC 3A5TA 3CCVP 1LNQA 4LLHA 4RJTA 3P7KA 3G6EP 4N78E 1G2CB 1M1JC 2GUVA 4HYTB 1U7JA 1NVOA 3HD7C 4Y28J 1ZR4A 1N73B 2QJPB 5E79H 1NTMK 3B8EB 3MP7B 3QH9A 2NPSA 2BEZF 2YMYA 1U57A 3V4WA 2M5AB 5KJ7D 1N86A 1NTKE 4A7PA 1KQFB 1JY3O 2FYUD 1BGYJ 3AEGC 1VQ6P 2XNDH 3II6A 3Q5PA 2R32A 1KILD 4UB6H 1W5CE 2E76D 5AVQB 4XE5B 1LWUC 4KT0J 2BCCD 3L75E 3OA7A 1SFCD 4U3FG 4Y99B 1L2PA 1JTHA 3AE5C 1JOCA 4BRYA 1Y9BA 1KV4A 1EZVD 4YXWH 1YHQP 1FDOA 3H1HD 1FZEA 4R4MA 1SQBD 1KC8Q 2E74B 3BRTB 4UB6E 3AEAC 1S9KD 4DJGA 4RO0A 1OWAA 4JPZB 2E42A 5BVZA 2QEXP 1JTHB 3P8CD 1NTZG 4BRYB 3A0BH 1KYOH 1ZW0A 3BVHA 1DH3A 1RE3A 2BASA 2E5YA 4KHXA 1JMBA 4Z1MH 3HUSA 5B66H 3BCCJ 2WPRA 2NPSC 4EYYQ 3H1KD 3Q3DA 5KJ7A 1PV3A 2ZXEB 2N9BA 1UIXA 1PPJG 1SQXD 1SP4A 1P84H 3HUSB 3AEEC 3TGUJ 1LP1A 2O3JA 1YTZT 1KILA 2HYNA 4HB1A 5B66E 1NWQA 2A06G 1PP9D 2YO2A 2IX7C 2E74C 5KAIH 2LXCB 3B5ND 1GW4A 1FC2C 5M1BA 2WT7B 2AXTH 1SFCA 3C8VA 2K3RA 3O6QA 3TNUA 3I55P 4LC1A 5KAFE 1X9VA 3L70G 1LP1B 5KLVE 1N2DC 2WPSA 1Q81Q 1KILB 3RL0C 4PD4E 3LW5H 1WRGA 2E76B 4PV1D 3CWBG 1FZGA 3H1JE 2OYIA 1K04A 2VRSA 5AW7B 1VQPP 1SFCB 1L0LE 3JSVC 1OX3A 1BSNA 3O6QB 2R5DA 3TNUB 1LTBC 2Q5UA 3TSIA 3L72J 3M0AA 1YBKA 1RE3C 3L73D 3H6PA 1SQQG 3HUSC 3Q5RA 4ASWA 2FXOA 3TF5A 2OYIB 2N9YB 5KJ7C 1KD1Q 2IZ0A 1NHLA 3EFGA 1SQVE 5APWA 4BWNA 1KFMA 3NMDA 3CX5I 3A2AA 1YJWP 1S5LE 1JCCA 2HLOA 2YIUC 1WT6A 1BE3G 4HJGH 1HWTC 1H89A 2O01N 4TLFA 2R3SA 2WITA 2KNCA 4N3YB 1L0ND 3A3YB 2KZIA 2QIWA 1G1IA 1X8YA 3B5NA 1VQNP 1IFPA 3OAKA 1SFCC 1VQ8P 3L74G 3L37A 3IFMA 1NU1G 4RKUJ 3V5BA 4C7RA 2IBZI 2M8RA 2KNCB 2YMKA 1QVFO 1K73Q 1MZ9A 3B5NB 2E5TA 2FYNC 2OYIC 4YTPC 1NGMB 1SQXK 2Q9IA 1KYOD 1JO5A 1GD2E 3TDKA 1NTKJ 1ZOYC 3R2PA 4I7ZC 2G8YA 4KJMA 2PGDA 3S1KA 3RK3D 3AECC 1JY2P 2GA1A 3MIWA 2KS1A 2Y0EA 2IFMA 3UIAA 4L75A 2DW3A 3EFFK 1FZCB 2KI7B 1JCDA 2WTYA 4DT0A 1P84D 2OTJP 2B88A 1EC5A 2WWWA 3L75J 4I6MC 1NTKK 2YKQA 1MFZA 1IFMA 3CXHI 2KS1B 1GTWA 1QL2A 1OXZA 1SQPG 1DIPA 2QJKC 4UB8E 4WVZA 2HPCA 1FZAA 1LTSC 4HKZH 2AXCA 3E1IA 2V7QJ 1AA0A 1BDCA 1KTMA 3CCEP 2P58A 3D70A 4PV1C 1FAVA 1BCCD 2PAJA 3MTUE 1LT9A 3WU2H 3VP8A 3M0DA 1FDMA 1CW5A 2HPCB 1J1DC 1H8AA 3V2NA 2IPPA 4QMAA 2Z5HA 1TU3F 3V4QA 1K05A 2Z4EA 2I1KA 4U3FE 4IFDK 2HODB 3V2PA 2G3AA 2AEMA 2LXBA 4DOJA 1JNMA 3JCUH 1IFJA 4C46A 3VMZA 2I1JA 5B5EH 3E7KA 4BXLA 2FXMA 2W27A 1FS0E 5AW6B 1RY3A 3NFQA 5KLVJ 3RGUA 1VPCA 1NTZE 2K9YA 3W67A 1S4XA 4ZMDA 3Q2YA 4JYCA 1L0LJ 1RF1A 1BGYD 2Y0DA 1FZBA 3CI9A 1KQGB 3L4FA 1EDJA 1PPJE 3NTNA 2HG5D 3B71A 1M1JB 2CPBA 2XZRA 3D6ZA 1ZV8A 1LT9C 1NTMG 2IDBA 3HD7B 3M0DC 3S9OA 4M3LA 1KN7A 3T97A 3H1IG 4L76A 2KK7A 1KZUB 1SQVJ 3L71G 2A06E 4HH2A 3VP9A 1L0LK 3RK3C 1AQTA 1BCCJ 5CJ0A 2OARA 2Y9YA 5TISE 2WVRA 1VQKP 5APVA 3L70E 1XTGB 2LKMA 3T97B 3CWBE 2YXRB 1SQVK 3RL0D 1QL1A 3CCMP 1N8RQ 2H7HA 1YQ3C 1LWUB 1LTTC 3BCCD 1H88A 5AVYB
chains in the Genus database with same CATH topology
3A0BH 5KAIH 5TISH 4IL6H 4UB6H 3JCUH 5KAFH 2AXTH 3KZIH 5B5EH 5B66H 5E79H 4UB8H 5H2FH 4PJ0H 1S5LH 3A0HH 5GTIH 3WU2H 5GTHH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0B H;  5KAI H;  5TIS H;  4IL6 H;  4UB6 H;  3JCU H;  5KAF H;  2AXT H;  3KZI H;  5B5E H;  5B66 H;  5E79 H;  4UB8 H;  5H2F H;  4PJ0 H;  1S5L H;  3A0H H;  5GTI H;  3WU2 H;  5GTH H; 
#chains in the Genus database with same CATH topology
 3AEB C;  5KLI C;  1VQM P;  1RH5 B;  2ZT9 D;  1PL5 A;  2V4H A;  1SQQ E;  3FX0 A;  1LGH B;  2GUS A;  3RK2 C;  2XNX A;  3KPE A;  2IBZ G;  1RF1 C;  3GMA A;  2ZXX A;  4K3A A;  4D6T G;  2CPS A;  3TGU D;  2CK3 H;  1BE3 E;  2QJY B;  5KTB A;  2Q7C A;  3C9I A;  2QM8 A;  5AW3 B;  2OGU A;  3Q1M A;  1VF5 D;  2P67 A;  2Z5I A;  1ZN5 A;  2NPS B;  1KB9 E;  1HTL C;  3FGA D;  5BU8 B;  1NH4 A;  3GG2 A;  5CJ4 A;  3L74 E;  3RBZ A;  2W83 C;  1NU1 E;  2V7Q H;  2WSF J;  3R4Y A;  5AW5 B;  3KZI E;  4GOE A;  1NKZ B;  3TK1 A;  1KYO I;  2YNY A;  3GW6 A;  3L72 D;  1GDT A;  1M90 Q;  1GW3 A;  3AE7 C;  2J59 M;  1DD3 A;  3L36 A;  2D2C D;  2J5U A;  3VMX A;  2QJY C;  2C9N Y;  1HF9 A;  3RL0 B;  4ZNC A;  1T3J A;  4MN4 C;  2WQY C;  3RBX A;  4I2L C;  3RL0 g;  2LR2 A;  2H89 C;  1LTA C;  2FYU G;  1VQ9 P;  1P84 I;  5AW8 B;  1ZME C;  1JY2 N;  2M3E A;  1Z56 A;  1T6A A;  3C1L A;  4IL6 X;  2ZFC A;  5CCG D;  3A0H E;  4U3F J;  4IFF A;  2K1A A;  5KAF H;  1SLQ A;  3M9H A;  1IFN A;  2UWJ E;  4N78 D;  1SQP E;  4PD4 H;  4H0L D;  2BCC G;  1OVR A;  1E79 H;  3ABV C;  3HE4 A;  5APT A;  5L8R J;  1SQQ D;  3L35 A;  4CPG A;  1EZV G;  1IO4 A;  3H1H G;  1NTZ J;  3B4S A;  3AE8 C;  1EXI A;  2FKW B;  1AQ5 A;  1SQB G;  3VMA A;  2YIU B;  3CC7 P;  2XKM A;  1JY2 O;  4ZKP A;  1NTK D;  1M8O B;  1XTC C;  1OW7 A;  1M7L A;  2W90 A;  3VN0 A;  1ZRT E;  1VQ5 P;  1IFI A;  1OVV A;  1JEK A;  5BU5 A;  2JDI H;  1JY3 P;  4NPE A;  3M9B A;  4WY4 D;  1S5L H;  1GU5 A;  2ZT9 C;  2QA4 P;  1VQO P;  3H1K G;  3Q5S A;  2KOG A;  3EWK A;  3L74 D;  2ZAE B;  1M1K Q;  3SWF A;  3CLQ A;  1PZQ A;  3L75 D;  3HRN A;  2OQQ A;  1SQX G;  4GOF A;  2PFX A;  4IOI H;  2P7J A;  2FYN B;  2D2C B;  2JR8 A;  3CCR P;  1KOR A;  5CCG A;  5AVU B;  2H88 C;  1PFI A;  2JEE A;  4I7Z B;  4LGD E;  1YIT P;  3L70 J;  5K5G B;  1PP9 G;  1JMM A;  1SS1 A;  4C7N A;  3CWB J;  1VF5 C;  2POH A;  2K88 A;  1GL2 D;  3AED C;  2QE7 H;  1MKM A;  4AQR D;  3MZW B;  5KKZ B;  2AEJ A;  4ZKU A;  4NPD A;  1URQ D;  3NXS A;  4DZO A;  2GM4 A;  1N7S D;  2JP3 A;  1SQQ J;  2XV5 A;  1LTJ A;  3CC2 P;  3CPW O;  1USD A;  5GTI H;  1NTM E;  4DCK A;  3H1I E;  2O1J A;  2FBW C;  2WSE J;  1EDL A;  3D6Y A;  1E5W A;  2H8P D;  3L71 E;  3EQ2 A;  2D2C C;  2J58 A;  2QJK B;  3L73 G;  4YPC A;  1PGJ A;  5APQ A;  4WY4 A;  5APU A;  1A02 F;  3CCU P;  1R5S A;  3CME P;  1BE3 J;  4PJ0 H;  2C0X A;  3U1A A;  3VTP C;  1FBM A;  3I56 P;  2WSC J;  4OVN F;  5AVT B;  1LTJ B;  1QGK B;  4EIJ A;  1AFO A;  2WSF H;  2FFD A;  5H2F E;  2QRX A;  4PV1 B;  1SQQ K;  3IF4 A;  3CX5 E;  5GTI E;  3WUT A;  2K9J A;  2P10 A;  3OJA B;  2B9B A;  5KLV D;  4WY4 B;  4UB8 H;  1AVO A;  5CCG C;  1J1D B;  3L74 J;  4U7J A;  4PD4 D;  5KKZ C;  1HJB A;  1RF0 A;  1DX7 A;  1NU1 J;  1L0N G;  3H1J D;  1KMI Z;  4IFM A;  4PJ0 E;  2A45 I;  4H0L C;  2FFD B;  1HBW A;  1L0L D;  1LJ2 A;  1JB0 J;  4W80 A;  3M91 A;  1GL2 A;  4WBA A;  2R3C A;  1L4A D;  1PGO A;  1OIP A;  2E43 A;  5CBO A;  2IBZ E;  2KLV A;  1URQ A;  3RK2 D;  2N1T D;  4D6T E;  1N7S A;  5CBN A;  2B87 A;  2MJZ A;  1SQV D;  1OMI A;  1LTJ C;  1GL2 B;  1OVU A;  1YI2 P;  3MD0 A;  2P1J A;  1Y47 A;  3CXH H;  2YO3 A;  4GKG A;  1HJ0 A;  3OW2 O;  3G71 P;  2PRR A;  3W68 A;  1URQ B;  4WY4 C;  1SVF A;  2KYV A;  5GTH E;  1MUU A;  4B86 A;  1Q7Y Q;  4WWI A;  2FFD C;  1SQP J;  3WMM 0;  3N4X A;  1VQ7 P;  3I5C A;  3V6I A;  1LT9 B;  1EZV I;  2AEF A;  3FXE A;  3CXH E;  2ZVO B;  4H13 D;  1RF0 C;  2OTL P;  5CCH D;  3RK3 B;  1X0T A;  2RH0 A;  3IN6 A;  1K9M Q;  1FOS F;  3PHL A;  1LTI C;  1EDI A;  1J2J B;  1GL2 C;  1SQP K;  1L4A A;  1GK6 A;  1DD4 A;  3H32 A;  3AE9 C;  3H1J J;  4I1L A;  4K35 A;  1USE A;  4W7Y A;  2KSE A;  2SPZ A;  1LT1 A;  2W6A A;  1YJN P;  1PGQ A;  2FYU E;  1URQ C;  1PIX A;  3H1L G;  3PRJ A;  2N1T A;  1N7S C;  1X22 A;  5TIS H;  1NOH A;  3LIE A;  1KIL E;  1L4A B;  5KLV K;  1WMK A;  5KLI B;  3H32 B;  2BEQ D;  2BCC E;  1A02 J;  3V2R A;  3RK2 B;  2N1T B;  2C0W A;  3PTZ A;  1RF1 B;  3AEF C;  1VDF A;  1IJD B;  3GHG A;  4JQ0 D;  1EZV E;  1EDK A;  3D71 A;  3H1H E;  3CC4 P;  1SQB E;  5CHX A;  3CCS P;  1DEB A;  3IAO A;  2Q1K A;  1S9K E;  1IZN B;  2W8Z A;  3VYI A;  3G9R A;  3ITK A;  2M0B A;  2QVA A;  5AW2 B;  2R44 A;  3P8C E;  3FXD A;  2WSE H;  5CCH A;  1NAY A;  1HGZ A;  2O1K A;  1NO4 A;  1G2C A;  3H1K E;  2Y0C A;  3HE5 A;  2WSC H;  1L4A C;  1BGY G;  4JYB A;  1N73 A;  3H1I J;  1JY3 N;  4H13 B;  3L71 J;  1SQX E;  3JC2 2;  4U3F D;  1KB9 H;  2N1T C;  5TJH A;  2M5A A;  3E1R A;  3P32 A;  3CXH D;  2KSJ A;  3HE5 B;  2ZVN B;  4XFJ A;  1PP9 E;  3KZI H;  3O8Z A;  1S1C X;  4IL6 E;  3CL3 D;  1NTZ D;  3V2Q A;  3AE6 C;  3GHG C;  3G4S P;  2JJL A;  2QG4 A;  4N6J A;  1S3J A;  3USS A;  1LTG C;  1RQU A;  3AE2 C;  2FYZ A;  1VQ4 P;  5E79 E;  1PPJ D;  4H13 C;  1GK4 A;  1Y8A A;  2A45 G;  3BCC G;  5CCH C;  2M3B A;  2JWD A;  1FE6 A;  2HFE D;  3MHV A;  4D6T J;  3L73 E;  2Q6Q A;  5DJU B;  3KQG A;  1CSB A;  2ZYD A;  3A0H H;  5APY A;  2A06 D;  1YJ9 P;  1N73 C;  2QJP C;  3M9Q A;  3TGU G;  5C39 A;  2H43 A;  2JWA A;  3IR9 A;  1J1E B;  3GLM A;  3L70 D;  2Q3I A;  5AW4 B;  4PD4 I;  3CWB D;  1KQL A;  1L0N E;  3HTK A;  3FWL A;  2ZT9 B;  1IK7 A;  1FZF A;  2ZJS E;  2RKL A;  3BRV B;  5AVZ B;  1G1J A;  3AE4 C;  3CCJ P;  3F89 A;  5DJT B;  2WZ7 A;  2KB7 P;  1T8Z A;  4TT3 H;  3U1C A;  3PLN A;  3HTK B;  2WT7 A;  4XA4 A;  2RN0 A;  1KQS O;  4W7Z A;  1OW6 A;  2OTK E;  4Y99 C;  3H25 A;  2KUB A;  1D7M A;  1HH0 A;  2O01 J;  3A0B E;  1KYO E;  3L72 G;  1S2E A;  1IFD A;  5AVS B;  2W6B A;  1VF5 B;  5APX A;  1BE3 D;  1RE4 A;  4AYC A;  2FYU J;  3HE4 B;  3RK3 E;  3ZDM A;  1J1E C;  1EQ7 A;  1VL2 A;  1AV1 A;  3VMY A;  1KB9 D;  1RHZ B;  1NTZ K;  5APS A;  1P84 E;  2BCC J;  3CCL P;  1MV8 A;  3A7O A;  2PP6 A;  2YKO A;  4R4L A;  1NU1 D;  1OFC X;  4AUW A;  2FYU K;  1HVV A;  5KAI E;  4OGQ D;  2HR3 A;  3SFD C;  3H1H J;  3KXD A;  2AXT E;  1Q90 D;  1SQB J;  2L91 A;  1ZLL A;  3CCQ P;  4RES B;  2OYO A;  4OWF A;  2QM7 A;  2IZ1 A;  3SWY A;  1GZL A;  5EFW B;  2E75 D;  5AVX B;  3BAS A;  2KLU A;  3H1L E;  1BCC E;  1NTK G;  4YXD C;  3H1K J;  2WPQ A;  1YYC A;  2YKP A;  2RMZ A;  1SQB K;  1KIL C;  4H0L B;  4C7N B;  5H2F H;  1RQV A;  1FU1 A;  2E76 C;  1SQX J;  3CX5 H;  1RE4 C;  1X79 B;  3S4R A;  2FXP A;  1Q2N A;  3P8M C;  5AW9 B;  1SQP D;  2P2U A;  3L75 G;  1DEE G;  1HUC A;  4GOD A;  1PP9 J;  2QSI A;  3KYQ A;  1ZXG A;  1YTZ I;  1Q82 Q;  1FZC A;  1K8A Q;  1W2B O;  3BAT A;  4H44 D;  5CMZ A;  1M56 D;  4JF7 A;  2KXP B;  3CMA P;  3CD6 P;  1H0T A;  1CI6 A;  2IYP A;  1ZRT D;  4EDF A;  4L73 A;  3K5B A;  4EI2 A;  3PH0 A;  2IYO A;  1BGY E;  4OH8 B;  1FDI A;  1S5L X;  1HGV A;  4OGQ B;  3GF3 A;  3MGN A;  1OZH A;  3SSU A;  1EXJ A;  2K9J B;  1T2K D;  3L73 J;  1H0T B;  1NJI Q;  4L74 A;  1CI6 B;  3WUV A;  5GTH H;  3M06 A;  1FOS E;  1S72 P;  1AJY A;  1NU1 K;  2L5G B;  1JUN A;  3QWO C;  2MKV A;  2E75 B;  3B5N C;  1QEX A;  2I8D A;  1T3U A;  3HD7 D;  1PGP A;  2A45 H;  4GDO A;  2ZYG A;  3F5H A;  1Q86 Q;  1QLE D;  1BSH A;  1QVG O;  1L0N J;  2K37 A;  3PP5 A;  2JKV A;  1IK9 A;  2WSS H;  1N7S B;  2B87 B;  3H1L D;  5KLV G;  2HOD A;  2O01 H;  3PJS K;  5AW0 B;  3GF7 A;  1FZC C;  3LID A;  3H1J G;  4OGQ C;  1FJK A;  1VQL P;  1W2E A;  1NAF A;  1BDD A;  3BCC E;  3WUU A;  3VOP A;  1L0L G;  1CZQ A;  3TYY A;  4NPF X;  2Q3E A;  5AW1 B;  1NTM D;  3KHU A;  3MUD A;  2R5B A;  1L0N K;  3AE3 C;  2Y9Z A;  2KIK A;  3H1I D;  1JM0 A;  3L71 D;  1KFN A;  2XU6 A;  1UII A;  4WB4 A;  1GMJ A;  1AVY A;  1OW8 A;  2ZYA A;  2E75 C;  2KP8 A;  4H44 B;  3WU2 E;  2XDJ A;  3FWN A;  3TGU E;  2OYH A;  2IFN A;  2WPV B;  1QX8 A;  1SQV G;  3SFE C;  3CX5 D;  3KDP B;  2NZ2 A;  2WMM A;  1BCC G;  2W6J H;  1GU4 A;  1FJP A;  2B89 A;  2FY8 A;  1M1J A;  1M57 D;  5AVV B;  4EOT A;  3G3Z A;  3HD7 A;  2KZJ A;  2OYH B;  3JCU E;  5AVW B;  3SWK A;  1R5L A;  3U59 A;  5B5E E;  2NPS D;  2C9L Y;  4O9B A;  2YXQ B;  2IBZ D;  4GT1 A;  2ITA A;  4ASV A;  3LW5 J;  3L72 E;  4GIF A;  1NYH A;  1R8E A;  4D6T D;  1MFT A;  4H44 C;  1ZR2 A;  2JO1 A;  3H1L J;  1NKN A;  3MUD C;  3N7N A;  3GHG B;  1U7M A;  1YQ4 C;  1LWU A;  2E74 D;  3AE1 C;  1KB9 I;  1ZP0 C;  1YIJ P;  5AVR B;  1IC2 A;  1N7L A;  1NTM J;  2NRG A;  4IL6 H;  1T2K C;  4JBZ A;  2OYH C;  3A5T A;  3CCV P;  1LNQ A;  4LLH A;  4RJT A;  3P7K A;  3G6E P;  4N78 E;  1G2C B;  1M1J C;  2GUV A;  4HYT B;  1U7J A;  1NVO A;  3HD7 C;  4Y28 J;  1ZR4 A;  1N73 B;  2QJP B;  5E79 H;  1NTM K;  3B8E B;  3MP7 B;  3QH9 A;  2NPS A;  2BEZ F;  2YMY A;  1U57 A;  3V4W A;  2M5A B;  5KJ7 D;  1N86 A;  1NTK E;  4A7P A;  1KQF B;  1JY3 O;  2FYU D;  1BGY J;  3AEG C;  1VQ6 P;  2XND H;  3II6 A;  3Q5P A;  2R32 A;  1KIL D;  4UB6 H;  1W5C E;  2E76 D;  5AVQ B;  4XE5 B;  1LWU C;  4KT0 J;  2BCC D;  3L75 E;  3OA7 A;  1SFC D;  4U3F G;  4Y99 B;  1L2P A;  1JTH A;  3AE5 C;  1JOC A;  4BRY A;  1Y9B A;  1KV4 A;  1EZV D;  4YXW H;  1YHQ P;  1FDO A;  3H1H D;  1FZE A;  4R4M A;  1SQB D;  1KC8 Q;  2E74 B;  3BRT B;  4UB6 E;  3AEA C;  1S9K D;  4DJG A;  4RO0 A;  1OWA A;  4JPZ B;  2E42 A;  5BVZ A;  2QEX P;  1JTH B;  3P8C D;  1NTZ G;  4BRY B;  3A0B H;  1KYO H;  1ZW0 A;  3BVH A;  1DH3 A;  1RE3 A;  2BAS A;  2E5Y A;  4KHX A;  1JMB A;  4Z1M H;  3HUS A;  5B66 H;  3BCC J;  2WPR A;  2NPS C;  4EYY Q;  3H1K D;  3Q3D A;  5KJ7 A;  1PV3 A;  2ZXE B;  2N9B A;  1UIX A;  1PPJ G;  1SQX D;  1SP4 A;  1P84 H;  3HUS B;  3AEE C;  3TGU J;  1LP1 A;  2O3J A;  1YTZ T;  1KIL A;  2HYN A;  4HB1 A;  5B66 E;  1NWQ A;  2A06 G;  1PP9 D;  2YO2 A;  2IX7 C;  2E74 C;  5KAI H;  2LXC B;  3B5N D;  1GW4 A;  1FC2 C;  5M1B A;  2WT7 B;  2AXT H;  1SFC A;  3C8V A;  2K3R A;  3O6Q A;  3TNU A;  3I55 P;  4LC1 A;  5KAF E;  1X9V A;  3L70 G;  1LP1 B;  5KLV E;  1N2D C;  2WPS A;  1Q81 Q;  1KIL B;  3RL0 C;  4PD4 E;  3LW5 H;  1WRG A;  2E76 B;  4PV1 D;  3CWB G;  1FZG A;  3H1J E;  2OYI A;  1K04 A;  2VRS A;  5AW7 B;  1VQP P;  1SFC B;  1L0L E;  3JSV C;  1OX3 A;  1BSN A;  3O6Q B;  2R5D A;  3TNU B;  1LTB C;  2Q5U A;  3TSI A;  3L72 J;  3M0A A;  1YBK A;  1RE3 C;  3L73 D;  3H6P A;  1SQQ G;  3HUS C;  3Q5R A;  4ASW A;  2FXO A;  3TF5 A;  2OYI B;  2N9Y B;  5KJ7 C;  1KD1 Q;  2IZ0 A;  1NHL A;  3EFG A;  1SQV E;  5APW A;  4BWN A;  1KFM A;  3NMD A;  3CX5 I;  3A2A A;  1YJW P;  1S5L E;  1JCC A;  2HLO A;  2YIU C;  1WT6 A;  1BE3 G;  4HJG H;  1HWT C;  1H89 A;  2O01 N;  4TLF A;  2R3S A;  2WIT A;  2KNC A;  4N3Y B;  1L0N D;  3A3Y B;  2KZI A;  2QIW A;  1G1I A;  1X8Y A;  3B5N A;  1VQN P;  1IFP A;  3OAK A;  1SFC C;  1VQ8 P;  3L74 G;  3L37 A;  3IFM A;  1NU1 G;  4RKU J;  3V5B A;  4C7R A;  2IBZ I;  2M8R A;  2KNC B;  2YMK A;  1QVF O;  1K73 Q;  1MZ9 A;  3B5N B;  2E5T A;  2FYN C;  2OYI C;  4YTP C;  1NGM B;  1SQX K;  2Q9I A;  1KYO D;  1JO5 A;  1GD2 E;  3TDK A;  1NTK J;  1ZOY C;  3R2P A;  4I7Z C;  2G8Y A;  4KJM A;  2PGD A;  3S1K A;  3RK3 D;  3AEC C;  1JY2 P;  2GA1 A;  3MIW A;  2KS1 A;  2Y0E A;  2IFM A;  3UIA A;  4L75 A;  2DW3 A;  3EFF K;  1FZC B;  2KI7 B;  1JCD A;  2WTY A;  4DT0 A;  1P84 D;  2OTJ P;  2B88 A;  1EC5 A;  2WWW A;  3L75 J;  4I6M C;  1NTK K;  2YKQ A;  1MFZ A;  1IFM A;  3CXH I;  2KS1 B;  1GTW A;  1QL2 A;  1OXZ A;  1SQP G;  1DIP A;  2QJK C;  4UB8 E;  4WVZ A;  2HPC A;  1FZA A;  1LTS C;  4HKZ H;  2AXC A;  3E1I A;  2V7Q J;  1AA0 A;  1BDC A;  1KTM A;  3CCE P;  2P58 A;  3D70 A;  4PV1 C;  1FAV A;  1BCC D;  2PAJ A;  3MTU E;  1LT9 A;  3WU2 H;  3VP8 A;  3M0D A;  1FDM A;  1CW5 A;  2HPC B;  1J1D C;  1H8A A;  3V2N A;  2IPP A;  4QMA A;  2Z5H A;  1TU3 F;  3V4Q A;  1K05 A;  2Z4E A;  2I1K A;  4U3F E;  4IFD K;  2HOD B;  3V2P A;  2G3A A;  2AEM A;  2LXB A;  4DOJ A;  1JNM A;  3JCU H;  1IFJ A;  4C46 A;  3VMZ A;  2I1J A;  5B5E H;  3E7K A;  4BXL A;  2FXM A;  2W27 A;  1FS0 E;  5AW6 B;  1RY3 A;  3NFQ A;  5KLV J;  3RGU A;  1VPC A;  1NTZ E;  2K9Y A;  3W67 A;  1S4X A;  4ZMD A;  3Q2Y A;  4JYC A;  1L0L J;  1RF1 A;  1BGY D;  2Y0D A;  1FZB A;  3CI9 A;  1KQG B;  3L4F A;  1EDJ A;  1PPJ E;  3NTN A;  2HG5 D;  3B71 A;  1M1J B;  2CPB A;  2XZR A;  3D6Z A;  1ZV8 A;  1LT9 C;  1NTM G;  2IDB A;  3HD7 B;  3M0D C;  3S9O A;  4M3L A;  1KN7 A;  3T97 A;  3H1I G;  4L76 A;  2KK7 A;  1KZU B;  1SQV J;  3L71 G;  2A06 E;  4HH2 A;  3VP9 A;  1L0L K;  3RK3 C;  1AQT A;  1BCC J;  5CJ0 A;  2OAR A;  2Y9Y A;  5TIS E;  2WVR A;  1VQK P;  5APV A;  3L70 E;  1XTG B;  2LKM A;  3T97 B;  3CWB E;  2YXR B;  1SQV K;  3RL0 D;  1QL1 A;  3CCM P;  1N8R Q;  2H7H A;  1YQ3 C;  1LWU B;  1LTT C;  3BCC D;  1H88 A;  5AVY B; 
#chains in the Genus database with same CATH homology
 3A0B H;  5KAI H;  5TIS H;  4IL6 H;  4UB6 H;  3JCU H;  5KAF H;  2AXT H;  3KZI H;  5B5E H;  5B66 H;  5E79 H;  4UB8 H;  5H2F H;  4PJ0 H;  1S5L H;  3A0H H;  5GTI H;  3WU2 H;  5GTH H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...