5H2FH

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
total genus 15
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5h2fH01
4UB6H 3JCUH 1S5LH 5KAIH 4IL6H 5B66H 4UB8H 3A0BH 5B5EH 5E79H 2AXTH 5TISH 3KZIH 3A0HH 3WU2H 4PJ0H 5KAFH 5H2FH 5GTHH 5GTIH
chains in the Genus database with same CATH superfamily
3L73E 3AE3C 2BASA 1URQA 1RQVA 4WVZA 5CBNA 3GF7A 3A0HE 1BE3G 1VQLP 2PFXA 3M9QA 2QSIA 5AVUB 1NOHA 1NU1K 2NRGA 4RESB 1SQBE 1W2BO 3B4SA 2FYUG 2P10A 1X0TA 3TF5A 1RF0A 1L0NK 1SQVJ 3G4SP 1NH4A 1YQ3C 1YIJP 3TGUD 2IZ1A 1NTKK 1N7SD 2JWDA 1CW5A 1WRGA 1NAFA 5KAIH 2M3BA 2YO3A 2QA4P 4D6TD 2HFED 2D2CB 1FOSF 2WPVB 2GUVA 1SS1A 1Q81Q 2KP8A 4ZKUA 2PAJA 1PL5A 2HPCA 1GW3A 1LTSC 3GG2A 3T97A 1KQSO 3TGUJ 1OMIA 5B66E 2LXCB 1PP9J 3RK2B 2Z4EA 2Q3EA 2WVRA 1M90Q 1GMJA 3PTZA 3A0HH 3AEFC 1KV4A 4KT0J 2WSSH 3CCUP 3PP5A 1JY3O 4BRYB 1M1JC 3QH9A 1LTJB 4ASWA 5GTIE 4WWIA 3A0BE 5B5EE 1KN7A 2E75C 5BVZA 1SQQE 1E79H 4I7ZC 3Q3DA 2XNXA 3B5ND 1W5CE 4H0LC 2W6BA 3CC4P 1K73Q 2E74C 1VDFA 2M0BA 3L74E 3PHLA 2ITAA 3CC7P 3JCUH 1AQTA 1HF9A 3HUSA 1NU1D 4IOIH 2WPRA 4Y99B 2SPZA 4HKZH 3FX0A 3AE6C 1Q2NA 3SFDC 1SQPE 3L75E 1AFOA 4OWFA 2BCCE 2KUBA 1T2KD 2E5TA 1GTWA 1NTZK 1L0ND 3RK2D 4EOTA 1ZV8A 2YMYA 2IZ0A 5B66H 2OQQA 1NTKD 2ZAEB 4XFJA 1AV1A 2OTJP 1NU1J 4Y28J 3WU2E 1FJKA 2KSEA 4PV1B 2QRXA 4GDOA 3H1KD 3SSUA 3AECC 5GTIH 3VMZA 2MKVA 1L0NJ 1SQVG 2D2CC 4DCKA 1NTKJ 2ZVOB 3RL0B 1MZ9A 3GHGB 4Z1MH 3H1KJ 2B89A 5BU5A 1K9MQ 1W2EA 3L71E 4KHXA 4NPFX 3HD7D 2W90A 3TGUG 5KLVE 2WT7A 1PP9G 1ZMEC 2IX7C 1KYOE 2WSCJ 3BVHA 4GIFA 3S9OA 3L4FA 4IL6X 1M1KQ 5C39A 3WUUA 2QJKC 3OW2O 5EFWB 4PV1D 4OH8B 3WU2H 1M1JA 1FZEA 2Y0DA 2XNDH 4I1LA 4WY4B 2Q7CA 3L72D 1FZCA 5CMZA 1S5LX 1PGJA 3TK1A 3RL0D 1NTZD 1JTHB 4Y99C 1YTZT 3BCCE 1BCCE 1SQXK 4L75A 1XTCC 1NKNA 4OVNF 3RL0g 4RJTA 4UB8E 3L72J 4U7JA 1FU1A 1BDDA 2FYUK 3W68A 3GF3A 5AVQB 5TJHA 4AQRD 5AVYB 1NTZJ 2OTLP 3CX5H 1NVOA 2WSEJ 5AW4B 1FC2C 1LWUC 2WZ7A 1U7JA 1KYOH 2H88C 1NU1G 1N2DC 1SQBK 2L91A 3A7OA 4C7RA 1QL2A 4WY4D 4DOJA 1NTME 1U7MA 1L0NG 1G1JA 4LLHA 3GHGC 2QVAA 3AE7C 1NTKG 3H1JD 3VN0A 1T6AA 1ZXGA 2NPSC 1WT6A 1VQMP 3R2PA 3RGUA 3CWBE 3H1KG 1EXJA 3PH0A 3TNUB 3MP7B 3HE5B 2OTKE 2K1AA 4WBAA 1IFPA 4UB8H 3B71A 4U3FE 3H1LE 2CPSA 3JC22 4IFMA 3IN6A 3I55P 2BEQD 1JCDA 2PGDA 3IAOA 3C8VA 3CCJP 1GL2D 3CC2P 1SQXD 3VYIA 5E79E 5KJ7C 1EZVI 1N8RQ 2J5UA 2B87B 1SQQK 5AW0B 1N73B 5CCGC 3KZIE 1LTTC 3CCQP 2FYUD 3CCVP 1BSHA 1LP1A 1OW6A 4PD4E 1HGVA 1QL1A 2HG5D 1NO4A 3KDPB 1VQOP 3S4RA 2R3CA 1OW8A 4GODA 3CCLP 1SQXJ 1R5SA 4HJGH 1FS0E 3LW5H 5AVSB 1SFCB 5KAFH 3RBZA 3L72G 3L73J 1LGHB 4O9BA 1L0LK 2HLOA 1DEBA 3NXSA 3P8CD 3C9IA 2FXPA 1NTZG 3USSA 2LXBA 2YKQA 5CJ4A 1KILB 2WSFJ 2IFNA 1IO4A 1LWUA 2IBZE 3BRVB 5KKZB 2M8RA 1MKMA 3E7KA 1SQBJ 1U57A 2KS1B 2JKVA 3KQGA 5E79H 3Q1MA 3O6QB 5DJTB 5CCHC 3KZIH 1JY3P 1DEEG 4H13D 1FDMA 1FOSE 3GHGA 2C9NY 1KQFB 3CXHH 3R4YA 2KXPB 1EZVD 3L70E 3F5HA 1ZRTE 3FWNA 3VP8A 2NPSA 1ZLLA 1KORA 3N4XA 3FXEA 1BGYE 4JF7A 1VQ7P 1JMMA 1PPJG 5KLVK 1L4AD 2XZRA 4C7NB 1BDCA 2Y0CA 2WWWA 1IFNA 1YI2P 1KILD 3MGNA 2OGUA 1N7SB 1LT9B 3L74D 4YXWH 1OFCX 1DD4A 3V2QA 1Q82Q 3CX5I 3HUSC 2H89C 1GK6A 4YPCA 1KYOI 2PRRA 4N6JA 4WY4A 1SQQJ 3P8MC 4HH2A 1BE3E 3H1HD 5KJ7A 4N78E 5CCGA 3MIWA 1L0LD 1MUUA 5AVTB 3A2AA 1JTHA 2M3EA 1SQVD 3L74J 3D6YA 1RF1C 1VQ9P 1SFCC 1SQXG 4DT0A 4IFFA 3H1HJ 5AW5B 3RK3D 1FE6A 5DJUB 1SQPJ 2KZIA 3L73G 1L0LJ 1ZP0C 1P84E 1YBKA 3B5NB 3H32B 5KKZC 4IL6E 1PP9D 2R5BA 5K5GB 3Q2YA 3H1IE 2JEEA 3AEGC 1QLED 2ZT9C 1IJDB 2VRSA 1ZOYC 1KB9E 3SWKA 1SQBG 1IFDA 1IFMA 4EYYQ 1Q90D 1S5LE 1EXIA 3L71D 1JY3N 3M0DC 4K35A 3L37A 3CX5D 1YYCA 2J58A 2YIUB 3VTPC 5CCHA 2QJYB 5KLVD 1VF5B 3CCEP 1KYOD 2M5AA 5AVXB 3HE5A 1DX7A 4IFDK 1FZCC 3L71J 3O8ZA 1QEXA 4JBZA 2A06D 1EDJA 3U1AA 1N7SC 5KLVJ 2E76B 1P84H 3CMEP 2QM7A 1VQ8P 2QE7H 2H7HA 1EZVG 3GLMA 1A02J 1VQ6P 3BCCD 3BATA 2WQYC 2WMMA 5APQA 2B87A 4GOFA 2R3SA 1KB9H 1SQQG 3EFGA 3D70A 4H44D 3HD7B 1JY2N 1S5LH 4NPDA 3MZWB 3L74G 2Q6QA 4ZMDA 1VF5D 2C0WA 2RN0A 3BCCJ 3CMAP 1RF1A 2FYZA 1HWTC 2A45H 1JOCA 3NTNA 1JY2O 3CXHI 1SFCA 2P58A 3U1CA 3H1HG 5APXA 2I1KA 2E5YA 3B5NC 1OW7A 2J59M 1SQPG 1SLQA 2R44A 2ZFCA 3A0BH 1L0LG 3AE4C 3V6IA 5B5EH 1NWQA 2E76D 3VP9A 2O3JA 2FFDB 1EDKA 2YKPA 1VPCA 3OAKA 1VL2A 1T3JA 1KTMA 1FZAA 3CWBD 2KS1A 3O6QA 5CHXA 2YIUC 4D6TE 3D71A 3RK2C 3OA7A 3HE4B 3PJSK 2WPSA 1E5WA 2V4HA 2JWAA 3M0DA 5KLIB 1L2PA 5AVVB 1LTJC 2V7QH 3LW5J 3EFFK 1VQ5P 4JYCA 1FZBA 3CWBJ 3ZDMA 5KTBA 1Z56A 2FKWB 3JSVC 1IK7A 1YITP 3L71G 3AE9C 1OVVA 4C7NA 4ZNCA 2IDBA 2FYNB 3VMYA 5KLVG 4ZKPA 3SWYA 3H1LJ 2YMKA 1N7SA 4JYBA 1QX8A 3CXHD 1PGOA 1ZR4A 1LT1A 2QG4A 1G1IA 4UB6E 1GK4A 2I1JA 5CBOA 2CPBA 3AE2C 3HD7C 1OWAA 2A06G 3P32A 3A3YB 1VQKP 1YJ9P 1NU1E 1S9KE 4LGDE 2HR3A 2R5DA 1VQPP 2RKLA 4PV1C 1FDOA 2JR8A 3BCCG 2QIWA 2OYIB 1UIIA 2KLVA 2O01H 3NFQA 2N1TD 1CZQA 1GL2B 4PJ0E 1D7MA 2FFDC 2O1JA 1QVFO 3B5NA 4OGQB 3H32A 1KFMA 3TDKA 5GTHE 3RL0C 4XE5B 1IZNB 1PPJD 1S4XA 3HTKB 4ASVA 2KIKA 1Q86Q 1X79B 1P84I 3S1KA 4KJMA 3A5TA 1EC5A 1URQD 3T97B 4YXDC 2K9YA 1WMKA 1J1DB 4GOEA 1KB9I 1FJPA 2I8DA 4EDFA 1A02F 5AVZB 1HTLC 2XV5A 1RE4C 4BRYA 5APUA 1YJNP 2P2UA 3CI9A 3AEBC 1LTJA 3L70J 3M9BA 2MJZA 3CWBG 5APVA 4WY4C 1H0TB 2FY8A 2A45I 1IFJA 1IFIA 4DZOA 1RY3A 4OGQD 1S3JA 4PJ0H 2LKMA 3L73D 2Y0EA 3V2NA 1EDLA 3FXDA 1JO5A 3H1LG 5GTHH 5APYA 2HODB 4H13B 1HBWA 3L72E 4JPZB 4W7YA 3M06A 2KNCB 2W27A 1RQUA 1NTZE 2POHA 1SQBD 1SQPK 3CCMP 3HD7A 1OZHA 4W7ZA 2YKOA 1Y47A 2OYIC 1L4AB 2G3AA 4C46A 1T8ZA 2H8PD 2E42A 4HB1A 3RBXA 1OVRA 2K88A 2XKMA 3I5CA 1GL2C 5APSA 2YO2A 3U59A 2JP3A 1EDIA 2IYPA 4R4MA 1KQLA 3MHVA 1VQNP 4K3AA 1N86A 3MTUE 2FFDA 1J1EB 1H88A 3CLQA 1ZR2A 1CI6B 4L74A 3H1IJ 4PD4H 2ZJSE 1J1DC 3MD0A 5AW1B 3CL3D 2GUSA 1UIXA 3RK3B 2AEMA 3H1JE 3HE4A 2YXQB 1RHZB 1SQQD 4I2LC 1DIPA 2C0XA 2C9LY 1NJIQ 1DH3A 3W67A 1KZUB 1M1JB 1JM0A 1RE4A 3L70G 1N73C 1YQ4C 3WUTA 1S2EA 3L36A 1AVOA 2E75B 3KYQA 4I7ZB 3HRNA 4CPGA 4H13C 3F89A 1SQPD 3L75D 4H0LB 2KZJA 2BCCD 3AE5C 3TYYA 3ABVC 1JY2P 3AEAC 2FYUE 1LNQA 1ZW0A 3L75J 2KSJA 1L4AC 2BCCJ 3NMDA 1NYHA 1KILC 3E1RA 2V7QJ 3OJAB 2LR2A 2Y9YA 3Q5SA 2OYIA 1T3UA 2B88A 1OXZA 1S1CX 4GKGA 1GL2A 1FZGA 3P8CE 4EIJA 2E75D 2KI7B 2JO1A 1J1EC 3CD6P 4MN4C 3JCUE 2NZ2A 1NTMK 5CJ0A 3CPWO 4H0LD 1SP4A 2OYOA 2E74D 2W6JH 4NPEA 3VMAA 4H44B 3AE1C 3HTKA 1LTIC 1M7LA 1MFZA 2QJPB 3H1IG 4AUWA 1G2CB 2H43A 1IK9A 2RMZA 3E1IA 3GMAA 3RK3C 2PP6A 3TNUA 2FXOA 1GU4A 4BWNA 2XU6A 4D6TJ 3FGAD 2K9JB 1EZVE 2FBWC 3G71P 1LT9C 2P1JA 2BEZF 3N7NA 2WSFH 2A45G 4BXLA 1R5LA 5AW8B 2O01J 2Q1KA 2QJKB 4IL6H 1MV8A 2ZYAA 1H0TA 1USDA 1BCCD 2W6AA 2ZVNB 3EWKA 1HGZA 1N73A 1KILE 2KK7A 1LP1B 4LC1A 1R8EA 2D2CD 1Y9BA 3TSIA 2HODA 2JJLA 3MUDC 5AW7B 3GW6A 1LJ2A 1S9KD 1Y8AA 3H1HE 2Q3IA 1K04A 3VOPA 1BCCJ 2KNCA 1H8AA 3ITKA 1L0LE 4PD4I 4EI2A 1SQVE 2XDJA 1IC2A 1OIPA 2L5GB 5M1BA 3L75G 2Y9ZA 2BCCG 2Q5UA 1NTMD 1HVVA 1L4AA 3CCRP 1HJ0A 4XA4A 2AEJA 2QEXP 2O01N 1VQ4P 1KILA 1LWUB 3RK3E 2WTYA 1NAYA 1XTGB 2Q9IA 1OVUA 2IPPA 2OYHB 4TT3H 3QWOC 3TGUE 1PP9E 4R4LA 4H44C 5TISE 1T2KC 1NTMJ 2IFMA 3C1LA 2QJYC 1GD2E 4N3YB 2IBZI 2QJPC 1JNMA 2GA1A 1VF5C 1CI6A 4U3FD 4B86A 4WB4A 3EQ2A 3VMXA 3IF4A 3H1LD 1HUCA 2NPSB 1KFNA 3B8EB 3CX5E 2KOGA 2WITA 3L35A 2GM4A 2N1TB 1S72P 4QMAA 3WUVA 2E76C 1OX3A 4D6TG 1PGPA 1JUNA 2YNYA 1M57D 4U3FJ 4DJGA 1KD1Q 4L76A 1LT9A 4L73A 4PD4D 2KB7P 3CCSP 2A06E 2G8YA 2O1KA 3AEDC 1PIXA 2IYOA 1AJYA 2R32A 1URQB 2KLUA 3V4QA 3UIAA 5TISH 1RE3C 3M9HA 2DW3A 3M0AA 5H2FE 1BSNA 1KMIZ 2NPSD 3MUDA 3FWLA 3BRTB 1BCCG 2IBZD 1USEA 1AA0A 1L0NE 2K37A 4TLFA 1YHQP 1NTKE 1KC8Q 1EQ7A 1LTAC 2AXCA 3P7KA 2OYHC 1JCCA 3H1KE 2ZXEB 2HYNA 3PRJA 2ZXXA 3V2PA 5KJ7D 1QVGO 2YXRB 3L70D 2HPCB 1ZRTD 1N7LA 5CCGD 1TU3F 2Z5IA 4UB6H 1GW4A 1NTMG 3LIEA 3AEEC 5KLIC 1PV3A 1BGYD 2AEFA 1LTBC 4JQ0D 5KAFE 1X8YA 1G2CA 2M5AB 2P67A 5AW2B 2N1TC 1PFIA 5H2FH 1PGQA 3WMM0 1J2JB 3V2RA 3IFMA 2JDIH 5BU8B 2K9JA 3G9RA 2FYNC 5AW3B 3H1JJ 1BGYJ 4RKUJ 1YTZI 3KPEA 2E43A 3V4WA 4W80A 1BE3D 1H89A 4N78D 4U3FG 1HJBA 3G6EP 3BASA 1YJWP 3K5BA 3II6A 2RH0A 3HUSB 1PZQA 1MFTA 1URQC 2CK3H 2QM8A 1JB0J 1GU5A 1ZN5A 3M91A 3KHUA 4RO0A 4GT1A 3H6PA 5APWA 3CXHE 1BE3J 1JEKA 5CCHD 1SVFA 2OARA 1FZFA 4I6MC 1FBMA 1P84D 2WSCH 2ZYDA 5AVWB 1RE3A 1RF1B 3KXDA 1M8OB 1RF0C 2FYUJ 4A7PA 1AVYA 3SFEC 3H1ID 1X9VA 4OGQC 1SQVK 1DD3A 1KB9D 4M3LA 2AXTE 2Z5HA 3V5BA 1K05A 1CSBA 4HYTB 1Q7YQ 2OYHA 2K3RA 1KQGB 2N9BA 2ZT9B 1QGKB 2IBZG 3I56P 1M56D 4YTPC 1AQ5A 3D6ZA 1PPJE 1NHLA 3IR9A 3G3ZA 2ZYGA 1NKZB 2WT7B 2KYVA 1GZLA 2WSEH 3AE8C 1FDIA 3SWFA 4AYCA 2P7JA 1RH5B 1SFCD 1K8AQ 2WPQA 3Q5RA 2N1TA 5AW6B 1FAVA 5AW9B 2B9BA 3H25A 1FZCB 5KAIE 1JMBA 5AVRB 3H1JG 1BGYG 2N9YB 2W8ZA 1NGMB 2E74B 1X22A 1HH0A 2AXTH 2UWJE 3PLNA 1SQXE 1GDTA 5APTA 5L8RJ 2W83C 2FXMA 3Q5PA 2ZT9D 1LTGC 3LIDA
chains in the Genus database with same CATH topology
4UB6H 3JCUH 1S5LH 5KAIH 4IL6H 5B66H 4UB8H 3A0BH 5B5EH 5E79H 2AXTH 5TISH 3KZIH 3A0HH 3WU2H 4PJ0H 5KAFH 5H2FH 5GTHH 5GTIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB6 H;  3JCU H;  1S5L H;  5KAI H;  4IL6 H;  5B66 H;  4UB8 H;  3A0B H;  5B5E H;  5E79 H;  2AXT H;  5TIS H;  3KZI H;  3A0H H;  3WU2 H;  4PJ0 H;  5KAF H;  5H2F H;  5GTH H;  5GTI H; 
#chains in the Genus database with same CATH topology
 3L73 E;  3AE3 C;  2BAS A;  1URQ A;  1RQV A;  4WVZ A;  5CBN A;  3GF7 A;  3A0H E;  1BE3 G;  1VQL P;  2PFX A;  3M9Q A;  2QSI A;  5AVU B;  1NOH A;  1NU1 K;  2NRG A;  4RES B;  1SQB E;  1W2B O;  3B4S A;  2FYU G;  2P10 A;  1X0T A;  3TF5 A;  1RF0 A;  1L0N K;  1SQV J;  3G4S P;  1NH4 A;  1YQ3 C;  1YIJ P;  3TGU D;  2IZ1 A;  1NTK K;  1N7S D;  2JWD A;  1CW5 A;  1WRG A;  1NAF A;  5KAI H;  2M3B A;  2YO3 A;  2QA4 P;  4D6T D;  2HFE D;  2D2C B;  1FOS F;  2WPV B;  2GUV A;  1SS1 A;  1Q81 Q;  2KP8 A;  4ZKU A;  2PAJ A;  1PL5 A;  2HPC A;  1GW3 A;  1LTS C;  3GG2 A;  3T97 A;  1KQS O;  3TGU J;  1OMI A;  5B66 E;  2LXC B;  1PP9 J;  3RK2 B;  2Z4E A;  2Q3E A;  2WVR A;  1M90 Q;  1GMJ A;  3PTZ A;  3A0H H;  3AEF C;  1KV4 A;  4KT0 J;  2WSS H;  3CCU P;  3PP5 A;  1JY3 O;  4BRY B;  1M1J C;  3QH9 A;  1LTJ B;  4ASW A;  5GTI E;  4WWI A;  3A0B E;  5B5E E;  1KN7 A;  2E75 C;  5BVZ A;  1SQQ E;  1E79 H;  4I7Z C;  3Q3D A;  2XNX A;  3B5N D;  1W5C E;  4H0L C;  2W6B A;  3CC4 P;  1K73 Q;  2E74 C;  1VDF A;  2M0B A;  3L74 E;  3PHL A;  2ITA A;  3CC7 P;  3JCU H;  1AQT A;  1HF9 A;  3HUS A;  1NU1 D;  4IOI H;  2WPR A;  4Y99 B;  2SPZ A;  4HKZ H;  3FX0 A;  3AE6 C;  1Q2N A;  3SFD C;  1SQP E;  3L75 E;  1AFO A;  4OWF A;  2BCC E;  2KUB A;  1T2K D;  2E5T A;  1GTW A;  1NTZ K;  1L0N D;  3RK2 D;  4EOT A;  1ZV8 A;  2YMY A;  2IZ0 A;  5B66 H;  2OQQ A;  1NTK D;  2ZAE B;  4XFJ A;  1AV1 A;  2OTJ P;  1NU1 J;  4Y28 J;  3WU2 E;  1FJK A;  2KSE A;  4PV1 B;  2QRX A;  4GDO A;  3H1K D;  3SSU A;  3AEC C;  5GTI H;  3VMZ A;  2MKV A;  1L0N J;  1SQV G;  2D2C C;  4DCK A;  1NTK J;  2ZVO B;  3RL0 B;  1MZ9 A;  3GHG B;  4Z1M H;  3H1K J;  2B89 A;  5BU5 A;  1K9M Q;  1W2E A;  3L71 E;  4KHX A;  4NPF X;  3HD7 D;  2W90 A;  3TGU G;  5KLV E;  2WT7 A;  1PP9 G;  1ZME C;  2IX7 C;  1KYO E;  2WSC J;  3BVH A;  4GIF A;  3S9O A;  3L4F A;  4IL6 X;  1M1K Q;  5C39 A;  3WUU A;  2QJK C;  3OW2 O;  5EFW B;  4PV1 D;  4OH8 B;  3WU2 H;  1M1J A;  1FZE A;  2Y0D A;  2XND H;  4I1L A;  4WY4 B;  2Q7C A;  3L72 D;  1FZC A;  5CMZ A;  1S5L X;  1PGJ A;  3TK1 A;  3RL0 D;  1NTZ D;  1JTH B;  4Y99 C;  1YTZ T;  3BCC E;  1BCC E;  1SQX K;  4L75 A;  1XTC C;  1NKN A;  4OVN F;  3RL0 g;  4RJT A;  4UB8 E;  3L72 J;  4U7J A;  1FU1 A;  1BDD A;  2FYU K;  3W68 A;  3GF3 A;  5AVQ B;  5TJH A;  4AQR D;  5AVY B;  1NTZ J;  2OTL P;  3CX5 H;  1NVO A;  2WSE J;  5AW4 B;  1FC2 C;  1LWU C;  2WZ7 A;  1U7J A;  1KYO H;  2H88 C;  1NU1 G;  1N2D C;  1SQB K;  2L91 A;  3A7O A;  4C7R A;  1QL2 A;  4WY4 D;  4DOJ A;  1NTM E;  1U7M A;  1L0N G;  1G1J A;  4LLH A;  3GHG C;  2QVA A;  3AE7 C;  1NTK G;  3H1J D;  3VN0 A;  1T6A A;  1ZXG A;  2NPS C;  1WT6 A;  1VQM P;  3R2P A;  3RGU A;  3CWB E;  3H1K G;  1EXJ A;  3PH0 A;  3TNU B;  3MP7 B;  3HE5 B;  2OTK E;  2K1A A;  4WBA A;  1IFP A;  4UB8 H;  3B71 A;  4U3F E;  3H1L E;  2CPS A;  3JC2 2;  4IFM A;  3IN6 A;  3I55 P;  2BEQ D;  1JCD A;  2PGD A;  3IAO A;  3C8V A;  3CCJ P;  1GL2 D;  3CC2 P;  1SQX D;  3VYI A;  5E79 E;  5KJ7 C;  1EZV I;  1N8R Q;  2J5U A;  2B87 B;  1SQQ K;  5AW0 B;  1N73 B;  5CCG C;  3KZI E;  1LTT C;  3CCQ P;  2FYU D;  3CCV P;  1BSH A;  1LP1 A;  1OW6 A;  4PD4 E;  1HGV A;  1QL1 A;  2HG5 D;  1NO4 A;  3KDP B;  1VQO P;  3S4R A;  2R3C A;  1OW8 A;  4GOD A;  3CCL P;  1SQX J;  1R5S A;  4HJG H;  1FS0 E;  3LW5 H;  5AVS B;  1SFC B;  5KAF H;  3RBZ A;  3L72 G;  3L73 J;  1LGH B;  4O9B A;  1L0L K;  2HLO A;  1DEB A;  3NXS A;  3P8C D;  3C9I A;  2FXP A;  1NTZ G;  3USS A;  2LXB A;  2YKQ A;  5CJ4 A;  1KIL B;  2WSF J;  2IFN A;  1IO4 A;  1LWU A;  2IBZ E;  3BRV B;  5KKZ B;  2M8R A;  1MKM A;  3E7K A;  1SQB J;  1U57 A;  2KS1 B;  2JKV A;  3KQG A;  5E79 H;  3Q1M A;  3O6Q B;  5DJT B;  5CCH C;  3KZI H;  1JY3 P;  1DEE G;  4H13 D;  1FDM A;  1FOS E;  3GHG A;  2C9N Y;  1KQF B;  3CXH H;  3R4Y A;  2KXP B;  1EZV D;  3L70 E;  3F5H A;  1ZRT E;  3FWN A;  3VP8 A;  2NPS A;  1ZLL A;  1KOR A;  3N4X A;  3FXE A;  1BGY E;  4JF7 A;  1VQ7 P;  1JMM A;  1PPJ G;  5KLV K;  1L4A D;  2XZR A;  4C7N B;  1BDC A;  2Y0C A;  2WWW A;  1IFN A;  1YI2 P;  1KIL D;  3MGN A;  2OGU A;  1N7S B;  1LT9 B;  3L74 D;  4YXW H;  1OFC X;  1DD4 A;  3V2Q A;  1Q82 Q;  3CX5 I;  3HUS C;  2H89 C;  1GK6 A;  4YPC A;  1KYO I;  2PRR A;  4N6J A;  4WY4 A;  1SQQ J;  3P8M C;  4HH2 A;  1BE3 E;  3H1H D;  5KJ7 A;  4N78 E;  5CCG A;  3MIW A;  1L0L D;  1MUU A;  5AVT B;  3A2A A;  1JTH A;  2M3E A;  1SQV D;  3L74 J;  3D6Y A;  1RF1 C;  1VQ9 P;  1SFC C;  1SQX G;  4DT0 A;  4IFF A;  3H1H J;  5AW5 B;  3RK3 D;  1FE6 A;  5DJU B;  1SQP J;  2KZI A;  3L73 G;  1L0L J;  1ZP0 C;  1P84 E;  1YBK A;  3B5N B;  3H32 B;  5KKZ C;  4IL6 E;  1PP9 D;  2R5B A;  5K5G B;  3Q2Y A;  3H1I E;  2JEE A;  3AEG C;  1QLE D;  2ZT9 C;  1IJD B;  2VRS A;  1ZOY C;  1KB9 E;  3SWK A;  1SQB G;  1IFD A;  1IFM A;  4EYY Q;  1Q90 D;  1S5L E;  1EXI A;  3L71 D;  1JY3 N;  3M0D C;  4K35 A;  3L37 A;  3CX5 D;  1YYC A;  2J58 A;  2YIU B;  3VTP C;  5CCH A;  2QJY B;  5KLV D;  1VF5 B;  3CCE P;  1KYO D;  2M5A A;  5AVX B;  3HE5 A;  1DX7 A;  4IFD K;  1FZC C;  3L71 J;  3O8Z A;  1QEX A;  4JBZ A;  2A06 D;  1EDJ A;  3U1A A;  1N7S C;  5KLV J;  2E76 B;  1P84 H;  3CME P;  2QM7 A;  1VQ8 P;  2QE7 H;  2H7H A;  1EZV G;  3GLM A;  1A02 J;  1VQ6 P;  3BCC D;  3BAT A;  2WQY C;  2WMM A;  5APQ A;  2B87 A;  4GOF A;  2R3S A;  1KB9 H;  1SQQ G;  3EFG A;  3D70 A;  4H44 D;  3HD7 B;  1JY2 N;  1S5L H;  4NPD A;  3MZW B;  3L74 G;  2Q6Q A;  4ZMD A;  1VF5 D;  2C0W A;  2RN0 A;  3BCC J;  3CMA P;  1RF1 A;  2FYZ A;  1HWT C;  2A45 H;  1JOC A;  3NTN A;  1JY2 O;  3CXH I;  1SFC A;  2P58 A;  3U1C A;  3H1H G;  5APX A;  2I1K A;  2E5Y A;  3B5N C;  1OW7 A;  2J59 M;  1SQP G;  1SLQ A;  2R44 A;  2ZFC A;  3A0B H;  1L0L G;  3AE4 C;  3V6I A;  5B5E H;  1NWQ A;  2E76 D;  3VP9 A;  2O3J A;  2FFD B;  1EDK A;  2YKP A;  1VPC A;  3OAK A;  1VL2 A;  1T3J A;  1KTM A;  1FZA A;  3CWB D;  2KS1 A;  3O6Q A;  5CHX A;  2YIU C;  4D6T E;  3D71 A;  3RK2 C;  3OA7 A;  3HE4 B;  3PJS K;  2WPS A;  1E5W A;  2V4H A;  2JWA A;  3M0D A;  5KLI B;  1L2P A;  5AVV B;  1LTJ C;  2V7Q H;  3LW5 J;  3EFF K;  1VQ5 P;  4JYC A;  1FZB A;  3CWB J;  3ZDM A;  5KTB A;  1Z56 A;  2FKW B;  3JSV C;  1IK7 A;  1YIT P;  3L71 G;  3AE9 C;  1OVV A;  4C7N A;  4ZNC A;  2IDB A;  2FYN B;  3VMY A;  5KLV G;  4ZKP A;  3SWY A;  3H1L J;  2YMK A;  1N7S A;  4JYB A;  1QX8 A;  3CXH D;  1PGO A;  1ZR4 A;  1LT1 A;  2QG4 A;  1G1I A;  4UB6 E;  1GK4 A;  2I1J A;  5CBO A;  2CPB A;  3AE2 C;  3HD7 C;  1OWA A;  2A06 G;  3P32 A;  3A3Y B;  1VQK P;  1YJ9 P;  1NU1 E;  1S9K E;  4LGD E;  2HR3 A;  2R5D A;  1VQP P;  2RKL A;  4PV1 C;  1FDO A;  2JR8 A;  3BCC G;  2QIW A;  2OYI B;  1UII A;  2KLV A;  2O01 H;  3NFQ A;  2N1T D;  1CZQ A;  1GL2 B;  4PJ0 E;  1D7M A;  2FFD C;  2O1J A;  1QVF O;  3B5N A;  4OGQ B;  3H32 A;  1KFM A;  3TDK A;  5GTH E;  3RL0 C;  4XE5 B;  1IZN B;  1PPJ D;  1S4X A;  3HTK B;  4ASV A;  2KIK A;  1Q86 Q;  1X79 B;  1P84 I;  3S1K A;  4KJM A;  3A5T A;  1EC5 A;  1URQ D;  3T97 B;  4YXD C;  2K9Y A;  1WMK A;  1J1D B;  4GOE A;  1KB9 I;  1FJP A;  2I8D A;  4EDF A;  1A02 F;  5AVZ B;  1HTL C;  2XV5 A;  1RE4 C;  4BRY A;  5APU A;  1YJN P;  2P2U A;  3CI9 A;  3AEB C;  1LTJ A;  3L70 J;  3M9B A;  2MJZ A;  3CWB G;  5APV A;  4WY4 C;  1H0T B;  2FY8 A;  2A45 I;  1IFJ A;  1IFI A;  4DZO A;  1RY3 A;  4OGQ D;  1S3J A;  4PJ0 H;  2LKM A;  3L73 D;  2Y0E A;  3V2N A;  1EDL A;  3FXD A;  1JO5 A;  3H1L G;  5GTH H;  5APY A;  2HOD B;  4H13 B;  1HBW A;  3L72 E;  4JPZ B;  4W7Y A;  3M06 A;  2KNC B;  2W27 A;  1RQU A;  1NTZ E;  2POH A;  1SQB D;  1SQP K;  3CCM P;  3HD7 A;  1OZH A;  4W7Z A;  2YKO A;  1Y47 A;  2OYI C;  1L4A B;  2G3A A;  4C46 A;  1T8Z A;  2H8P D;  2E42 A;  4HB1 A;  3RBX A;  1OVR A;  2K88 A;  2XKM A;  3I5C A;  1GL2 C;  5APS A;  2YO2 A;  3U59 A;  2JP3 A;  1EDI A;  2IYP A;  4R4M A;  1KQL A;  3MHV A;  1VQN P;  4K3A A;  1N86 A;  3MTU E;  2FFD A;  1J1E B;  1H88 A;  3CLQ A;  1ZR2 A;  1CI6 B;  4L74 A;  3H1I J;  4PD4 H;  2ZJS E;  1J1D C;  3MD0 A;  5AW1 B;  3CL3 D;  2GUS A;  1UIX A;  3RK3 B;  2AEM A;  3H1J E;  3HE4 A;  2YXQ B;  1RHZ B;  1SQQ D;  4I2L C;  1DIP A;  2C0X A;  2C9L Y;  1NJI Q;  1DH3 A;  3W67 A;  1KZU B;  1M1J B;  1JM0 A;  1RE4 A;  3L70 G;  1N73 C;  1YQ4 C;  3WUT A;  1S2E A;  3L36 A;  1AVO A;  2E75 B;  3KYQ A;  4I7Z B;  3HRN A;  4CPG A;  4H13 C;  3F89 A;  1SQP D;  3L75 D;  4H0L B;  2KZJ A;  2BCC D;  3AE5 C;  3TYY A;  3ABV C;  1JY2 P;  3AEA C;  2FYU E;  1LNQ A;  1ZW0 A;  3L75 J;  2KSJ A;  1L4A C;  2BCC J;  3NMD A;  1NYH A;  1KIL C;  3E1R A;  2V7Q J;  3OJA B;  2LR2 A;  2Y9Y A;  3Q5S A;  2OYI A;  1T3U A;  2B88 A;  1OXZ A;  1S1C X;  4GKG A;  1GL2 A;  1FZG A;  3P8C E;  4EIJ A;  2E75 D;  2KI7 B;  2JO1 A;  1J1E C;  3CD6 P;  4MN4 C;  3JCU E;  2NZ2 A;  1NTM K;  5CJ0 A;  3CPW O;  4H0L D;  1SP4 A;  2OYO A;  2E74 D;  2W6J H;  4NPE A;  3VMA A;  4H44 B;  3AE1 C;  3HTK A;  1LTI C;  1M7L A;  1MFZ A;  2QJP B;  3H1I G;  4AUW A;  1G2C B;  2H43 A;  1IK9 A;  2RMZ A;  3E1I A;  3GMA A;  3RK3 C;  2PP6 A;  3TNU A;  2FXO A;  1GU4 A;  4BWN A;  2XU6 A;  4D6T J;  3FGA D;  2K9J B;  1EZV E;  2FBW C;  3G71 P;  1LT9 C;  2P1J A;  2BEZ F;  3N7N A;  2WSF H;  2A45 G;  4BXL A;  1R5L A;  5AW8 B;  2O01 J;  2Q1K A;  2QJK B;  4IL6 H;  1MV8 A;  2ZYA A;  1H0T A;  1USD A;  1BCC D;  2W6A A;  2ZVN B;  3EWK A;  1HGZ A;  1N73 A;  1KIL E;  2KK7 A;  1LP1 B;  4LC1 A;  1R8E A;  2D2C D;  1Y9B A;  3TSI A;  2HOD A;  2JJL A;  3MUD C;  5AW7 B;  3GW6 A;  1LJ2 A;  1S9K D;  1Y8A A;  3H1H E;  2Q3I A;  1K04 A;  3VOP A;  1BCC J;  2KNC A;  1H8A A;  3ITK A;  1L0L E;  4PD4 I;  4EI2 A;  1SQV E;  2XDJ A;  1IC2 A;  1OIP A;  2L5G B;  5M1B A;  3L75 G;  2Y9Z A;  2BCC G;  2Q5U A;  1NTM D;  1HVV A;  1L4A A;  3CCR P;  1HJ0 A;  4XA4 A;  2AEJ A;  2QEX P;  2O01 N;  1VQ4 P;  1KIL A;  1LWU B;  3RK3 E;  2WTY A;  1NAY A;  1XTG B;  2Q9I A;  1OVU A;  2IPP A;  2OYH B;  4TT3 H;  3QWO C;  3TGU E;  1PP9 E;  4R4L A;  4H44 C;  5TIS E;  1T2K C;  1NTM J;  2IFM A;  3C1L A;  2QJY C;  1GD2 E;  4N3Y B;  2IBZ I;  2QJP C;  1JNM A;  2GA1 A;  1VF5 C;  1CI6 A;  4U3F D;  4B86 A;  4WB4 A;  3EQ2 A;  3VMX A;  3IF4 A;  3H1L D;  1HUC A;  2NPS B;  1KFN A;  3B8E B;  3CX5 E;  2KOG A;  2WIT A;  3L35 A;  2GM4 A;  2N1T B;  1S72 P;  4QMA A;  3WUV A;  2E76 C;  1OX3 A;  4D6T G;  1PGP A;  1JUN A;  2YNY A;  1M57 D;  4U3F J;  4DJG A;  1KD1 Q;  4L76 A;  1LT9 A;  4L73 A;  4PD4 D;  2KB7 P;  3CCS P;  2A06 E;  2G8Y A;  2O1K A;  3AED C;  1PIX A;  2IYO A;  1AJY A;  2R32 A;  1URQ B;  2KLU A;  3V4Q A;  3UIA A;  5TIS H;  1RE3 C;  3M9H A;  2DW3 A;  3M0A A;  5H2F E;  1BSN A;  1KMI Z;  2NPS D;  3MUD A;  3FWL A;  3BRT B;  1BCC G;  2IBZ D;  1USE A;  1AA0 A;  1L0N E;  2K37 A;  4TLF A;  1YHQ P;  1NTK E;  1KC8 Q;  1EQ7 A;  1LTA C;  2AXC A;  3P7K A;  2OYH C;  1JCC A;  3H1K E;  2ZXE B;  2HYN A;  3PRJ A;  2ZXX A;  3V2P A;  5KJ7 D;  1QVG O;  2YXR B;  3L70 D;  2HPC B;  1ZRT D;  1N7L A;  5CCG D;  1TU3 F;  2Z5I A;  4UB6 H;  1GW4 A;  1NTM G;  3LIE A;  3AEE C;  5KLI C;  1PV3 A;  1BGY D;  2AEF A;  1LTB C;  4JQ0 D;  5KAF E;  1X8Y A;  1G2C A;  2M5A B;  2P67 A;  5AW2 B;  2N1T C;  1PFI A;  5H2F H;  1PGQ A;  3WMM 0;  1J2J B;  3V2R A;  3IFM A;  2JDI H;  5BU8 B;  2K9J A;  3G9R A;  2FYN C;  5AW3 B;  3H1J J;  1BGY J;  4RKU J;  1YTZ I;  3KPE A;  2E43 A;  3V4W A;  4W80 A;  1BE3 D;  1H89 A;  4N78 D;  4U3F G;  1HJB A;  3G6E P;  3BAS A;  1YJW P;  3K5B A;  3II6 A;  2RH0 A;  3HUS B;  1PZQ A;  1MFT A;  1URQ C;  2CK3 H;  2QM8 A;  1JB0 J;  1GU5 A;  1ZN5 A;  3M91 A;  3KHU A;  4RO0 A;  4GT1 A;  3H6P A;  5APW A;  3CXH E;  1BE3 J;  1JEK A;  5CCH D;  1SVF A;  2OAR A;  1FZF A;  4I6M C;  1FBM A;  1P84 D;  2WSC H;  2ZYD A;  5AVW B;  1RE3 A;  1RF1 B;  3KXD A;  1M8O B;  1RF0 C;  2FYU J;  4A7P A;  1AVY A;  3SFE C;  3H1I D;  1X9V A;  4OGQ C;  1SQV K;  1DD3 A;  1KB9 D;  4M3L A;  2AXT E;  2Z5H A;  3V5B A;  1K05 A;  1CSB A;  4HYT B;  1Q7Y Q;  2OYH A;  2K3R A;  1KQG B;  2N9B A;  2ZT9 B;  1QGK B;  2IBZ G;  3I56 P;  1M56 D;  4YTP C;  1AQ5 A;  3D6Z A;  1PPJ E;  1NHL A;  3IR9 A;  3G3Z A;  2ZYG A;  1NKZ B;  2WT7 B;  2KYV A;  1GZL A;  2WSE H;  3AE8 C;  1FDI A;  3SWF A;  4AYC A;  2P7J A;  1RH5 B;  1SFC D;  1K8A Q;  2WPQ A;  3Q5R A;  2N1T A;  5AW6 B;  1FAV A;  5AW9 B;  2B9B A;  3H25 A;  1FZC B;  5KAI E;  1JMB A;  5AVR B;  3H1J G;  1BGY G;  2N9Y B;  2W8Z A;  1NGM B;  2E74 B;  1X22 A;  1HH0 A;  2AXT H;  2UWJ E;  3PLN A;  1SQX E;  1GDT A;  5APT A;  5L8R J;  2W83 C;  2FXM A;  3Q5P A;  2ZT9 D;  1LTG C;  3LID A; 
#chains in the Genus database with same CATH homology
 4UB6 H;  3JCU H;  1S5L H;  5KAI H;  4IL6 H;  5B66 H;  4UB8 H;  3A0B H;  5B5E H;  5E79 H;  2AXT H;  5TIS H;  3KZI H;  3A0H H;  3WU2 H;  4PJ0 H;  5KAF H;  5H2F H;  5GTH H;  5GTI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...