5H2FH

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
total genus 15
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5h2fH01
5KAIH 5H2FH 3JCUH 5GTIH 4UB8H 4UB6H 3A0BH 5KAFH 5TISH 2AXTH 3A0HH 5E79H 5GTHH 1S5LH 3WU2H 5B66H 5B5EH 3KZIH 4PJ0H 4IL6H
chains in the Genus database with same CATH superfamily
1RHZB 3CCRP 1U7MA 5KLIB 3TGUE 1GL2B 1FOSF 1LT1A 1SQXG 2K9JB 2KSJA 1NTZD 3V4WA 4AUWA 1N7SB 2NPSD 3LIEA 5AW7B 3AE7C 3L73D 5AW8B 3RL0g 1N73A 4IFMA 1AQTA 3Q5SA 4NPDA 4W80A 1AA0A 3ABVC 2J58A 1GU5A 5AVSB 3RBZA 1MZ9A 2AEMA 1K05A 3L75J 3I5CA 1EDJA 5B66H 2HFED 1JY3O 3AE8C 3HE5A 1BCCG 1AVYA 3CLQA 5KLVK 3C1LA 1RF1B 1JY3P 1LTGC 2LXBA 5AVUB 1LWUB 1ZR2A 1YTZT 4QMAA 1G1JA 1PZQA 1FDIA 1N73B 3B4SA 4NPFX 2Y9ZA 1PP9J 3EFFK 2M3BA 3H1KG 5GTIE 1SQBD 2WPSA 1JOCA 1NYHA 1E79H 2M8RA 2W90A 1DEBA 1L0LD 1WMKA 2JDIH 2QJYB 4XE5B 3JC22 4H13B 1Q2NA 1KQFB 1PPJD 1X0TA 4R4MA 5GTIH 1H0TA 3RGUA 2LKMA 3MGNA 1JY2P 2C0XA 5CCGA 3LIDA 4I2LC 3WU2E 3CCQP 1YHQP 1NTKE 3L71E 1N7LA 3BASA 3EFGA 2FYUG 3L72E 5AW9B 2ZYAA 3CWBG 2Q3EA 4D6TJ 1NWQA 1KN7A 2E74B 2O1KA 2P1JA 1M57D 2RKLA 3SSUA 5CBNA 2LR2A 1PPJG 2IDBA 4PD4D 1GD2E 2QA4P 1SQVK 4PD4H 5APTA 2WQYC 2OARA 2P67A 1SQPG 3II6A 1IFMA 1SFCC 4L73A 3TGUJ 2KS1B 3BCCE 3H1JG 2A45H 3TNUB 5KKZB 3CCVP 1R8EA 1L0LG 1NTZE 3TYYA 1PV3A 2POHA 3L74J 1FDMA 5CCHA 3E7KA 4IFDK 1E5WA 2Z5IA 1M90Q 4IL6X 1LWUA 3H1JD 1JCDA 1GL2C 2A45G 4H0LB 2HYNA 3Q5PA 3CWBD 1KZUB 1RE3A 1ZLLA 4I6MC 5KJ7A 2WTYA 3CWBE 3WMM0 3M0DA 4U7JA 1PGJA 2PGDA 2KZJA 3VYIA 1CSBA 4L75A 1JTHB 2Y0DA 4WVZA 1L0NK 1SQXJ 1FJPA 4RESB 1KB9I 1ZN5A 3MD0A 1L0LJ 1N7SA 2JP3A 2WSCJ 1M7LA 1OVVA 2K9JA 3AE5C 3W68A 1HGZA 1H0TB 2I8DA 2IZ1A 1JCCA 4H13C 2YMYA 4IL6H 2Q1KA 2DW3A 2WSSH 2N1TC 3G9RA 3PLNA 5DJUB 2ZJSE 3GG2A 3Q2YA 1S5LX 5KJ7D 1URQD 5CBOA 5CCGC 3ITKA 1OX3A 5AVWB 5B5EH 2HODB 1NAYA 1ZRTD 3VN0A 2KLVA 1SFCA 3I55P 2QJYC 3L75E 3FWNA 1AJYA 1NTME 4K3AA 1HTLC 1KB9D 4EDFA 1PGOA 1RF1C 4LLHA 1H89A 2BEQD 1EDIA 4I7ZC 1PFIA 3HTKA 3R2PA 3TF5A 2H7HA 4GKGA 3AEGC 4OH8B 3FWLA 1NTZJ 3CC7P 1VQNP 4MN4C 3OAKA 1HWTC 1LJ2A 3GW6A 2QSIA 1JNMA 3HRNA 1GW4A 1S1CX 2KNCB 2QJKB 4GIFA 3B5NA 5GTHH 4C46A 1ZR4A 2HLOA 3H1LE 2IYPA 3HD7D 2Q7CA 2R5BA 1LT9A 1IZNB 2I1KA 2MKVA 3CXHE 4PJ0H 3SFDC 1VQ4P 1KILE 1FC2C 2QM7A 3HE4A 3L35A 1N86A 5B66E 1NTMG 1HJBA 1BDCA 3CMAP 3FGAD 4Y99C 5C39A 3IFMA 5AVYB 2CK3H 1DD4A 1EZVI 1RF0C 2FXMA 2A06D 2KI7B 1KYOH 2WSEH 2XKMA 5DJTB 3WUTA 5BVZA 1L4AA 1FZGA 1NAFA 3KPEA 2HPCA 1KYOI 1SS1A 3CWBJ 5M1BA 1S4XA 3AEBC 3L71D 4C7RA 4LC1A 3U1AA 2JWDA 1X79B 3A7OA 3D6ZA 3A2AA 4ASWA 5TISH 3D70A 2R44A 3IAOA 1MKMA 1BCCD 1T2KC 4BRYB 2C9LY 1KV4A 4PV1C 1RQUA 1N8RQ 3H1KJ 3CXHI 2O01H 2QVAA 2GUVA 1G2CB 3P32A 1KQSO 1QL2A 5AVRB 1K9MQ 2Y0CA 3GMAA 1QX8A 1VDFA 2NPSA 3B5ND 3VTPC 3T97B 4UB6E 2RMZA 2XNDH 1FS0E 2QM8A 3QWOC 2C9NY 3L70G 3HE5B 1KYOE 2YO2A 1G1IA 3RK3D 3MIWA 1DH3A 1BDDA 2BCCG 4ZKUA 1L0NE 1VQ7P 1LTJA 2BASA 3L74D 2G8YA 5APWA 2YKPA 1U57A 2KP8A 3KZIH 5H2FE 4U3FG 3CC2P 4DOJA 2BEZF 5KLVD 3V5BA 4H44C 1Z56A 3MP7B 4HYTB 1SFCD 2Z5HA 2ZYDA 1LTTC 3B71A 4WB4A 4CPGA 1Y9BA 2XNXA 4TLFA 1JTHA 3L73G 3CPWO 1X9VA 1IFIA 4EYYQ 2BCCJ 1M8OB 3FXEA 1J1EB 1QLED 2E76D 3F89A 2WT7A 1L0NG 1EXIA 1X8YA 1HBWA 2IX7C 1SQQD 4W7YA 2KYVA 2ZFCA 2B9BA 1R5LA 3M9QA 3Q5RA 2QG4A 3H1KE 1S2EA 3GHGB 1Q7YQ 3Q3DA 3CCEP 1BGYJ 1L0ND 2ZT9D 4KJMA 5AW3B 2FBWC 2R32A 3KYQA 3V4QA 4ASVA 3JSVC 5CCHD 3A0BH 4OGQD 3G3ZA 2H88C 1NU1K 5KJ7C 1VQPP 3H25A 5L8RJ 1OMIA 5KLIC 3H1HE 2PFXA 3FX0A 1N7SC 3BATA 2G3AA 4H44B 1NTMK 2E75D 1RE4A 3U1CA 2E42A 4IFFA 3CCSP 5TJHA 1PP9E 3C8VA 3HUSC 3P8CE 2KUBA 3A0HH 3JCUE 2K3RA 1HH0A 2AXCA 2YKQA 1H8AA 1N73C 3TSIA 1CZQA 1KD1Q 4PD4E 3KXDA 1PGQA 2JKVA 3VMAA 1OVUA 2WMMA 3V2PA 1FZCB 5E79E 1GL2D 1ZXGA 2E43A 3MTUE 3L74G 1CI6B 1BE3E 3WU2H 4L76A 5KLVG 2E5YA 2N9BA 4KHXA 2IBZD 2XDJA 1GL2A 4DJGA 2FXPA 2B88A 1JUNA 5KAFE 1SQBE 3AE4C 4KT0J 1IFJA 3L70D 3GHGC 1SQPE 1JY3N 1ZP0C 1XTGB 1FZFA 1RF0A 1LTBC 3HD7A 1GU4A 1HF9A 2JWAA 2N1TD 4U3FE 3W67A 1AFOA 2B89A 4RO0A 5CCGD 2N1TA 3AE3C 2W8ZA 1YTZI 2FYNB 3MUDC 3RK2B 3VP8A 1KILC 2W83C 5E79H 1Q86Q 1BSHA 3U59A 2FYUD 5CJ4A 1BE3G 1SQQJ 2O01N 1GZLA 3V2NA 2WPVB 1HUCA 1CW5A 1NTKK 1OVRA 1U7JA 3H1HJ 1NHLA 1T8ZA 3ZDMA 3JCUH 4EIJA 1J1DB 4WWIA 4RKUJ 1IJDB 1L4AD 2FYZA 2WWWA 3BCCJ 4EI2A 1GK6A 1KFNA 1LGHB 2O1JA 2P10A 2OGUA 2PP6A 3PJSK 4R4LA 1FZAA 1QL1A 4DCKA 1URQA 5KTBA 1S9KD 1NTZK 3USSA 2Z4EA 4IOIH 1YYCA 2R3SA 1YQ3C 1NH4A 3KDPB 1BSNA 3PTZA 2OYOA 2VRSA 5KKZC 3OJAB 4JYCA 3VOPA 2K88A 3AEDC 1FZCA 1HVVA 2A06E 4N78E 3S9OA 1RQVA 1PL5A 2OYHB 1SQBJ 2E76C 1KMIZ 3BRVB 3FXDA 2KSEA 4WY4A 1OFCX 3EWKA 3HUSB 2FYUE 2NZ2A 1JO5A 1AVOA 1X22A 2D2CB 5AW0B 5KAIE 1NKNA 1YQ4C 2GUSA 2FKWB 2V4HA 2FFDC 2OYHA 1KILB 3H1LJ 1T2KD 3KQGA 3H1ID 3AE6C 4PV1D 2XV5A 1UIXA 4ZMDA 4JBZA 3VMYA 1SQQE 2QEXP 2K9YA 4Y99B 3H1LG 1DEEG 1T3JA 3CCMP 1KQGB 1SP4A 1FDOA 2L91A 2B87B 2QJPB 3O6QB 4OGQC 1IC2A 4WY4D 1USDA 5AW1B 3CMEP 3BCCG 3H1JE 1KB9E 5APUA 1BCCE 3N4XA 3SFEC 1VQ6P 3RK3C 1FBMA 2OTJP 3L70J 1N7SD 2NPSB 1WT6A 2FY8A 1BE3D 2N9YB 3NXSA 4UB8E 2FYUK 1G2CA 3I56P 1IO4A 2CPSA 1VQLP 1LT9C 1SQPJ 2E5TA 3KZIE 2A45I 2OQQA 3CX5E 3SWFA 2Q3IA 4Y28J 4H44D 3S4RA 1FU1A 1JMBA 3WUUA 1VQ8P 1EZVG 2B87A 2KIKA 3SWKA 1DD3A 4BWNA 1SQBG 2JEEA 4N6JA 5APVA 2KK7A 3KHUA 3QH9A 5AW2B 5CHXA 3IR9A 1L0LK 4M3LA 3RK2C 1OW6A 4UB6H 1ZMEC 1OW8A 1A02F 3P8CD 1JY2O 1IFNA 1L4AB 3G6EP 1K8AQ 4HB1A 2H43A 1KILA 3G4SP 2E74D 2QJKC 1KTMA 2GM4A 1TU3F 4HJGH 2WSFH 2XZRA 2J5UA 1VQ5P 1PGPA 3OW2O 5BU8B 1FZEA 1OZHA 1M56D 2W6BA 2ZVOB 3AECC 2WSEJ 3K5BA 4C7NB 4N3YB 4O9BA 5TISE 3B5NB 2AXTE 3BRTB 4GODA 2P58A 1ZRTE 2ZT9C 1CI6A 1VF5C 3H32B 4YXDC 2KB7P 1K73Q 2H89C 3HTKB 4TT3H 2M5AA 1NTZG 4AYCA 4H0LD 1SQXD 2IFMA 5CCHC 1NJIQ 3CX5D 1VPCA 2QE7H 3H1IG 3CX5H 1KFMA 3H32A 1KILD 3H1LD 1T3UA 3P7KA 4PJ0E 2W6JH 3RK3E 2YNYA 3O8ZA 1RY3A 2QJPC 1NU1J 1SVFA 5GTHE 2L5GB 1OIPA 2LXCB 4K35A 3BVHA 1L0NJ 1SQXK 3CCLP 1J1EC 2E75C 1PPJE 2D2CC 3R4YA 1KB9H 1YJ9P 2K1AA 2WPRA 3V6IA 2FFDB 1NU1D 5AW5B 2QRXA 3H1HD 2OYHC 1IK7A 1L4AC 2E76B 1Y8AA 2MJZA 1IFDA 1P84H 1VQMP 1YITP 1VQKP 3H1IE 2ITAA 5AVZB 2Q9IA 5AVQB 3AE2C 5BU5A 5K5GB 2XU6A 3D6YA 1IFPA 1JM0A 2KXPB 3BCCD 1H88A 1OW7A 2NRGA 2NPSC 2QIWA 3L75G 1L2PA 5APXA 1KYOD 4EOTA 1M1KQ 3RL0C 1OXZA 1VF5B 3OA7A 3H1KD 5CMZA 5KLVJ 2GA1A 1LP1A 2KNCA 3M91A 2H8PD 1EZVD 1GK4A 2BCCE 2WSFJ 1KQLA 3AE1C 1S5LH 3RK3B 1LNQA 2KS1A 2Y0EA 3L70E 2Q6QA 1W2EA 1FZCC 1SQVG 2IZ0A 3IF4A 1YIJP 3TGUG 4GT1A 1N2DC 1YBKA 2SPZA 3CI9A 1VL2A 3L4FA 3PHLA 1OWAA 1NU1E 2YIUB 4PD4I 1M1JB 3L36A 2WPQA 3RBXA 2YKOA 4I1LA 2O3JA 1W2BO 1S5LE 4NPEA 2OYIC 2IBZI 3HD7B 1ZV8A 4WY4C 1GW3A 5AW4B 4D6TG 3B8EB 4HKZH 1HGVA 4DT0A 3CX5I 1YI2P 3CCUP 3AE9C 2I1JA 1QVGO 1M1JA 3PP5A 1YJNP 1MV8A 1K04A 1SQVJ 1XTCC 1LTIC 3LW5J 4GDOA 2IPPA 3G71P 1NOHA 3CCJP 1FJKA 2K37A 1W5CE 2IBZG 2P7JA 4I7ZB 3A3YB 4L74A 3M06A 1A02J 1P84E 1SQVD 1R5SA 1YJWP 1RF1A 3CC4P 1LP1B 2HR3A 3SWYA 3RL0B 1BGYG 3GF3A 1ZOYC 1S3JA 2WITA 2W6AA 1URQB 3H1IJ 4HH2A 3TDKA 5KAFH 4WBAA 1GTWA 3UIAA 1JY2N 1BE3J 1NTKG 2M0BA 2PAJA 3L72G 4RJTA 4DZOA 1S9KE 2ZAEB 1NGMB 1QEXA 3GHGA 3CL3D 1NO4A 1DIPA 3M9HA 4XA4A 1NVOA 3NMDA 1UIIA 3D71A 3GLMA 1J2JB 2AEJA 2O01J 1WRGA 1SQBK 3E1RA 1KORA 1MUUA 3IN6A 5KLVE 2HPCB 4YXWH 3V2QA 1NTMJ 5AVTB 1SQQG 1USEA 1HJ0A 2R5DA 3AEFC 4JYBA 4C7NA 1S72P 1Q81Q 3P8MC 2FFDA 3PRJA 1RH5B 1P84I 2FYNC 1PP9G 1MFTA 1NTKD 3L72D 3L73E 3A0HE 1NU1G 2AXTH 1M1JC 1BGYD 1VQ9P 2OTKE 4JF7A 2A06G 2V7QH 4U3FJ 2IFNA 2W27A 3EQ2A 3MHVA 3V2RA 4Z1MH 3GF7A 1FE6A 2FXOA 1EDLA 1LTAC 1ZW0A 2WSCH 1EXJA 1LTJB 3VMXA 2RN0A 3O6QA 2M5AB 4GOFA 2ZXXA 3AEAC 1VQOP 1MFZA 3S1KA 1DX7A 4XFJA 1EZVE 2BCCD 1P84D 1SQVE 3M0DC 2FYUJ 3A0BE 1RE3C 3VMZA 4PV1B 3WUVA 2M3EA 2ZXEB 1SQPK 4W7ZA 5AVXB 3H1HG 3RK2D 4D6TD 2HODA 3H1JJ 2KOGA 3CD6P 1J1DC 2YXRB 1LTSC 5AVVB 1AQ5A 4B86A 3HD7C 4WY4B 4N78D 3CXHH 2RH0A 3CXHD 2AEFA 1GMJA 1RE4C 2E74C 1Y47A 4LGDE 3NFQA 4UB8H 5APQA 2JO1A 3H6PA 5CJ0A 3TGUD 2YIUC 1QVFO 3LW5H 2OTLP 4U3FD 3RL0D 1PP9D 1JEKA 3MZWB 2OYIB 3L71G 1Q90D 1QGKB 1Q82Q 5EFWB 1NTKJ 2J59M 2Q5UA 2ZVNB 3L72J 2JJLA 4JQ0D 4A7PA 4AQRD 1VF5D 1EQ7A 2UWJE 4ZNCA 1KC8Q 3HE4B 2YMKA 4H13D 3A5TA 3T97A 3L75D 2IBZE 4H0LC 1NTMD 1BGYE 2KZIA 4ZKPA 1URQC 2C0WA 2R3CA 4OGQB 5APYA 1EDKA 2WVRA 5AW6B 3M9BA 1T6AA 1LWUC 1BCCJ 2KLUA 2YXQB 4JPZB 1PIXA 5B5EE 5KAIH 3Q1MA 1SLQA 5H2FH 2CPBA 1JMMA 3E1IA 3B5NC 3L74E 4OWFA 3TNUA 4BRYA 3M0AA 3L71J 4D6TE 1SQXE 1JB0J 2IYOA 2ZT9B 2JR8A 3F5HA 4IL6E 2D2CD 2YO3A 1FOSE 3C9IA 2PRRA 2ZYGA 1IK9A 1LTJC 2HG5D 1FAVA 4OVNF 2N1TB 1D7MA 3N7NA 4YPCA 4BXLA 2P2UA 2Y9YA 3AEEC 3NTNA 2WT7B 1FZBA 2V7QJ 1AV1A 1SFCB 3L37A 3VP9A 1EC5A 1SQPD 3MUDA 4YTPC 3L73J 4GOEA 5APSA 2WZ7A 3PH0A 1L0LE 2OYIA 1SQQK 1GDTA 3TK1A 3HUSA 1LT9B 1NKZB 2E75B
chains in the Genus database with same CATH topology
5KAIH 5H2FH 3JCUH 5GTIH 4UB8H 4UB6H 3A0BH 5KAFH 5TISH 2AXTH 3A0HH 5E79H 5GTHH 1S5LH 3WU2H 5B66H 5B5EH 3KZIH 4PJ0H 4IL6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI H;  5H2F H;  3JCU H;  5GTI H;  4UB8 H;  4UB6 H;  3A0B H;  5KAF H;  5TIS H;  2AXT H;  3A0H H;  5E79 H;  5GTH H;  1S5L H;  3WU2 H;  5B66 H;  5B5E H;  3KZI H;  4PJ0 H;  4IL6 H; 
#chains in the Genus database with same CATH topology
 1RHZ B;  3CCR P;  1U7M A;  5KLI B;  3TGU E;  1GL2 B;  1FOS F;  1LT1 A;  1SQX G;  2K9J B;  2KSJ A;  1NTZ D;  3V4W A;  4AUW A;  1N7S B;  2NPS D;  3LIE A;  5AW7 B;  3AE7 C;  3L73 D;  5AW8 B;  3RL0 g;  1N73 A;  4IFM A;  1AQT A;  3Q5S A;  4NPD A;  4W80 A;  1AA0 A;  3ABV C;  2J58 A;  1GU5 A;  5AVS B;  3RBZ A;  1MZ9 A;  2AEM A;  1K05 A;  3L75 J;  3I5C A;  1EDJ A;  5B66 H;  2HFE D;  1JY3 O;  3AE8 C;  3HE5 A;  1BCC G;  1AVY A;  3CLQ A;  5KLV K;  3C1L A;  1RF1 B;  1JY3 P;  1LTG C;  2LXB A;  5AVU B;  1LWU B;  1ZR2 A;  1YTZ T;  4QMA A;  1G1J A;  1PZQ A;  1FDI A;  1N73 B;  3B4S A;  4NPF X;  2Y9Z A;  1PP9 J;  3EFF K;  2M3B A;  3H1K G;  5GTI E;  1SQB D;  2WPS A;  1JOC A;  1NYH A;  1E79 H;  2M8R A;  2W90 A;  1DEB A;  1L0L D;  1WMK A;  2JDI H;  2QJY B;  4XE5 B;  3JC2 2;  4H13 B;  1Q2N A;  1KQF B;  1PPJ D;  1X0T A;  4R4M A;  5GTI H;  1H0T A;  3RGU A;  2LKM A;  3MGN A;  1JY2 P;  2C0X A;  5CCG A;  3LID A;  4I2L C;  3WU2 E;  3CCQ P;  1YHQ P;  1NTK E;  3L71 E;  1N7L A;  3BAS A;  3EFG A;  2FYU G;  3L72 E;  5AW9 B;  2ZYA A;  3CWB G;  2Q3E A;  4D6T J;  1NWQ A;  1KN7 A;  2E74 B;  2O1K A;  2P1J A;  1M57 D;  2RKL A;  3SSU A;  5CBN A;  2LR2 A;  1PPJ G;  2IDB A;  4PD4 D;  1GD2 E;  2QA4 P;  1SQV K;  4PD4 H;  5APT A;  2WQY C;  2OAR A;  2P67 A;  1SQP G;  3II6 A;  1IFM A;  1SFC C;  4L73 A;  3TGU J;  2KS1 B;  3BCC E;  3H1J G;  2A45 H;  3TNU B;  5KKZ B;  3CCV P;  1R8E A;  1L0L G;  1NTZ E;  3TYY A;  1PV3 A;  2POH A;  3L74 J;  1FDM A;  5CCH A;  3E7K A;  4IFD K;  1E5W A;  2Z5I A;  1M90 Q;  4IL6 X;  1LWU A;  3H1J D;  1JCD A;  1GL2 C;  2A45 G;  4H0L B;  2HYN A;  3Q5P A;  3CWB D;  1KZU B;  1RE3 A;  1ZLL A;  4I6M C;  5KJ7 A;  2WTY A;  3CWB E;  3WMM 0;  3M0D A;  4U7J A;  1PGJ A;  2PGD A;  2KZJ A;  3VYI A;  1CSB A;  4L75 A;  1JTH B;  2Y0D A;  4WVZ A;  1L0N K;  1SQX J;  1FJP A;  4RES B;  1KB9 I;  1ZN5 A;  3MD0 A;  1L0L J;  1N7S A;  2JP3 A;  2WSC J;  1M7L A;  1OVV A;  2K9J A;  3AE5 C;  3W68 A;  1HGZ A;  1H0T B;  2I8D A;  2IZ1 A;  1JCC A;  4H13 C;  2YMY A;  4IL6 H;  2Q1K A;  2DW3 A;  2WSS H;  2N1T C;  3G9R A;  3PLN A;  5DJU B;  2ZJS E;  3GG2 A;  3Q2Y A;  1S5L X;  5KJ7 D;  1URQ D;  5CBO A;  5CCG C;  3ITK A;  1OX3 A;  5AVW B;  5B5E H;  2HOD B;  1NAY A;  1ZRT D;  3VN0 A;  2KLV A;  1SFC A;  3I55 P;  2QJY C;  3L75 E;  3FWN A;  1AJY A;  1NTM E;  4K3A A;  1HTL C;  1KB9 D;  4EDF A;  1PGO A;  1RF1 C;  4LLH A;  1H89 A;  2BEQ D;  1EDI A;  4I7Z C;  1PFI A;  3HTK A;  3R2P A;  3TF5 A;  2H7H A;  4GKG A;  3AEG C;  4OH8 B;  3FWL A;  1NTZ J;  3CC7 P;  1VQN P;  4MN4 C;  3OAK A;  1HWT C;  1LJ2 A;  3GW6 A;  2QSI A;  1JNM A;  3HRN A;  1GW4 A;  1S1C X;  2KNC B;  2QJK B;  4GIF A;  3B5N A;  5GTH H;  4C46 A;  1ZR4 A;  2HLO A;  3H1L E;  2IYP A;  3HD7 D;  2Q7C A;  2R5B A;  1LT9 A;  1IZN B;  2I1K A;  2MKV A;  3CXH E;  4PJ0 H;  3SFD C;  1VQ4 P;  1KIL E;  1FC2 C;  2QM7 A;  3HE4 A;  3L35 A;  1N86 A;  5B66 E;  1NTM G;  1HJB A;  1BDC A;  3CMA P;  3FGA D;  4Y99 C;  5C39 A;  3IFM A;  5AVY B;  2CK3 H;  1DD4 A;  1EZV I;  1RF0 C;  2FXM A;  2A06 D;  2KI7 B;  1KYO H;  2WSE H;  2XKM A;  5DJT B;  3WUT A;  5BVZ A;  1L4A A;  1FZG A;  1NAF A;  3KPE A;  2HPC A;  1KYO I;  1SS1 A;  3CWB J;  5M1B A;  1S4X A;  3AEB C;  3L71 D;  4C7R A;  4LC1 A;  3U1A A;  2JWD A;  1X79 B;  3A7O A;  3D6Z A;  3A2A A;  4ASW A;  5TIS H;  3D70 A;  2R44 A;  3IAO A;  1MKM A;  1BCC D;  1T2K C;  4BRY B;  2C9L Y;  1KV4 A;  4PV1 C;  1RQU A;  1N8R Q;  3H1K J;  3CXH I;  2O01 H;  2QVA A;  2GUV A;  1G2C B;  3P32 A;  1KQS O;  1QL2 A;  5AVR B;  1K9M Q;  2Y0C A;  3GMA A;  1QX8 A;  1VDF A;  2NPS A;  3B5N D;  3VTP C;  3T97 B;  4UB6 E;  2RMZ A;  2XND H;  1FS0 E;  2QM8 A;  3QWO C;  2C9N Y;  3L70 G;  3HE5 B;  1KYO E;  2YO2 A;  1G1I A;  3RK3 D;  3MIW A;  1DH3 A;  1BDD A;  2BCC G;  4ZKU A;  1L0N E;  1VQ7 P;  1LTJ A;  2BAS A;  3L74 D;  2G8Y A;  5APW A;  2YKP A;  1U57 A;  2KP8 A;  3KZI H;  5H2F E;  4U3F G;  3CC2 P;  4DOJ A;  2BEZ F;  5KLV D;  3V5B A;  4H44 C;  1Z56 A;  3MP7 B;  4HYT B;  1SFC D;  2Z5H A;  2ZYD A;  1LTT C;  3B71 A;  4WB4 A;  4CPG A;  1Y9B A;  2XNX A;  4TLF A;  1JTH A;  3L73 G;  3CPW O;  1X9V A;  1IFI A;  4EYY Q;  2BCC J;  1M8O B;  3FXE A;  1J1E B;  1QLE D;  2E76 D;  3F89 A;  2WT7 A;  1L0N G;  1EXI A;  1X8Y A;  1HBW A;  2IX7 C;  1SQQ D;  4W7Y A;  2KYV A;  2ZFC A;  2B9B A;  1R5L A;  3M9Q A;  3Q5R A;  2QG4 A;  3H1K E;  1S2E A;  3GHG B;  1Q7Y Q;  3Q3D A;  3CCE P;  1BGY J;  1L0N D;  2ZT9 D;  4KJM A;  5AW3 B;  2FBW C;  2R32 A;  3KYQ A;  3V4Q A;  4ASV A;  3JSV C;  5CCH D;  3A0B H;  4OGQ D;  3G3Z A;  2H88 C;  1NU1 K;  5KJ7 C;  1VQP P;  3H25 A;  5L8R J;  1OMI A;  5KLI C;  3H1H E;  2PFX A;  3FX0 A;  1N7S C;  3BAT A;  2G3A A;  4H44 B;  1NTM K;  2E75 D;  1RE4 A;  3U1C A;  2E42 A;  4IFF A;  3CCS P;  5TJH A;  1PP9 E;  3C8V A;  3HUS C;  3P8C E;  2KUB A;  3A0H H;  3JCU E;  2K3R A;  1HH0 A;  2AXC A;  2YKQ A;  1H8A A;  1N73 C;  3TSI A;  1CZQ A;  1KD1 Q;  4PD4 E;  3KXD A;  1PGQ A;  2JKV A;  3VMA A;  1OVU A;  2WMM A;  3V2P A;  1FZC B;  5E79 E;  1GL2 D;  1ZXG A;  2E43 A;  3MTU E;  3L74 G;  1CI6 B;  1BE3 E;  3WU2 H;  4L76 A;  5KLV G;  2E5Y A;  2N9B A;  4KHX A;  2IBZ D;  2XDJ A;  1GL2 A;  4DJG A;  2FXP A;  2B88 A;  1JUN A;  5KAF E;  1SQB E;  3AE4 C;  4KT0 J;  1IFJ A;  3L70 D;  3GHG C;  1SQP E;  1JY3 N;  1ZP0 C;  1XTG B;  1FZF A;  1RF0 A;  1LTB C;  3HD7 A;  1GU4 A;  1HF9 A;  2JWA A;  2N1T D;  4U3F E;  3W67 A;  1AFO A;  2B89 A;  4RO0 A;  5CCG D;  2N1T A;  3AE3 C;  2W8Z A;  1YTZ I;  2FYN B;  3MUD C;  3RK2 B;  3VP8 A;  1KIL C;  2W83 C;  5E79 H;  1Q86 Q;  1BSH A;  3U59 A;  2FYU D;  5CJ4 A;  1BE3 G;  1SQQ J;  2O01 N;  1GZL A;  3V2N A;  2WPV B;  1HUC A;  1CW5 A;  1NTK K;  1OVR A;  1U7J A;  3H1H J;  1NHL A;  1T8Z A;  3ZDM A;  3JCU H;  4EIJ A;  1J1D B;  4WWI A;  4RKU J;  1IJD B;  1L4A D;  2FYZ A;  2WWW A;  3BCC J;  4EI2 A;  1GK6 A;  1KFN A;  1LGH B;  2O1J A;  2P10 A;  2OGU A;  2PP6 A;  3PJS K;  4R4L A;  1FZA A;  1QL1 A;  4DCK A;  1URQ A;  5KTB A;  1S9K D;  1NTZ K;  3USS A;  2Z4E A;  4IOI H;  1YYC A;  2R3S A;  1YQ3 C;  1NH4 A;  3KDP B;  1BSN A;  3PTZ A;  2OYO A;  2VRS A;  5KKZ C;  3OJA B;  4JYC A;  3VOP A;  2K88 A;  3AED C;  1FZC A;  1HVV A;  2A06 E;  4N78 E;  3S9O A;  1RQV A;  1PL5 A;  2OYH B;  1SQB J;  2E76 C;  1KMI Z;  3BRV B;  3FXD A;  2KSE A;  4WY4 A;  1OFC X;  3EWK A;  3HUS B;  2FYU E;  2NZ2 A;  1JO5 A;  1AVO A;  1X22 A;  2D2C B;  5AW0 B;  5KAI E;  1NKN A;  1YQ4 C;  2GUS A;  2FKW B;  2V4H A;  2FFD C;  2OYH A;  1KIL B;  3H1L J;  1T2K D;  3KQG A;  3H1I D;  3AE6 C;  4PV1 D;  2XV5 A;  1UIX A;  4ZMD A;  4JBZ A;  3VMY A;  1SQQ E;  2QEX P;  2K9Y A;  4Y99 B;  3H1L G;  1DEE G;  1T3J A;  3CCM P;  1KQG B;  1SP4 A;  1FDO A;  2L91 A;  2B87 B;  2QJP B;  3O6Q B;  4OGQ C;  1IC2 A;  4WY4 D;  1USD A;  5AW1 B;  3CME P;  3BCC G;  3H1J E;  1KB9 E;  5APU A;  1BCC E;  3N4X A;  3SFE C;  1VQ6 P;  3RK3 C;  1FBM A;  2OTJ P;  3L70 J;  1N7S D;  2NPS B;  1WT6 A;  2FY8 A;  1BE3 D;  2N9Y B;  3NXS A;  4UB8 E;  2FYU K;  1G2C A;  3I56 P;  1IO4 A;  2CPS A;  1VQL P;  1LT9 C;  1SQP J;  2E5T A;  3KZI E;  2A45 I;  2OQQ A;  3CX5 E;  3SWF A;  2Q3I A;  4Y28 J;  4H44 D;  3S4R A;  1FU1 A;  1JMB A;  3WUU A;  1VQ8 P;  1EZV G;  2B87 A;  2KIK A;  3SWK A;  1DD3 A;  4BWN A;  1SQB G;  2JEE A;  4N6J A;  5APV A;  2KK7 A;  3KHU A;  3QH9 A;  5AW2 B;  5CHX A;  3IR9 A;  1L0L K;  4M3L A;  3RK2 C;  1OW6 A;  4UB6 H;  1ZME C;  1OW8 A;  1A02 F;  3P8C D;  1JY2 O;  1IFN A;  1L4A B;  3G6E P;  1K8A Q;  4HB1 A;  2H43 A;  1KIL A;  3G4S P;  2E74 D;  2QJK C;  1KTM A;  2GM4 A;  1TU3 F;  4HJG H;  2WSF H;  2XZR A;  2J5U A;  1VQ5 P;  1PGP A;  3OW2 O;  5BU8 B;  1FZE A;  1OZH A;  1M56 D;  2W6B A;  2ZVO B;  3AEC C;  2WSE J;  3K5B A;  4C7N B;  4N3Y B;  4O9B A;  5TIS E;  3B5N B;  2AXT E;  3BRT B;  4GOD A;  2P58 A;  1ZRT E;  2ZT9 C;  1CI6 A;  1VF5 C;  3H32 B;  4YXD C;  2KB7 P;  1K73 Q;  2H89 C;  3HTK B;  4TT3 H;  2M5A A;  1NTZ G;  4AYC A;  4H0L D;  1SQX D;  2IFM A;  5CCH C;  1NJI Q;  3CX5 D;  1VPC A;  2QE7 H;  3H1I G;  3CX5 H;  1KFM A;  3H32 A;  1KIL D;  3H1L D;  1T3U A;  3P7K A;  4PJ0 E;  2W6J H;  3RK3 E;  2YNY A;  3O8Z A;  1RY3 A;  2QJP C;  1NU1 J;  1SVF A;  5GTH E;  2L5G B;  1OIP A;  2LXC B;  4K35 A;  3BVH A;  1L0N J;  1SQX K;  3CCL P;  1J1E C;  2E75 C;  1PPJ E;  2D2C C;  3R4Y A;  1KB9 H;  1YJ9 P;  2K1A A;  2WPR A;  3V6I A;  2FFD B;  1NU1 D;  5AW5 B;  2QRX A;  3H1H D;  2OYH C;  1IK7 A;  1L4A C;  2E76 B;  1Y8A A;  2MJZ A;  1IFD A;  1P84 H;  1VQM P;  1YIT P;  1VQK P;  3H1I E;  2ITA A;  5AVZ B;  2Q9I A;  5AVQ B;  3AE2 C;  5BU5 A;  5K5G B;  2XU6 A;  3D6Y A;  1IFP A;  1JM0 A;  2KXP B;  3BCC D;  1H88 A;  1OW7 A;  2NRG A;  2NPS C;  2QIW A;  3L75 G;  1L2P A;  5APX A;  1KYO D;  4EOT A;  1M1K Q;  3RL0 C;  1OXZ A;  1VF5 B;  3OA7 A;  3H1K D;  5CMZ A;  5KLV J;  2GA1 A;  1LP1 A;  2KNC A;  3M91 A;  2H8P D;  1EZV D;  1GK4 A;  2BCC E;  2WSF J;  1KQL A;  3AE1 C;  1S5L H;  3RK3 B;  1LNQ A;  2KS1 A;  2Y0E A;  3L70 E;  2Q6Q A;  1W2E A;  1FZC C;  1SQV G;  2IZ0 A;  3IF4 A;  1YIJ P;  3TGU G;  4GT1 A;  1N2D C;  1YBK A;  2SPZ A;  3CI9 A;  1VL2 A;  3L4F A;  3PHL A;  1OWA A;  1NU1 E;  2YIU B;  4PD4 I;  1M1J B;  3L36 A;  2WPQ A;  3RBX A;  2YKO A;  4I1L A;  2O3J A;  1W2B O;  1S5L E;  4NPE A;  2OYI C;  2IBZ I;  3HD7 B;  1ZV8 A;  4WY4 C;  1GW3 A;  5AW4 B;  4D6T G;  3B8E B;  4HKZ H;  1HGV A;  4DT0 A;  3CX5 I;  1YI2 P;  3CCU P;  3AE9 C;  2I1J A;  1QVG O;  1M1J A;  3PP5 A;  1YJN P;  1MV8 A;  1K04 A;  1SQV J;  1XTC C;  1LTI C;  3LW5 J;  4GDO A;  2IPP A;  3G71 P;  1NOH A;  3CCJ P;  1FJK A;  2K37 A;  1W5C E;  2IBZ G;  2P7J A;  4I7Z B;  3A3Y B;  4L74 A;  3M06 A;  1A02 J;  1P84 E;  1SQV D;  1R5S A;  1YJW P;  1RF1 A;  3CC4 P;  1LP1 B;  2HR3 A;  3SWY A;  3RL0 B;  1BGY G;  3GF3 A;  1ZOY C;  1S3J A;  2WIT A;  2W6A A;  1URQ B;  3H1I J;  4HH2 A;  3TDK A;  5KAF H;  4WBA A;  1GTW A;  3UIA A;  1JY2 N;  1BE3 J;  1NTK G;  2M0B A;  2PAJ A;  3L72 G;  4RJT A;  4DZO A;  1S9K E;  2ZAE B;  1NGM B;  1QEX A;  3GHG A;  3CL3 D;  1NO4 A;  1DIP A;  3M9H A;  4XA4 A;  1NVO A;  3NMD A;  1UII A;  3D71 A;  3GLM A;  1J2J B;  2AEJ A;  2O01 J;  1WRG A;  1SQB K;  3E1R A;  1KOR A;  1MUU A;  3IN6 A;  5KLV E;  2HPC B;  4YXW H;  3V2Q A;  1NTM J;  5AVT B;  1SQQ G;  1USE A;  1HJ0 A;  2R5D A;  3AEF C;  4JYB A;  4C7N A;  1S72 P;  1Q81 Q;  3P8M C;  2FFD A;  3PRJ A;  1RH5 B;  1P84 I;  2FYN C;  1PP9 G;  1MFT A;  1NTK D;  3L72 D;  3L73 E;  3A0H E;  1NU1 G;  2AXT H;  1M1J C;  1BGY D;  1VQ9 P;  2OTK E;  4JF7 A;  2A06 G;  2V7Q H;  4U3F J;  2IFN A;  2W27 A;  3EQ2 A;  3MHV A;  3V2R A;  4Z1M H;  3GF7 A;  1FE6 A;  2FXO A;  1EDL A;  1LTA C;  1ZW0 A;  2WSC H;  1EXJ A;  1LTJ B;  3VMX A;  2RN0 A;  3O6Q A;  2M5A B;  4GOF A;  2ZXX A;  3AEA C;  1VQO P;  1MFZ A;  3S1K A;  1DX7 A;  4XFJ A;  1EZV E;  2BCC D;  1P84 D;  1SQV E;  3M0D C;  2FYU J;  3A0B E;  1RE3 C;  3VMZ A;  4PV1 B;  3WUV A;  2M3E A;  2ZXE B;  1SQP K;  4W7Z A;  5AVX B;  3H1H G;  3RK2 D;  4D6T D;  2HOD A;  3H1J J;  2KOG A;  3CD6 P;  1J1D C;  2YXR B;  1LTS C;  5AVV B;  1AQ5 A;  4B86 A;  3HD7 C;  4WY4 B;  4N78 D;  3CXH H;  2RH0 A;  3CXH D;  2AEF A;  1GMJ A;  1RE4 C;  2E74 C;  1Y47 A;  4LGD E;  3NFQ A;  4UB8 H;  5APQ A;  2JO1 A;  3H6P A;  5CJ0 A;  3TGU D;  2YIU C;  1QVF O;  3LW5 H;  2OTL P;  4U3F D;  3RL0 D;  1PP9 D;  1JEK A;  3MZW B;  2OYI B;  3L71 G;  1Q90 D;  1QGK B;  1Q82 Q;  5EFW B;  1NTK J;  2J59 M;  2Q5U A;  2ZVN B;  3L72 J;  2JJL A;  4JQ0 D;  4A7P A;  4AQR D;  1VF5 D;  1EQ7 A;  2UWJ E;  4ZNC A;  1KC8 Q;  3HE4 B;  2YMK A;  4H13 D;  3A5T A;  3T97 A;  3L75 D;  2IBZ E;  4H0L C;  1NTM D;  1BGY E;  2KZI A;  4ZKP A;  1URQ C;  2C0W A;  2R3C A;  4OGQ B;  5APY A;  1EDK A;  2WVR A;  5AW6 B;  3M9B A;  1T6A A;  1LWU C;  1BCC J;  2KLU A;  2YXQ B;  4JPZ B;  1PIX A;  5B5E E;  5KAI H;  3Q1M A;  1SLQ A;  5H2F H;  2CPB A;  1JMM A;  3E1I A;  3B5N C;  3L74 E;  4OWF A;  3TNU A;  4BRY A;  3M0A A;  3L71 J;  4D6T E;  1SQX E;  1JB0 J;  2IYO A;  2ZT9 B;  2JR8 A;  3F5H A;  4IL6 E;  2D2C D;  2YO3 A;  1FOS E;  3C9I A;  2PRR A;  2ZYG A;  1IK9 A;  1LTJ C;  2HG5 D;  1FAV A;  4OVN F;  2N1T B;  1D7M A;  3N7N A;  4YPC A;  4BXL A;  2P2U A;  2Y9Y A;  3AEE C;  3NTN A;  2WT7 B;  1FZB A;  2V7Q J;  1AV1 A;  1SFC B;  3L37 A;  3VP9 A;  1EC5 A;  1SQP D;  3MUD A;  4YTP C;  3L73 J;  4GOE A;  5APS A;  2WZ7 A;  3PH0 A;  1L0L E;  2OYI A;  1SQQ K;  1GDT A;  3TK1 A;  3HUS A;  1LT9 B;  1NKZ B;  2E75 B; 
#chains in the Genus database with same CATH homology
 5KAI H;  5H2F H;  3JCU H;  5GTI H;  4UB8 H;  4UB6 H;  3A0B H;  5KAF H;  5TIS H;  2AXT H;  3A0H H;  5E79 H;  5GTH H;  1S5L H;  3WU2 H;  5B66 H;  5B5E H;  3KZI H;  4PJ0 H;  4IL6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...