2WPSA

Salmonella enterica sada 483-523 fused to gcn4 adaptors (sadak3b-v2, out-of-register fusion)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
98
structure length
98
Chain Sequence
QIEDKIEEILSKIYHIENEIARIKKLIEKVDQNTADITTNTNSINQNTTDIATNTTNINNLSDSITTLMKQIEDKIEEILSKIYHIENEIARIKKLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRIMERIC AUTOTRANSPORTER ADHESIN FRAGMENT
publication title A Coiled-Coil Motif that Sequesters Ions to the Hydrophobic Core.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Membrane protein
total genus 44
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wpsA00
4DZOA 1S9KE 5AW6B 4LC1A 4EOTA 2YO3A 1G2CB 3KQGA 3NFQA 5APSA 1NWQA 3T97A 3VN0A 3SWFA 3VMYA 5APXA 3L37A 5AW8B 4HYTB 1MUUA 1GD2E 3M0DA 2JJLA 4C7NB 3NXSA 1H8AA 1JUNA 1FOSE 2C9LY 2ZXEB 3L35A 2WT7A 2P2UA 2N9BA 2Q7CA 1GTWA 4M3LA 4KHXA 2BASA 5APQA 5CMZA 3I5CA 2QM7A 3IR9A 3TNUB 4AQRD 5APWA 2R5BA 2XU6A 1CI6B 3HE4B 3HE5A 5AVWB 5AVXB 1T2KD 1OWAA 5AW1B 5AW4B 3UIAA 1SP4A 3O8ZA 1HJBA 4RESB 5AVZB 5AVSB 5AVTB 1H88A 1SLQA 3V5BA 1DH3A 2E43A 5AVVB 4C46A 1CZQA 4AUWA 3TYYA 2WWWA 2XZRA 2QM8A 5APTA 4GKGA 3M91A 2XV5A 5AVRB 3M06A 3A7OA 2P7JA 3OAKA 1J2JB 2H7HA 2WPSA 3A3YB 3L36A 3M0AA 1A02F 2KP8A 1IO4A 3LIEA 2WTYA 1GU5A 4B86A 3M9BA 4XE5B 1KQLA 2E42A 2ZFCA 3TNUA 2Z5HA 3A2AA 3V4WA 1H89A 1GK4A 3VTPC 3NMDA 5APYA 3HE4A 1HUCA 5AW3B 3KDPB 3VMZA 4I2LC 5AW5B 3VMXA 5AW9B 4JYCA 1GK6A 3V4QA 3P8MC 5AW7B 1YYCA 2VRSA 1GZLA 1OXZA 5AW2B 3A5TA 1JNMA 2YNYA 2R32A 3VYIA 1FAVA 1HWTC 2Z5IA 4AYCA 2YO2A 4GT1A 1GU4A 1MFZA 3M9HA 5AVQB 4C7NA 3B8EB 3NTNA 2R3CA 3LIDA 5AVUB 3TK1A 2IPPA 2Q5UA 2WT7B 1NAFA 2C9NY 5AW0B 2W6AA 2Q3IA 3P7KA 4JYBA 3MD0A 2WPQA 2R5DA 1S9KD 1CSBA 3HTKA 1X8YA 4I6MC 1FOSF 2W27A 3MGNA 1A02J 1T2KC 1CI6A 3HE5B 5AVYB 1MV8A 2WPRA 5APVA 5APUA 1HBWA 3P32A 2P67A
chains in the Genus database with same CATH superfamily
2K88A 1RE3A 1VQMP 1GW3A 1S9KE 2M8RA 1DEBA 1BCCE 1KTMA 4JQ0D 2FY8A 3VMYA 2YMKA 2O01H 4OGQB 3L73G 4L75A 5GTIH 4N78D 1GD2E 3P8CD 2E74C 2G3AA 5GTIE 5CJ4A 1SQQK 5KKZC 1VL2A 4WVZA 1LT9C 3GHGA 1L0NG 2JKVA 2KS1B 5AVTB 3SFEC 5BU5A 3L70D 4MN4C 1PPJE 1RE4A 2OYIB 1CZQA 3AE1C 1KB9D 1K9MQ 4BWNA 2FFDB 2D2CB 2P7JA 1NTKD 1L4AD 1W5CE 3CMAP 3RL0g 4U3FJ 1EZVD 2I8DA 4JBZA 1GL2D 3E1IA 1SQVK 3CX5I 2WSCH 1JEKA 2WSSH 1LT1A 2VRSA 1GZLA 2YNYA 1GW4A 2KB7P 3EFGA 3LIDA 3AEBC 2WT7B 1EXIA 1NAFA 3D70A 1T3UA 5AW0B 4EI2A 3MD0A 1NYHA 1VQ6P 2XDJA 2KNCB 1YBKA 1PL5A 3L71G 2BEQD 3SWYA 2E75B 1U7MA 1N73C 1NTZG 1LT9A 3CXHI 3SWFA 1YITP 3L37A 4EIJA 4L74A 1H8AA 2O3JA 1BSHA 1JY3O 2KIKA 2HR3A 2DW3A 3V2NA 3AE8C 3IAOA 2AEFA 4WY4C 1URQB 2QIWA 1RQUA 4D6TG 1VQOP 1HJBA 1QLED 2I1JA 1IK9A 2J58A 1G2CA 1SQXK 1AVOA 5CBOA 1YTZI 2AXTH 3M91A 3V2RA 2JO1A 1J2JB 2OARA 4DCKA 2HFED 2V7QJ 1IFMA 2AXTE 1KD1Q 2KP8A 4H0LB 3CX5H 1Q82Q 2K9YA 2Y0CA 1BGYG 3A2AA 1KILD 5APYA 3CX5E 4EDFA 1SQQE 5AW2B 4H13D 1BE3J 2K9JA 1N73A 1GDTA 4IL6H 2QEXP 3CWBE 3CCSP 1AQ5A 1VF5D 3AE2C 4IL6E 4JYBA 1JM0A 2OGUA 3GW6A 2KK7A 3L72G 1M1JC 1EQ7A 4DZOA 4BRYB 5AW6B 3TF5A 4EOTA 3ITKA 2FYNC 1ZRTD 2O1JA 1S4XA 3MP7B 2QJPB 1SQVE 2JJLA 4L73A 1FOSE 1ZXGA 1SVFA 1HGZA 1NTKK 4BXLA 3B5NB 2BCCD 2V4HA 1DIPA 3L74J 2MJZA 1P84D 2Q1KA 4C46A 2OYHC 3O6QA 2L91A 5AVRB 4HKZH 3SFDC 2OTJP 2K1AA 1YQ3C 1KB9I 1PPJG 1M90Q 2CPBA 2V7QH 1NAYA 2CK3H 2ZJSE 3HE4A 2WPVB 3RL0D 3V2QA 2KZJA 1XTGB 1G1JA 4HH2A 5AW7B 2OYOA 4IFMA 1M1JA 3PRJA 1HWTC 2JWAA 3WMM0 3D71A 3H1JD 1AVYA 3BRTB 3BRVB 3H32B 3GG2A 1LTIC 1BE3E 1SQXE 1M8OB 1JO5A 1NTZJ 3KZIH 1L4AA 4PV1D 2B88A 2HODA 3AEFC 3KZIE 2O01N 3U59A 1SQBE 3RGUA 4CPGA 4HYTB 3M0DC 3CCEP 1MUUA 1FDIA 1RF0C 2OYHA 4XA4A 5KLVG 4Y99B 1FU1A 1KILC 3TNUB 4N78E 3RK3C 1T2KD 3P8CE 1KORA 1JTHA 3E1RA 4H13C 5L8RJ 2FYZA 2W6JH 1VF5C 5APTA 5CJ0A 2C0XA 1KB9H 2H89C 2QJKC 1BGYJ 2P58A 1E79H 3L70E 1EDJA 1Y47A 1ZMEC 1KB9E 2E76D 3AEEC 1JCDA 4R4LA 5AW3B 1LP1A 1HUCA 1NU1J 3E7KA 1NTKE 5AW9B 1JY2N 3P8MC 3TGUD 1JNMA 2NPSB 4WBAA 1E5WA 2H88C 2B87A 2YO2A 1EZVE 3LW5J 3NTNA 2G8YA 1LNQA 4I7ZC 2W6AA 3HUSC 3RK2B 4TLFA 1JY3N 1CI6A 1RF0A 1BDCA 1GMJA 3D6ZA 3CWBG 1KILA 3IFMA 3T97A 1ZV8A 3L75E 2HYNA 2K9JB 4YXWH 2RMZA 1BCCJ 4PD4D 1FZAA 2O1KA 2IX7C 3A0BH 4GODA 1YTZT 3CXHD 4U7JA 2KUBA 1AV1A 3A0BE 3IR9A 5BU8B 2K3RA 2R5BA 3RL0C 5AVWB 1R8EA 2A06D 1YIJP 3AE6C 1HGVA 1SP4A 4RESB 2HLOA 5AVSB 2PFXA 1VQNP 3OJAB 1VPCA 2QVAA 1H88A 1OZHA 1PGQA 2ZAEB 1OFCX 2XZRA 5BVZA 2Y0EA 2QA4P 2YIUB 3OAKA 3F5HA 1P84I 3AE4C 1YI2P 3MUDC 5C39A 2GM4A 1K05A 3IF4A 1FDOA 1GU4A 4O9BA 1KILE 3TK1A 3H1HD 2IPPA 1IFIA 2E5TA 2C9NY 3CCLP 2W6BA 2HPCA 3C1LA 2WSCJ 3F89A 2E5YA 1SQPD 1NOHA 1RH5B 4LGDE 2WITA 1L0LD 3C8VA 1T2KC 1UIIA 2IBZG 3G9RA 2N1TB 1NVOA 2WTYA 2H8PD 4WY4D 4UB8H 4LC1A 3PLNA 2SPZA 2RKLA 3GLMA 4UB8E 1OW6A 1BE3G 5APXA 1M1JB 1SQXG 3HRNA 4ZMDA 2XNXA 1RQVA 2FYUD 2YXRB 1LTSC 1ZRTE 3JSVC 3BCCD 3PHLA 2QM7A 1SQBG 1VQ8P 4AQRD 3HE5A 1L4AB 2JEEA 3Q2YA 2M3EA 2IFNA 1R5LA 1N2DC 1GL2B 3EQ2A 3CC4P 3MUDA 2Y9ZA 2BCCE 4AUWA 1P84H 1FDMA 3PJSK 3A7OA 1OMIA 1P84E 2R44A 1A02F 4GDOA 3H25A 4B86A 3CCMP 3CCRP 1D7MA 1AQTA 1JTHB 3L74G 2KYVA 2YXQB 3L70G 1N86A 1L0ND 2ZT9C 1KFNA 2W90A 5E79H 1SQQJ 3QH9A 3SWKA 1T3JA 1PFIA 2QJYC 1JMMA 5E79E 1RF1C 1N7SD 1PV3A 3HTKA 1IJDB 2XKMA 3CWBJ 3H1JE 2M3BA 1QL1A 4IL6X 3B4SA 2YKPA 1EZVG 1CW5A 3AEDC 3KHUA 2J59M 1LP1B 5APSA 1J1DC 1LWUC 1KN7A 4RJTA 1LTJC 1NH4A 2W83C 4I1LA 4ZKPA 3L75D 1SQVJ 2GA1A 2KSJA 4PD4I 1FZCC 1CI6B 4NPEA 3FGAD 4C7RA 1KILB 1KQFB 3CCVP 3AEGC 3Q5RA 3T97B 2PGDA 4GKGA 2ITAA 2D2CD 2R3SA 1QVFO 2P10A 1SQPK 4QMAA 1L0LK 1ZR2A 1JCCA 1KQLA 5M1BA 1RF1A 1T8ZA 3VTPC 1M57D 1PGJA 4N6JA 1SFCC 3PP5A 1OXZA 5KLIC 1OVRA 1QX8A 4LLHA 3H1HJ 3VP8A 3HD7C 2B9BA 2FYUK 1LWUA 2I1KA 3CC7P 1VQ4P 3TGUE 3P7KA 1LTJA 2GUVA 3CLQA 1CSBA 2LR2A 4L76A 3RK3D 2LXCB 1SQXJ 1NU1G 1J1EC 1R5SA 1FZCA 3H6PA 5KJ7D 3CI9A 4DJGA 1ZP0C 4GOFA 1SQBJ 1H0TB 4N3YB 3G3ZA 2PAJA 4PD4H 4H44B 3GF3A 1FZGA 3CXHH 4PD4E 1FZEA 3PTZA 1URQD 4WY4A 3CXHE 2LXBA 3O8ZA 1FS0E 2WSEH 1KQGB 1VQPP 1WT6A 1NGMB 3RL0B 1L0NK 2WWWA 2A45G 2A06E 1WMKA 2GUSA 1N7SC 1BCCG 2WQYC 3HD7A 5KTBA 2QG4A 1QL2A 2BCCG 2RN0A 1H89A 3M9QA 3L70J 4PV1B 1NTMD 5TJHA 3D6YA 1FZBA 3MTUE 1MFZA 3B8EB 4W7YA 1NTKJ 3CCJP 1Q90D 3KPEA 3AE5C 3H1LD 2WPRA 3H1HE 3GHGB 1DD4A 1FC2C 2Y0DA 2IZ0A 3CPWO 2YO3A 1VQ7P 2OYIC 3K5BA 3KQGA 1SQPE 3NFQA 1FE6A 4YXDC 1BSNA 1L0LE 1PP9D 1NTZK 3H1JG 2FFDC 2D2CC 2WVRA 3L75J 3L4FA 4Z1MH 4Y28J 1N7SA 3HTKB 1LGHB 2FYUE 1M7LA 1HH0A 2E76B 2WZ7A 3BCCE 2AEJA 2YMYA 2Q6QA 2IFMA 1Q81Q 3EFFK 4DT0A 2E74B 1UIXA 5KLVD 1GU5A 2LKMA 3NMDA 5KKZB 3KDPB 4OWFA 4I2LC 5AW5B 5KJ7C 1LT9B 1ZR4A 2MKVA 2WSFH 3G6EP 2Z5IA 1TU3F 1Q2NA 2OYIA 3V2PA 3U1AA 2Q5UA 1OVUA 4XFJA 2WPQA 2FFDA 1MZ9A 1L0NE 3MGNA 1URQC 4WB4A 3KYQA 2FKWB 1G2CB 4ZNCA 1NWQA 1S5LH 2KLUA 2YKQA 3M0DA 4KT0J 3IN6A 1S5LE 1SQQG 1JB0J 2C9LY 3A0HH 4YTPC 2WT7A 4H0LC 2ZVOB 5CMZA 2AEMA 3A0HE 3I5CA 3OW2O 1YJ9P 1KYOD 5APWA 1Y8AA 1EC5A 5AVXB 3ABVC 1IC2A 5KAFH 4U3FD 1N73B 2IYOA 2ZT9D 2KSEA 1NTMK 5KAFE 4ASWA 5KJ7A 1X0TA 3CCUP 2QM8A 3H1KD 2Y9YA 1K8AQ 2BCCJ 1SQVG 4IFFA 4XE5B 2ZFCA 2A06G 3H1ID 1NHLA 2QSIA 3I56P 2NPSD 1K73Q 1URQA 4ZKUA 4WY4B 4IFDK 2QJPC 3KXDA 3BATA 4GT1A 3Q1MA 2KOGA 1KC8Q 3B5NC 3WUUA 3HUSA 3R2PA 2FBWC 4RO0A 5TISH 1HBWA 2HG5D 2P67A 4AYCA 1S3JA 2KZIA 3H1JJ 5TISE 1PP9J 3RK3E 3O6QB 1EDLA 1HTLC 5AW8B 1NO4A 2OQQA 1ZN5A 3H1HG 5B66H 2KLVA 2P2UA 5B66E 5CCGD 1KV4A 4UB6H 1IK7A 5KLVK 3HE4B 1JY2P 4W7ZA 1Q86Q 1YJWP 2IBZD 4UB6E 1SFCD 3G4SP 4BRYA 3WUVA 1RE4C 1YHQP 1X79B 3CD6P 2FYNB 3HD7D 2FXMA 3TYYA 3Q5SA 3CC2P 2FYUG 3GF7A 2H7HA 2WPSA 3RBZA 1PIXA 4NPFX 2HODB 3C9IA 1M1KQ 3VMZA 2H43A 2PRRA 3V4QA 2J5UA 2R32A 2BEZF 1VQ9P 3U1CA 1OW8A 3L73D 2N9YB 1HVVA 1ZW0A 2OYHB 3V6IA 3VP9A 4Y99C 4TT3H 1NTME 1AJYA 3S9OA 4R4MA 2N1TD 1ZLLA 4RKUJ 3TGUJ 2ZYDA 1ZOYC 2NRGA 4WWIA 3JC22 3H1LE 1IFJA 1N8RQ 3L74D 1NTKG 2ZXEB 2JDIH 3MIWA 3H32A 1IFNA 1PP9E 1DX7A 1LTBC 1OX3A 3AE7C 2NPSC 3N4XA 4OGQD 3EWKA 4EYYQ 1LTTC 2B87B 3Q3DA 1OW7A 1KYOI 1VQLP 2UWJE 3H1KJ 3RK2C 2ZYGA 3PH0A 2WSEJ 3L75G 3A3YB 3M0AA 2M5AA 4JF7A 3FWLA 3L71D 2FXOA 1PZQA 3TNUA 3H1IJ 1NTZD 3RK3B 3VMXA 1JY2O 1YYCA 5DJTB 3A5TA 3CCQP 4H13B 5KLVE 4C7NA 1VQ5P 1X9VA 1EXJA 1HJ0A 1VF5B 5H2FH 5CCGC 1PGOA 5H2FE 2QJKB 4ASVA 1MV8A 2K37A 5APVA 4JPZB 3R4YA 1MKMA 4D6TD 1JOCA 1HF9A 1QEXA 1U7JA 2NPSA 1BDDA 2YIUC 1SQPJ 1JUNA 1L0LJ 1YQ4C 5CCHD 1GTWA 1KQSO 3W67A 2E75D 4I7ZB 3HUSB 1BGYD 1W2BO 1OWAA 5AW1B 5B5EH 1SQBK 1KYOH 3QWOC 1FJKA 2CPSA 2FYUJ 1NU1D 5B5EE 2E43A 1Y9BA 1KYOE 2IBZI 3GMAA 3BCCJ 2HPCB 4U3FE 1U57A 2IYPA 2N1TC 5CBNA 3H1KE 3L72D 3BASA 5CCGA 3V4WA 2Z5HA 1GK4A 1VDFA 4W80A 1S2EA 1SFCA 3L73J 1LJ2A 3H1IE 4H0LD 1S72P 1S9KD 2R5DA 3BVHA 4I6MC 5GTHH 1BCCD 2ZXXA 4OH8B 2POHA 1L4AC 3FXEA 2WSFJ 3FWNA 3HE5B 5AVYB 3B71A 3P32A 3AE9C 4OGQC 3ZDMA 1YJNP 5GTHE 1GL2C 1L0NJ 4PJ0H 2ZVNB 3WUTA 1NTMG 2WMMA 2AXCA 4PJ0E 5DJUB 5KAIH 1PGPA 1IZNB 1MFTA 1M56D 3L35A 2N9BA 5KAIE 2Q7CA 1S5LX 4H44D 1IFPA 3H1LG 1PPJD 2M0BA 1X22A 2XU6A 2N1TA 2C0WA 2XNDH 1SLQA 2JR8A 1PP9G 1XTCC 2IBZE 3B5ND 1EZVI 1QVGO 3M06A 2B89A 3W68A 3L71J 3M9BA 1AA0A 1WRGA 3VYIA 1FAVA 1GL2A 1Z56A 3I55P 5AVQB 2R3CA 2RH0A 5CCHC 1JMBA 3MHVA 2E75C 2Q3IA 3MZWB 4OVNF 1X8YA 1FOSF 3L73E 2IZ1A 2W27A 1A02J 1KZUB 2M5AB 4HB1A 4D6TJ 2KS1A 4HJGH 1LTAC 2OTKE 4YPCA 3VN0A 3JCUH 1NU1K 1L2PA 3WU2H 1RY3A 2QE7H 1OVVA 4C7NB 2ZT9B 1QGKB 3JCUE 3WU2E 1N7LA 1USEA 2BASA 1NJIQ 2QJYB 2W8ZA 1RF1B 3L74E 3II6A 4K35A 3TGUG 1RHZB 3Q5PA 3UIAA 5AW4B 2KI7B 1DH3A 5AVVB 1J1DB 1LWUB 2XV5A 1LTJB 3N7NA 1EDKA 4K3AA 3CX5D 2KNCA 1IFDA 1FZFA 2E74D 1SQQD 5CCHA 3LIEA 1K04A 3L72J 3FX0A 2E42A 3CWBD 1FZCB 3FXDA 4JYCA 4U3FG 1GK6A 1W2EA 3RBXA 3L71E 4NPDA 3M9HA 3H1KG 1NTZE 3TDKA 4H44C 1DEEG 1FBMA 1S1CX 2IDBA 5APUA 2JWDA 3VOPA 1LTGC 1NTMJ 1SQVD 4A7PA 2A45I 1SS1A 2O01J 3H1IG 1KMIZ 5CHXA 3S1KA 1FJPA 3CMEP 1SFCB 5KLIB 2PP6A 3RK2D 3NXSA 3H1LJ 2OTLP 4D6TE 2ZYAA 3HD7B 3G71P 1RE3C 4M3LA 4KHXA 5APQA 1USDA 3SSUA 1KFMA 3VMAA 3AECC 4PV1C 3USSA 4DOJA 2FXPA 5AVZB 2KXPB 3CL3D 1VQKP 3V5BA 1J1EB 1BGYE 2YKOA 4KJMA 1NKNA 2JP3A 3AEAC 1SQPG 1L0LG 1H0TA 3L36A 1NU1E 3AE3C 3GHGC 1Q7YQ 1IO4A 3LW5H 3OA7A 5EFWB 1G1IA 2P1JA 2NZ2A 2Q3EA 5K5GB 1DD3A 1T6AA 3TSIA 1NKZB 1OIPA 1BE3D 1SQXD 3L72E 5AVUB 1JY3P 4GIFA 2Z4EA 2L5GB 3BCCG 1EDIA 4GOEA 5KLVJ 3B5NA 3S4RA 2QRXA 4IOIH 1N7SB 1SQBD 2A45H 2E76C 1AFOA 2Q9IA
chains in the Genus database with same CATH topology
1RE3A 1GW3A 1S9KE 2M8RA 1KILA 2YO3A 2OYIC 3NFQA 3KQGA 1DEBA 1JOCA 3IFMA 2NPSA 3T97A 1ZV8A 3VMYA 1NTZK 2O01H 2HYNA 2FFDC 4N78D 1GD2E 1JUNA 1FZAA 2O1KA 3P8CD 2IX7C 1YTZT 5CCHD 3L4FA 1GTWA 5CJ4A 1SQQK 1N7SA 3HUSB 3HTKB 1LGHB 3IR9A 5BU8B 2R5BA 3RL0C 5AVWB 1LT9C 3GHGA 1M7LA 1OWAA 1HH0A 5AW1B 1SQBK 1HGVA 1SP4A 1FJKA 4RESB 2CPSA 2HLOA 2WZ7A 5AVSB 5AVTB 5BU5A 3OJAB 1VPCA 1H88A 1RE4A 2YMYA 2OYIB 2E43A 1CZQA 2IFMA 2XZRA 5BVZA 2HPCB 2FFDB 3OAKA 2P7JA 1L4AD 2N1TC 1GU5A 2LKMA 3BASA 5CCGA 3V4WA 2Z5HA 1GL2D 1GK4A 3E1IA 3NMDA 1SQVK 1VDFA 3KDPB 2WSCH 4I2LC 5AW5B 5KJ7C 4W80A 2GM4A 1LT9B 2VRSA 1GZLA 1ZR4A 2YNYA 1SFCA 2WSFH 2Z5IA 1GU4A 4O9BA 1GW4A 2KB7P 3EFGA 2OYIA 3LIDA 3V2PA 3U1AA 3TK1A 2IPPA 1IFIA 2Q5UA 1NAFA 2WT7B 2C9NY 1T3UA 5AW0B 2W6BA 2HPCA 3MD0A 2WPQA 2R5DA 1S9KD 2FFDA 1MZ9A 2XDJA 1NOHA 4I6MC 3BVHA 4LGDE 4OH8B 3MGNA 2WITA 2POHA 1L4AC 1T2KC 3HE5B 5AVYB 1URQC 2N1TB 3SWYA 4WB4A 3P32A 2WTYA 2H8PD 4WY4D 3KYQA 1N73C 1GL2C 2FKWB 4LC1A 1G2CB 1NWQA 1LT9A 3SWFA 5APXA 1M1JB 3L37A 4EIJA 2YKQA 3HRNA 2XNXA 3M0DA 1H8AA 2C9LY 3L35A 2WT7A 2N9BA 1JY3O 1LTSC 2Q7CA 5CMZA 3I5CA 2QM7A 3V2NA 4AQRD 5APWA 2XU6A 3HE5A 5AVXB 1L4AB 2JEEA 2N1TA 1IC2A 4WY4C 1URQB 2IFNA 1HJBA 2I1JA 2C0WA 1IK9A 2J58A 1N73B 1N2DC 1GL2B 3EQ2A 1G2CA 1SLQA 1NTMK 3MUDA 1XTCC 1SQXK 5KJ7A 4AUWA 2QM8A 1YTZI 3B5ND 3M91A 3V2RA 1FDMA 3M06A 3A7OA 1J2JB 2OARA 2HFED 1IFMA 1A02F 2KP8A 4IFFA 4B86A 3M9BA 4XE5B 1WRGA 2ZFCA 3A2AA 1KILD 5APYA 1NHLA 2NPSD 1JTHB 1URQA 4ZKUA 5AW2B 4WY4B 4IFDK 2KYVA 3VYIA 1FAVA 1N73A 1GDTA 3BATA 1N86A 1GL2A 4GT1A 1Z56A 2KOGA 5AVQB 1KFNA 2R3CA 5CCHC 1AQ5A 1T3JA 1PFIA 3B5NC 2Q3IA 1JMMA 4JYBA 1RF1C 1N7SD 3HUSA 3HTKA 1X8YA 1FOSF 1IJDB 2W27A 2XKMA 3R2PA 1KZUB 2M3BA 1QL1A 1A02J 2YKPA 1HBWA 2P67A 2HG5D 1M1JC 4AYCA 1CW5A 1EQ7A 4DZOA 5AW6B 2J59M 4EOTA 1LTAC 5APSA 1J1DC 1LWUC 2O1JA 3VN0A 1NU1K 1HTLC 1LTJC 1RY3A 5AW8B 1NO4A 1ZN5A 2JJLA 1NH4A 4C7NB 1FOSE 1N7LA 1SVFA 2KLVA 2P2UA 4I1LA 4ZKPA 1HGZA 1NTKK 3B5NB 2BASA 5CCGD 1RF1B 2KSJA 3II6A 5KLVK 1FZCC 3HE4B 1CI6B 1JY2P 4W7ZA 3UIAA 5AW4B 1SFCD 4C7RA 1KILB 2MJZA 1RE4C 1DH3A 5AVVB 4C46A 1X79B 2OYHC 3HD7D 1J1DB 2FXMA 3TYYA 1LWUB 4GKGA 2XV5A 1LTJB 3N7NA 5AVRB 1IFDA 2H7HA 1FZFA 2WPSA 1SQPK 5CCHA 3LIEA 1L0LK 1ZR2A 1JCCA 1KQLA 2CPBA 2HODB 3C9IA 1RF1A 2E42A 1T8ZA 3VTPC 3HE4A 3RL0D 3V2QA 3VMZA 2H43A 1FZCB 4N6JA 1XTGB 1G1JA 4JYCA 1GK6A 4HH2A 3V4QA 1SFCC 5AW7B 3PP5A 1OXZA 1W2EA 4IFMA 1M1JA 2R32A 1HWTC 3U1CA 3WMM0 1HVVA 3M9HA 4LLHA 3VP8A 3HD7C 2FYUK 1LWUA 2I1KA 2OYHB 3VP9A 4Y99C 3BRTB 3BRVB 3H32B 3P7KA 1LTJA 2GUVA 3CLQA 1CSBA 1LTIC 1JO5A 1FBMA 1L4AA 2N1TD 3RK3D 1ZLLA 5APUA 1LTGC 3VOPA 2HODA 2A45I 1J1EC 1FZCA 5CHXA 3U59A 3H6PA 1IFJA 5KJ7D 3CI9A 1FJPA 1SFCB 2PP6A 4HYTB 3M0DC 3RK2D 1MUUA 3NXSA 1RF0C 2ZXEB 4N3YB 2OYHA 3HD7B 3MIWA 4XA4A 3G3ZA 2PAJA 1RE3C 3H32A 4M3LA 1IFNA 4KHXA 5APQA 4Y99B 1FU1A 1KFMA 1KILC 3TNUB 4N78E 1FZGA 3RK3C 1T2KD 1DX7A 1LTBC 3P8CE 1FZEA 2NPSC 1URQD 1JTHA 3N4XA 4DOJA 4WY4A 3O8ZA 2WSEH 5AVZB 1LTTC 2FYZA 1WT6A 3CL3D 3V5BA 1J1EB 3RL0B 1L0NK 2YKOA 2WWWA 2A45G 1NKNA 5APTA 2GUSA 3RK2C 1N7SC 5CJ0A 2C0XA 3A3YB 3L36A 3M0AA 3HD7A 3GHGC 4JF7A 1IO4A 5KTBA 3LW5H 1QL2A 3OA7A 3TNUA 1H89A 1JCDA 3M9QA 5AW3B 1HUCA 1G1IA 2P1JA 3RK3B 3VMXA 5AW9B 1JY2N 1JY2O 3P8MC 1YYCA 2NPSB 4WBAA 3A5TA 1JNMA 1E5WA 3TSIA 1NKZB 2YO2A 1FZBA 3MTUE 1MFZA 4C7NA 3B8EB 3NTNA 4W7YA 1X9VA 5AVUB 1JY3P 4GIFA 3KPEA 2Z4EA 2L5GB 2W6AA 3B5NA 5CCGC 3HUSC 3RK2B 1N7SB 1JY3N 1CI6A 1RF0A 2A45H 1MV8A 2WPRA 5APVA 3GHGB 1AFOA 2Q9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DZO A;  1S9K E;  5AW6 B;  4LC1 A;  4EOT A;  2YO3 A;  1G2C B;  3KQG A;  3NFQ A;  5APS A;  1NWQ A;  3T97 A;  3VN0 A;  3SWF A;  3VMY A;  5APX A;  3L37 A;  5AW8 B;  4HYT B;  1MUU A;  1GD2 E;  3M0D A;  2JJL A;  4C7N B;  3NXS A;  1H8A A;  1JUN A;  1FOS E;  2C9L Y;  2ZXE B;  3L35 A;  2WT7 A;  2P2U A;  2N9B A;  2Q7C A;  1GTW A;  4M3L A;  4KHX A;  2BAS A;  5APQ A;  5CMZ A;  3I5C A;  2QM7 A;  3IR9 A;  3TNU B;  4AQR D;  5APW A;  2R5B A;  2XU6 A;  1CI6 B;  3HE4 B;  3HE5 A;  5AVW B;  5AVX B;  1T2K D;  1OWA A;  5AW1 B;  5AW4 B;  3UIA A;  1SP4 A;  3O8Z A;  1HJB A;  4RES B;  5AVZ B;  5AVS B;  5AVT B;  1H88 A;  1SLQ A;  3V5B A;  1DH3 A;  2E43 A;  5AVV B;  4C46 A;  1CZQ A;  4AUW A;  3TYY A;  2WWW A;  2XZR A;  2QM8 A;  5APT A;  4GKG A;  3M91 A;  2XV5 A;  5AVR B;  3M06 A;  3A7O A;  2P7J A;  3OAK A;  1J2J B;  2H7H A;  2WPS A;  3A3Y B;  3L36 A;  3M0A A;  1A02 F;  2KP8 A;  1IO4 A;  3LIE A;  2WTY A;  1GU5 A;  4B86 A;  3M9B A;  4XE5 B;  1KQL A;  2E42 A;  2ZFC A;  3TNU A;  2Z5H A;  3A2A A;  3V4W A;  1H89 A;  1GK4 A;  3VTP C;  3NMD A;  5APY A;  3HE4 A;  1HUC A;  5AW3 B;  3KDP B;  3VMZ A;  4I2L C;  5AW5 B;  3VMX A;  5AW9 B;  4JYC A;  1GK6 A;  3V4Q A;  3P8M C;  5AW7 B;  1YYC A;  2VRS A;  1GZL A;  1OXZ A;  5AW2 B;  3A5T A;  1JNM A;  2YNY A;  2R32 A;  3VYI A;  1FAV A;  1HWT C;  2Z5I A;  4AYC A;  2YO2 A;  4GT1 A;  1GU4 A;  1MFZ A;  3M9H A;  5AVQ B;  4C7N A;  3B8E B;  3NTN A;  2R3C A;  3LID A;  5AVU B;  3TK1 A;  2IPP A;  2Q5U A;  2WT7 B;  1NAF A;  2C9N Y;  5AW0 B;  2W6A A;  2Q3I A;  3P7K A;  4JYB A;  3MD0 A;  2WPQ A;  2R5D A;  1S9K D;  1CSB A;  3HTK A;  1X8Y A;  4I6M C;  1FOS F;  2W27 A;  3MGN A;  1A02 J;  1T2K C;  1CI6 A;  3HE5 B;  5AVY B;  1MV8 A;  2WPR A;  5APV A;  5APU A;  1HBW A;  3P32 A;  2P67 A; 
#chains in the Genus database with same CATH topology
 2K88 A;  1RE3 A;  1VQM P;  1GW3 A;  1S9K E;  2M8R A;  1DEB A;  1BCC E;  1KTM A;  4JQ0 D;  2FY8 A;  3VMY A;  2YMK A;  2O01 H;  4OGQ B;  3L73 G;  4L75 A;  5GTI H;  4N78 D;  1GD2 E;  3P8C D;  2E74 C;  2G3A A;  5GTI E;  5CJ4 A;  1SQQ K;  5KKZ C;  1VL2 A;  4WVZ A;  1LT9 C;  3GHG A;  1L0N G;  2JKV A;  2KS1 B;  5AVT B;  3SFE C;  5BU5 A;  3L70 D;  4MN4 C;  1PPJ E;  1RE4 A;  2OYI B;  1CZQ A;  3AE1 C;  1KB9 D;  1K9M Q;  4BWN A;  2FFD B;  2D2C B;  2P7J A;  1NTK D;  1L4A D;  1W5C E;  3CMA P;  3RL0 g;  4U3F J;  1EZV D;  2I8D A;  4JBZ A;  1GL2 D;  3E1I A;  1SQV K;  3CX5 I;  2WSC H;  1JEK A;  2WSS H;  1LT1 A;  2VRS A;  1GZL A;  2YNY A;  1GW4 A;  2KB7 P;  3EFG A;  3LID A;  3AEB C;  2WT7 B;  1EXI A;  1NAF A;  3D70 A;  1T3U A;  5AW0 B;  4EI2 A;  3MD0 A;  1NYH A;  1VQ6 P;  2XDJ A;  2KNC B;  1YBK A;  1PL5 A;  3L71 G;  2BEQ D;  3SWY A;  2E75 B;  1U7M A;  1N73 C;  1NTZ G;  1LT9 A;  3CXH I;  3SWF A;  1YIT P;  3L37 A;  4EIJ A;  4L74 A;  1H8A A;  2O3J A;  1BSH A;  1JY3 O;  2KIK A;  2HR3 A;  2DW3 A;  3V2N A;  3AE8 C;  3IAO A;  2AEF A;  4WY4 C;  1URQ B;  2QIW A;  1RQU A;  4D6T G;  1VQO P;  1HJB A;  1QLE D;  2I1J A;  1IK9 A;  2J58 A;  1G2C A;  1SQX K;  1AVO A;  5CBO A;  1YTZ I;  2AXT H;  3M91 A;  3V2R A;  2JO1 A;  1J2J B;  2OAR A;  4DCK A;  2HFE D;  2V7Q J;  1IFM A;  2AXT E;  1KD1 Q;  2KP8 A;  4H0L B;  3CX5 H;  1Q82 Q;  2K9Y A;  2Y0C A;  1BGY G;  3A2A A;  1KIL D;  5APY A;  3CX5 E;  4EDF A;  1SQQ E;  5AW2 B;  4H13 D;  1BE3 J;  2K9J A;  1N73 A;  1GDT A;  4IL6 H;  2QEX P;  3CWB E;  3CCS P;  1AQ5 A;  1VF5 D;  3AE2 C;  4IL6 E;  4JYB A;  1JM0 A;  2OGU A;  3GW6 A;  2KK7 A;  3L72 G;  1M1J C;  1EQ7 A;  4DZO A;  4BRY B;  5AW6 B;  3TF5 A;  4EOT A;  3ITK A;  2FYN C;  1ZRT D;  2O1J A;  1S4X A;  3MP7 B;  2QJP B;  1SQV E;  2JJL A;  4L73 A;  1FOS E;  1ZXG A;  1SVF A;  1HGZ A;  1NTK K;  4BXL A;  3B5N B;  2BCC D;  2V4H A;  1DIP A;  3L74 J;  2MJZ A;  1P84 D;  2Q1K A;  4C46 A;  2OYH C;  3O6Q A;  2L91 A;  5AVR B;  4HKZ H;  3SFD C;  2OTJ P;  2K1A A;  1YQ3 C;  1KB9 I;  1PPJ G;  1M90 Q;  2CPB A;  2V7Q H;  1NAY A;  2CK3 H;  2ZJS E;  3HE4 A;  2WPV B;  3RL0 D;  3V2Q A;  2KZJ A;  1XTG B;  1G1J A;  4HH2 A;  5AW7 B;  2OYO A;  4IFM A;  1M1J A;  3PRJ A;  1HWT C;  2JWA A;  3WMM 0;  3D71 A;  3H1J D;  1AVY A;  3BRT B;  3BRV B;  3H32 B;  3GG2 A;  1LTI C;  1BE3 E;  1SQX E;  1M8O B;  1JO5 A;  1NTZ J;  3KZI H;  1L4A A;  4PV1 D;  2B88 A;  2HOD A;  3AEF C;  3KZI E;  2O01 N;  3U59 A;  1SQB E;  3RGU A;  4CPG A;  4HYT B;  3M0D C;  3CCE P;  1MUU A;  1FDI A;  1RF0 C;  2OYH A;  4XA4 A;  5KLV G;  4Y99 B;  1FU1 A;  1KIL C;  3TNU B;  4N78 E;  3RK3 C;  1T2K D;  3P8C E;  1KOR A;  1JTH A;  3E1R A;  4H13 C;  5L8R J;  2FYZ A;  2W6J H;  1VF5 C;  5APT A;  5CJ0 A;  2C0X A;  1KB9 H;  2H89 C;  2QJK C;  1BGY J;  2P58 A;  1E79 H;  3L70 E;  1EDJ A;  1Y47 A;  1ZME C;  1KB9 E;  2E76 D;  3AEE C;  1JCD A;  4R4L A;  5AW3 B;  1LP1 A;  1HUC A;  1NU1 J;  3E7K A;  1NTK E;  5AW9 B;  1JY2 N;  3P8M C;  3TGU D;  1JNM A;  2NPS B;  4WBA A;  1E5W A;  2H88 C;  2B87 A;  2YO2 A;  1EZV E;  3LW5 J;  3NTN A;  2G8Y A;  1LNQ A;  4I7Z C;  2W6A A;  3HUS C;  3RK2 B;  4TLF A;  1JY3 N;  1CI6 A;  1RF0 A;  1BDC A;  1GMJ A;  3D6Z A;  3CWB G;  1KIL A;  3IFM A;  3T97 A;  1ZV8 A;  3L75 E;  2HYN A;  2K9J B;  4YXW H;  2RMZ A;  1BCC J;  4PD4 D;  1FZA A;  2O1K A;  2IX7 C;  3A0B H;  4GOD A;  1YTZ T;  3CXH D;  4U7J A;  2KUB A;  1AV1 A;  3A0B E;  3IR9 A;  5BU8 B;  2K3R A;  2R5B A;  3RL0 C;  5AVW B;  1R8E A;  2A06 D;  1YIJ P;  3AE6 C;  1HGV A;  1SP4 A;  4RES B;  2HLO A;  5AVS B;  2PFX A;  1VQN P;  3OJA B;  1VPC A;  2QVA A;  1H88 A;  1OZH A;  1PGQ A;  2ZAE B;  1OFC X;  2XZR A;  5BVZ A;  2Y0E A;  2QA4 P;  2YIU B;  3OAK A;  3F5H A;  1P84 I;  3AE4 C;  1YI2 P;  3MUD C;  5C39 A;  2GM4 A;  1K05 A;  3IF4 A;  1FDO A;  1GU4 A;  4O9B A;  1KIL E;  3TK1 A;  3H1H D;  2IPP A;  1IFI A;  2E5T A;  2C9N Y;  3CCL P;  2W6B A;  2HPC A;  3C1L A;  2WSC J;  3F89 A;  2E5Y A;  1SQP D;  1NOH A;  1RH5 B;  4LGD E;  2WIT A;  1L0L D;  3C8V A;  1T2K C;  1UII A;  2IBZ G;  3G9R A;  2N1T B;  1NVO A;  2WTY A;  2H8P D;  4WY4 D;  4UB8 H;  4LC1 A;  3PLN A;  2SPZ A;  2RKL A;  3GLM A;  4UB8 E;  1OW6 A;  1BE3 G;  5APX A;  1M1J B;  1SQX G;  3HRN A;  4ZMD A;  2XNX A;  1RQV A;  2FYU D;  2YXR B;  1LTS C;  1ZRT E;  3JSV C;  3BCC D;  3PHL A;  2QM7 A;  1SQB G;  1VQ8 P;  4AQR D;  3HE5 A;  1L4A B;  2JEE A;  3Q2Y A;  2M3E A;  2IFN A;  1R5L A;  1N2D C;  1GL2 B;  3EQ2 A;  3CC4 P;  3MUD A;  2Y9Z A;  2BCC E;  4AUW A;  1P84 H;  1FDM A;  3PJS K;  3A7O A;  1OMI A;  1P84 E;  2R44 A;  1A02 F;  4GDO A;  3H25 A;  4B86 A;  3CCM P;  3CCR P;  1D7M A;  1AQT A;  1JTH B;  3L74 G;  2KYV A;  2YXQ B;  3L70 G;  1N86 A;  1L0N D;  2ZT9 C;  1KFN A;  2W90 A;  5E79 H;  1SQQ J;  3QH9 A;  3SWK A;  1T3J A;  1PFI A;  2QJY C;  1JMM A;  5E79 E;  1RF1 C;  1N7S D;  1PV3 A;  3HTK A;  1IJD B;  2XKM A;  3CWB J;  3H1J E;  2M3B A;  1QL1 A;  4IL6 X;  3B4S A;  2YKP A;  1EZV G;  1CW5 A;  3AED C;  3KHU A;  2J59 M;  1LP1 B;  5APS A;  1J1D C;  1LWU C;  1KN7 A;  4RJT A;  1LTJ C;  1NH4 A;  2W83 C;  4I1L A;  4ZKP A;  3L75 D;  1SQV J;  2GA1 A;  2KSJ A;  4PD4 I;  1FZC C;  1CI6 B;  4NPE A;  3FGA D;  4C7R A;  1KIL B;  1KQF B;  3CCV P;  3AEG C;  3Q5R A;  3T97 B;  2PGD A;  4GKG A;  2ITA A;  2D2C D;  2R3S A;  1QVF O;  2P10 A;  1SQP K;  4QMA A;  1L0L K;  1ZR2 A;  1JCC A;  1KQL A;  5M1B A;  1RF1 A;  1T8Z A;  3VTP C;  1M57 D;  1PGJ A;  4N6J A;  1SFC C;  3PP5 A;  1OXZ A;  5KLI C;  1OVR A;  1QX8 A;  4LLH A;  3H1H J;  3VP8 A;  3HD7 C;  2B9B A;  2FYU K;  1LWU A;  2I1K A;  3CC7 P;  1VQ4 P;  3TGU E;  3P7K A;  1LTJ A;  2GUV A;  3CLQ A;  1CSB A;  2LR2 A;  4L76 A;  3RK3 D;  2LXC B;  1SQX J;  1NU1 G;  1J1E C;  1R5S A;  1FZC A;  3H6P A;  5KJ7 D;  3CI9 A;  4DJG A;  1ZP0 C;  4GOF A;  1SQB J;  1H0T B;  4N3Y B;  3G3Z A;  2PAJ A;  4PD4 H;  4H44 B;  3GF3 A;  1FZG A;  3CXH H;  4PD4 E;  1FZE A;  3PTZ A;  1URQ D;  4WY4 A;  3CXH E;  2LXB A;  3O8Z A;  1FS0 E;  2WSE H;  1KQG B;  1VQP P;  1WT6 A;  1NGM B;  3RL0 B;  1L0N K;  2WWW A;  2A45 G;  2A06 E;  1WMK A;  2GUS A;  1N7S C;  1BCC G;  2WQY C;  3HD7 A;  5KTB A;  2QG4 A;  1QL2 A;  2BCC G;  2RN0 A;  1H89 A;  3M9Q A;  3L70 J;  4PV1 B;  1NTM D;  5TJH A;  3D6Y A;  1FZB A;  3MTU E;  1MFZ A;  3B8E B;  4W7Y A;  1NTK J;  3CCJ P;  1Q90 D;  3KPE A;  3AE5 C;  3H1L D;  2WPR A;  3H1H E;  3GHG B;  1DD4 A;  1FC2 C;  2Y0D A;  2IZ0 A;  3CPW O;  2YO3 A;  1VQ7 P;  2OYI C;  3K5B A;  3KQG A;  1SQP E;  3NFQ A;  1FE6 A;  4YXD C;  1BSN A;  1L0L E;  1PP9 D;  1NTZ K;  3H1J G;  2FFD C;  2D2C C;  2WVR A;  3L75 J;  3L4F A;  4Z1M H;  4Y28 J;  1N7S A;  3HTK B;  1LGH B;  2FYU E;  1M7L A;  1HH0 A;  2E76 B;  2WZ7 A;  3BCC E;  2AEJ A;  2YMY A;  2Q6Q A;  2IFM A;  1Q81 Q;  3EFF K;  4DT0 A;  2E74 B;  1UIX A;  5KLV D;  1GU5 A;  2LKM A;  3NMD A;  5KKZ B;  3KDP B;  4OWF A;  4I2L C;  5AW5 B;  5KJ7 C;  1LT9 B;  1ZR4 A;  2MKV A;  2WSF H;  3G6E P;  2Z5I A;  1TU3 F;  1Q2N A;  2OYI A;  3V2P A;  3U1A A;  2Q5U A;  1OVU A;  4XFJ A;  2WPQ A;  2FFD A;  1MZ9 A;  1L0N E;  3MGN A;  1URQ C;  4WB4 A;  3KYQ A;  2FKW B;  1G2C B;  4ZNC A;  1NWQ A;  1S5L H;  2KLU A;  2YKQ A;  3M0D A;  4KT0 J;  3IN6 A;  1S5L E;  1SQQ G;  1JB0 J;  2C9L Y;  3A0H H;  4YTP C;  2WT7 A;  4H0L C;  2ZVO B;  5CMZ A;  2AEM A;  3A0H E;  3I5C A;  3OW2 O;  1YJ9 P;  1KYO D;  5APW A;  1Y8A A;  1EC5 A;  5AVX B;  3ABV C;  1IC2 A;  5KAF H;  4U3F D;  1N73 B;  2IYO A;  2ZT9 D;  2KSE A;  1NTM K;  5KAF E;  4ASW A;  5KJ7 A;  1X0T A;  3CCU P;  2QM8 A;  3H1K D;  2Y9Y A;  1K8A Q;  2BCC J;  1SQV G;  4IFF A;  4XE5 B;  2ZFC A;  2A06 G;  3H1I D;  1NHL A;  2QSI A;  3I56 P;  2NPS D;  1K73 Q;  1URQ A;  4ZKU A;  4WY4 B;  4IFD K;  2QJP C;  3KXD A;  3BAT A;  4GT1 A;  3Q1M A;  2KOG A;  1KC8 Q;  3B5N C;  3WUU A;  3HUS A;  3R2P A;  2FBW C;  4RO0 A;  5TIS H;  1HBW A;  2HG5 D;  2P67 A;  4AYC A;  1S3J A;  2KZI A;  3H1J J;  5TIS E;  1PP9 J;  3RK3 E;  3O6Q B;  1EDL A;  1HTL C;  5AW8 B;  1NO4 A;  2OQQ A;  1ZN5 A;  3H1H G;  5B66 H;  2KLV A;  2P2U A;  5B66 E;  5CCG D;  1KV4 A;  4UB6 H;  1IK7 A;  5KLV K;  3HE4 B;  1JY2 P;  4W7Z A;  1Q86 Q;  1YJW P;  2IBZ D;  4UB6 E;  1SFC D;  3G4S P;  4BRY A;  3WUV A;  1RE4 C;  1YHQ P;  1X79 B;  3CD6 P;  2FYN B;  3HD7 D;  2FXM A;  3TYY A;  3Q5S A;  3CC2 P;  2FYU G;  3GF7 A;  2H7H A;  2WPS A;  3RBZ A;  1PIX A;  4NPF X;  2HOD B;  3C9I A;  1M1K Q;  3VMZ A;  2H43 A;  2PRR A;  3V4Q A;  2J5U A;  2R32 A;  2BEZ F;  1VQ9 P;  3U1C A;  1OW8 A;  3L73 D;  2N9Y B;  1HVV A;  1ZW0 A;  2OYH B;  3V6I A;  3VP9 A;  4Y99 C;  4TT3 H;  1NTM E;  1AJY A;  3S9O A;  4R4M A;  2N1T D;  1ZLL A;  4RKU J;  3TGU J;  2ZYD A;  1ZOY C;  2NRG A;  4WWI A;  3JC2 2;  3H1L E;  1IFJ A;  1N8R Q;  3L74 D;  1NTK G;  2ZXE B;  2JDI H;  3MIW A;  3H32 A;  1IFN A;  1PP9 E;  1DX7 A;  1LTB C;  1OX3 A;  3AE7 C;  2NPS C;  3N4X A;  4OGQ D;  3EWK A;  4EYY Q;  1LTT C;  2B87 B;  3Q3D A;  1OW7 A;  1KYO I;  1VQL P;  2UWJ E;  3H1K J;  3RK2 C;  2ZYG A;  3PH0 A;  2WSE J;  3L75 G;  3A3Y B;  3M0A A;  2M5A A;  4JF7 A;  3FWL A;  3L71 D;  2FXO A;  1PZQ A;  3TNU A;  3H1I J;  1NTZ D;  3RK3 B;  3VMX A;  1JY2 O;  1YYC A;  5DJT B;  3A5T A;  3CCQ P;  4H13 B;  5KLV E;  4C7N A;  1VQ5 P;  1X9V A;  1EXJ A;  1HJ0 A;  1VF5 B;  5H2F H;  5CCG C;  1PGO A;  5H2F E;  2QJK B;  4ASV A;  1MV8 A;  2K37 A;  5APV A;  4JPZ B;  3R4Y A;  1MKM A;  4D6T D;  1JOC A;  1HF9 A;  1QEX A;  1U7J A;  2NPS A;  1BDD A;  2YIU C;  1SQP J;  1JUN A;  1L0L J;  1YQ4 C;  5CCH D;  1GTW A;  1KQS O;  3W67 A;  2E75 D;  4I7Z B;  3HUS B;  1BGY D;  1W2B O;  1OWA A;  5AW1 B;  5B5E H;  1SQB K;  1KYO H;  3QWO C;  1FJK A;  2CPS A;  2FYU J;  1NU1 D;  5B5E E;  2E43 A;  1Y9B A;  1KYO E;  2IBZ I;  3GMA A;  3BCC J;  2HPC B;  4U3F E;  1U57 A;  2IYP A;  2N1T C;  5CBN A;  3H1K E;  3L72 D;  3BAS A;  5CCG A;  3V4W A;  2Z5H A;  1GK4 A;  1VDF A;  4W80 A;  1S2E A;  1SFC A;  3L73 J;  1LJ2 A;  3H1I E;  4H0L D;  1S72 P;  1S9K D;  2R5D A;  3BVH A;  4I6M C;  5GTH H;  1BCC D;  2ZXX A;  4OH8 B;  2POH A;  1L4A C;  3FXE A;  2WSF J;  3FWN A;  3HE5 B;  5AVY B;  3B71 A;  3P32 A;  3AE9 C;  4OGQ C;  3ZDM A;  1YJN P;  5GTH E;  1GL2 C;  1L0N J;  4PJ0 H;  2ZVN B;  3WUT A;  1NTM G;  2WMM A;  2AXC A;  4PJ0 E;  5DJU B;  5KAI H;  1PGP A;  1IZN B;  1MFT A;  1M56 D;  3L35 A;  2N9B A;  5KAI E;  2Q7C A;  1S5L X;  4H44 D;  1IFP A;  3H1L G;  1PPJ D;  2M0B A;  1X22 A;  2XU6 A;  2N1T A;  2C0W A;  2XND H;  1SLQ A;  2JR8 A;  1PP9 G;  1XTC C;  2IBZ E;  3B5N D;  1EZV I;  1QVG O;  3M06 A;  2B89 A;  3W68 A;  3L71 J;  3M9B A;  1AA0 A;  1WRG A;  3VYI A;  1FAV A;  1GL2 A;  1Z56 A;  3I55 P;  5AVQ B;  2R3C A;  2RH0 A;  5CCH C;  1JMB A;  3MHV A;  2E75 C;  2Q3I A;  3MZW B;  4OVN F;  1X8Y A;  1FOS F;  3L73 E;  2IZ1 A;  2W27 A;  1A02 J;  1KZU B;  2M5A B;  4HB1 A;  4D6T J;  2KS1 A;  4HJG H;  1LTA C;  2OTK E;  4YPC A;  3VN0 A;  3JCU H;  1NU1 K;  1L2P A;  3WU2 H;  1RY3 A;  2QE7 H;  1OVV A;  4C7N B;  2ZT9 B;  1QGK B;  3JCU E;  3WU2 E;  1N7L A;  1USE A;  2BAS A;  1NJI Q;  2QJY B;  2W8Z A;  1RF1 B;  3L74 E;  3II6 A;  4K35 A;  3TGU G;  1RHZ B;  3Q5P A;  3UIA A;  5AW4 B;  2KI7 B;  1DH3 A;  5AVV B;  1J1D B;  1LWU B;  2XV5 A;  1LTJ B;  3N7N A;  1EDK A;  4K3A A;  3CX5 D;  2KNC A;  1IFD A;  1FZF A;  2E74 D;  1SQQ D;  5CCH A;  3LIE A;  1K04 A;  3L72 J;  3FX0 A;  2E42 A;  3CWB D;  1FZC B;  3FXD A;  4JYC A;  4U3F G;  1GK6 A;  1W2E A;  3RBX A;  3L71 E;  4NPD A;  3M9H A;  3H1K G;  1NTZ E;  3TDK A;  4H44 C;  1DEE G;  1FBM A;  1S1C X;  2IDB A;  5APU A;  2JWD A;  3VOP A;  1LTG C;  1NTM J;  1SQV D;  4A7P A;  2A45 I;  1SS1 A;  2O01 J;  3H1I G;  1KMI Z;  5CHX A;  3S1K A;  1FJP A;  3CME P;  1SFC B;  5KLI B;  2PP6 A;  3RK2 D;  3NXS A;  3H1L J;  2OTL P;  4D6T E;  2ZYA A;  3HD7 B;  3G71 P;  1RE3 C;  4M3L A;  4KHX A;  5APQ A;  1USD A;  3SSU A;  1KFM A;  3VMA A;  3AEC C;  4PV1 C;  3USS A;  4DOJ A;  2FXP A;  5AVZ B;  2KXP B;  3CL3 D;  1VQK P;  3V5B A;  1J1E B;  1BGY E;  2YKO A;  4KJM A;  1NKN A;  2JP3 A;  3AEA C;  1SQP G;  1L0L G;  1H0T A;  3L36 A;  1NU1 E;  3AE3 C;  3GHG C;  1Q7Y Q;  1IO4 A;  3LW5 H;  3OA7 A;  5EFW B;  1G1I A;  2P1J A;  2NZ2 A;  2Q3E A;  5K5G B;  1DD3 A;  1T6A A;  3TSI A;  1NKZ B;  1OIP A;  1BE3 D;  1SQX D;  3L72 E;  5AVU B;  1JY3 P;  4GIF A;  2Z4E A;  2L5G B;  3BCC G;  1EDI A;  4GOE A;  5KLV J;  3B5N A;  3S4R A;  2QRX A;  4IOI H;  1N7S B;  1SQB D;  2A45 H;  2E76 C;  1AFO A;  2Q9I A; 
#chains in the Genus database with same CATH homology
 1RE3 A;  1GW3 A;  1S9K E;  2M8R A;  1KIL A;  2YO3 A;  2OYI C;  3NFQ A;  3KQG A;  1DEB A;  1JOC A;  3IFM A;  2NPS A;  3T97 A;  1ZV8 A;  3VMY A;  1NTZ K;  2O01 H;  2HYN A;  2FFD C;  4N78 D;  1GD2 E;  1JUN A;  1FZA A;  2O1K A;  3P8C D;  2IX7 C;  1YTZ T;  5CCH D;  3L4F A;  1GTW A;  5CJ4 A;  1SQQ K;  1N7S A;  3HUS B;  3HTK B;  1LGH B;  3IR9 A;  5BU8 B;  2R5B A;  3RL0 C;  5AVW B;  1LT9 C;  3GHG A;  1M7L A;  1OWA A;  1HH0 A;  5AW1 B;  1SQB K;  1HGV A;  1SP4 A;  1FJK A;  4RES B;  2CPS A;  2HLO A;  2WZ7 A;  5AVS B;  5AVT B;  5BU5 A;  3OJA B;  1VPC A;  1H88 A;  1RE4 A;  2YMY A;  2OYI B;  2E43 A;  1CZQ A;  2IFM A;  2XZR A;  5BVZ A;  2HPC B;  2FFD B;  3OAK A;  2P7J A;  1L4A D;  2N1T C;  1GU5 A;  2LKM A;  3BAS A;  5CCG A;  3V4W A;  2Z5H A;  1GL2 D;  1GK4 A;  3E1I A;  3NMD A;  1SQV K;  1VDF A;  3KDP B;  2WSC H;  4I2L C;  5AW5 B;  5KJ7 C;  4W80 A;  2GM4 A;  1LT9 B;  2VRS A;  1GZL A;  1ZR4 A;  2YNY A;  1SFC A;  2WSF H;  2Z5I A;  1GU4 A;  4O9B A;  1GW4 A;  2KB7 P;  3EFG A;  2OYI A;  3LID A;  3V2P A;  3U1A A;  3TK1 A;  2IPP A;  1IFI A;  2Q5U A;  1NAF A;  2WT7 B;  2C9N Y;  1T3U A;  5AW0 B;  2W6B A;  2HPC A;  3MD0 A;  2WPQ A;  2R5D A;  1S9K D;  2FFD A;  1MZ9 A;  2XDJ A;  1NOH A;  4I6M C;  3BVH A;  4LGD E;  4OH8 B;  3MGN A;  2WIT A;  2POH A;  1L4A C;  1T2K C;  3HE5 B;  5AVY B;  1URQ C;  2N1T B;  3SWY A;  4WB4 A;  3P32 A;  2WTY A;  2H8P D;  4WY4 D;  3KYQ A;  1N73 C;  1GL2 C;  2FKW B;  4LC1 A;  1G2C B;  1NWQ A;  1LT9 A;  3SWF A;  5APX A;  1M1J B;  3L37 A;  4EIJ A;  2YKQ A;  3HRN A;  2XNX A;  3M0D A;  1H8A A;  2C9L Y;  3L35 A;  2WT7 A;  2N9B A;  1JY3 O;  1LTS C;  2Q7C A;  5CMZ A;  3I5C A;  2QM7 A;  3V2N A;  4AQR D;  5APW A;  2XU6 A;  3HE5 A;  5AVX B;  1L4A B;  2JEE A;  2N1T A;  1IC2 A;  4WY4 C;  1URQ B;  2IFN A;  1HJB A;  2I1J A;  2C0W A;  1IK9 A;  2J58 A;  1N73 B;  1N2D C;  1GL2 B;  3EQ2 A;  1G2C A;  1SLQ A;  1NTM K;  3MUD A;  1XTC C;  1SQX K;  5KJ7 A;  4AUW A;  2QM8 A;  1YTZ I;  3B5N D;  3M91 A;  3V2R A;  1FDM A;  3M06 A;  3A7O A;  1J2J B;  2OAR A;  2HFE D;  1IFM A;  1A02 F;  2KP8 A;  4IFF A;  4B86 A;  3M9B A;  4XE5 B;  1WRG A;  2ZFC A;  3A2A A;  1KIL D;  5APY A;  1NHL A;  2NPS D;  1JTH B;  1URQ A;  4ZKU A;  5AW2 B;  4WY4 B;  4IFD K;  2KYV A;  3VYI A;  1FAV A;  1N73 A;  1GDT A;  3BAT A;  1N86 A;  1GL2 A;  4GT1 A;  1Z56 A;  2KOG A;  5AVQ B;  1KFN A;  2R3C A;  5CCH C;  1AQ5 A;  1T3J A;  1PFI A;  3B5N C;  2Q3I A;  1JMM A;  4JYB A;  1RF1 C;  1N7S D;  3HUS A;  3HTK A;  1X8Y A;  1FOS F;  1IJD B;  2W27 A;  2XKM A;  3R2P A;  1KZU B;  2M3B A;  1QL1 A;  1A02 J;  2YKP A;  1HBW A;  2P67 A;  2HG5 D;  1M1J C;  4AYC A;  1CW5 A;  1EQ7 A;  4DZO A;  5AW6 B;  2J59 M;  4EOT A;  1LTA C;  5APS A;  1J1D C;  1LWU C;  2O1J A;  3VN0 A;  1NU1 K;  1HTL C;  1LTJ C;  1RY3 A;  5AW8 B;  1NO4 A;  1ZN5 A;  2JJL A;  1NH4 A;  4C7N B;  1FOS E;  1N7L A;  1SVF A;  2KLV A;  2P2U A;  4I1L A;  4ZKP A;  1HGZ A;  1NTK K;  3B5N B;  2BAS A;  5CCG D;  1RF1 B;  2KSJ A;  3II6 A;  5KLV K;  1FZC C;  3HE4 B;  1CI6 B;  1JY2 P;  4W7Z A;  3UIA A;  5AW4 B;  1SFC D;  4C7R A;  1KIL B;  2MJZ A;  1RE4 C;  1DH3 A;  5AVV B;  4C46 A;  1X79 B;  2OYH C;  3HD7 D;  1J1D B;  2FXM A;  3TYY A;  1LWU B;  4GKG A;  2XV5 A;  1LTJ B;  3N7N A;  5AVR B;  1IFD A;  2H7H A;  1FZF A;  2WPS A;  1SQP K;  5CCH A;  3LIE A;  1L0L K;  1ZR2 A;  1JCC A;  1KQL A;  2CPB A;  2HOD B;  3C9I A;  1RF1 A;  2E42 A;  1T8Z A;  3VTP C;  3HE4 A;  3RL0 D;  3V2Q A;  3VMZ A;  2H43 A;  1FZC B;  4N6J A;  1XTG B;  1G1J A;  4JYC A;  1GK6 A;  4HH2 A;  3V4Q A;  1SFC C;  5AW7 B;  3PP5 A;  1OXZ A;  1W2E A;  4IFM A;  1M1J A;  2R32 A;  1HWT C;  3U1C A;  3WMM 0;  1HVV A;  3M9H A;  4LLH A;  3VP8 A;  3HD7 C;  2FYU K;  1LWU A;  2I1K A;  2OYH B;  3VP9 A;  4Y99 C;  3BRT B;  3BRV B;  3H32 B;  3P7K A;  1LTJ A;  2GUV A;  3CLQ A;  1CSB A;  1LTI C;  1JO5 A;  1FBM A;  1L4A A;  2N1T D;  3RK3 D;  1ZLL A;  5APU A;  1LTG C;  3VOP A;  2HOD A;  2A45 I;  1J1E C;  1FZC A;  5CHX A;  3U59 A;  3H6P A;  1IFJ A;  5KJ7 D;  3CI9 A;  1FJP A;  1SFC B;  2PP6 A;  4HYT B;  3M0D C;  3RK2 D;  1MUU A;  3NXS A;  1RF0 C;  2ZXE B;  4N3Y B;  2OYH A;  3HD7 B;  3MIW A;  4XA4 A;  3G3Z A;  2PAJ A;  1RE3 C;  3H32 A;  4M3L A;  1IFN A;  4KHX A;  5APQ A;  4Y99 B;  1FU1 A;  1KFM A;  1KIL C;  3TNU B;  4N78 E;  1FZG A;  3RK3 C;  1T2K D;  1DX7 A;  1LTB C;  3P8C E;  1FZE A;  2NPS C;  1URQ D;  1JTH A;  3N4X A;  4DOJ A;  4WY4 A;  3O8Z A;  2WSE H;  5AVZ B;  1LTT C;  2FYZ A;  1WT6 A;  3CL3 D;  3V5B A;  1J1E B;  3RL0 B;  1L0N K;  2YKO A;  2WWW A;  2A45 G;  1NKN A;  5APT A;  2GUS A;  3RK2 C;  1N7S C;  5CJ0 A;  2C0X A;  3A3Y B;  3L36 A;  3M0A A;  3HD7 A;  3GHG C;  4JF7 A;  1IO4 A;  5KTB A;  3LW5 H;  1QL2 A;  3OA7 A;  3TNU A;  1H89 A;  1JCD A;  3M9Q A;  5AW3 B;  1HUC A;  1G1I A;  2P1J A;  3RK3 B;  3VMX A;  5AW9 B;  1JY2 N;  1JY2 O;  3P8M C;  1YYC A;  2NPS B;  4WBA A;  3A5T A;  1JNM A;  1E5W A;  3TSI A;  1NKZ B;  2YO2 A;  1FZB A;  3MTU E;  1MFZ A;  4C7N A;  3B8E B;  3NTN A;  4W7Y A;  1X9V A;  5AVU B;  1JY3 P;  4GIF A;  3KPE A;  2Z4E A;  2L5G B;  2W6A A;  3B5N A;  5CCG C;  3HUS C;  3RK2 B;  1N7S B;  1JY3 N;  1CI6 A;  1RF0 A;  2A45 H;  1MV8 A;  2WPR A;  5APV A;  3GHG B;  1AFO A;  2Q9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...