2WPSA

Salmonella enterica sada 483-523 fused to gcn4 adaptors (sadak3b-v2, out-of-register fusion)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
98
structure length
98
Chain Sequence
QIEDKIEEILSKIYHIENEIARIKKLIEKVDQNTADITTNTNSINQNTTDIATNTTNINNLSDSITTLMKQIEDKIEEILSKIYHIENEIARIKKLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords TRIMERIC AUTOTRANSPORTER ADHESIN FRAGMENT
publication title A Coiled-Coil Motif that Sequesters Ions to the Hydrophobic Core.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 44
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wpsA00
2XV5A 1CI6B 1GZLA 1GK6A 2IPPA 2Z5HA 3HE5B 2Q5UA 3L35A 1KQLA 1GU4A 4GT1A 2R3CA 2WT7A 3HE4B 2WTYA 3P7KA 2WPSA 5AVSB 1A02J 5APTA 2ZXEB 1JNMA 3MGNA 2W27A 5AW8B 3B8EB 1H88A 2WPRA 1DH3A 3LIEA 1OWAA 5AW1B 5AW6B 1FOSE 1IO4A 1FOSF 2P2UA 3NFQA 3L37A 3SWFA 4EOTA 2H7HA 5AW3B 4XE5B 3VMXA 5AW5B 2WT7B 3M0AA 1SP4A 2XZRA 1H8AA 3A2AA 3P8MC 5APVA 1G2CB 3LIDA 5AVVB 3M06A 5APWA 3OAKA 3V5BA 2Z5IA 4DZOA 4I2LC 1GU5A 3M0DA 3UIAA 5AW7B 1GTWA 1J2JB 4LC1A 1CZQA 4GKGA 5AVZB 1MV8A 1YYCA 5AVRB 4KHXA 5AW4B 3NXSA 3V4WA 5APSA 1S9KE 2N9BA 3M91A 1HJBA 2ZFCA 1T2KC 3M9HA 3VTPC 2R5BA 2E43A 2C9LY 2Q7CA 1SLQA 2R5DA 3HTKA 4AYCA 5AW9B 2XU6A 1S9KD 4JYCA 2QM7A 4B86A 4RESB 2KP8A 5AVQB 4AUWA 3TNUA 5AVUB 3NMDA 4I6MC 3VYIA 5AW2B 2R32A 2JJLA 3KDPB 5AVXB 3IR9A 2YO2A 5CMZA 5APYA 5AVYB 1JUNA 4C7NA 5AVWB 2QM8A 5APXA 3MD0A 2BASA 3T97A 3TNUB 5APQA 3A3YB 3M9BA 3O8ZA 2VRSA 3VMZA 3A5TA 1GK4A 1A02F 3NTNA 3L36A 2WPQA 3VMYA 1GD2E 1X8YA 2P67A 3KQGA 4JYBA 2W6AA 5AW0B 1H89A 4C7NB 5APUA 1CSBA 2YO3A 3VN0A 1HBWA 1OXZA 3A7OA 3P32A 1NWQA 1CI6A 3HE5A 2E42A 2P7JA 2YNYA 3I5CA 3TYYA 4M3LA 3HE4A 1MUUA 4AQRD 1HWTC 3TK1A 2WWWA 1T2KD 2C9NY 1MFZA 3V4QA 1NAFA 5AVTB 4C46A 4HYTB 1FAVA 2Q3IA 1HUCA
chains in the Genus database with same CATH superfamily
1XTCC 2HODA 3KZIH 3G71P 1IFNA 1YI2P 1DEEG 1S5LX 3TSIA 3EFGA 2ZJSE 3S9OA 2IBZE 3MGNA 2W27A 3MTUE 5E79E 2WPRA 1SFCD 1SQVK 1IO4A 2GUSA 1FS0E 3LW5H 5AW3B 3RK2B 5CCGD 1LWUC 1DD3A 1OX3A 2FY8A 1N73B 1ZRTE 2GUVA 3Q2YA 4I2LC 1J1EC 2QJYB 3S1KA 3L75E 2E74C 2K37A 3OA7A 4KHXA 1IK7A 3M91A 2IBZG 2QVAA 1KB9H 3E1RA 2IYOA 2Q3EA 3EWKA 2FYNC 3KPEA 1KYOD 1KB9E 1LTIC 3L75G 4PD4H 2A45H 1YBKA 1SQPJ 2KNCA 1S72P 3B5ND 3F89A 3CX5I 1LTSC 1KILB 3L36A 3AECC 3H1IE 2K88A 3BCCG 1RE4C 4OWFA 3CC2P 3T97B 2DW3A 2H89C 2BCCE 3RGUA 4H44B 1SQQG 1KILE 1S4XA 2IYPA 3TK1A 3V4QA 3MHVA 2XV5A 1CI6B 1FZCC 1DEBA 2A45G 1KMIZ 2Q5UA 2I1JA 2ZT9B 1NTZD 1MFTA 4BXLA 1N73A 1DIPA 1T3JA 3H1KJ 4R4LA 1PPJE 5AW6B 5H2FH 3AE9C 1VQ4P 2FYUK 4YTPC 5C39A 1G2CB 2GM4A 2Q9IA 1BE3D 5APWA 3OAKA 1HTLC 2N1TB 5H2FE 3CCUP 1RY3A 1NTKE 2OYHC 5CBNA 2FXOA 3I55P 1PPJG 3IFMA 1LTBC 2WSCJ 1RE3C 1NTMD 1SQBK 3H1JJ 2M8RA 3BRVB 4BWNA 2W6JH 3JCUE 1LWUB 3WU2E 5KLVE 3CX5D 4PJ0E 5AW2B 1KILA 1LTGC 1NTKG 2E74B 2OYOA 3H1HJ 3L70D 5AVYB 2KLVA 3PP5A 3T97A 2L91A 2YKPA 4LLHA 3MP7B 5AW0B 1S5LE 2WSEJ 1CI6A 2FBWC 3TGUD 1MUUA 4YXWH 3CMAP 1OMIA 2FFDC 2XNXA 4LGDE 1SQPK 1X79B 3L35A 1JMMA 1IFDA 3JC22 2ZYGA 1AVOA 1G2CA 1A02J 1L0LJ 4NPEA 2N1TA 4D6TD 5CCHD 5K5GB 2LXBA 2B87B 1OWAA 4N78E 3BRTB 2IDBA 5KTBA 1SP4A 1QL1A 3LIDA 5AVVB 1NGMB 2YMKA 3A0HH 3ZDMA 2KXPB 5TISE 1M1JB 1LWUA 2MKVA 2XDJA 4WY4B 1JY3N 1VPCA 4PD4I 1SQVD 3AEGC 5KLIC 4PV1C 4OGQC 2WITA 4DCKA 2IZ0A 3GMAA 3HD7D 2W83C 3D71A 3L74E 2Q6QA 2VRSA 3VMZA 1L0NJ 3R2PA 3FXEA 3P32A 3N7NA 3AEFC 1JY3P 4IOIH 4L74A 2NRGA 2YIUC 2JWDA 1RE4A 1RF0C 2C9NY 2Q3IA 4GODA 3L74G 2B87A 1N86A 5B66H 1OZHA 1BCCJ 2P58A 2YKOA 2Y0EA 2JO1A 1DH3A 3V2PA 3LIEA 2B9BA 2QJKC 5B66E 4CPGA 3VMXA 1M1JA 2WT7B 4BRYB 2OQQA 2KS1B 1Y8AA 2M0BA 3P8MC 1S1CX 1M57D 4WY4A 3CWBG 1FZBA 2Y0DA 1TU3F 3H1LD 3VTPC 1HGZA 3B5NB 3MIWA 1EZVG 1KYOE 4UB8H 2XU6A 1VF5C 1DX7A 3K5BA 3L72D 2KYVA 1K04A 1L0LK 3E1IA 1JMBA 2YMYA 3FWLA 1RE3A 4UB8E 2AXTE 1USEA 2A06E 2OARA 1AQTA 5KLIB 3VN0A 3RK3D 3PRJA 4XA4A 4IFMA 4OGQB 2GA1A 2UWJE 2E42A 3CC7P 1AJYA 3TYYA 3EQ2A 1YQ4C 4H13D 5EFWB 1FZFA 1NTZE 1PZQA 1FZGA 2A06G 3W67A 4WVZA 3V2NA 2R3CA 2WT7A 4BRYA 2KS1A 1PP9G 2CPSA 2POHA 2ZXEB 1L0NK 3PTZA 1JY2N 1BE3E 2YIUB 2P2UA 2O01N 1H8AA 3S4RA 1N73C 2BEQD 1X0TA 2PRRA 3B5NA 1H0TB 1N7SD 3Q5RA 1SQPD 1UIIA 1FDIA 2C9LY 3LW5J 1KFMA 1M1KQ 4ZMDA 3II6A 2QM7A 2V7QH 4Y99B 5AVQB 1ZLLA 1Q2NA 5GTHH 4Y28J 3D6YA 1FZEA 1KQFB 5GTIH 3BCCJ 3MD0A 3M9BA 1Q7YQ 3L73G 3NTNA 1SQQJ 3TGUE 1NU1G 4JYBA 2W6AA 5KAIH 3H1KD 1BSNA 5CJ4A 1ZN5A 4C46A 3TDKA 1GK6A 2LR2A 2ZT9C 3TGUG 3L72J 1LTJC 1LP1B 1BGYE 2C0WA 3CLQA 1YQ3C 1BDDA 1ZMEC 1H0TA 5AW8B 1RQVA 2K9JB 3QWOC 1FOSF 3H1JD 2ITAA 3BVHA 2H7HA 1IFJA 2J58A 2N1TC 3RK3C 5E79H 3UIAA 1BGYG 3H1HD 2I1KA 3PH0A 2Y0CA 2MJZA 1SQVE 1KTMA 1VQ9P 3FX0A 2Q7CA 3GLMA 1NTKJ 1X22A 3V6IA 3B71A 1QVFO 3CXHI 1KC8Q 4W80A 3CC4P 1R8EA 2H8PD 3IR9A 5APYA 3O6QB 1SQXE 3MUDC 3TNUB 2QIWA 1ZR2A 5DJUB 4EYYQ 1VQPP 5CCHA 1A02F 4I7ZB 3CCJP 2V4HA 2P1JA 1HBWA 3A7OA 2IX7C 3G4SP 1L0LD 1HJ0A 3AE7C 1VQOP 1LP1A 1GDTA 1SQXG 4AQRD 3HUSC 2K9JA 3Q5SA 1OVUA 1VQNP 4U7JA 1SQQK 4UB6E 1P84I 1FDOA 3L71E 1LGHB 1QEXA 4NPFX 3M0DA 3H1IG 3H1LE 1LTJB 1FC2C 1M1JC 3CXHD 1QLED 2BCCG 2FYUE 2R5BA 4WY4C 1SLQA 1L0ND 3O6QA 3VP8A 2NPSD 3L71G 2KP8A 4AUWA 3TNUA 1FBMA 4KJMA 3RK3B 4XFJA 2PP6A 3L4FA 5AVWB 3JCUH 2FYUG 3WU2H 1SQBE 4PJ0H 3RK3E 3AEBC 4JF7A 4WWIA 2KLUA 1L4AD 2P67A 5APUA 2JR8A 1OXZA 1BCCD 1NH4A 1KFNA 3E7KA 4DJGA 2JP3A 3H6PA 2OTJP 1SFCC 5BU5A 1S5LH 4IL6X 2HPCB 1SQBG 5CCGC 1FZAA 4Z1MH 1YJWP 1OVVA 3SFEC 4RKUJ 1P84D 1N7SB 5KLVG 1OFCX 5KKZC 3RL0D 2IBZI 2KSEA 1LTJA 3CWBJ 1OW7A 3SWFA 5AW5B 1PGPA 3A2AA 1SQPE 2WSSH 3HUSB 1LT9B 5TJHA 5CJ0A 2FKWB 2M3BA 1CZQA 5AVZB 2Y9YA 2XNDH 1E5WA 2WSFJ 1HF9A 2O01J 1Q82Q 3B5NC 1SS1A 5TISH 3CCMP 3CCEP 2ZVNB 4QMAA 4U3FJ 1KB9I 1VQKP 2R32A 3AEAC 2AEJA 1HVVA 1S2EA 4JPZB 3CCVP 2YKQA 2WQYC 5KJ7D 3USSA 1OW6A 3GHGC 1IFMA 2PFXA 3BASA 1GK4A 4GOEA 2A45I 4KT0J 4TLFA 3H1KE 1SVFA 2HPCA 3MUDA 2O1KA 1CSBA 1T6AA 2C0XA 1RH5B 4IFFA 1N7SA 1PP9J 2IBZD 4N6JA 5B5EE 1VQ6P 1BSHA 4TT3H 3U1CA 3P7KA 3HUSA 2J5UA 1LT9A 3RL0g 1ZRTD 2KB7P 2WPSA 1N8RQ 3L75D 5AW1B 1FOSE 1SFCB 3U1AA 3L37A 4XE5B 1IC2A 4N3YB 3H1HE 3M06A 2WMMA 2Z5IA 1M90Q 3IAOA 5AVRB 2WSFH 5AW4B 3BCCD 5APSA 5KKZB 2N9BA 4H0LD 1KB9D 2O01H 1NKZB 3SWYA 1SQQD 5M1BA 4AYCA 2H43A 4Y99C 1QL2A 1PGQA 3H1HG 2E75D 3EFFK 1EDKA 4PD4D 1KYOH 5AVXB 3L73J 1NU1J 1YTZI 2QA4P 4IL6E 2JWAA 1QVGO 3A3YB 2N9YB 1BDCA 1URQD 1OVRA 2V7QJ 1L0LE 1GL2D 3KQGA 1H89A 3G6EP 2AXTH 1PIXA 5CCHC 4OH8B 2OYIC 1U7MA 1LJ2A 5AVTB 1Y9BA 1PPJD 1GZLA 4ZKPA 2IPPA 3GHGB 1SFCA 2L5GB 5CCGA 1ZOYC 4WBAA 1H88A 3ITKA 1BGYJ 1OIPA 1NTKD 1QGKB 2E5YA 4L75A 5BVZA 3IN6A 2K1AA 3CL3D 2NPSB 2YXRB 3CXHE 1GU5A 1G1JA 2ZYAA 3CCSP 3PHLA 3HD7C 1HJBA 1L2PA 1JY3O 3WMM0 2XKMA 3M0DC 1K8AQ 3G9RA 2RKLA 3W68A 1NTZG 1L4AB 1S3JA 5AVUB 3VYIA 2M5AB 3CX5H 3HTKB 1JM0A 1NTME 1PL5A 1LNQA 3A0BE 1CW5A 5APQA 3L75J 1BE3G 5DJTB 1BCCE 4I7ZC 1FJPA 3AE1C 3CX5E 3H25A 3FGAD 2ZYDA 1GD2E 1SQXJ 1X8YA 3AEDC 2E76D 4C7NB 3SSUA 3L70E 2HLOA 3AE5C 2CK3H 3GHGA 4H0LC 1RF1B 1NTMG 1ZXGA 2YNYA 3I5CA 3RBXA 1YJ9P 4K35A 1P84E 3VMAA 1T2KD 4N78D 1LTAC 3HE5B 1NU1K 1LT1A 4GT1A 3TF5A 3GF3A 3L70G 1E79H 1YITP 2NPSA 2JDIH 3Q5PA 4YPCA 1KQGB 3H1IJ 1EZVI 2R44A 2OYIB 2XZRA 2BCCJ 4HH2A 1QX8A 4HB1A 4D6TE 3C9IA 3L71J 1L4AA 1YTZT 1NHLA 3V4WA 3WUTA 2M5AA 3U59A 1EDLA 2R5DA 3HTKA 3D6ZA 1EXIA 1USDA 3C8VA 4B86A 1U7JA 1JEKA 1X9VA 2FYUJ 1AA0A 3Q3DA 1U57A 2Z4EA 3L74D 4D6TG 2JJLA 1JCDA 3KDPB 3FXDA 3PLNA 4C7NA 5KAFE 3HD7B 5APXA 4H13C 3AE6C 2KI7B 2ZXXA 3O8ZA 3A5TA 1G1IA 1RF1A 4YXDC 5CHXA 1SQBJ 3PJSK 1KORA 4W7ZA 3HE5A 4C7RA 3KZIE 3CWBD 1SQVG 4EI2A 3RBZA 5KLVJ 2WWWA 3FWNA 4HYTB 3SWKA 2LKMA 1VQMP 1NKNA 2IFNA 1EZVD 3MZWB 1KQLA 2OYIA 1EC5A 1N7SC 1JY2O 4EIJA 1WMKA 1JNMA 4H0LB 1SQXK 1PGOA 4EOTA 3JSVC 3AE8C 4U3FD 1LT9C 1DD4A 4I1LA 2E76C 1FE6A 2E75B 3BCCE 3V5BA 4UB6H 1NOHA 1JB0J 2B89A 5KJ7A 4JQ0D 2KK7A 1SQQE 3I56P 2K9YA 1ZR4A 1T2KC 2QE7H 2W6BA 3WUUA 1URQB 4PD4E 1PGJA 3HD7A 3Q1MA 1GL2B 2IZ1A 1NJIQ 1XTGB 1FDMA 4GIFA 2QJPC 2G3AA 2A06D 1VQ8P 2PAJA 5CMZA 3L72E 1PP9D 1KD1Q 2LXCB 3GW6A 4DOJA 1W5CE 4PV1D 2YO3A 5L8RJ 4DT0A 1Y47A 1NWQA 4OGQD 3H1LG 1M56D 2QRXA 3L72G 4H13B 3P8CD 1FAVA 2RN0A 3KYQA 1M7LA 1GU4A 3VP9A 1NO4A 3L74J 2W90A 2KUBA 1NTKK 1KZUB 3VOPA 1VQLP 4R4MA 3M0AA 3GF7A 3QH9A 3L73D 1J1EB 4LC1A 4GOFA 1URQA 2OTLP 1NU1D 5KLVK 2RMZA 1GL2A 2HFED 3NXSA 4GDOA 1T8ZA 2E43A 1W2EA 2QSIA 2O1JA 5AW9B 1S9KD 1K73Q 4JYCA 1MKMA 2ZVOB 4RESB 2D2CD 3M9QA 2E76B 2FYNB 2KSJA 3NMDA 1RHZB 2J59M 2BEZF 1Q90D 4OVNF 2FXMA 1GMJA 4EDFA 1VF5D 1IZNB 2KIKA 3CMEP 1W2BO 1N7LA 2OTKE 1SQPG 3R4YA 1J1DC 1KQSO 1Q86Q 2QJPB 1T3UA 3WUVA 1BGYD 1YIJP 1NVOA 4ZNCA 1NAFA 1KN7A 1HUCA 1FZCB 1JOCA 1Q81Q 1Z56A 2WTYA 2AEMA 2KZIA 1N2DC 5B5EH 5AVSB 2PGDA 5BU8B 4K3AA 3CCRP 3B8EB 3A0HE 2WSCH 1AVYA 1FU1A 3NFQA 2NPSC 1FJKA 2SPZA 5APVA 3H1KG 4DZOA 5AW7B 3H1JE 3GG2A 2OGUA 1NTZJ 2OYHB 2CPBA 2O3JA 4ASVA 3CI9A 1YHQP 1GW3A 3RK2D 1SQXD 4HJGH 1L4AC 1NAYA 2HYNA 3B4SA 1BE3J 2G8YA 2WSEH 3CCLP 2NZ2A 1M8OB 2HG5D 3H1JG 1MZ9A 4ZKUA 2AEFA 3CD6P 1NTMJ 2WPQA 1UIXA 4A7PA 4IL6H 5CBOA 3CWBE 1VQ5P 2P10A 3RL0C 1FZCA 1RF1C 3H1ID 1IFIA 3L70J 1EZVE 1HWTC 2BCCD 1WT6A 2FYZA 2D2CC 1NYHA 1EDJA 2FFDB 1KILD 1ZW0A 3OJAB 2Z5HA 3OW2O 4MN4C 3L71D 3HE4B 3SFDC 1J1DB 2KOGA 2I8DA 4WB4A 5APTA 4H44D 4U3FE 3TGUJ 3V2RA 2R3SA 4ASWA 4NPDA 2IFMA 2OYHA 2FYUD 1K9MQ 1HH0A 1EDIA 1L0LG 2ZT9D 4GKGA 1KV4A 1MV8A 1R5SA 1VDFA 2RH0A 4U3FG 3CXHH 4D6TJ 2JKVA 1EXJA 5KJ7C 1AFOA 1SQBD 1PFIA 3V2QA 2N1TD 4PV1B 4I6MC 1PP9E 3F5HA 1L0NE 1HGVA 2QM8A 5KLVD 1JO5A 3AEEC 1NTZK 1AV1A 1SQVJ 1JTHB 3A0BH 2QG4A 1D7MA 1VL2A 2FFDA 3G3ZA 3P8CE 2Y9ZA 2E74D 2P7JA 4O9BA 3AE3C 3AE2C 1L0NG 2ZAEB 3HE4A 3H32B 2WVRA 3RK2C 1IJDB 4RO0A 1IK9A 3ABVC 1VQ7P 1IFPA 2YXQB 1LTTC 2QJYC 1GW4A 3BATA 1P84H 1JCCA 3RL0B 1NTMK 3CCQP 2HODB 3CPWO 4HKZH 4L76A 2H88C 2Q1KA 2QJKB 3L73E 4L73A 1AQ5A 1NU1E 1BCCG 2D2CB 2E75C 1JY2P 1GTWA 4RJTA 1J2JB 4IFDK 1YYCA 2M3EA 1PV3A 1S9KE 2ZFCA 5GTHE 3M9HA 3IF4A 3D70A 2AXCA 1URQC 1KILC 2FXPA 1K05A 4JBZA 1ZV8A 1VF5B 1GL2C 2QEXP 4W7YA 2WZ7A 5GTIE 3N4XA 2KZJA 1ZP0C 2WPVB 3KHUA 2HR3A 2K3RA 3C1LA 3AE4C 4H44C 2YO2A 1JUNA 1JTHA 2BASA 2W8ZA 1OW8A 2JEEA 3H1LJ 1KYOI 4WY4D 5KAIE 3H32A 3VMYA 5KAFH 1RF0A 1YJNP 1R5LA 1RQUA 2KNCB 3HRNA 1EQ7A 1WRGA 2E5TA 3KXDA 4M3LA 2B88A 1MFZA
chains in the Genus database with same CATH topology
1FZGA 1XTCC 3KYQA 2HODA 1M7LA 1IFNA 1GU4A 3VP9A 1NO4A 3V2NA 2R3CA 2WT7A 3U1CA 3TSIA 3P7KA 3EFGA 2CPSA 3HUSA 1LT9A 2WPSA 2KB7P 2POHA 2ZXEB 1NTKK 3MGNA 2W27A 3MTUE 1L0NK 1KZUB 2WPRA 1JY2N 1SFCD 5AW1B 1SQVK 1FOSE 1IO4A 1SFCB 2GUSA 3U1AA 3VOPA 2P2UA 3L37A 3LW5H 4XE5B 5AW3B 1IC2A 3RK2B 3M0AA 5CCGD 4N3YB 1H8AA 1N73C 1LWUC 1N73B 3M06A 3B5NA 2GUVA 2Z5IA 4I2LC 1J1EC 1J1EB 4LC1A 1URQA 1N7SD 5KLVK 3OA7A 1GL2A 5AVRB 4KHXA 2WSFH 2HFED 3NXSA 5AW4B 5APSA 2N9BA 3M91A 2O01H 1T8ZA 2E43A 2C9LY 1NKZB 1W2EA 3SWYA 2O1JA 1KFMA 4AYCA 5AW9B 1S9KD 2H43A 4Y99C 4JYCA 1QL2A 2QM7A 3II6A 4Y99B 4RESB 5AVQB 1ZLLA 3M9QA 3KPEA 2KSJA 3NMDA 1LTIC 1FZEA 5AVXB 2A45H 1YTZI 2J59M 3MD0A 3B5ND 3A3YB 2FXMA 3M9BA 1URQD 1LTSC 1KILB 3NTNA 3L36A 1GL2D 3KQGA 1N7LA 4JYBA 2W6AA 1H89A 1J1DC 1RE4C 1T3UA 5CCHC 4OH8B 5CJ4A 2OYIC 3TK1A 1ZN5A 3V4QA 1NAFA 5AVTB 4C46A 1HUCA 2XV5A 1CI6B 1GZLA 4ZKPA 1DEBA 1GK6A 2IPPA 3GHGB 1FZCC 2A45G 1FZCB 1JOCA 1SFCA 2Q5UA 2I1JA 1Z56A 1LTJC 2C0WA 2WTYA 2L5GB 3CLQA 5CCGA 1N2DC 5AVSB 1N73A 5BU8B 4WBAA 1T3JA 5AW8B 3B8EB 1H88A 5AW6B 1FOSF 2FYUK 2WSCH 1FU1A 3NFQA 3BVHA 2H7HA 1IFJA 2NPSC 5BVZA 3CL3D 1FJKA 2J58A 2NPSB 5APVA 1G2CB 2GM4A 2Q9IA 2N1TC 5APWA 3OAKA 3RK3C 1HTLC 2N1TB 4DZOA 1GU5A 3UIAA 5AW7B 1G1JA 2I1KA 1RY3A 3HD7C 2MJZA 2OYHC 1HJBA 1JY3O 3WMM0 2OYHB 2CPBA 3IFMA 1LTBC 2XKMA 3M0DC 2Q7CA 3CI9A 1RE3C 1GW3A 1SQBK 3RK2D 2M8RA 3BRVB 1L4AC 1L4AB 2HYNA 1LWUB 5AVUB 3VYIA 2WSEH 5AW2B 4W80A 1KILA 2H8PD 3IR9A 3HTKB 1LTGC 2HG5D 5APYA 5AVYB 1MZ9A 2KLVA 3PP5A 3T97A 4ZKUA 3TNUB 1ZR2A 1CW5A 5APQA 2YKPA 1FJPA 5CCHA 1A02F 4LLHA 2WPQA 1GD2E 2P1JA 1X8YA 5AW0B 4C7NB 1HBWA 2HLOA 3A7OA 2IX7C 1CI6A 3RL0C 3GHGA 1FZCA 1RF1C 1RF1B 1IFIA 2YNYA 3I5CA 1GDTA 1MUUA 4AQRD 1HWTC 1T2KD 1WT6A 2FYZA 2FFDC 3HUSC 2FFDB 1KILD 4N78D 1LTAC 2XNXA 3OJAB 2Z5HA 3HE5B 1NU1K 4LGDE 1SQPK 1X79B 3L35A 4GT1A 1JMMA 1IFDA 3HE4B 1J1DB 2NPSA 1G2CA 2KOGA 4WB4A 1A02J 5APTA 2N1TA 1SQQK 5CCHD 1OWAA 3V2RA 4N78E 2OYIB 3BRTB 5KTBA 1SP4A 2IFMA 2XZRA 2OYHA 4HH2A 1QL1A 1HH0A 3LIDA 5AVVB 1LGHB 3M0DA 3C9IA 4GKGA 1LTJB 1MV8A 1VDFA 1M1JC 1L4AA 1YTZT 1M1JB 1NHLA 3V4WA 1LWUA 3U59A 2R5BA 4WY4C 2XDJA 1SLQA 2R5DA 5KJ7C 4WY4B 3HTKA 1JY3N 1VPCA 3VP8A 2NPSD 4B86A 1AFOA 2KP8A 1X9VA 4AUWA 1PFIA 3V2QA 3TNUA 2N1TD 1FBMA 3RK3B 4I6MC 2Z4EA 2WITA 2JJLA 1JCDA 3KDPB 3HD7D 4C7NA 2PP6A 3L4FA 5AVWB 3HD7B 1HGVA 2QM8A 5APXA 1JO5A 4N6JA 3O8ZA 2VRSA 3VMZA 1G1IA 4JF7A 3A5TA 1RF1A 1NTZK 1L4AD 2P67A 5APUA 5CHXA 3R2PA 1OXZA 1JTHB 1NH4A 3P32A 1KFNA 2FFDA 3N7NA 4W7ZA 3G3ZA 1JY3P 3HE5A 3P8CE 4C7RA 3H6PA 2P7JA 4O9BA 1SFCC 5BU5A 3HE4A 3H32B 2HPCB 1RE4A 3RK2C 1RF0C 1IJDB 2WWWA 2C9NY 1IK9A 5CCGC 1FZAA 4HYTB 2Q3IA 2LKMA 1NKNA 1LTTC 1N86A 2IFNA 1KQLA 2OYIA 1GW4A 1N7SC 3BATA 1JCCA 1N7SB 1JY2O 4EIJA 3RL0D 2YKOA 3RL0B 1JNMA 1NTMK 1DH3A 2HODB 3LIEA 1SQXK 3V2PA 1LTJA 3SWFA 4EOTA 3VMXA 1M1JA 5AW5B 2WT7B 1AQ5A 1LT9C 3A2AA 4I1LA 3P8MC 3HUSB 1LT9B 3V5BA 5CJ0A 1JY2P 1NOHA 2FKWB 4WY4A 1GTWA 1J2JB 5KJ7A 2M3BA 1CZQA 5AVZB 4IFDK 1FZBA 1YYCA 1E5WA 1S9KE 2ZFCA 1ZR4A 1T2KC 3B5NC 3M9HA 3VTPC 1HGZA 3B5NB 3MIWA 2W6BA 1URQC 1KILC 2XU6A 1DX7A 1URQB 1ZV8A 1GL2C 3HD7A 4W7YA 1GL2B 2WZ7A 2KYVA 1L0LK 3N4XA 3E1IA 1XTGB 1FDMA 4GIFA 2YMYA 1RE3A 2R32A 2PAJA 2YO2A 5CMZA 1JUNA 1HVVA 1JTHA 2BASA 2JEEA 4WY4D 2YKQA 4DOJA 5KJ7D 3GHGC 1IFMA 3BASA 1GK4A 2OARA 2A45I 1SVFA 3H32A 3VMYA 2HPCA 3MUDA 2O1KA 1CSBA 1RF0A 2YO3A 3RK3D 3VN0A 4XA4A 1NWQA 4IFMA 2C0XA 3HRNA 1EQ7A 1WRGA 2E42A 3TYYA 4IFFA 4M3LA 3EQ2A 1N7SA 1FZFA 1MFZA 3P8CD 1FAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XV5 A;  1CI6 B;  1GZL A;  1GK6 A;  2IPP A;  2Z5H A;  3HE5 B;  2Q5U A;  3L35 A;  1KQL A;  1GU4 A;  4GT1 A;  2R3C A;  2WT7 A;  3HE4 B;  2WTY A;  3P7K A;  2WPS A;  5AVS B;  1A02 J;  5APT A;  2ZXE B;  1JNM A;  3MGN A;  2W27 A;  5AW8 B;  3B8E B;  1H88 A;  2WPR A;  1DH3 A;  3LIE A;  1OWA A;  5AW1 B;  5AW6 B;  1FOS E;  1IO4 A;  1FOS F;  2P2U A;  3NFQ A;  3L37 A;  3SWF A;  4EOT A;  2H7H A;  5AW3 B;  4XE5 B;  3VMX A;  5AW5 B;  2WT7 B;  3M0A A;  1SP4 A;  2XZR A;  1H8A A;  3A2A A;  3P8M C;  5APV A;  1G2C B;  3LID A;  5AVV B;  3M06 A;  5APW A;  3OAK A;  3V5B A;  2Z5I A;  4DZO A;  4I2L C;  1GU5 A;  3M0D A;  3UIA A;  5AW7 B;  1GTW A;  1J2J B;  4LC1 A;  1CZQ A;  4GKG A;  5AVZ B;  1MV8 A;  1YYC A;  5AVR B;  4KHX A;  5AW4 B;  3NXS A;  3V4W A;  5APS A;  1S9K E;  2N9B A;  3M91 A;  1HJB A;  2ZFC A;  1T2K C;  3M9H A;  3VTP C;  2R5B A;  2E43 A;  2C9L Y;  2Q7C A;  1SLQ A;  2R5D A;  3HTK A;  4AYC A;  5AW9 B;  2XU6 A;  1S9K D;  4JYC A;  2QM7 A;  4B86 A;  4RES B;  2KP8 A;  5AVQ B;  4AUW A;  3TNU A;  5AVU B;  3NMD A;  4I6M C;  3VYI A;  5AW2 B;  2R32 A;  2JJL A;  3KDP B;  5AVX B;  3IR9 A;  2YO2 A;  5CMZ A;  5APY A;  5AVY B;  1JUN A;  4C7N A;  5AVW B;  2QM8 A;  5APX A;  3MD0 A;  2BAS A;  3T97 A;  3TNU B;  5APQ A;  3A3Y B;  3M9B A;  3O8Z A;  2VRS A;  3VMZ A;  3A5T A;  1GK4 A;  1A02 F;  3NTN A;  3L36 A;  2WPQ A;  3VMY A;  1GD2 E;  1X8Y A;  2P67 A;  3KQG A;  4JYB A;  2W6A A;  5AW0 B;  1H89 A;  4C7N B;  5APU A;  1CSB A;  2YO3 A;  3VN0 A;  1HBW A;  1OXZ A;  3A7O A;  3P32 A;  1NWQ A;  1CI6 A;  3HE5 A;  2E42 A;  2P7J A;  2YNY A;  3I5C A;  3TYY A;  4M3L A;  3HE4 A;  1MUU A;  4AQR D;  1HWT C;  3TK1 A;  2WWW A;  1T2K D;  2C9N Y;  1MFZ A;  3V4Q A;  1NAF A;  5AVT B;  4C46 A;  4HYT B;  1FAV A;  2Q3I A;  1HUC A; 
#chains in the Genus database with same CATH topology
 1XTC C;  2HOD A;  3KZI H;  3G71 P;  1IFN A;  1YI2 P;  1DEE G;  1S5L X;  3TSI A;  3EFG A;  2ZJS E;  3S9O A;  2IBZ E;  3MGN A;  2W27 A;  3MTU E;  5E79 E;  2WPR A;  1SFC D;  1SQV K;  1IO4 A;  2GUS A;  1FS0 E;  3LW5 H;  5AW3 B;  3RK2 B;  5CCG D;  1LWU C;  1DD3 A;  1OX3 A;  2FY8 A;  1N73 B;  1ZRT E;  2GUV A;  3Q2Y A;  4I2L C;  1J1E C;  2QJY B;  3S1K A;  3L75 E;  2E74 C;  2K37 A;  3OA7 A;  4KHX A;  1IK7 A;  3M91 A;  2IBZ G;  2QVA A;  1KB9 H;  3E1R A;  2IYO A;  2Q3E A;  3EWK A;  2FYN C;  3KPE A;  1KYO D;  1KB9 E;  1LTI C;  3L75 G;  4PD4 H;  2A45 H;  1YBK A;  1SQP J;  2KNC A;  1S72 P;  3B5N D;  3F89 A;  3CX5 I;  1LTS C;  1KIL B;  3L36 A;  3AEC C;  3H1I E;  2K88 A;  3BCC G;  1RE4 C;  4OWF A;  3CC2 P;  3T97 B;  2DW3 A;  2H89 C;  2BCC E;  3RGU A;  4H44 B;  1SQQ G;  1KIL E;  1S4X A;  2IYP A;  3TK1 A;  3V4Q A;  3MHV A;  2XV5 A;  1CI6 B;  1FZC C;  1DEB A;  2A45 G;  1KMI Z;  2Q5U A;  2I1J A;  2ZT9 B;  1NTZ D;  1MFT A;  4BXL A;  1N73 A;  1DIP A;  1T3J A;  3H1K J;  4R4L A;  1PPJ E;  5AW6 B;  5H2F H;  3AE9 C;  1VQ4 P;  2FYU K;  4YTP C;  5C39 A;  1G2C B;  2GM4 A;  2Q9I A;  1BE3 D;  5APW A;  3OAK A;  1HTL C;  2N1T B;  5H2F E;  3CCU P;  1RY3 A;  1NTK E;  2OYH C;  5CBN A;  2FXO A;  3I55 P;  1PPJ G;  3IFM A;  1LTB C;  2WSC J;  1RE3 C;  1NTM D;  1SQB K;  3H1J J;  2M8R A;  3BRV B;  4BWN A;  2W6J H;  3JCU E;  1LWU B;  3WU2 E;  5KLV E;  3CX5 D;  4PJ0 E;  5AW2 B;  1KIL A;  1LTG C;  1NTK G;  2E74 B;  2OYO A;  3H1H J;  3L70 D;  5AVY B;  2KLV A;  3PP5 A;  3T97 A;  2L91 A;  2YKP A;  4LLH A;  3MP7 B;  5AW0 B;  1S5L E;  2WSE J;  1CI6 A;  2FBW C;  3TGU D;  1MUU A;  4YXW H;  3CMA P;  1OMI A;  2FFD C;  2XNX A;  4LGD E;  1SQP K;  1X79 B;  3L35 A;  1JMM A;  1IFD A;  3JC2 2;  2ZYG A;  1AVO A;  1G2C A;  1A02 J;  1L0L J;  4NPE A;  2N1T A;  4D6T D;  5CCH D;  5K5G B;  2LXB A;  2B87 B;  1OWA A;  4N78 E;  3BRT B;  2IDB A;  5KTB A;  1SP4 A;  1QL1 A;  3LID A;  5AVV B;  1NGM B;  2YMK A;  3A0H H;  3ZDM A;  2KXP B;  5TIS E;  1M1J B;  1LWU A;  2MKV A;  2XDJ A;  4WY4 B;  1JY3 N;  1VPC A;  4PD4 I;  1SQV D;  3AEG C;  5KLI C;  4PV1 C;  4OGQ C;  2WIT A;  4DCK A;  2IZ0 A;  3GMA A;  3HD7 D;  2W83 C;  3D71 A;  3L74 E;  2Q6Q A;  2VRS A;  3VMZ A;  1L0N J;  3R2P A;  3FXE A;  3P32 A;  3N7N A;  3AEF C;  1JY3 P;  4IOI H;  4L74 A;  2NRG A;  2YIU C;  2JWD A;  1RE4 A;  1RF0 C;  2C9N Y;  2Q3I A;  4GOD A;  3L74 G;  2B87 A;  1N86 A;  5B66 H;  1OZH A;  1BCC J;  2P58 A;  2YKO A;  2Y0E A;  2JO1 A;  1DH3 A;  3V2P A;  3LIE A;  2B9B A;  2QJK C;  5B66 E;  4CPG A;  3VMX A;  1M1J A;  2WT7 B;  4BRY B;  2OQQ A;  2KS1 B;  1Y8A A;  2M0B A;  3P8M C;  1S1C X;  1M57 D;  4WY4 A;  3CWB G;  1FZB A;  2Y0D A;  1TU3 F;  3H1L D;  3VTP C;  1HGZ A;  3B5N B;  3MIW A;  1EZV G;  1KYO E;  4UB8 H;  2XU6 A;  1VF5 C;  1DX7 A;  3K5B A;  3L72 D;  2KYV A;  1K04 A;  1L0L K;  3E1I A;  1JMB A;  2YMY A;  3FWL A;  1RE3 A;  4UB8 E;  2AXT E;  1USE A;  2A06 E;  2OAR A;  1AQT A;  5KLI B;  3VN0 A;  3RK3 D;  3PRJ A;  4XA4 A;  4IFM A;  4OGQ B;  2GA1 A;  2UWJ E;  2E42 A;  3CC7 P;  1AJY A;  3TYY A;  3EQ2 A;  1YQ4 C;  4H13 D;  5EFW B;  1FZF A;  1NTZ E;  1PZQ A;  1FZG A;  2A06 G;  3W67 A;  4WVZ A;  3V2N A;  2R3C A;  2WT7 A;  4BRY A;  2KS1 A;  1PP9 G;  2CPS A;  2POH A;  2ZXE B;  1L0N K;  3PTZ A;  1JY2 N;  1BE3 E;  2YIU B;  2P2U A;  2O01 N;  1H8A A;  3S4R A;  1N73 C;  2BEQ D;  1X0T A;  2PRR A;  3B5N A;  1H0T B;  1N7S D;  3Q5R A;  1SQP D;  1UII A;  1FDI A;  2C9L Y;  3LW5 J;  1KFM A;  1M1K Q;  4ZMD A;  3II6 A;  2QM7 A;  2V7Q H;  4Y99 B;  5AVQ B;  1ZLL A;  1Q2N A;  5GTH H;  4Y28 J;  3D6Y A;  1FZE A;  1KQF B;  5GTI H;  3BCC J;  3MD0 A;  3M9B A;  1Q7Y Q;  3L73 G;  3NTN A;  1SQQ J;  3TGU E;  1NU1 G;  4JYB A;  2W6A A;  5KAI H;  3H1K D;  1BSN A;  5CJ4 A;  1ZN5 A;  4C46 A;  3TDK A;  1GK6 A;  2LR2 A;  2ZT9 C;  3TGU G;  3L72 J;  1LTJ C;  1LP1 B;  1BGY E;  2C0W A;  3CLQ A;  1YQ3 C;  1BDD A;  1ZME C;  1H0T A;  5AW8 B;  1RQV A;  2K9J B;  3QWO C;  1FOS F;  3H1J D;  2ITA A;  3BVH A;  2H7H A;  1IFJ A;  2J58 A;  2N1T C;  3RK3 C;  5E79 H;  3UIA A;  1BGY G;  3H1H D;  2I1K A;  3PH0 A;  2Y0C A;  2MJZ A;  1SQV E;  1KTM A;  1VQ9 P;  3FX0 A;  2Q7C A;  3GLM A;  1NTK J;  1X22 A;  3V6I A;  3B71 A;  1QVF O;  3CXH I;  1KC8 Q;  4W80 A;  3CC4 P;  1R8E A;  2H8P D;  3IR9 A;  5APY A;  3O6Q B;  1SQX E;  3MUD C;  3TNU B;  2QIW A;  1ZR2 A;  5DJU B;  4EYY Q;  1VQP P;  5CCH A;  1A02 F;  4I7Z B;  3CCJ P;  2V4H A;  2P1J A;  1HBW A;  3A7O A;  2IX7 C;  3G4S P;  1L0L D;  1HJ0 A;  3AE7 C;  1VQO P;  1LP1 A;  1GDT A;  1SQX G;  4AQR D;  3HUS C;  2K9J A;  3Q5S A;  1OVU A;  1VQN P;  4U7J A;  1SQQ K;  4UB6 E;  1P84 I;  1FDO A;  3L71 E;  1LGH B;  1QEX A;  4NPF X;  3M0D A;  3H1I G;  3H1L E;  1LTJ B;  1FC2 C;  1M1J C;  3CXH D;  1QLE D;  2BCC G;  2FYU E;  2R5B A;  4WY4 C;  1SLQ A;  1L0N D;  3O6Q A;  3VP8 A;  2NPS D;  3L71 G;  2KP8 A;  4AUW A;  3TNU A;  1FBM A;  4KJM A;  3RK3 B;  4XFJ A;  2PP6 A;  3L4F A;  5AVW B;  3JCU H;  2FYU G;  3WU2 H;  1SQB E;  4PJ0 H;  3RK3 E;  3AEB C;  4JF7 A;  4WWI A;  2KLU A;  1L4A D;  2P67 A;  5APU A;  2JR8 A;  1OXZ A;  1BCC D;  1NH4 A;  1KFN A;  3E7K A;  4DJG A;  2JP3 A;  3H6P A;  2OTJ P;  1SFC C;  5BU5 A;  1S5L H;  4IL6 X;  2HPC B;  1SQB G;  5CCG C;  1FZA A;  4Z1M H;  1YJW P;  1OVV A;  3SFE C;  4RKU J;  1P84 D;  1N7S B;  5KLV G;  1OFC X;  5KKZ C;  3RL0 D;  2IBZ I;  2KSE A;  1LTJ A;  3CWB J;  1OW7 A;  3SWF A;  5AW5 B;  1PGP A;  3A2A A;  1SQP E;  2WSS H;  3HUS B;  1LT9 B;  5TJH A;  5CJ0 A;  2FKW B;  2M3B A;  1CZQ A;  5AVZ B;  2Y9Y A;  2XND H;  1E5W A;  2WSF J;  1HF9 A;  2O01 J;  1Q82 Q;  3B5N C;  1SS1 A;  5TIS H;  3CCM P;  3CCE P;  2ZVN B;  4QMA A;  4U3F J;  1KB9 I;  1VQK P;  2R32 A;  3AEA C;  2AEJ A;  1HVV A;  1S2E A;  4JPZ B;  3CCV P;  2YKQ A;  2WQY C;  5KJ7 D;  3USS A;  1OW6 A;  3GHG C;  1IFM A;  2PFX A;  3BAS A;  1GK4 A;  4GOE A;  2A45 I;  4KT0 J;  4TLF A;  3H1K E;  1SVF A;  2HPC A;  3MUD A;  2O1K A;  1CSB A;  1T6A A;  2C0X A;  1RH5 B;  4IFF A;  1N7S A;  1PP9 J;  2IBZ D;  4N6J A;  5B5E E;  1VQ6 P;  1BSH A;  4TT3 H;  3U1C A;  3P7K A;  3HUS A;  2J5U A;  1LT9 A;  3RL0 g;  1ZRT D;  2KB7 P;  2WPS A;  1N8R Q;  3L75 D;  5AW1 B;  1FOS E;  1SFC B;  3U1A A;  3L37 A;  4XE5 B;  1IC2 A;  4N3Y B;  3H1H E;  3M06 A;  2WMM A;  2Z5I A;  1M90 Q;  3IAO A;  5AVR B;  2WSF H;  5AW4 B;  3BCC D;  5APS A;  5KKZ B;  2N9B A;  4H0L D;  1KB9 D;  2O01 H;  1NKZ B;  3SWY A;  1SQQ D;  5M1B A;  4AYC A;  2H43 A;  4Y99 C;  1QL2 A;  1PGQ A;  3H1H G;  2E75 D;  3EFF K;  1EDK A;  4PD4 D;  1KYO H;  5AVX B;  3L73 J;  1NU1 J;  1YTZ I;  2QA4 P;  4IL6 E;  2JWA A;  1QVG O;  3A3Y B;  2N9Y B;  1BDC A;  1URQ D;  1OVR A;  2V7Q J;  1L0L E;  1GL2 D;  3KQG A;  1H89 A;  3G6E P;  2AXT H;  1PIX A;  5CCH C;  4OH8 B;  2OYI C;  1U7M A;  1LJ2 A;  5AVT B;  1Y9B A;  1PPJ D;  1GZL A;  4ZKP A;  2IPP A;  3GHG B;  1SFC A;  2L5G B;  5CCG A;  1ZOY C;  4WBA A;  1H88 A;  3ITK A;  1BGY J;  1OIP A;  1NTK D;  1QGK B;  2E5Y A;  4L75 A;  5BVZ A;  3IN6 A;  2K1A A;  3CL3 D;  2NPS B;  2YXR B;  3CXH E;  1GU5 A;  1G1J A;  2ZYA A;  3CCS P;  3PHL A;  3HD7 C;  1HJB A;  1L2P A;  1JY3 O;  3WMM 0;  2XKM A;  3M0D C;  1K8A Q;  3G9R A;  2RKL A;  3W68 A;  1NTZ G;  1L4A B;  1S3J A;  5AVU B;  3VYI A;  2M5A B;  3CX5 H;  3HTK B;  1JM0 A;  1NTM E;  1PL5 A;  1LNQ A;  3A0B E;  1CW5 A;  5APQ A;  3L75 J;  1BE3 G;  5DJT B;  1BCC E;  4I7Z C;  1FJP A;  3AE1 C;  3CX5 E;  3H25 A;  3FGA D;  2ZYD A;  1GD2 E;  1SQX J;  1X8Y A;  3AED C;  2E76 D;  4C7N B;  3SSU A;  3L70 E;  2HLO A;  3AE5 C;  2CK3 H;  3GHG A;  4H0L C;  1RF1 B;  1NTM G;  1ZXG A;  2YNY A;  3I5C A;  3RBX A;  1YJ9 P;  4K35 A;  1P84 E;  3VMA A;  1T2K D;  4N78 D;  1LTA C;  3HE5 B;  1NU1 K;  1LT1 A;  4GT1 A;  3TF5 A;  3GF3 A;  3L70 G;  1E79 H;  1YIT P;  2NPS A;  2JDI H;  3Q5P A;  4YPC A;  1KQG B;  3H1I J;  1EZV I;  2R44 A;  2OYI B;  2XZR A;  2BCC J;  4HH2 A;  1QX8 A;  4HB1 A;  4D6T E;  3C9I A;  3L71 J;  1L4A A;  1YTZ T;  1NHL A;  3V4W A;  3WUT A;  2M5A A;  3U59 A;  1EDL A;  2R5D A;  3HTK A;  3D6Z A;  1EXI A;  1USD A;  3C8V A;  4B86 A;  1U7J A;  1JEK A;  1X9V A;  2FYU J;  1AA0 A;  3Q3D A;  1U57 A;  2Z4E A;  3L74 D;  4D6T G;  2JJL A;  1JCD A;  3KDP B;  3FXD A;  3PLN A;  4C7N A;  5KAF E;  3HD7 B;  5APX A;  4H13 C;  3AE6 C;  2KI7 B;  2ZXX A;  3O8Z A;  3A5T A;  1G1I A;  1RF1 A;  4YXD C;  5CHX A;  1SQB J;  3PJS K;  1KOR A;  4W7Z A;  3HE5 A;  4C7R A;  3KZI E;  3CWB D;  1SQV G;  4EI2 A;  3RBZ A;  5KLV J;  2WWW A;  3FWN A;  4HYT B;  3SWK A;  2LKM A;  1VQM P;  1NKN A;  2IFN A;  1EZV D;  3MZW B;  1KQL A;  2OYI A;  1EC5 A;  1N7S C;  1JY2 O;  4EIJ A;  1WMK A;  1JNM A;  4H0L B;  1SQX K;  1PGO A;  4EOT A;  3JSV C;  3AE8 C;  4U3F D;  1LT9 C;  1DD4 A;  4I1L A;  2E76 C;  1FE6 A;  2E75 B;  3BCC E;  3V5B A;  4UB6 H;  1NOH A;  1JB0 J;  2B89 A;  5KJ7 A;  4JQ0 D;  2KK7 A;  1SQQ E;  3I56 P;  2K9Y A;  1ZR4 A;  1T2K C;  2QE7 H;  2W6B A;  3WUU A;  1URQ B;  4PD4 E;  1PGJ A;  3HD7 A;  3Q1M A;  1GL2 B;  2IZ1 A;  1NJI Q;  1XTG B;  1FDM A;  4GIF A;  2QJP C;  2G3A A;  2A06 D;  1VQ8 P;  2PAJ A;  5CMZ A;  3L72 E;  1PP9 D;  1KD1 Q;  2LXC B;  3GW6 A;  4DOJ A;  1W5C E;  4PV1 D;  2YO3 A;  5L8R J;  4DT0 A;  1Y47 A;  1NWQ A;  4OGQ D;  3H1L G;  1M56 D;  2QRX A;  3L72 G;  4H13 B;  3P8C D;  1FAV A;  2RN0 A;  3KYQ A;  1M7L A;  1GU4 A;  3VP9 A;  1NO4 A;  3L74 J;  2W90 A;  2KUB A;  1NTK K;  1KZU B;  3VOP A;  1VQL P;  4R4M A;  3M0A A;  3GF7 A;  3QH9 A;  3L73 D;  1J1E B;  4LC1 A;  4GOF A;  1URQ A;  2OTL P;  1NU1 D;  5KLV K;  2RMZ A;  1GL2 A;  2HFE D;  3NXS A;  4GDO A;  1T8Z A;  2E43 A;  1W2E A;  2QSI A;  2O1J A;  5AW9 B;  1S9K D;  1K73 Q;  4JYC A;  1MKM A;  2ZVO B;  4RES B;  2D2C D;  3M9Q A;  2E76 B;  2FYN B;  2KSJ A;  3NMD A;  1RHZ B;  2J59 M;  2BEZ F;  1Q90 D;  4OVN F;  2FXM A;  1GMJ A;  4EDF A;  1VF5 D;  1IZN B;  2KIK A;  3CME P;  1W2B O;  1N7L A;  2OTK E;  1SQP G;  3R4Y A;  1J1D C;  1KQS O;  1Q86 Q;  2QJP B;  1T3U A;  3WUV A;  1BGY D;  1YIJ P;  1NVO A;  4ZNC A;  1NAF A;  1KN7 A;  1HUC A;  1FZC B;  1JOC A;  1Q81 Q;  1Z56 A;  2WTY A;  2AEM A;  2KZI A;  1N2D C;  5B5E H;  5AVS B;  2PGD A;  5BU8 B;  4K3A A;  3CCR P;  3B8E B;  3A0H E;  2WSC H;  1AVY A;  1FU1 A;  3NFQ A;  2NPS C;  1FJK A;  2SPZ A;  5APV A;  3H1K G;  4DZO A;  5AW7 B;  3H1J E;  3GG2 A;  2OGU A;  1NTZ J;  2OYH B;  2CPB A;  2O3J A;  4ASV A;  3CI9 A;  1YHQ P;  1GW3 A;  3RK2 D;  1SQX D;  4HJG H;  1L4A C;  1NAY A;  2HYN A;  3B4S A;  1BE3 J;  2G8Y A;  2WSE H;  3CCL P;  2NZ2 A;  1M8O B;  2HG5 D;  3H1J G;  1MZ9 A;  4ZKU A;  2AEF A;  3CD6 P;  1NTM J;  2WPQ A;  1UIX A;  4A7P A;  4IL6 H;  5CBO A;  3CWB E;  1VQ5 P;  2P10 A;  3RL0 C;  1FZC A;  1RF1 C;  3H1I D;  1IFI A;  3L70 J;  1EZV E;  1HWT C;  2BCC D;  1WT6 A;  2FYZ A;  2D2C C;  1NYH A;  1EDJ A;  2FFD B;  1KIL D;  1ZW0 A;  3OJA B;  2Z5H A;  3OW2 O;  4MN4 C;  3L71 D;  3HE4 B;  3SFD C;  1J1D B;  2KOG A;  2I8D A;  4WB4 A;  5APT A;  4H44 D;  4U3F E;  3TGU J;  3V2R A;  2R3S A;  4ASW A;  4NPD A;  2IFM A;  2OYH A;  2FYU D;  1K9M Q;  1HH0 A;  1EDI A;  1L0L G;  2ZT9 D;  4GKG A;  1KV4 A;  1MV8 A;  1R5S A;  1VDF A;  2RH0 A;  4U3F G;  3CXH H;  4D6T J;  2JKV A;  1EXJ A;  5KJ7 C;  1AFO A;  1SQB D;  1PFI A;  3V2Q A;  2N1T D;  4PV1 B;  4I6M C;  1PP9 E;  3F5H A;  1L0N E;  1HGV A;  2QM8 A;  5KLV D;  1JO5 A;  3AEE C;  1NTZ K;  1AV1 A;  1SQV J;  1JTH B;  3A0B H;  2QG4 A;  1D7M A;  1VL2 A;  2FFD A;  3G3Z A;  3P8C E;  2Y9Z A;  2E74 D;  2P7J A;  4O9B A;  3AE3 C;  3AE2 C;  1L0N G;  2ZAE B;  3HE4 A;  3H32 B;  2WVR A;  3RK2 C;  1IJD B;  4RO0 A;  1IK9 A;  3ABV C;  1VQ7 P;  1IFP A;  2YXQ B;  1LTT C;  2QJY C;  1GW4 A;  3BAT A;  1P84 H;  1JCC A;  3RL0 B;  1NTM K;  3CCQ P;  2HOD B;  3CPW O;  4HKZ H;  4L76 A;  2H88 C;  2Q1K A;  2QJK B;  3L73 E;  4L73 A;  1AQ5 A;  1NU1 E;  1BCC G;  2D2C B;  2E75 C;  1JY2 P;  1GTW A;  4RJT A;  1J2J B;  4IFD K;  1YYC A;  2M3E A;  1PV3 A;  1S9K E;  2ZFC A;  5GTH E;  3M9H A;  3IF4 A;  3D70 A;  2AXC A;  1URQ C;  1KIL C;  2FXP A;  1K05 A;  4JBZ A;  1ZV8 A;  1VF5 B;  1GL2 C;  2QEX P;  4W7Y A;  2WZ7 A;  5GTI E;  3N4X A;  2KZJ A;  1ZP0 C;  2WPV B;  3KHU A;  2HR3 A;  2K3R A;  3C1L A;  3AE4 C;  4H44 C;  2YO2 A;  1JUN A;  1JTH A;  2BAS A;  2W8Z A;  1OW8 A;  2JEE A;  3H1L J;  1KYO I;  4WY4 D;  5KAI E;  3H32 A;  3VMY A;  5KAF H;  1RF0 A;  1YJN P;  1R5L A;  1RQU A;  2KNC B;  3HRN A;  1EQ7 A;  1WRG A;  2E5T A;  3KXD A;  4M3L A;  2B88 A;  1MFZ A; 
#chains in the Genus database with same CATH homology
 1FZG A;  1XTC C;  3KYQ A;  2HOD A;  1M7L A;  1IFN A;  1GU4 A;  3VP9 A;  1NO4 A;  3V2N A;  2R3C A;  2WT7 A;  3U1C A;  3TSI A;  3P7K A;  3EFG A;  2CPS A;  3HUS A;  1LT9 A;  2WPS A;  2KB7 P;  2POH A;  2ZXE B;  1NTK K;  3MGN A;  2W27 A;  3MTU E;  1L0N K;  1KZU B;  2WPR A;  1JY2 N;  1SFC D;  5AW1 B;  1SQV K;  1FOS E;  1IO4 A;  1SFC B;  2GUS A;  3U1A A;  3VOP A;  2P2U A;  3L37 A;  3LW5 H;  4XE5 B;  5AW3 B;  1IC2 A;  3RK2 B;  3M0A A;  5CCG D;  4N3Y B;  1H8A A;  1N73 C;  1LWU C;  1N73 B;  3M06 A;  3B5N A;  2GUV A;  2Z5I A;  4I2L C;  1J1E C;  1J1E B;  4LC1 A;  1URQ A;  1N7S D;  5KLV K;  3OA7 A;  1GL2 A;  5AVR B;  4KHX A;  2WSF H;  2HFE D;  3NXS A;  5AW4 B;  5APS A;  2N9B A;  3M91 A;  2O01 H;  1T8Z A;  2E43 A;  2C9L Y;  1NKZ B;  1W2E A;  3SWY A;  2O1J A;  1KFM A;  4AYC A;  5AW9 B;  1S9K D;  2H43 A;  4Y99 C;  4JYC A;  1QL2 A;  2QM7 A;  3II6 A;  4Y99 B;  4RES B;  5AVQ B;  1ZLL A;  3M9Q A;  3KPE A;  2KSJ A;  3NMD A;  1LTI C;  1FZE A;  5AVX B;  2A45 H;  1YTZ I;  2J59 M;  3MD0 A;  3B5N D;  3A3Y B;  2FXM A;  3M9B A;  1URQ D;  1LTS C;  1KIL B;  3NTN A;  3L36 A;  1GL2 D;  3KQG A;  1N7L A;  4JYB A;  2W6A A;  1H89 A;  1J1D C;  1RE4 C;  1T3U A;  5CCH C;  4OH8 B;  5CJ4 A;  2OYI C;  3TK1 A;  1ZN5 A;  3V4Q A;  1NAF A;  5AVT B;  4C46 A;  1HUC A;  2XV5 A;  1CI6 B;  1GZL A;  4ZKP A;  1DEB A;  1GK6 A;  2IPP A;  3GHG B;  1FZC C;  2A45 G;  1FZC B;  1JOC A;  1SFC A;  2Q5U A;  2I1J A;  1Z56 A;  1LTJ C;  2C0W A;  2WTY A;  2L5G B;  3CLQ A;  5CCG A;  1N2D C;  5AVS B;  1N73 A;  5BU8 B;  4WBA A;  1T3J A;  5AW8 B;  3B8E B;  1H88 A;  5AW6 B;  1FOS F;  2FYU K;  2WSC H;  1FU1 A;  3NFQ A;  3BVH A;  2H7H A;  1IFJ A;  2NPS C;  5BVZ A;  3CL3 D;  1FJK A;  2J58 A;  2NPS B;  5APV A;  1G2C B;  2GM4 A;  2Q9I A;  2N1T C;  5APW A;  3OAK A;  3RK3 C;  1HTL C;  2N1T B;  4DZO A;  1GU5 A;  3UIA A;  5AW7 B;  1G1J A;  2I1K A;  1RY3 A;  3HD7 C;  2MJZ A;  2OYH C;  1HJB A;  1JY3 O;  3WMM 0;  2OYH B;  2CPB A;  3IFM A;  1LTB C;  2XKM A;  3M0D C;  2Q7C A;  3CI9 A;  1RE3 C;  1GW3 A;  1SQB K;  3RK2 D;  2M8R A;  3BRV B;  1L4A C;  1L4A B;  2HYN A;  1LWU B;  5AVU B;  3VYI A;  2WSE H;  5AW2 B;  4W80 A;  1KIL A;  2H8P D;  3IR9 A;  3HTK B;  1LTG C;  2HG5 D;  5APY A;  5AVY B;  1MZ9 A;  2KLV A;  3PP5 A;  3T97 A;  4ZKU A;  3TNU B;  1ZR2 A;  1CW5 A;  5APQ A;  2YKP A;  1FJP A;  5CCH A;  1A02 F;  4LLH A;  2WPQ A;  1GD2 E;  2P1J A;  1X8Y A;  5AW0 B;  4C7N B;  1HBW A;  2HLO A;  3A7O A;  2IX7 C;  1CI6 A;  3RL0 C;  3GHG A;  1FZC A;  1RF1 C;  1RF1 B;  1IFI A;  2YNY A;  3I5C A;  1GDT A;  1MUU A;  4AQR D;  1HWT C;  1T2K D;  1WT6 A;  2FYZ A;  2FFD C;  3HUS C;  2FFD B;  1KIL D;  4N78 D;  1LTA C;  2XNX A;  3OJA B;  2Z5H A;  3HE5 B;  1NU1 K;  4LGD E;  1SQP K;  1X79 B;  3L35 A;  4GT1 A;  1JMM A;  1IFD A;  3HE4 B;  1J1D B;  2NPS A;  1G2C A;  2KOG A;  4WB4 A;  1A02 J;  5APT A;  2N1T A;  1SQQ K;  5CCH D;  1OWA A;  3V2R A;  4N78 E;  2OYI B;  3BRT B;  5KTB A;  1SP4 A;  2IFM A;  2XZR A;  2OYH A;  4HH2 A;  1QL1 A;  1HH0 A;  3LID A;  5AVV B;  1LGH B;  3M0D A;  3C9I A;  4GKG A;  1LTJ B;  1MV8 A;  1VDF A;  1M1J C;  1L4A A;  1YTZ T;  1M1J B;  1NHL A;  3V4W A;  1LWU A;  3U59 A;  2R5B A;  4WY4 C;  2XDJ A;  1SLQ A;  2R5D A;  5KJ7 C;  4WY4 B;  3HTK A;  1JY3 N;  1VPC A;  3VP8 A;  2NPS D;  4B86 A;  1AFO A;  2KP8 A;  1X9V A;  4AUW A;  1PFI A;  3V2Q A;  3TNU A;  2N1T D;  1FBM A;  3RK3 B;  4I6M C;  2Z4E A;  2WIT A;  2JJL A;  1JCD A;  3KDP B;  3HD7 D;  4C7N A;  2PP6 A;  3L4F A;  5AVW B;  3HD7 B;  1HGV A;  2QM8 A;  5APX A;  1JO5 A;  4N6J A;  3O8Z A;  2VRS A;  3VMZ A;  1G1I A;  4JF7 A;  3A5T A;  1RF1 A;  1NTZ K;  1L4A D;  2P67 A;  5APU A;  5CHX A;  3R2P A;  1OXZ A;  1JTH B;  1NH4 A;  3P32 A;  1KFN A;  2FFD A;  3N7N A;  4W7Z A;  3G3Z A;  1JY3 P;  3HE5 A;  3P8C E;  4C7R A;  3H6P A;  2P7J A;  4O9B A;  1SFC C;  5BU5 A;  3HE4 A;  3H32 B;  2HPC B;  1RE4 A;  3RK2 C;  1RF0 C;  1IJD B;  2WWW A;  2C9N Y;  1IK9 A;  5CCG C;  1FZA A;  4HYT B;  2Q3I A;  2LKM A;  1NKN A;  1LTT C;  1N86 A;  2IFN A;  1KQL A;  2OYI A;  1GW4 A;  1N7S C;  3BAT A;  1JCC A;  1N7S B;  1JY2 O;  4EIJ A;  3RL0 D;  2YKO A;  3RL0 B;  1JNM A;  1NTM K;  1DH3 A;  2HOD B;  3LIE A;  1SQX K;  3V2P A;  1LTJ A;  3SWF A;  4EOT A;  3VMX A;  1M1J A;  5AW5 B;  2WT7 B;  1AQ5 A;  1LT9 C;  3A2A A;  4I1L A;  3P8M C;  3HUS B;  1LT9 B;  3V5B A;  5CJ0 A;  1JY2 P;  1NOH A;  2FKW B;  4WY4 A;  1GTW A;  1J2J B;  5KJ7 A;  2M3B A;  1CZQ A;  5AVZ B;  4IFD K;  1FZB A;  1YYC A;  1E5W A;  1S9K E;  2ZFC A;  1ZR4 A;  1T2K C;  3B5N C;  3M9H A;  3VTP C;  1HGZ A;  3B5N B;  3MIW A;  2W6B A;  1URQ C;  1KIL C;  2XU6 A;  1DX7 A;  1URQ B;  1ZV8 A;  1GL2 C;  3HD7 A;  4W7Y A;  1GL2 B;  2WZ7 A;  2KYV A;  1L0L K;  3N4X A;  3E1I A;  1XTG B;  1FDM A;  4GIF A;  2YMY A;  1RE3 A;  2R32 A;  2PAJ A;  2YO2 A;  5CMZ A;  1JUN A;  1HVV A;  1JTH A;  2BAS A;  2JEE A;  4WY4 D;  2YKQ A;  4DOJ A;  5KJ7 D;  3GHG C;  1IFM A;  3BAS A;  1GK4 A;  2OAR A;  2A45 I;  1SVF A;  3H32 A;  3VMY A;  2HPC A;  3MUD A;  2O1K A;  1CSB A;  1RF0 A;  2YO3 A;  3RK3 D;  3VN0 A;  4XA4 A;  1NWQ A;  4IFM A;  2C0X A;  3HRN A;  1EQ7 A;  1WRG A;  2E42 A;  3TYY A;  4IFF A;  4M3L A;  3EQ2 A;  1N7S A;  1FZF A;  1MFZ A;  3P8C D;  1FAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...