4ZMDA

C domain of staphylococcal protein a mutant - q9w
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
56
structure length
56
Chain Sequence
b'NKFNKEWQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein A
publication title Suppression of conformational heterogeneity at a protein-protein interface.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 22
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4zmdA00
1JM0A 2KZJA 2I8DA 1LP1A 4IOIH 2KUBA 2ZAEB 1EDLA 1S3JA 4KJMA 2WMMA 4NPDA 3FXEA 1U7JA 1OVRA 1BDDA 2K3RA 1NVOA 1ZW0A 2P58A 2UWJE 1EC5A 2RKLA 1DEEG 1X0TA 1LT1A 4HB1A 1EDIA 5C39A 2B87B 2SPZA 2KIKA 4K3AA 4NPFX 3MZWB 2JWDA 5DJTB 1H0TA 4K35A 4ZNCA 2LXCB 1LP1B 4BXLA 4GODA 1EDJA 3ZDMA 2B89A 4CPGA 2HR3A 1H0TB 1OVUA 2QVAA 4GOEA 2M5AA 4WWIA 2Q1KA 4ASVA 1Y47A 1JMBA 5CBNA 4GOFA 3FXDA 3RGUA 3MHVA 2OTKE 4JBZA 4MN4C 2M5AB 2LXBA 2B88A 1Q2NA 1OVVA 1ZXGA 1BDCA 4EYYQ 4ASWA 2M0BA 4HJGH 2R44A 1EDKA 2LR2A 4NPEA 5DJUB 3S1KA 4HKZH 5K5GB 1SS1A 2QRXA 4ZMDA 1U7MA 2KZIA 3QWOC 1FC2C 5EFWB 3PH0A 2B87A 2KI7B 5CBOA 1MFTA 2KS1B
chains in the Genus database with same CATH superfamily
4I7ZB 5KAFE 1P84E 2KP8A 1NYHA 2GM4A 1XTCC 2R3SA 1S5LH 4M3LA 1QL1A 1HJ0A 1FZCA 1KYOE 1OIPA 2K37A 2L5GB 1ZOYC 4PD4D 4Y99B 5DJTB 1NKNA 3L71D 2JEEA 3IF4A 3HD7D 3HD7A 3SWKA 2WSCJ 3A5TA 3ITKA 3VN0A 1UIXA 2JJLA 1M56D 1NTMJ 3F89A 3FXDA 2P1JA 5AW3B 3H1IE 5E79H 2WSCH 1M1KQ 1JY3P 2NPSB 2E76B 1S9KD 2P7JA 3OJAB 1JCDA 1NH4A 3H1LG 2FKWB 1RE3A 3WMM0 1LWUB 2A06G 3H1JE 4TT3H 5KKZC 2G8YA 1SFCD 2A45I 1DD3A 3C8VA 3CCSP 2YIUC 1CW5A 3CI9A 3CCVP 1WT6A 1T3UA 2E5YA 4IFMA 5K5GB 1GMJA 1LTJB 5AVQB 2A45H 2YKPA 2WPSA 1UIIA 1SQBJ 2KZJA 1IFNA 1SQPJ 3GF3A 3H1LD 3VOPA 1VQPP 3LW5J 1OZHA 2A06D 2C0XA 2L91A 4U3FG 3U1CA 1YQ4C 3AE5C 5AW1B 2XNDH 3MGNA 2NPSA 3FWNA 1T8ZA 3EFGA 3LW5H 1N86A 2O01N 1PGJA 1GW3A 2W27A 1LWUA 2J5UA 2LKMA 4K35A 4N6JA 1FDMA 2LXCB 1NTKE 1D7MA 1IFMA 3L70G 1HBWA 1H0TB 1CSBA 1NTZE 2Q1KA 4JPZB 5AVXB 1IZNB 1LTJA 3AE1C 3L73G 1NTKK 4U3FD 2QA4P 1FZBA 1OVVA 4EYYQ 2FYUG 1LT9C 1OX3A 3V2NA 1P84I 2E74B 2BCCE 1VQ6P 3L70D 2OYOA 2BEZF 2QSIA 5BVZA 1KYOI 5KAFH 1P84H 1KFMA 3QH9A 1JM0A 2AXCA 1GU4A 1EDLA 1L0NK 1FE6A 4L75A 2KOGA 3R4YA 2FYUD 1KYOH 3NXSA 1N73C 3N4XA 1RF0A 1YYCA 1NTMG 2RKLA 2IFMA 2WQYC 3H1IJ 1J2JB 2R32A 4WY4C 2JO1A 1W2EA 4UB8E 1LJ2A 4GODA 5AW6B 3CMAP 1FOSE 3MUDC 1KTMA 2ZJSE 3RK2D 2A45G 1OVUA 3H1JJ 1LTIC 4UB6H 2JDIH 3UIAA 1PPJE 1Q90D 1KORA 3O8ZA 4H44D 3C9IA 5APYA 1NTMD 1AVYA 1SQBG 3RK2C 2H88C 4BRYA 5AVWB 3Q3DA 2FYNB 2M0BA 1SQPG 1VQ7P 3AE4C 1EXJA 3AE6C 1GU5A 4PV1D 2I1KA 3JC22 4QMAA 2QG4A 2YKOA 2B9BA 3PLNA 1JY2N 1QVFO 1M7LA 3H1HE 1GZLA 1VF5D 2ZT9D 1SQBD 1NVOA 1NTKJ 2IZ0A 5TISE 5GTIE 1RF1B 4IFFA 1SQPD 4KHXA 3M06A 1YQ3C 1NTZJ 3M9QA 1A02J 1Q7YQ 3VTPC 2ITAA 3AEDC 2M3EA 5KLIC 3Q5SA 1S4XA 1ZP0C 2WSSH 2ZT9C 1PGQA 2O1JA 5B66E 1Z56A 5AVTB 4I1LA 5CBNA 2YKQA 3RK3C 3MP7B 2WPQA 5AVYB 3L74E 4C7NA 1NAFA 2Z5HA 2B88A 1EXIA 2HPCB 4JQ0D 2BCCJ 3ABVC 5KAIE 2K88A 3B5ND 1SQVE 1JCCA 2QJKB 1BCCJ 2R44A 5AW5B 3S1KA 1RF1A 4HKZH 5CJ4A 5CMZA 4ZMDA 3P8CD 1U7MA 4EI2A 1SQVK 2KZIA 1LTSC 2YMKA 2FYZA 3B5NC 1BSHA 3IFMA 2OTLP 1P84D 2Z5IA 1BGYJ 1M1JA 3AEFC 1GTWA 1JY2O 5APWA 1SQXE 3LIEA 2E42A 1KYOD 3H1JG 3CCRP 1ZW0A 5KJ7C 5AW9B 4HB1A 1URQD 3IR9A 1JO5A 5CCHA 2QJPB 2HPCA 2Q5UA 4UB8H 2B87B 3N7NA 3MZWB 1VQ8P 1KC8Q 1RHZB 2RMZA 2IYPA 4YPCA 5KLVE 1IO4A 3KPEA 3H1ID 2E75B 1URQC 1AQTA 3VP8A 4GOFA 1KQSO 4MN4C 3GG2A 3JCUE 5KLVK 3H1JD 2FFDB 4H0LD 3M9BA 1NHLA 3M0DC 1SQBK 2K9JB 1GL2B 3CMEP 3HUSC 1JY3N 3TNUB 4NPEA 1G1JA 1FS0E 3RL0D 1ZV8A 1NTKG 2QRXA 5AVVB 3H1HJ 3QWOC 1ZLLA 3D70A 4WBAA 5APXA 1FC2C 1KQGB 2B87A 1HGZA 3A0HH 4D6TE 1PP9E 1HUCA 4H13D 1N7SB 2JKVA 2YXRB 3CCUP 5CCGD 1G2CB 3PJSK 3RL0C 5APUA 5TISH 4C7RA 1LTGC 4WB4A 5BU5A 1PIXA 2DW3A 3H1KE 1ZRTD 4GIFA 1DIPA 2FFDA 1OW8A 4LC1A 5KKZB 5CCGC 1NTKD 3M9HA 5B66H 3L74J 2BCCG 1VQ5P 1L0NG 2K9JA 1NTZD 1GL2A 3RBZA 4OGQB 1SQQE 3TNUA 1KQFB 1BCCG 3A0BE 1Y9BA 1SQVJ 3A7OA 3CXHE 1EZVE 1Y47A 1JUNA 2QM8A 3SFEC 1U57A 5KAIH 1H8AA 1SQQK 3GHGB 1OFCX 2K1AA 3KZIE 1N7SA 2C0WA 1ZXGA 1BGYG 2AEMA 1GD2E 3PTZA 1FZCC 2OQQA 2IZ1A 4L76A 2BCCD 3CX5E 1L0ND 1VDFA 4BWNA 1JY3O 1JNMA 1BCCD 1SQXJ 3HD7C 1FZAA 3CCJP 3M0AA 3CPWO 1FAVA 2PP6A 1PPJG 2KUBA 5CJ0A 2R5BA 4B86A 2WMMA 5AW2B 1BDDA 1YJ9P 4DOJA 1BGYD 1RE3C 1JTHB 2FBWC 5KLVJ 3CLQA 3V2QA 4I7ZC 1SFCC 3GHGA 2W90A 3CL3D 2FY8A 3IAOA 1PGPA 1LTAC 1DD4A 5AW7B 4ZKPA 2B89A 1K04A 1T3JA 4Y99C 1CI6B 1PPJD 3HRNA 2NPSD 2Q3EA 3JCUH 2E76D 1JMBA 1K73Q 3CC2P 1E79H 2M5AB 3H1HG 2HODB 2Q3IA 2LXBA 2IBZE 3WU2E 5AW4B 3VP9A 1Q86Q 4JF7A 4JYCA 3Q5RA 1BDCA 3BASA 2NZ2A 3D71A 3H25A 2NPSC 2XZRA 1DX7A 4D6TJ 1PP9J 4XFJA 3VMXA 5GTHE 2POHA 3L72E 1JTHA 1LWUC 2QE7H 2BASA 2Y0CA 1T6AA 2KSJA 2WITA 3OA7A 3GLMA 1VPCA 1NTZK 1YBKA 1YJNP 2N1TB 1MKMA 4WY4B 1NGMB 3HTKB 3H1KJ 3H1HD 1T2KD 1X79B 3L74G 1LTJC 2D2CB 3AEGC 1SQVG 1IFJA 1SQQJ 3CXHI 1EZVI 2HODA 1X0TA 1HJBA 3Q1MA 4AUWA 1T2KC 2OGUA 1JEKA 4K3AA 1YIJP 1YTZI 3A0BH 2WTYA 1H0TA 3H32B 2C9NY 1IC2A 3CXHH 4RJTA 1N8RQ 3VMYA 3L74D 4DT0A 1HWTC 2ZFCA 2OTKE 2H7HA 1FDIA 1SQXG 1QGKB 2N1TA 1NOHA 4WY4A 1SQVD 3HTKA 1YI2P 3S9OA 2V7QJ 1BSNA 3V2RA 1KILB 1RF0C 1OMIA 3CCEP 1H89A 1Y8AA 3CX5H 2IDBA 1EDKA 2LR2A 1X8YA 4RKUJ 2E74D 1DH3A 2V7QH 2ZVOB 2XU6A 5KLVG 3AE9C 3L35A 1NU1E 1KD1Q 3E7KA 2KNCB 2QJYB 1X22A 5CBOA 1RQUA 3AE7C 1ZR4A 5H2FE 3H32A 1M90Q 2E74C 1SQXD 1QL2A 1NU1K 1L0LE 1N7LA 4NPDA 5TJHA 3RK3B 4H44C 3VMZA 1VQKP 5APTA 4AYCA 1R8EA 1L0LK 2BEQD 1IJDB 4NPFX 5KLVD 4PV1C 1KILA 1KN7A 3L4FA 3F5HA 1USDA 3U59A 3SWYA 2AEFA 4D6TG 1PP9G 4EDFA 4ASVA 5AVRB 2WPVB 3WU2H 4R4LA 2XKMA 4N78E 2KNCA 1G1IA 3CC7P 1SP4A 2O01J 3HE5B 3L72J 1BE3E 1VF5C 2YNYA 2ZYDA 2Y0DA 5AVSB 2FXMA 1VQOP 3H1KG 5GTHH 3CWBE 5CHXA 3MIWA 3H6PA 2V4HA 3L73E 4IFDK 1SQQG 2OYIB 2FYNC 4D6TD 1PP9D 2WT7B 1EZVG 1QX8A 3IN6A 4I2LC 1MFTA 2WVRA 2YXQB 4WVZA 5B5EE 3P7KA 3R2PA 3KDPB 1S3JA 3M91A 4KJMA 2RH0A 2KLVA 2P10A 3H1KD 3VYIA 3I55P 2P58A 2KK7A 1XTGB 3HE5A 1L4AB 1J1DB 3H1IG 5C39A 1SQQD 4YXDC 1RF1C 4Z1MH 1OXZA 3TGUE 4ZNCA 3CXHD 1EZVD 1IFIA 4LLHA 1NKZB 4WWIA 3V4QA 1M1JC 2WZ7A 3V6IA 5CCHD 2OYIA 3MHVA 3A3YB 4JBZA 2OYHC 3FX0A 1SQXK 1RE4A 2M8RA 3RBXA 4ZKUA 1FDOA 1NU1J 4AQRD 2P2UA 1KILE 1YITP 4ASWA 2WWWA 2ZXXA 3CX5D 4HJGH 5CCHC 2M3BA 2QM7A 1L0LJ 2AXTE 1SLQA 2QJKC 1L4AA 1VQNP 1K9MQ 5H2FH 2PFXA 1VQLP 1LGHB 3GW6A 2E5TA 2KXPB 1QVGO 2ZAEB 2IBZG 3MD0A 1RQVA 3RK3E 2K3RA 4H0LC 4IL6E 1PFIA 2QEXP 1NTZG 3D6ZA 3RL0g 3L72G 2J58A 3E1IA 3OW2O 1M57D 2IFNA 5GTIH 1BE3J 3VMAA 2E75D 4N3YB 2VRSA 1EDJA 2IPPA 3AEEC 2HR3A 1Q81Q 2IBZD 3CWBJ 4XE5B 2YO2A 1A02F 4H13C 1PZQA 5BU8B 1J1EC 2YIUB 1AA0A 2C9LY 1IFDA 3SSUA 4RO0A 3L73J 1GL2D 1Q2NA 3JSVC 4YTPC 1K05A 2WPRA 3L72D 2FFDC 2XNXA 2GUVA 4IL6X 1SFCB 3I5CA 5APQA 4R4MA 1SS1A 3V2PA 4W80A 1R5SA 3KHUA 1L2PA 1GL2C 5AVUB 1ZMEC 2W6JH 1N7SD 4GKGA 5B5EH 1HF9A 4W7YA 3PH0A 2ZYAA 3L36A 2KI7B 1G2CA 2CPSA 3CCLP 4EIJA 5KTBA 3SFDC 3AECC 2W83C 3TGUJ 2ZYGA 3CCMP 1N7SC 2UWJE 1LT1A 1KB9E 3AEBC 4Y28J 1S1CX 3PHLA 4OGQD 3CC4P 4HYTB 2R3CA 3EQ2A 4UB6E 1NU1G 2JWDA 2JWAA 5AW0B 5APVA 1QLED 3AE8C 1SFCA 2QVAA 1FOSF 1GK4A 3BCCE 1L0LG 4OGQC 4PJ0E 2G3AA 2AEJA 1LT9B 2KYVA 1HH0A 3WUUA 2XV5A 1NJIQ 4YXWH 1PV3A 1WMKA 4KT0J 3GHGC 3L75E 2AXTH 1NU1D 2KLUA 1AFOA 1FZEA 4OH8B 3TDKA 3MTUE 2W6BA 3D6YA 3V5BA 3AEAC 1L0LD 1N73B 2E76C 3TK1A 1BE3G 1ZRTE 3FGAD 4IL6H 4W7ZA 1AV1A 3Q2YA 1U7JA 1RY3A 3HE4B 2IX7C 2O1KA 1VQMP 3C1LA 3CWBG 1LT9A 2N9BA 1E5WA 1USEA 1Q82Q 3SWFA 3GF7A 2R5DA 1JOCA 1GK6A 1KZUB 1LP1B 1CI6A 4PD4E 3TF5A 2MJZA 1PL5A 2XDJA 3L71E 4N78D 2M5AA 3G9RA 4I6MC 1BE3D 3KQGA 4XA4A 1LTTC 3RK2B 4GDOA 3S4RA 3EWKA 3U1AA 1L0NE 3CWBD 3GMAA 1N73A 1S9KE 4H44B 1BCCE 2HFED 1FBMA 2FXOA 1HGVA 3L73D 5M1BA 3G6EP 1LNQA 4BRYB 3CX5I 3HE4A 3KZIH 3TGUG 2N1TD 4WY4D 3G4SP 3V4WA 4PV1B 3KYQA 5L8RJ 3MUDA 5EFWB 1BGYE 1KB9I 2D2CD 2KB7P 2KS1B 3B8EB 1CZQA 4U7JA 4C46A 2PRRA 1LP1A 2O3JA 3A2AA 3BATA 4IOIH 3TYYA 2Y9ZA 4L73A 2WSFJ 2N1TC 3FXEA 3AE3C 1HVVA 1MFZA 4OVNF 2P67A 5KLIB 2NRGA 1KB9H 3H1LE 1PGOA 2ZVNB 1OW7A 1VQ9P 2OTJP 2A06E 1KV4A 1VF5B 1GW4A 2CPBA 2ZT9B 2D2CC 1S72P 2WSFH 5APSA 3TGUD 1LTBC 3BCCJ 3KXDA 1FJKA 1OW6A 1AVOA 2KIKA 2GA1A 4DJGA 1AQ5A 1IK9A 3K5BA 1FU1A 4DCKA 3ZDMA 3NFQA 4A7PA 1MZ9A 3L37A 4PJ0H 2MKVA 3L75J 2FXPA 1WRGA 3LIDA 2YO3A 3PP5A 2IBZI 1KILD 1FZFA 1NWQA 1R5LA 2H43A 4JYBA 2KS1A 4TLFA 1KMIZ 4C7NB 4U3FE 3BRVB 1W2BO 2W8ZA 2JP3A 3B5NB 1VQ4P 3A0HE 2CK3H 3CD6P 5DJUB 1KILC 1S2EA 3TSIA 2HG5D 3P8MC 3P32A 3BRTB 3L70E 2O01H 3O6QB 2H89C 3RK3D 2E43A 3WUVA 3BVHA 2QJYC 1M1JB 2GUSA 3B71A 1JB0J 4PD4I 2Q6QA 1VL2A 2JR8A 3PRJA 2OYHB 1YJWP 1EC5A 1DEEG 1N2DC 2FYUE 3L71J 1S5LE 3T97B 1IK7A 2SPZA 4PD4H 1URQB 4OWFA 1JMMA 4BXLA 3II6A 2FYUK 1L0NJ 4CPGA 3B5NA 2ZXEB 1FJPA 4GOEA 2Y0EA 3USSA 3RGUA 2PAJA 4LGDE 3HUSB 5E79E 3O6QA 1M8OB 4O9BA 3OAKA 3I56P 2YMYA 5KJ7D 5KJ7A 4H0LB 1NTME 4GT1A 1GDTA 2Y9YA 3NTNA 1MV8A 1YHQP 2OYHA 1JY2P 3WUTA 4RESB 1W5CE 4EOTA 2WT7A 2W6AA 1DEBA 5AVZB 1NAYA 2RN0A 1S5LX 3RL0B 1NTMK 2I1JA 3T97A 2KSEA 3H1LJ 1URQA 3BCCG 1TU3F 1QEXA 2OARA 2OYIC 2I8DA 2HYNA 4L74A 1RE4C 1YTZT 4H13B 1AJYA 1OVRA 2Q7CA 1ZR2A 1L4AD 1J1EB 2Q9IA 3M0DA 1KB9D 3L75G 2H8PD 2K9YA 1SQBE 2Z4EA 3HUSA 1EDIA 1MUUA 1SQPE 1SVFA 2WSEJ 1KFNA 1HTLC 1L4AC 1J1DC 3E1RA 2IYOA 3BCCD 4U3FJ 2WSEH 1EQ7A 1SQPK 3FWLA 1IFPA 1OWAA 1FZCB 4DZOA 3W67A 3CCQP 1H88A 3L75D 2QJPC 2J59M 4HH2A 1ZN5A 1X9VA 2QIWA 3L70J 3HD7B 1FZGA 3EFFK 3AE2C 5CCGA 2N9YB 3G3ZA 3B4SA 1NO4A 2E75C 3G71P 5AW8B 1KQLA 3L71G 3W68A 3P8CE 2HLOA 3Q5PA 1K8AQ 3NMDA 2PGDA 1RH5B 2FYUJ
chains in the Genus database with same CATH topology
1JM0A 2KZJA 2I8DA 1LP1A 4IOIH 2KUBA 2ZAEB 1EDLA 1S3JA 4KJMA 2WMMA 4NPDA 3FXEA 1U7JA 1OVRA 1BDDA 2K3RA 1NVOA 1ZW0A 2P58A 2UWJE 1EC5A 2RKLA 1DEEG 1X0TA 1LT1A 4HB1A 1EDIA 5C39A 2B87B 2SPZA 2KIKA 4K3AA 4NPFX 3MZWB 2JWDA 5DJTB 1H0TA 4K35A 4ZNCA 2LXCB 1LP1B 4BXLA 4GODA 1EDJA 3ZDMA 2B89A 4CPGA 2HR3A 1H0TB 1OVUA 2QVAA 4GOEA 2M5AA 4WWIA 2Q1KA 4ASVA 1Y47A 1JMBA 5CBNA 4GOFA 3FXDA 3RGUA 3MHVA 2OTKE 4JBZA 4MN4C 2M5AB 2LXBA 2B88A 1Q2NA 1OVVA 1ZXGA 1BDCA 4EYYQ 4ASWA 2M0BA 4HJGH 2R44A 1EDKA 2LR2A 4NPEA 5DJUB 3S1KA 4HKZH 5K5GB 1SS1A 2QRXA 4ZMDA 1U7MA 2KZIA 3QWOC 1FC2C 5EFWB 3PH0A 2B87A 2KI7B 5CBOA 1MFTA 2KS1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JM0 A;  2KZJ A;  2I8D A;  1LP1 A;  4IOI H;  2KUB A;  2ZAE B;  1EDL A;  1S3J A;  4KJM A;  2WMM A;  4NPD A;  3FXE A;  1U7J A;  1OVR A;  1BDD A;  2K3R A;  1NVO A;  1ZW0 A;  2P58 A;  2UWJ E;  1EC5 A;  2RKL A;  1DEE G;  1X0T A;  1LT1 A;  4HB1 A;  1EDI A;  5C39 A;  2B87 B;  2SPZ A;  2KIK A;  4K3A A;  4NPF X;  3MZW B;  2JWD A;  5DJT B;  1H0T A;  4K35 A;  4ZNC A;  2LXC B;  1LP1 B;  4BXL A;  4GOD A;  1EDJ A;  3ZDM A;  2B89 A;  4CPG A;  2HR3 A;  1H0T B;  1OVU A;  2QVA A;  4GOE A;  2M5A A;  4WWI A;  2Q1K A;  4ASV A;  1Y47 A;  1JMB A;  5CBN A;  4GOF A;  3FXD A;  3RGU A;  3MHV A;  2OTK E;  4JBZ A;  4MN4 C;  2M5A B;  2LXB A;  2B88 A;  1Q2N A;  1OVV A;  1ZXG A;  1BDC A;  4EYY Q;  4ASW A;  2M0B A;  4HJG H;  2R44 A;  1EDK A;  2LR2 A;  4NPE A;  5DJU B;  3S1K A;  4HKZ H;  5K5G B;  1SS1 A;  2QRX A;  4ZMD A;  1U7M A;  2KZI A;  3QWO C;  1FC2 C;  5EFW B;  3PH0 A;  2B87 A;  2KI7 B;  5CBO A;  1MFT A;  2KS1 B; 
#chains in the Genus database with same CATH topology
 4I7Z B;  5KAF E;  1P84 E;  2KP8 A;  1NYH A;  2GM4 A;  1XTC C;  2R3S A;  1S5L H;  4M3L A;  1QL1 A;  1HJ0 A;  1FZC A;  1KYO E;  1OIP A;  2K37 A;  2L5G B;  1ZOY C;  4PD4 D;  4Y99 B;  5DJT B;  1NKN A;  3L71 D;  2JEE A;  3IF4 A;  3HD7 D;  3HD7 A;  3SWK A;  2WSC J;  3A5T A;  3ITK A;  3VN0 A;  1UIX A;  2JJL A;  1M56 D;  1NTM J;  3F89 A;  3FXD A;  2P1J A;  5AW3 B;  3H1I E;  5E79 H;  2WSC H;  1M1K Q;  1JY3 P;  2NPS B;  2E76 B;  1S9K D;  2P7J A;  3OJA B;  1JCD A;  1NH4 A;  3H1L G;  2FKW B;  1RE3 A;  3WMM 0;  1LWU B;  2A06 G;  3H1J E;  4TT3 H;  5KKZ C;  2G8Y A;  1SFC D;  2A45 I;  1DD3 A;  3C8V A;  3CCS P;  2YIU C;  1CW5 A;  3CI9 A;  3CCV P;  1WT6 A;  1T3U A;  2E5Y A;  4IFM A;  5K5G B;  1GMJ A;  1LTJ B;  5AVQ B;  2A45 H;  2YKP A;  2WPS A;  1UII A;  1SQB J;  2KZJ A;  1IFN A;  1SQP J;  3GF3 A;  3H1L D;  3VOP A;  1VQP P;  3LW5 J;  1OZH A;  2A06 D;  2C0X A;  2L91 A;  4U3F G;  3U1C A;  1YQ4 C;  3AE5 C;  5AW1 B;  2XND H;  3MGN A;  2NPS A;  3FWN A;  1T8Z A;  3EFG A;  3LW5 H;  1N86 A;  2O01 N;  1PGJ A;  1GW3 A;  2W27 A;  1LWU A;  2J5U A;  2LKM A;  4K35 A;  4N6J A;  1FDM A;  2LXC B;  1NTK E;  1D7M A;  1IFM A;  3L70 G;  1HBW A;  1H0T B;  1CSB A;  1NTZ E;  2Q1K A;  4JPZ B;  5AVX B;  1IZN B;  1LTJ A;  3AE1 C;  3L73 G;  1NTK K;  4U3F D;  2QA4 P;  1FZB A;  1OVV A;  4EYY Q;  2FYU G;  1LT9 C;  1OX3 A;  3V2N A;  1P84 I;  2E74 B;  2BCC E;  1VQ6 P;  3L70 D;  2OYO A;  2BEZ F;  2QSI A;  5BVZ A;  1KYO I;  5KAF H;  1P84 H;  1KFM A;  3QH9 A;  1JM0 A;  2AXC A;  1GU4 A;  1EDL A;  1L0N K;  1FE6 A;  4L75 A;  2KOG A;  3R4Y A;  2FYU D;  1KYO H;  3NXS A;  1N73 C;  3N4X A;  1RF0 A;  1YYC A;  1NTM G;  2RKL A;  2IFM A;  2WQY C;  3H1I J;  1J2J B;  2R32 A;  4WY4 C;  2JO1 A;  1W2E A;  4UB8 E;  1LJ2 A;  4GOD A;  5AW6 B;  3CMA P;  1FOS E;  3MUD C;  1KTM A;  2ZJS E;  3RK2 D;  2A45 G;  1OVU A;  3H1J J;  1LTI C;  4UB6 H;  2JDI H;  3UIA A;  1PPJ E;  1Q90 D;  1KOR A;  3O8Z A;  4H44 D;  3C9I A;  5APY A;  1NTM D;  1AVY A;  1SQB G;  3RK2 C;  2H88 C;  4BRY A;  5AVW B;  3Q3D A;  2FYN B;  2M0B A;  1SQP G;  1VQ7 P;  3AE4 C;  1EXJ A;  3AE6 C;  1GU5 A;  4PV1 D;  2I1K A;  3JC2 2;  4QMA A;  2QG4 A;  2YKO A;  2B9B A;  3PLN A;  1JY2 N;  1QVF O;  1M7L A;  3H1H E;  1GZL A;  1VF5 D;  2ZT9 D;  1SQB D;  1NVO A;  1NTK J;  2IZ0 A;  5TIS E;  5GTI E;  1RF1 B;  4IFF A;  1SQP D;  4KHX A;  3M06 A;  1YQ3 C;  1NTZ J;  3M9Q A;  1A02 J;  1Q7Y Q;  3VTP C;  2ITA A;  3AED C;  2M3E A;  5KLI C;  3Q5S A;  1S4X A;  1ZP0 C;  2WSS H;  2ZT9 C;  1PGQ A;  2O1J A;  5B66 E;  1Z56 A;  5AVT B;  4I1L A;  5CBN A;  2YKQ A;  3RK3 C;  3MP7 B;  2WPQ A;  5AVY B;  3L74 E;  4C7N A;  1NAF A;  2Z5H A;  2B88 A;  1EXI A;  2HPC B;  4JQ0 D;  2BCC J;  3ABV C;  5KAI E;  2K88 A;  3B5N D;  1SQV E;  1JCC A;  2QJK B;  1BCC J;  2R44 A;  5AW5 B;  3S1K A;  1RF1 A;  4HKZ H;  5CJ4 A;  5CMZ A;  4ZMD A;  3P8C D;  1U7M A;  4EI2 A;  1SQV K;  2KZI A;  1LTS C;  2YMK A;  2FYZ A;  3B5N C;  1BSH A;  3IFM A;  2OTL P;  1P84 D;  2Z5I A;  1BGY J;  1M1J A;  3AEF C;  1GTW A;  1JY2 O;  5APW A;  1SQX E;  3LIE A;  2E42 A;  1KYO D;  3H1J G;  3CCR P;  1ZW0 A;  5KJ7 C;  5AW9 B;  4HB1 A;  1URQ D;  3IR9 A;  1JO5 A;  5CCH A;  2QJP B;  2HPC A;  2Q5U A;  4UB8 H;  2B87 B;  3N7N A;  3MZW B;  1VQ8 P;  1KC8 Q;  1RHZ B;  2RMZ A;  2IYP A;  4YPC A;  5KLV E;  1IO4 A;  3KPE A;  3H1I D;  2E75 B;  1URQ C;  1AQT A;  3VP8 A;  4GOF A;  1KQS O;  4MN4 C;  3GG2 A;  3JCU E;  5KLV K;  3H1J D;  2FFD B;  4H0L D;  3M9B A;  1NHL A;  3M0D C;  1SQB K;  2K9J B;  1GL2 B;  3CME P;  3HUS C;  1JY3 N;  3TNU B;  4NPE A;  1G1J A;  1FS0 E;  3RL0 D;  1ZV8 A;  1NTK G;  2QRX A;  5AVV B;  3H1H J;  3QWO C;  1ZLL A;  3D70 A;  4WBA A;  5APX A;  1FC2 C;  1KQG B;  2B87 A;  1HGZ A;  3A0H H;  4D6T E;  1PP9 E;  1HUC A;  4H13 D;  1N7S B;  2JKV A;  2YXR B;  3CCU P;  5CCG D;  1G2C B;  3PJS K;  3RL0 C;  5APU A;  5TIS H;  4C7R A;  1LTG C;  4WB4 A;  5BU5 A;  1PIX A;  2DW3 A;  3H1K E;  1ZRT D;  4GIF A;  1DIP A;  2FFD A;  1OW8 A;  4LC1 A;  5KKZ B;  5CCG C;  1NTK D;  3M9H A;  5B66 H;  3L74 J;  2BCC G;  1VQ5 P;  1L0N G;  2K9J A;  1NTZ D;  1GL2 A;  3RBZ A;  4OGQ B;  1SQQ E;  3TNU A;  1KQF B;  1BCC G;  3A0B E;  1Y9B A;  1SQV J;  3A7O A;  3CXH E;  1EZV E;  1Y47 A;  1JUN A;  2QM8 A;  3SFE C;  1U57 A;  5KAI H;  1H8A A;  1SQQ K;  3GHG B;  1OFC X;  2K1A A;  3KZI E;  1N7S A;  2C0W A;  1ZXG A;  1BGY G;  2AEM A;  1GD2 E;  3PTZ A;  1FZC C;  2OQQ A;  2IZ1 A;  4L76 A;  2BCC D;  3CX5 E;  1L0N D;  1VDF A;  4BWN A;  1JY3 O;  1JNM A;  1BCC D;  1SQX J;  3HD7 C;  1FZA A;  3CCJ P;  3M0A A;  3CPW O;  1FAV A;  2PP6 A;  1PPJ G;  2KUB A;  5CJ0 A;  2R5B A;  4B86 A;  2WMM A;  5AW2 B;  1BDD A;  1YJ9 P;  4DOJ A;  1BGY D;  1RE3 C;  1JTH B;  2FBW C;  5KLV J;  3CLQ A;  3V2Q A;  4I7Z C;  1SFC C;  3GHG A;  2W90 A;  3CL3 D;  2FY8 A;  3IAO A;  1PGP A;  1LTA C;  1DD4 A;  5AW7 B;  4ZKP A;  2B89 A;  1K04 A;  1T3J A;  4Y99 C;  1CI6 B;  1PPJ D;  3HRN A;  2NPS D;  2Q3E A;  3JCU H;  2E76 D;  1JMB A;  1K73 Q;  3CC2 P;  1E79 H;  2M5A B;  3H1H G;  2HOD B;  2Q3I A;  2LXB A;  2IBZ E;  3WU2 E;  5AW4 B;  3VP9 A;  1Q86 Q;  4JF7 A;  4JYC A;  3Q5R A;  1BDC A;  3BAS A;  2NZ2 A;  3D71 A;  3H25 A;  2NPS C;  2XZR A;  1DX7 A;  4D6T J;  1PP9 J;  4XFJ A;  3VMX A;  5GTH E;  2POH A;  3L72 E;  1JTH A;  1LWU C;  2QE7 H;  2BAS A;  2Y0C A;  1T6A A;  2KSJ A;  2WIT A;  3OA7 A;  3GLM A;  1VPC A;  1NTZ K;  1YBK A;  1YJN P;  2N1T B;  1MKM A;  4WY4 B;  1NGM B;  3HTK B;  3H1K J;  3H1H D;  1T2K D;  1X79 B;  3L74 G;  1LTJ C;  2D2C B;  3AEG C;  1SQV G;  1IFJ A;  1SQQ J;  3CXH I;  1EZV I;  2HOD A;  1X0T A;  1HJB A;  3Q1M A;  4AUW A;  1T2K C;  2OGU A;  1JEK A;  4K3A A;  1YIJ P;  1YTZ I;  3A0B H;  2WTY A;  1H0T A;  3H32 B;  2C9N Y;  1IC2 A;  3CXH H;  4RJT A;  1N8R Q;  3VMY A;  3L74 D;  4DT0 A;  1HWT C;  2ZFC A;  2OTK E;  2H7H A;  1FDI A;  1SQX G;  1QGK B;  2N1T A;  1NOH A;  4WY4 A;  1SQV D;  3HTK A;  1YI2 P;  3S9O A;  2V7Q J;  1BSN A;  3V2R A;  1KIL B;  1RF0 C;  1OMI A;  3CCE P;  1H89 A;  1Y8A A;  3CX5 H;  2IDB A;  1EDK A;  2LR2 A;  1X8Y A;  4RKU J;  2E74 D;  1DH3 A;  2V7Q H;  2ZVO B;  2XU6 A;  5KLV G;  3AE9 C;  3L35 A;  1NU1 E;  1KD1 Q;  3E7K A;  2KNC B;  2QJY B;  1X22 A;  5CBO A;  1RQU A;  3AE7 C;  1ZR4 A;  5H2F E;  3H32 A;  1M90 Q;  2E74 C;  1SQX D;  1QL2 A;  1NU1 K;  1L0L E;  1N7L A;  4NPD A;  5TJH A;  3RK3 B;  4H44 C;  3VMZ A;  1VQK P;  5APT A;  4AYC A;  1R8E A;  1L0L K;  2BEQ D;  1IJD B;  4NPF X;  5KLV D;  4PV1 C;  1KIL A;  1KN7 A;  3L4F A;  3F5H A;  1USD A;  3U59 A;  3SWY A;  2AEF A;  4D6T G;  1PP9 G;  4EDF A;  4ASV A;  5AVR B;  2WPV B;  3WU2 H;  4R4L A;  2XKM A;  4N78 E;  2KNC A;  1G1I A;  3CC7 P;  1SP4 A;  2O01 J;  3HE5 B;  3L72 J;  1BE3 E;  1VF5 C;  2YNY A;  2ZYD A;  2Y0D A;  5AVS B;  2FXM A;  1VQO P;  3H1K G;  5GTH H;  3CWB E;  5CHX A;  3MIW A;  3H6P A;  2V4H A;  3L73 E;  4IFD K;  1SQQ G;  2OYI B;  2FYN C;  4D6T D;  1PP9 D;  2WT7 B;  1EZV G;  1QX8 A;  3IN6 A;  4I2L C;  1MFT A;  2WVR A;  2YXQ B;  4WVZ A;  5B5E E;  3P7K A;  3R2P A;  3KDP B;  1S3J A;  3M91 A;  4KJM A;  2RH0 A;  2KLV A;  2P10 A;  3H1K D;  3VYI A;  3I55 P;  2P58 A;  2KK7 A;  1XTG B;  3HE5 A;  1L4A B;  1J1D B;  3H1I G;  5C39 A;  1SQQ D;  4YXD C;  1RF1 C;  4Z1M H;  1OXZ A;  3TGU E;  4ZNC A;  3CXH D;  1EZV D;  1IFI A;  4LLH A;  1NKZ B;  4WWI A;  3V4Q A;  1M1J C;  2WZ7 A;  3V6I A;  5CCH D;  2OYI A;  3MHV A;  3A3Y B;  4JBZ A;  2OYH C;  3FX0 A;  1SQX K;  1RE4 A;  2M8R A;  3RBX A;  4ZKU A;  1FDO A;  1NU1 J;  4AQR D;  2P2U A;  1KIL E;  1YIT P;  4ASW A;  2WWW A;  2ZXX A;  3CX5 D;  4HJG H;  5CCH C;  2M3B A;  2QM7 A;  1L0L J;  2AXT E;  1SLQ A;  2QJK C;  1L4A A;  1VQN P;  1K9M Q;  5H2F H;  2PFX A;  1VQL P;  1LGH B;  3GW6 A;  2E5T A;  2KXP B;  1QVG O;  2ZAE B;  2IBZ G;  3MD0 A;  1RQV A;  3RK3 E;  2K3R A;  4H0L C;  4IL6 E;  1PFI A;  2QEX P;  1NTZ G;  3D6Z A;  3RL0 g;  3L72 G;  2J58 A;  3E1I A;  3OW2 O;  1M57 D;  2IFN A;  5GTI H;  1BE3 J;  3VMA A;  2E75 D;  4N3Y B;  2VRS A;  1EDJ A;  2IPP A;  3AEE C;  2HR3 A;  1Q81 Q;  2IBZ D;  3CWB J;  4XE5 B;  2YO2 A;  1A02 F;  4H13 C;  1PZQ A;  5BU8 B;  1J1E C;  2YIU B;  1AA0 A;  2C9L Y;  1IFD A;  3SSU A;  4RO0 A;  3L73 J;  1GL2 D;  1Q2N A;  3JSV C;  4YTP C;  1K05 A;  2WPR A;  3L72 D;  2FFD C;  2XNX A;  2GUV A;  4IL6 X;  1SFC B;  3I5C A;  5APQ A;  4R4M A;  1SS1 A;  3V2P A;  4W80 A;  1R5S A;  3KHU A;  1L2P A;  1GL2 C;  5AVU B;  1ZME C;  2W6J H;  1N7S D;  4GKG A;  5B5E H;  1HF9 A;  4W7Y A;  3PH0 A;  2ZYA A;  3L36 A;  2KI7 B;  1G2C A;  2CPS A;  3CCL P;  4EIJ A;  5KTB A;  3SFD C;  3AEC C;  2W83 C;  3TGU J;  2ZYG A;  3CCM P;  1N7S C;  2UWJ E;  1LT1 A;  1KB9 E;  3AEB C;  4Y28 J;  1S1C X;  3PHL A;  4OGQ D;  3CC4 P;  4HYT B;  2R3C A;  3EQ2 A;  4UB6 E;  1NU1 G;  2JWD A;  2JWA A;  5AW0 B;  5APV A;  1QLE D;  3AE8 C;  1SFC A;  2QVA A;  1FOS F;  1GK4 A;  3BCC E;  1L0L G;  4OGQ C;  4PJ0 E;  2G3A A;  2AEJ A;  1LT9 B;  2KYV A;  1HH0 A;  3WUU A;  2XV5 A;  1NJI Q;  4YXW H;  1PV3 A;  1WMK A;  4KT0 J;  3GHG C;  3L75 E;  2AXT H;  1NU1 D;  2KLU A;  1AFO A;  1FZE A;  4OH8 B;  3TDK A;  3MTU E;  2W6B A;  3D6Y A;  3V5B A;  3AEA C;  1L0L D;  1N73 B;  2E76 C;  3TK1 A;  1BE3 G;  1ZRT E;  3FGA D;  4IL6 H;  4W7Z A;  1AV1 A;  3Q2Y A;  1U7J A;  1RY3 A;  3HE4 B;  2IX7 C;  2O1K A;  1VQM P;  3C1L A;  3CWB G;  1LT9 A;  2N9B A;  1E5W A;  1USE A;  1Q82 Q;  3SWF A;  3GF7 A;  2R5D A;  1JOC A;  1GK6 A;  1KZU B;  1LP1 B;  1CI6 A;  4PD4 E;  3TF5 A;  2MJZ A;  1PL5 A;  2XDJ A;  3L71 E;  4N78 D;  2M5A A;  3G9R A;  4I6M C;  1BE3 D;  3KQG A;  4XA4 A;  1LTT C;  3RK2 B;  4GDO A;  3S4R A;  3EWK A;  3U1A A;  1L0N E;  3CWB D;  3GMA A;  1N73 A;  1S9K E;  4H44 B;  1BCC E;  2HFE D;  1FBM A;  2FXO A;  1HGV A;  3L73 D;  5M1B A;  3G6E P;  1LNQ A;  4BRY B;  3CX5 I;  3HE4 A;  3KZI H;  3TGU G;  2N1T D;  4WY4 D;  3G4S P;  3V4W A;  4PV1 B;  3KYQ A;  5L8R J;  3MUD A;  5EFW B;  1BGY E;  1KB9 I;  2D2C D;  2KB7 P;  2KS1 B;  3B8E B;  1CZQ A;  4U7J A;  4C46 A;  2PRR A;  1LP1 A;  2O3J A;  3A2A A;  3BAT A;  4IOI H;  3TYY A;  2Y9Z A;  4L73 A;  2WSF J;  2N1T C;  3FXE A;  3AE3 C;  1HVV A;  1MFZ A;  4OVN F;  2P67 A;  5KLI B;  2NRG A;  1KB9 H;  3H1L E;  1PGO A;  2ZVN B;  1OW7 A;  1VQ9 P;  2OTJ P;  2A06 E;  1KV4 A;  1VF5 B;  1GW4 A;  2CPB A;  2ZT9 B;  2D2C C;  1S72 P;  2WSF H;  5APS A;  3TGU D;  1LTB C;  3BCC J;  3KXD A;  1FJK A;  1OW6 A;  1AVO A;  2KIK A;  2GA1 A;  4DJG A;  1AQ5 A;  1IK9 A;  3K5B A;  1FU1 A;  4DCK A;  3ZDM A;  3NFQ A;  4A7P A;  1MZ9 A;  3L37 A;  4PJ0 H;  2MKV A;  3L75 J;  2FXP A;  1WRG A;  3LID A;  2YO3 A;  3PP5 A;  2IBZ I;  1KIL D;  1FZF A;  1NWQ A;  1R5L A;  2H43 A;  4JYB A;  2KS1 A;  4TLF A;  1KMI Z;  4C7N B;  4U3F E;  3BRV B;  1W2B O;  2W8Z A;  2JP3 A;  3B5N B;  1VQ4 P;  3A0H E;  2CK3 H;  3CD6 P;  5DJU B;  1KIL C;  1S2E A;  3TSI A;  2HG5 D;  3P8M C;  3P32 A;  3BRT B;  3L70 E;  2O01 H;  3O6Q B;  2H89 C;  3RK3 D;  2E43 A;  3WUV A;  3BVH A;  2QJY C;  1M1J B;  2GUS A;  3B71 A;  1JB0 J;  4PD4 I;  2Q6Q A;  1VL2 A;  2JR8 A;  3PRJ A;  2OYH B;  1YJW P;  1EC5 A;  1DEE G;  1N2D C;  2FYU E;  3L71 J;  1S5L E;  3T97 B;  1IK7 A;  2SPZ A;  4PD4 H;  1URQ B;  4OWF A;  1JMM A;  4BXL A;  3II6 A;  2FYU K;  1L0N J;  4CPG A;  3B5N A;  2ZXE B;  1FJP A;  4GOE A;  2Y0E A;  3USS A;  3RGU A;  2PAJ A;  4LGD E;  3HUS B;  5E79 E;  3O6Q A;  1M8O B;  4O9B A;  3OAK A;  3I56 P;  2YMY A;  5KJ7 D;  5KJ7 A;  4H0L B;  1NTM E;  4GT1 A;  1GDT A;  2Y9Y A;  3NTN A;  1MV8 A;  1YHQ P;  2OYH A;  1JY2 P;  3WUT A;  4RES B;  1W5C E;  4EOT A;  2WT7 A;  2W6A A;  1DEB A;  5AVZ B;  1NAY A;  2RN0 A;  1S5L X;  3RL0 B;  1NTM K;  2I1J A;  3T97 A;  2KSE A;  3H1L J;  1URQ A;  3BCC G;  1TU3 F;  1QEX A;  2OAR A;  2OYI C;  2I8D A;  2HYN A;  4L74 A;  1RE4 C;  1YTZ T;  4H13 B;  1AJY A;  1OVR A;  2Q7C A;  1ZR2 A;  1L4A D;  1J1E B;  2Q9I A;  3M0D A;  1KB9 D;  3L75 G;  2H8P D;  2K9Y A;  1SQB E;  2Z4E A;  3HUS A;  1EDI A;  1MUU A;  1SQP E;  1SVF A;  2WSE J;  1KFN A;  1HTL C;  1L4A C;  1J1D C;  3E1R A;  2IYO A;  3BCC D;  4U3F J;  2WSE H;  1EQ7 A;  1SQP K;  3FWL A;  1IFP A;  1OWA A;  1FZC B;  4DZO A;  3W67 A;  3CCQ P;  1H88 A;  3L75 D;  2QJP C;  2J59 M;  4HH2 A;  1ZN5 A;  1X9V A;  2QIW A;  3L70 J;  3HD7 B;  1FZG A;  3EFF K;  3AE2 C;  5CCG A;  2N9Y B;  3G3Z A;  3B4S A;  1NO4 A;  2E75 C;  3G71 P;  5AW8 B;  1KQL A;  3L71 G;  3W68 A;  3P8C E;  2HLO A;  3Q5P A;  1K8A Q;  3NMD A;  2PGD A;  1RH5 B;  2FYU J; 
#chains in the Genus database with same CATH homology
 1JM0 A;  2KZJ A;  2I8D A;  1LP1 A;  4IOI H;  2KUB A;  2ZAE B;  1EDL A;  1S3J A;  4KJM A;  2WMM A;  4NPD A;  3FXE A;  1U7J A;  1OVR A;  1BDD A;  2K3R A;  1NVO A;  1ZW0 A;  2P58 A;  2UWJ E;  1EC5 A;  2RKL A;  1DEE G;  1X0T A;  1LT1 A;  4HB1 A;  1EDI A;  5C39 A;  2B87 B;  2SPZ A;  2KIK A;  4K3A A;  4NPF X;  3MZW B;  2JWD A;  5DJT B;  1H0T A;  4K35 A;  4ZNC A;  2LXC B;  1LP1 B;  4BXL A;  4GOD A;  1EDJ A;  3ZDM A;  2B89 A;  4CPG A;  2HR3 A;  1H0T B;  1OVU A;  2QVA A;  4GOE A;  2M5A A;  4WWI A;  2Q1K A;  4ASV A;  1Y47 A;  1JMB A;  5CBN A;  4GOF A;  3FXD A;  3RGU A;  3MHV A;  2OTK E;  4JBZ A;  4MN4 C;  2M5A B;  2LXB A;  2B88 A;  1Q2N A;  1OVV A;  1ZXG A;  1BDC A;  4EYY Q;  4ASW A;  2M0B A;  4HJG H;  2R44 A;  1EDK A;  2LR2 A;  4NPE A;  5DJU B;  3S1K A;  4HKZ H;  5K5G B;  1SS1 A;  2QRX A;  4ZMD A;  1U7M A;  2KZI A;  3QWO C;  1FC2 C;  5EFW B;  3PH0 A;  2B87 A;  2KI7 B;  5CBO A;  1MFT A;  2KS1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...