4ZMDA

C domain of staphylococcal protein a mutant - q9w
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
56
structure length
56
Chain Sequence
NKFNKEWQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
publication title Suppression of conformational heterogeneity at a protein-protein interface.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 22
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4zmdA00
1EDLA 4ZNCA 3ZDMA 2JWDA 2K3RA 1Q2NA 4GODA 4ZMDA 1NVOA 1BDDA 1LT1A 1S3JA 3FXDA 2RKLA 2OTKE 2KS1B 1DEEG 5EFWB 1EDJA 3MZWB 1X0TA 2SPZA 2UWJE 2LXBA 2R44A 1ZXGA 4HKZH 2KI7B 2M5AB 1OVUA 2P58A 1LP1A 4IOIH 5C39A 5K5GB 1Y47A 5CBOA 2LR2A 1EDIA 4MN4C 4KJMA 2LXCB 4ASVA 4EYYQ 4ASWA 2WMMA 4K3AA 2B87B 3RGUA 3FXEA 2KZJA 1EC5A 1ZW0A 2KIKA 4HB1A 2Q1KA 3QWOC 2HR3A 5DJUB 1H0TA 2B88A 2QVAA 2QRXA 4GOEA 1MFTA 1OVRA 3S1KA 4NPDA 3PH0A 1JMBA 4NPEA 2KZIA 4CPGA 2ZAEB 1JM0A 1BDCA 1LP1B 4K35A 4JBZA 2M5AA 1H0TB 1SS1A 2B89A 4GOFA 4HJGH 4BXLA 1FC2C 1U7MA 4NPFX 5DJTB 1U7JA 1EDKA 3MHVA 4WWIA 2M0BA 2KUBA 2I8DA 1OVVA 5CBNA 2B87A
chains in the Genus database with same CATH superfamily
3L71D 5B66E 4GT1A 1NTZG 2XV5A 1YJWP 1PGOA 4O9BA 4L73A 2HYNA 1YBKA 3MUDC 1PP9D 1NTKG 1HGVA 2YKQA 3OW2O 5E79H 4XFJA 1L0NG 3AE4C 1LWUB 2WTYA 1IC2A 1D7MA 1FS0E 1K8AQ 1Q82Q 2AEFA 3TGUE 3VP8A 4JYBA 1MV8A 4GIFA 2PFXA 4JPZB 2N9BA 2NPSD 4L76A 4RO0A 4DZOA 1OWAA 2M3EA 5AVQB 5AVRB 3SSUA 2FYZA 1NTMJ 2IPPA 4NPEA 1M1KQ 4N78E 5KTBA 3IR9A 1Z56A 2J59M 2P2UA 1L0LD 4DCKA 2QE7H 2FYUD 5B66H 2I1KA 3Q5RA 3JSVC 2GA1A 3O6QB 3L74D 1L2PA 2E74B 3AE1C 2M0BA 1AA0A 1KYOD 2YIUB 4ZKUA 1RE3C 3R4YA 3SFDC 1UIIA 4H13D 3M91A 1RQUA 1VQ6P 2IBZD 1LTAC 2IZ1A 3MTUE 1KFMA 2XDJA 3L70J 1J1DC 1NTME 2KNCB 2YO3A 4B86A 2BASA 3NMDA 1NTKJ 3FGAD 2Q9IA 2HODA 2GUVA 1RF0C 1R5SA 1N8RQ 1L0LG 2OTJP 5BU5A 3D70A 1JB0J 1BSHA 1NAFA 1BE3D 1FAVA 3L74G 2OYIC 4UB6H 5KJ7A 2B89A 3GHGC 1MFZA 3C1LA 3TYYA 3L70E 4BRYB 1YI2P 1GW3A 2KK7A 4WY4C 2BEZF 2J5UA 4U3FJ 1KMIZ 1Q86Q 3CCLP 3IAOA 2IBZG 3RK3B 2P10A 2JWDA 1RE4A 1NTKE 3L71J 4GODA 2KS1B 1GU4A 3CCVP 2UWJE 1LTJB 2FYNC 2IDBA 1L0NE 1PP9J 3C9IA 3R2PA 1NU1K 1SFCC 3H1HD 1GL2B 4I1LA 2H8PD 3WU2E 2R3CA 1KILC 3CXHH 1P84I 3UIAA 4Y28J 1VQOP 3O6QA 1IFNA 1BE3G 4U3FE 3II6A 1QLED 3K5BA 2JP3A 2YNYA 3G6EP 1EXIA 3KZIH 2HR3A 3AEGC 5KLIC 1VQ7P 2MKVA 2HPCB 2WPSA 2Q5UA 2AEMA 1T2KC 1Y9BA 2WZ7A 3AE9C 3RBZA 1S2EA 2QA4P 1FZFA 1QGKB 3A5TA 1PP9E 2KNCA 2FYUJ 5DJTB 1AFOA 3CWBD 2Q6QA 3RK2D 3L74J 1USEA 2W6AA 4EDFA 1VPCA 3H1HG 1K9MQ 1Q2NA 1SQXD 1JY2O 3FXDA 1LJ2A 2OTKE 3CC7P 2WPVB 1DEEG 2VRSA 1L4AA 1N7SC 1FJKA 2O1KA 2HLOA 3O8ZA 2CPSA 1M1JB 1NJIQ 3EWKA 2P58A 1NGMB 2C0WA 3CL3D 2V7QJ 2ZT9D 2QM7A 2V4HA 4BRYA 5BVZA 2QJKC 1L0LE 4H0LC 2FYUE 3AE3C 1ZR2A 1RQVA 1KC8Q 3BCCG 1DH3A 1PGPA 3RBXA 3B5NB 3L74E 3JCUE 2ZYGA 1W2EA 3M9BA 2KS1A 1URQB 1KYOE 2WSEJ 3AEAC 2AXCA 1LTJA 1JM0A 1BE3J 1NU1D 3RL0g 3H6PA 3VMYA 3BRVB 2IBZE 1VF5B 5AVWB 3V6IA 2QJPC 3VYIA 1FZCB 1KTMA 2FFDB 4ZNCA 3ZDMA 2OQQA 1EZVI 5APUA 5AW8B 3TNUB 2O01N 1JTHB 5APVA 2QJYC 2N1TB 2W6JH 3QH9A 1ZR4A 3VMZA 2HPCA 3WMM0 5AW4B 3PP5A 4PJ0E 1YJNP 2WITA 2LXBA 1XTGB 3NFQA 4TLFA 3VOPA 4PD4E 2YMYA 3MIWA 3WUVA 2J58A 1HWTC 2W6BA 5K5GB 1BE3E 4I2LC 5CJ4A 3L75D 4Y99C 1EDIA 2LXCB 1X9VA 4I7ZC 1PIXA 2A06D 1KORA 1KYOH 1M90Q 4A7PA 3KQGA 1PGJA 1JOCA 2KP8A 1LT9B 2D2CC 3KPEA 1MFTA 4DT0A 1BCCD 3S1KA 1X79B 4XA4A 2AEJA 3IN6A 1CI6B 1YYCA 3V4QA 1GMJA 3GF3A 1N73B 2WSSH 4H44C 1LP1B 3M0DC 1M1JA 5E79E 1FOSE 1WRGA 2IYOA 4BXLA 1FC2C 4R4LA 2WQYC 2E75C 3A0HE 1PZQA 2Q3EA 3H1HE 3T97B 3AEEC 5TISH 5APSA 2I8DA 3CWBJ 1OW8A 4PJ0H 2PGDA 5AW7B 5B5EH 2WSEH 1SQXJ 1JCCA 4RJTA 3L75G 1URQA 4HKZH 1TU3F 1YQ3C 1OX3A 4IOIH 5C39A 2FXPA 5KLVD 2ZT9C 1H8AA 1XTCC 3BCCE 5H2FH 3RGUA 5L8RJ 4GDOA 5BU8B 1SFCD 1FZCA 4HB1A 2FFDA 2XNXA 3S4RA 3CWBE 4JQ0D 1QVGO 3CX5I 3TF5A 3L4FA 2PAJA 1IK9A 1IFMA 1KILD 2HFED 1JTHA 1N86A 2N1TA 3A0HH 1S5LH 2E76B 4EIJA 3VMXA 3RL0C 5CCGA 1NU1J 1IK7A 1GZLA 1W5CE 2ZJSE 5AVXB 4U3FG 5APXA 3Q1MA 1T2KD 2P1JA 3KYQA 1L4AD 3Q2YA 3CCRP 4OH8B 3L71G 3E1IA 5CJ0A 1HTLC 1LT9A 4PV1C 1X0TA 1NO4A 1VDFA 2OYHA 3HD7B 4WY4B 3FWNA 2OGUA 4UB6E 1PP9G 2Y0DA 2E42A 1E5WA 1Q90D 3PHLA 4OGQB 1N73A 1LP1A 1HJBA 1JY3N 2R5BA 4ZKPA 3P32A 1W2BO 1N7SD 2R32A 3V2PA 1NU1E 3L75J 1R8EA 3H25A 3MP7B 1E79H 3T97A 3RK3D 3HUSB 1JY2P 1FDOA 2R3SA 1KN7A 2W83C 1PPJD 1T3JA 1KV4A 4KT0J 2QVAA 4GOEA 4WB4A 1OIPA 1OVRA 4NPDA 3PLNA 2IYPA 1BCCJ 5KJ7C 3CCSP 3P7KA 4H0LD 2XKMA 4UB8E 5AVTB 1H0TB 2H7HA 2NPSB 1SQXK 2KLUA 3CXHE 4IFFA 5CCHA 2FYUG 5M1BA 1ZN5A 1RE4C 1JCDA 1OVVA 3CI9A 1GK4A 1HH0A 1LTBC 5AW1B 3L75E 2AXTH 3KZIE 3SFEC 3BASA 1HVVA 4XE5B 3OA7A 3ABVC 1WT6A 2A06E 2K88A 2JWAA 1LWUA 3GW6A 3H1JD 1AVOA 2GUSA 1FDIA 5AVSB 1DEBA 1BCCE 1Y47A 3M06A 4U7JA 1PPJG 3L73D 2E74C 5KLVJ 4ASWA 2WMMA 4C7NB 4H13B 3B71A 2YIUC 2Y9YA 2MJZA 4UB8H 3PJSK 3H1KD 1ZRTE 1M56D 3CC4P 1JMBA 1LTIC 4TT3H 3HTKB 2QIWA 2RH0A 1NAYA 1P84H 1GDTA 3LIDA 3CPWO 3HD7A 1K05A 1IFJA 1WMKA 1VQKP 4K35A 4JBZA 3H1LD 3W68A 1HBWA 1M8OB 2M8RA 5CMZA 1SQQD 2D2CD 1LTGC 3AEDC 1OW6A 3L71E 1H88A 5CBNA 1J1EB 4W80A 1OFCX 4JF7A 1Q7YQ 3A7OA 5KLVE 3HUSA 4H44D 5KAFE 1L4AC 1SQVK 3L72J 3NXSA 1GK6A 2B9BA 1N2DC 2E75D 1CZQA 3D6ZA 2A45I 3D71A 3L73G 3AEFC 4EOTA 1YITP 1SLQA 2FXMA 1FZGA 1KILE 2JEEA 5KKZC 1KFNA 2M3BA 5AVYB 2NPSA 4R4MA 4OVNF 5CBOA 2G3AA 1NKNA 4ASVA 3I56P 2Y0CA 3WUTA 3H1KG 1KD1Q 1IFDA 1K04A 3RK3C 3CCQP 1EXJA 1HF9A 1KB9I 3D6YA 1NOHA 2JR8A 2Z5HA 1K73Q 2QRXA 2PRRA 1LTJC 4M3LA 1G1IA 3PRJA 5CCGD 3FX0A 3F5HA 2C9LY 1SS1A 2YXQB 2H89C 3C8VA 5KAFH 4NPFX 3VTPC 2GM4A 1RF1B 3H1ID 2OTLP 1IFIA 2OARA 4GKGA 1S1CX 4C7NA 3CWBG 4LC1A 2ITAA 3L36A 2CK3H 2QEXP 1GL2A 3RL0D 5APYA 3TDKA 1ZOYC 3AE8C 5KLVK 1U57A 4N3YB 1NYHA 1MUUA 1SQXG 4L75A 1BGYD 3NTNA 5GTIH 1DD4A 3RK2B 1OZHA 1PPJE 3H1JJ 4D6TD 1RH5B 1ZMEC 1SQBK 3B8EB 2JJLA 4MN4C 4JYCA 4EYYQ 2C0XA 4PV1D 5TISE 3L73J 1QVFO 3AECC 4OWFA 3SWKA 2K1AA 1JNMA 1Q81Q 1S4XA 1P84D 1X22A 5B5EE 2P67A 1SQVD 5DJUB 2FBWC 1FJPA 1G2CB 2E5YA 4C46A 2ZT9B 1YTZT 1M1JC 3H1IG 3M9HA 1RY3A 3S9OA 3H1KJ 1AV1A 3V2RA 1SQPK 3H32B 5CCHD 3E1RA 3GMAA 1NU1G 1AQTA 1KQSO 3H1LJ 1AQ5A 5H2FE 3H1JE 1T8ZA 1KZUB 1SQQJ 1G1JA 1A02F 3MHVA 1BGYG 5KJ7D 2OYOA 4IFDK 1NTZD 2L91A 3L73E 4W7ZA 1GD2E 1LTSC 3CLQA 2O1JA 3MGNA 1URQC 3GG2A 4IL6H 3AE2C 1S5LE 1IJDB 1OVUA 3N7NA 3H1KE 1VF5C 3KHUA 4LGDE 2R5DA 1SQVG 1GTWA 3BATA 4KJMA 1DX7A 1KB9D 3B5NA 5APWA 1RF1A 1FZCC 2FFDC 1IZNB 3H1LE 4PD4I 3GLMA 1S9KD 4I6MC 2A06G 2KIKA 2N9YB 2Q1KA 1DD3A 3QWOC 3TK1A 1KQGB 2N1TC 2W90A 2WPQA 1VQ8P 2BEQD 5AW2B 1VQNP 4EI2A 2E74D 3U59A 1OXZA 1BCCG 5CCGC 3A0BH 1LNQA 2A45G 1J1DB 1SQBD 1X8YA 1FZAA 3CCMP 3EQ2A 3TNUA 3L37A 1JMMA 3CX5H 3IFMA 2PP6A 3H1IJ 3GF7A 2W8ZA 1ZV8A 2K9JB 1SQXE 1LT9C 2E5TA 4ZMDA 1DIPA 2JDIH 1PL5A 2OYHC 2RKLA 2RN0A 2KB7P 5EFWB 2YKOA 2WPRA 1G2CA 5AVVB 1EZVD 1N73C 1UIXA 1BGYJ 1SQPD 2KI7B 2M5AB 3MUDA 3SWFA 1ZP0C 5GTHE 1JY3P 1OW7A 3L72D 2OYIB 3H32A 1VQ9P 4D6TJ 1VQLP 3GHGB 5AW9B 1M57D 5KLVG 3HE4B 3BRTB 2B87B 2DW3A 2WT7B 2AXTE 1CI6A 1S5LX 1MKMA 2O01J 1FDMA 3H1IE 1JEKA 2B88A 1SQQK 1S72P 1SQVJ 1SQBG 1FE6A 4AYCA 1YJ9P 3CCUP 2ZAEB 1J2JB 1R5LA 2FYNB 5CCHC 1SFCB 2Y0EA 1BGYE 2ZVOB 2ZXEB 1VQPP 3V4WA 1FOSF 1KILB 2BCCD 3TSIA 1H89A 3I55P 3M0AA 4D6TE 3HE5B 1IO4A 2ZFCA 1YTZI 2XU6A 1GL2D 1EZVG 1OMIA 4DJGA 3I5CA 1EDLA 1SQPG 2IX7C 1NTZJ 2WSFJ 5GTHH 3LW5J 1BSNA 1LWUC 3AEBC 1NVOA 3L72G 1S3JA 3Q5SA 2JKVA 2LKMA 2FY8A 5KLIB 1P84E 2E76C 1RE3A 1VQ5P 2R44A 1FU1A 1SQVE 2WSCJ 3A2AA 1JUNA 4HYTB 3E7KA 5CHXA 1JY2N 4PD4D 2YMKA 1NHLA 1L4AB 1L0NJ 3P8CD 3G3ZA 4YPCA 3U1AA 3FXEA 2KZJA 1T3UA 2P7JA 2K9JA 3V2QA 5APTA 3KDPB 3M9QA 5KKZB 1RF0A 5TJHA 5KAIE 3HD7C 2K9YA 1NTZE 3L35A 1PGQA 1N7SB 2KLVA 1VQMP 2JO1A 4OGQC 3CX5D 2BCCG 2ZXXA 1BDCA 4IFMA 2M5AA 2QG4A 3CMAP 2OYIA 2Q3IA 1PFIA 5APQA 1U7JA 1SQBJ 3GHGA 2O01H 3HUSC 1A02J 3HE4A 1QX8A 2QJKB 2B87A 2QM8A 3VP9A 4WY4A 1YIJP 4H0LB 2WT7A 3FWLA 2K3RA 4HH2A 1KB9E 3CXHI 4AUWA 2KOGA 2IFMA 5AVUB 1RHZB 1NTMK 1JY3O 3F89A 1S9KE 3MZWB 3P8MC 2YKPA 1ZXGA 2NPSC 3H1JG 2ZVNB 1SQPJ 1YQ4C 1N7LA 3B5ND 1KQFB 1PV3A 1SFCA 1USDA 3CMEP 1T6AA 2H88C 1URQD 4RKUJ 2WWWA 5KAIH 2HG5D 2KXPB 1KILA 3BCCD 2WSFH 1LTTC 3LW5H 2QJPB 2A45H 3CCEP 3HE5A 1SQBE 1MZ9A 4BWNA 1EC5A 4Z1MH 1L0LJ 1VF5D 1VQ4P 3B4SA 3MD0A 1H0TA 4AQRD 2WSCH 2QJYB 5GTIE 3VN0A 3WUUA 2H43A 1AJYA 1EQ7A 1VL2A 3CCJP 5AW6B 2FXOA 1NTZK 3TGUD 4RESB 2O3JA 1GW4A 4HJGH 3LIEA 2N1TD 1EZVE 1U7MA 3H1LG 1KB9H 3WU2H 1NTKK 3V5BA 1SQPE 4H13C 2YXRB 1SQQG 2QSIA 4Y99B 4WWIA 3L72E 2RMZA 2KUBA 1GL2C 2BCCJ 4I7ZB 2XZRA 3BVHA 1L0NK 2KSJA 1GU5A 4N78D 1BDDA 1LT1A 3EFFK 1FBMA 4LLHA 1EDJA 2NZ2A 3G9RA 2D2CB 2KYVA 3HRNA 3PTZA 3OAKA 2ZYDA 2Z5IA 1N7SA 3USSA 3SWYA 4H44B 4N6JA 2NRGA 2ZYAA 3EFGA 2G8YA 3KXDA 2E75B 3RK3E 3Q5PA 1J1EC 4K3AA 4WVZA 1HGZA 1FZEA 3AE7C 3HTKA 4L74A 3Q3DA 2Z4EA 3CD6P 3TGUG 1QL1A 3VMAA 2BCCE 4IL6E 1NTMD 4WBAA 3A3YB 5AW5B 5AW3B 3PH0A 3W67A 2KZIA 4YXDC 4GOFA 5AVZB 1SVFA 2Y9ZA 4KHXA 1HUCA 1NKZB 1SP4A 3CC2P 3CXHD 1EDKA 1JO5A 2IFNA 4QMAA 2KSEA 2FKWB 3P8CE 3H1HJ 3N4XA 1CW5A 1NWQA 1NH4A 1Y8AA 2L5GB 3JCUH 2CPBA 1KYOI 1KQLA 3L70D 2SPZA 3A0BE 2XNDH 1CSBA 1HJ0A 3AE5C 1L0LK 3G71P 2FYUK 3B5NC 1RF1C 2IBZI 2C9NY 3RL0B 4D6TG 2LR2A 4C7RA 3CX5E 2OYHB 1NTKD 3V2NA 1NTMG 2I1JA 2E76D 3ITKA 4YTPC 4W7YA 3AE6C 2V7QH 1ZLLA 1ZW0A 3BCCJ 1FZBA 1L0ND 4DOJA 2E43A 1LGHB 3OJAB 1M7LA 5AW0B 2W27A 2IZ0A 3RK2C 4PV1B 2POHA 2K37A 3IF4A 1ZRTD 1IFPA 4CPGA 2YO2A 4PD4H 1SQQE 3U1CA 1AVYA 3TGUJ 3JC22 1QEXA 3M0DA 4U3FD 1QL2A 3G4SP 2Q7CA 3HD7D 4WY4D 4YXWH 1YHQP 2WVRA 4IL6X 2HODB 4OGQD 3L70G
chains in the Genus database with same CATH topology
1EDLA 4ZNCA 3ZDMA 2JWDA 2K3RA 1Q2NA 4GODA 4ZMDA 1NVOA 1BDDA 1LT1A 1S3JA 3FXDA 2RKLA 2OTKE 2KS1B 1DEEG 5EFWB 1EDJA 3MZWB 1X0TA 2SPZA 2UWJE 2LXBA 2R44A 1ZXGA 4HKZH 2KI7B 2M5AB 1OVUA 2P58A 1LP1A 4IOIH 5C39A 5K5GB 1Y47A 5CBOA 2LR2A 1EDIA 4MN4C 4KJMA 2LXCB 4ASVA 4EYYQ 4ASWA 2WMMA 4K3AA 2B87B 3RGUA 3FXEA 2KZJA 1EC5A 1ZW0A 2KIKA 4HB1A 2Q1KA 3QWOC 2HR3A 5DJUB 1H0TA 2B88A 2QVAA 2QRXA 4GOEA 1MFTA 1OVRA 3S1KA 4NPDA 3PH0A 1JMBA 4NPEA 2KZIA 4CPGA 2ZAEB 1JM0A 1BDCA 1LP1B 4K35A 4JBZA 2M5AA 1H0TB 1SS1A 2B89A 4GOFA 4HJGH 4BXLA 1FC2C 1U7MA 4NPFX 5DJTB 1U7JA 1EDKA 3MHVA 4WWIA 2M0BA 2KUBA 2I8DA 1OVVA 5CBNA 2B87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDL A;  4ZNC A;  3ZDM A;  2JWD A;  2K3R A;  1Q2N A;  4GOD A;  4ZMD A;  1NVO A;  1BDD A;  1LT1 A;  1S3J A;  3FXD A;  2RKL A;  2OTK E;  2KS1 B;  1DEE G;  5EFW B;  1EDJ A;  3MZW B;  1X0T A;  2SPZ A;  2UWJ E;  2LXB A;  2R44 A;  1ZXG A;  4HKZ H;  2KI7 B;  2M5A B;  1OVU A;  2P58 A;  1LP1 A;  4IOI H;  5C39 A;  5K5G B;  1Y47 A;  5CBO A;  2LR2 A;  1EDI A;  4MN4 C;  4KJM A;  2LXC B;  4ASV A;  4EYY Q;  4ASW A;  2WMM A;  4K3A A;  2B87 B;  3RGU A;  3FXE A;  2KZJ A;  1EC5 A;  1ZW0 A;  2KIK A;  4HB1 A;  2Q1K A;  3QWO C;  2HR3 A;  5DJU B;  1H0T A;  2B88 A;  2QVA A;  2QRX A;  4GOE A;  1MFT A;  1OVR A;  3S1K A;  4NPD A;  3PH0 A;  1JMB A;  4NPE A;  2KZI A;  4CPG A;  2ZAE B;  1JM0 A;  1BDC A;  1LP1 B;  4K35 A;  4JBZ A;  2M5A A;  1H0T B;  1SS1 A;  2B89 A;  4GOF A;  4HJG H;  4BXL A;  1FC2 C;  1U7M A;  4NPF X;  5DJT B;  1U7J A;  1EDK A;  3MHV A;  4WWI A;  2M0B A;  2KUB A;  2I8D A;  1OVV A;  5CBN A;  2B87 A; 
#chains in the Genus database with same CATH topology
 3L71 D;  5B66 E;  4GT1 A;  1NTZ G;  2XV5 A;  1YJW P;  1PGO A;  4O9B A;  4L73 A;  2HYN A;  1YBK A;  3MUD C;  1PP9 D;  1NTK G;  1HGV A;  2YKQ A;  3OW2 O;  5E79 H;  4XFJ A;  1L0N G;  3AE4 C;  1LWU B;  2WTY A;  1IC2 A;  1D7M A;  1FS0 E;  1K8A Q;  1Q82 Q;  2AEF A;  3TGU E;  3VP8 A;  4JYB A;  1MV8 A;  4GIF A;  2PFX A;  4JPZ B;  2N9B A;  2NPS D;  4L76 A;  4RO0 A;  4DZO A;  1OWA A;  2M3E A;  5AVQ B;  5AVR B;  3SSU A;  2FYZ A;  1NTM J;  2IPP A;  4NPE A;  1M1K Q;  4N78 E;  5KTB A;  3IR9 A;  1Z56 A;  2J59 M;  2P2U A;  1L0L D;  4DCK A;  2QE7 H;  2FYU D;  5B66 H;  2I1K A;  3Q5R A;  3JSV C;  2GA1 A;  3O6Q B;  3L74 D;  1L2P A;  2E74 B;  3AE1 C;  2M0B A;  1AA0 A;  1KYO D;  2YIU B;  4ZKU A;  1RE3 C;  3R4Y A;  3SFD C;  1UII A;  4H13 D;  3M91 A;  1RQU A;  1VQ6 P;  2IBZ D;  1LTA C;  2IZ1 A;  3MTU E;  1KFM A;  2XDJ A;  3L70 J;  1J1D C;  1NTM E;  2KNC B;  2YO3 A;  4B86 A;  2BAS A;  3NMD A;  1NTK J;  3FGA D;  2Q9I A;  2HOD A;  2GUV A;  1RF0 C;  1R5S A;  1N8R Q;  1L0L G;  2OTJ P;  5BU5 A;  3D70 A;  1JB0 J;  1BSH A;  1NAF A;  1BE3 D;  1FAV A;  3L74 G;  2OYI C;  4UB6 H;  5KJ7 A;  2B89 A;  3GHG C;  1MFZ A;  3C1L A;  3TYY A;  3L70 E;  4BRY B;  1YI2 P;  1GW3 A;  2KK7 A;  4WY4 C;  2BEZ F;  2J5U A;  4U3F J;  1KMI Z;  1Q86 Q;  3CCL P;  3IAO A;  2IBZ G;  3RK3 B;  2P10 A;  2JWD A;  1RE4 A;  1NTK E;  3L71 J;  4GOD A;  2KS1 B;  1GU4 A;  3CCV P;  2UWJ E;  1LTJ B;  2FYN C;  2IDB A;  1L0N E;  1PP9 J;  3C9I A;  3R2P A;  1NU1 K;  1SFC C;  3H1H D;  1GL2 B;  4I1L A;  2H8P D;  3WU2 E;  2R3C A;  1KIL C;  3CXH H;  1P84 I;  3UIA A;  4Y28 J;  1VQO P;  3O6Q A;  1IFN A;  1BE3 G;  4U3F E;  3II6 A;  1QLE D;  3K5B A;  2JP3 A;  2YNY A;  3G6E P;  1EXI A;  3KZI H;  2HR3 A;  3AEG C;  5KLI C;  1VQ7 P;  2MKV A;  2HPC B;  2WPS A;  2Q5U A;  2AEM A;  1T2K C;  1Y9B A;  2WZ7 A;  3AE9 C;  3RBZ A;  1S2E A;  2QA4 P;  1FZF A;  1QGK B;  3A5T A;  1PP9 E;  2KNC A;  2FYU J;  5DJT B;  1AFO A;  3CWB D;  2Q6Q A;  3RK2 D;  3L74 J;  1USE A;  2W6A A;  4EDF A;  1VPC A;  3H1H G;  1K9M Q;  1Q2N A;  1SQX D;  1JY2 O;  3FXD A;  1LJ2 A;  2OTK E;  3CC7 P;  2WPV B;  1DEE G;  2VRS A;  1L4A A;  1N7S C;  1FJK A;  2O1K A;  2HLO A;  3O8Z A;  2CPS A;  1M1J B;  1NJI Q;  3EWK A;  2P58 A;  1NGM B;  2C0W A;  3CL3 D;  2V7Q J;  2ZT9 D;  2QM7 A;  2V4H A;  4BRY A;  5BVZ A;  2QJK C;  1L0L E;  4H0L C;  2FYU E;  3AE3 C;  1ZR2 A;  1RQV A;  1KC8 Q;  3BCC G;  1DH3 A;  1PGP A;  3RBX A;  3B5N B;  3L74 E;  3JCU E;  2ZYG A;  1W2E A;  3M9B A;  2KS1 A;  1URQ B;  1KYO E;  2WSE J;  3AEA C;  2AXC A;  1LTJ A;  1JM0 A;  1BE3 J;  1NU1 D;  3RL0 g;  3H6P A;  3VMY A;  3BRV B;  2IBZ E;  1VF5 B;  5AVW B;  3V6I A;  2QJP C;  3VYI A;  1FZC B;  1KTM A;  2FFD B;  4ZNC A;  3ZDM A;  2OQQ A;  1EZV I;  5APU A;  5AW8 B;  3TNU B;  2O01 N;  1JTH B;  5APV A;  2QJY C;  2N1T B;  2W6J H;  3QH9 A;  1ZR4 A;  3VMZ A;  2HPC A;  3WMM 0;  5AW4 B;  3PP5 A;  4PJ0 E;  1YJN P;  2WIT A;  2LXB A;  1XTG B;  3NFQ A;  4TLF A;  3VOP A;  4PD4 E;  2YMY A;  3MIW A;  3WUV A;  2J58 A;  1HWT C;  2W6B A;  5K5G B;  1BE3 E;  4I2L C;  5CJ4 A;  3L75 D;  4Y99 C;  1EDI A;  2LXC B;  1X9V A;  4I7Z C;  1PIX A;  2A06 D;  1KOR A;  1KYO H;  1M90 Q;  4A7P A;  3KQG A;  1PGJ A;  1JOC A;  2KP8 A;  1LT9 B;  2D2C C;  3KPE A;  1MFT A;  4DT0 A;  1BCC D;  3S1K A;  1X79 B;  4XA4 A;  2AEJ A;  3IN6 A;  1CI6 B;  1YYC A;  3V4Q A;  1GMJ A;  3GF3 A;  1N73 B;  2WSS H;  4H44 C;  1LP1 B;  3M0D C;  1M1J A;  5E79 E;  1FOS E;  1WRG A;  2IYO A;  4BXL A;  1FC2 C;  4R4L A;  2WQY C;  2E75 C;  3A0H E;  1PZQ A;  2Q3E A;  3H1H E;  3T97 B;  3AEE C;  5TIS H;  5APS A;  2I8D A;  3CWB J;  1OW8 A;  4PJ0 H;  2PGD A;  5AW7 B;  5B5E H;  2WSE H;  1SQX J;  1JCC A;  4RJT A;  3L75 G;  1URQ A;  4HKZ H;  1TU3 F;  1YQ3 C;  1OX3 A;  4IOI H;  5C39 A;  2FXP A;  5KLV D;  2ZT9 C;  1H8A A;  1XTC C;  3BCC E;  5H2F H;  3RGU A;  5L8R J;  4GDO A;  5BU8 B;  1SFC D;  1FZC A;  4HB1 A;  2FFD A;  2XNX A;  3S4R A;  3CWB E;  4JQ0 D;  1QVG O;  3CX5 I;  3TF5 A;  3L4F A;  2PAJ A;  1IK9 A;  1IFM A;  1KIL D;  2HFE D;  1JTH A;  1N86 A;  2N1T A;  3A0H H;  1S5L H;  2E76 B;  4EIJ A;  3VMX A;  3RL0 C;  5CCG A;  1NU1 J;  1IK7 A;  1GZL A;  1W5C E;  2ZJS E;  5AVX B;  4U3F G;  5APX A;  3Q1M A;  1T2K D;  2P1J A;  3KYQ A;  1L4A D;  3Q2Y A;  3CCR P;  4OH8 B;  3L71 G;  3E1I A;  5CJ0 A;  1HTL C;  1LT9 A;  4PV1 C;  1X0T A;  1NO4 A;  1VDF A;  2OYH A;  3HD7 B;  4WY4 B;  3FWN A;  2OGU A;  4UB6 E;  1PP9 G;  2Y0D A;  2E42 A;  1E5W A;  1Q90 D;  3PHL A;  4OGQ B;  1N73 A;  1LP1 A;  1HJB A;  1JY3 N;  2R5B A;  4ZKP A;  3P32 A;  1W2B O;  1N7S D;  2R32 A;  3V2P A;  1NU1 E;  3L75 J;  1R8E A;  3H25 A;  3MP7 B;  1E79 H;  3T97 A;  3RK3 D;  3HUS B;  1JY2 P;  1FDO A;  2R3S A;  1KN7 A;  2W83 C;  1PPJ D;  1T3J A;  1KV4 A;  4KT0 J;  2QVA A;  4GOE A;  4WB4 A;  1OIP A;  1OVR A;  4NPD A;  3PLN A;  2IYP A;  1BCC J;  5KJ7 C;  3CCS P;  3P7K A;  4H0L D;  2XKM A;  4UB8 E;  5AVT B;  1H0T B;  2H7H A;  2NPS B;  1SQX K;  2KLU A;  3CXH E;  4IFF A;  5CCH A;  2FYU G;  5M1B A;  1ZN5 A;  1RE4 C;  1JCD A;  1OVV A;  3CI9 A;  1GK4 A;  1HH0 A;  1LTB C;  5AW1 B;  3L75 E;  2AXT H;  3KZI E;  3SFE C;  3BAS A;  1HVV A;  4XE5 B;  3OA7 A;  3ABV C;  1WT6 A;  2A06 E;  2K88 A;  2JWA A;  1LWU A;  3GW6 A;  3H1J D;  1AVO A;  2GUS A;  1FDI A;  5AVS B;  1DEB A;  1BCC E;  1Y47 A;  3M06 A;  4U7J A;  1PPJ G;  3L73 D;  2E74 C;  5KLV J;  4ASW A;  2WMM A;  4C7N B;  4H13 B;  3B71 A;  2YIU C;  2Y9Y A;  2MJZ A;  4UB8 H;  3PJS K;  3H1K D;  1ZRT E;  1M56 D;  3CC4 P;  1JMB A;  1LTI C;  4TT3 H;  3HTK B;  2QIW A;  2RH0 A;  1NAY A;  1P84 H;  1GDT A;  3LID A;  3CPW O;  3HD7 A;  1K05 A;  1IFJ A;  1WMK A;  1VQK P;  4K35 A;  4JBZ A;  3H1L D;  3W68 A;  1HBW A;  1M8O B;  2M8R A;  5CMZ A;  1SQQ D;  2D2C D;  1LTG C;  3AED C;  1OW6 A;  3L71 E;  1H88 A;  5CBN A;  1J1E B;  4W80 A;  1OFC X;  4JF7 A;  1Q7Y Q;  3A7O A;  5KLV E;  3HUS A;  4H44 D;  5KAF E;  1L4A C;  1SQV K;  3L72 J;  3NXS A;  1GK6 A;  2B9B A;  1N2D C;  2E75 D;  1CZQ A;  3D6Z A;  2A45 I;  3D71 A;  3L73 G;  3AEF C;  4EOT A;  1YIT P;  1SLQ A;  2FXM A;  1FZG A;  1KIL E;  2JEE A;  5KKZ C;  1KFN A;  2M3B A;  5AVY B;  2NPS A;  4R4M A;  4OVN F;  5CBO A;  2G3A A;  1NKN A;  4ASV A;  3I56 P;  2Y0C A;  3WUT A;  3H1K G;  1KD1 Q;  1IFD A;  1K04 A;  3RK3 C;  3CCQ P;  1EXJ A;  1HF9 A;  1KB9 I;  3D6Y A;  1NOH A;  2JR8 A;  2Z5H A;  1K73 Q;  2QRX A;  2PRR A;  1LTJ C;  4M3L A;  1G1I A;  3PRJ A;  5CCG D;  3FX0 A;  3F5H A;  2C9L Y;  1SS1 A;  2YXQ B;  2H89 C;  3C8V A;  5KAF H;  4NPF X;  3VTP C;  2GM4 A;  1RF1 B;  3H1I D;  2OTL P;  1IFI A;  2OAR A;  4GKG A;  1S1C X;  4C7N A;  3CWB G;  4LC1 A;  2ITA A;  3L36 A;  2CK3 H;  2QEX P;  1GL2 A;  3RL0 D;  5APY A;  3TDK A;  1ZOY C;  3AE8 C;  5KLV K;  1U57 A;  4N3Y B;  1NYH A;  1MUU A;  1SQX G;  4L75 A;  1BGY D;  3NTN A;  5GTI H;  1DD4 A;  3RK2 B;  1OZH A;  1PPJ E;  3H1J J;  4D6T D;  1RH5 B;  1ZME C;  1SQB K;  3B8E B;  2JJL A;  4MN4 C;  4JYC A;  4EYY Q;  2C0X A;  4PV1 D;  5TIS E;  3L73 J;  1QVF O;  3AEC C;  4OWF A;  3SWK A;  2K1A A;  1JNM A;  1Q81 Q;  1S4X A;  1P84 D;  1X22 A;  5B5E E;  2P67 A;  1SQV D;  5DJU B;  2FBW C;  1FJP A;  1G2C B;  2E5Y A;  4C46 A;  2ZT9 B;  1YTZ T;  1M1J C;  3H1I G;  3M9H A;  1RY3 A;  3S9O A;  3H1K J;  1AV1 A;  3V2R A;  1SQP K;  3H32 B;  5CCH D;  3E1R A;  3GMA A;  1NU1 G;  1AQT A;  1KQS O;  3H1L J;  1AQ5 A;  5H2F E;  3H1J E;  1T8Z A;  1KZU B;  1SQQ J;  1G1J A;  1A02 F;  3MHV A;  1BGY G;  5KJ7 D;  2OYO A;  4IFD K;  1NTZ D;  2L91 A;  3L73 E;  4W7Z A;  1GD2 E;  1LTS C;  3CLQ A;  2O1J A;  3MGN A;  1URQ C;  3GG2 A;  4IL6 H;  3AE2 C;  1S5L E;  1IJD B;  1OVU A;  3N7N A;  3H1K E;  1VF5 C;  3KHU A;  4LGD E;  2R5D A;  1SQV G;  1GTW A;  3BAT A;  4KJM A;  1DX7 A;  1KB9 D;  3B5N A;  5APW A;  1RF1 A;  1FZC C;  2FFD C;  1IZN B;  3H1L E;  4PD4 I;  3GLM A;  1S9K D;  4I6M C;  2A06 G;  2KIK A;  2N9Y B;  2Q1K A;  1DD3 A;  3QWO C;  3TK1 A;  1KQG B;  2N1T C;  2W90 A;  2WPQ A;  1VQ8 P;  2BEQ D;  5AW2 B;  1VQN P;  4EI2 A;  2E74 D;  3U59 A;  1OXZ A;  1BCC G;  5CCG C;  3A0B H;  1LNQ A;  2A45 G;  1J1D B;  1SQB D;  1X8Y A;  1FZA A;  3CCM P;  3EQ2 A;  3TNU A;  3L37 A;  1JMM A;  3CX5 H;  3IFM A;  2PP6 A;  3H1I J;  3GF7 A;  2W8Z A;  1ZV8 A;  2K9J B;  1SQX E;  1LT9 C;  2E5T A;  4ZMD A;  1DIP A;  2JDI H;  1PL5 A;  2OYH C;  2RKL A;  2RN0 A;  2KB7 P;  5EFW B;  2YKO A;  2WPR A;  1G2C A;  5AVV B;  1EZV D;  1N73 C;  1UIX A;  1BGY J;  1SQP D;  2KI7 B;  2M5A B;  3MUD A;  3SWF A;  1ZP0 C;  5GTH E;  1JY3 P;  1OW7 A;  3L72 D;  2OYI B;  3H32 A;  1VQ9 P;  4D6T J;  1VQL P;  3GHG B;  5AW9 B;  1M57 D;  5KLV G;  3HE4 B;  3BRT B;  2B87 B;  2DW3 A;  2WT7 B;  2AXT E;  1CI6 A;  1S5L X;  1MKM A;  2O01 J;  1FDM A;  3H1I E;  1JEK A;  2B88 A;  1SQQ K;  1S72 P;  1SQV J;  1SQB G;  1FE6 A;  4AYC A;  1YJ9 P;  3CCU P;  2ZAE B;  1J2J B;  1R5L A;  2FYN B;  5CCH C;  1SFC B;  2Y0E A;  1BGY E;  2ZVO B;  2ZXE B;  1VQP P;  3V4W A;  1FOS F;  1KIL B;  2BCC D;  3TSI A;  1H89 A;  3I55 P;  3M0A A;  4D6T E;  3HE5 B;  1IO4 A;  2ZFC A;  1YTZ I;  2XU6 A;  1GL2 D;  1EZV G;  1OMI A;  4DJG A;  3I5C A;  1EDL A;  1SQP G;  2IX7 C;  1NTZ J;  2WSF J;  5GTH H;  3LW5 J;  1BSN A;  1LWU C;  3AEB C;  1NVO A;  3L72 G;  1S3J A;  3Q5S A;  2JKV A;  2LKM A;  2FY8 A;  5KLI B;  1P84 E;  2E76 C;  1RE3 A;  1VQ5 P;  2R44 A;  1FU1 A;  1SQV E;  2WSC J;  3A2A A;  1JUN A;  4HYT B;  3E7K A;  5CHX A;  1JY2 N;  4PD4 D;  2YMK A;  1NHL A;  1L4A B;  1L0N J;  3P8C D;  3G3Z A;  4YPC A;  3U1A A;  3FXE A;  2KZJ A;  1T3U A;  2P7J A;  2K9J A;  3V2Q A;  5APT A;  3KDP B;  3M9Q A;  5KKZ B;  1RF0 A;  5TJH A;  5KAI E;  3HD7 C;  2K9Y A;  1NTZ E;  3L35 A;  1PGQ A;  1N7S B;  2KLV A;  1VQM P;  2JO1 A;  4OGQ C;  3CX5 D;  2BCC G;  2ZXX A;  1BDC A;  4IFM A;  2M5A A;  2QG4 A;  3CMA P;  2OYI A;  2Q3I A;  1PFI A;  5APQ A;  1U7J A;  1SQB J;  3GHG A;  2O01 H;  3HUS C;  1A02 J;  3HE4 A;  1QX8 A;  2QJK B;  2B87 A;  2QM8 A;  3VP9 A;  4WY4 A;  1YIJ P;  4H0L B;  2WT7 A;  3FWL A;  2K3R A;  4HH2 A;  1KB9 E;  3CXH I;  4AUW A;  2KOG A;  2IFM A;  5AVU B;  1RHZ B;  1NTM K;  1JY3 O;  3F89 A;  1S9K E;  3MZW B;  3P8M C;  2YKP A;  1ZXG A;  2NPS C;  3H1J G;  2ZVN B;  1SQP J;  1YQ4 C;  1N7L A;  3B5N D;  1KQF B;  1PV3 A;  1SFC A;  1USD A;  3CME P;  1T6A A;  2H88 C;  1URQ D;  4RKU J;  2WWW A;  5KAI H;  2HG5 D;  2KXP B;  1KIL A;  3BCC D;  2WSF H;  1LTT C;  3LW5 H;  2QJP B;  2A45 H;  3CCE P;  3HE5 A;  1SQB E;  1MZ9 A;  4BWN A;  1EC5 A;  4Z1M H;  1L0L J;  1VF5 D;  1VQ4 P;  3B4S A;  3MD0 A;  1H0T A;  4AQR D;  2WSC H;  2QJY B;  5GTI E;  3VN0 A;  3WUU A;  2H43 A;  1AJY A;  1EQ7 A;  1VL2 A;  3CCJ P;  5AW6 B;  2FXO A;  1NTZ K;  3TGU D;  4RES B;  2O3J A;  1GW4 A;  4HJG H;  3LIE A;  2N1T D;  1EZV E;  1U7M A;  3H1L G;  1KB9 H;  3WU2 H;  1NTK K;  3V5B A;  1SQP E;  4H13 C;  2YXR B;  1SQQ G;  2QSI A;  4Y99 B;  4WWI A;  3L72 E;  2RMZ A;  2KUB A;  1GL2 C;  2BCC J;  4I7Z B;  2XZR A;  3BVH A;  1L0N K;  2KSJ A;  1GU5 A;  4N78 D;  1BDD A;  1LT1 A;  3EFF K;  1FBM A;  4LLH A;  1EDJ A;  2NZ2 A;  3G9R A;  2D2C B;  2KYV A;  3HRN A;  3PTZ A;  3OAK A;  2ZYD A;  2Z5I A;  1N7S A;  3USS A;  3SWY A;  4H44 B;  4N6J A;  2NRG A;  2ZYA A;  3EFG A;  2G8Y A;  3KXD A;  2E75 B;  3RK3 E;  3Q5P A;  1J1E C;  4K3A A;  4WVZ A;  1HGZ A;  1FZE A;  3AE7 C;  3HTK A;  4L74 A;  3Q3D A;  2Z4E A;  3CD6 P;  3TGU G;  1QL1 A;  3VMA A;  2BCC E;  4IL6 E;  1NTM D;  4WBA A;  3A3Y B;  5AW5 B;  5AW3 B;  3PH0 A;  3W67 A;  2KZI A;  4YXD C;  4GOF A;  5AVZ B;  1SVF A;  2Y9Z A;  4KHX A;  1HUC A;  1NKZ B;  1SP4 A;  3CC2 P;  3CXH D;  1EDK A;  1JO5 A;  2IFN A;  4QMA A;  2KSE A;  2FKW B;  3P8C E;  3H1H J;  3N4X A;  1CW5 A;  1NWQ A;  1NH4 A;  1Y8A A;  2L5G B;  3JCU H;  2CPB A;  1KYO I;  1KQL A;  3L70 D;  2SPZ A;  3A0B E;  2XND H;  1CSB A;  1HJ0 A;  3AE5 C;  1L0L K;  3G71 P;  2FYU K;  3B5N C;  1RF1 C;  2IBZ I;  2C9N Y;  3RL0 B;  4D6T G;  2LR2 A;  4C7R A;  3CX5 E;  2OYH B;  1NTK D;  3V2N A;  1NTM G;  2I1J A;  2E76 D;  3ITK A;  4YTP C;  4W7Y A;  3AE6 C;  2V7Q H;  1ZLL A;  1ZW0 A;  3BCC J;  1FZB A;  1L0N D;  4DOJ A;  2E43 A;  1LGH B;  3OJA B;  1M7L A;  5AW0 B;  2W27 A;  2IZ0 A;  3RK2 C;  4PV1 B;  2POH A;  2K37 A;  3IF4 A;  1ZRT D;  1IFP A;  4CPG A;  2YO2 A;  4PD4 H;  1SQQ E;  3U1C A;  1AVY A;  3TGU J;  3JC2 2;  1QEX A;  3M0D A;  4U3F D;  1QL2 A;  3G4S P;  2Q7C A;  3HD7 D;  4WY4 D;  4YXW H;  1YHQ P;  2WVR A;  4IL6 X;  2HOD B;  4OGQ D;  3L70 G; 
#chains in the Genus database with same CATH homology
 1EDL A;  4ZNC A;  3ZDM A;  2JWD A;  2K3R A;  1Q2N A;  4GOD A;  4ZMD A;  1NVO A;  1BDD A;  1LT1 A;  1S3J A;  3FXD A;  2RKL A;  2OTK E;  2KS1 B;  1DEE G;  5EFW B;  1EDJ A;  3MZW B;  1X0T A;  2SPZ A;  2UWJ E;  2LXB A;  2R44 A;  1ZXG A;  4HKZ H;  2KI7 B;  2M5A B;  1OVU A;  2P58 A;  1LP1 A;  4IOI H;  5C39 A;  5K5G B;  1Y47 A;  5CBO A;  2LR2 A;  1EDI A;  4MN4 C;  4KJM A;  2LXC B;  4ASV A;  4EYY Q;  4ASW A;  2WMM A;  4K3A A;  2B87 B;  3RGU A;  3FXE A;  2KZJ A;  1EC5 A;  1ZW0 A;  2KIK A;  4HB1 A;  2Q1K A;  3QWO C;  2HR3 A;  5DJU B;  1H0T A;  2B88 A;  2QVA A;  2QRX A;  4GOE A;  1MFT A;  1OVR A;  3S1K A;  4NPD A;  3PH0 A;  1JMB A;  4NPE A;  2KZI A;  4CPG A;  2ZAE B;  1JM0 A;  1BDC A;  1LP1 B;  4K35 A;  4JBZ A;  2M5A A;  1H0T B;  1SS1 A;  2B89 A;  4GOF A;  4HJG H;  4BXL A;  1FC2 C;  1U7M A;  4NPF X;  5DJT B;  1U7J A;  1EDK A;  3MHV A;  4WWI A;  2M0B A;  2KUB A;  2I8D A;  1OVV A;  5CBN A;  2B87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...