4ZMDA

C domain of staphylococcal protein a mutant - q9w
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
56
structure length
56
Chain Sequence
NKFNKEWQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein A
publication title Suppression of conformational heterogeneity at a protein-protein interface.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 22
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4zmdA00
1LT1A 1OVRA 2UWJE 2KZJA 5DJTB 1Q2NA 1LP1A 2KZIA 3PH0A 4JBZA 1SS1A 1OVUA 1EDLA 2OTKE 4GOEA 1NVOA 4GODA 1U7MA 4HB1A 4MN4C 2KUBA 1BDDA 2M0BA 2LXBA 4ZMDA 1MFTA 3MZWB 2QRXA 4NPEA 3ZDMA 5CBNA 4HKZH 1BDCA 2KIKA 2SPZA 1ZW0A 2P58A 1JMBA 4KJMA 2HR3A 2K3RA 4CPGA 1H0TB 2KI7B 2Q1KA 1Y47A 1H0TA 4HJGH 4EYYQ 1EDJA 2B89A 2LR2A 5K5GB 4BXLA 1FC2C 4K35A 2B87B 3FXEA 4NPDA 5EFWB 1EDIA 3FXDA 1DEEG 2RKLA 5DJUB 5C39A 2WMMA 3S1KA 1U7JA 2R44A 1LP1B 3RGUA 4ZNCA 5CBOA 1ZXGA 3MHVA 4ASVA 4IOIH 2ZAEB 2LXCB 1JM0A 2B87A 1X0TA 4NPFX 3QWOC 1OVVA 2M5AB 4WWIA 4K3AA 2M5AA 2I8DA 1EC5A 2QVAA 4ASWA 1S3JA 2KS1B 2B88A 2JWDA 4GOFA 1EDKA
chains in the Genus database with same CATH superfamily
3D71A 2OYHB 1JO5A 1PGOA 4R4LA 4H0LC 2M8RA 5APUA 1PP9G 2WSEH 1PPJD 4RJTA 4IFFA 1YTZI 1KQSO 4ZMDA 2V7QJ 5AW5B 2D2CD 5KJ7A 2Q7CA 1BCCG 4PD4D 1IK7A 1Q81Q 1SFCC 5APTA 2L91A 5AVTB 1Q90D 3RK3D 3CCMP 2YKQA 1KV4A 2ITAA 5AW8B 1AFOA 1URQB 1Y47A 1L0NJ 1PGPA 1QL1A 1YTZT 1JTHA 1HBWA 3CPWO 5KAIE 2FXMA 1N7SA 5GTIH 3LW5H 1FC2C 4YTPC 1NU1D 4DZOA 1W5CE 5CCGC 3M0DA 3L74J 1FDMA 5AVWB 3SWKA 1FE6A 1MZ9A 4OGQB 1FJPA 2LXCB 2H89C 1MUUA 3B5NA 2FXOA 2N9BA 1K04A 1VQ9P 2XU6A 4H0LB 2Q3IA 5B66E 1JCDA 2GA1A 1YI2P 1E5WA 1GZLA 5AW4B 1SQXG 4JBZA 4A7PA 2C9NY 1EDLA 2OTKE 1SFCB 4GOEA 1NKNA 1L0NK 1U7MA 2FKWB 3AEDC 2HODB 2WSCH 1L2PA 4AQRD 4WB4A 3CX5D 4HKZH 1A02F 2K88A 1OIPA 4W7YA 1OW8A 4RKUJ 3H32A 1YQ4C 1SQPG 2P7JA 4XA4A 3HUSA 1NTKK 4GT1A 5KKZC 3H1KG 3L71G 1M1JC 4RESB 2XV5A 1L0LJ 2M3EA 3L74D 3L70J 2KXPB 1RF0A 1P84D 1T2KC 3G3ZA 1RQUA 3H1JJ 3CWBJ 3M9BA 1LT9C 1SQBG 1T3JA 3HRNA 2ZYGA 1UIIA 2IX7C 1DH3A 4WY4C 1SVFA 1NTZD 3TGUD 1WRGA 2H8PD 2IBZG 3QWOC 2H43A 1SQVD 1IJDB 1USDA 2A06E 4GOFA 4I6MC 2Y0DA 3U1AA 3A5TA 3CMAP 1AA0A 5KAIH 1PPJG 4H13C 3FX0A 3G4SP 1FU1A 2JEEA 3S4RA 3H1LD 1S9KD 3PHLA 1NGMB 1FDOA 2AXCA 2Q5UA 4U3FG 3L36A 1HH0A 1M7LA 1FOSF 1KQLA 5KKZB 3H1KE 2N1TA 3M0AA 1M1JB 2ZYAA 3HD7D 2IZ0A 5AVZB 2WPSA 1CI6A 1U57A 1M90Q 2K9JB 1GW4A 2IPPA 3A2AA 5TJHA 1NU1G 3N4XA 1SQBE 1LT9B 1NKZB 3RL0D 3B8EB 4YPCA 3IF4A 4WY4B 1MKMA 3L75J 3L72D 2JO1A 2IBZE 1HF9A 5APSA 1BGYD 1N86A 5AVRB 1YYCA 3IFMA 1LWUA 3BCCD 3VYIA 2AEFA 2N9YB 1GL2A 1G1IA 4IL6H 2D2CC 2GUVA 3FWLA 5AW9B 2AEMA 1KB9I 4H13B 4WWIA 4BWNA 2QEXP 2I8DA 3GHGA 3OJAB 3RK3C 2ZXXA 1IFDA 2W83C 3FGAD 2YXQB 3F89A 4PD4E 2BCCD 1ZRTE 4N6JA 2FYUD 3JCUE 3SFEC 2YNYA 1T3UA 5AW7B 4N3YB 5H2FH 5CJ0A 3L73E 3HTKA 1ZP0C 2YIUC 3AE3C 1PP9D 2WZ7A 3CC2P 3VMAA 3G71P 2NPSD 2IFMA 4GKGA 3K5BA 3L74G 1XTGB 3RL0g 3V4WA 3W67A 2H88C 5AVUB 2K9YA 2G8YA 2W6JH 2W8ZA 1IC2A 1DEEG 1UIXA 2D2CB 1KYOD 3H1ID 1YBKA 1WMKA 2WMMA 2O1JA 1S72P 1FZBA 4KHXA 3RK3B 1NTZG 3TGUG 1VDFA 1SQVG 3IR9A 1R8EA 1OZHA 2CK3H 2FFDC 2XDJA 4BRYA 1KILD 4I2LC 3H1HE 2OYOA 2KS1B 1S5LX 1OVRA 2UWJE 1IK9A 4XFJA 1RE4A 1SP4A 4IFDK 2JWAA 3O8ZA 4TLFA 2JR8A 2P67A 2WSSH 2YIUB 3H1LG 1JTHB 1H89A 1PGJA 2PAJA 5GTIE 1AJYA 1NTMD 3ZDMA 3RBZA 5CBNA 2PP6A 1YIJP 1GDTA 1HWTC 2SPZA 5BU5A 2WPRA 3A0HH 1DX7A 2K3RA 5AVVB 2OARA 1L0LG 2VRSA 1QVFO 1IFNA 1KFMA 1LTJA 2QJKC 2YO3A 1K73Q 2R5DA 3O6QA 3CWBG 1CW5A 3E1RA 1S2EA 3L72G 3TYYA 3TGUE 1RF1B 3ITKA 3C9IA 1PL5A 3MGNA 2FFDB 1BGYG 1SQQE 2ZFCA 2WSFH 3MP7B 3PP5A 3L4FA 1LGHB 1Q82Q 3V4QA 2POHA 3L71D 3P8CD 1KYOI 3KZIE 5KAFH 4H44C 3GLMA 2WQYC 2M5AA 1ZLLA 1ZV8A 3CD6P 2KLVA 3HD7C 2KZIA 2BCCG 2OYIA 2FYUG 4C7NA 5KTBA 1PIXA 1IZNB 1JOCA 4N78E 3RL0C 3SWFA 1VF5D 5AVQB 1NAYA 2QJKB 1JMBA 2R5BA 5KLVJ 1K05A 2Z4EA 2OTLP 4U3FD 2JDIH 1EZVE 1BGYE 4C46A 2J5UA 3FXEA 3BCCE 3CLQA 4JPZB 2DW3A 5EFWB 3CX5H 4M3LA 3CCSP 3H1IG 2Q6QA 3CCUP 1GL2C 4ZKPA 2Y0CA 3H1HJ 1BE3J 5KJ7D 3OW2O 1LTGC 3AE9C 3HD7B 1W2EA 2C0WA 1IFPA 3AE2C 3IAOA 4D6TE 2BCCE 1OMIA 2C9LY 1P84H 4EIJA 2KYVA 3RL0B 3LW5J 5DJTB 1KMIZ 1N7SD 1SS1A 2ZVOB 5KLVK 1NTKJ 2NPSC 4OVNF 1VQMP 3Q5PA 5APQA 5AVYB 3KHUA 1OFCX 1Y8AA 1PP9E 4PV1D 1RE3C 1NTMG 3M06A 1NOHA 3L37A 1BCCE 3GW6A 3B5ND 2HLOA 3JSVC 3KZIH 3GG2A 3TK1A 2QE7H 1JNMA 3P8MC 3A7OA 5BVZA 1KILC 3D70A 4IL6E 5L8RJ 1FZGA 4K35A 1AQTA 4LC1A 1FJKA 1L0ND 1L4AA 2QJPC 1LTIC 3I5CA 3CCRP 2WSCJ 1ZN5A 2HG5D 4ZNCA 5CBOA 3CCQP 2Y9YA 1TU3F 3CXHI 3KDPB 1X0TA 1L4AD 3E7KA 4WVZA 2NPSB 4YXWH 2RH0A 5H2FE 5AW6B 3WU2H 3U1CA 3P7KA 2GM4A 2I1KA 2B88A 1H88A 2E75D 2KP8A 3HTKB 1KB9D 1Q2NA 4JQ0D 1BSNA 1NTME 2KNCB 1GTWA 1FAVA 1SQXE 1GW3A 4MN4C 4PJ0H 3T97B 1SQQK 1Y9BA 1VL2A 2WVRA 1D7MA 2ZVNB 2ZXEB 2WWWA 1MFZA 3RK2D 1KILB 5KLIC 4HH2A 1H0TB 5CCHA 3NMDA 2K37A 3EFGA 3GMAA 1URQA 3WMM0 1SQPE 4H44D 3NXSA 3F5HA 3CCLP 4LLHA 5CJ4A 3L71E 4BRYB 1PFIA 1GD2E 2WT7A 1QGKB 4D6TJ 5AW3B 2YKPA 1Q7YQ 5CCHD 1RQVA 2QM8A 3EFFK 2R3CA 1L0LD 3S1KA 1OXZA 3L70D 2NRGA 4W7ZA 2JJLA 3H1JD 1R5SA 2ZAEB 2N1TD 3CWBD 1FZEA 1VF5C 3P32A 1JY3O 4IFMA 3M91A 1M8OB 2OYIC 1KFNA 5AVXB 1H8AA 3Q1MA 3CMEP 5APXA 2IFNA 1MV8A 1KYOH 1X8YA 3A0HE 1NWQA 1NVOA 1SFCA 2IDBA 1OW7A 5E79E 3M9QA 1PPJE 2E74D 2FBWC 5KLIB 3MZWB 1VQ8P 1VQNP 5AVSB 4U3FE 2O3JA 1GL2D 1RH5B 4I1LA 2K1AA 1HGVA 5KJ7C 3RK3E 2Q1KA 4B86A 1Z56A 2CPSA 3TNUB 1VQ6P 1LTTC 5CCGA 1M1KQ 3MUDA 5KAFE 1L0NG 4NPDA 3MD0A 1NU1E 3FXDA 2FYZA 1T8ZA 1N7SC 1VF5B 5BU8B 1G2CB 2R3SA 4RO0A 2OYIB 3M0DC 3SWYA 3HE5A 3L75D 4PV1C 1EXIA 3HE4B 1SQXJ 3LIDA 1FZFA 2Q9IA 1LTSC 1NTKG 2LKMA 2PFXA 2P1JA 2KSEA 2P10A 3B5NC 1LNQA 1GMJA 2JP3A 1IFIA 2BEZF 2KK7A 1JY2P 1MFTA 2E76C 2WPVB 3AE6C 4XE5B 1EZVI 1ZW0A 3V5BA 3V6IA 3VMZA 3H1KJ 2HPCA 3CX5E 1M1JA 2HR3A 2BEQD 1HJBA 4CPGA 2XNDH 1KZUB 1L0NE 2XNXA 1LJ2A 1J2JB 1L4AC 1N7SB 1IFMA 1DD4A 1OX3A 1SQXK 1SQBJ 3HUSC 3TSIA 3Q2YA 3L74E 2E75C 4PV1B 1FOSE 3VOPA 1QX8A 2Q3EA 2FYNC 1P84E 2R32A 3R4YA 5E79H 3PLNA 1VQOP 3L70G 3M9HA 2IYOA 1U7JA 1RF0C 4C7RA 3I56P 3CI9A 2AXTH 3WUVA 3H1JG 2ZYDA 3CCEP 3B5NB 4IOIH 1HVVA 2B87A 1KQFB 3AE8C 4NPFX 1JUNA 2YO2A 4OWFA 3KXDA 1NTZE 2A06D 2RMZA 2O01H 1SQPK 1SQVE 3TDKA 1HTLC 3RK2C 1ZR4A 2FXPA 1NYHA 4I7ZC 2KZJA 1N8RQ 4JYCA 2L5GB 3OAKA 1FZAA 2AEJA 2QIWA 2PGDA 1BDDA 3W68A 2WSFJ 1PZQA 3H1LE 1S9KE 1KQGB 1AQ5A 1SQBK 5CCHC 3A0BE 3L73J 1N2DC 1L4AB 4DT0A 3H32B 1JY2O 3VP9A 1NU1J 1WT6A 3HUSB 3WUTA 2E75B 2HYNA 2N1TC 2FYNB 4LGDE 3V2PA 1L0LE 1DD3A 4BXLA 3KPEA 3VMXA 3H1JE 3WU2E 2XZRA 3CWBE 2IYPA 1JEKA 2YMYA 2V7QH 2NZ2A 3L72E 4IL6X 3L75G 3RK2B 2E74C 2YXRB 4EI2A 5AW0B 4I7ZB 2WSEJ 4PJ0E 2A45I 2WITA 1OVVA 3PJSK 2QSIA 1LWUC 1J1DC 4H44B 3VN0A 3CXHD 2KS1A 1ZRTD 3AECC 1OVUA 3OA7A 2W90A 1NU1K 3GHGC 2W27A 4Y99C 3V2RA 2KUBA 2FYUE 2E5YA 5TISH 2LXBA 3L73D 3C1LA 2QRXA 2H7HA 3G6EP 2WPQA 1KD1Q 2M3BA 2N1TB 2WT7B 4ZKUA 1CI6B 1KB9H 5APWA 2KI7B 3MUDC 1VQ7P 4UB6H 2P2UA 1GU5A 2KB7P 2PRRA 1HJ0A 2YMKA 5CHXA 3SSUA 5KLVD 1FZCA 2YKOA 4O9BA 1SLQA 4QMAA 3L75E 4L75A 5GTHE 2E74B 3PRJA 4U7JA 2E42A 4KT0J 2RKLA 3KQGA 1OWAA 1NTZJ 3TGUJ 5C39A 1RF1A 3V2NA 2A45G 1SQVJ 2FFDA 1LWUB 1KYOE 1SQQJ 1J1DB 2IBZI 3H1IE 1X9VA 1GL2B 1ZXGA 1FBMA 3EQ2A 1NAFA 1YQ3C 1RY3A 3MHVA 1N73A 3A0BH 3AE4C 1NJIQ 2E76D 3USSA 2J58A 3MIWA 3H1HD 1BE3D 1AV1A 2A06G 2W6AA 3GHGB 1EC5A 4UB8H 4Y99B 1KILE 1JY3P 2E5TA 1S3JA 2JWDA 1VQPP 3H1LJ 4DOJA 1LP1A 1X22A 2ZJSE 1S5LH 4PD4I 4GODA 3AE7C 3D6YA 2ZT9D 4HB1A 2OGUA 2GUSA 1RE4C 3PTZA 1S1CX 1NTKD 1AVYA 1JY3N 2MJZA 4OH8B 2J59M 2OYHA 1NO4A 4AYCA 4KJMA 3AEEC 1NTZK 2KSJA 1IO4A 1SQVK 2Z5IA 2QM7A 1VQLP 4EYYQ 5B5EE 3L72J 4W80A 2LR2A 3HE5B 1PGQA 2O1KA 1QVGO 1BGYJ 3BCCJ 1KN7A 2G3AA 4L74A 2OTJP 1SQQD 2E43A 1LTJC 1M56D 1CZQA 1BSHA 3AE1C 3ABVC 2QJPB 3N7NA 2RN0A 3Q5SA 3Q5RA 1FS0E 3KYQA 2I1JA 1KORA 3HD7A 3P8CE 3AEFC 2BCCJ 5CMZA 3V2QA 2XKMA 4K3AA 2FYUJ 2QA4P 1J1EC 4ASWA 3Q3DA 1URQD 1L0LK 1Q86Q 2HFED 1CSBA 4EOTA 3WUUA 1USEA 3VP8A 2HPCB 1EXJA 2KOGA 2QG4A 4N78D 3BATA 3CL3D 1ZOYC 3CX5I 3L73G 2JKVA 5GTHH 4JF7A 1PP9J 4DCKA 5B66H 1OW6A 4NPEA 3VTPC 3H6PA 4OGQD 2P58A 1BCCJ 2C0XA 1VPCA 3B4SA 4R4MA 3D6ZA 1DIPA 3BRVB 4H0LD 2HODA 1EZVD 2W6BA 2AXTE 1P84I 1LTJB 3O6QB 3C8VA 5KLVG 2B9BA 3H1IJ 1NHLA 3NTNA 2V4HA 2B87B 2CPBA 1GU4A 4JYBA 2FYUK 1SFCD 1R5LA 1QEXA 3MTUE 1GK4A 1YJWP 1J1EB 3CXHE 4D6TD 1N7LA 1HGZA 3NFQA 1JM0A 1YJNP 3H1HG 1BE3G 1K9MQ 1XTCC 2M5AB 2NPSA 3R2PA 3BVHA 4WBAA 3TF5A 3I55P 5CCGD 1AVOA 5B5EH 4C7NB 3AEBC 1RE3A 3L35A 1NTMJ 2A45H 2KNCA 1LTBC 2FY8A 2BASA 3B71A 1IFJA 1JMMA 2M0BA 1QLED 3T97A 1FDIA 4EDFA 3II6A 3AE5C 1JCCA 1YJ9P 4Y28J 1BCCD 1E79H 1BDCA 2KIKA 5KLVE 4YXDC 1KILA 3AEGC 2O01N 2Y9ZA 1M57D 1H0TA 4HJGH 3JC22 1FZCC 1YITP 1NH4A 1EDJA 5AW2B 5K5GB 1SQPJ 4GDOA 1HUCA 3GF3A 1RF1C 4L73A 1T6AA 4TT3H 3UIAA 3L71J 3E1IA 1SQQG 1KTMA 1W2BO 2QJYC 1BE3E 1N73C 2K9JA 2R44A 4Z1MH 3RGUA 1JY2N 2ZT9C 1LTAC 1NTMK 1LT9A 3IN6A 3U59A 3GF7A 5TISE 4WY4A 3AEAC 1PV3A 4AUWA 3EWKA 1T2KD 1LT1A 1NTKE 3PH0A 1GK6A 2WTYA 3H25A 1RHZB 1SQXD 1VQ5P 3QH9A 1KB9E 1ZR2A 4UB6E 3SFDC 1G1JA 4WY4D 3G9RA 3BRTB 2OYHC 2IZ1A 1FZCB 1QL2A 1YHQP 3RBXA 2E76B 3CXHH 4PD4H 3BASA 3FWNA 4U3FJ 5APVA 3VMYA 3JCUH 2O01J 1SQPD 1EZVG 4H13D 4HYTB 1K8AQ 2B89A 4DJGA 3CC7P 3TNUA 2QJYB 3BCCG 2KLUA 3H1KD 1N73B 3LIEA 2MKVA 1VQKP 1S4XA 2ZT9B 5AW1B 1URQC 1ZMEC 1EDIA 4UB8E 3CCVP 1X79B 5M1BA 5DJUB 5APYA 1A02J 3CCJP 1KC8Q 1LP1B 1SQBD 1G2CA 1JB0J 2Z5HA 3A3YB 4D6TG 2Y0EA 3L70E 1S5LE 4ASVA 3CC4P 3S9OA 1DEBA 2IBZD 1EQ7A 4GIFA 3HE4A 4OGQC 4L76A 2QVAA 2OQQA 1VQ4P 1EDKA
chains in the Genus database with same CATH topology
1LT1A 1OVRA 2UWJE 2KZJA 5DJTB 1Q2NA 1LP1A 2KZIA 3PH0A 4JBZA 1SS1A 1OVUA 1EDLA 2OTKE 4GOEA 1NVOA 4GODA 1U7MA 4HB1A 4MN4C 2KUBA 1BDDA 2M0BA 2LXBA 4ZMDA 1MFTA 3MZWB 2QRXA 4NPEA 3ZDMA 5CBNA 4HKZH 1BDCA 2KIKA 2SPZA 1ZW0A 2P58A 1JMBA 4KJMA 2HR3A 2K3RA 4CPGA 1H0TB 2KI7B 2Q1KA 1Y47A 1H0TA 4HJGH 4EYYQ 1EDJA 2B89A 2LR2A 5K5GB 4BXLA 1FC2C 4K35A 2B87B 3FXEA 4NPDA 5EFWB 1EDIA 3FXDA 1DEEG 2RKLA 5DJUB 5C39A 2WMMA 3S1KA 1U7JA 2R44A 1LP1B 3RGUA 4ZNCA 5CBOA 1ZXGA 3MHVA 4ASVA 4IOIH 2ZAEB 2LXCB 1JM0A 2B87A 1X0TA 4NPFX 3QWOC 1OVVA 2M5AB 4WWIA 4K3AA 2M5AA 2I8DA 1EC5A 2QVAA 4ASWA 1S3JA 2KS1B 2B88A 2JWDA 4GOFA 1EDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT1 A;  1OVR A;  2UWJ E;  2KZJ A;  5DJT B;  1Q2N A;  1LP1 A;  2KZI A;  3PH0 A;  4JBZ A;  1SS1 A;  1OVU A;  1EDL A;  2OTK E;  4GOE A;  1NVO A;  4GOD A;  1U7M A;  4HB1 A;  4MN4 C;  2KUB A;  1BDD A;  2M0B A;  2LXB A;  4ZMD A;  1MFT A;  3MZW B;  2QRX A;  4NPE A;  3ZDM A;  5CBN A;  4HKZ H;  1BDC A;  2KIK A;  2SPZ A;  1ZW0 A;  2P58 A;  1JMB A;  4KJM A;  2HR3 A;  2K3R A;  4CPG A;  1H0T B;  2KI7 B;  2Q1K A;  1Y47 A;  1H0T A;  4HJG H;  4EYY Q;  1EDJ A;  2B89 A;  2LR2 A;  5K5G B;  4BXL A;  1FC2 C;  4K35 A;  2B87 B;  3FXE A;  4NPD A;  5EFW B;  1EDI A;  3FXD A;  1DEE G;  2RKL A;  5DJU B;  5C39 A;  2WMM A;  3S1K A;  1U7J A;  2R44 A;  1LP1 B;  3RGU A;  4ZNC A;  5CBO A;  1ZXG A;  3MHV A;  4ASV A;  4IOI H;  2ZAE B;  2LXC B;  1JM0 A;  2B87 A;  1X0T A;  4NPF X;  3QWO C;  1OVV A;  2M5A B;  4WWI A;  4K3A A;  2M5A A;  2I8D A;  1EC5 A;  2QVA A;  4ASW A;  1S3J A;  2KS1 B;  2B88 A;  2JWD A;  4GOF A;  1EDK A; 
#chains in the Genus database with same CATH topology
 3D71 A;  2OYH B;  1JO5 A;  1PGO A;  4R4L A;  4H0L C;  2M8R A;  5APU A;  1PP9 G;  2WSE H;  1PPJ D;  4RJT A;  4IFF A;  1YTZ I;  1KQS O;  4ZMD A;  2V7Q J;  5AW5 B;  2D2C D;  5KJ7 A;  2Q7C A;  1BCC G;  4PD4 D;  1IK7 A;  1Q81 Q;  1SFC C;  5APT A;  2L91 A;  5AVT B;  1Q90 D;  3RK3 D;  3CCM P;  2YKQ A;  1KV4 A;  2ITA A;  5AW8 B;  1AFO A;  1URQ B;  1Y47 A;  1L0N J;  1PGP A;  1QL1 A;  1YTZ T;  1JTH A;  1HBW A;  3CPW O;  5KAI E;  2FXM A;  1N7S A;  5GTI H;  3LW5 H;  1FC2 C;  4YTP C;  1NU1 D;  4DZO A;  1W5C E;  5CCG C;  3M0D A;  3L74 J;  1FDM A;  5AVW B;  3SWK A;  1FE6 A;  1MZ9 A;  4OGQ B;  1FJP A;  2LXC B;  2H89 C;  1MUU A;  3B5N A;  2FXO A;  2N9B A;  1K04 A;  1VQ9 P;  2XU6 A;  4H0L B;  2Q3I A;  5B66 E;  1JCD A;  2GA1 A;  1YI2 P;  1E5W A;  1GZL A;  5AW4 B;  1SQX G;  4JBZ A;  4A7P A;  2C9N Y;  1EDL A;  2OTK E;  1SFC B;  4GOE A;  1NKN A;  1L0N K;  1U7M A;  2FKW B;  3AED C;  2HOD B;  2WSC H;  1L2P A;  4AQR D;  4WB4 A;  3CX5 D;  4HKZ H;  1A02 F;  2K88 A;  1OIP A;  4W7Y A;  1OW8 A;  4RKU J;  3H32 A;  1YQ4 C;  1SQP G;  2P7J A;  4XA4 A;  3HUS A;  1NTK K;  4GT1 A;  5KKZ C;  3H1K G;  3L71 G;  1M1J C;  4RES B;  2XV5 A;  1L0L J;  2M3E A;  3L74 D;  3L70 J;  2KXP B;  1RF0 A;  1P84 D;  1T2K C;  3G3Z A;  1RQU A;  3H1J J;  3CWB J;  3M9B A;  1LT9 C;  1SQB G;  1T3J A;  3HRN A;  2ZYG A;  1UII A;  2IX7 C;  1DH3 A;  4WY4 C;  1SVF A;  1NTZ D;  3TGU D;  1WRG A;  2H8P D;  2IBZ G;  3QWO C;  2H43 A;  1SQV D;  1IJD B;  1USD A;  2A06 E;  4GOF A;  4I6M C;  2Y0D A;  3U1A A;  3A5T A;  3CMA P;  1AA0 A;  5KAI H;  1PPJ G;  4H13 C;  3FX0 A;  3G4S P;  1FU1 A;  2JEE A;  3S4R A;  3H1L D;  1S9K D;  3PHL A;  1NGM B;  1FDO A;  2AXC A;  2Q5U A;  4U3F G;  3L36 A;  1HH0 A;  1M7L A;  1FOS F;  1KQL A;  5KKZ B;  3H1K E;  2N1T A;  3M0A A;  1M1J B;  2ZYA A;  3HD7 D;  2IZ0 A;  5AVZ B;  2WPS A;  1CI6 A;  1U57 A;  1M90 Q;  2K9J B;  1GW4 A;  2IPP A;  3A2A A;  5TJH A;  1NU1 G;  3N4X A;  1SQB E;  1LT9 B;  1NKZ B;  3RL0 D;  3B8E B;  4YPC A;  3IF4 A;  4WY4 B;  1MKM A;  3L75 J;  3L72 D;  2JO1 A;  2IBZ E;  1HF9 A;  5APS A;  1BGY D;  1N86 A;  5AVR B;  1YYC A;  3IFM A;  1LWU A;  3BCC D;  3VYI A;  2AEF A;  2N9Y B;  1GL2 A;  1G1I A;  4IL6 H;  2D2C C;  2GUV A;  3FWL A;  5AW9 B;  2AEM A;  1KB9 I;  4H13 B;  4WWI A;  4BWN A;  2QEX P;  2I8D A;  3GHG A;  3OJA B;  3RK3 C;  2ZXX A;  1IFD A;  2W83 C;  3FGA D;  2YXQ B;  3F89 A;  4PD4 E;  2BCC D;  1ZRT E;  4N6J A;  2FYU D;  3JCU E;  3SFE C;  2YNY A;  1T3U A;  5AW7 B;  4N3Y B;  5H2F H;  5CJ0 A;  3L73 E;  3HTK A;  1ZP0 C;  2YIU C;  3AE3 C;  1PP9 D;  2WZ7 A;  3CC2 P;  3VMA A;  3G71 P;  2NPS D;  2IFM A;  4GKG A;  3K5B A;  3L74 G;  1XTG B;  3RL0 g;  3V4W A;  3W67 A;  2H88 C;  5AVU B;  2K9Y A;  2G8Y A;  2W6J H;  2W8Z A;  1IC2 A;  1DEE G;  1UIX A;  2D2C B;  1KYO D;  3H1I D;  1YBK A;  1WMK A;  2WMM A;  2O1J A;  1S72 P;  1FZB A;  4KHX A;  3RK3 B;  1NTZ G;  3TGU G;  1VDF A;  1SQV G;  3IR9 A;  1R8E A;  1OZH A;  2CK3 H;  2FFD C;  2XDJ A;  4BRY A;  1KIL D;  4I2L C;  3H1H E;  2OYO A;  2KS1 B;  1S5L X;  1OVR A;  2UWJ E;  1IK9 A;  4XFJ A;  1RE4 A;  1SP4 A;  4IFD K;  2JWA A;  3O8Z A;  4TLF A;  2JR8 A;  2P67 A;  2WSS H;  2YIU B;  3H1L G;  1JTH B;  1H89 A;  1PGJ A;  2PAJ A;  5GTI E;  1AJY A;  1NTM D;  3ZDM A;  3RBZ A;  5CBN A;  2PP6 A;  1YIJ P;  1GDT A;  1HWT C;  2SPZ A;  5BU5 A;  2WPR A;  3A0H H;  1DX7 A;  2K3R A;  5AVV B;  2OAR A;  1L0L G;  2VRS A;  1QVF O;  1IFN A;  1KFM A;  1LTJ A;  2QJK C;  2YO3 A;  1K73 Q;  2R5D A;  3O6Q A;  3CWB G;  1CW5 A;  3E1R A;  1S2E A;  3L72 G;  3TYY A;  3TGU E;  1RF1 B;  3ITK A;  3C9I A;  1PL5 A;  3MGN A;  2FFD B;  1BGY G;  1SQQ E;  2ZFC A;  2WSF H;  3MP7 B;  3PP5 A;  3L4F A;  1LGH B;  1Q82 Q;  3V4Q A;  2POH A;  3L71 D;  3P8C D;  1KYO I;  3KZI E;  5KAF H;  4H44 C;  3GLM A;  2WQY C;  2M5A A;  1ZLL A;  1ZV8 A;  3CD6 P;  2KLV A;  3HD7 C;  2KZI A;  2BCC G;  2OYI A;  2FYU G;  4C7N A;  5KTB A;  1PIX A;  1IZN B;  1JOC A;  4N78 E;  3RL0 C;  3SWF A;  1VF5 D;  5AVQ B;  1NAY A;  2QJK B;  1JMB A;  2R5B A;  5KLV J;  1K05 A;  2Z4E A;  2OTL P;  4U3F D;  2JDI H;  1EZV E;  1BGY E;  4C46 A;  2J5U A;  3FXE A;  3BCC E;  3CLQ A;  4JPZ B;  2DW3 A;  5EFW B;  3CX5 H;  4M3L A;  3CCS P;  3H1I G;  2Q6Q A;  3CCU P;  1GL2 C;  4ZKP A;  2Y0C A;  3H1H J;  1BE3 J;  5KJ7 D;  3OW2 O;  1LTG C;  3AE9 C;  3HD7 B;  1W2E A;  2C0W A;  1IFP A;  3AE2 C;  3IAO A;  4D6T E;  2BCC E;  1OMI A;  2C9L Y;  1P84 H;  4EIJ A;  2KYV A;  3RL0 B;  3LW5 J;  5DJT B;  1KMI Z;  1N7S D;  1SS1 A;  2ZVO B;  5KLV K;  1NTK J;  2NPS C;  4OVN F;  1VQM P;  3Q5P A;  5APQ A;  5AVY B;  3KHU A;  1OFC X;  1Y8A A;  1PP9 E;  4PV1 D;  1RE3 C;  1NTM G;  3M06 A;  1NOH A;  3L37 A;  1BCC E;  3GW6 A;  3B5N D;  2HLO A;  3JSV C;  3KZI H;  3GG2 A;  3TK1 A;  2QE7 H;  1JNM A;  3P8M C;  3A7O A;  5BVZ A;  1KIL C;  3D70 A;  4IL6 E;  5L8R J;  1FZG A;  4K35 A;  1AQT A;  4LC1 A;  1FJK A;  1L0N D;  1L4A A;  2QJP C;  1LTI C;  3I5C A;  3CCR P;  2WSC J;  1ZN5 A;  2HG5 D;  4ZNC A;  5CBO A;  3CCQ P;  2Y9Y A;  1TU3 F;  3CXH I;  3KDP B;  1X0T A;  1L4A D;  3E7K A;  4WVZ A;  2NPS B;  4YXW H;  2RH0 A;  5H2F E;  5AW6 B;  3WU2 H;  3U1C A;  3P7K A;  2GM4 A;  2I1K A;  2B88 A;  1H88 A;  2E75 D;  2KP8 A;  3HTK B;  1KB9 D;  1Q2N A;  4JQ0 D;  1BSN A;  1NTM E;  2KNC B;  1GTW A;  1FAV A;  1SQX E;  1GW3 A;  4MN4 C;  4PJ0 H;  3T97 B;  1SQQ K;  1Y9B A;  1VL2 A;  2WVR A;  1D7M A;  2ZVN B;  2ZXE B;  2WWW A;  1MFZ A;  3RK2 D;  1KIL B;  5KLI C;  4HH2 A;  1H0T B;  5CCH A;  3NMD A;  2K37 A;  3EFG A;  3GMA A;  1URQ A;  3WMM 0;  1SQP E;  4H44 D;  3NXS A;  3F5H A;  3CCL P;  4LLH A;  5CJ4 A;  3L71 E;  4BRY B;  1PFI A;  1GD2 E;  2WT7 A;  1QGK B;  4D6T J;  5AW3 B;  2YKP A;  1Q7Y Q;  5CCH D;  1RQV A;  2QM8 A;  3EFF K;  2R3C A;  1L0L D;  3S1K A;  1OXZ A;  3L70 D;  2NRG A;  4W7Z A;  2JJL A;  3H1J D;  1R5S A;  2ZAE B;  2N1T D;  3CWB D;  1FZE A;  1VF5 C;  3P32 A;  1JY3 O;  4IFM A;  3M91 A;  1M8O B;  2OYI C;  1KFN A;  5AVX B;  1H8A A;  3Q1M A;  3CME P;  5APX A;  2IFN A;  1MV8 A;  1KYO H;  1X8Y A;  3A0H E;  1NWQ A;  1NVO A;  1SFC A;  2IDB A;  1OW7 A;  5E79 E;  3M9Q A;  1PPJ E;  2E74 D;  2FBW C;  5KLI B;  3MZW B;  1VQ8 P;  1VQN P;  5AVS B;  4U3F E;  2O3J A;  1GL2 D;  1RH5 B;  4I1L A;  2K1A A;  1HGV A;  5KJ7 C;  3RK3 E;  2Q1K A;  4B86 A;  1Z56 A;  2CPS A;  3TNU B;  1VQ6 P;  1LTT C;  5CCG A;  1M1K Q;  3MUD A;  5KAF E;  1L0N G;  4NPD A;  3MD0 A;  1NU1 E;  3FXD A;  2FYZ A;  1T8Z A;  1N7S C;  1VF5 B;  5BU8 B;  1G2C B;  2R3S A;  4RO0 A;  2OYI B;  3M0D C;  3SWY A;  3HE5 A;  3L75 D;  4PV1 C;  1EXI A;  3HE4 B;  1SQX J;  3LID A;  1FZF A;  2Q9I A;  1LTS C;  1NTK G;  2LKM A;  2PFX A;  2P1J A;  2KSE A;  2P10 A;  3B5N C;  1LNQ A;  1GMJ A;  2JP3 A;  1IFI A;  2BEZ F;  2KK7 A;  1JY2 P;  1MFT A;  2E76 C;  2WPV B;  3AE6 C;  4XE5 B;  1EZV I;  1ZW0 A;  3V5B A;  3V6I A;  3VMZ A;  3H1K J;  2HPC A;  3CX5 E;  1M1J A;  2HR3 A;  2BEQ D;  1HJB A;  4CPG A;  2XND H;  1KZU B;  1L0N E;  2XNX A;  1LJ2 A;  1J2J B;  1L4A C;  1N7S B;  1IFM A;  1DD4 A;  1OX3 A;  1SQX K;  1SQB J;  3HUS C;  3TSI A;  3Q2Y A;  3L74 E;  2E75 C;  4PV1 B;  1FOS E;  3VOP A;  1QX8 A;  2Q3E A;  2FYN C;  1P84 E;  2R32 A;  3R4Y A;  5E79 H;  3PLN A;  1VQO P;  3L70 G;  3M9H A;  2IYO A;  1U7J A;  1RF0 C;  4C7R A;  3I56 P;  3CI9 A;  2AXT H;  3WUV A;  3H1J G;  2ZYD A;  3CCE P;  3B5N B;  4IOI H;  1HVV A;  2B87 A;  1KQF B;  3AE8 C;  4NPF X;  1JUN A;  2YO2 A;  4OWF A;  3KXD A;  1NTZ E;  2A06 D;  2RMZ A;  2O01 H;  1SQP K;  1SQV E;  3TDK A;  1HTL C;  3RK2 C;  1ZR4 A;  2FXP A;  1NYH A;  4I7Z C;  2KZJ A;  1N8R Q;  4JYC A;  2L5G B;  3OAK A;  1FZA A;  2AEJ A;  2QIW A;  2PGD A;  1BDD A;  3W68 A;  2WSF J;  1PZQ A;  3H1L E;  1S9K E;  1KQG B;  1AQ5 A;  1SQB K;  5CCH C;  3A0B E;  3L73 J;  1N2D C;  1L4A B;  4DT0 A;  3H32 B;  1JY2 O;  3VP9 A;  1NU1 J;  1WT6 A;  3HUS B;  3WUT A;  2E75 B;  2HYN A;  2N1T C;  2FYN B;  4LGD E;  3V2P A;  1L0L E;  1DD3 A;  4BXL A;  3KPE A;  3VMX A;  3H1J E;  3WU2 E;  2XZR A;  3CWB E;  2IYP A;  1JEK A;  2YMY A;  2V7Q H;  2NZ2 A;  3L72 E;  4IL6 X;  3L75 G;  3RK2 B;  2E74 C;  2YXR B;  4EI2 A;  5AW0 B;  4I7Z B;  2WSE J;  4PJ0 E;  2A45 I;  2WIT A;  1OVV A;  3PJS K;  2QSI A;  1LWU C;  1J1D C;  4H44 B;  3VN0 A;  3CXH D;  2KS1 A;  1ZRT D;  3AEC C;  1OVU A;  3OA7 A;  2W90 A;  1NU1 K;  3GHG C;  2W27 A;  4Y99 C;  3V2R A;  2KUB A;  2FYU E;  2E5Y A;  5TIS H;  2LXB A;  3L73 D;  3C1L A;  2QRX A;  2H7H A;  3G6E P;  2WPQ A;  1KD1 Q;  2M3B A;  2N1T B;  2WT7 B;  4ZKU A;  1CI6 B;  1KB9 H;  5APW A;  2KI7 B;  3MUD C;  1VQ7 P;  4UB6 H;  2P2U A;  1GU5 A;  2KB7 P;  2PRR A;  1HJ0 A;  2YMK A;  5CHX A;  3SSU A;  5KLV D;  1FZC A;  2YKO A;  4O9B A;  1SLQ A;  4QMA A;  3L75 E;  4L75 A;  5GTH E;  2E74 B;  3PRJ A;  4U7J A;  2E42 A;  4KT0 J;  2RKL A;  3KQG A;  1OWA A;  1NTZ J;  3TGU J;  5C39 A;  1RF1 A;  3V2N A;  2A45 G;  1SQV J;  2FFD A;  1LWU B;  1KYO E;  1SQQ J;  1J1D B;  2IBZ I;  3H1I E;  1X9V A;  1GL2 B;  1ZXG A;  1FBM A;  3EQ2 A;  1NAF A;  1YQ3 C;  1RY3 A;  3MHV A;  1N73 A;  3A0B H;  3AE4 C;  1NJI Q;  2E76 D;  3USS A;  2J58 A;  3MIW A;  3H1H D;  1BE3 D;  1AV1 A;  2A06 G;  2W6A A;  3GHG B;  1EC5 A;  4UB8 H;  4Y99 B;  1KIL E;  1JY3 P;  2E5T A;  1S3J A;  2JWD A;  1VQP P;  3H1L J;  4DOJ A;  1LP1 A;  1X22 A;  2ZJS E;  1S5L H;  4PD4 I;  4GOD A;  3AE7 C;  3D6Y A;  2ZT9 D;  4HB1 A;  2OGU A;  2GUS A;  1RE4 C;  3PTZ A;  1S1C X;  1NTK D;  1AVY A;  1JY3 N;  2MJZ A;  4OH8 B;  2J59 M;  2OYH A;  1NO4 A;  4AYC A;  4KJM A;  3AEE C;  1NTZ K;  2KSJ A;  1IO4 A;  1SQV K;  2Z5I A;  2QM7 A;  1VQL P;  4EYY Q;  5B5E E;  3L72 J;  4W80 A;  2LR2 A;  3HE5 B;  1PGQ A;  2O1K A;  1QVG O;  1BGY J;  3BCC J;  1KN7 A;  2G3A A;  4L74 A;  2OTJ P;  1SQQ D;  2E43 A;  1LTJ C;  1M56 D;  1CZQ A;  1BSH A;  3AE1 C;  3ABV C;  2QJP B;  3N7N A;  2RN0 A;  3Q5S A;  3Q5R A;  1FS0 E;  3KYQ A;  2I1J A;  1KOR A;  3HD7 A;  3P8C E;  3AEF C;  2BCC J;  5CMZ A;  3V2Q A;  2XKM A;  4K3A A;  2FYU J;  2QA4 P;  1J1E C;  4ASW A;  3Q3D A;  1URQ D;  1L0L K;  1Q86 Q;  2HFE D;  1CSB A;  4EOT A;  3WUU A;  1USE A;  3VP8 A;  2HPC B;  1EXJ A;  2KOG A;  2QG4 A;  4N78 D;  3BAT A;  3CL3 D;  1ZOY C;  3CX5 I;  3L73 G;  2JKV A;  5GTH H;  4JF7 A;  1PP9 J;  4DCK A;  5B66 H;  1OW6 A;  4NPE A;  3VTP C;  3H6P A;  4OGQ D;  2P58 A;  1BCC J;  2C0X A;  1VPC A;  3B4S A;  4R4M A;  3D6Z A;  1DIP A;  3BRV B;  4H0L D;  2HOD A;  1EZV D;  2W6B A;  2AXT E;  1P84 I;  1LTJ B;  3O6Q B;  3C8V A;  5KLV G;  2B9B A;  3H1I J;  1NHL A;  3NTN A;  2V4H A;  2B87 B;  2CPB A;  1GU4 A;  4JYB A;  2FYU K;  1SFC D;  1R5L A;  1QEX A;  3MTU E;  1GK4 A;  1YJW P;  1J1E B;  3CXH E;  4D6T D;  1N7L A;  1HGZ A;  3NFQ A;  1JM0 A;  1YJN P;  3H1H G;  1BE3 G;  1K9M Q;  1XTC C;  2M5A B;  2NPS A;  3R2P A;  3BVH A;  4WBA A;  3TF5 A;  3I55 P;  5CCG D;  1AVO A;  5B5E H;  4C7N B;  3AEB C;  1RE3 A;  3L35 A;  1NTM J;  2A45 H;  2KNC A;  1LTB C;  2FY8 A;  2BAS A;  3B71 A;  1IFJ A;  1JMM A;  2M0B A;  1QLE D;  3T97 A;  1FDI A;  4EDF A;  3II6 A;  3AE5 C;  1JCC A;  1YJ9 P;  4Y28 J;  1BCC D;  1E79 H;  1BDC A;  2KIK A;  5KLV E;  4YXD C;  1KIL A;  3AEG C;  2O01 N;  2Y9Z A;  1M57 D;  1H0T A;  4HJG H;  3JC2 2;  1FZC C;  1YIT P;  1NH4 A;  1EDJ A;  5AW2 B;  5K5G B;  1SQP J;  4GDO A;  1HUC A;  3GF3 A;  1RF1 C;  4L73 A;  1T6A A;  4TT3 H;  3UIA A;  3L71 J;  3E1I A;  1SQQ G;  1KTM A;  1W2B O;  2QJY C;  1BE3 E;  1N73 C;  2K9J A;  2R44 A;  4Z1M H;  3RGU A;  1JY2 N;  2ZT9 C;  1LTA C;  1NTM K;  1LT9 A;  3IN6 A;  3U59 A;  3GF7 A;  5TIS E;  4WY4 A;  3AEA C;  1PV3 A;  4AUW A;  3EWK A;  1T2K D;  1LT1 A;  1NTK E;  3PH0 A;  1GK6 A;  2WTY A;  3H25 A;  1RHZ B;  1SQX D;  1VQ5 P;  3QH9 A;  1KB9 E;  1ZR2 A;  4UB6 E;  3SFD C;  1G1J A;  4WY4 D;  3G9R A;  3BRT B;  2OYH C;  2IZ1 A;  1FZC B;  1QL2 A;  1YHQ P;  3RBX A;  2E76 B;  3CXH H;  4PD4 H;  3BAS A;  3FWN A;  4U3F J;  5APV A;  3VMY A;  3JCU H;  2O01 J;  1SQP D;  1EZV G;  4H13 D;  4HYT B;  1K8A Q;  2B89 A;  4DJG A;  3CC7 P;  3TNU A;  2QJY B;  3BCC G;  2KLU A;  3H1K D;  1N73 B;  3LIE A;  2MKV A;  1VQK P;  1S4X A;  2ZT9 B;  5AW1 B;  1URQ C;  1ZME C;  1EDI A;  4UB8 E;  3CCV P;  1X79 B;  5M1B A;  5DJU B;  5APY A;  1A02 J;  3CCJ P;  1KC8 Q;  1LP1 B;  1SQB D;  1G2C A;  1JB0 J;  2Z5H A;  3A3Y B;  4D6T G;  2Y0E A;  3L70 E;  1S5L E;  4ASV A;  3CC4 P;  3S9O A;  1DEB A;  2IBZ D;  1EQ7 A;  4GIF A;  3HE4 A;  4OGQ C;  4L76 A;  2QVA A;  2OQQ A;  1VQ4 P;  1EDK A; 
#chains in the Genus database with same CATH homology
 1LT1 A;  1OVR A;  2UWJ E;  2KZJ A;  5DJT B;  1Q2N A;  1LP1 A;  2KZI A;  3PH0 A;  4JBZ A;  1SS1 A;  1OVU A;  1EDL A;  2OTK E;  4GOE A;  1NVO A;  4GOD A;  1U7M A;  4HB1 A;  4MN4 C;  2KUB A;  1BDD A;  2M0B A;  2LXB A;  4ZMD A;  1MFT A;  3MZW B;  2QRX A;  4NPE A;  3ZDM A;  5CBN A;  4HKZ H;  1BDC A;  2KIK A;  2SPZ A;  1ZW0 A;  2P58 A;  1JMB A;  4KJM A;  2HR3 A;  2K3R A;  4CPG A;  1H0T B;  2KI7 B;  2Q1K A;  1Y47 A;  1H0T A;  4HJG H;  4EYY Q;  1EDJ A;  2B89 A;  2LR2 A;  5K5G B;  4BXL A;  1FC2 C;  4K35 A;  2B87 B;  3FXE A;  4NPD A;  5EFW B;  1EDI A;  3FXD A;  1DEE G;  2RKL A;  5DJU B;  5C39 A;  2WMM A;  3S1K A;  1U7J A;  2R44 A;  1LP1 B;  3RGU A;  4ZNC A;  5CBO A;  1ZXG A;  3MHV A;  4ASV A;  4IOI H;  2ZAE B;  2LXC B;  1JM0 A;  2B87 A;  1X0T A;  4NPF X;  3QWO C;  1OVV A;  2M5A B;  4WWI A;  4K3A A;  2M5A A;  2I8D A;  1EC5 A;  2QVA A;  4ASW A;  1S3J A;  2KS1 B;  2B88 A;  2JWD A;  4GOF A;  1EDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...