4ZMDA

C domain of staphylococcal protein a mutant - q9w
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
56
structure length
56
Chain Sequence
NKFNKEWQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein A
publication title Suppression of conformational heterogeneity at a protein-protein interface.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 22
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4zmdA00
2KI7B 2KIKA 3RGUA 2R44A 3S1KA 1OVUA 4GODA 4ZNCA 1OVVA 4K3AA 1U7JA 1ZXGA 5DJTB 1DEEG 2KZIA 1EDIA 2UWJE 2ZAEB 3FXEA 1EC5A 1Q2NA 4EYYQ 5DJUB 4WWIA 1JM0A 1H0TB 5K5GB 2KUBA 2RKLA 3FXDA 2B88A 5CBOA 1LT1A 1LP1B 5CBNA 2I8DA 1BDCA 5EFWB 4K35A 5C39A 2LR2A 4NPDA 4ASWA 2Q1KA 1Y47A 2M5AB 2SPZA 4HJGH 1EDLA 1S3JA 4GOFA 1H0TA 1MFTA 2KS1B 3QWOC 2B87A 1LP1A 1FC2C 4ASVA 3MZWB 1X0TA 2K3RA 2OTKE 3MHVA 4JBZA 2B87B 4GOEA 1EDJA 2KZJA 2M5AA 4MN4C 1EDKA 2HR3A 4IOIH 2QVAA 4KJMA 2B89A 2LXBA 2QRXA 1BDDA 2M0BA 4CPGA 1ZW0A 1JMBA 3ZDMA 1NVOA 3PH0A 1OVRA 1U7MA 2JWDA 4HKZH 4NPEA 2P58A 4HB1A 4ZMDA 2WMMA 1SS1A 4NPFX 2LXCB 4BXLA
chains in the Genus database with same CATH superfamily
2N1TB 2QM8A 1FZCB 2WPRA 3H1HE 1LWUC 1NAYA 2M3EA 2OYHB 3TGUG 4QMAA 4K3AA 1SQXD 2KOGA 2UWJE 2WSEH 1XTCC 4I2LC 3A0BE 1G2CA 1AJYA 4C46A 3FGAD 2W90A 1H0TB 2JP3A 1T2KD 1KB9E 1FBMA 4IL6E 3V6IA 1SQBJ 1P84H 3CD6P 5C39A 1GL2D 4H13D 3AE5C 4JPZB 1Q7YQ 2PFXA 3NMDA 1YJNP 3H1HG 3L72E 2AEJA 2WWWA 3L73E 3MUDA 1KORA 2JR8A 1SQVJ 1J1EC 3MUDC 3AE1C 2KZJA 1MZ9A 1QL2A 1Y9BA 4KJMA 2LXBA 1X9VA 3NTNA 2O01J 1IK7A 3G3ZA 1CW5A 1FDOA 2KK7A 1SQXE 1OMIA 3B8EB 4UB6E 2XKMA 3WMM0 3L72G 3M9QA 3L73G 1UIIA 3VTPC 3KZIE 5KAFH 5AW2B 1NTKD 2JO1A 3AECC 5H2FE 3H1LJ 3O8ZA 1IFMA 3CXHH 1IO4A 1DEEG 3IAOA 3FX0A 1N7LA 1SQVG 3F89A 2OYIC 2WSFH 3HD7D 3FXDA 1UIXA 3HE4A 1LJ2A 1SQXG 3PJSK 3GF7A 4GT1A 4K35A 1SQPK 4RKUJ 1EDLA 2MKVA 2RMZA 1PV3A 1URQC 1W2EA 2NPSD 2FFDC 1GZLA 1GTWA 4IFMA 1P84I 2O1KA 3JCUE 1LT9B 2E43A 3C8VA 4R4MA 1NTZK 1SVFA 3RK3C 1NTKE 4CPGA 1HGVA 1HWTC 1HGZA 3EFFK 3LIDA 2XU6A 4NPEA 1IFNA 4HB1A 1RE4A 2W6JH 3GG2A 3V5BA 3L71J 4TLFA 1NTMD 5CCGA 1N73A 1P84D 1FU1A 3IFMA 2Q9IA 1R5LA 1YTZI 1MV8A 2HFED 2WZ7A 3M9HA 1VF5C 2YMYA 4ZNCA 1RF1A 1ZXGA 1NTKG 1EDIA 3RK2B 5KKZC 1RF1C 2ZAEB 3Q5RA 4YPCA 1IK9A 2E5YA 1VQ4P 3H1IJ 4WWIA 2PRRA 1NOHA 2B88A 2P1JA 4I7ZC 3SWFA 4OGQB 3R4YA 2H88C 3P7KA 2BCCJ 3IR9A 5EFWB 4IFFA 1M56D 3CXHI 3CLQA 2W6AA 2V7QJ 1GL2B 3NFQA 1M90Q 1NKZB 4GOFA 3D70A 2KS1B 3OAKA 2FYUJ 3U59A 5APUA 5GTIH 1H88A 4HYTB 1VQ6P 4D6TD 5CHXA 3L71G 4XE5B 5KLIB 1AFOA 1NTZD 4I6MC 1AVYA 3GW6A 3CMEP 2WT7B 3SSUA 4IOIH 2IX7C 1YIJP 1NJIQ 2V4HA 1NTME 1K9MQ 1P84E 3MTUE 2YIUB 3ZDMA 5KJ7A 1NVOA 3SFDC 1ZRTE 4A7PA 2K88A 3CXHD 1E5WA 5KJ7C 2CK3H 1OW7A 1QX8A 3M91A 3RL0C 5M1BA 1NGMB 1L0LJ 1KMIZ 1KV4A 2XZRA 1NO4A 1ZN5A 2FYUG 3BVHA 1U7JA 2YKPA 2BEZF 1NTMG 3H32A 3Q5PA 1M1JA 3CL3D 2Q3EA 3HE5B 4BRYA 4DOJA 5K5GB 2J58A 3H6PA 4D6TE 1CSBA 4PJ0H 2K9JA 2I8DA 1NTZE 5KAFE 3H1JJ 1MFZA 1GW4A 3RK3D 4YTPC 2FY8A 3L4FA 1K8AQ 4KT0J 1HJBA 2WSFJ 1S3JA 4DT0A 1MFTA 1W2BO 1FJPA 2YKQA 1A02F 3CXHE 1X0TA 5KTBA 2A45H 2W8ZA 4AYCA 3D6YA 2NPSB 4LLHA 4MN4C 4WB4A 4BWNA 1KILB 3TF5A 5AVYB 1FS0E 4D6TG 4W7ZA 1ZW0A 1L0NJ 1QVFO 2AXCA 1KYOH 2GA1A 1VF5D 5APQA 3AE4C 5AW7B 2O01H 2AXTH 2YNYA 3HUSC 1Z56A 4IL6X 3O6QA 2IZ1A 2HLOA 2JDIH 2FKWB 5L8RJ 5AW3B 3H1JG 3BATA 2A06D 5KLVJ 3W67A 1LTJA 3S1KA 1SFCA 1BCCJ 1KFNA 3L74J 4GODA 3RK3E 1LTJC 4U3FD 1SFCC 3E7KA 3TGUD 4OH8B 1USEA 2FYNC 3CX5H 1EC5A 1CI6A 2YMKA 2KUBA 2QJYC 3M0DC 4EOTA 1ZLLA 1SQVK 1L4AC 1L0NG 1JB0J 1PP9J 1QGKB 4HJGH 1ZR4A 3V2PA 1SQXK 5KJ7D 1R5SA 1EXJA 4GKGA 1LTBC 2ZT9B 2OTKE 2OYOA 3TK1A 1JY2N 3AE6C 3RL0D 1PPJG 3GHGB 3L37A 3VMYA 3BASA 5KLVG 1A02J 2WITA 2QEXP 5AVSB 2WVRA 2H8PD 1PGQA 3I55P 4U3FE 2M3BA 1MUUA 3TGUE 1KQLA 1OWAA 3CCEP 2Y0DA 1NU1J 3S9OA 2MJZA 3JC22 4GDOA 4BXLA 1HTLC 1K05A 1KYOI 1SP4A 3HRNA 3MP7B 1IZNB 1PP9G 3V2NA 3VMXA 2R44A 1SQBD 1YTZT 4C7RA 3HE4B 1OVVA 1FAVA 2Q7CA 1N2DC 2FXMA 1N86A 4EDFA 1BGYJ 4WY4A 1SLQA 3A2AA 3PHLA 5DJUB 4ZKUA 3KXDA 4WY4C 1NTKK 4U3FG 1SQVD 3CMAP 4PD4H 1H89A 1TU3F 2P2UA 1KD1Q 1BE3J 2ZFCA 3L70J 1KYOD 2QA4P 3CX5I 1IJDB 2POHA 3QWOC 2B87A 2HODA 3WU2H 2V7QH 1NH4A 2K3RA 4W80A 1RE3C 4GOEA 4PV1B 1JY2O 1RY3A 3RBZA 2JJLA 2G8YA 3RL0g 1LGHB 1WMKA 4PJ0E 3KHUA 3B5NA 1HVVA 1HF9A 1JMBA 3C1LA 3H1LD 3B5NC 2E75B 2YXRB 1N73B 1SQBE 1OVRA 1SFCD 1ZP0C 1EQ7A 4JF7A 3CX5D 2WMMA 2FXOA 3CCMP 2YO3A 1JCCA 5APXA 3RBXA 2Z4EA 2WPVB 1N7SB 1SQVE 2R3SA 5AW6B 1OVUA 5AVXB 3CWBJ 2D2CB 1BSNA 2CPBA 4Z1MH 3HTKB 3H25A 1KYOE 1WRGA 1ZOYC 1SQBG 2FYUK 2Z5IA 1YHQP 1NTMK 4R4LA 1W5CE 1YBKA 2QJPC 2LR2A 2A45G 3AEDC 4ZKPA 1IC2A 1S2EA 3L75J 1OFCX 2OYIA 1PGPA 3H1KJ 1PGOA 3H1LE 5AVUB 1J1DC 3MZWB 1LTAC 3AEBC 2KYVA 1VDFA 5B5EE 1EDJA 1JUNA 3KQGA 3CX5E 2WPQA 3V2QA 4H0LB 3CCRP 2M8RA 3L71D 1URQA 4H44B 1EZVI 1BDDA 1NAFA 2FFDA 3CWBG 5AW0B 2KNCB 1YI2P 3D71A 2O1JA 1YJ9P 3KPEA 4Y28J 2E76D 2E74C 2RH0A 3BCCJ 3AE3C 1PGJA 3H1LG 3VOPA 1X79B 3H1ID 4WY4D 3H32B 1OW8A 1YYCA 2N1TC 1FZCC 2IPPA 2Y9YA 2ITAA 2I1JA 1M1JB 2IZ0A 3C9IA 3PLNA 2WSSH 5BVZA 2OYHC 1KQGB 3LW5J 3USSA 3L75G 1EZVD 1M8OB 3JSVC 3H1KG 1Q90D 2K9JB 3PRJA 2FYUD 2HG5D 2KB7P 1USDA 2L5GB 5AW8B 1VQ7P 1LT1A 2G3AA 1ZRTD 2LKMA 3E1RA 3BRTB 4EI2A 2KP8A 3AE8C 4ASWA 3KDPB 3L71E 4Y99B 2H7HA 3M06A 1IFPA 3AE9C 3B5ND 5CJ4A 2WQYC 3AEGC 2ZVOB 1LP1A 3TNUB 1T6AA 1L0NK 2Y9ZA 2OARA 4JBZA 1FOSF 1OX3A 3T97A 5CCHA 2Y0EA 1VQNP 5CCHC 2QVAA 3H1IE 4YXWH 1L0LD 3PTZA 2N9BA 4H13B 1YITP 2P10A 3A5TA 5B66H 1EZVE 2HYNA 5KLVK 2ZYDA 2P58A 5APSA 1JY2P 4LC1A 2QJKB 2FYUE 2FYNB 3I5CA 2KLUA 2J5UA 2C0XA 1IFDA 1CI6B 4L75A 3H1JD 2OTJP 3L35A 3H1IG 5DJTB 4JQ0D 3UIAA 3CC2P 1RQVA 2KSJA 2Q6QA 2BCCG 1EZVG 1QLED 2P67A 5CBNA 2OQQA 3MGNA 2R5DA 3SWYA 1SQPJ 1NYHA 2IYOA 3S4RA 1URQD 3KYQA 1L0LE 1L0ND 5APYA 2XNDH 1FJKA 3MHVA 2E74D 1K73Q 1LT9C 1PZQA 3BRVB 2M5AA 3HD7B 3WUVA 2PAJA 1EXIA 1PPJD 5KAIH 1HUCA 1T3UA 1SQQJ 1E79H 3VYIA 5KLVD 2CPSA 4WBAA 3H1JE 3L74D 5AVRB 1L0LG 1VQLP 2E76B 4XFJA 3SWKA 4NPFX 1JEKA 2FYZA 2NZ2A 3Q1MA 1LWUB 3Q2YA 2K37A 3HUSA 1NWQA 1PP9D 3RK2C 1L0NE 1FDMA 4UB6H 2Z5HA 1G2CB 5CBOA 2XNXA 5AVQB 2P7JA 4OGQC 5CCHD 4NPDA 1SQQG 5H2FH 1SQBK 2KS1A 3ITKA 3G9RA 1PPJE 1GL2C 5AVZB 2IBZG 3P8CD 2R3CA 1FC2C 5KLVE 2VRSA 3M0DA 1S5LH 1BCCE 3L74E 1L4AA 2WT7A 5KLIC 1J1EB 1KC8Q 2IFMA 2HR3A 1OW6A 1NU1D 2YIUC 1Q81Q 1M1KQ 3OA7A 4UB8H 1QEXA 1RF0C 4OVNF 1PP9E 1HJ0A 4B86A 4N6JA 2R5BA 2HPCA 2LXCB 1BCCG 3L74G 2A45I 1PL5A 2RN0A 1KQSO 3A3YB 5GTIE 1BE3D 3L70D 3LW5H 3II6A 1GK4A 3P8CE 5B66E 3ABVC 3QH9A 3CCQP 2DW3A 2OTLP 2OYIB 3N7NA 4W7YA 1FZFA 1ZV8A 3N4XA 5TJHA 1PIXA 3K5BA 3U1AA 2WPSA 1GW3A 1DD4A 1KZUB 1NU1E 3VMZA 2AEFA 1URQB 4RESB 3CC7P 1RQUA 4ASVA 3R2PA 1MKMA 2FFDB 3H1HJ 2NPSC 3A0HH 3E1IA 2ZYGA 4C7NA 2H43A 1KILA 3CCVP 2PP6A 1KILC 1VPCA 5AW4B 3RK3B 1FZEA 1NKNA 1RE3A 3M9BA 1NHLA 3PH0A 3CWBD 3RK2D 1XTGB 4DJGA 1BE3E 1NU1G 3Q5SA 3L70E 5E79H 3MIWA 3V4WA 3B71A 1JMMA 1JTHA 4OGQD 3L72J 2KIKA 3L73J 1GK6A 2FBWC 3EWKA 5KAIE 1BGYG 1VQMP 1VF5B 4JYCA 3PP5A 1Y8AA 3L75D 5KKZB 1RF1B 3H1KD 3VMAA 1HBWA 1VQ5P 3VP8A 1JM0A 3LIEA 1K04A 1LP1B 1L4AD 4I7ZB 1BE3G 3L70G 1LTSC 3T97B 1Y47A 1SQXJ 1GMJA 2AXTE 5AVTB 2ZT9C 1IFJA 3GHGA 3CWBE 2L91A 1VQKP 3GHGC 2QE7H 1JO5A 3CCUP 4U7JA 3BCCD 1JY3N 1KN7A 4WVZA 1JOCA 2O3JA 4L73A 5CMZA 1M57D 3AEFC 3P8MC 2Y0CA 4PD4I 4O9BA 2WSCJ 2IDBA 2JKVA 5TISH 1LNQA 3WUTA 1S5LE 3L75E 3RL0B 3H1KE 2Q5UA 3TDKA 1L0LK 1Q86Q 1T8ZA 2KI7B 5AW5B 3GLMA 3M0AA 3TYYA 3OJAB 4L76A 4UB8E 1CZQA 2ZYAA 2N1TA 3FXEA 1FZCA 4DCKA 1QL1A 1NTKJ 4PD4D 3B4SA 2KXPB 2OYHA 2NRGA 4BRYB 2BCCD 1BDCA 1KILD 3BCCE 4AUWA 3Q3DA 1QVGO 2M5AB 2SPZA 4I1LA 2C9LY 2H89C 2IFNA 3GF3A 5GTHH 1H0TA 1SQQK 1FZBA 4TT3H 4PV1C 5AW1B 4IFDK 4DZOA 1KQFB 3FWNA 2I1KA 5AVWB 1OXZA 1JY3O 1RE4C 2O01N 1AVOA 1DX7A 2E75C 1AQ5A 1FZGA 5CCGC 1N73C 1LTTC 2YKOA 3BCCG 1VQOP 1FDIA 2JWDA 1RHZB 3HUSB 2E42A 2Q3IA 2YO2A 3EFGA 1R8EA 1N7SA 3A0HE 4LGDE 5AW9B 2FXPA 4PD4E 1X8YA 3O6QB 1N7SC 3RGUA 1VQ8P 2D2CC 3HTKA 2YXQB 2ZJSE 2BCCE 1SQPD 1VL2A 2WSEJ 1KILE 5CJ0A 2IBZI 1LTJB 1SFCB 3WU2E 1RH5B 2W83C 4L74A 2IYPA 1S4XA 2ZT9D 1X22A 4EYYQ 1NTMJ 2E5TA 1YQ3C 5E79E 1ZR2A 1AA0A 4JYBA 2QJYB 3V4QA 2QSIA 1DH3A 1L4AB 3AE7C 2B9BA 1HH0A 2QG4A 2QIWA 1M7LA 5APVA 4YXDC 4KHXA 1SQQD 3IF4A 2JWAA 1KTMA 2IBZD 3CC4P 3L36A 2GM4A 4H0LC 1LTGC 2AEMA 4H44C 2KNCA 2OGUA 2QRXA 1PFIA 2BASA 2PGDA 1AQTA 2HPCB 1LT9A 2GUVA 2K1AA 1SQPE 4D6TJ 3A0BH 4RJTA 2BEQD 3IN6A 1NTZJ 1S1CX 1JNMA 4RO0A 1KB9H 2N1TD 1VQ9P 4IL6H 1M1JC 1FE6A 1NU1K 2ZXEB 1L2PA 1IFIA 1BCCD 3VP9A 4N78D 1SQQE 1FOSE 3G71P 1SQPG 4PV1D 2IBZE 2JEEA 5TISE 4WY4B 1GU4A 3MD0A 3TSIA 4XA4A 1FZAA 4Y99C 2KLVA 2Q1KA 4C7NB 3EQ2A 3TNUA 1J2JB 2E75D 2GUSA 1G1IA 1G1JA 5CCGD 3G6EP 3CI9A 1NTZG 2B87B 3AE2C 3CCSP 2HODB 2XV5A 3KZIH 1EDKA 1T2KC 1GL2A 2B89A 1N7SD 4H13C 2J59M 3AEEC 2D2CD 3B5NB 2WTYA 1JTHB 4N3YB 5GTHE 1JCDA 5BU5A 1AV1A 4ZMDA 3GMAA 1OZHA 5APTA 2QJKC 4AQRD 5B5EH 4N78E 2C9NY 2WSCH 3NXSA 3U1CA 4OWFA 2W6BA 1DIPA 2ZVNB 1JY3P 3I56P 4EIJA 1RF0A 5BU8B 1OIPA 3VN0A 4GIFA 2R32A 1S9KD 4M3LA 3G4SP 3A7OA 3P32A 1LTIC 3CPWO 1S72P 2KZIA 1BSHA 1KB9I 1BGYD 3JCUH 1Q2NA 1GU5A 5APWA 3CCLP 3H1HD 2RKLA 4H0LD 4H44D 3OW2O 1ZMEC 2ZXXA 2QJPB 4U3FJ 3HE5A 1U57A 3TGUJ 3WUUA 1N8RQ 1S5LX 2A06E 1J1DB 3HD7A 1WT6A 3F5HA 1YJWP 1YQ4C 1KB9D 1T3JA 3HD7C 1GD2E 2C0WA 1DEBA 2N9YB 3V2RA 1DD3A 1Q82Q 2M0BA 3FWLA 2XDJA 1D7MA 3L72D 2KSEA 2NPSA 3L73D 1H8AA 1S9KE 3W68A 2W27A 5AVVB 1VQPP 1GDTA 1U7MA 4HKZH 3D6ZA 3SFEC 1KFMA 2E74B 2K9YA 1BGYE 2E76C 3AEAC 1SS1A 2A06G 4HH2A 3CCJP 1LWUA 2QM7A
chains in the Genus database with same CATH topology
2KI7B 2KIKA 3RGUA 2R44A 3S1KA 1OVUA 4GODA 4ZNCA 1OVVA 4K3AA 1U7JA 1ZXGA 5DJTB 1DEEG 2KZIA 1EDIA 2UWJE 2ZAEB 3FXEA 1EC5A 1Q2NA 4EYYQ 5DJUB 4WWIA 1JM0A 1H0TB 5K5GB 2KUBA 2RKLA 3FXDA 2B88A 5CBOA 1LT1A 1LP1B 5CBNA 2I8DA 1BDCA 5EFWB 4K35A 5C39A 2LR2A 4NPDA 4ASWA 2Q1KA 1Y47A 2M5AB 2SPZA 4HJGH 1EDLA 1S3JA 4GOFA 1H0TA 1MFTA 2KS1B 3QWOC 2B87A 1LP1A 1FC2C 4ASVA 3MZWB 1X0TA 2K3RA 2OTKE 3MHVA 4JBZA 2B87B 4GOEA 1EDJA 2KZJA 2M5AA 4MN4C 1EDKA 2HR3A 4IOIH 2QVAA 4KJMA 2B89A 2LXBA 2QRXA 1BDDA 2M0BA 4CPGA 1ZW0A 1JMBA 3ZDMA 1NVOA 3PH0A 1OVRA 1U7MA 2JWDA 4HKZH 4NPEA 2P58A 4HB1A 4ZMDA 2WMMA 1SS1A 4NPFX 2LXCB 4BXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI7 B;  2KIK A;  3RGU A;  2R44 A;  3S1K A;  1OVU A;  4GOD A;  4ZNC A;  1OVV A;  4K3A A;  1U7J A;  1ZXG A;  5DJT B;  1DEE G;  2KZI A;  1EDI A;  2UWJ E;  2ZAE B;  3FXE A;  1EC5 A;  1Q2N A;  4EYY Q;  5DJU B;  4WWI A;  1JM0 A;  1H0T B;  5K5G B;  2KUB A;  2RKL A;  3FXD A;  2B88 A;  5CBO A;  1LT1 A;  1LP1 B;  5CBN A;  2I8D A;  1BDC A;  5EFW B;  4K35 A;  5C39 A;  2LR2 A;  4NPD A;  4ASW A;  2Q1K A;  1Y47 A;  2M5A B;  2SPZ A;  4HJG H;  1EDL A;  1S3J A;  4GOF A;  1H0T A;  1MFT A;  2KS1 B;  3QWO C;  2B87 A;  1LP1 A;  1FC2 C;  4ASV A;  3MZW B;  1X0T A;  2K3R A;  2OTK E;  3MHV A;  4JBZ A;  2B87 B;  4GOE A;  1EDJ A;  2KZJ A;  2M5A A;  4MN4 C;  1EDK A;  2HR3 A;  4IOI H;  2QVA A;  4KJM A;  2B89 A;  2LXB A;  2QRX A;  1BDD A;  2M0B A;  4CPG A;  1ZW0 A;  1JMB A;  3ZDM A;  1NVO A;  3PH0 A;  1OVR A;  1U7M A;  2JWD A;  4HKZ H;  4NPE A;  2P58 A;  4HB1 A;  4ZMD A;  2WMM A;  1SS1 A;  4NPF X;  2LXC B;  4BXL A; 
#chains in the Genus database with same CATH topology
 2N1T B;  2QM8 A;  1FZC B;  2WPR A;  3H1H E;  1LWU C;  1NAY A;  2M3E A;  2OYH B;  3TGU G;  4QMA A;  4K3A A;  1SQX D;  2KOG A;  2UWJ E;  2WSE H;  1XTC C;  4I2L C;  3A0B E;  1G2C A;  1AJY A;  4C46 A;  3FGA D;  2W90 A;  1H0T B;  2JP3 A;  1T2K D;  1KB9 E;  1FBM A;  4IL6 E;  3V6I A;  1SQB J;  1P84 H;  3CD6 P;  5C39 A;  1GL2 D;  4H13 D;  3AE5 C;  4JPZ B;  1Q7Y Q;  2PFX A;  3NMD A;  1YJN P;  3H1H G;  3L72 E;  2AEJ A;  2WWW A;  3L73 E;  3MUD A;  1KOR A;  2JR8 A;  1SQV J;  1J1E C;  3MUD C;  3AE1 C;  2KZJ A;  1MZ9 A;  1QL2 A;  1Y9B A;  4KJM A;  2LXB A;  1X9V A;  3NTN A;  2O01 J;  1IK7 A;  3G3Z A;  1CW5 A;  1FDO A;  2KK7 A;  1SQX E;  1OMI A;  3B8E B;  4UB6 E;  2XKM A;  3WMM 0;  3L72 G;  3M9Q A;  3L73 G;  1UII A;  3VTP C;  3KZI E;  5KAF H;  5AW2 B;  1NTK D;  2JO1 A;  3AEC C;  5H2F E;  3H1L J;  3O8Z A;  1IFM A;  3CXH H;  1IO4 A;  1DEE G;  3IAO A;  3FX0 A;  1N7L A;  1SQV G;  3F89 A;  2OYI C;  2WSF H;  3HD7 D;  3FXD A;  1UIX A;  3HE4 A;  1LJ2 A;  1SQX G;  3PJS K;  3GF7 A;  4GT1 A;  4K35 A;  1SQP K;  4RKU J;  1EDL A;  2MKV A;  2RMZ A;  1PV3 A;  1URQ C;  1W2E A;  2NPS D;  2FFD C;  1GZL A;  1GTW A;  4IFM A;  1P84 I;  2O1K A;  3JCU E;  1LT9 B;  2E43 A;  3C8V A;  4R4M A;  1NTZ K;  1SVF A;  3RK3 C;  1NTK E;  4CPG A;  1HGV A;  1HWT C;  1HGZ A;  3EFF K;  3LID A;  2XU6 A;  4NPE A;  1IFN A;  4HB1 A;  1RE4 A;  2W6J H;  3GG2 A;  3V5B A;  3L71 J;  4TLF A;  1NTM D;  5CCG A;  1N73 A;  1P84 D;  1FU1 A;  3IFM A;  2Q9I A;  1R5L A;  1YTZ I;  1MV8 A;  2HFE D;  2WZ7 A;  3M9H A;  1VF5 C;  2YMY A;  4ZNC A;  1RF1 A;  1ZXG A;  1NTK G;  1EDI A;  3RK2 B;  5KKZ C;  1RF1 C;  2ZAE B;  3Q5R A;  4YPC A;  1IK9 A;  2E5Y A;  1VQ4 P;  3H1I J;  4WWI A;  2PRR A;  1NOH A;  2B88 A;  2P1J A;  4I7Z C;  3SWF A;  4OGQ B;  3R4Y A;  2H88 C;  3P7K A;  2BCC J;  3IR9 A;  5EFW B;  4IFF A;  1M56 D;  3CXH I;  3CLQ A;  2W6A A;  2V7Q J;  1GL2 B;  3NFQ A;  1M90 Q;  1NKZ B;  4GOF A;  3D70 A;  2KS1 B;  3OAK A;  2FYU J;  3U59 A;  5APU A;  5GTI H;  1H88 A;  4HYT B;  1VQ6 P;  4D6T D;  5CHX A;  3L71 G;  4XE5 B;  5KLI B;  1AFO A;  1NTZ D;  4I6M C;  1AVY A;  3GW6 A;  3CME P;  2WT7 B;  3SSU A;  4IOI H;  2IX7 C;  1YIJ P;  1NJI Q;  2V4H A;  1NTM E;  1K9M Q;  1P84 E;  3MTU E;  2YIU B;  3ZDM A;  5KJ7 A;  1NVO A;  3SFD C;  1ZRT E;  4A7P A;  2K88 A;  3CXH D;  1E5W A;  5KJ7 C;  2CK3 H;  1OW7 A;  1QX8 A;  3M91 A;  3RL0 C;  5M1B A;  1NGM B;  1L0L J;  1KMI Z;  1KV4 A;  2XZR A;  1NO4 A;  1ZN5 A;  2FYU G;  3BVH A;  1U7J A;  2YKP A;  2BEZ F;  1NTM G;  3H32 A;  3Q5P A;  1M1J A;  3CL3 D;  2Q3E A;  3HE5 B;  4BRY A;  4DOJ A;  5K5G B;  2J58 A;  3H6P A;  4D6T E;  1CSB A;  4PJ0 H;  2K9J A;  2I8D A;  1NTZ E;  5KAF E;  3H1J J;  1MFZ A;  1GW4 A;  3RK3 D;  4YTP C;  2FY8 A;  3L4F A;  1K8A Q;  4KT0 J;  1HJB A;  2WSF J;  1S3J A;  4DT0 A;  1MFT A;  1W2B O;  1FJP A;  2YKQ A;  1A02 F;  3CXH E;  1X0T A;  5KTB A;  2A45 H;  2W8Z A;  4AYC A;  3D6Y A;  2NPS B;  4LLH A;  4MN4 C;  4WB4 A;  4BWN A;  1KIL B;  3TF5 A;  5AVY B;  1FS0 E;  4D6T G;  4W7Z A;  1ZW0 A;  1L0N J;  1QVF O;  2AXC A;  1KYO H;  2GA1 A;  1VF5 D;  5APQ A;  3AE4 C;  5AW7 B;  2O01 H;  2AXT H;  2YNY A;  3HUS C;  1Z56 A;  4IL6 X;  3O6Q A;  2IZ1 A;  2HLO A;  2JDI H;  2FKW B;  5L8R J;  5AW3 B;  3H1J G;  3BAT A;  2A06 D;  5KLV J;  3W67 A;  1LTJ A;  3S1K A;  1SFC A;  1BCC J;  1KFN A;  3L74 J;  4GOD A;  3RK3 E;  1LTJ C;  4U3F D;  1SFC C;  3E7K A;  3TGU D;  4OH8 B;  1USE A;  2FYN C;  3CX5 H;  1EC5 A;  1CI6 A;  2YMK A;  2KUB A;  2QJY C;  3M0D C;  4EOT A;  1ZLL A;  1SQV K;  1L4A C;  1L0N G;  1JB0 J;  1PP9 J;  1QGK B;  4HJG H;  1ZR4 A;  3V2P A;  1SQX K;  5KJ7 D;  1R5S A;  1EXJ A;  4GKG A;  1LTB C;  2ZT9 B;  2OTK E;  2OYO A;  3TK1 A;  1JY2 N;  3AE6 C;  3RL0 D;  1PPJ G;  3GHG B;  3L37 A;  3VMY A;  3BAS A;  5KLV G;  1A02 J;  2WIT A;  2QEX P;  5AVS B;  2WVR A;  2H8P D;  1PGQ A;  3I55 P;  4U3F E;  2M3B A;  1MUU A;  3TGU E;  1KQL A;  1OWA A;  3CCE P;  2Y0D A;  1NU1 J;  3S9O A;  2MJZ A;  3JC2 2;  4GDO A;  4BXL A;  1HTL C;  1K05 A;  1KYO I;  1SP4 A;  3HRN A;  3MP7 B;  1IZN B;  1PP9 G;  3V2N A;  3VMX A;  2R44 A;  1SQB D;  1YTZ T;  4C7R A;  3HE4 B;  1OVV A;  1FAV A;  2Q7C A;  1N2D C;  2FXM A;  1N86 A;  4EDF A;  1BGY J;  4WY4 A;  1SLQ A;  3A2A A;  3PHL A;  5DJU B;  4ZKU A;  3KXD A;  4WY4 C;  1NTK K;  4U3F G;  1SQV D;  3CMA P;  4PD4 H;  1H89 A;  1TU3 F;  2P2U A;  1KD1 Q;  1BE3 J;  2ZFC A;  3L70 J;  1KYO D;  2QA4 P;  3CX5 I;  1IJD B;  2POH A;  3QWO C;  2B87 A;  2HOD A;  3WU2 H;  2V7Q H;  1NH4 A;  2K3R A;  4W80 A;  1RE3 C;  4GOE A;  4PV1 B;  1JY2 O;  1RY3 A;  3RBZ A;  2JJL A;  2G8Y A;  3RL0 g;  1LGH B;  1WMK A;  4PJ0 E;  3KHU A;  3B5N A;  1HVV A;  1HF9 A;  1JMB A;  3C1L A;  3H1L D;  3B5N C;  2E75 B;  2YXR B;  1N73 B;  1SQB E;  1OVR A;  1SFC D;  1ZP0 C;  1EQ7 A;  4JF7 A;  3CX5 D;  2WMM A;  2FXO A;  3CCM P;  2YO3 A;  1JCC A;  5APX A;  3RBX A;  2Z4E A;  2WPV B;  1N7S B;  1SQV E;  2R3S A;  5AW6 B;  1OVU A;  5AVX B;  3CWB J;  2D2C B;  1BSN A;  2CPB A;  4Z1M H;  3HTK B;  3H25 A;  1KYO E;  1WRG A;  1ZOY C;  1SQB G;  2FYU K;  2Z5I A;  1YHQ P;  1NTM K;  4R4L A;  1W5C E;  1YBK A;  2QJP C;  2LR2 A;  2A45 G;  3AED C;  4ZKP A;  1IC2 A;  1S2E A;  3L75 J;  1OFC X;  2OYI A;  1PGP A;  3H1K J;  1PGO A;  3H1L E;  5AVU B;  1J1D C;  3MZW B;  1LTA C;  3AEB C;  2KYV A;  1VDF A;  5B5E E;  1EDJ A;  1JUN A;  3KQG A;  3CX5 E;  2WPQ A;  3V2Q A;  4H0L B;  3CCR P;  2M8R A;  3L71 D;  1URQ A;  4H44 B;  1EZV I;  1BDD A;  1NAF A;  2FFD A;  3CWB G;  5AW0 B;  2KNC B;  1YI2 P;  3D71 A;  2O1J A;  1YJ9 P;  3KPE A;  4Y28 J;  2E76 D;  2E74 C;  2RH0 A;  3BCC J;  3AE3 C;  1PGJ A;  3H1L G;  3VOP A;  1X79 B;  3H1I D;  4WY4 D;  3H32 B;  1OW8 A;  1YYC A;  2N1T C;  1FZC C;  2IPP A;  2Y9Y A;  2ITA A;  2I1J A;  1M1J B;  2IZ0 A;  3C9I A;  3PLN A;  2WSS H;  5BVZ A;  2OYH C;  1KQG B;  3LW5 J;  3USS A;  3L75 G;  1EZV D;  1M8O B;  3JSV C;  3H1K G;  1Q90 D;  2K9J B;  3PRJ A;  2FYU D;  2HG5 D;  2KB7 P;  1USD A;  2L5G B;  5AW8 B;  1VQ7 P;  1LT1 A;  2G3A A;  1ZRT D;  2LKM A;  3E1R A;  3BRT B;  4EI2 A;  2KP8 A;  3AE8 C;  4ASW A;  3KDP B;  3L71 E;  4Y99 B;  2H7H A;  3M06 A;  1IFP A;  3AE9 C;  3B5N D;  5CJ4 A;  2WQY C;  3AEG C;  2ZVO B;  1LP1 A;  3TNU B;  1T6A A;  1L0N K;  2Y9Z A;  2OAR A;  4JBZ A;  1FOS F;  1OX3 A;  3T97 A;  5CCH A;  2Y0E A;  1VQN P;  5CCH C;  2QVA A;  3H1I E;  4YXW H;  1L0L D;  3PTZ A;  2N9B A;  4H13 B;  1YIT P;  2P10 A;  3A5T A;  5B66 H;  1EZV E;  2HYN A;  5KLV K;  2ZYD A;  2P58 A;  5APS A;  1JY2 P;  4LC1 A;  2QJK B;  2FYU E;  2FYN B;  3I5C A;  2KLU A;  2J5U A;  2C0X A;  1IFD A;  1CI6 B;  4L75 A;  3H1J D;  2OTJ P;  3L35 A;  3H1I G;  5DJT B;  4JQ0 D;  3UIA A;  3CC2 P;  1RQV A;  2KSJ A;  2Q6Q A;  2BCC G;  1EZV G;  1QLE D;  2P67 A;  5CBN A;  2OQQ A;  3MGN A;  2R5D A;  3SWY A;  1SQP J;  1NYH A;  2IYO A;  3S4R A;  1URQ D;  3KYQ A;  1L0L E;  1L0N D;  5APY A;  2XND H;  1FJK A;  3MHV A;  2E74 D;  1K73 Q;  1LT9 C;  1PZQ A;  3BRV B;  2M5A A;  3HD7 B;  3WUV A;  2PAJ A;  1EXI A;  1PPJ D;  5KAI H;  1HUC A;  1T3U A;  1SQQ J;  1E79 H;  3VYI A;  5KLV D;  2CPS A;  4WBA A;  3H1J E;  3L74 D;  5AVR B;  1L0L G;  1VQL P;  2E76 B;  4XFJ A;  3SWK A;  4NPF X;  1JEK A;  2FYZ A;  2NZ2 A;  3Q1M A;  1LWU B;  3Q2Y A;  2K37 A;  3HUS A;  1NWQ A;  1PP9 D;  3RK2 C;  1L0N E;  1FDM A;  4UB6 H;  2Z5H A;  1G2C B;  5CBO A;  2XNX A;  5AVQ B;  2P7J A;  4OGQ C;  5CCH D;  4NPD A;  1SQQ G;  5H2F H;  1SQB K;  2KS1 A;  3ITK A;  3G9R A;  1PPJ E;  1GL2 C;  5AVZ B;  2IBZ G;  3P8C D;  2R3C A;  1FC2 C;  5KLV E;  2VRS A;  3M0D A;  1S5L H;  1BCC E;  3L74 E;  1L4A A;  2WT7 A;  5KLI C;  1J1E B;  1KC8 Q;  2IFM A;  2HR3 A;  1OW6 A;  1NU1 D;  2YIU C;  1Q81 Q;  1M1K Q;  3OA7 A;  4UB8 H;  1QEX A;  1RF0 C;  4OVN F;  1PP9 E;  1HJ0 A;  4B86 A;  4N6J A;  2R5B A;  2HPC A;  2LXC B;  1BCC G;  3L74 G;  2A45 I;  1PL5 A;  2RN0 A;  1KQS O;  3A3Y B;  5GTI E;  1BE3 D;  3L70 D;  3LW5 H;  3II6 A;  1GK4 A;  3P8C E;  5B66 E;  3ABV C;  3QH9 A;  3CCQ P;  2DW3 A;  2OTL P;  2OYI B;  3N7N A;  4W7Y A;  1FZF A;  1ZV8 A;  3N4X A;  5TJH A;  1PIX A;  3K5B A;  3U1A A;  2WPS A;  1GW3 A;  1DD4 A;  1KZU B;  1NU1 E;  3VMZ A;  2AEF A;  1URQ B;  4RES B;  3CC7 P;  1RQU A;  4ASV A;  3R2P A;  1MKM A;  2FFD B;  3H1H J;  2NPS C;  3A0H H;  3E1I A;  2ZYG A;  4C7N A;  2H43 A;  1KIL A;  3CCV P;  2PP6 A;  1KIL C;  1VPC A;  5AW4 B;  3RK3 B;  1FZE A;  1NKN A;  1RE3 A;  3M9B A;  1NHL A;  3PH0 A;  3CWB D;  3RK2 D;  1XTG B;  4DJG A;  1BE3 E;  1NU1 G;  3Q5S A;  3L70 E;  5E79 H;  3MIW A;  3V4W A;  3B71 A;  1JMM A;  1JTH A;  4OGQ D;  3L72 J;  2KIK A;  3L73 J;  1GK6 A;  2FBW C;  3EWK A;  5KAI E;  1BGY G;  1VQM P;  1VF5 B;  4JYC A;  3PP5 A;  1Y8A A;  3L75 D;  5KKZ B;  1RF1 B;  3H1K D;  3VMA A;  1HBW A;  1VQ5 P;  3VP8 A;  1JM0 A;  3LIE A;  1K04 A;  1LP1 B;  1L4A D;  4I7Z B;  1BE3 G;  3L70 G;  1LTS C;  3T97 B;  1Y47 A;  1SQX J;  1GMJ A;  2AXT E;  5AVT B;  2ZT9 C;  1IFJ A;  3GHG A;  3CWB E;  2L91 A;  1VQK P;  3GHG C;  2QE7 H;  1JO5 A;  3CCU P;  4U7J A;  3BCC D;  1JY3 N;  1KN7 A;  4WVZ A;  1JOC A;  2O3J A;  4L73 A;  5CMZ A;  1M57 D;  3AEF C;  3P8M C;  2Y0C A;  4PD4 I;  4O9B A;  2WSC J;  2IDB A;  2JKV A;  5TIS H;  1LNQ A;  3WUT A;  1S5L E;  3L75 E;  3RL0 B;  3H1K E;  2Q5U A;  3TDK A;  1L0L K;  1Q86 Q;  1T8Z A;  2KI7 B;  5AW5 B;  3GLM A;  3M0A A;  3TYY A;  3OJA B;  4L76 A;  4UB8 E;  1CZQ A;  2ZYA A;  2N1T A;  3FXE A;  1FZC A;  4DCK A;  1QL1 A;  1NTK J;  4PD4 D;  3B4S A;  2KXP B;  2OYH A;  2NRG A;  4BRY B;  2BCC D;  1BDC A;  1KIL D;  3BCC E;  4AUW A;  3Q3D A;  1QVG O;  2M5A B;  2SPZ A;  4I1L A;  2C9L Y;  2H89 C;  2IFN A;  3GF3 A;  5GTH H;  1H0T A;  1SQQ K;  1FZB A;  4TT3 H;  4PV1 C;  5AW1 B;  4IFD K;  4DZO A;  1KQF B;  3FWN A;  2I1K A;  5AVW B;  1OXZ A;  1JY3 O;  1RE4 C;  2O01 N;  1AVO A;  1DX7 A;  2E75 C;  1AQ5 A;  1FZG A;  5CCG C;  1N73 C;  1LTT C;  2YKO A;  3BCC G;  1VQO P;  1FDI A;  2JWD A;  1RHZ B;  3HUS B;  2E42 A;  2Q3I A;  2YO2 A;  3EFG A;  1R8E A;  1N7S A;  3A0H E;  4LGD E;  5AW9 B;  2FXP A;  4PD4 E;  1X8Y A;  3O6Q B;  1N7S C;  3RGU A;  1VQ8 P;  2D2C C;  3HTK A;  2YXQ B;  2ZJS E;  2BCC E;  1SQP D;  1VL2 A;  2WSE J;  1KIL E;  5CJ0 A;  2IBZ I;  1LTJ B;  1SFC B;  3WU2 E;  1RH5 B;  2W83 C;  4L74 A;  2IYP A;  1S4X A;  2ZT9 D;  1X22 A;  4EYY Q;  1NTM J;  2E5T A;  1YQ3 C;  5E79 E;  1ZR2 A;  1AA0 A;  4JYB A;  2QJY B;  3V4Q A;  2QSI A;  1DH3 A;  1L4A B;  3AE7 C;  2B9B A;  1HH0 A;  2QG4 A;  2QIW A;  1M7L A;  5APV A;  4YXD C;  4KHX A;  1SQQ D;  3IF4 A;  2JWA A;  1KTM A;  2IBZ D;  3CC4 P;  3L36 A;  2GM4 A;  4H0L C;  1LTG C;  2AEM A;  4H44 C;  2KNC A;  2OGU A;  2QRX A;  1PFI A;  2BAS A;  2PGD A;  1AQT A;  2HPC B;  1LT9 A;  2GUV A;  2K1A A;  1SQP E;  4D6T J;  3A0B H;  4RJT A;  2BEQ D;  3IN6 A;  1NTZ J;  1S1C X;  1JNM A;  4RO0 A;  1KB9 H;  2N1T D;  1VQ9 P;  4IL6 H;  1M1J C;  1FE6 A;  1NU1 K;  2ZXE B;  1L2P A;  1IFI A;  1BCC D;  3VP9 A;  4N78 D;  1SQQ E;  1FOS E;  3G71 P;  1SQP G;  4PV1 D;  2IBZ E;  2JEE A;  5TIS E;  4WY4 B;  1GU4 A;  3MD0 A;  3TSI A;  4XA4 A;  1FZA A;  4Y99 C;  2KLV A;  2Q1K A;  4C7N B;  3EQ2 A;  3TNU A;  1J2J B;  2E75 D;  2GUS A;  1G1I A;  1G1J A;  5CCG D;  3G6E P;  3CI9 A;  1NTZ G;  2B87 B;  3AE2 C;  3CCS P;  2HOD B;  2XV5 A;  3KZI H;  1EDK A;  1T2K C;  1GL2 A;  2B89 A;  1N7S D;  4H13 C;  2J59 M;  3AEE C;  2D2C D;  3B5N B;  2WTY A;  1JTH B;  4N3Y B;  5GTH E;  1JCD A;  5BU5 A;  1AV1 A;  4ZMD A;  3GMA A;  1OZH A;  5APT A;  2QJK C;  4AQR D;  5B5E H;  4N78 E;  2C9N Y;  2WSC H;  3NXS A;  3U1C A;  4OWF A;  2W6B A;  1DIP A;  2ZVN B;  1JY3 P;  3I56 P;  4EIJ A;  1RF0 A;  5BU8 B;  1OIP A;  3VN0 A;  4GIF A;  2R32 A;  1S9K D;  4M3L A;  3G4S P;  3A7O A;  3P32 A;  1LTI C;  3CPW O;  1S72 P;  2KZI A;  1BSH A;  1KB9 I;  1BGY D;  3JCU H;  1Q2N A;  1GU5 A;  5APW A;  3CCL P;  3H1H D;  2RKL A;  4H0L D;  4H44 D;  3OW2 O;  1ZME C;  2ZXX A;  2QJP B;  4U3F J;  3HE5 A;  1U57 A;  3TGU J;  3WUU A;  1N8R Q;  1S5L X;  2A06 E;  1J1D B;  3HD7 A;  1WT6 A;  3F5H A;  1YJW P;  1YQ4 C;  1KB9 D;  1T3J A;  3HD7 C;  1GD2 E;  2C0W A;  1DEB A;  2N9Y B;  3V2R A;  1DD3 A;  1Q82 Q;  2M0B A;  3FWL A;  2XDJ A;  1D7M A;  3L72 D;  2KSE A;  2NPS A;  3L73 D;  1H8A A;  1S9K E;  3W68 A;  2W27 A;  5AVV B;  1VQP P;  1GDT A;  1U7M A;  4HKZ H;  3D6Z A;  3SFE C;  1KFM A;  2E74 B;  2K9Y A;  1BGY E;  2E76 C;  3AEA C;  1SS1 A;  2A06 G;  4HH2 A;  3CCJ P;  1LWU A;  2QM7 A; 
#chains in the Genus database with same CATH homology
 2KI7 B;  2KIK A;  3RGU A;  2R44 A;  3S1K A;  1OVU A;  4GOD A;  4ZNC A;  1OVV A;  4K3A A;  1U7J A;  1ZXG A;  5DJT B;  1DEE G;  2KZI A;  1EDI A;  2UWJ E;  2ZAE B;  3FXE A;  1EC5 A;  1Q2N A;  4EYY Q;  5DJU B;  4WWI A;  1JM0 A;  1H0T B;  5K5G B;  2KUB A;  2RKL A;  3FXD A;  2B88 A;  5CBO A;  1LT1 A;  1LP1 B;  5CBN A;  2I8D A;  1BDC A;  5EFW B;  4K35 A;  5C39 A;  2LR2 A;  4NPD A;  4ASW A;  2Q1K A;  1Y47 A;  2M5A B;  2SPZ A;  4HJG H;  1EDL A;  1S3J A;  4GOF A;  1H0T A;  1MFT A;  2KS1 B;  3QWO C;  2B87 A;  1LP1 A;  1FC2 C;  4ASV A;  3MZW B;  1X0T A;  2K3R A;  2OTK E;  3MHV A;  4JBZ A;  2B87 B;  4GOE A;  1EDJ A;  2KZJ A;  2M5A A;  4MN4 C;  1EDK A;  2HR3 A;  4IOI H;  2QVA A;  4KJM A;  2B89 A;  2LXB A;  2QRX A;  1BDD A;  2M0B A;  4CPG A;  1ZW0 A;  1JMB A;  3ZDM A;  1NVO A;  3PH0 A;  1OVR A;  1U7M A;  2JWD A;  4HKZ H;  4NPE A;  2P58 A;  4HB1 A;  4ZMD A;  2WMM A;  1SS1 A;  4NPF X;  2LXC B;  4BXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...