3GW6A

Intramolecular chaperone
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
264
structure length
256
Chain Sequence
HVTIRIRSEVLMEGEYGFIGKSIPTDNPAGQRIIFCGGEGTSSTTGAQITLYGANNTDSRRIVYNGDEHLFQSADVKPYNDNVTALGGPSNRFTTAYLGSNPIVTANGERKTEPVVFDDAFLDAWGDVHYIMYQWLDAVQLKGNDARIHFGVIAQQIRDVFIAHGLMDENSCRYAVLCYDKYPRMTDTVFSHNEIVEHTDEEGNVTTTEEPVYTEVVIHEEGEEWGVRPDGIFFAEAAYQRRKLERIEARLSALEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Endo-N-acetylneuraminidase
publication title Crystal structure of an intramolecular chaperone mediating triple-beta-helix folding.
pubmed doi rcsb
source organism Enterobacteria phage k1f
total genus 41
structure length 256
sequence length 264
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.129: Endo-alpha-sialidase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13884 Peptidase_S74 Chaperone of endosialidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3gw6A04
1.20.5.1240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Endo-n-acetylneuraminidase 3gw6A02
3.30.2460.10 Alpha Beta 2-Layer Sandwich Endo-n-acetylneuraminidase fold Endo-n-acetylneuraminidase domain 3gw6A03
4.10.1090.10 Few Secondary Structures Irregular Endosialidase, domain 4 Endosialidase, domain 4 3gw6A01
1SQQD 3BCCD 2QJPB 2RN0A 3H1ID 4HIZA 2L91A 3L75D 3FWLA 2BCCD 5KLVD 4U3FD 4RJTA 2YIUB 1SQPD 3GW6A 1NTMD 1PP9D 3PLNA 3L74D 1V0EA 3H1JD 5TJHA 3JU4A 1BGYD 3H1HD 3PRJA 3TF5A 1V0FA 3PTZA 2Y0EA 5KKZB 1NTZD 3H1LD 5KLIB 1NTKD 3L73D 4EDFA 3TGUD 2RMZA 3L70D 2IBZD 3ITKA 3GG2A 3L72D 1KB9D 4PD4D 3GVJA 2Y0DA 3CXHD 4D6TD 3KHUA 2Q3EA 2QJKB 2KNCB 2A06D 2FYNB 2FYUD 3CWBD 1ZRTD 2QG4A 2Y0CA 1EZVD 3H1KD 3L71D 1L0LD 2KS1A 1SQBD 1SQXD 1KYOD 1BCCD 1PPJD 1NU1D 1BE3D 2N9YB 3GVKA 3CX5D 2O3JA 3PHLA 3TDKA 4A7PA 3GVLA 1L0ND 1P84D 3VMAA 2JWAA 1SQVD 2QJYB 2K9JB
chains in the Genus database with same CATH superfamily
4H0LD 2A06G 1NTZJ 1N8RQ 3L73J 2ZT9D 4NPFX 4IFDK 2WPRA 4H13D 1L0LG 1HVVA 2WSCH 3VN0A 2M0BA 1OZHA 1FAVA 1SFCD 2C0WA 1YQ3C 4PD4E 3F89A 1DX7A 4GDOA 1SQBJ 1SQVG 1BCCJ 5TJHA 1JEKA 2OYHC 3QWOC 2WSFJ 3AEFC 3H1IG 3EFFK 1H89A 4Y99B 1ZV8A 4IFFA 3CMAP 1W2BO 2SPZA 2OTJP 1L4AA 2I8DA 4R4LA 1N7SD 1LTBC 1JMMA 1J1EB 2RH0A 1SQQJ 1FZAA 1DEEG 5H2FH 2Y0DA 4D6TE 3UIAA 3L74J 2WQYC 2QA4P 2IFNA 3M0AA 5KAFH 2WT7A 2IPPA 3MUDC 1KZUB 1JY2N 2W83C 2LKMA 4YPCA 1SQXD 2AEJA 1JCCA 3CL3D 2G3AA 5B66H 1PZQA 2R5BA 2AXTH 3LIDA 2HODB 4D6TG 1L2PA 2WSEJ 1CZQA 2KZJA 3SWYA 1LT9B 2Q3IA 3RK2B 3CCUP 1EC5A 4N6JA 3IN6A 1GZLA 3VP9A 5TISE 2E76B 1NTZE 2YIUB 4WBAA 1FDIA 1JCDA 1IFIA 3P8CE 3CWBJ 3BRTB 1YHQP 2B88A 2K9YA 2C9LY 3CX5H 1V0EA 3H1JD 1PFIA 2Z4EA 1GD2E 3TNUA 1NTMK 2QJYC 5KKZB 2I1JA 3H32B 2AXCA 2H8PD 2WPVB 1FDOA 2KSJA 5BU5A 1SQBE 3CX5I 1BCCE 2YXRB 3JCUE 3U1CA 2P58A 1R5LA 2J59M 1T8ZA 1P84E 2G8YA 3E7KA 2JWDA 2PGDA 1JMBA 1SQQE 3HUSB 5BVZA 3H1KD 1DEBA 2JEEA 3E1RA 1AVOA 4ZKUA 4ASWA 1HJBA 1AV1A 2NRGA 2FYZA 4QMAA 1CW5A 4L75A 4N78D 1J2JB 3TDKA 4W7ZA 3CC2P 5APQA 3U1AA 3VMAA 2Z5IA 1NTME 1RY3A 1JY2O 3H1LJ 2OYIB 4WWIA 2A45H 1PP9E 1VQNP 4OGQD 5AW8B 1X0TA 4WVZA 5M1BA 3PJSK 2KYVA 1IO4A 1OIPA 1SQPD 2A45I 3CD6P 2XV5A 1T2KD 1NTMG 3BCCG 2BCCJ 5E79E 1N7SC 2E75C 5KLVJ 1NYHA 1KD1Q 4W80A 1PP9G 1URQC 1QEXA 2ZFCA 2Q5UA 3VTPC 1U7MA 3VMXA 1RQUA 3WU2H 2QRXA 2FXMA 1OW6A 1OW7A 1KQGB 3GG2A 1KILB 4C7NB 2JR8A 2CPBA 2Q3EA 2KNCB 1M7LA 1HGZA 4BRYB 1USEA 3B5ND 4XA4A 3H1HG 2N1TB 5AVZB 1YI2P 3V6IA 2Q9IA 1KMIZ 3L75E 4L73A 1OMIA 3CX5D 3M9QA 2KIKA 4PV1D 2B9BA 3KPEA 3RL0C 4K3AA 2OYIA 1Q90D 1G2CA 3HD7B 3SFEC 3V2QA 1AA0A 3W68A 3FWLA 3NMDA 1YIJP 3SSUA 4I1LA 1VDFA 3A0BH 3RK3B 4H0LB 4LLHA 5GTIH 1VQLP 1KILE 2M5AB 2UWJE 3P7KA 3H1LE 4M3LA 3V4QA 3P8MC 3L37A 3TGUE 3IR9A 1S3JA 1HH0A 3M9HA 3L70E 1VQ5P 2CK3H 3L74D 1J1DC 1V0FA 4DOJA 1SFCB 3ABVC 4UB8E 4JQ0D 2K9JB 3MD0A 4EDFA 1N7LA 4U3FG 4HYTB 3GVJA 5KAIE 1N86A 3AE5C 1AJYA 2N1TA 1BGYJ 1M56D 1FJKA 2OTKE 2Y9YA 3G9RA 5AW1B 2WVRA 1YTZI 2J5UA 3RK3E 1RF1B 1KQFB 2M3EA 1T6AA 1NTKJ 1UIIA 4O9BA 1AVYA 1L4AC 1RE3A 3SFDC 3HD7A 3H1JJ 4A7PA 1KTMA 4EI2A 2ZAEB 2IBZG 3GVLA 4RO0A 1SQXK 2IBZI 1PGOA 1Y9BA 2K1AA 1GMJA 3L71G 2WSCJ 1KC8Q 1T2KC 2HG5D 2XNDH 3KZIH 3JSVC 3H1KJ 1LTJB 3HE4B 5AW6B 3AEDC 3VOPA 2P67A 3WUUA 5CCGA 3L35A 5CBOA 1Y47A 1HF9A 5KTBA 2AEFA 2XU6A 4AUWA 1SQXE 1FZCB 4H44C 4DT0A 2YMYA 2ZVOB 1FS0E 3AE7C 4AQRD 1RF1A 2KS1B 1MUUA 2FYUD 1KN7A 4ZMDA 3RL0g 5BU8B 1FDMA 1FBMA 4NPEA 1Y8AA 1QVGO 1LTIC 2D2CC 1S4XA 1JY2P 2WPSA 2E5YA 3L72G 2N9BA 1LTSC 3H1JE 3NTNA 1PGJA 2R3CA 2BCCD 2LXCB 1GL2B 5KLVD 1MFTA 2PP6A 1LT9C 1YBKA 4UB6E 3D70A 1RE4A 3S9OA 4I7ZC 5AW9B 1OX3A 2KXPB 3MIWA 1U57A 3C1LA 2FFDB 1KFMA 1FE6A 2JP3A 5DJTB 2E76C 1EDKA 3TF5A 3A0HH 2QSIA 1SQPK 3LIEA 2K88A 3AEEC 3H1KE 4EIJA 4JYCA 3P32A 2KUBA 3IAOA 1EDIA 3Q5PA 3CC7P 1LJ2A 4JF7A 2ZYGA 5AVRB 1VF5D 4KJMA 3Q5RA 2W8ZA 1NOHA 4RESB 1BSNA 3TSIA 4L76A 2JDIH 4W7YA 2KI7B 3USSA 4PD4H 2E75D 1URQD 5H2FE 2YNYA 3OAKA 2OTLP 1S5LH 1S72P 3B5NB 3O6QB 4GODA 3D6ZA 3Q1MA 1NTZK 5AVSB 3HUSC 1L0ND 1KORA 5KAFE 1SQPE 4TT3H 4PD4I 1OW8A 2BEQD 2QJPB 4PV1B 3U59A 3OJAB 1CI6A 1G1JA 2E5TA 5B66E 1NU1J 5AW3B 2K9JA 1NKZB 2AXTE 2JKVA 4RJTA 3JC22 1R5SA 1SQBK 2OYIC 3GW6A 3A5TA 1M57D 2YO2A 3BCCJ 5APUA 3RL0D 3MZWB 2QE7H 1H0TB 3WMM0 4N3YB 3AE6C 1SQPG 5B5EH 1YJWP 1BGYD 1KQSO 1K05A 1JB0J 1SQQK 2C9NY 1N2DC 4U7JA 2CPSA 5CJ0A 1NTKD 2R3SA 3L73E 3LW5H 1IK9A 2BASA 1ZW0A 2GUSA 3RBZA 2IFMA 3CX5E 5AVWB 2O1JA 2A06D 5TISH 2J58A 1RQVA 1PGQA 1ZR2A 1SVFA 2WITA 2KOGA 1L0LD 2V7QH 2HPCB 4L74A 1PPJD 1NTZG 2N9YB 4C7RA 1LWUB 3L73G 4EYYQ 2OYHB 4AYCA 4YTPC 2N1TC 4NPDA 5AVTB 3WUTA 1SQVD 4OH8B 3F5HA 1RH5B 2R32A 1YTZT 3H1ID 1QL2A 3JCUH 1GU5A 2O01N 3L74E 2KLUA 5DJUB 2HODA 1RE3C 1LT9A 1SQBG 5AW2B 1BCCG 3CC4P 2YO3A 1L4AD 1VQ7P 3HD7C 2FYUJ 2IYPA 1BSHA 3MP7B 3PLNA 1FZGA 2E74C 1SQQG 3PRJA 1K04A 5CCHA 4LC1A 3R2PA 2Y0EA 1Q86Q 4CPGA 5CJ4A 4KT0J 3V4WA 1IC2A 2Q6QA 1KQLA 2NZ2A 3CCQP 1VF5C 3M06A 1AQTA 3VMZA 4D6TD 4Y28J 3H32A 1VQOP 5AVXB 1QGKB 4WY4B 1VQ8P 2XZRA 5CCGC 3CWBE 1GK4A 3CCJP 1R8EA 1NGMB 1H8AA 3V5BA 4DCKA 3TYYA 2P1JA 3HUSA 1NJIQ 2ITAA 1RF1C 4H44D 1M1JB 2XKMA 5APWA 5AW4B 4PJ0H 2QJYB 4HB1A 1VQMP 3AEGC 1KB9H 3CWBG 1GK6A 1ZR4A 2QM7A 4ASVA 3HTKB 3GHGB 1BE3J 3FX0A 1NO4A 1WRGA 3FXEA 1M1KQ 2D2CD 1KB9I 5AVVB 1E79H 2XNXA 3IFMA 5GTHH 5KLVK 2NPSB 2WTYA 1FZEA 3A0BE 2FYUE 1ZXGA 5GTIE 3CCLP 3B4SA 3L75G 1YITP 2ZT9B 2MJZA 1L0NJ 3VYIA 1BDDA 2WSSH 5C39A 4WY4A 1S9KD 1MKMA 4H13B 1IZNB 1RE4C 1H88A 1FOSE 2KZIA 1OVVA 1JTHB 2QJKB 4C46A 1X8YA 1XTCC 5AVUB 3EQ2A 1EZVE 1FJPA 1KILA 4C7NA 2E76D 1W2EA 1OWAA 2LR2A 3CCEP 1EXIA 2KNCA 1M1JA 1PGPA 3CCRP 4BRYA 1NU1D 3H1LG 2BCCE 3SWKA 5KLVE 3TGUG 1VQ4P 3L70G 5KLIC 1N7SB 1VL2A 2IZ1A 2E75B 1SS1A 4MN4C 1S1CX 1OXZA 1URQB 1M8OB 3BCCD 3G71P 1LP1B 5KAIH 1JNMA 1EZVG 2FYNC 1IJDB 1AFOA 2Q7CA 2B87B 3BATA 1EDLA 3BVHA 5AVYB 3E1IA 1USDA 1HWTC 4WB4A 2R5DA 1DIPA 2FY8A 5KLVG 1HUCA 1GTWA 1KYOH 1Q82Q 3CCVP 1S5LX 1L0LJ 2M5AA 3JU4A 1G1IA 3H1HD 2KSEA 3CI9A 3H6PA 3I55P 1KYOI 1JTHA 1ZP0C 3KZIE 1SQVJ 4JYBA 3PP5A 1Q7YQ 2P2UA 1SFCA 3Q5SA 5APVA 1KB9D 3H1IJ 3SWFA 1FZBA 1NTKK 1L0NE 3AE9C 3MTUE 2M3BA 3PH0A 1RHZB 2FKWB 2JO1A 4IL6H 1IFNA 4Y99C 2HFED 5CBNA 4I6MC 1J1EC 3AE4C 2L91A 1KFNA 3CXHH 1OVRA 1BGYE 3QH9A 2OARA 3BRVB 4D6TJ 3OA7A 4U3FD 1SQXG 1NTKE 2QJPC 1QLED 1NWQA 2YXQB 3IF4A 1K73Q 3CXHI 5APSA 1SP4A 4EOTA 3EFGA 1GU4A 1RF0C 2N1TD 4GKGA 1L4AB 3G3ZA 1QVFO 2GA1A 4BWNA 1A02F 1VQPP 1NHLA 1DD3A 3W67A 1LTJA 3HE4A 1YQ4C 1L0LE 1FZFA 1JM0A 4OGQB 4YXWH 3RK2C 3NXSA 2IBZD 1PPJE 2WT7B 3LW5J 1NTKG 3HD7D 3R4YA 1LGHB 3ZDMA 3A0HE 3MGNA 1FZCA 2YIUC 2LXBA 3KXDA 1T3JA 2W6BA 5L8RJ 2XDJA 2Y9ZA 1SQVE 2Y0CA 3H1JG 5CCHC 2YMKA 2E74D 1KV4A 3L71D 1Q81Q 1FC2C 3H1IE 2KS1A 1JO5A 1KYOD 3WUVA 2P10A 3G6EP 5AW0B 2ZJSE 2V7QJ 1BE3D 4N78E 5KKZC 3RGUA 2GM4A 1PPJG 4OWFA 2JWAA 1FU1A 1SLQA 1W5CE 1HTLC 4GIFA 1LWUC 4H44B 5CCGD 1S5LE 4TLFA 3H1KG 1IFMA 1N73B 1HBWA 2WMMA 1GL2A 4BXLA 3TNUB 1YYCA 3T97B 2D2CB 3V2NA 1UIXA 3PTZA 1BDCA 1PL5A 3KYQA 2FFDA 3KDPB 2IZ0A 3M0DC 3M9BA 3N7NA 1NTMJ 3L72D 4YXDC 1MZ9A 3CXHD 2HR3A 5B5EE 3FWNA 1PP9J 2C0XA 2Q1KA 1HGVA 2ZXEB 3KQGA 3A2AA 1ZRTD 4I2LC 1NVOA 1ZLLA 1X9VA 2BEZF 3BASA 4I7ZB 2Z5HA 2FXOA 4OVNF 2OQQA 4WY4C 1Q2NA 3H1HJ 1VPCA 5APTA 3TK1A 1NU1K 3B5NA 3O6QA 2RN0A 5KJ7C 3GF3A 1KILC 1IFJA 1N73A 1M1JC 1DH3A 3B8EB 1GDTA 4IFMA 4XFJA 3EWKA 2KP8A 1LTAC 3II6A 2V4HA 3AEAC 3T97A 1RF0A 1S9KE 2WSFH 3CCMP 5APYA 3GHGC 1OVUA 2KK7A 1DD4A 3L75J 2POHA 5APXA 1P84H 1MV8A 1H0TA 1JY3P 3C9IA 2JJLA 2NPSC 2KLVA 3O8ZA 1JOCA 2ZVNB 3ITKA 1NU1E 4PD4D 3RK3C 2H7HA 1P84I 4H0LC 4ZNCA 3I5CA 2QIWA 2ZT9C 5CHXA 2RKLA 1GL2D 4U3FJ 3L74G 4K35A 3BCCE 1WT6A 2R44A 4H13C 3TGUJ 3FXDA 2GUVA 1VQ9P 2QJKC 2PAJA 2ZXXA 3L70J 2OYOA 1G2CB 1SFCC 1D7MA 2WSEH 2HPCA 2E42A 1NU1G 1A02J 2A45G 3L4FA 1HJ0A 3HE5B 3WU2E 1LWUA 4HIZA 2OYHA 4RKUJ 3NFQA 1PV3A 2AEMA 1GW4A 3H1HE 2FYUK 1EXJA 3A3YB 5E79H 1PIXA 3B71A 3H25A 4PJ0E 1KB9E 3L71J 4IL6X 2ZYAA 1NH4A 3FGAD 2I1KA 3MUDA 3M0DA 2IX7C 5AVQB 1NTZD 3VMYA 3AE2C 3S4RA 3L73D 3P8CD 2H89C 5GTHE 5AW5B 2OGUA 3KHUA 2O1KA 1JY3N 1AQ5A 1T3UA 3N4XA 2FBWC 2M8RA 2PRRA 3V2RA 1QX8A 1SQBD 1LTJC 2W6AA 4HH2A 1BCCD 1TU3F 1ZMEC 3PHLA 3HE5A 2W27A 4U3FE 2E74B 3RK2D 1P84D 1EDJA 1OFCX 2W6JH 3L36A 1SQQD 4Z1MH 1FZCC 2VRSA 5KJ7A 4JBZA 2FYUG 1VF5B 1S2EA 1SQXJ 3G4SP 1X22A 5CCHD 3L72J 4LGDE 4B86A 4UB8H 2HLOA 1LTTC 1K9MQ 4XE5B 2WPQA 2KB7P 2MKVA 2WZ7A 2W90A 2H88C 3HTKA 3S1KA 1XTGB 3GHGA 1NTMD 1YJ9P 2P7JA 2IBZE 1PP9D 5AW7B 4F0AB 1NAYA 2YKOA 1L0NK 1IFDA 1EZVI 2ZYDA 3RBXA 4ZKPA 2E43A 2H43A 2NPSA 2BCCG 3L71E 3AE1C 3A7OA 1KYOE 1NAFA 1EQ7A 2RMZA 1BE3E 1GL2C 4DJGA 1NKNA 4GOEA 3GF7A 1IFPA 3CCSP 3Q2YA 2B89A 2O01J 2IYOA 3C8VA 3CWBD 4OGQC 3RL0B 3AEBC 3D71A 2FFDC 3AECC 3CMEP 1MFZA 4GOFA 3Q3DA 3GVKA 1JY3O 1E5WA 1JUNA 1LT1A 1BE3G 1X79B 1IK7A 4R4MA 1ZN5A 2WWWA 3GLMA 1YJNP 3L75D 1N7SA 5K5GB 3M91A 1VQ6P 4IL6E 1URQA 3V2PA 4DZOA 1ZOYC 1J1DB 2PFXA 1LP1A 1L0LK 1QL1A 2L5GB 4WY4D 1M90Q 1U7JA 2B87A 3L72E 1L0NG 2YKQA 3CXHE 3B5NC 1GW3A 2IDBA 3VP8A 2DW3A 3GMAA 1SQVK 1N73C 1ZRTE 1Z56A 5KJ7D 1KILD 2QM8A 2QVAA 3H1LD 5KLIB 4JPZB 4KHXA 4PV1C 1WMKA 2FXPA 3TGUD 3HRNA 1SQPJ 3L70D 1VQKP 1FOSF 2YKPA 3AE3C 2A06E 2FYNB 3AE8C 1K8AQ 2K37A 3CPWO 2QG4A 2HYNA 1EZVD 1BGYG 1LNQA 3K5BA 1LTGC 2QEXP 4IOIH 3OW2O 3MHVA 2O3JA 4GT1A 2O01H 3D6YA 3I56P 3CLQA 2NPSD 5CMZA 2K3RA 4HJGH 1CI6B 4HKZH 5EFWB 3RK3D 4UB6H 1CSBA
chains in the Genus database with same CATH topology
1SQQD 3BCCD 2QJPB 2RN0A 3H1ID 4HIZA 2L91A 3L75D 3FWLA 2BCCD 5KLVD 4U3FD 4RJTA 2YIUB 1SQPD 3GW6A 1NTMD 1PP9D 3PLNA 3L74D 1V0EA 3H1JD 5TJHA 3JU4A 1BGYD 3H1HD 3PRJA 3TF5A 1V0FA 3PTZA 2Y0EA 5KKZB 1NTZD 3H1LD 5KLIB 1NTKD 3L73D 4EDFA 3TGUD 2RMZA 3L70D 2IBZD 3ITKA 3GG2A 3L72D 1KB9D 4PD4D 3GVJA 2Y0DA 3CXHD 4D6TD 3KHUA 2Q3EA 2QJKB 2KNCB 2A06D 2FYNB 2FYUD 3CWBD 1ZRTD 2QG4A 2Y0CA 1EZVD 3H1KD 3L71D 1L0LD 2KS1A 1SQBD 1SQXD 1KYOD 1BCCD 1PPJD 1NU1D 1BE3D 2N9YB 3GVKA 3CX5D 2O3JA 3PHLA 3TDKA 4A7PA 3GVLA 1L0ND 1P84D 3VMAA 2JWAA 1SQVD 2QJYB 2K9JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ D;  3BCC D;  2QJP B;  2RN0 A;  3H1I D;  4HIZ A;  2L91 A;  3L75 D;  3FWL A;  2BCC D;  5KLV D;  4U3F D;  4RJT A;  2YIU B;  1SQP D;  3GW6 A;  1NTM D;  1PP9 D;  3PLN A;  3L74 D;  1V0E A;  3H1J D;  5TJH A;  3JU4 A;  1BGY D;  3H1H D;  3PRJ A;  3TF5 A;  1V0F A;  3PTZ A;  2Y0E A;  5KKZ B;  1NTZ D;  3H1L D;  5KLI B;  1NTK D;  3L73 D;  4EDF A;  3TGU D;  2RMZ A;  3L70 D;  2IBZ D;  3ITK A;  3GG2 A;  3L72 D;  1KB9 D;  4PD4 D;  3GVJ A;  2Y0D A;  3CXH D;  4D6T D;  3KHU A;  2Q3E A;  2QJK B;  2KNC B;  2A06 D;  2FYN B;  2FYU D;  3CWB D;  1ZRT D;  2QG4 A;  2Y0C A;  1EZV D;  3H1K D;  3L71 D;  1L0L D;  2KS1 A;  1SQB D;  1SQX D;  1KYO D;  1BCC D;  1PPJ D;  1NU1 D;  1BE3 D;  2N9Y B;  3GVK A;  3CX5 D;  2O3J A;  3PHL A;  3TDK A;  4A7P A;  3GVL A;  1L0N D;  1P84 D;  3VMA A;  2JWA A;  1SQV D;  2QJY B;  2K9J B; 
#chains in the Genus database with same CATH topology
 4H0L D;  2A06 G;  1NTZ J;  1N8R Q;  3L73 J;  2ZT9 D;  4NPF X;  4IFD K;  2WPR A;  4H13 D;  1L0L G;  1HVV A;  2WSC H;  3VN0 A;  2M0B A;  1OZH A;  1FAV A;  1SFC D;  2C0W A;  1YQ3 C;  4PD4 E;  3F89 A;  1DX7 A;  4GDO A;  1SQB J;  1SQV G;  1BCC J;  5TJH A;  1JEK A;  2OYH C;  3QWO C;  2WSF J;  3AEF C;  3H1I G;  3EFF K;  1H89 A;  4Y99 B;  1ZV8 A;  4IFF A;  3CMA P;  1W2B O;  2SPZ A;  2OTJ P;  1L4A A;  2I8D A;  4R4L A;  1N7S D;  1LTB C;  1JMM A;  1J1E B;  2RH0 A;  1SQQ J;  1FZA A;  1DEE G;  5H2F H;  2Y0D A;  4D6T E;  3UIA A;  3L74 J;  2WQY C;  2QA4 P;  2IFN A;  3M0A A;  5KAF H;  2WT7 A;  2IPP A;  3MUD C;  1KZU B;  1JY2 N;  2W83 C;  2LKM A;  4YPC A;  1SQX D;  2AEJ A;  1JCC A;  3CL3 D;  2G3A A;  5B66 H;  1PZQ A;  2R5B A;  2AXT H;  3LID A;  2HOD B;  4D6T G;  1L2P A;  2WSE J;  1CZQ A;  2KZJ A;  3SWY A;  1LT9 B;  2Q3I A;  3RK2 B;  3CCU P;  1EC5 A;  4N6J A;  3IN6 A;  1GZL A;  3VP9 A;  5TIS E;  2E76 B;  1NTZ E;  2YIU B;  4WBA A;  1FDI A;  1JCD A;  1IFI A;  3P8C E;  3CWB J;  3BRT B;  1YHQ P;  2B88 A;  2K9Y A;  2C9L Y;  3CX5 H;  1V0E A;  3H1J D;  1PFI A;  2Z4E A;  1GD2 E;  3TNU A;  1NTM K;  2QJY C;  5KKZ B;  2I1J A;  3H32 B;  2AXC A;  2H8P D;  2WPV B;  1FDO A;  2KSJ A;  5BU5 A;  1SQB E;  3CX5 I;  1BCC E;  2YXR B;  3JCU E;  3U1C A;  2P58 A;  1R5L A;  2J59 M;  1T8Z A;  1P84 E;  2G8Y A;  3E7K A;  2JWD A;  2PGD A;  1JMB A;  1SQQ E;  3HUS B;  5BVZ A;  3H1K D;  1DEB A;  2JEE A;  3E1R A;  1AVO A;  4ZKU A;  4ASW A;  1HJB A;  1AV1 A;  2NRG A;  2FYZ A;  4QMA A;  1CW5 A;  4L75 A;  4N78 D;  1J2J B;  3TDK A;  4W7Z A;  3CC2 P;  5APQ A;  3U1A A;  3VMA A;  2Z5I A;  1NTM E;  1RY3 A;  1JY2 O;  3H1L J;  2OYI B;  4WWI A;  2A45 H;  1PP9 E;  1VQN P;  4OGQ D;  5AW8 B;  1X0T A;  4WVZ A;  5M1B A;  3PJS K;  2KYV A;  1IO4 A;  1OIP A;  1SQP D;  2A45 I;  3CD6 P;  2XV5 A;  1T2K D;  1NTM G;  3BCC G;  2BCC J;  5E79 E;  1N7S C;  2E75 C;  5KLV J;  1NYH A;  1KD1 Q;  4W80 A;  1PP9 G;  1URQ C;  1QEX A;  2ZFC A;  2Q5U A;  3VTP C;  1U7M A;  3VMX A;  1RQU A;  3WU2 H;  2QRX A;  2FXM A;  1OW6 A;  1OW7 A;  1KQG B;  3GG2 A;  1KIL B;  4C7N B;  2JR8 A;  2CPB A;  2Q3E A;  2KNC B;  1M7L A;  1HGZ A;  4BRY B;  1USE A;  3B5N D;  4XA4 A;  3H1H G;  2N1T B;  5AVZ B;  1YI2 P;  3V6I A;  2Q9I A;  1KMI Z;  3L75 E;  4L73 A;  1OMI A;  3CX5 D;  3M9Q A;  2KIK A;  4PV1 D;  2B9B A;  3KPE A;  3RL0 C;  4K3A A;  2OYI A;  1Q90 D;  1G2C A;  3HD7 B;  3SFE C;  3V2Q A;  1AA0 A;  3W68 A;  3FWL A;  3NMD A;  1YIJ P;  3SSU A;  4I1L A;  1VDF A;  3A0B H;  3RK3 B;  4H0L B;  4LLH A;  5GTI H;  1VQL P;  1KIL E;  2M5A B;  2UWJ E;  3P7K A;  3H1L E;  4M3L A;  3V4Q A;  3P8M C;  3L37 A;  3TGU E;  3IR9 A;  1S3J A;  1HH0 A;  3M9H A;  3L70 E;  1VQ5 P;  2CK3 H;  3L74 D;  1J1D C;  1V0F A;  4DOJ A;  1SFC B;  3ABV C;  4UB8 E;  4JQ0 D;  2K9J B;  3MD0 A;  4EDF A;  1N7L A;  4U3F G;  4HYT B;  3GVJ A;  5KAI E;  1N86 A;  3AE5 C;  1AJY A;  2N1T A;  1BGY J;  1M56 D;  1FJK A;  2OTK E;  2Y9Y A;  3G9R A;  5AW1 B;  2WVR A;  1YTZ I;  2J5U A;  3RK3 E;  1RF1 B;  1KQF B;  2M3E A;  1T6A A;  1NTK J;  1UII A;  4O9B A;  1AVY A;  1L4A C;  1RE3 A;  3SFD C;  3HD7 A;  3H1J J;  4A7P A;  1KTM A;  4EI2 A;  2ZAE B;  2IBZ G;  3GVL A;  4RO0 A;  1SQX K;  2IBZ I;  1PGO A;  1Y9B A;  2K1A A;  1GMJ A;  3L71 G;  2WSC J;  1KC8 Q;  1T2K C;  2HG5 D;  2XND H;  3KZI H;  3JSV C;  3H1K J;  1LTJ B;  3HE4 B;  5AW6 B;  3AED C;  3VOP A;  2P67 A;  3WUU A;  5CCG A;  3L35 A;  5CBO A;  1Y47 A;  1HF9 A;  5KTB A;  2AEF A;  2XU6 A;  4AUW A;  1SQX E;  1FZC B;  4H44 C;  4DT0 A;  2YMY A;  2ZVO B;  1FS0 E;  3AE7 C;  4AQR D;  1RF1 A;  2KS1 B;  1MUU A;  2FYU D;  1KN7 A;  4ZMD A;  3RL0 g;  5BU8 B;  1FDM A;  1FBM A;  4NPE A;  1Y8A A;  1QVG O;  1LTI C;  2D2C C;  1S4X A;  1JY2 P;  2WPS A;  2E5Y A;  3L72 G;  2N9B A;  1LTS C;  3H1J E;  3NTN A;  1PGJ A;  2R3C A;  2BCC D;  2LXC B;  1GL2 B;  5KLV D;  1MFT A;  2PP6 A;  1LT9 C;  1YBK A;  4UB6 E;  3D70 A;  1RE4 A;  3S9O A;  4I7Z C;  5AW9 B;  1OX3 A;  2KXP B;  3MIW A;  1U57 A;  3C1L A;  2FFD B;  1KFM A;  1FE6 A;  2JP3 A;  5DJT B;  2E76 C;  1EDK A;  3TF5 A;  3A0H H;  2QSI A;  1SQP K;  3LIE A;  2K88 A;  3AEE C;  3H1K E;  4EIJ A;  4JYC A;  3P32 A;  2KUB A;  3IAO A;  1EDI A;  3Q5P A;  3CC7 P;  1LJ2 A;  4JF7 A;  2ZYG A;  5AVR B;  1VF5 D;  4KJM A;  3Q5R A;  2W8Z A;  1NOH A;  4RES B;  1BSN A;  3TSI A;  4L76 A;  2JDI H;  4W7Y A;  2KI7 B;  3USS A;  4PD4 H;  2E75 D;  1URQ D;  5H2F E;  2YNY A;  3OAK A;  2OTL P;  1S5L H;  1S72 P;  3B5N B;  3O6Q B;  4GOD A;  3D6Z A;  3Q1M A;  1NTZ K;  5AVS B;  3HUS C;  1L0N D;  1KOR A;  5KAF E;  1SQP E;  4TT3 H;  4PD4 I;  1OW8 A;  2BEQ D;  2QJP B;  4PV1 B;  3U59 A;  3OJA B;  1CI6 A;  1G1J A;  2E5T A;  5B66 E;  1NU1 J;  5AW3 B;  2K9J A;  1NKZ B;  2AXT E;  2JKV A;  4RJT A;  3JC2 2;  1R5S A;  1SQB K;  2OYI C;  3GW6 A;  3A5T A;  1M57 D;  2YO2 A;  3BCC J;  5APU A;  3RL0 D;  3MZW B;  2QE7 H;  1H0T B;  3WMM 0;  4N3Y B;  3AE6 C;  1SQP G;  5B5E H;  1YJW P;  1BGY D;  1KQS O;  1K05 A;  1JB0 J;  1SQQ K;  2C9N Y;  1N2D C;  4U7J A;  2CPS A;  5CJ0 A;  1NTK D;  2R3S A;  3L73 E;  3LW5 H;  1IK9 A;  2BAS A;  1ZW0 A;  2GUS A;  3RBZ A;  2IFM A;  3CX5 E;  5AVW B;  2O1J A;  2A06 D;  5TIS H;  2J58 A;  1RQV A;  1PGQ A;  1ZR2 A;  1SVF A;  2WIT A;  2KOG A;  1L0L D;  2V7Q H;  2HPC B;  4L74 A;  1PPJ D;  1NTZ G;  2N9Y B;  4C7R A;  1LWU B;  3L73 G;  4EYY Q;  2OYH B;  4AYC A;  4YTP C;  2N1T C;  4NPD A;  5AVT B;  3WUT A;  1SQV D;  4OH8 B;  3F5H A;  1RH5 B;  2R32 A;  1YTZ T;  3H1I D;  1QL2 A;  3JCU H;  1GU5 A;  2O01 N;  3L74 E;  2KLU A;  5DJU B;  2HOD A;  1RE3 C;  1LT9 A;  1SQB G;  5AW2 B;  1BCC G;  3CC4 P;  2YO3 A;  1L4A D;  1VQ7 P;  3HD7 C;  2FYU J;  2IYP A;  1BSH A;  3MP7 B;  3PLN A;  1FZG A;  2E74 C;  1SQQ G;  3PRJ A;  1K04 A;  5CCH A;  4LC1 A;  3R2P A;  2Y0E A;  1Q86 Q;  4CPG A;  5CJ4 A;  4KT0 J;  3V4W A;  1IC2 A;  2Q6Q A;  1KQL A;  2NZ2 A;  3CCQ P;  1VF5 C;  3M06 A;  1AQT A;  3VMZ A;  4D6T D;  4Y28 J;  3H32 A;  1VQO P;  5AVX B;  1QGK B;  4WY4 B;  1VQ8 P;  2XZR A;  5CCG C;  3CWB E;  1GK4 A;  3CCJ P;  1R8E A;  1NGM B;  1H8A A;  3V5B A;  4DCK A;  3TYY A;  2P1J A;  3HUS A;  1NJI Q;  2ITA A;  1RF1 C;  4H44 D;  1M1J B;  2XKM A;  5APW A;  5AW4 B;  4PJ0 H;  2QJY B;  4HB1 A;  1VQM P;  3AEG C;  1KB9 H;  3CWB G;  1GK6 A;  1ZR4 A;  2QM7 A;  4ASV A;  3HTK B;  3GHG B;  1BE3 J;  3FX0 A;  1NO4 A;  1WRG A;  3FXE A;  1M1K Q;  2D2C D;  1KB9 I;  5AVV B;  1E79 H;  2XNX A;  3IFM A;  5GTH H;  5KLV K;  2NPS B;  2WTY A;  1FZE A;  3A0B E;  2FYU E;  1ZXG A;  5GTI E;  3CCL P;  3B4S A;  3L75 G;  1YIT P;  2ZT9 B;  2MJZ A;  1L0N J;  3VYI A;  1BDD A;  2WSS H;  5C39 A;  4WY4 A;  1S9K D;  1MKM A;  4H13 B;  1IZN B;  1RE4 C;  1H88 A;  1FOS E;  2KZI A;  1OVV A;  1JTH B;  2QJK B;  4C46 A;  1X8Y A;  1XTC C;  5AVU B;  3EQ2 A;  1EZV E;  1FJP A;  1KIL A;  4C7N A;  2E76 D;  1W2E A;  1OWA A;  2LR2 A;  3CCE P;  1EXI A;  2KNC A;  1M1J A;  1PGP A;  3CCR P;  4BRY A;  1NU1 D;  3H1L G;  2BCC E;  3SWK A;  5KLV E;  3TGU G;  1VQ4 P;  3L70 G;  5KLI C;  1N7S B;  1VL2 A;  2IZ1 A;  2E75 B;  1SS1 A;  4MN4 C;  1S1C X;  1OXZ A;  1URQ B;  1M8O B;  3BCC D;  3G71 P;  1LP1 B;  5KAI H;  1JNM A;  1EZV G;  2FYN C;  1IJD B;  1AFO A;  2Q7C A;  2B87 B;  3BAT A;  1EDL A;  3BVH A;  5AVY B;  3E1I A;  1USD A;  1HWT C;  4WB4 A;  2R5D A;  1DIP A;  2FY8 A;  5KLV G;  1HUC A;  1GTW A;  1KYO H;  1Q82 Q;  3CCV P;  1S5L X;  1L0L J;  2M5A A;  3JU4 A;  1G1I A;  3H1H D;  2KSE A;  3CI9 A;  3H6P A;  3I55 P;  1KYO I;  1JTH A;  1ZP0 C;  3KZI E;  1SQV J;  4JYB A;  3PP5 A;  1Q7Y Q;  2P2U A;  1SFC A;  3Q5S A;  5APV A;  1KB9 D;  3H1I J;  3SWF A;  1FZB A;  1NTK K;  1L0N E;  3AE9 C;  3MTU E;  2M3B A;  3PH0 A;  1RHZ B;  2FKW B;  2JO1 A;  4IL6 H;  1IFN A;  4Y99 C;  2HFE D;  5CBN A;  4I6M C;  1J1E C;  3AE4 C;  2L91 A;  1KFN A;  3CXH H;  1OVR A;  1BGY E;  3QH9 A;  2OAR A;  3BRV B;  4D6T J;  3OA7 A;  4U3F D;  1SQX G;  1NTK E;  2QJP C;  1QLE D;  1NWQ A;  2YXQ B;  3IF4 A;  1K73 Q;  3CXH I;  5APS A;  1SP4 A;  4EOT A;  3EFG A;  1GU4 A;  1RF0 C;  2N1T D;  4GKG A;  1L4A B;  3G3Z A;  1QVF O;  2GA1 A;  4BWN A;  1A02 F;  1VQP P;  1NHL A;  1DD3 A;  3W67 A;  1LTJ A;  3HE4 A;  1YQ4 C;  1L0L E;  1FZF A;  1JM0 A;  4OGQ B;  4YXW H;  3RK2 C;  3NXS A;  2IBZ D;  1PPJ E;  2WT7 B;  3LW5 J;  1NTK G;  3HD7 D;  3R4Y A;  1LGH B;  3ZDM A;  3A0H E;  3MGN A;  1FZC A;  2YIU C;  2LXB A;  3KXD A;  1T3J A;  2W6B A;  5L8R J;  2XDJ A;  2Y9Z A;  1SQV E;  2Y0C A;  3H1J G;  5CCH C;  2YMK A;  2E74 D;  1KV4 A;  3L71 D;  1Q81 Q;  1FC2 C;  3H1I E;  2KS1 A;  1JO5 A;  1KYO D;  3WUV A;  2P10 A;  3G6E P;  5AW0 B;  2ZJS E;  2V7Q J;  1BE3 D;  4N78 E;  5KKZ C;  3RGU A;  2GM4 A;  1PPJ G;  4OWF A;  2JWA A;  1FU1 A;  1SLQ A;  1W5C E;  1HTL C;  4GIF A;  1LWU C;  4H44 B;  5CCG D;  1S5L E;  4TLF A;  3H1K G;  1IFM A;  1N73 B;  1HBW A;  2WMM A;  1GL2 A;  4BXL A;  3TNU B;  1YYC A;  3T97 B;  2D2C B;  3V2N A;  1UIX A;  3PTZ A;  1BDC A;  1PL5 A;  3KYQ A;  2FFD A;  3KDP B;  2IZ0 A;  3M0D C;  3M9B A;  3N7N A;  1NTM J;  3L72 D;  4YXD C;  1MZ9 A;  3CXH D;  2HR3 A;  5B5E E;  3FWN A;  1PP9 J;  2C0X A;  2Q1K A;  1HGV A;  2ZXE B;  3KQG A;  3A2A A;  1ZRT D;  4I2L C;  1NVO A;  1ZLL A;  1X9V A;  2BEZ F;  3BAS A;  4I7Z B;  2Z5H A;  2FXO A;  4OVN F;  2OQQ A;  4WY4 C;  1Q2N A;  3H1H J;  1VPC A;  5APT A;  3TK1 A;  1NU1 K;  3B5N A;  3O6Q A;  2RN0 A;  5KJ7 C;  3GF3 A;  1KIL C;  1IFJ A;  1N73 A;  1M1J C;  1DH3 A;  3B8E B;  1GDT A;  4IFM A;  4XFJ A;  3EWK A;  2KP8 A;  1LTA C;  3II6 A;  2V4H A;  3AEA C;  3T97 A;  1RF0 A;  1S9K E;  2WSF H;  3CCM P;  5APY A;  3GHG C;  1OVU A;  2KK7 A;  1DD4 A;  3L75 J;  2POH A;  5APX A;  1P84 H;  1MV8 A;  1H0T A;  1JY3 P;  3C9I A;  2JJL A;  2NPS C;  2KLV A;  3O8Z A;  1JOC A;  2ZVN B;  3ITK A;  1NU1 E;  4PD4 D;  3RK3 C;  2H7H A;  1P84 I;  4H0L C;  4ZNC A;  3I5C A;  2QIW A;  2ZT9 C;  5CHX A;  2RKL A;  1GL2 D;  4U3F J;  3L74 G;  4K35 A;  3BCC E;  1WT6 A;  2R44 A;  4H13 C;  3TGU J;  3FXD A;  2GUV A;  1VQ9 P;  2QJK C;  2PAJ A;  2ZXX A;  3L70 J;  2OYO A;  1G2C B;  1SFC C;  1D7M A;  2WSE H;  2HPC A;  2E42 A;  1NU1 G;  1A02 J;  2A45 G;  3L4F A;  1HJ0 A;  3HE5 B;  3WU2 E;  1LWU A;  4HIZ A;  2OYH A;  4RKU J;  3NFQ A;  1PV3 A;  2AEM A;  1GW4 A;  3H1H E;  2FYU K;  1EXJ A;  3A3Y B;  5E79 H;  1PIX A;  3B71 A;  3H25 A;  4PJ0 E;  1KB9 E;  3L71 J;  4IL6 X;  2ZYA A;  1NH4 A;  3FGA D;  2I1K A;  3MUD A;  3M0D A;  2IX7 C;  5AVQ B;  1NTZ D;  3VMY A;  3AE2 C;  3S4R A;  3L73 D;  3P8C D;  2H89 C;  5GTH E;  5AW5 B;  2OGU A;  3KHU A;  2O1K A;  1JY3 N;  1AQ5 A;  1T3U A;  3N4X A;  2FBW C;  2M8R A;  2PRR A;  3V2R A;  1QX8 A;  1SQB D;  1LTJ C;  2W6A A;  4HH2 A;  1BCC D;  1TU3 F;  1ZME C;  3PHL A;  3HE5 A;  2W27 A;  4U3F E;  2E74 B;  3RK2 D;  1P84 D;  1EDJ A;  1OFC X;  2W6J H;  3L36 A;  1SQQ D;  4Z1M H;  1FZC C;  2VRS A;  5KJ7 A;  4JBZ A;  2FYU G;  1VF5 B;  1S2E A;  1SQX J;  3G4S P;  1X22 A;  5CCH D;  3L72 J;  4LGD E;  4B86 A;  4UB8 H;  2HLO A;  1LTT C;  1K9M Q;  4XE5 B;  2WPQ A;  2KB7 P;  2MKV A;  2WZ7 A;  2W90 A;  2H88 C;  3HTK A;  3S1K A;  1XTG B;  3GHG A;  1NTM D;  1YJ9 P;  2P7J A;  2IBZ E;  1PP9 D;  5AW7 B;  4F0A B;  1NAY A;  2YKO A;  1L0N K;  1IFD A;  1EZV I;  2ZYD A;  3RBX A;  4ZKP A;  2E43 A;  2H43 A;  2NPS A;  2BCC G;  3L71 E;  3AE1 C;  3A7O A;  1KYO E;  1NAF A;  1EQ7 A;  2RMZ A;  1BE3 E;  1GL2 C;  4DJG A;  1NKN A;  4GOE A;  3GF7 A;  1IFP A;  3CCS P;  3Q2Y A;  2B89 A;  2O01 J;  2IYO A;  3C8V A;  3CWB D;  4OGQ C;  3RL0 B;  3AEB C;  3D71 A;  2FFD C;  3AEC C;  3CME P;  1MFZ A;  4GOF A;  3Q3D A;  3GVK A;  1JY3 O;  1E5W A;  1JUN A;  1LT1 A;  1BE3 G;  1X79 B;  1IK7 A;  4R4M A;  1ZN5 A;  2WWW A;  3GLM A;  1YJN P;  3L75 D;  1N7S A;  5K5G B;  3M91 A;  1VQ6 P;  4IL6 E;  1URQ A;  3V2P A;  4DZO A;  1ZOY C;  1J1D B;  2PFX A;  1LP1 A;  1L0L K;  1QL1 A;  2L5G B;  4WY4 D;  1M90 Q;  1U7J A;  2B87 A;  3L72 E;  1L0N G;  2YKQ A;  3CXH E;  3B5N C;  1GW3 A;  2IDB A;  3VP8 A;  2DW3 A;  3GMA A;  1SQV K;  1N73 C;  1ZRT E;  1Z56 A;  5KJ7 D;  1KIL D;  2QM8 A;  2QVA A;  3H1L D;  5KLI B;  4JPZ B;  4KHX A;  4PV1 C;  1WMK A;  2FXP A;  3TGU D;  3HRN A;  1SQP J;  3L70 D;  1VQK P;  1FOS F;  2YKP A;  3AE3 C;  2A06 E;  2FYN B;  3AE8 C;  1K8A Q;  2K37 A;  3CPW O;  2QG4 A;  2HYN A;  1EZV D;  1BGY G;  1LNQ A;  3K5B A;  1LTG C;  2QEX P;  4IOI H;  3OW2 O;  3MHV A;  2O3J A;  4GT1 A;  2O01 H;  3D6Y A;  3I56 P;  3CLQ A;  2NPS D;  5CMZ A;  2K3R A;  4HJG H;  1CI6 B;  4HKZ H;  5EFW B;  3RK3 D;  4UB6 H;  1CSB A; 
#chains in the Genus database with same CATH homology
 1SQQ D;  3BCC D;  2QJP B;  2RN0 A;  3H1I D;  4HIZ A;  2L91 A;  3L75 D;  3FWL A;  2BCC D;  5KLV D;  4U3F D;  4RJT A;  2YIU B;  1SQP D;  3GW6 A;  1NTM D;  1PP9 D;  3PLN A;  3L74 D;  1V0E A;  3H1J D;  5TJH A;  3JU4 A;  1BGY D;  3H1H D;  3PRJ A;  3TF5 A;  1V0F A;  3PTZ A;  2Y0E A;  5KKZ B;  1NTZ D;  3H1L D;  5KLI B;  1NTK D;  3L73 D;  4EDF A;  3TGU D;  2RMZ A;  3L70 D;  2IBZ D;  3ITK A;  3GG2 A;  3L72 D;  1KB9 D;  4PD4 D;  3GVJ A;  2Y0D A;  3CXH D;  4D6T D;  3KHU A;  2Q3E A;  2QJK B;  2KNC B;  2A06 D;  2FYN B;  2FYU D;  3CWB D;  1ZRT D;  2QG4 A;  2Y0C A;  1EZV D;  3H1K D;  3L71 D;  1L0L D;  2KS1 A;  1SQB D;  1SQX D;  1KYO D;  1BCC D;  1PPJ D;  1NU1 D;  1BE3 D;  2N9Y B;  3GVK A;  3CX5 D;  2O3J A;  3PHL A;  3TDK A;  4A7P A;  3GVL A;  1L0N D;  1P84 D;  3VMA A;  2JWA A;  1SQV D;  2QJY B;  2K9J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...