3GW6A

Intramolecular chaperone
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
264
structure length
256
Chain Sequence
HVTIRIRSEVLMEGEYGFIGKSIPTDNPAGQRIIFCGGEGTSSTTGAQITLYGANNTDSRRIVYNGDEHLFQSADVKPYNDNVTALGGPSNRFTTAYLGSNPIVTANGERKTEPVVFDDAFLDAWGDVHYIMYQWLDAVQLKGNDARIHFGVIAQQIRDVFIAHGLMDENSCRYAVLCYDKYPRMTDTVFSHNEIVEHTDEEGNVTTTEEPVYTEVVIHEEGEEWGVRPDGIFFAEAAYQRRKLERIEARLSALEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endo-N-acetylneuraminidase
publication title Crystal structure of an intramolecular chaperone mediating triple-beta-helix folding.
pubmed doi rcsb
source organism Enterobacteria phage k1f
molecule tags Chaperone
total genus 41
structure length 256
sequence length 264
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.129: Endo-alpha-sialidase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13884 Peptidase_S74 Chaperone of endosialidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3gw6A04
1.20.5.1240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Endo-n-acetylneuraminidase 3gw6A02
3.30.2460.10 Alpha Beta 2-Layer Sandwich Endo-n-acetylneuraminidase fold Endo-n-acetylneuraminidase domain 3gw6A03
4.10.1090.10 Few Secondary Structures Irregular Endosialidase, domain 4 Endosialidase, domain 4 3gw6A01
4D6TD 3CX5D 3GVJA 2KNCB 3TDKA 4EDFA 3CWBD 2O3JA 2Y0CA 5KLVD 3H1LD 2Q3EA 2RMZA 3H1KD 1SQBD 2KS1A 1BE3D 3L74D 1BGYD 2BCCD 2YIUB 1P84D 3TF5A 1NU1D 2QJPB 3PHLA 3TGUD 2IBZD 3PLNA 1L0LD 1NTMD 3GVKA 3L70D 1SQVD 4RJTA 1EZVD 1V0FA 1ZRTD 3CXHD 5KKZB 1L0ND 3H1JD 2FYNB 4HIZA 1BCCD 1SQPD 3GW6A 4U3FD 1PP9D 5TJHA 3ITKA 2RN0A 4PD4D 3PTZA 2QJYB 3FWLA 5KLIB 2L91A 3L72D 3VMAA 2FYUD 2JWAA 2N9YB 3H1ID 1SQXD 3H1HD 2QJKB 2A06D 1NTZD 3L75D 1KB9D 3GG2A 2QG4A 3GVLA 1NTKD 1SQQD 3JU4A 1PPJD 2Y0DA 2K9JB 3BCCD 4A7PA 3PRJA 2Y0EA 1V0EA 3KHUA 3L73D 1KYOD 3L71D
chains in the Genus database with same CATH superfamily
1LNQA 2B9BA 3GHGC 5BVZA 3AEBC 5APXA 1TU3F 2FYUE 3Q5RA 3H6PA 1IFPA 3OAKA 1EDIA 1L0NJ 3H1KD 3EFFK 1KYOH 2ITAA 2CPSA 3PHLA 1SQQE 1L0LJ 3O6QB 1NTMD 2ZJSE 3CCSP 4KT0J 4O9BA 1Y9BA 5M1BA 3SWYA 1LWUB 5E79E 1SQBG 3D6YA 1N8RQ 5DJUB 4EIJA 2O01J 4L76A 3T97A 5AW2B 4KHXA 3PJSK 2PGDA 1IJDB 1SFCB 4IFFA 5CBOA 1NTZK 4JBZA 3L74E 3WUVA 3RL0g 2E5TA 5KTBA 1YHQP 1N73C 1HWTC 3H1JG 4IL6H 3TGUE 2G3AA 4DJGA 2FYUJ 2KUBA 2QSIA 2W6JH 2JWAA 2OTLP 3HD7D 5AW9B 4PJ0E 2W90A 1N7SA 1ZRTE 4H44C 1Q90D 2PRRA 5KLIC 1FS0E 4A7PA 3VMXA 2A45G 4U3FE 3L75G 1ZLLA 4OGQD 5APSA 4PD4E 1LTIC 3GVJA 3TDKA 2CK3H 1GTWA 3H32A 3RGUA 3D71A 1W2EA 1M1JA 3RK3D 3L74J 1LTJA 3TGUJ 1JCCA 3VMYA 2Q9IA 3K5BA 3CC2P 1VDFA 1FOSF 1KYOE 4I2LC 2J5UA 3H25A 1AA0A 3L36A 1FDMA 3CL3D 1VF5B 1SQXK 1IO4A 2D2CB 1T3UA 3GF3A 5KLVE 3O6QA 3F89A 5KKZC 1LWUA 3FXEA 4I6MC 1ZOYC 3HD7B 2N9BA 3L70E 1SQVE 2Q6QA 4IL6E 5DJTB 3V4QA 1SFCA 1FZEA 2QM8A 2OYIB 2Y0DA 1X0TA 4Y99C 1FZCA 2NRGA 2K1AA 1PP9E 5KAIH 1NTZG 2MJZA 2N1TA 3AE2C 1PPJG 2HYNA 1NTMK 4OWFA 3L72E 1VQ4P 3EQ2A 1M56D 3H1IE 5KLVJ 2E43A 4H0LD 3VOPA 2OYHB 5AW1B 1IK9A 1P84D 1BCCJ 3MGNA 1OWAA 2IFMA 2OQQA 3E1RA 5AW3B 1AQ5A 5AW6B 3HUSC 2R44A 3L70J 3BASA 3HE5B 4L73A 2BASA 1DIPA 1AV1A 1JY2O 1BGYG 4WWIA 5H2FH 4I7ZB 2Q1KA 3CXHH 4JPZB 2I1KA 4OH8B 1JOCA 1NHLA 3CWBE 1PZQA 3HTKB 3MTUE 3NMDA 2RKLA 5AVWB 1PP9J 3FX0A 4Z1MH 1JY2N 1NKZB 2QM7A 2WZ7A 1R8EA 1KZUB 1NU1E 1OVVA 1NOHA 2YIUC 3FWLA 3L72J 3W68A 3MIWA 3H1IJ 2JR8A 5CJ4A 1RF0C 2ZYGA 3FGAD 1SQQG 2JEEA 2O01N 1HJ0A 1XTGB 1KB9H 4IL6X 2QG4A 1R5SA 3KXDA 1VQ6P 2KS1B 4ASWA 1G1JA 2L5GB 2WPRA 1SQXG 2E76D 3HD7A 2KIKA 3KHUA 2M3EA 4WY4D 3WU2E 1LT9C 2E5YA 1BSNA 2YO3A 3CWBJ 4H0LB 4C7RA 5KAIE 3ZDMA 2OYIA 4JQ0D 3II6A 3AE5C 1M90Q 3AE6C 3A0BH 2A06E 2AEMA 1NU1J 5APTA 1L4AB 1CZQA 2WSFH 1YI2P 3CCRP 4LGDE 3H1KG 2FKWB 1KFNA 1PGQA 4HH2A 1HJBA 1D7MA 3USSA 4DOJA 1NYHA 2OYHA 4HIZA 1NTMG 4R4MA 2KZJA 2I1JA 1G2CB 1YITP 2C0WA 3H1LE 4BWNA 2YMKA 4JYBA 1NTKJ 3BRVB 1NO4A 2JP3A 5AVYB 3HE5A 2H88C 3CMEP 2IBZE 2QJYB 4ZMDA 3C8VA 1OW6A 1IFNA 2W83C 1LJ2A 5CJ0A 3HTKA 1X9VA 5APQA 5GTIH 1NAFA 3CCLP 2E76B 2K9JB 3BCCD 3M9QA 1V0EA 2BCCJ 1FDOA 1ZW0A 1VQPP 3L71D 3P32A 5AVUB 5AVTB 2KI7B 3N7NA 2P10A 3AEAC 4BXLA 1GU4A 5APVA 1CI6B 1KILD 1PGOA 3U1AA 1LTJC 4MN4C 3H1HE 2KS1A 3H1JJ 3RBZA 2Y9YA 3AECC 3B5ND 3L37A 1K05A 1P84I 1L0LD 5AVRB 1EQ7A 1Q82Q 3GVKA 4H13B 4XFJA 1VQ9P 1VQNP 1FJKA 2I8DA 1T2KC 1HTLC 1J2JB 2FBWC 2OTJP 4W80A 1L4AA 2KLVA 3AE3C 1SP4A 3Q5PA 2JKVA 1LT1A 2WTYA 3CI9A 3RK2C 3JCUH 3AE9C 2QJPC 2FYUD 1JY3P 2XU6A 4I1LA 2HPCB 2QVAA 1JEKA 1BSHA 1N7LA 3BVHA 2QJKB 5EFWB 2V7QH 4LLHA 2GA1A 1G2CA 3SFDC 4K3AA 1AJYA 1L0NE 1K73Q 1SQQD 1KD1Q 3WMM0 1LTBC 2FY8A 3RL0D 1GU5A 1BDCA 1AVYA 3AEEC 1IFDA 1SLQA 1NVOA 2QE7H 2WSFJ 1KILB 3D70A 5CCHD 3GMAA 2WPQA 2KNCB 2A45I 2ZVOB 2ZXEB 5GTHH 2WT7B 3L35A 3B5NB 2K9JA 1U7MA 1YYCA 1VQ5P 3L74D 1EDLA 2YKOA 1LTGC 3A5TA 1SS1A 3TGUD 2ZT9B 1RF1B 2Q5UA 2Z5IA 1CI6A 4GOEA 3CX5I 1Q86Q 1ZRTD 5KJ7D 4PV1D 5L8RJ 1AVOA 4GKGA 3OA7A 1OZHA 1ZN5A 5BU8B 4U3FD 3P8CE 2WMMA 4RKUJ 4HKZH 3MUDC 1NWQA 4PD4D 4IFDK 4W7ZA 3BRTB 2KK7A 4UB8H 4AYCA 3VMAA 1VF5C 2N9YB 3WUTA 2P7JA 3V2NA 1NH4A 1NJIQ 1J1EC 3AE1C 3JCUE 2LXCB 2B87B 2JDIH 2O1KA 1LP1B 2HG5D 1FZCB 3I5CA 4U7JA 4AUWA 1RY3A 5CCGA 1QL2A 1KYOD 3IN6A 2W8ZA 2HPCA 1IFMA 2N1TB 1A02J 1URQC 3IF4A 2HLOA 1RE4A 2OYIC 1L0LK 3H1LG 3KYQA 2NPSB 2YNYA 5KLVD 2Q3EA 2AXCA 1J1DB 1YTZI 1OMIA 4TT3H 5GTHE 4L74A 3V6IA 1W2BO 4M3LA 3KPEA 1KILA 2E74C 2KNCA 3L70D 4PV1B 1SQVD 1JO5A 2WT7A 3AE8C 2PFXA 2P2UA 4D6TE 1KQFB 3B5NA 2POHA 4H44D 2Y9ZA 1K9MQ 1FZGA 1JCDA 2FYUK 4OVNF 1M1KQ 5AVQB 2V7QJ 3BATA 1PP9D 5TJHA 1VQLP 1RF1A 3LW5H 3M0DA 1BE3E 1M8OB 3M9HA 3GHGB 2Z5HA 1SQQK 4ZKPA 1OW8A 3H1HG 3L72D 2M0BA 5AW7B 3H1ID 1FZBA 1Y47A 5BU5A 1EZVE 5AW0B 3CCEP 1UIIA 3HRNA 2Q3IA 4UB8E 4EOTA 1AQTA 3JC22 3A0HH 1A02F 1BCCE 1SQPE 4JF7A 1YBKA 3I55P 2AXTH 4D6TJ 4JYCA 3BCCG 3CWBD 1OFCX 1LTSC 2B87A 1M57D 2Y0CA 4AQRD 4ZNCA 1LP1A 3CCUP 3L71G 1BE3J 1N73B 4RO0A 3VN0A 4OGQB 1PV3A 5CCHA 3TF5A 1NU1D 3QH9A 5AW5B 3S9OA 3PLNA 4UB6H 3G4SP 1KORA 3RK3B 1HUCA 1QX8A 4H44B 3L73E 1RQUA 1YTZT 2NPSA 3S4RA 1L4AC 4Y28J 1H8AA 1L0LG 2M5AB 1GL2C 5APYA 1SQPJ 2XNDH 2H8PD 1GK4A 3NFQA 2C9NY 3TSIA 1IFIA 3Q5SA 2XKMA 4YTPC 4PD4I 4GT1A 1HGVA 2O1JA 1QLED 3CCMP 3M0AA 2A06D 2M3BA 3Q1MA 1HF9A 1NAYA 2ZFCA 1LTTC 2QJYC 3JU4A 3GHGA 2FYUG 5B5EH 2KB7P 2Y0EA 1WMKA 5KLVK 1UIXA 3TK1A 3L73J 1WT6A 2K9YA 2A45H 3A0HE 3SFEC 3IR9A 1EXIA 2AXTE 1SQVK 2QRXA 1DH3A 1LGHB 3H1LD 1ZR4A 2IBZD 1NTKE 3VTPC 2R3SA 3LW5J 3CX5H 3AEFC 3L74G 1OIPA 1VQKP 2UWJE 1VPCA 3TGUG 4Y99B 4UB6E 4CPGA 3PP5A 1N73A 3IFMA 2E75C 1YQ3C 1RE3A 2PP6A 4H13C 3V5BA 1SQBE 1RH5B 4HJGH 4N78E 2BCCE 1PGPA 1Q81Q 1OW7A 4C7NB 4WVZA 5AW4B 1N2DC 2OTKE 3M91A 4U3FG 2M5AA 3V2PA 4YXWH 3H1HD 2FFDB 5AW8B 2HR3A 5H2FE 3CXHE 3H1JE 4DZOA 2OYOA 1Y8AA 2VRSA 3PRJA 1HBWA 1N7SC 1GMJA 1FJPA 3QWOC 1NU1K 3JSVC 5B5EE 4L75A 2R3CA 4WY4B 2H43A 1SQBJ 3AE4C 2YIUB 1X22A 3L75E 1QGKB 1KB9E 4R4LA 4ZKUA 2GM4A 2P1JA 1S4XA 1MUUA 5KLVG 1M1JC 1YJNP 3B8EB 3S1KA 2WSSH 1EXJA 1KQGB 2YO2A 3M9BA 2ZXXA 1BCCG 1W5CE 1L0ND 2KSEA 2ZT9C 3CX5E 2XZRA 1VQ7P 1EC5A 5CHXA 3M0DC 1R5LA 3GW6A 1GZLA 1M7LA 3L70G 1SQVG 4XA4A 1LT9B 4LC1A 3SWKA 3D6ZA 3A0BE 2RN0A 2WWWA 5K5GB 3VP8A 2IYOA 2JJLA 2MKVA 1OVRA 4ASVA 1PP9G 1HH0A 1JTHB 3U59A 1MZ9A 3P8MC 3L75J 1LWUC 4YXDC 1MFZA 5APUA 1GDTA 3L72G 2Q7CA 2W27A 4XE5B 2ZYDA 3H1IG 3GF7A 4C7NA 3AEGC 1SFCC 3E1IA 2FXMA 3LIEA 2IZ0A 4RESB 3M06A 2FFDA 3CC4P 3AEDC 3CCQP 1S9KE 1FZFA 1FZCC 1T2KD 2O3JA 2P58A 3P8CD 1OXZA 1VL2A 1X8YA 3R4YA 1NTZE 2N1TC 5GTIE 4N3YB 5AVSB 3CWBG 1BDDA 1PPJE 3RK2D 1QVFO 1KMIZ 2IBZI 3RBXA 1MKMA 2NPSC 4RJTA 2KXPB 3MD0A 1J1DC 4PJ0H 4K35A 2BEQD 1HGZA 3OW2O 4WY4A 1NU1G 4N6JA 3G6EP 3W67A 1USDA 4BRYB 1E5WA 1RF0A 1H0TB 2HFED 3B71A 1JB0J 4PD4H 1EDKA 2KP8A 2LKMA 2WQYC 3CCVP 4GODA 2FXPA 3P7KA 3NXSA 2Z4EA 5TISH 1NTKG 1NTZJ 1LT9A 3GG2A 1ZV8A 1JNMA 1FDIA 2K88A 3C9IA 3HE4B 2QIWA 2H7HA 4IFMA 2A06G 2D2CC 4D6TD 1JTHA 4WBAA 1JUNA 1FZAA 2LR2A 5AVZB 1DEBA 1GD2E 3HD7C 2BCCG 1ZMEC 3RL0B 2YMYA 1SQXE 2RMZA 1BGYJ 3MZWB 1BE3D 2YXQB 3RK2B 2LXBA 1L0NK 2R5BA 2G8YA 2QJPB 1H89A 1FE6A 1NKNA 4NPFX 1NGMB 1VF5D 3FXDA 1EZVD 2D2CD 2NZ2A 1RE3C 4OGQC 3CD6P 1KN7A 2IBZG 2KSJA 2FYNB 1JY2P 1BCCD 1SQPD 2YKPA 2AEFA 3RK3C 2WVRA 3H1KE 1SQQJ 1JY3O 1IC2A 2C9LY 2WITA 2OYHC 2YXRB 1L2PA 1URQD 1NTME 5KAFH 1SQXJ 2PAJA 2XDJA 1U7JA 1JY3N 4BRYA 1H0TA 1RQVA 1PIXA 1YQ4C 3GVLA 4I7ZC 5TISE 2E74D 4TLFA 2JO1A 4DCKA 3CCJP 2KZIA 3L73D 4W7YA 3SWFA 3KQGA 1DX7A 1T8ZA 1T3JA 2FXOA 1S5LH 1AFOA 1GW3A 1KFMA 1S3JA 1KQLA 1OVUA 3CLQA 3H1KJ 2B88A 3TNUB 3HE4A 2BEZF 2DW3A 2WPSA 4U3FJ 2OARA 1NTMJ 2K37A 1Q7YQ 1J1EB 2IX7C 3B4SA 3TYYA 2K3RA 5B66H 2IZ1A 1YJ9P 1E79H 1N86A 2J59M 1P84H 1K04A 3V4WA 2WPVB 4QMAA 2GUVA 2AEJA 4H0LC 3NTNA 3WU2H 3RK3E 1URQB 2ZYAA 4C46A 1IK7A 3VMZA 1L0NG 2CPBA 2RH0A 5KLIB 2L91A 1GW4A 3AE7C 1KQSO 1RHZB 3IAOA 4GDOA 2SPZA 5KAFE 3EFGA 2E74B 2QA4P 1NTKD 5KJ7A 1IFJA 1S2EA 1U57A 3F5HA 4WB4A 2FFDC 1IZNB 2JWDA 1SQVJ 1L4AD 4EDFA 1GL2D 1S1CX 1ZP0C 4NPDA 1SQBD 2KLUA 4N78D 2BCCD 1CSBA 1SVFA 3WUUA 1S5LE 1VQ8P 2IDBA 4HYTB 1KYOI 2HODB 1SQPK 1DD4A 2E76C 1PL5A 3A3YB 4WY4C 4YPCA 1EDJA 1KC8Q 1V0FA 1EZVI 3CXHD 5KKZB 3EWKA 3MUDA 3TNUA 3MP7B 3H1JD 3KZIH 3I56P 5AVXB 1USEA 5C39A 5B66E 2KYVA 3GLMA 2GUSA 1P84E 3G9RA 2B89A 2ZAEB 1Z56A 2C0XA 1Q2NA 4NPEA 1JMBA 3OJAB 3KDPB 3L75D 1KB9D 2WSEH 4IOIH 1URQA 3VYIA 1MFTA 2R5DA 1H88A 1S72P 3VP9A 2WSCH 1GL2B 4HB1A 2M8RA 3CX5D 3PH0A 3CPWO 2IFNA 1ZXGA 1WRGA 2E75D 3HUSB 4GOFA 5CCGC 2R32A 3G3ZA 4H13D 2IPPA 4D6TG 2QJKC 2FYZA 1RE4C 1PFIA 1DEEG 1S5LX 3FWNA 1JM0A 3LIDA 2YKQA 3UIAA 1CW5A 1FU1A 5APWA 1LTAC 3A2AA 1BE3G 3R2PA 2QEXP 4B86A 3A7OA 5CMZA 1KILC 1MV8A 3V2QA 5CCGD 1ZR2A 1K8AQ 2V4HA 1T6AA 1EZVG 1PGJA 1FAVA 2HODA 1N7SD 3Q3DA 3B5NC 3KZIE 5CBNA 1NTKK 3PTZA 1S9KD 2O01H 1SQPG 1KTMA 1QVGO 1RF1C 3ABVC 3O8ZA 1NTZD 1FC2C 1FBMA 1PPJD 3H1LJ 3E7KA 3G71P 1XTCC 1SQBK 1G1IA 1YJWP 2E75B 1OX3A 3CC7P 2ZT9D 3N4XA 2XV5A 3L73G 4EYYQ 1BGYD 2W6BA 3T97B 5E79H 4F0AB 2W6AA 1DD3A 3V2RA 2OGUA 2P67A 3BCCE 3SSUA 1GL2A 3RL0C 4DT0A 2ZVNB 3HUSA 3L71E 3C1LA 5CCHC 2J58A 3Q2YA 1X79B 4EI2A 3CXHI 3H1HJ 3CMAP 1KILE 1N7SB 1YIJP 2WSEJ 3ITKA 4KJMA 1VQOP 1SFCD 3L4FA 2FYNC 1QEXA 1L0LE 2WSCJ 2XNXA 1JMMA 1HVVA 1SQXD 4GIFA 3MHVA 5KJ7C 4PV1C 2E42A 3H32B 2KOGA 2N1TD 1KV4A 2H89C 1GK6A 1BGYE 3BCCJ 1KB9I 5AVVB 1M1JB 1FOSE 3U1CA 1LTJB 1QL1A 2NPSD 3L71J 1VQMP 2IYPA
chains in the Genus database with same CATH topology
4D6TD 3CX5D 3GVJA 2KNCB 3TDKA 4EDFA 3CWBD 2O3JA 2Y0CA 5KLVD 3H1LD 2Q3EA 2RMZA 3H1KD 1SQBD 2KS1A 1BE3D 3L74D 1BGYD 2BCCD 2YIUB 1P84D 3TF5A 1NU1D 2QJPB 3PHLA 3TGUD 2IBZD 3PLNA 1L0LD 1NTMD 3GVKA 3L70D 1SQVD 4RJTA 1EZVD 1V0FA 1ZRTD 3CXHD 5KKZB 1L0ND 3H1JD 2FYNB 4HIZA 1BCCD 1SQPD 3GW6A 4U3FD 1PP9D 5TJHA 3ITKA 2RN0A 4PD4D 3PTZA 2QJYB 3FWLA 5KLIB 2L91A 3L72D 3VMAA 2FYUD 2JWAA 2N9YB 3H1ID 1SQXD 3H1HD 2QJKB 2A06D 1NTZD 3L75D 1KB9D 3GG2A 2QG4A 3GVLA 1NTKD 1SQQD 3JU4A 1PPJD 2Y0DA 2K9JB 3BCCD 4A7PA 3PRJA 2Y0EA 1V0EA 3KHUA 3L73D 1KYOD 3L71D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6T D;  3CX5 D;  3GVJ A;  2KNC B;  3TDK A;  4EDF A;  3CWB D;  2O3J A;  2Y0C A;  5KLV D;  3H1L D;  2Q3E A;  2RMZ A;  3H1K D;  1SQB D;  2KS1 A;  1BE3 D;  3L74 D;  1BGY D;  2BCC D;  2YIU B;  1P84 D;  3TF5 A;  1NU1 D;  2QJP B;  3PHL A;  3TGU D;  2IBZ D;  3PLN A;  1L0L D;  1NTM D;  3GVK A;  3L70 D;  1SQV D;  4RJT A;  1EZV D;  1V0F A;  1ZRT D;  3CXH D;  5KKZ B;  1L0N D;  3H1J D;  2FYN B;  4HIZ A;  1BCC D;  1SQP D;  3GW6 A;  4U3F D;  1PP9 D;  5TJH A;  3ITK A;  2RN0 A;  4PD4 D;  3PTZ A;  2QJY B;  3FWL A;  5KLI B;  2L91 A;  3L72 D;  3VMA A;  2FYU D;  2JWA A;  2N9Y B;  3H1I D;  1SQX D;  3H1H D;  2QJK B;  2A06 D;  1NTZ D;  3L75 D;  1KB9 D;  3GG2 A;  2QG4 A;  3GVL A;  1NTK D;  1SQQ D;  3JU4 A;  1PPJ D;  2Y0D A;  2K9J B;  3BCC D;  4A7P A;  3PRJ A;  2Y0E A;  1V0E A;  3KHU A;  3L73 D;  1KYO D;  3L71 D; 
#chains in the Genus database with same CATH topology
 1LNQ A;  2B9B A;  3GHG C;  5BVZ A;  3AEB C;  5APX A;  1TU3 F;  2FYU E;  3Q5R A;  3H6P A;  1IFP A;  3OAK A;  1EDI A;  1L0N J;  3H1K D;  3EFF K;  1KYO H;  2ITA A;  2CPS A;  3PHL A;  1SQQ E;  1L0L J;  3O6Q B;  1NTM D;  2ZJS E;  3CCS P;  4KT0 J;  4O9B A;  1Y9B A;  5M1B A;  3SWY A;  1LWU B;  5E79 E;  1SQB G;  3D6Y A;  1N8R Q;  5DJU B;  4EIJ A;  2O01 J;  4L76 A;  3T97 A;  5AW2 B;  4KHX A;  3PJS K;  2PGD A;  1IJD B;  1SFC B;  4IFF A;  5CBO A;  1NTZ K;  4JBZ A;  3L74 E;  3WUV A;  3RL0 g;  2E5T A;  5KTB A;  1YHQ P;  1N73 C;  1HWT C;  3H1J G;  4IL6 H;  3TGU E;  2G3A A;  4DJG A;  2FYU J;  2KUB A;  2QSI A;  2W6J H;  2JWA A;  2OTL P;  3HD7 D;  5AW9 B;  4PJ0 E;  2W90 A;  1N7S A;  1ZRT E;  4H44 C;  1Q90 D;  2PRR A;  5KLI C;  1FS0 E;  4A7P A;  3VMX A;  2A45 G;  4U3F E;  3L75 G;  1ZLL A;  4OGQ D;  5APS A;  4PD4 E;  1LTI C;  3GVJ A;  3TDK A;  2CK3 H;  1GTW A;  3H32 A;  3RGU A;  3D71 A;  1W2E A;  1M1J A;  3RK3 D;  3L74 J;  1LTJ A;  3TGU J;  1JCC A;  3VMY A;  2Q9I A;  3K5B A;  3CC2 P;  1VDF A;  1FOS F;  1KYO E;  4I2L C;  2J5U A;  3H25 A;  1AA0 A;  3L36 A;  1FDM A;  3CL3 D;  1VF5 B;  1SQX K;  1IO4 A;  2D2C B;  1T3U A;  3GF3 A;  5KLV E;  3O6Q A;  3F89 A;  5KKZ C;  1LWU A;  3FXE A;  4I6M C;  1ZOY C;  3HD7 B;  2N9B A;  3L70 E;  1SQV E;  2Q6Q A;  4IL6 E;  5DJT B;  3V4Q A;  1SFC A;  1FZE A;  2QM8 A;  2OYI B;  2Y0D A;  1X0T A;  4Y99 C;  1FZC A;  2NRG A;  2K1A A;  1PP9 E;  5KAI H;  1NTZ G;  2MJZ A;  2N1T A;  3AE2 C;  1PPJ G;  2HYN A;  1NTM K;  4OWF A;  3L72 E;  1VQ4 P;  3EQ2 A;  1M56 D;  3H1I E;  5KLV J;  2E43 A;  4H0L D;  3VOP A;  2OYH B;  5AW1 B;  1IK9 A;  1P84 D;  1BCC J;  3MGN A;  1OWA A;  2IFM A;  2OQQ A;  3E1R A;  5AW3 B;  1AQ5 A;  5AW6 B;  3HUS C;  2R44 A;  3L70 J;  3BAS A;  3HE5 B;  4L73 A;  2BAS A;  1DIP A;  1AV1 A;  1JY2 O;  1BGY G;  4WWI A;  5H2F H;  4I7Z B;  2Q1K A;  3CXH H;  4JPZ B;  2I1K A;  4OH8 B;  1JOC A;  1NHL A;  3CWB E;  1PZQ A;  3HTK B;  3MTU E;  3NMD A;  2RKL A;  5AVW B;  1PP9 J;  3FX0 A;  4Z1M H;  1JY2 N;  1NKZ B;  2QM7 A;  2WZ7 A;  1R8E A;  1KZU B;  1NU1 E;  1OVV A;  1NOH A;  2YIU C;  3FWL A;  3L72 J;  3W68 A;  3MIW A;  3H1I J;  2JR8 A;  5CJ4 A;  1RF0 C;  2ZYG A;  3FGA D;  1SQQ G;  2JEE A;  2O01 N;  1HJ0 A;  1XTG B;  1KB9 H;  4IL6 X;  2QG4 A;  1R5S A;  3KXD A;  1VQ6 P;  2KS1 B;  4ASW A;  1G1J A;  2L5G B;  2WPR A;  1SQX G;  2E76 D;  3HD7 A;  2KIK A;  3KHU A;  2M3E A;  4WY4 D;  3WU2 E;  1LT9 C;  2E5Y A;  1BSN A;  2YO3 A;  3CWB J;  4H0L B;  4C7R A;  5KAI E;  3ZDM A;  2OYI A;  4JQ0 D;  3II6 A;  3AE5 C;  1M90 Q;  3AE6 C;  3A0B H;  2A06 E;  2AEM A;  1NU1 J;  5APT A;  1L4A B;  1CZQ A;  2WSF H;  1YI2 P;  3CCR P;  4LGD E;  3H1K G;  2FKW B;  1KFN A;  1PGQ A;  4HH2 A;  1HJB A;  1D7M A;  3USS A;  4DOJ A;  1NYH A;  2OYH A;  4HIZ A;  1NTM G;  4R4M A;  2KZJ A;  2I1J A;  1G2C B;  1YIT P;  2C0W A;  3H1L E;  4BWN A;  2YMK A;  4JYB A;  1NTK J;  3BRV B;  1NO4 A;  2JP3 A;  5AVY B;  3HE5 A;  2H88 C;  3CME P;  2IBZ E;  2QJY B;  4ZMD A;  3C8V A;  1OW6 A;  1IFN A;  2W83 C;  1LJ2 A;  5CJ0 A;  3HTK A;  1X9V A;  5APQ A;  5GTI H;  1NAF A;  3CCL P;  2E76 B;  2K9J B;  3BCC D;  3M9Q A;  1V0E A;  2BCC J;  1FDO A;  1ZW0 A;  1VQP P;  3L71 D;  3P32 A;  5AVU B;  5AVT B;  2KI7 B;  3N7N A;  2P10 A;  3AEA C;  4BXL A;  1GU4 A;  5APV A;  1CI6 B;  1KIL D;  1PGO A;  3U1A A;  1LTJ C;  4MN4 C;  3H1H E;  2KS1 A;  3H1J J;  3RBZ A;  2Y9Y A;  3AEC C;  3B5N D;  3L37 A;  1K05 A;  1P84 I;  1L0L D;  5AVR B;  1EQ7 A;  1Q82 Q;  3GVK A;  4H13 B;  4XFJ A;  1VQ9 P;  1VQN P;  1FJK A;  2I8D A;  1T2K C;  1HTL C;  1J2J B;  2FBW C;  2OTJ P;  4W80 A;  1L4A A;  2KLV A;  3AE3 C;  1SP4 A;  3Q5P A;  2JKV A;  1LT1 A;  2WTY A;  3CI9 A;  3RK2 C;  3JCU H;  3AE9 C;  2QJP C;  2FYU D;  1JY3 P;  2XU6 A;  4I1L A;  2HPC B;  2QVA A;  1JEK A;  1BSH A;  1N7L A;  3BVH A;  2QJK B;  5EFW B;  2V7Q H;  4LLH A;  2GA1 A;  1G2C A;  3SFD C;  4K3A A;  1AJY A;  1L0N E;  1K73 Q;  1SQQ D;  1KD1 Q;  3WMM 0;  1LTB C;  2FY8 A;  3RL0 D;  1GU5 A;  1BDC A;  1AVY A;  3AEE C;  1IFD A;  1SLQ A;  1NVO A;  2QE7 H;  2WSF J;  1KIL B;  3D70 A;  5CCH D;  3GMA A;  2WPQ A;  2KNC B;  2A45 I;  2ZVO B;  2ZXE B;  5GTH H;  2WT7 B;  3L35 A;  3B5N B;  2K9J A;  1U7M A;  1YYC A;  1VQ5 P;  3L74 D;  1EDL A;  2YKO A;  1LTG C;  3A5T A;  1SS1 A;  3TGU D;  2ZT9 B;  1RF1 B;  2Q5U A;  2Z5I A;  1CI6 A;  4GOE A;  3CX5 I;  1Q86 Q;  1ZRT D;  5KJ7 D;  4PV1 D;  5L8R J;  1AVO A;  4GKG A;  3OA7 A;  1OZH A;  1ZN5 A;  5BU8 B;  4U3F D;  3P8C E;  2WMM A;  4RKU J;  4HKZ H;  3MUD C;  1NWQ A;  4PD4 D;  4IFD K;  4W7Z A;  3BRT B;  2KK7 A;  4UB8 H;  4AYC A;  3VMA A;  1VF5 C;  2N9Y B;  3WUT A;  2P7J A;  3V2N A;  1NH4 A;  1NJI Q;  1J1E C;  3AE1 C;  3JCU E;  2LXC B;  2B87 B;  2JDI H;  2O1K A;  1LP1 B;  2HG5 D;  1FZC B;  3I5C A;  4U7J A;  4AUW A;  1RY3 A;  5CCG A;  1QL2 A;  1KYO D;  3IN6 A;  2W8Z A;  2HPC A;  1IFM A;  2N1T B;  1A02 J;  1URQ C;  3IF4 A;  2HLO A;  1RE4 A;  2OYI C;  1L0L K;  3H1L G;  3KYQ A;  2NPS B;  2YNY A;  5KLV D;  2Q3E A;  2AXC A;  1J1D B;  1YTZ I;  1OMI A;  4TT3 H;  5GTH E;  4L74 A;  3V6I A;  1W2B O;  4M3L A;  3KPE A;  1KIL A;  2E74 C;  2KNC A;  3L70 D;  4PV1 B;  1SQV D;  1JO5 A;  2WT7 A;  3AE8 C;  2PFX A;  2P2U A;  4D6T E;  1KQF B;  3B5N A;  2POH A;  4H44 D;  2Y9Z A;  1K9M Q;  1FZG A;  1JCD A;  2FYU K;  4OVN F;  1M1K Q;  5AVQ B;  2V7Q J;  3BAT A;  1PP9 D;  5TJH A;  1VQL P;  1RF1 A;  3LW5 H;  3M0D A;  1BE3 E;  1M8O B;  3M9H A;  3GHG B;  2Z5H A;  1SQQ K;  4ZKP A;  1OW8 A;  3H1H G;  3L72 D;  2M0B A;  5AW7 B;  3H1I D;  1FZB A;  1Y47 A;  5BU5 A;  1EZV E;  5AW0 B;  3CCE P;  1UII A;  3HRN A;  2Q3I A;  4UB8 E;  4EOT A;  1AQT A;  3JC2 2;  3A0H H;  1A02 F;  1BCC E;  1SQP E;  4JF7 A;  1YBK A;  3I55 P;  2AXT H;  4D6T J;  4JYC A;  3BCC G;  3CWB D;  1OFC X;  1LTS C;  2B87 A;  1M57 D;  2Y0C A;  4AQR D;  4ZNC A;  1LP1 A;  3CCU P;  3L71 G;  1BE3 J;  1N73 B;  4RO0 A;  3VN0 A;  4OGQ B;  1PV3 A;  5CCH A;  3TF5 A;  1NU1 D;  3QH9 A;  5AW5 B;  3S9O A;  3PLN A;  4UB6 H;  3G4S P;  1KOR A;  3RK3 B;  1HUC A;  1QX8 A;  4H44 B;  3L73 E;  1RQU A;  1YTZ T;  2NPS A;  3S4R A;  1L4A C;  4Y28 J;  1H8A A;  1L0L G;  2M5A B;  1GL2 C;  5APY A;  1SQP J;  2XND H;  2H8P D;  1GK4 A;  3NFQ A;  2C9N Y;  3TSI A;  1IFI A;  3Q5S A;  2XKM A;  4YTP C;  4PD4 I;  4GT1 A;  1HGV A;  2O1J A;  1QLE D;  3CCM P;  3M0A A;  2A06 D;  2M3B A;  3Q1M A;  1HF9 A;  1NAY A;  2ZFC A;  1LTT C;  2QJY C;  3JU4 A;  3GHG A;  2FYU G;  5B5E H;  2KB7 P;  2Y0E A;  1WMK A;  5KLV K;  1UIX A;  3TK1 A;  3L73 J;  1WT6 A;  2K9Y A;  2A45 H;  3A0H E;  3SFE C;  3IR9 A;  1EXI A;  2AXT E;  1SQV K;  2QRX A;  1DH3 A;  1LGH B;  3H1L D;  1ZR4 A;  2IBZ D;  1NTK E;  3VTP C;  2R3S A;  3LW5 J;  3CX5 H;  3AEF C;  3L74 G;  1OIP A;  1VQK P;  2UWJ E;  1VPC A;  3TGU G;  4Y99 B;  4UB6 E;  4CPG A;  3PP5 A;  1N73 A;  3IFM A;  2E75 C;  1YQ3 C;  1RE3 A;  2PP6 A;  4H13 C;  3V5B A;  1SQB E;  1RH5 B;  4HJG H;  4N78 E;  2BCC E;  1PGP A;  1Q81 Q;  1OW7 A;  4C7N B;  4WVZ A;  5AW4 B;  1N2D C;  2OTK E;  3M91 A;  4U3F G;  2M5A A;  3V2P A;  4YXW H;  3H1H D;  2FFD B;  5AW8 B;  2HR3 A;  5H2F E;  3CXH E;  3H1J E;  4DZO A;  2OYO A;  1Y8A A;  2VRS A;  3PRJ A;  1HBW A;  1N7S C;  1GMJ A;  1FJP A;  3QWO C;  1NU1 K;  3JSV C;  5B5E E;  4L75 A;  2R3C A;  4WY4 B;  2H43 A;  1SQB J;  3AE4 C;  2YIU B;  1X22 A;  3L75 E;  1QGK B;  1KB9 E;  4R4L A;  4ZKU A;  2GM4 A;  2P1J A;  1S4X A;  1MUU A;  5KLV G;  1M1J C;  1YJN P;  3B8E B;  3S1K A;  2WSS H;  1EXJ A;  1KQG B;  2YO2 A;  3M9B A;  2ZXX A;  1BCC G;  1W5C E;  1L0N D;  2KSE A;  2ZT9 C;  3CX5 E;  2XZR A;  1VQ7 P;  1EC5 A;  5CHX A;  3M0D C;  1R5L A;  3GW6 A;  1GZL A;  1M7L A;  3L70 G;  1SQV G;  4XA4 A;  1LT9 B;  4LC1 A;  3SWK A;  3D6Z A;  3A0B E;  2RN0 A;  2WWW A;  5K5G B;  3VP8 A;  2IYO A;  2JJL A;  2MKV A;  1OVR A;  4ASV A;  1PP9 G;  1HH0 A;  1JTH B;  3U59 A;  1MZ9 A;  3P8M C;  3L75 J;  1LWU C;  4YXD C;  1MFZ A;  5APU A;  1GDT A;  3L72 G;  2Q7C A;  2W27 A;  4XE5 B;  2ZYD A;  3H1I G;  3GF7 A;  4C7N A;  3AEG C;  1SFC C;  3E1I A;  2FXM A;  3LIE A;  2IZ0 A;  4RES B;  3M06 A;  2FFD A;  3CC4 P;  3AED C;  3CCQ P;  1S9K E;  1FZF A;  1FZC C;  1T2K D;  2O3J A;  2P58 A;  3P8C D;  1OXZ A;  1VL2 A;  1X8Y A;  3R4Y A;  1NTZ E;  2N1T C;  5GTI E;  4N3Y B;  5AVS B;  3CWB G;  1BDD A;  1PPJ E;  3RK2 D;  1QVF O;  1KMI Z;  2IBZ I;  3RBX A;  1MKM A;  2NPS C;  4RJT A;  2KXP B;  3MD0 A;  1J1D C;  4PJ0 H;  4K35 A;  2BEQ D;  1HGZ A;  3OW2 O;  4WY4 A;  1NU1 G;  4N6J A;  3G6E P;  3W67 A;  1USD A;  4BRY B;  1E5W A;  1RF0 A;  1H0T B;  2HFE D;  3B71 A;  1JB0 J;  4PD4 H;  1EDK A;  2KP8 A;  2LKM A;  2WQY C;  3CCV P;  4GOD A;  2FXP A;  3P7K A;  3NXS A;  2Z4E A;  5TIS H;  1NTK G;  1NTZ J;  1LT9 A;  3GG2 A;  1ZV8 A;  1JNM A;  1FDI A;  2K88 A;  3C9I A;  3HE4 B;  2QIW A;  2H7H A;  4IFM A;  2A06 G;  2D2C C;  4D6T D;  1JTH A;  4WBA A;  1JUN A;  1FZA A;  2LR2 A;  5AVZ B;  1DEB A;  1GD2 E;  3HD7 C;  2BCC G;  1ZME C;  3RL0 B;  2YMY A;  1SQX E;  2RMZ A;  1BGY J;  3MZW B;  1BE3 D;  2YXQ B;  3RK2 B;  2LXB A;  1L0N K;  2R5B A;  2G8Y A;  2QJP B;  1H89 A;  1FE6 A;  1NKN A;  4NPF X;  1NGM B;  1VF5 D;  3FXD A;  1EZV D;  2D2C D;  2NZ2 A;  1RE3 C;  4OGQ C;  3CD6 P;  1KN7 A;  2IBZ G;  2KSJ A;  2FYN B;  1JY2 P;  1BCC D;  1SQP D;  2YKP A;  2AEF A;  3RK3 C;  2WVR A;  3H1K E;  1SQQ J;  1JY3 O;  1IC2 A;  2C9L Y;  2WIT A;  2OYH C;  2YXR B;  1L2P A;  1URQ D;  1NTM E;  5KAF H;  1SQX J;  2PAJ A;  2XDJ A;  1U7J A;  1JY3 N;  4BRY A;  1H0T A;  1RQV A;  1PIX A;  1YQ4 C;  3GVL A;  4I7Z C;  5TIS E;  2E74 D;  4TLF A;  2JO1 A;  4DCK A;  3CCJ P;  2KZI A;  3L73 D;  4W7Y A;  3SWF A;  3KQG A;  1DX7 A;  1T8Z A;  1T3J A;  2FXO A;  1S5L H;  1AFO A;  1GW3 A;  1KFM A;  1S3J A;  1KQL A;  1OVU A;  3CLQ A;  3H1K J;  2B88 A;  3TNU B;  3HE4 A;  2BEZ F;  2DW3 A;  2WPS A;  4U3F J;  2OAR A;  1NTM J;  2K37 A;  1Q7Y Q;  1J1E B;  2IX7 C;  3B4S A;  3TYY A;  2K3R A;  5B66 H;  2IZ1 A;  1YJ9 P;  1E79 H;  1N86 A;  2J59 M;  1P84 H;  1K04 A;  3V4W A;  2WPV B;  4QMA A;  2GUV A;  2AEJ A;  4H0L C;  3NTN A;  3WU2 H;  3RK3 E;  1URQ B;  2ZYA A;  4C46 A;  1IK7 A;  3VMZ A;  1L0N G;  2CPB A;  2RH0 A;  5KLI B;  2L91 A;  1GW4 A;  3AE7 C;  1KQS O;  1RHZ B;  3IAO A;  4GDO A;  2SPZ A;  5KAF E;  3EFG A;  2E74 B;  2QA4 P;  1NTK D;  5KJ7 A;  1IFJ A;  1S2E A;  1U57 A;  3F5H A;  4WB4 A;  2FFD C;  1IZN B;  2JWD A;  1SQV J;  1L4A D;  4EDF A;  1GL2 D;  1S1C X;  1ZP0 C;  4NPD A;  1SQB D;  2KLU A;  4N78 D;  2BCC D;  1CSB A;  1SVF A;  3WUU A;  1S5L E;  1VQ8 P;  2IDB A;  4HYT B;  1KYO I;  2HOD B;  1SQP K;  1DD4 A;  2E76 C;  1PL5 A;  3A3Y B;  4WY4 C;  4YPC A;  1EDJ A;  1KC8 Q;  1V0F A;  1EZV I;  3CXH D;  5KKZ B;  3EWK A;  3MUD A;  3TNU A;  3MP7 B;  3H1J D;  3KZI H;  3I56 P;  5AVX B;  1USE A;  5C39 A;  5B66 E;  2KYV A;  3GLM A;  2GUS A;  1P84 E;  3G9R A;  2B89 A;  2ZAE B;  1Z56 A;  2C0X A;  1Q2N A;  4NPE A;  1JMB A;  3OJA B;  3KDP B;  3L75 D;  1KB9 D;  2WSE H;  4IOI H;  1URQ A;  3VYI A;  1MFT A;  2R5D A;  1H88 A;  1S72 P;  3VP9 A;  2WSC H;  1GL2 B;  4HB1 A;  2M8R A;  3CX5 D;  3PH0 A;  3CPW O;  2IFN A;  1ZXG A;  1WRG A;  2E75 D;  3HUS B;  4GOF A;  5CCG C;  2R32 A;  3G3Z A;  4H13 D;  2IPP A;  4D6T G;  2QJK C;  2FYZ A;  1RE4 C;  1PFI A;  1DEE G;  1S5L X;  3FWN A;  1JM0 A;  3LID A;  2YKQ A;  3UIA A;  1CW5 A;  1FU1 A;  5APW A;  1LTA C;  3A2A A;  1BE3 G;  3R2P A;  2QEX P;  4B86 A;  3A7O A;  5CMZ A;  1KIL C;  1MV8 A;  3V2Q A;  5CCG D;  1ZR2 A;  1K8A Q;  2V4H A;  1T6A A;  1EZV G;  1PGJ A;  1FAV A;  2HOD A;  1N7S D;  3Q3D A;  3B5N C;  3KZI E;  5CBN A;  1NTK K;  3PTZ A;  1S9K D;  2O01 H;  1SQP G;  1KTM A;  1QVG O;  1RF1 C;  3ABV C;  3O8Z A;  1NTZ D;  1FC2 C;  1FBM A;  1PPJ D;  3H1L J;  3E7K A;  3G71 P;  1XTC C;  1SQB K;  1G1I A;  1YJW P;  2E75 B;  1OX3 A;  3CC7 P;  2ZT9 D;  3N4X A;  2XV5 A;  3L73 G;  4EYY Q;  1BGY D;  2W6B A;  3T97 B;  5E79 H;  4F0A B;  2W6A A;  1DD3 A;  3V2R A;  2OGU A;  2P67 A;  3BCC E;  3SSU A;  1GL2 A;  3RL0 C;  4DT0 A;  2ZVN B;  3HUS A;  3L71 E;  3C1L A;  5CCH C;  2J58 A;  3Q2Y A;  1X79 B;  4EI2 A;  3CXH I;  3H1H J;  3CMA P;  1KIL E;  1N7S B;  1YIJ P;  2WSE J;  3ITK A;  4KJM A;  1VQO P;  1SFC D;  3L4F A;  2FYN C;  1QEX A;  1L0L E;  2WSC J;  2XNX A;  1JMM A;  1HVV A;  1SQX D;  4GIF A;  3MHV A;  5KJ7 C;  4PV1 C;  2E42 A;  3H32 B;  2KOG A;  2N1T D;  1KV4 A;  2H89 C;  1GK6 A;  1BGY E;  3BCC J;  1KB9 I;  5AVV B;  1M1J B;  1FOS E;  3U1C A;  1LTJ B;  1QL1 A;  2NPS D;  3L71 J;  1VQM P;  2IYP A; 
#chains in the Genus database with same CATH homology
 4D6T D;  3CX5 D;  3GVJ A;  2KNC B;  3TDK A;  4EDF A;  3CWB D;  2O3J A;  2Y0C A;  5KLV D;  3H1L D;  2Q3E A;  2RMZ A;  3H1K D;  1SQB D;  2KS1 A;  1BE3 D;  3L74 D;  1BGY D;  2BCC D;  2YIU B;  1P84 D;  3TF5 A;  1NU1 D;  2QJP B;  3PHL A;  3TGU D;  2IBZ D;  3PLN A;  1L0L D;  1NTM D;  3GVK A;  3L70 D;  1SQV D;  4RJT A;  1EZV D;  1V0F A;  1ZRT D;  3CXH D;  5KKZ B;  1L0N D;  3H1J D;  2FYN B;  4HIZ A;  1BCC D;  1SQP D;  3GW6 A;  4U3F D;  1PP9 D;  5TJH A;  3ITK A;  2RN0 A;  4PD4 D;  3PTZ A;  2QJY B;  3FWL A;  5KLI B;  2L91 A;  3L72 D;  3VMA A;  2FYU D;  2JWA A;  2N9Y B;  3H1I D;  1SQX D;  3H1H D;  2QJK B;  2A06 D;  1NTZ D;  3L75 D;  1KB9 D;  3GG2 A;  2QG4 A;  3GVL A;  1NTK D;  1SQQ D;  3JU4 A;  1PPJ D;  2Y0D A;  2K9J B;  3BCC D;  4A7P A;  3PRJ A;  2Y0E A;  1V0E A;  3KHU A;  3L73 D;  1KYO D;  3L71 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...