3GW6A

Intramolecular chaperone
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
264
structure length
256
Chain Sequence
HVTIRIRSEVLMEGEYGFIGKSIPTDNPAGQRIIFCGGEGTSSTTGAQITLYGANNTDSRRIVYNGDEHLFQSADVKPYNDNVTALGGPSNRFTTAYLGSNPIVTANGERKTEPVVFDDAFLDAWGDVHYIMYQWLDAVQLKGNDARIHFGVIAQQIRDVFIAHGLMDENSCRYAVLCYDKYPRMTDTVFSHNEIVEHTDEEGNVTTTEEPVYTEVVIHEEGEEWGVRPDGIFFAEAAYQRRKLERIEARLSALEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of an intramolecular chaperone mediating triple-beta-helix folding.
pubmed doi rcsb
source organism Enterobacteria phage k1f
molecule tags Chaperone
molecule keywords Endo-N-acetylneuraminidase
total genus 41
structure length 256
sequence length 264
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.129: Endo-alpha-sialidase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13884 Peptidase_S74 Chaperone of endosialidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3gw6A04
1.20.5.1240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Endo-n-acetylneuraminidase 3gw6A02
3.30.2460.10 Alpha Beta 2-Layer Sandwich Endo-n-acetylneuraminidase fold Endo-n-acetylneuraminidase domain 3gw6A03
4.10.1090.10 Few Secondary Structures Irregular Endosialidase, domain 4 Endosialidase, domain 4 3gw6A01
1EZVD 4PD4D 2L91A 3CXHD 3L75D 3TGUD 2QJPB 3H1LD 1PP9D 3PHLA 2QJKB 2K9JB 3GVKA 3KHUA 2QG4A 1BGYD 2A06D 2Y0DA 4U3FD 2FYUD 1SQPD 3L71D 1SQXD 4A7PA 2JWAA 1BE3D 1V0EA 3GG2A 5KKZB 4EDFA 5KLVD 4RJTA 1ZRTD 2RN0A 1SQVD 3L72D 1KYOD 3VMAA 3CX5D 1KB9D 4HIZA 3H1ID 2BCCD 1SQQD 3TF5A 3L74D 4D6TD 3PTZA 1L0LD 3ITKA 3GVJA 1PPJD 3TDKA 3GW6A 1NU1D 1NTMD 3GVLA 3BCCD 3H1KD 2N9YB 2FYNB 1L0ND 2O3JA 2KS1A 3L73D 1NTKD 1P84D 3CWBD 2RMZA 5TJHA 3L70D 3FWLA 5KLIB 2YIUB 2Y0CA 2Q3EA 1SQBD 3PRJA 1BCCD 1NTZD 1V0FA 3PLNA 2IBZD 2QJYB 2Y0EA 3H1JD 3JU4A 2KNCB 3H1HD
chains in the Genus database with same CATH superfamily
1OIPA 2M5AA 2KSJA 1EZVD 1VF5C 1NO4A 1SQXE 1L4AD 3U1CA 1DD4A 3RL0C 3TGUE 1SQXG 1L0NE 2FXMA 2FBWC 3B4SA 3BATA 1FZGA 4N6JA 3CC4P 3CXHD 3BVHA 1P84E 3SWKA 2I1JA 2C0WA 3E7KA 4N78E 1ZXGA 1KQLA 3CWBE 5APUA 5KLVE 3TGUD 2HODA 3C8VA 2Q6QA 2BASA 1KB9I 3RK2C 2WT7A 4GDOA 2H88C 2OGUA 4DZOA 1VQMP 2AEFA 2KXPB 1YITP 2KYVA 2ZYGA 1NTKJ 3CXHI 3U1AA 1QX8A 2WT7B 2IFMA 1KYOH 1PP9E 1PGJA 1GW3A 1LTIC 2YKOA 3JSVC 4WY4B 2QRXA 2QG4A 2YXRB 3KHUA 2P1JA 1YTZI 2YXQB 3CI9A 5CMZA 3B71A 3M0AA 2WVRA 1KILD 4D6TE 1GTWA 3P32A 1JY2O 2KSEA 1RE3C 1RY3A 1CI6A 4EIJA 1NU1E 1L0NK 3FWNA 2FYUD 2Q9IA 1YQ4C 4KT0J 5KKZC 3ABVC 1KQGB 3L71D 3S9OA 5CCHC 2NPSA 2OYHB 1NTZJ 1BSHA 3QWOC 4JYBA 1S2EA 5AVSB 2FXOA 4A7PA 3H1LG 2JWAA 3D6YA 3H1JJ 3R4YA 3PP5A 1HTLC 3EFGA 3CCEP 3F5HA 1Y9BA 1P84H 1RF1B 3GG2A 1MKMA 1WRGA 1BSNA 2WSSH 1LNQA 4UB6H 3FXEA 5KLVD 1J1DC 3AE6C 4XA4A 3V2NA 3PTZA 2WSEH 4GODA 1SFCA 3L73E 4I2LC 2R44A 3VMAA 1AA0A 3CX5D 3WMM0 1A02J 2E74D 1S72P 2V7QH 1WMKA 4HIZA 1X9VA 4WVZA 1SQPK 3AEFC 1FZBA 2ZT9B 5CBOA 4HH2A 4OGQB 3TF5A 1TU3F 4D6TD 4H13D 1N8RQ 1AQTA 5M1BA 3AE5C 1MFTA 1NTMK 2WPQA 3H1HJ 3HUSB 1DH3A 2K1AA 2FYNC 2KZJA 1NH4A 3TDKA 1JY3P 3L35A 1ZW0A 1BGYE 2XU6A 3A0HE 1NTMD 1SQPE 2P58A 2QE7H 1URQD 3HE4B 1Q86Q 2N1TB 1BGYG 2ITAA 4WB4A 3CCMP 3GHGA 2NPSB 1GU4A 2QA4P 3AE3C 4YXWH 1NVOA 2Z5IA 2B9BA 2HFED 3M91A 1J2JB 5AW2B 3KYQA 2M3BA 1HUCA 4JQ0D 1EXJA 2E43A 2ZYAA 2DW3A 1K05A 1PP9J 1Y8AA 1FZEA 2CK3H 2W90A 5CJ4A 1CZQA 1SQQK 5KJ7A 1L0ND 2ZXXA 3RK2D 1M90Q 2PP6A 1VQ8P 1NTMG 2E74C 3CXHE 3FX0A 1S5LH 5B5EH 1YJNP 3GF3A 1R5SA 2YKQA 1OX3A 2FFDA 1AQ5A 3H1KG 5AVZB 3L75E 2HPCA 1EZVI 2FXPA 5KJ7D 3TGUG 5KTBA 2WPRA 3SWYA 1NHLA 1RF1A 3JU4A 1PGOA 2AEMA 1HGZA 3Q1MA 4TLFA 1JM0A 2E42A 1FZCA 5AW6B 3V2RA 1OW6A 2WSCH 1OW7A 4WBAA 3CPWO 3BRVB 1G2CA 1SQBD 2K88A 2KP8A 2N9BA 1T2KD 1R8EA 3CMEP 4IL6H 1SQXJ 1W2BO 1L0LK 2R5BA 1JNMA 1VF5D 5KAIE 3Q5SA 4AQRD 1CI6B 3A7OA 5B5EE 1VDFA 2E76D 3AEDC 1ZOYC 1RQUA 3RL0D 3VMZA 3K5BA 4LGDE 3H1HD 1AVOA 2SPZA 3H1IG 5KLVK 1L2PA 1R5LA 2Y9ZA 2ZFCA 2YIUC 1LWUC 2Q5UA 3L72G 5TISE 3HE5B 3LW5J 4N78D 4WY4A 3CC7P 2J59M 3MHVA 1K04A 2VRSA 2WSCJ 3S1KA 1GMJA 2BEZF 2IX7C 1SFCD 3CX5H 4BRYB 1M1JB 1N2DC 4H13B 1LJ2A 3H1LD 3EFFK 4K3AA 2E75B 2E5TA 3SFDC 4D6TJ 2QJKB 2D2CB 2FY8A 2K9JB 1IZNB 2OYHC 3GVKA 2A06G 3HD7B 1N7SD 1NU1J 1NYHA 3AEBC 4GOEA 1FE6A 3P8CE 2HPCB 3EQ2A 1PV3A 3KQGA 4DCKA 5AW5B 2HR3A 5APWA 3G71P 1URQC 1U7JA 1IC2A 1H8AA 3AEAC 1N73A 1FC2C 3TYYA 3KZIH 1S4XA 2WSEJ 3H1JE 1PL5A 1EDKA 3N7NA 1LTBC 2IBZI 4U3FD 2O01J 1HH0A 1KILA 2ZJSE 4L76A 1VL2A 1SQBJ 4NPDA 1IFDA 4UB6E 5AVQB 1GW4A 1KTMA 3UIAA 1NU1G 1S5LX 2A45H 4HB1A 1L0NJ 3GHGB 3TSIA 3W68A 4GOFA 1N7SA 1LT9A 1RF0C 2A45I 2B87A 1YTZT 2KNCA 3L73J 1X79B 3P8MC 4ASWA 3NFQA 5B66E 3AECC 5E79E 1PFIA 4D6TG 1GDTA 3L71E 1EDJA 3CWBJ 5BU8B 1V0EA 1LGHB 3L70J 4EDFA 1MFZA 1ZRTD 2RN0A 4CPGA 3SSUA 1BE3E 5AW3B 1LT1A 1VQ4P 1SQVD 2QM7A 4H44D 4N3YB 1KYOD 3TK1A 1NTKE 4PD4H 2I8DA 2WZ7A 3V2PA 1QVGO 1USDA 2O1KA 3WUUA 4C46A 1N7SC 1MZ9A 1RF0A 2N1TC 3IR9A 1H88A 2NPSC 2KOGA 3KXDA 1SQVE 3H1JG 4I6MC 2BCCD 1L4AA 1NWQA 2YKPA 2LR2A 2MJZA 4B86A 1EQ7A 1GL2C 2QVAA 1NOHA 1VQNP 3G6EP 2H43A 1Q81Q 2OTJP 3VOPA 3B5NB 2YMYA 2OQQA 4K35A 3RK3E 4HKZH 4IOIH 2A06E 1VQ6P 2OTKE 4OH8B 1WT6A 4F0AB 3GVLA 2O1JA 3AEEC 2BEQD 1S3JA 1VQPP 2IYOA 2ZVNB 2OYHA 2V4HA 2AEJA 1NJIQ 3MGNA 1VPCA 1VQOP 2FFDC 1NTKG 3L75J 3OJAB 2W6AA 4Y99C 5AVUB 3TGUJ 3L75G 2W83C 4JYCA 4LLHA 2FYUK 3SFEC 1QVFO 1E79H 1EDIA 2KS1A 2O3JA 1RHZB 5KJ7C 2Q1KA 4H0LD 3T97A 2WPSA 3L72E 2I1KA 4IFDK 2IZ1A 2FKWB 5APXA 3RL0g 1RE4A 3IFMA 1QL2A 2H89C 3WU2H 3WU2E 2PAJA 2RMZA 2C9NY 3OW2O 1M56D 4UB8E 4YTPC 3Q3DA 1FU1A 3FWLA 1YJWP 2OARA 3VN0A 4Y28J 1LTAC 1GL2A 2QIWA 2WSFJ 3LIDA 4YXDC 2WPVB 2YIUB 1LWUB 4W80A 1JB0J 1BDCA 2WITA 1ZR2A 1FAVA 1NTZK 1BGYJ 2W8ZA 3CCVP 2Y0CA 1LTTC 1NU1K 2Q3EA 3NMDA 4U7JA 1H0TB 1FZAA 2KUBA 3CX5I 3G3ZA 3L71J 1YJ9P 2BCCJ 1BCCD 1NTZD 3PLNA 1FOSE 2IBZD 4NPFX 3CL3D 3H1HG 5BVZA 1M1JC 5EFWB 4AYCA 1RQVA 2KNCB 4KJMA 4W7YA 3W67A 1LP1A 1L0LJ 4EI2A 4U3FE 4JBZA 4XE5B 1A02F 1NTZE 2M5AB 1KN7A 2QJKC 2D2CC 2ZYDA 1YQ3C 5CCGC 3L36A 2R3CA 4H44B 1AJYA 3L70G 1OVUA 1NTMJ 1SFCC 2OYIB 3CWBG 4JF7A 4PD4D 1SQVJ 1J1EC 2W6JH 3FXDA 4EYYQ 2ZVOB 2JKVA 3BCCJ 5K5GB 3JCUH 2KI7B 1S1CX 2LXCB 3U59A 1KILC 2W6BA 2IPPA 2QJYC 1L0NG 1URQB 1KD1Q 1DEBA 1FDMA 1JY2P 1BDDA 3L75D 4W7ZA 3CCQP 2P10A 2M8RA 2QJPB 1LT9C 3OAKA 1PP9D 3A3YB 3HTKA 2JDIH 3MZWB 1URQA 2J5UA 3B5ND 3PHLA 2V7QJ 3L71G 5AVXB 1VQKP 4L73A 5KAFE 1KB9H 3C9IA 3M9QA 4IFMA 1IJDB 1P84I 2KIKA 4R4MA 1N73C 3L74E 4C7RA 1ZR4A 1BCCE 1IFJA 5KLIC 2K9YA 3CC2P 2IBZE 2YNYA 4I7ZC 1YI2P 1W2EA 3M9HA 3TNUA 1JY2N 1KORA 1HJ0A 3BCCG 5APQA 1W5CE 1JOCA 2A06D 2RKLA 2Y0DA 2JEEA 3WUVA 1FS0E 2IZ0A 3KDPB 1HVVA 1JY3N 4ZMDA 4PV1C 3T97B 3P7KA 1SQXD 3PH0A 3M0DC 1AV1A 5APTA 3AE2C 3RK3B 1L0LG 5H2FH 5AW0B 1DX7A 2XDJA 3H1KE 1LWUA 4H0LC 1IFMA 5CHXA 3S4RA 5AVWB 1AFOA 4PD4I 1NAFA 3SWFA 2PRRA 4RKUJ 1FDOA 2E5YA 1H0TA 3VP9A 4RJTA 2JR8A 3H1LE 5L8RJ 3JCUE 2NPSD 1JMBA 3RBXA 4C7NA 4WWIA 5GTIE 3L72D 5APYA 1NTZG 1GZLA 2Z4EA 2OYOA 2WQYC 3MIWA 3USSA 3WUTA 4EOTA 2NRGA 1KB9D 5CCHD 1D7MA 4OWFA 5CJ0A 1L0LE 2HG5D 3A0BE 4O9BA 1FZCC 1CW5A 1M8OB 2P67A 5GTHE 1PPJE 3RK2B 1VQ7P 5AW7B 4R4LA 3L74D 1HJBA 2FFDB 1GK6A 3H32A 3JC22 1L4AB 3H1IE 1RE3A 1FBMA 1OVRA 2JJLA 1XTGB 1OMIA 3GLMA 3HRNA 1QGKB 1KMIZ 1QL1A 1N86A 1ZP0C 3II6A 3ITKA 2E75D 1PPJD 4ZKPA 3GW6A 2YO3A 1DIPA 3GF7A 4ZKUA 2FYUE 4PV1D 2D2CD 5CCGD 1JCDA 1KV4A 3LIEA 3BCCD 1LTSC 3NXSA 2W27A 5KAFH 1IK9A 2AXTH 4IL6E 1DEEG 1OXZA 1JY3O 3RGUA 1GD2E 2JWDA 2G8YA 2GA1A 4H13C 1JUNA 1NKZB 1IFPA 1QLED 3L73G 3TNUB 1NTKK 2JO1A 4WY4D 3V2QA 1ZRTE 4NPEA 2MKVA 4OGQD 1USEA 3L37A 2KB7P 3M9BA 1UIIA 2WMMA 2YO2A 1EC5A 1NTKD 3CD6P 2ZAEB 2GM4A 1PIXA 1VQ5P 2E76C 3CWBD 4Y99B 5AW4B 1KYOI 3I56P 1JTHB 1RH5B 3AE7C 3CLQA 1OFCX 3CXHH 1J1DB 4KHXA 4PJ0E 2Q7CA 1DD3A 3ZDMA 5KLVJ 3LW5H 1ZLLA 1KC8Q 3MD0A 1Z56A 2R32A 3N4XA 2PGDA 4U3FJ 4PJ0H 1J1EB 1SQBK 5DJTB 1LTJC 1M1KQ 3R2PA 3H1HE 3RK3D 2M3EA 2ZT9C 4DJGA 2XKMA 1T6AA 2A45G 1JCCA 1SQVG 1EZVE 1PGPA 1SQQG 1SQQJ 2QJYB 1YYCA 2GUVA 2Q3IA 3F89A 4GT1A 4MN4C 5CBNA 3MUDA 3A2AA 3H1JD 1SQBE 3HUSC 2QJPC 2M0BA 3A0HH 2KK7A 3HD7D 1Q82Q 1MV8A 2IBZG 1GK4A 1T8ZA 1BCCG 3AEGC 4UB8H 1EDLA 1BE3G 1IFNA 3IN6A 1HGVA 2XZRA 1U57A 5AW1B 3V5BA 2POHA 1JMMA 1T3UA 4OVNF 4TT3H 4YPCA 1ZV8A 2GUSA 1X8YA 2Y9YA 1SVFA 2L91A 3L72J 2AXTE 4L74A 1KQFB 5CCHA 3I55P 3CCUP 3Q2YA 4ASVA 3C1LA 3PJSK 1Q90D 3D6ZA 1SQPG 1SQXK 1FZFA 1N73B 3H1IJ 4HJGH 1AVYA 3HTKB 1LP1B 4I7ZB 1U7MA 1YHQP 3OA7A 1IK7A 1XTCC 4QMAA 1SLQA 3L74J 1E5WA 1GL2B 1RE4C 3VMYA 1VF5B 1JTHA 1X0TA 3H6PA 1UIXA 5AVRB 3RL0B 2AXCA 5GTHH 3FGAD 3RK3C 2ZT9D 3A0BH 1FDIA 1KFMA 4BXLA 3KZIE 2XV5A 1YBKA 1EXIA 1T3JA 1NAYA 1M57D 5AVVB 3P8CD 3H1KJ 3V6IA 5GTIH 1BGYD 1NKNA 2Z5HA 3HE5A 3M06A 3NTNA 4JPZB 1NTME 1SQPD 3CMAP 1K73Q 2BCCG 3G9RA 1Y47A 1H89A 4DT0A 2IDBA 1G2CB 2N1TD 1JEKA 3I5CA 3MP7B 5AW8B 4WY4C 1IO4A 1PP9G 5AVTB 4PD4E 2B89A 3AE4C 3O6QA 5H2FE 2HYNA 1FZCB 1BE3D 3Q5PA 2OTLP 1K9MQ 3L74G 4XFJA 1Q7YQ 1NGMB 4AUWA 1KYOE 2L5GB 3B5NA 2LKMA 3CX5E 4RESB 1L4AC 4Z1MH 1KZUB 5KKZB 3CCSP 3V4WA 3H32B 2CPSA 2P2UA 5E79H 2N1TA 5B66H 3A5TA 3HE4A 4L75A 2OYIA 2C9LY 1EZVG 1Q2NA 1SQQE 2WWWA 4IL6X 2KS1B 2HLOA 3M0DA 3H1ID 1IFIA 3CCRP 2JP3A 3HUSA 2WSFH 2B88A 4ZNCA 2O01H 3E1IA 1BCCJ 3VMXA 1FOSF 2E75C 1VQ9P 2LXBA 1OW8A 1SQQD 2FYUG 2FYZA 2PFXA 2UWJE 1KB9E 4M3LA 5AVYB 5DJUB 3L4FA 3V4QA 4C7NB 4DOJA 1K8AQ 1RF1C 1MUUA 1LTJA 1L0LD 2H8PD 2IYPA 2RH0A 2BCCE 3AE1C 1N7LA 1SQVK 3HD7C 2R3SA 2WTYA 1M7LA 3H25A 3GVJA 1NU1D 2R5DA 4H44C 3O8ZA 1SFCB 1G1JA 1OWAA 3BASA 4I1LA 4U3FG 2OYIC 2CPBA 2H7HA 4OGQC 2E76B 5AW9B 1ZN5A 2KLUA 3QH9A 1KFNA 1KILB 2IFNA 1OZHA 2XNXA 3H1KD 5APVA 1OVVA 1JO5A 2N9YB 1GL2D 2XNDH 3BCCE 1SQPJ 2K37A 3EWKA 3H1LJ 3KPEA 4RO0A 2ZXEB 1S5LE 4LC1A 1LT9B 4BWNA 2FYNB 1SS1A 3GHGC 1VQLP 3CCLP 2J58A 3VP8A 2QM8A 1FJKA 1SP4A 2C0XA 1LTJB 2YMKA 3L73D 3L70E 3RBZA 3Q5RA 1S9KD 1KQSO 1ZMEC 1X22A 1BE3J 1P84D 2G3AA 3AE8C 4HYTB 5BU5A 5TISH 1HWTC 1GU5A 1HF9A 3HD7A 2P7JA 3CCJP 1PZQA 1LTGC 3VYIA 5TJHA 3L70D 2K9JA 2K3RA 1S9KE 3G4SP 2KLVA 3B5NC 2O01N 5KLIB 1G1IA 3E1RA 3VTPC 2QSIA 2NZ2A 3MUDC 1CSBA 5KAIH 1M1JA 1PPJG 5C39A 1N7SB 2B87B 3IF4A 1HBWA 2FYUJ 4BRYA 1FJPA 3GMAA 3AE9C 3PRJA 3B8EB 3D70A 2E74B 5APSA 4PV1B 3D71A 1KILE 5CCGA 1SQBG 1V0FA 3BRTB 3IAOA 2QEXP 1PGQA 4IFFA 2Y0EA 2HODB 5KLVG 4GIFA 1QEXA 4GKGA 1YIJP 3O6QB 1T2KC 4H0LB 3MTUE 2KZIA
chains in the Genus database with same CATH topology
1EZVD 4PD4D 2L91A 3CXHD 3L75D 3TGUD 2QJPB 3H1LD 1PP9D 3PHLA 2QJKB 2K9JB 3GVKA 3KHUA 2QG4A 1BGYD 2A06D 2Y0DA 4U3FD 2FYUD 1SQPD 3L71D 1SQXD 4A7PA 2JWAA 1BE3D 1V0EA 3GG2A 5KKZB 4EDFA 5KLVD 4RJTA 1ZRTD 2RN0A 1SQVD 3L72D 1KYOD 3VMAA 3CX5D 1KB9D 4HIZA 3H1ID 2BCCD 1SQQD 3TF5A 3L74D 4D6TD 3PTZA 1L0LD 3ITKA 3GVJA 1PPJD 3TDKA 3GW6A 1NU1D 1NTMD 3GVLA 3BCCD 3H1KD 2N9YB 2FYNB 1L0ND 2O3JA 2KS1A 3L73D 1NTKD 1P84D 3CWBD 2RMZA 5TJHA 3L70D 3FWLA 5KLIB 2YIUB 2Y0CA 2Q3EA 1SQBD 3PRJA 1BCCD 1NTZD 1V0FA 3PLNA 2IBZD 2QJYB 2Y0EA 3H1JD 3JU4A 2KNCB 3H1HD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV D;  4PD4 D;  2L91 A;  3CXH D;  3L75 D;  3TGU D;  2QJP B;  3H1L D;  1PP9 D;  3PHL A;  2QJK B;  2K9J B;  3GVK A;  3KHU A;  2QG4 A;  1BGY D;  2A06 D;  2Y0D A;  4U3F D;  2FYU D;  1SQP D;  3L71 D;  1SQX D;  4A7P A;  2JWA A;  1BE3 D;  1V0E A;  3GG2 A;  5KKZ B;  4EDF A;  5KLV D;  4RJT A;  1ZRT D;  2RN0 A;  1SQV D;  3L72 D;  1KYO D;  3VMA A;  3CX5 D;  1KB9 D;  4HIZ A;  3H1I D;  2BCC D;  1SQQ D;  3TF5 A;  3L74 D;  4D6T D;  3PTZ A;  1L0L D;  3ITK A;  3GVJ A;  1PPJ D;  3TDK A;  3GW6 A;  1NU1 D;  1NTM D;  3GVL A;  3BCC D;  3H1K D;  2N9Y B;  2FYN B;  1L0N D;  2O3J A;  2KS1 A;  3L73 D;  1NTK D;  1P84 D;  3CWB D;  2RMZ A;  5TJH A;  3L70 D;  3FWL A;  5KLI B;  2YIU B;  2Y0C A;  2Q3E A;  1SQB D;  3PRJ A;  1BCC D;  1NTZ D;  1V0F A;  3PLN A;  2IBZ D;  2QJY B;  2Y0E A;  3H1J D;  3JU4 A;  2KNC B;  3H1H D; 
#chains in the Genus database with same CATH topology
 1OIP A;  2M5A A;  2KSJ A;  1EZV D;  1VF5 C;  1NO4 A;  1SQX E;  1L4A D;  3U1C A;  1DD4 A;  3RL0 C;  3TGU E;  1SQX G;  1L0N E;  2FXM A;  2FBW C;  3B4S A;  3BAT A;  1FZG A;  4N6J A;  3CC4 P;  3CXH D;  3BVH A;  1P84 E;  3SWK A;  2I1J A;  2C0W A;  3E7K A;  4N78 E;  1ZXG A;  1KQL A;  3CWB E;  5APU A;  5KLV E;  3TGU D;  2HOD A;  3C8V A;  2Q6Q A;  2BAS A;  1KB9 I;  3RK2 C;  2WT7 A;  4GDO A;  2H88 C;  2OGU A;  4DZO A;  1VQM P;  2AEF A;  2KXP B;  1YIT P;  2KYV A;  2ZYG A;  1NTK J;  3CXH I;  3U1A A;  1QX8 A;  2WT7 B;  2IFM A;  1KYO H;  1PP9 E;  1PGJ A;  1GW3 A;  1LTI C;  2YKO A;  3JSV C;  4WY4 B;  2QRX A;  2QG4 A;  2YXR B;  3KHU A;  2P1J A;  1YTZ I;  2YXQ B;  3CI9 A;  5CMZ A;  3B71 A;  3M0A A;  2WVR A;  1KIL D;  4D6T E;  1GTW A;  3P32 A;  1JY2 O;  2KSE A;  1RE3 C;  1RY3 A;  1CI6 A;  4EIJ A;  1NU1 E;  1L0N K;  3FWN A;  2FYU D;  2Q9I A;  1YQ4 C;  4KT0 J;  5KKZ C;  3ABV C;  1KQG B;  3L71 D;  3S9O A;  5CCH C;  2NPS A;  2OYH B;  1NTZ J;  1BSH A;  3QWO C;  4JYB A;  1S2E A;  5AVS B;  2FXO A;  4A7P A;  3H1L G;  2JWA A;  3D6Y A;  3H1J J;  3R4Y A;  3PP5 A;  1HTL C;  3EFG A;  3CCE P;  3F5H A;  1Y9B A;  1P84 H;  1RF1 B;  3GG2 A;  1MKM A;  1WRG A;  1BSN A;  2WSS H;  1LNQ A;  4UB6 H;  3FXE A;  5KLV D;  1J1D C;  3AE6 C;  4XA4 A;  3V2N A;  3PTZ A;  2WSE H;  4GOD A;  1SFC A;  3L73 E;  4I2L C;  2R44 A;  3VMA A;  1AA0 A;  3CX5 D;  3WMM 0;  1A02 J;  2E74 D;  1S72 P;  2V7Q H;  1WMK A;  4HIZ A;  1X9V A;  4WVZ A;  1SQP K;  3AEF C;  1FZB A;  2ZT9 B;  5CBO A;  4HH2 A;  4OGQ B;  3TF5 A;  1TU3 F;  4D6T D;  4H13 D;  1N8R Q;  1AQT A;  5M1B A;  3AE5 C;  1MFT A;  1NTM K;  2WPQ A;  3H1H J;  3HUS B;  1DH3 A;  2K1A A;  2FYN C;  2KZJ A;  1NH4 A;  3TDK A;  1JY3 P;  3L35 A;  1ZW0 A;  1BGY E;  2XU6 A;  3A0H E;  1NTM D;  1SQP E;  2P58 A;  2QE7 H;  1URQ D;  3HE4 B;  1Q86 Q;  2N1T B;  1BGY G;  2ITA A;  4WB4 A;  3CCM P;  3GHG A;  2NPS B;  1GU4 A;  2QA4 P;  3AE3 C;  4YXW H;  1NVO A;  2Z5I A;  2B9B A;  2HFE D;  3M91 A;  1J2J B;  5AW2 B;  3KYQ A;  2M3B A;  1HUC A;  4JQ0 D;  1EXJ A;  2E43 A;  2ZYA A;  2DW3 A;  1K05 A;  1PP9 J;  1Y8A A;  1FZE A;  2CK3 H;  2W90 A;  5CJ4 A;  1CZQ A;  1SQQ K;  5KJ7 A;  1L0N D;  2ZXX A;  3RK2 D;  1M90 Q;  2PP6 A;  1VQ8 P;  1NTM G;  2E74 C;  3CXH E;  3FX0 A;  1S5L H;  5B5E H;  1YJN P;  3GF3 A;  1R5S A;  2YKQ A;  1OX3 A;  2FFD A;  1AQ5 A;  3H1K G;  5AVZ B;  3L75 E;  2HPC A;  1EZV I;  2FXP A;  5KJ7 D;  3TGU G;  5KTB A;  2WPR A;  3SWY A;  1NHL A;  1RF1 A;  3JU4 A;  1PGO A;  2AEM A;  1HGZ A;  3Q1M A;  4TLF A;  1JM0 A;  2E42 A;  1FZC A;  5AW6 B;  3V2R A;  1OW6 A;  2WSC H;  1OW7 A;  4WBA A;  3CPW O;  3BRV B;  1G2C A;  1SQB D;  2K88 A;  2KP8 A;  2N9B A;  1T2K D;  1R8E A;  3CME P;  4IL6 H;  1SQX J;  1W2B O;  1L0L K;  2R5B A;  1JNM A;  1VF5 D;  5KAI E;  3Q5S A;  4AQR D;  1CI6 B;  3A7O A;  5B5E E;  1VDF A;  2E76 D;  3AED C;  1ZOY C;  1RQU A;  3RL0 D;  3VMZ A;  3K5B A;  4LGD E;  3H1H D;  1AVO A;  2SPZ A;  3H1I G;  5KLV K;  1L2P A;  1R5L A;  2Y9Z A;  2ZFC A;  2YIU C;  1LWU C;  2Q5U A;  3L72 G;  5TIS E;  3HE5 B;  3LW5 J;  4N78 D;  4WY4 A;  3CC7 P;  2J59 M;  3MHV A;  1K04 A;  2VRS A;  2WSC J;  3S1K A;  1GMJ A;  2BEZ F;  2IX7 C;  1SFC D;  3CX5 H;  4BRY B;  1M1J B;  1N2D C;  4H13 B;  1LJ2 A;  3H1L D;  3EFF K;  4K3A A;  2E75 B;  2E5T A;  3SFD C;  4D6T J;  2QJK B;  2D2C B;  2FY8 A;  2K9J B;  1IZN B;  2OYH C;  3GVK A;  2A06 G;  3HD7 B;  1N7S D;  1NU1 J;  1NYH A;  3AEB C;  4GOE A;  1FE6 A;  3P8C E;  2HPC B;  3EQ2 A;  1PV3 A;  3KQG A;  4DCK A;  5AW5 B;  2HR3 A;  5APW A;  3G71 P;  1URQ C;  1U7J A;  1IC2 A;  1H8A A;  3AEA C;  1N73 A;  1FC2 C;  3TYY A;  3KZI H;  1S4X A;  2WSE J;  3H1J E;  1PL5 A;  1EDK A;  3N7N A;  1LTB C;  2IBZ I;  4U3F D;  2O01 J;  1HH0 A;  1KIL A;  2ZJS E;  4L76 A;  1VL2 A;  1SQB J;  4NPD A;  1IFD A;  4UB6 E;  5AVQ B;  1GW4 A;  1KTM A;  3UIA A;  1NU1 G;  1S5L X;  2A45 H;  4HB1 A;  1L0N J;  3GHG B;  3TSI A;  3W68 A;  4GOF A;  1N7S A;  1LT9 A;  1RF0 C;  2A45 I;  2B87 A;  1YTZ T;  2KNC A;  3L73 J;  1X79 B;  3P8M C;  4ASW A;  3NFQ A;  5B66 E;  3AEC C;  5E79 E;  1PFI A;  4D6T G;  1GDT A;  3L71 E;  1EDJ A;  3CWB J;  5BU8 B;  1V0E A;  1LGH B;  3L70 J;  4EDF A;  1MFZ A;  1ZRT D;  2RN0 A;  4CPG A;  3SSU A;  1BE3 E;  5AW3 B;  1LT1 A;  1VQ4 P;  1SQV D;  2QM7 A;  4H44 D;  4N3Y B;  1KYO D;  3TK1 A;  1NTK E;  4PD4 H;  2I8D A;  2WZ7 A;  3V2P A;  1QVG O;  1USD A;  2O1K A;  3WUU A;  4C46 A;  1N7S C;  1MZ9 A;  1RF0 A;  2N1T C;  3IR9 A;  1H88 A;  2NPS C;  2KOG A;  3KXD A;  1SQV E;  3H1J G;  4I6M C;  2BCC D;  1L4A A;  1NWQ A;  2YKP A;  2LR2 A;  2MJZ A;  4B86 A;  1EQ7 A;  1GL2 C;  2QVA A;  1NOH A;  1VQN P;  3G6E P;  2H43 A;  1Q81 Q;  2OTJ P;  3VOP A;  3B5N B;  2YMY A;  2OQQ A;  4K35 A;  3RK3 E;  4HKZ H;  4IOI H;  2A06 E;  1VQ6 P;  2OTK E;  4OH8 B;  1WT6 A;  4F0A B;  3GVL A;  2O1J A;  3AEE C;  2BEQ D;  1S3J A;  1VQP P;  2IYO A;  2ZVN B;  2OYH A;  2V4H A;  2AEJ A;  1NJI Q;  3MGN A;  1VPC A;  1VQO P;  2FFD C;  1NTK G;  3L75 J;  3OJA B;  2W6A A;  4Y99 C;  5AVU B;  3TGU J;  3L75 G;  2W83 C;  4JYC A;  4LLH A;  2FYU K;  3SFE C;  1QVF O;  1E79 H;  1EDI A;  2KS1 A;  2O3J A;  1RHZ B;  5KJ7 C;  2Q1K A;  4H0L D;  3T97 A;  2WPS A;  3L72 E;  2I1K A;  4IFD K;  2IZ1 A;  2FKW B;  5APX A;  3RL0 g;  1RE4 A;  3IFM A;  1QL2 A;  2H89 C;  3WU2 H;  3WU2 E;  2PAJ A;  2RMZ A;  2C9N Y;  3OW2 O;  1M56 D;  4UB8 E;  4YTP C;  3Q3D A;  1FU1 A;  3FWL A;  1YJW P;  2OAR A;  3VN0 A;  4Y28 J;  1LTA C;  1GL2 A;  2QIW A;  2WSF J;  3LID A;  4YXD C;  2WPV B;  2YIU B;  1LWU B;  4W80 A;  1JB0 J;  1BDC A;  2WIT A;  1ZR2 A;  1FAV A;  1NTZ K;  1BGY J;  2W8Z A;  3CCV P;  2Y0C A;  1LTT C;  1NU1 K;  2Q3E A;  3NMD A;  4U7J A;  1H0T B;  1FZA A;  2KUB A;  3CX5 I;  3G3Z A;  3L71 J;  1YJ9 P;  2BCC J;  1BCC D;  1NTZ D;  3PLN A;  1FOS E;  2IBZ D;  4NPF X;  3CL3 D;  3H1H G;  5BVZ A;  1M1J C;  5EFW B;  4AYC A;  1RQV A;  2KNC B;  4KJM A;  4W7Y A;  3W67 A;  1LP1 A;  1L0L J;  4EI2 A;  4U3F E;  4JBZ A;  4XE5 B;  1A02 F;  1NTZ E;  2M5A B;  1KN7 A;  2QJK C;  2D2C C;  2ZYD A;  1YQ3 C;  5CCG C;  3L36 A;  2R3C A;  4H44 B;  1AJY A;  3L70 G;  1OVU A;  1NTM J;  1SFC C;  2OYI B;  3CWB G;  4JF7 A;  4PD4 D;  1SQV J;  1J1E C;  2W6J H;  3FXD A;  4EYY Q;  2ZVO B;  2JKV A;  3BCC J;  5K5G B;  3JCU H;  2KI7 B;  1S1C X;  2LXC B;  3U59 A;  1KIL C;  2W6B A;  2IPP A;  2QJY C;  1L0N G;  1URQ B;  1KD1 Q;  1DEB A;  1FDM A;  1JY2 P;  1BDD A;  3L75 D;  4W7Z A;  3CCQ P;  2P10 A;  2M8R A;  2QJP B;  1LT9 C;  3OAK A;  1PP9 D;  3A3Y B;  3HTK A;  2JDI H;  3MZW B;  1URQ A;  2J5U A;  3B5N D;  3PHL A;  2V7Q J;  3L71 G;  5AVX B;  1VQK P;  4L73 A;  5KAF E;  1KB9 H;  3C9I A;  3M9Q A;  4IFM A;  1IJD B;  1P84 I;  2KIK A;  4R4M A;  1N73 C;  3L74 E;  4C7R A;  1ZR4 A;  1BCC E;  1IFJ A;  5KLI C;  2K9Y A;  3CC2 P;  2IBZ E;  2YNY A;  4I7Z C;  1YI2 P;  1W2E A;  3M9H A;  3TNU A;  1JY2 N;  1KOR A;  1HJ0 A;  3BCC G;  5APQ A;  1W5C E;  1JOC A;  2A06 D;  2RKL A;  2Y0D A;  2JEE A;  3WUV A;  1FS0 E;  2IZ0 A;  3KDP B;  1HVV A;  1JY3 N;  4ZMD A;  4PV1 C;  3T97 B;  3P7K A;  1SQX D;  3PH0 A;  3M0D C;  1AV1 A;  5APT A;  3AE2 C;  3RK3 B;  1L0L G;  5H2F H;  5AW0 B;  1DX7 A;  2XDJ A;  3H1K E;  1LWU A;  4H0L C;  1IFM A;  5CHX A;  3S4R A;  5AVW B;  1AFO A;  4PD4 I;  1NAF A;  3SWF A;  2PRR A;  4RKU J;  1FDO A;  2E5Y A;  1H0T A;  3VP9 A;  4RJT A;  2JR8 A;  3H1L E;  5L8R J;  3JCU E;  2NPS D;  1JMB A;  3RBX A;  4C7N A;  4WWI A;  5GTI E;  3L72 D;  5APY A;  1NTZ G;  1GZL A;  2Z4E A;  2OYO A;  2WQY C;  3MIW A;  3USS A;  3WUT A;  4EOT A;  2NRG A;  1KB9 D;  5CCH D;  1D7M A;  4OWF A;  5CJ0 A;  1L0L E;  2HG5 D;  3A0B E;  4O9B A;  1FZC C;  1CW5 A;  1M8O B;  2P67 A;  5GTH E;  1PPJ E;  3RK2 B;  1VQ7 P;  5AW7 B;  4R4L A;  3L74 D;  1HJB A;  2FFD B;  1GK6 A;  3H32 A;  3JC2 2;  1L4A B;  3H1I E;  1RE3 A;  1FBM A;  1OVR A;  2JJL A;  1XTG B;  1OMI A;  3GLM A;  3HRN A;  1QGK B;  1KMI Z;  1QL1 A;  1N86 A;  1ZP0 C;  3II6 A;  3ITK A;  2E75 D;  1PPJ D;  4ZKP A;  3GW6 A;  2YO3 A;  1DIP A;  3GF7 A;  4ZKU A;  2FYU E;  4PV1 D;  2D2C D;  5CCG D;  1JCD A;  1KV4 A;  3LIE A;  3BCC D;  1LTS C;  3NXS A;  2W27 A;  5KAF H;  1IK9 A;  2AXT H;  4IL6 E;  1DEE G;  1OXZ A;  1JY3 O;  3RGU A;  1GD2 E;  2JWD A;  2G8Y A;  2GA1 A;  4H13 C;  1JUN A;  1NKZ B;  1IFP A;  1QLE D;  3L73 G;  3TNU B;  1NTK K;  2JO1 A;  4WY4 D;  3V2Q A;  1ZRT E;  4NPE A;  2MKV A;  4OGQ D;  1USE A;  3L37 A;  2KB7 P;  3M9B A;  1UII A;  2WMM A;  2YO2 A;  1EC5 A;  1NTK D;  3CD6 P;  2ZAE B;  2GM4 A;  1PIX A;  1VQ5 P;  2E76 C;  3CWB D;  4Y99 B;  5AW4 B;  1KYO I;  3I56 P;  1JTH B;  1RH5 B;  3AE7 C;  3CLQ A;  1OFC X;  3CXH H;  1J1D B;  4KHX A;  4PJ0 E;  2Q7C A;  1DD3 A;  3ZDM A;  5KLV J;  3LW5 H;  1ZLL A;  1KC8 Q;  3MD0 A;  1Z56 A;  2R32 A;  3N4X A;  2PGD A;  4U3F J;  4PJ0 H;  1J1E B;  1SQB K;  5DJT B;  1LTJ C;  1M1K Q;  3R2P A;  3H1H E;  3RK3 D;  2M3E A;  2ZT9 C;  4DJG A;  2XKM A;  1T6A A;  2A45 G;  1JCC A;  1SQV G;  1EZV E;  1PGP A;  1SQQ G;  1SQQ J;  2QJY B;  1YYC A;  2GUV A;  2Q3I A;  3F89 A;  4GT1 A;  4MN4 C;  5CBN A;  3MUD A;  3A2A A;  3H1J D;  1SQB E;  3HUS C;  2QJP C;  2M0B A;  3A0H H;  2KK7 A;  3HD7 D;  1Q82 Q;  1MV8 A;  2IBZ G;  1GK4 A;  1T8Z A;  1BCC G;  3AEG C;  4UB8 H;  1EDL A;  1BE3 G;  1IFN A;  3IN6 A;  1HGV A;  2XZR A;  1U57 A;  5AW1 B;  3V5B A;  2POH A;  1JMM A;  1T3U A;  4OVN F;  4TT3 H;  4YPC A;  1ZV8 A;  2GUS A;  1X8Y A;  2Y9Y A;  1SVF A;  2L91 A;  3L72 J;  2AXT E;  4L74 A;  1KQF B;  5CCH A;  3I55 P;  3CCU P;  3Q2Y A;  4ASV A;  3C1L A;  3PJS K;  1Q90 D;  3D6Z A;  1SQP G;  1SQX K;  1FZF A;  1N73 B;  3H1I J;  4HJG H;  1AVY A;  3HTK B;  1LP1 B;  4I7Z B;  1U7M A;  1YHQ P;  3OA7 A;  1IK7 A;  1XTC C;  4QMA A;  1SLQ A;  3L74 J;  1E5W A;  1GL2 B;  1RE4 C;  3VMY A;  1VF5 B;  1JTH A;  1X0T A;  3H6P A;  1UIX A;  5AVR B;  3RL0 B;  2AXC A;  5GTH H;  3FGA D;  3RK3 C;  2ZT9 D;  3A0B H;  1FDI A;  1KFM A;  4BXL A;  3KZI E;  2XV5 A;  1YBK A;  1EXI A;  1T3J A;  1NAY A;  1M57 D;  5AVV B;  3P8C D;  3H1K J;  3V6I A;  5GTI H;  1BGY D;  1NKN A;  2Z5H A;  3HE5 A;  3M06 A;  3NTN A;  4JPZ B;  1NTM E;  1SQP D;  3CMA P;  1K73 Q;  2BCC G;  3G9R A;  1Y47 A;  1H89 A;  4DT0 A;  2IDB A;  1G2C B;  2N1T D;  1JEK A;  3I5C A;  3MP7 B;  5AW8 B;  4WY4 C;  1IO4 A;  1PP9 G;  5AVT B;  4PD4 E;  2B89 A;  3AE4 C;  3O6Q A;  5H2F E;  2HYN A;  1FZC B;  1BE3 D;  3Q5P A;  2OTL P;  1K9M Q;  3L74 G;  4XFJ A;  1Q7Y Q;  1NGM B;  4AUW A;  1KYO E;  2L5G B;  3B5N A;  2LKM A;  3CX5 E;  4RES B;  1L4A C;  4Z1M H;  1KZU B;  5KKZ B;  3CCS P;  3V4W A;  3H32 B;  2CPS A;  2P2U A;  5E79 H;  2N1T A;  5B66 H;  3A5T A;  3HE4 A;  4L75 A;  2OYI A;  2C9L Y;  1EZV G;  1Q2N A;  1SQQ E;  2WWW A;  4IL6 X;  2KS1 B;  2HLO A;  3M0D A;  3H1I D;  1IFI A;  3CCR P;  2JP3 A;  3HUS A;  2WSF H;  2B88 A;  4ZNC A;  2O01 H;  3E1I A;  1BCC J;  3VMX A;  1FOS F;  2E75 C;  1VQ9 P;  2LXB A;  1OW8 A;  1SQQ D;  2FYU G;  2FYZ A;  2PFX A;  2UWJ E;  1KB9 E;  4M3L A;  5AVY B;  5DJU B;  3L4F A;  3V4Q A;  4C7N B;  4DOJ A;  1K8A Q;  1RF1 C;  1MUU A;  1LTJ A;  1L0L D;  2H8P D;  2IYP A;  2RH0 A;  2BCC E;  3AE1 C;  1N7L A;  1SQV K;  3HD7 C;  2R3S A;  2WTY A;  1M7L A;  3H25 A;  3GVJ A;  1NU1 D;  2R5D A;  4H44 C;  3O8Z A;  1SFC B;  1G1J A;  1OWA A;  3BAS A;  4I1L A;  4U3F G;  2OYI C;  2CPB A;  2H7H A;  4OGQ C;  2E76 B;  5AW9 B;  1ZN5 A;  2KLU A;  3QH9 A;  1KFN A;  1KIL B;  2IFN A;  1OZH A;  2XNX A;  3H1K D;  5APV A;  1OVV A;  1JO5 A;  2N9Y B;  1GL2 D;  2XND H;  3BCC E;  1SQP J;  2K37 A;  3EWK A;  3H1L J;  3KPE A;  4RO0 A;  2ZXE B;  1S5L E;  4LC1 A;  1LT9 B;  4BWN A;  2FYN B;  1SS1 A;  3GHG C;  1VQL P;  3CCL P;  2J58 A;  3VP8 A;  2QM8 A;  1FJK A;  1SP4 A;  2C0X A;  1LTJ B;  2YMK A;  3L73 D;  3L70 E;  3RBZ A;  3Q5R A;  1S9K D;  1KQS O;  1ZME C;  1X22 A;  1BE3 J;  1P84 D;  2G3A A;  3AE8 C;  4HYT B;  5BU5 A;  5TIS H;  1HWT C;  1GU5 A;  1HF9 A;  3HD7 A;  2P7J A;  3CCJ P;  1PZQ A;  1LTG C;  3VYI A;  5TJH A;  3L70 D;  2K9J A;  2K3R A;  1S9K E;  3G4S P;  2KLV A;  3B5N C;  2O01 N;  5KLI B;  1G1I A;  3E1R A;  3VTP C;  2QSI A;  2NZ2 A;  3MUD C;  1CSB A;  5KAI H;  1M1J A;  1PPJ G;  5C39 A;  1N7S B;  2B87 B;  3IF4 A;  1HBW A;  2FYU J;  4BRY A;  1FJP A;  3GMA A;  3AE9 C;  3PRJ A;  3B8E B;  3D70 A;  2E74 B;  5APS A;  4PV1 B;  3D71 A;  1KIL E;  5CCG A;  1SQB G;  1V0F A;  3BRT B;  3IAO A;  2QEX P;  1PGQ A;  4IFF A;  2Y0E A;  2HOD B;  5KLV G;  4GIF A;  1QEX A;  4GKG A;  1YIJ P;  3O6Q B;  1T2K C;  4H0L B;  3MTU E;  2KZI A; 
#chains in the Genus database with same CATH homology
 1EZV D;  4PD4 D;  2L91 A;  3CXH D;  3L75 D;  3TGU D;  2QJP B;  3H1L D;  1PP9 D;  3PHL A;  2QJK B;  2K9J B;  3GVK A;  3KHU A;  2QG4 A;  1BGY D;  2A06 D;  2Y0D A;  4U3F D;  2FYU D;  1SQP D;  3L71 D;  1SQX D;  4A7P A;  2JWA A;  1BE3 D;  1V0E A;  3GG2 A;  5KKZ B;  4EDF A;  5KLV D;  4RJT A;  1ZRT D;  2RN0 A;  1SQV D;  3L72 D;  1KYO D;  3VMA A;  3CX5 D;  1KB9 D;  4HIZ A;  3H1I D;  2BCC D;  1SQQ D;  3TF5 A;  3L74 D;  4D6T D;  3PTZ A;  1L0L D;  3ITK A;  3GVJ A;  1PPJ D;  3TDK A;  3GW6 A;  1NU1 D;  1NTM D;  3GVL A;  3BCC D;  3H1K D;  2N9Y B;  2FYN B;  1L0N D;  2O3J A;  2KS1 A;  3L73 D;  1NTK D;  1P84 D;  3CWB D;  2RMZ A;  5TJH A;  3L70 D;  3FWL A;  5KLI B;  2YIU B;  2Y0C A;  2Q3E A;  1SQB D;  3PRJ A;  1BCC D;  1NTZ D;  1V0F A;  3PLN A;  2IBZ D;  2QJY B;  2Y0E A;  3H1J D;  3JU4 A;  2KNC B;  3H1H D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...