3GW6A

Intramolecular chaperone
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
264
structure length
256
Chain Sequence
b'HVTIRIRSEVLMEGEYGFIGKSIPTDNPAGQRIIFCGGEGTSSTTGAQITLYGANNTDSRRIVYNGDEHLFQSADVKPYNDNVTALGGPSNRFTTAYLGSNPIVTANGERKTEPVVFDDAFLDAWGDVHYIMYQWLDAVQLKGNDARIHFGVIAQQIRDVFIAHGLMDENSCRYAVLCYDKYPRMTDTVFSHNEIVEHTDEEGNVTTTEEPVYTEVVIHEEGEEWGVRPDGIFFAEAAYQRRKLERIEARLSALEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endo-N-acetylneuraminidase
publication title Crystal structure of an intramolecular chaperone mediating triple-beta-helix folding.
pubmed doi rcsb
source organism Enterobacteria phage k1f
molecule tags Chaperone
total genus 41
structure length 256
sequence length 264
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.129: Endo-alpha-sialidase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13884 Peptidase_S74 Chaperone of endosialidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3gw6A04
1.20.5.1240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Endo-n-acetylneuraminidase 3gw6A02
3.30.2460.10 Alpha Beta 2-Layer Sandwich Endo-n-acetylneuraminidase fold Endo-n-acetylneuraminidase domain 3gw6A03
4.10.1090.10 Few Secondary Structures Irregular Endosialidase, domain 4 Endosialidase, domain 4 3gw6A01
3GW6A 3L75D 1SQVD 3TGUD 2Y0EA 5KLIB 2IBZD 2QJPB 2K9JB 1SQPD 4EDFA 1PP9D 1KB9D 2Y0DA 2KS1A 3L70D 4HIZA 3L73D 1SQBD 2L91A 4PD4D 5KKZB 3L72D 3JU4A 3ITKA 1SQQD 2YIUB 2QJYB 3PRJA 2JWAA 1NTKD 1L0LD 1BCCD 2FYNB 2N9YB 3PTZA 3TDKA 3H1HD 1SQXD 2QJKB 1BGYD 3GVJA 2Q3EA 2O3JA 3BCCD 1L0ND 2QG4A 2Y0CA 2KNCB 1NTZD 3H1KD 3PHLA 3H1LD 1EZVD 1ZRTD 2RMZA 2A06D 3FWLA 3KHUA 3PLNA 2FYUD 2BCCD 1KYOD 3GVLA 1V0EA 3VMAA 4D6TD 3CWBD 1P84D 1NTMD 1PPJD 2RN0A 1BE3D 3L74D 4RJTA 1V0FA 4U3FD 3GG2A 3GVKA 3CX5D 3L71D 5KLVD 1NU1D 3TF5A 3H1JD 3H1ID 5TJHA 3CXHD 4A7PA
chains in the Genus database with same CATH superfamily
4HH2A 2Y0EA 3JCUH 1KV4A 3CD6P 4WY4A 3AEFC 4M3LA 1KC8Q 4ZKUA 4WY4D 2KYVA 4K3AA 1VL2A 1LWUC 2GUVA 5CBNA 1YIJP 4KHXA 3Q1MA 2BEZF 2W6JH 1AFOA 2N9YB 2N9BA 2M5AB 3MHVA 1OX3A 1L4AA 3L4FA 1GK6A 3H1KD 1OVRA 4EOTA 2C9NY 2WTYA 3RBZA 3CCSP 4JF7A 2JJLA 1S5LE 5AW1B 3L71E 1R8EA 3GHGC 1SP4A 3CC2P 2JWDA 2YO3A 1DH3A 1ZV8A 1NWQA 3FWNA 1IJDB 2L5GB 3L74D 1G1JA 1VF5D 5APUA 4ZNCA 4DJGA 1EXIA 1P84I 4I1LA 3HTKB 3P8MC 2W27A 4AQRD 3CC4P 4TT3H 2ZT9B 4OH8B 2W6BA 1LGHB 2YO2A 2R3SA 3M06A 4JQ0D 1BGYJ 1YYCA 2E74D 3B5NB 5CCGD 1HGZA 2A06G 1FDIA 1SFCC 2LXCB 1SQBK 3C8VA 3G71P 3M0AA 1NTKE 1BGYG 1RF0C 3L70D 4GDOA 2KK7A 3I55P 1SQBD 3AEEC 3A5TA 2M0BA 1NOHA 2ZXXA 1EDIA 3EFGA 2WT7A 1LWUA 2KI7B 1KILC 1KN7A 1W2EA 3CXHI 5GTIE 1IK7A 1NAFA 2QJKB 1QLED 1N73B 1N86A 1JTHA 2QG4A 4UB6E 2WSFH 3KDPB 4Y99B 1ZRTD 5AVXB 1LTGC 1SQXK 1URQC 1GMJA 1SQVJ 2WSSH 3M9QA 1X8YA 1EXJA 1RE4A 3TNUA 2O1KA 1ZR2A 1RE3C 5K5GB 1M90Q 3CX5D 1HTLC 1L0LJ 4QMAA 4GKGA 1Y9BA 1K9MQ 5GTHH 3H1HJ 2FYUJ 3HE5A 1FZEA 2KSJA 1Q82Q 1FDOA 1L0LG 1L0NJ 5AVZB 1NU1K 2OQQA 4W80A 2FYUG 3MP7B 1J1EB 1SQQK 2L91A 1L0NG 1SQXE 3B4SA 5KAIH 1OWAA 1SFCD 1SQQD 5KKZC 3CWBJ 4C7NA 3CX5H 3VTPC 2KUBA 1BCCD 1NKZB 2WPVB 1LTSC 2J5UA 2GA1A 2A06E 1LTJC 3H1IG 3GVJA 3CWBG 1QL1A 1KILD 1AVOA 5L8RJ 3O6QA 4Y28J 1X79B 1FAVA 5KJ7C 5AVTB 2IYOA 1S9KE 3LW5J 3PJSK 1PGJA 3L72G 2K9YA 1NU1E 2A45G 2LR2A 1VQ4P 2GUSA 3AE9C 1URQD 1MUUA 2G3AA 1KQLA 3V2NA 3HD7B 2KXPB 2IBZG 5AW3B 4BXLA 5KAFE 5DJUB 3AEAC 2XV5A 2B87A 3RK2C 1FBMA 1BDDA 1SS1A 2ZFCA 3AE2C 3CC7P 2OYHB 3IF4A 1MKMA 2ZVNB 5KLVK 4HB1A 3P7KA 3M91A 2V7QJ 3GF7A 4EI2A 1HBWA 2P67A 2PRRA 1KB9E 4PD4D 1G2CA 3A0BH 4H0LD 2K9JA 2AEJA 2E42A 1FZFA 3L75J 2Z4EA 1ZP0C 3E1RA 1L0LE 1NH4A 2D2CC 1GU5A 4U3FJ 5AW7B 2FYUE 3L75G 2O01J 2WPSA 2K1AA 1AQTA 1DD4A 2ZXEB 1L0NE 3RGUA 4U3FG 2Q6QA 2R3CA 1JO5A 3RL0C 4CPGA 5DJTB 4L75A 2IDBA 1HJBA 2QA4P 3Q5SA 2BCCD 5KJ7A 1KYOD 2OTLP 4PD4H 3W68A 2OYIC 5KJ7D 4D6TD 5KLVE 2LXBA 4H13B 4IFMA 3H1IE 2SPZA 1PV3A 1S1CX 3CCQP 1HH0A 1EDKA 1AJYA 1JCDA 5AW4B 2H7HA 1EDJA 1RH5B 3BRVB 1VQNP 1GL2B 5TJHA 5APXA 2Q1KA 3EQ2A 3D6YA 2ITAA 3V4WA 3L72E 3U1CA 1IFNA 2MKVA 1RF1C 3FX0A 5KLIC 2QJPC 3T97B 3AE8C 2FXMA 3L73D 5AW8B 1LT1A 2HYNA 4L74A 2YIUB 1SQPK 3CCMP 5CJ0A 1NTMJ 4PD4I 1IC2A 2YMYA 2NRGA 2J59M 1N8RQ 1YITP 3TDKA 3EFFK 5TISE 2XDJA 3H1JG 2Q3EA 2KZJA 1FU1A 1NTMG 3BCCD 1Y47A 1N7SB 4HYTB 2KNCB 1NTZD 3H1LD 1EZVD 2JR8A 3QH9A 2G8YA 3KZIH 1L4AC 4IL6H 2KP8A 1USDA 2B89A 4H44D 3FWLA 2I8DA 1GU4A 3GVLA 3VN0A 1V0EA 2XKMA 3VMAA 2N1TB 1H8AA 1YQ4C 2IFMA 4JPZB 3Q2YA 1M1JB 3RL0D 3NTNA 3AE1C 3G9RA 1KYOI 4RKUJ 1LT9B 3HUSA 1GTWA 3V5BA 3L75E 3PP5A 3GG2A 1Q90D 2ZVOB 1YBKA 1PGOA 3L35A 4PV1D 1NTKJ 1SQPE 1PP9E 4U3FE 1HUCA 4B86A 1T3UA 1DEEG 1NVOA 1OXZA 1NHLA 1UIXA 1VQMP 5AVRB 4ASWA 1GDTA 2XNDH 1JCCA 5B5EH 3CLQA 4MN4C 1LJ2A 3OW2O 3CCEP 1QX8A 3ZDMA 1JMBA 1S72P 3L74G 3CPWO 1KMIZ 5APSA 4IL6X 4OGQB 3AE7C 2M5AA 2OTKE 5APYA 1QVFO 2KSEA 3AEGC 1W5CE 1K73Q 2WSCH 3L70J 2ZYDA 4PJ0E 4NPFX 3KQGA 1SQBJ 2AXTH 1P84E 1VQ5P 1PPJE 3W67A 2XZRA 1J1DC 1K05A 2AEFA 3HRNA 4DT0A 1ZXGA 3L70G 4YPCA 1J2JB 1EZVI 1SQBG 2JP3A 3V4QA 2NPSB 5CHXA 2E76C 1L4AD 1OIPA 1HJ0A 2YKQA 2Z5IA 4XFJA 1WRGA 3H1JE 1BE3D 4EYYQ 2OYOA 1NTME 2E5TA 4C46A 1MFZA 4I6MC 1RE4C 2O01N 2Y9ZA 1GK4A 1VPCA 4L76A 4WY4B 2ZT9D 3C1LA 3BASA 3TF5A 2YMKA 3B5NA 3CCVP 1SQXJ 1DIPA 2H43A 4IFFA 4I7ZC 2AXCA 2P2UA 5AVUB 3CXHE 3LIEA 1SQXG 1Q81Q 4I2LC 2CPSA 3Q3DA 4RO0A 2K37A 3AE4C 2QJYB 3PRJA 2B88A 2O1JA 1FZCB 2LKMA 3Q5PA 2FY8A 1NYHA 1NU1J 2JO1A 3OAKA 1YHQP 1VF5B 3L74E 3E7KA 1NU1G 4YXDC 2WWWA 2IPPA 1SQQG 3WMM0 4DOJA 2E74B 4WBAA 1NGMB 1BCCG 2BASA 3AE6C 4GOFA 2E76D 3HE4B 5AW5B 4UB6H 3FXEA 1FZAA 3L70E 1A02J 1SQBE 1CZQA 3H32B 4DCKA 5AVYB 3TSIA 1H88A 1BSNA 1LWUB 2YNYA 2KLUA 3IR9A 2H89C 3CCRP 3AEBC 1UIIA 2QEXP 4XE5B 4Z1MH 1JTHB 4JYBA 4W7ZA 5AVSB 5H2FE 5GTHE 1ZW0A 4TLFA 1ZRTE 4H0LC 1GZLA 1BGYD 1OW6A 3JC22 1ZMEC 3FGAD 3N7NA 5KLVJ 2HG5D 1CI6A 3H1IJ 1VQ8P 5AW6B 4YXWH 3TYYA 5KLVG 2P1JA 3GHGB 3L37A 2BEQD 1GD2E 3TGUJ 1CW5A 3PLNA 3CX5E 2W83C 2IX7C 2FBWC 5M1BA 1USEA 3R2PA 1N2DC 3HD7A 1DEBA 3TGUG 3VMZA 1OVVA 1YJWP 1KZUB 1OW8A 3L72J 1PGQA 2W6AA 2ZJSE 4WWIA 4JBZA 4L73A 2OYHA 1JMMA 2BCCJ 1E5WA 4R4MA 2R5BA 2POHA 1AVYA 3U1AA 3P32A 1S3JA 1SFCB 1GW3A 1KFMA 1SQVD 4IFDK 1SQQE 1IFMA 2P7JA 1YI2P 1N7LA 1KB9D 2BCCG 4HIZA 1BCCE 2FXOA 2KS1B 5KAFH 3CX5I 1KILB 2E75C 1KILE 4NPEA 2QVAA 2JWAA 3M0DA 1L0LD 2QM7A 2UWJE 5EFWB 5C39A 3H1HD 2PGDA 2FFDC 1A02F 1K8AQ 2VRSA 1QL2A 2FYNC 2OGUA 1L0ND 3C9IA 2YXQB 1URQB 4GODA 3B8EB 1KB9H 1FS0E 3MUDA 3CI9A 3JSVC 3L73G 1IFDA 1LNQA 1VQ9P 1SQPJ 1PP9J 3I5CA 3CWBD 1W2BO 4H44C 3P8CE 2ZAEB 1H0TB 3R4YA 4BRYB 1FOSF 1SQPG 4N78D 1PP9G 2KB7P 3WUUA 3RK3C 2H88C 2ZYGA 3BCCG 3K5BA 3WU2H 3HUSC 4N3YB 1OVUA 3RL0g 2HR3A 1ZR4A 1EZVG 2JEEA 4PV1C 2WSEJ 4PD4E 3SFEC 2HODB 5E79H 1KQGB 2IBZD 1MFTA 5CJ4A 2K9JB 1YQ3C 3T97A 2K3RA 3TGUE 2Y0DA 2M3EA 2I1JA 1R5SA 5KKZB 5B66E 3IN6A 2WVRA 3I56P 2WITA 1X9VA 3FXDA 1SLQA 3A2AA 2C9LY 1LTJB 2Q5UA 2XNXA 5CCHA 2IZ1A 5CCHD 3MTUE 1N7SA 2E75D 1N7SD 4LC1A 2KNCA 1PPJG 5AW9B 2BCCE 2IFNA 1KYOE 3USSA 4KT0J 4D6TE 2FFDA 4UB8E 1LP1A 2IYPA 3H1JJ 3LW5H 3AE3C 2Y9YA 2RMZA 1JM0A 3VMXA 2N1TA 2N1TD 1M1JA 1NTZK 3SSUA 1E79H 1LT9A 3SWKA 1VQKP 4LLHA 1X0TA 1FE6A 4RJTA 3CMAP 2KOGA 4U3FD 3RK2B 4K35A 3GMAA 3B71A 3KZIE 1JY3N 4IOIH 3M9BA 4HKZH 3CMEP 3L73E 2KZIA 4A7PA 2QE7H 2ZT9C 2V7QH 3RK3D 1FJKA 5BU5A 1WT6A 3A0HE 1H89A 3H1KJ 1BE3J 3B5NC 5AW0B 2FXPA 3II6A 2IBZI 2Z5HA 4KJMA 2PP6A 1M8OB 1RY3A 3H1KG 1D7MA 1BE3G 2Q3IA 3BCCE 1G1IA 3VP9A 3WUTA 1NTZE 2D2CB 3CL3D 2NZ2A 1EZVE 3PTZA 2P58A 3L74J 2O01H 3BRTB 5AVWB 1IFIA 2CPBA 2K88A 1JUNA 2QJKC 2DW3A 3RL0B 1N73C 1RHZB 1T2KC 3VYIA 2OYIB 1Y8AA 4Y99C 2WSFJ 2NPSA 2NPSD 3JCUE 3V2PA 2PAJA 1NTMD 1L2PA 3KPEA 2RN0A 1FC2C 1TU3F 2YKPA 5BU8B 1DD3A 3L71D 2AXTE 4PJ0H 2HPCB 1P84H 1YTZI 3NFQA 1JEKA 5AVVB 3CXHD 1RF1B 2B9BA 3HTKA 5KLIB 2QJPB 1AV1A 2QM8A 3F89A 1Q2NA 3AEDC 1YJ9P 1KQFB 4OWFA 3JU4A 3Q5RA 1NTKK 1J1EC 3B5ND 3KXDA 3A3YB 3H6PA 2H8PD 1S5LH 1NTKD 1Q7YQ 1FZCA 1PFIA 3PH0A 1T6AA 1FDMA 3CXHH 1FJPA 1L4AB 3PHLA 1QEXA 3MGNA 3VP8A 1IK9A 3H1KE 3CCUP 3A7OA 1BE3E 1S4XA 5APVA 1N73A 4GOEA 2KLVA 4LGDE 1CSBA 2WPQA 1T2KD 5CCGA 1T3JA 3MD0A 4ZKPA 3HE4A 1ZN5A 1HVVA 1SQQJ 1YTZT 3HD7C 4WB4A 4ZMDA 4U7JA 1MV8A 2Q7CA 1BCCJ 2FKWB 3H32A 3CCJP 3GW6A 1S5LX 5GTIH 3AECC 1JB0J 1JOCA 2JKVA 2OYHC 1VDFA 3GLMA 3BATA 3IFMA 5KTBA 1AQ5A 5AVQB 2GM4A 1JY3P 2WZ7A 1FZGA 2M8RA 3O8ZA 3MIWA 2IZ0A 2MJZA 3V2RA 1LTIC 2WT7B 1RQVA 1SQXD 4HJGH 1U7MA 1ZLLA 2M3BA 1XTGB 1M1KQ 2O3JA 3M0DC 4XA4A 1J1DB 4AUWA 1SQVG 4NPDA 3GHGA 1JNMA 2A06D 2WPRA 3S4RA 2E76B 2XU6A 4W7YA 4JYCA 5H2FH 3MUDC 3D71A 1QGKB 1MZ9A 3TNUB 1IO4A 4GT1A 1S9KD 2FYZA 4H13C 1V0FA 5KAIE 2R44A 3H1HG 2E5YA 1U57A 1NU1D 1OFCX 4I7ZB 1FZBA 1SFCA 4N6JA 5APQA 1KORA 3HD7D 1RF0A 2J58A 1GL2C 1M57D 3HE5B 3ABVC 4EDFA 1IZNB 1EC5A 2KS1A 1KILA 3G6EP 1JY2O 2AEMA 3AE5C 1BGYE 3E1IA 5BVZA 1SQVK 3ITKA 3V2QA 3CCLP 2YKOA 1CI6B 4D6TJ 1S2EA 3V6IA 1PL5A 1VQPP 1LTTC 1OW7A 2OARA 4RESB 2YIUC 4C7NB 2QRXA 2QIWA 1JY2N 1VQ7P 2P10A 1LTAC 3VMYA 3TK1A 4D6TG 3BVHA 1URQA 2Y0CA 1L0LK 5CCHC 1N7SC 3O6QB 2FYUK 1NKNA 5APWA 1VQOP 3P8CD 2FYUD 1L0NK 1RE3A 1IFPA 1M56D 3L36A 1H0TA 4BRYA 3L73J 5CBOA 2N1TC 2PFXA 1M1JC 1RQUA 2KIKA 3A0BE 4C7RA 1SQVE 3KYQA 4F0AB 5KLVD 1LT9C 1K04A 3UIAA 2B87B 3H1ID 4R4LA 2HODA 4H13D 1NJIQ 1DX7A 1IFJA 4EIJA 3BCCJ 1SVFA 3TGUD 3MZWB 1NTZJ 1X22A 1M7LA 3H1LJ 2W8ZA 1KFNA 1GL2A 1FOSE 1GW4A 3IAOA 1GL2D 1WMKA 1YJNP 2QSIA 3H1HE 3L72D 1NTZG 4BWNA 2WQYC 3H1LG 3GF3A 1LTJA 1OMIA 3WU2E 4H0LB 5AW2B 1G2CB 2RKLA 1HWTC 1ZOYC 1VQ6P 5E79E 3H25A 1Q86Q 4OGQC 2RH0A 3S9OA 1EDLA 1KB9I 1HGVA 3D6ZA 3CWBE 4O9BA 1XTCC 2WSCJ 5APTA 3KHUA 5B66H 2WMMA 4N78E 2Q9IA 2HLOA 4AYCA 3NXSA 3N4XA 2A45H 3RBXA 4ASVA 2NPSC 4GIFA 3RK2D 2C0XA 1KQSO 1BDCA 3SWFA 1LTBC 4OVNF 1KYOH 2IBZE 1BSHA 1VQLP 4UB8H 4YTPC 1HF9A 4WY4C 1U7JA 1JY3O 2R5DA 3OA7A 3SWYA 3L75D 2R32A 5TISH 2C0WA 3WUVA 1SQPD 3D70A 1PP9D 3VOPA 3OJAB 4DZOA 1PGPA 2E43A 1NAYA 3EWKA 4IL6E 3L71J 3NMDA 3LIDA 2E75B 1PIXA 1PZQA 1Z56A 1R5LA 2D2CD 2I1KA 2FFDB 3L71G 1LP1B 2HFED 3G4SP 2A45I 2FYNB 3QWOC 2QJYC 2OTJP 1OZHA 2YXRB 2V4HA 3A0HH 3F5HA 1FZCC 2ZYAA 5CMZA 2OYIA 4OGQD 3H1LE 1T8ZA 1VF5C 4H44B 1KTMA 3U59A 1P84D 1PPJD 1QVGO 1JY2P 5B5EE 1NTKG 3RK3B 3M9HA 3GVKA 3RK3E 2HPCA 1NO4A 3HUSB 2E74C 1EQ7A 2WSEH 5CCGC 1NTMK 2JDIH 3SFDC 2W90A 4PV1B 1AA0A 3H1JD 1KD1Q 1RF1A 3S1KA 4WVZA 3G3ZA 2CK3H
chains in the Genus database with same CATH topology
3GW6A 3L75D 1SQVD 3TGUD 2Y0EA 5KLIB 2IBZD 2QJPB 2K9JB 1SQPD 4EDFA 1PP9D 1KB9D 2Y0DA 2KS1A 3L70D 4HIZA 3L73D 1SQBD 2L91A 4PD4D 5KKZB 3L72D 3JU4A 3ITKA 1SQQD 2YIUB 2QJYB 3PRJA 2JWAA 1NTKD 1L0LD 1BCCD 2FYNB 2N9YB 3PTZA 3TDKA 3H1HD 1SQXD 2QJKB 1BGYD 3GVJA 2Q3EA 2O3JA 3BCCD 1L0ND 2QG4A 2Y0CA 2KNCB 1NTZD 3H1KD 3PHLA 3H1LD 1EZVD 1ZRTD 2RMZA 2A06D 3FWLA 3KHUA 3PLNA 2FYUD 2BCCD 1KYOD 3GVLA 1V0EA 3VMAA 4D6TD 3CWBD 1P84D 1NTMD 1PPJD 2RN0A 1BE3D 3L74D 4RJTA 1V0FA 4U3FD 3GG2A 3GVKA 3CX5D 3L71D 5KLVD 1NU1D 3TF5A 3H1JD 3H1ID 5TJHA 3CXHD 4A7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GW6 A;  3L75 D;  1SQV D;  3TGU D;  2Y0E A;  5KLI B;  2IBZ D;  2QJP B;  2K9J B;  1SQP D;  4EDF A;  1PP9 D;  1KB9 D;  2Y0D A;  2KS1 A;  3L70 D;  4HIZ A;  3L73 D;  1SQB D;  2L91 A;  4PD4 D;  5KKZ B;  3L72 D;  3JU4 A;  3ITK A;  1SQQ D;  2YIU B;  2QJY B;  3PRJ A;  2JWA A;  1NTK D;  1L0L D;  1BCC D;  2FYN B;  2N9Y B;  3PTZ A;  3TDK A;  3H1H D;  1SQX D;  2QJK B;  1BGY D;  3GVJ A;  2Q3E A;  2O3J A;  3BCC D;  1L0N D;  2QG4 A;  2Y0C A;  2KNC B;  1NTZ D;  3H1K D;  3PHL A;  3H1L D;  1EZV D;  1ZRT D;  2RMZ A;  2A06 D;  3FWL A;  3KHU A;  3PLN A;  2FYU D;  2BCC D;  1KYO D;  3GVL A;  1V0E A;  3VMA A;  4D6T D;  3CWB D;  1P84 D;  1NTM D;  1PPJ D;  2RN0 A;  1BE3 D;  3L74 D;  4RJT A;  1V0F A;  4U3F D;  3GG2 A;  3GVK A;  3CX5 D;  3L71 D;  5KLV D;  1NU1 D;  3TF5 A;  3H1J D;  3H1I D;  5TJH A;  3CXH D;  4A7P A; 
#chains in the Genus database with same CATH topology
 4HH2 A;  2Y0E A;  3JCU H;  1KV4 A;  3CD6 P;  4WY4 A;  3AEF C;  4M3L A;  1KC8 Q;  4ZKU A;  4WY4 D;  2KYV A;  4K3A A;  1VL2 A;  1LWU C;  2GUV A;  5CBN A;  1YIJ P;  4KHX A;  3Q1M A;  2BEZ F;  2W6J H;  1AFO A;  2N9Y B;  2N9B A;  2M5A B;  3MHV A;  1OX3 A;  1L4A A;  3L4F A;  1GK6 A;  3H1K D;  1OVR A;  4EOT A;  2C9N Y;  2WTY A;  3RBZ A;  3CCS P;  4JF7 A;  2JJL A;  1S5L E;  5AW1 B;  3L71 E;  1R8E A;  3GHG C;  1SP4 A;  3CC2 P;  2JWD A;  2YO3 A;  1DH3 A;  1ZV8 A;  1NWQ A;  3FWN A;  1IJD B;  2L5G B;  3L74 D;  1G1J A;  1VF5 D;  5APU A;  4ZNC A;  4DJG A;  1EXI A;  1P84 I;  4I1L A;  3HTK B;  3P8M C;  2W27 A;  4AQR D;  3CC4 P;  4TT3 H;  2ZT9 B;  4OH8 B;  2W6B A;  1LGH B;  2YO2 A;  2R3S A;  3M06 A;  4JQ0 D;  1BGY J;  1YYC A;  2E74 D;  3B5N B;  5CCG D;  1HGZ A;  2A06 G;  1FDI A;  1SFC C;  2LXC B;  1SQB K;  3C8V A;  3G71 P;  3M0A A;  1NTK E;  1BGY G;  1RF0 C;  3L70 D;  4GDO A;  2KK7 A;  3I55 P;  1SQB D;  3AEE C;  3A5T A;  2M0B A;  1NOH A;  2ZXX A;  1EDI A;  3EFG A;  2WT7 A;  1LWU A;  2KI7 B;  1KIL C;  1KN7 A;  1W2E A;  3CXH I;  5GTI E;  1IK7 A;  1NAF A;  2QJK B;  1QLE D;  1N73 B;  1N86 A;  1JTH A;  2QG4 A;  4UB6 E;  2WSF H;  3KDP B;  4Y99 B;  1ZRT D;  5AVX B;  1LTG C;  1SQX K;  1URQ C;  1GMJ A;  1SQV J;  2WSS H;  3M9Q A;  1X8Y A;  1EXJ A;  1RE4 A;  3TNU A;  2O1K A;  1ZR2 A;  1RE3 C;  5K5G B;  1M90 Q;  3CX5 D;  1HTL C;  1L0L J;  4QMA A;  4GKG A;  1Y9B A;  1K9M Q;  5GTH H;  3H1H J;  2FYU J;  3HE5 A;  1FZE A;  2KSJ A;  1Q82 Q;  1FDO A;  1L0L G;  1L0N J;  5AVZ B;  1NU1 K;  2OQQ A;  4W80 A;  2FYU G;  3MP7 B;  1J1E B;  1SQQ K;  2L91 A;  1L0N G;  1SQX E;  3B4S A;  5KAI H;  1OWA A;  1SFC D;  1SQQ D;  5KKZ C;  3CWB J;  4C7N A;  3CX5 H;  3VTP C;  2KUB A;  1BCC D;  1NKZ B;  2WPV B;  1LTS C;  2J5U A;  2GA1 A;  2A06 E;  1LTJ C;  3H1I G;  3GVJ A;  3CWB G;  1QL1 A;  1KIL D;  1AVO A;  5L8R J;  3O6Q A;  4Y28 J;  1X79 B;  1FAV A;  5KJ7 C;  5AVT B;  2IYO A;  1S9K E;  3LW5 J;  3PJS K;  1PGJ A;  3L72 G;  2K9Y A;  1NU1 E;  2A45 G;  2LR2 A;  1VQ4 P;  2GUS A;  3AE9 C;  1URQ D;  1MUU A;  2G3A A;  1KQL A;  3V2N A;  3HD7 B;  2KXP B;  2IBZ G;  5AW3 B;  4BXL A;  5KAF E;  5DJU B;  3AEA C;  2XV5 A;  2B87 A;  3RK2 C;  1FBM A;  1BDD A;  1SS1 A;  2ZFC A;  3AE2 C;  3CC7 P;  2OYH B;  3IF4 A;  1MKM A;  2ZVN B;  5KLV K;  4HB1 A;  3P7K A;  3M91 A;  2V7Q J;  3GF7 A;  4EI2 A;  1HBW A;  2P67 A;  2PRR A;  1KB9 E;  4PD4 D;  1G2C A;  3A0B H;  4H0L D;  2K9J A;  2AEJ A;  2E42 A;  1FZF A;  3L75 J;  2Z4E A;  1ZP0 C;  3E1R A;  1L0L E;  1NH4 A;  2D2C C;  1GU5 A;  4U3F J;  5AW7 B;  2FYU E;  3L75 G;  2O01 J;  2WPS A;  2K1A A;  1AQT A;  1DD4 A;  2ZXE B;  1L0N E;  3RGU A;  4U3F G;  2Q6Q A;  2R3C A;  1JO5 A;  3RL0 C;  4CPG A;  5DJT B;  4L75 A;  2IDB A;  1HJB A;  2QA4 P;  3Q5S A;  2BCC D;  5KJ7 A;  1KYO D;  2OTL P;  4PD4 H;  3W68 A;  2OYI C;  5KJ7 D;  4D6T D;  5KLV E;  2LXB A;  4H13 B;  4IFM A;  3H1I E;  2SPZ A;  1PV3 A;  1S1C X;  3CCQ P;  1HH0 A;  1EDK A;  1AJY A;  1JCD A;  5AW4 B;  2H7H A;  1EDJ A;  1RH5 B;  3BRV B;  1VQN P;  1GL2 B;  5TJH A;  5APX A;  2Q1K A;  3EQ2 A;  3D6Y A;  2ITA A;  3V4W A;  3L72 E;  3U1C A;  1IFN A;  2MKV A;  1RF1 C;  3FX0 A;  5KLI C;  2QJP C;  3T97 B;  3AE8 C;  2FXM A;  3L73 D;  5AW8 B;  1LT1 A;  2HYN A;  4L74 A;  2YIU B;  1SQP K;  3CCM P;  5CJ0 A;  1NTM J;  4PD4 I;  1IC2 A;  2YMY A;  2NRG A;  2J59 M;  1N8R Q;  1YIT P;  3TDK A;  3EFF K;  5TIS E;  2XDJ A;  3H1J G;  2Q3E A;  2KZJ A;  1FU1 A;  1NTM G;  3BCC D;  1Y47 A;  1N7S B;  4HYT B;  2KNC B;  1NTZ D;  3H1L D;  1EZV D;  2JR8 A;  3QH9 A;  2G8Y A;  3KZI H;  1L4A C;  4IL6 H;  2KP8 A;  1USD A;  2B89 A;  4H44 D;  3FWL A;  2I8D A;  1GU4 A;  3GVL A;  3VN0 A;  1V0E A;  2XKM A;  3VMA A;  2N1T B;  1H8A A;  1YQ4 C;  2IFM A;  4JPZ B;  3Q2Y A;  1M1J B;  3RL0 D;  3NTN A;  3AE1 C;  3G9R A;  1KYO I;  4RKU J;  1LT9 B;  3HUS A;  1GTW A;  3V5B A;  3L75 E;  3PP5 A;  3GG2 A;  1Q90 D;  2ZVO B;  1YBK A;  1PGO A;  3L35 A;  4PV1 D;  1NTK J;  1SQP E;  1PP9 E;  4U3F E;  1HUC A;  4B86 A;  1T3U A;  1DEE G;  1NVO A;  1OXZ A;  1NHL A;  1UIX A;  1VQM P;  5AVR B;  4ASW A;  1GDT A;  2XND H;  1JCC A;  5B5E H;  3CLQ A;  4MN4 C;  1LJ2 A;  3OW2 O;  3CCE P;  1QX8 A;  3ZDM A;  1JMB A;  1S72 P;  3L74 G;  3CPW O;  1KMI Z;  5APS A;  4IL6 X;  4OGQ B;  3AE7 C;  2M5A A;  2OTK E;  5APY A;  1QVF O;  2KSE A;  3AEG C;  1W5C E;  1K73 Q;  2WSC H;  3L70 J;  2ZYD A;  4PJ0 E;  4NPF X;  3KQG A;  1SQB J;  2AXT H;  1P84 E;  1VQ5 P;  1PPJ E;  3W67 A;  2XZR A;  1J1D C;  1K05 A;  2AEF A;  3HRN A;  4DT0 A;  1ZXG A;  3L70 G;  4YPC A;  1J2J B;  1EZV I;  1SQB G;  2JP3 A;  3V4Q A;  2NPS B;  5CHX A;  2E76 C;  1L4A D;  1OIP A;  1HJ0 A;  2YKQ A;  2Z5I A;  4XFJ A;  1WRG A;  3H1J E;  1BE3 D;  4EYY Q;  2OYO A;  1NTM E;  2E5T A;  4C46 A;  1MFZ A;  4I6M C;  1RE4 C;  2O01 N;  2Y9Z A;  1GK4 A;  1VPC A;  4L76 A;  4WY4 B;  2ZT9 D;  3C1L A;  3BAS A;  3TF5 A;  2YMK A;  3B5N A;  3CCV P;  1SQX J;  1DIP A;  2H43 A;  4IFF A;  4I7Z C;  2AXC A;  2P2U A;  5AVU B;  3CXH E;  3LIE A;  1SQX G;  1Q81 Q;  4I2L C;  2CPS A;  3Q3D A;  4RO0 A;  2K37 A;  3AE4 C;  2QJY B;  3PRJ A;  2B88 A;  2O1J A;  1FZC B;  2LKM A;  3Q5P A;  2FY8 A;  1NYH A;  1NU1 J;  2JO1 A;  3OAK A;  1YHQ P;  1VF5 B;  3L74 E;  3E7K A;  1NU1 G;  4YXD C;  2WWW A;  2IPP A;  1SQQ G;  3WMM 0;  4DOJ A;  2E74 B;  4WBA A;  1NGM B;  1BCC G;  2BAS A;  3AE6 C;  4GOF A;  2E76 D;  3HE4 B;  5AW5 B;  4UB6 H;  3FXE A;  1FZA A;  3L70 E;  1A02 J;  1SQB E;  1CZQ A;  3H32 B;  4DCK A;  5AVY B;  3TSI A;  1H88 A;  1BSN A;  1LWU B;  2YNY A;  2KLU A;  3IR9 A;  2H89 C;  3CCR P;  3AEB C;  1UII A;  2QEX P;  4XE5 B;  4Z1M H;  1JTH B;  4JYB A;  4W7Z A;  5AVS B;  5H2F E;  5GTH E;  1ZW0 A;  4TLF A;  1ZRT E;  4H0L C;  1GZL A;  1BGY D;  1OW6 A;  3JC2 2;  1ZME C;  3FGA D;  3N7N A;  5KLV J;  2HG5 D;  1CI6 A;  3H1I J;  1VQ8 P;  5AW6 B;  4YXW H;  3TYY A;  5KLV G;  2P1J A;  3GHG B;  3L37 A;  2BEQ D;  1GD2 E;  3TGU J;  1CW5 A;  3PLN A;  3CX5 E;  2W83 C;  2IX7 C;  2FBW C;  5M1B A;  1USE A;  3R2P A;  1N2D C;  3HD7 A;  1DEB A;  3TGU G;  3VMZ A;  1OVV A;  1YJW P;  1KZU B;  1OW8 A;  3L72 J;  1PGQ A;  2W6A A;  2ZJS E;  4WWI A;  4JBZ A;  4L73 A;  2OYH A;  1JMM A;  2BCC J;  1E5W A;  4R4M A;  2R5B A;  2POH A;  1AVY A;  3U1A A;  3P32 A;  1S3J A;  1SFC B;  1GW3 A;  1KFM A;  1SQV D;  4IFD K;  1SQQ E;  1IFM A;  2P7J A;  1YI2 P;  1N7L A;  1KB9 D;  2BCC G;  4HIZ A;  1BCC E;  2FXO A;  2KS1 B;  5KAF H;  3CX5 I;  1KIL B;  2E75 C;  1KIL E;  4NPE A;  2QVA A;  2JWA A;  3M0D A;  1L0L D;  2QM7 A;  2UWJ E;  5EFW B;  5C39 A;  3H1H D;  2PGD A;  2FFD C;  1A02 F;  1K8A Q;  2VRS A;  1QL2 A;  2FYN C;  2OGU A;  1L0N D;  3C9I A;  2YXQ B;  1URQ B;  4GOD A;  3B8E B;  1KB9 H;  1FS0 E;  3MUD A;  3CI9 A;  3JSV C;  3L73 G;  1IFD A;  1LNQ A;  1VQ9 P;  1SQP J;  1PP9 J;  3I5C A;  3CWB D;  1W2B O;  4H44 C;  3P8C E;  2ZAE B;  1H0T B;  3R4Y A;  4BRY B;  1FOS F;  1SQP G;  4N78 D;  1PP9 G;  2KB7 P;  3WUU A;  3RK3 C;  2H88 C;  2ZYG A;  3BCC G;  3K5B A;  3WU2 H;  3HUS C;  4N3Y B;  1OVU A;  3RL0 g;  2HR3 A;  1ZR4 A;  1EZV G;  2JEE A;  4PV1 C;  2WSE J;  4PD4 E;  3SFE C;  2HOD B;  5E79 H;  1KQG B;  2IBZ D;  1MFT A;  5CJ4 A;  2K9J B;  1YQ3 C;  3T97 A;  2K3R A;  3TGU E;  2Y0D A;  2M3E A;  2I1J A;  1R5S A;  5KKZ B;  5B66 E;  3IN6 A;  2WVR A;  3I56 P;  2WIT A;  1X9V A;  3FXD A;  1SLQ A;  3A2A A;  2C9L Y;  1LTJ B;  2Q5U A;  2XNX A;  5CCH A;  2IZ1 A;  5CCH D;  3MTU E;  1N7S A;  2E75 D;  1N7S D;  4LC1 A;  2KNC A;  1PPJ G;  5AW9 B;  2BCC E;  2IFN A;  1KYO E;  3USS A;  4KT0 J;  4D6T E;  2FFD A;  4UB8 E;  1LP1 A;  2IYP A;  3H1J J;  3LW5 H;  3AE3 C;  2Y9Y A;  2RMZ A;  1JM0 A;  3VMX A;  2N1T A;  2N1T D;  1M1J A;  1NTZ K;  3SSU A;  1E79 H;  1LT9 A;  3SWK A;  1VQK P;  4LLH A;  1X0T A;  1FE6 A;  4RJT A;  3CMA P;  2KOG A;  4U3F D;  3RK2 B;  4K35 A;  3GMA A;  3B71 A;  3KZI E;  1JY3 N;  4IOI H;  3M9B A;  4HKZ H;  3CME P;  3L73 E;  2KZI A;  4A7P A;  2QE7 H;  2ZT9 C;  2V7Q H;  3RK3 D;  1FJK A;  5BU5 A;  1WT6 A;  3A0H E;  1H89 A;  3H1K J;  1BE3 J;  3B5N C;  5AW0 B;  2FXP A;  3II6 A;  2IBZ I;  2Z5H A;  4KJM A;  2PP6 A;  1M8O B;  1RY3 A;  3H1K G;  1D7M A;  1BE3 G;  2Q3I A;  3BCC E;  1G1I A;  3VP9 A;  3WUT A;  1NTZ E;  2D2C B;  3CL3 D;  2NZ2 A;  1EZV E;  3PTZ A;  2P58 A;  3L74 J;  2O01 H;  3BRT B;  5AVW B;  1IFI A;  2CPB A;  2K88 A;  1JUN A;  2QJK C;  2DW3 A;  3RL0 B;  1N73 C;  1RHZ B;  1T2K C;  3VYI A;  2OYI B;  1Y8A A;  4Y99 C;  2WSF J;  2NPS A;  2NPS D;  3JCU E;  3V2P A;  2PAJ A;  1NTM D;  1L2P A;  3KPE A;  2RN0 A;  1FC2 C;  1TU3 F;  2YKP A;  5BU8 B;  1DD3 A;  3L71 D;  2AXT E;  4PJ0 H;  2HPC B;  1P84 H;  1YTZ I;  3NFQ A;  1JEK A;  5AVV B;  3CXH D;  1RF1 B;  2B9B A;  3HTK A;  5KLI B;  2QJP B;  1AV1 A;  2QM8 A;  3F89 A;  1Q2N A;  3AED C;  1YJ9 P;  1KQF B;  4OWF A;  3JU4 A;  3Q5R A;  1NTK K;  1J1E C;  3B5N D;  3KXD A;  3A3Y B;  3H6P A;  2H8P D;  1S5L H;  1NTK D;  1Q7Y Q;  1FZC A;  1PFI A;  3PH0 A;  1T6A A;  1FDM A;  3CXH H;  1FJP A;  1L4A B;  3PHL A;  1QEX A;  3MGN A;  3VP8 A;  1IK9 A;  3H1K E;  3CCU P;  3A7O A;  1BE3 E;  1S4X A;  5APV A;  1N73 A;  4GOE A;  2KLV A;  4LGD E;  1CSB A;  2WPQ A;  1T2K D;  5CCG A;  1T3J A;  3MD0 A;  4ZKP A;  3HE4 A;  1ZN5 A;  1HVV A;  1SQQ J;  1YTZ T;  3HD7 C;  4WB4 A;  4ZMD A;  4U7J A;  1MV8 A;  2Q7C A;  1BCC J;  2FKW B;  3H32 A;  3CCJ P;  3GW6 A;  1S5L X;  5GTI H;  3AEC C;  1JB0 J;  1JOC A;  2JKV A;  2OYH C;  1VDF A;  3GLM A;  3BAT A;  3IFM A;  5KTB A;  1AQ5 A;  5AVQ B;  2GM4 A;  1JY3 P;  2WZ7 A;  1FZG A;  2M8R A;  3O8Z A;  3MIW A;  2IZ0 A;  2MJZ A;  3V2R A;  1LTI C;  2WT7 B;  1RQV A;  1SQX D;  4HJG H;  1U7M A;  1ZLL A;  2M3B A;  1XTG B;  1M1K Q;  2O3J A;  3M0D C;  4XA4 A;  1J1D B;  4AUW A;  1SQV G;  4NPD A;  3GHG A;  1JNM A;  2A06 D;  2WPR A;  3S4R A;  2E76 B;  2XU6 A;  4W7Y A;  4JYC A;  5H2F H;  3MUD C;  3D71 A;  1QGK B;  1MZ9 A;  3TNU B;  1IO4 A;  4GT1 A;  1S9K D;  2FYZ A;  4H13 C;  1V0F A;  5KAI E;  2R44 A;  3H1H G;  2E5Y A;  1U57 A;  1NU1 D;  1OFC X;  4I7Z B;  1FZB A;  1SFC A;  4N6J A;  5APQ A;  1KOR A;  3HD7 D;  1RF0 A;  2J58 A;  1GL2 C;  1M57 D;  3HE5 B;  3ABV C;  4EDF A;  1IZN B;  1EC5 A;  2KS1 A;  1KIL A;  3G6E P;  1JY2 O;  2AEM A;  3AE5 C;  1BGY E;  3E1I A;  5BVZ A;  1SQV K;  3ITK A;  3V2Q A;  3CCL P;  2YKO A;  1CI6 B;  4D6T J;  1S2E A;  3V6I A;  1PL5 A;  1VQP P;  1LTT C;  1OW7 A;  2OAR A;  4RES B;  2YIU C;  4C7N B;  2QRX A;  2QIW A;  1JY2 N;  1VQ7 P;  2P10 A;  1LTA C;  3VMY A;  3TK1 A;  4D6T G;  3BVH A;  1URQ A;  2Y0C A;  1L0L K;  5CCH C;  1N7S C;  3O6Q B;  2FYU K;  1NKN A;  5APW A;  1VQO P;  3P8C D;  2FYU D;  1L0N K;  1RE3 A;  1IFP A;  1M56 D;  3L36 A;  1H0T A;  4BRY A;  3L73 J;  5CBO A;  2N1T C;  2PFX A;  1M1J C;  1RQU A;  2KIK A;  3A0B E;  4C7R A;  1SQV E;  3KYQ A;  4F0A B;  5KLV D;  1LT9 C;  1K04 A;  3UIA A;  2B87 B;  3H1I D;  4R4L A;  2HOD A;  4H13 D;  1NJI Q;  1DX7 A;  1IFJ A;  4EIJ A;  3BCC J;  1SVF A;  3TGU D;  3MZW B;  1NTZ J;  1X22 A;  1M7L A;  3H1L J;  2W8Z A;  1KFN A;  1GL2 A;  1FOS E;  1GW4 A;  3IAO A;  1GL2 D;  1WMK A;  1YJN P;  2QSI A;  3H1H E;  3L72 D;  1NTZ G;  4BWN A;  2WQY C;  3H1L G;  3GF3 A;  1LTJ A;  1OMI A;  3WU2 E;  4H0L B;  5AW2 B;  1G2C B;  2RKL A;  1HWT C;  1ZOY C;  1VQ6 P;  5E79 E;  3H25 A;  1Q86 Q;  4OGQ C;  2RH0 A;  3S9O A;  1EDL A;  1KB9 I;  1HGV A;  3D6Z A;  3CWB E;  4O9B A;  1XTC C;  2WSC J;  5APT A;  3KHU A;  5B66 H;  2WMM A;  4N78 E;  2Q9I A;  2HLO A;  4AYC A;  3NXS A;  3N4X A;  2A45 H;  3RBX A;  4ASV A;  2NPS C;  4GIF A;  3RK2 D;  2C0X A;  1KQS O;  1BDC A;  3SWF A;  1LTB C;  4OVN F;  1KYO H;  2IBZ E;  1BSH A;  1VQL P;  4UB8 H;  4YTP C;  1HF9 A;  4WY4 C;  1U7J A;  1JY3 O;  2R5D A;  3OA7 A;  3SWY A;  3L75 D;  2R32 A;  5TIS H;  2C0W A;  3WUV A;  1SQP D;  3D70 A;  1PP9 D;  3VOP A;  3OJA B;  4DZO A;  1PGP A;  2E43 A;  1NAY A;  3EWK A;  4IL6 E;  3L71 J;  3NMD A;  3LID A;  2E75 B;  1PIX A;  1PZQ A;  1Z56 A;  1R5L A;  2D2C D;  2I1K A;  2FFD B;  3L71 G;  1LP1 B;  2HFE D;  3G4S P;  2A45 I;  2FYN B;  3QWO C;  2QJY C;  2OTJ P;  1OZH A;  2YXR B;  2V4H A;  3A0H H;  3F5H A;  1FZC C;  2ZYA A;  5CMZ A;  2OYI A;  4OGQ D;  3H1L E;  1T8Z A;  1VF5 C;  4H44 B;  1KTM A;  3U59 A;  1P84 D;  1PPJ D;  1QVG O;  1JY2 P;  5B5E E;  1NTK G;  3RK3 B;  3M9H A;  3GVK A;  3RK3 E;  2HPC A;  1NO4 A;  3HUS B;  2E74 C;  1EQ7 A;  2WSE H;  5CCG C;  1NTM K;  2JDI H;  3SFD C;  2W90 A;  4PV1 B;  1AA0 A;  3H1J D;  1KD1 Q;  1RF1 A;  3S1K A;  4WVZ A;  3G3Z A;  2CK3 H; 
#chains in the Genus database with same CATH homology
 3GW6 A;  3L75 D;  1SQV D;  3TGU D;  2Y0E A;  5KLI B;  2IBZ D;  2QJP B;  2K9J B;  1SQP D;  4EDF A;  1PP9 D;  1KB9 D;  2Y0D A;  2KS1 A;  3L70 D;  4HIZ A;  3L73 D;  1SQB D;  2L91 A;  4PD4 D;  5KKZ B;  3L72 D;  3JU4 A;  3ITK A;  1SQQ D;  2YIU B;  2QJY B;  3PRJ A;  2JWA A;  1NTK D;  1L0L D;  1BCC D;  2FYN B;  2N9Y B;  3PTZ A;  3TDK A;  3H1H D;  1SQX D;  2QJK B;  1BGY D;  3GVJ A;  2Q3E A;  2O3J A;  3BCC D;  1L0N D;  2QG4 A;  2Y0C A;  2KNC B;  1NTZ D;  3H1K D;  3PHL A;  3H1L D;  1EZV D;  1ZRT D;  2RMZ A;  2A06 D;  3FWL A;  3KHU A;  3PLN A;  2FYU D;  2BCC D;  1KYO D;  3GVL A;  1V0E A;  3VMA A;  4D6T D;  3CWB D;  1P84 D;  1NTM D;  1PPJ D;  2RN0 A;  1BE3 D;  3L74 D;  4RJT A;  1V0F A;  4U3F D;  3GG2 A;  3GVK A;  3CX5 D;  3L71 D;  5KLV D;  1NU1 D;  3TF5 A;  3H1J D;  3H1I D;  5TJH A;  3CXH D;  4A7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...