3GW6A

Intramolecular chaperone
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
264
structure length
256
Chain Sequence
HVTIRIRSEVLMEGEYGFIGKSIPTDNPAGQRIIFCGGEGTSSTTGAQITLYGANNTDSRRIVYNGDEHLFQSADVKPYNDNVTALGGPSNRFTTAYLGSNPIVTANGERKTEPVVFDDAFLDAWGDVHYIMYQWLDAVQLKGNDARIHFGVIAQQIRDVFIAHGLMDENSCRYAVLCYDKYPRMTDTVFSHNEIVEHTDEEGNVTTTEEPVYTEVVIHEEGEEWGVRPDGIFFAEAAYQRRKLERIEARLSALEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of an intramolecular chaperone mediating triple-beta-helix folding.
pubmed doi rcsb
source organism Enterobacteria phage k1f
molecule tags Chaperone
molecule keywords Endo-N-acetylneuraminidase
total genus 41
structure length 256
sequence length 264
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.129: Endo-alpha-sialidase.
pdb deposition date 2009-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13884 Peptidase_S74 Chaperone of endosialidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3gw6A04
1.20.5.1240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Endo-n-acetylneuraminidase 3gw6A02
3.30.2460.10 Alpha Beta 2-Layer Sandwich Endo-n-acetylneuraminidase fold Endo-n-acetylneuraminidase domain 3gw6A03
4.10.1090.10 Few Secondary Structures Irregular Endosialidase, domain 4 Endosialidase, domain 4 3gw6A01
3H1HD 1SQVD 4PD4D 1KB9D 2KNCB 3PTZA 3GVKA 5KLVD 1BGYD 1PP9D 2RMZA 1EZVD 3L72D 3GVLA 3GG2A 2Y0DA 2K9JB 2QJKB 1L0LD 1PPJD 3CXHD 1V0FA 3GW6A 3VMAA 3TGUD 2QJYB 3CX5D 2Y0CA 3L75D 1P84D 1L0ND 4HIZA 2A06D 2BCCD 1NTMD 1NTKD 3H1JD 1NU1D 2FYNB 3H1ID 3CWBD 3H1LD 2KS1A 3TDKA 3JU4A 4U3FD 1NTZD 3L71D 2IBZD 2QJPB 3L74D 3L70D 3GVJA 3L73D 2FYUD 1ZRTD 3TF5A 2L91A 2Q3EA 2RN0A 1V0EA 2YIUB 4RJTA 2N9YB 1BCCD 1SQXD 3PLNA 3PHLA 4A7PA 3H1KD 3ITKA 1KYOD 3FWLA 1BE3D 5KKZB 5KLIB 2Y0EA 3BCCD 3PRJA 1SQBD 5TJHA 3KHUA 2JWAA 1SQQD 2O3JA 1SQPD 2QG4A 4EDFA 4D6TD
chains in the Genus database with same CATH superfamily
1OVRA 4IOIH 1EDIA 2KLVA 1SQQK 1N73B 3N4XA 5B5EE 3L71G 1M56D 3FXEA 2P10A 1RQVA 3TGUJ 2R3SA 4N78D 1NKNA 4CPGA 2R44A 3GVKA 1SQPJ 2PGDA 1PP9E 1NTMG 2I1JA 3EFGA 2ZVOB 5CBOA 1T2KC 1JEKA 1NHLA 5AVWB 1Q81Q 1FBMA 2YIUC 2K9YA 2Z5IA 3L72D 1IJDB 2I1KA 1YTZT 2KXPB 1GL2A 3BCCG 1N7SA 1QX8A 1KILE 3H1IG 1RF1C 2FY8A 1BSHA 2OYHB 2JR8A 3RK3D 1L0NG 2AEMA 4R4MA 3B71A 1QL1A 3A2AA 1LTTC 4KHXA 3V2QA 3BCCJ 2WT7B 3BASA 3CXHD 4H13B 4H44B 2SPZA 5APTA 2OGUA 1PPJE 3HTKB 3LW5J 5GTIE 3CCSP 1PIXA 4I1LA 1Q2NA 5CCGC 1BGYJ 1SQVG 3R4YA 5APVA 4EYYQ 2ZT9C 3VMAA 1Z56A 1RE4A 3AE6C 3TGUD 1FE6A 1YIJP 3HTKA 5APUA 4ZNCA 3CX5D 4W7YA 2ZXEB 3I5CA 1DD3A 1KYOI 3SSUA 3V2NA 3WU2H 4EOTA 2HPCA 2IYPA 2AXTE 2QVAA 2WSEJ 1T3JA 1N7LA 2O1KA 4XA4A 2Q3IA 3H32B 1G2CA 1PL5A 1DIPA 4HIZA 4PD4H 1L0LE 5APWA 2WPQA 5C39A 2P7JA 3VMXA 2FYUK 3U59A 2M5AA 1UIXA 2YMKA 1URQA 1M90Q 2CK3H 1SFCD 3CC2P 1NTMD 2E75C 3CI9A 4D6TE 4BXLA 1QVFO 2HODA 1G1JA 5KAIE 4U7JA 3CWBG 2JKVA 2K9JA 1S5LE 3B5NC 3I56P 1MUUA 1VPCA 1URQB 1X22A 4I6MC 4JBZA 1KD1Q 3AEDC 3H1ID 2G8YA 4UB8H 3CWBD 3RL0g 3T97B 5CCHD 2AXCA 3VP9A 2CPSA 5KKZC 1Q7YQ 2V4HA 3CWBJ 3GLMA 2ZXXA 2XZRA 2Q6QA 4LLHA 4N6JA 3HUSB 2W8ZA 3TDKA 1IO4A 1YQ3C 3M0DA 2Y9YA 2NZ2A 4OGQC 1GW3A 2H88C 1USDA 1AVOA 1KQFB 3U1AA 1L0NK 1AA0A 2QM8A 2IBZD 4OH8B 1JM0A 2Q7CA 3KDPB 4DZOA 1SQPK 5KAIH 1KQGB 2JJLA 1JTHA 3GVJA 3L73D 1FS0E 1HVVA 3M0AA 2D2CB 3PH0A 3G3ZA 1ZRTD 3GHGB 4UB8E 4W7ZA 3TGUE 3CCMP 4ASVA 2R5DA 1M1JA 4IFMA 3RBXA 1SS1A 2JEEA 2HYNA 2LXBA 1BCCJ 2YIUB 1ZR4A 1AQTA 1U7MA 1BCCD 2WPVB 3L74J 3PLNA 3H32A 2LXCB 2AEFA 3VP8A 1IC2A 2WWWA 1SFCA 3L71E 2K1AA 1H0TB 1BCCG 1SQBK 3CC7P 2WSEH 2R5BA 1SQPG 3L74G 3ITKA 1NTMJ 1JNMA 2ZYDA 1KILC 2NRGA 3AE3C 4PJ0E 1JY3P 2W90A 5L8RJ 3M0DC 1OW8A 5CHXA 3H25A 2KLUA 1N7SC 1RF1A 1CI6B 1GMJA 2KK7A 2M3EA 3H1IJ 3SWKA 1IFPA 2KZIA 2E74D 1VQ6P 1N73A 1DX7A 1X79B 3MGNA 3CCLP 2OYHC 2N9BA 4ZMDA 5APQA 5B66H 5AVUB 2N1TA 2C9NY 1J1DB 2IYOA 1JMMA 2E5YA 3RK2D 1M1KQ 3CPWO 3H1KE 1L0LK 4K3AA 4H13D 4H44D 1RHZB 1URQC 1XTCC 2IX7C 1L0LJ 2O01H 2QIWA 4PJ0H 1DEBA 4Z1MH 2KIKA 3MIWA 1HGVA 1PFIA 1H89A 2KZJA 4D6TD 3IN6A 3HE5A 3O6QB 3A3YB 3P32A 1RQUA 4IL6H 2YO2A 3I55P 1ZXGA 1T3UA 1KV4A 1KQLA 1EC5A 1L4AD 1T8ZA 3EWKA 2KNCB 3BATA 2A45G 4GODA 1YYCA 5AVZB 1ZLLA 2QJPC 2Q9IA 3F89A 5AW2B 5K5GB 4U3FG 3AEFC 2W6BA 1BGYE 4ASWA 1LT9A 1HH0A 1NU1E 4N3YB 1N7SD 3P8MC 2RMZA 3UIAA 1HF9A 2GM4A 1AVYA 1PZQA 3OJAB 1NOHA 3RGUA 3VMYA 1KQSO 1N73C 1R5SA 5CCHA 3GVLA 1H0TA 3CCVP 2HODB 2Y0DA 1Y47A 2W27A 3RK3E 2WITA 2J5UA 2WPRA 2OYIA 5CJ0A 1VQ7P 2QJKB 1FU1A 1LP1A 2OYIC 3S1KA 1PPJD 3T97A 3ZDMA 3L37A 3AE7C 2K3RA 1NAFA 1SQBG 1D7MA 2QRXA 3E1RA 2WSFH 3HD7B 1MFZA 1S9KE 1DEEG 1PP9J 2QEXP 2NPSD 3AE9C 1KILB 4XE5B 3IAOA 3KYQA 1SQBJ 2KSEA 3CX5E 1EZVE 2QJYB 3L72G 2PAJA 2N1TB 2H8PD 2HG5D 2NPSA 1ZOYC 3AEBC 3L75D 1KFMA 1VDFA 3H1IE 3USSA 5KLVG 1P84D 1BDCA 1JTHB 4WBAA 2IPPA 3D6YA 1L0NE 1WRGA 1NH4A 1LTBC 3V6IA 3JCUH 2D2CD 2KYVA 1AJYA 3HD7C 4YTPC 1LTJC 1OXZA 3O6QA 1OW7A 3KPEA 2V7QH 2MJZA 3V4QA 1GD2E 2B87A 1K05A 1PGJA 2FXOA 2WZ7A 1NTKD 1RH5B 5AVYB 2J58A 4B86A 4KT0J 2N1TC 1E5WA 1R5LA 3H1JD 1NU1D 2KSJA 2N1TD 2P2UA 3GF7A 2B88A 4M3LA 2FYNB 4H13C 4H44C 1BSNA 1LTIC 1KMIZ 3H1JG 4LGDE 1Q82Q 2E43A 1KN7A 5KAFE 5AW7B 3MD0A 3SFDC 3H1LD 4NPFX 2E74B 2KS1A 1KORA 2WSSH 1P84H 1BCCE 1NTZD 1HWTC 4PD4I 2M5AB 2KP8A 3RL0B 3KZIE 3LIEA 4IFDK 3L71D 1GW4A 1K73Q 5AW1B 1SFCB 1SLQA 2WQYC 2IBZE 4L74A 1VQ8P 3U1CA 1P84I 1U57A 2E75B 4D6TG 3Q3DA 1L0LG 3PJSK 1CSBA 2YMYA 1KB9I 4HH2A 2QA4P 3OAKA 3CWBE 2C0XA 4MN4C 1JMBA 1SQXK 2HR3A 1NU1J 2MKVA 2PP6A 3EFFK 2KUBA 4HJGH 4TT3H 1P84E 1W2EA 2ZFCA 3AEEC 4PV1D 1PGPA 4YPCA 3W68A 1L4AB 4PV1C 1VQ4P 1M57D 3KZIH 1OX3A 1NO4A 1FZFA 1IK7A 3SFEC 2E76B 3PHLA 3L35A 3A7OA 1YJWP 3H1KD 3P8CE 4ZKPA 2O01J 4JF7A 2OARA 5H2FE 1NTKK 1YBKA 3FWLA 1BE3D 1PGQA 3L73G 3LW5H 1J1EB 3RL0D 1DH3A 3CCQP 1VQ9P 2FYUE 2W83C 3TGUG 2O01N 3EQ2A 1FAVA 4OGQB 2FFDC 1IFJA 1JB0J 3H1JE 3H6PA 4AUWA 1MV8A 2L5GB 4WY4A 1YTZI 2RH0A 3H1HG 3W67A 1OVUA 2WPSA 1RE3A 1NVOA 1SQBD 5TJHA 1RF0C 1LTAC 1PGOA 1S5LX 3HE4A 1E79H 1ZV8A 2QSIA 1GK4A 4K35A 5GTIH 1LT9C 2GUSA 2IFNA 3AEAC 3C9IA 1MKMA 3H1HJ 3E1IA 1SQQD 4L75A 2O3JA 2WSCH 5AVTB 1LT9B 5AVXB 4BRYA 2A06E 2RKLA 1SQPD 1TU3F 1QL2A 2XU6A 2E76D 2KI7B 5CJ4A 1ZP0C 3OA7A 3L72J 4JPZB 4C7NA 5AVVB 4OGQD 1SQVJ 4ZKUA 1J1DC 2QJYC 1S4XA 1LTGC 1SQVD 2BCCJ 4GOEA 3N7NA 4PD4E 5KJ7C 2E42A 2E5TA 1EZVI 1KB9D 1WT6A 2Q1KA 3RL0C 3A5TA 2ZT9D 1S9KD 2B9BA 3D71A 2BASA 2BCCG 1EZVG 1VF5C 3IR9A 1GDTA 2YNYA 1NKZB 4YXDC 2ZYAA 1RE4C 4XFJA 1BGYD 5AW3B 2Y9ZA 3H1KG 2LR2A 5KTBA 1JCDA 1RF0A 1EZVD 3TK1A 5KLVE 2OTKE 1S5LH 5B5EH 2WTYA 3L75E 3GG2A 3MTUE 4NPDA 3H1KJ 1GK6A 3MP7B 4TLFA 4Y28J 2YXQB 4OWFA 1Q90D 2ZAEB 3H1HE 3CXHI 1J2JB 1QEXA 1SQXJ 1FZEA 2XKMA 3IFMA 1HTLC 2PRRA 1NGMB 2KNCA 1VQNP 2JO1A 2V7QJ 1HBWA 1V0FA 4C46A 1OMIA 2E76C 4HB1A 4WY4B 2WVRA 3A0HE 5AVQB 1KB9H 1NTKE 2UWJE 3HE4B 1JY3O 1ZRTE 2JDIH 3D6ZA 2FYUJ 3AE8C 3F5HA 3JSVC 2E74C 1M1JC 3VYIA 1VQ5P 4WWIA 3Q5SA 1H88A 4WB4A 3QWOC 1JY3N 1L0ND 4JYBA 3AE4C 3L70G 4D6TJ 2WSCJ 3BVHA 2IZ0A 1FZAA 3NXSA 1YQ4C 3B8EB 1N86A 1ZN5A 1NTZE 2ITAA 3CL3D 2XNDH 3S4RA 3L70J 2BCCD 1KB9E 3M06A 2WSFJ 3CMEP 1OFCX 1WMKA 2IBZI 1SQBE 2C0WA 2XNXA 3AECC 3L74E 5APSA 3MZWB 2Q5UA 1NAYA 1ZW0A 2XDJA 2C9LY 2OYIB 2NPSB 2BEQD 3L73J 3RK2C 1L4AC 4PV1B 3H1LJ 3V2PA 1RE3C 5DJTB 3M9BA 2DW3A 1IFNA 3M91A 4HYTB 3SWFA 1SQQJ 1SQVK 2IFMA 3AE1C 1FZCB 3CC4P 2M3BA 3QH9A 3G4SP 3JU4A 1KZUB 3NTNA 5B66E 2LKMA 1GZLA 1SQQG 1LT1A 4U3FJ 1K9MQ 1JO5A 4JQ0D 5APYA 1LGHB 2QJPB 3MUDA 4GT1A 2OTJP 2CPBA 1OVVA 1BE3E 3KXDA 1NWQA 3L70D 4BWNA 2Z4EA 1AQ5A 5KLIC 2FYUD 2YKQA 3PP5A 2FXPA 3WU2E 2D2CC 3TF5A 1HGZA 1NU1K 1NTMK 1PV3A 2AXTH 1N2DC 1GTWA 2Q3EA 1FZCC 1L0NJ 2KS1B 1VQKP 1V0EA 2HPCB 2M0BA 4DJGA 4JYCA 4RJTA 3G9RA 5BU8B 1HJ0A 1LWUA 2A06G 2ZT9B 1XTGB 1QLED 2H89C 1G2CB 1BGYG 3II6A 3P8CD 5CCGA 3K5BA 1YHQP 3CCUP 1KC8Q 3G71P 1KYOD 4UB6E 5CMZA 1YJNP 4RESB 1QGKB 1IZNB 3L75J 5KLIB 2H43A 1G1IA 2IBZG 2Y0EA 2FYNC 2YO3A 2Z5HA 3PRJA 3A0BE 2ZVNB 4GOFA 1GL2C 2YXRB 2POHA 3L75G 2R32A 4KJMA 1CW5A 2JWDA 1L4AA 3CMAP 4R4LA 5AW8B 1SVFA 1NTZK 4YXWH 1LTJB 3NFQA 1NYHA 3FGAD 1M8OB 2M8RA 3M9HA 4IFFA 1LJ2A 4W80A 5E79E 1N8RQ 1FOSF 4UB6H 2KOGA 1BE3G 3L72E 4AQRD 2P58A 3R2PA 2QG4A 1NTKG 1LTJA 1IK9A 2FYUG 2I8DA 2R3CA 3BCCE 3JC22 2PFXA 3A0BH 1QVGO 3TNUB 1EQ7A 3H1HD 4Y99B 3V4WA 1ZR2A 1K8AQ 1SQVE 1Y8AA 2FKWB 4PD4D 3TYYA 3V5BA 1KTMA 2IZ1A 2GA1A 3PTZA 2NPSC 1R8EA 3NMDA 4I2LC 5E79H 1VQOP 2VRSA 1NTZG 5KLVD 1PP9D 4GIFA 1LWUB 5AVRB 1SQPE 4L73A 3L4FA 3BRVB 5AW9B 4GDOA 1IFMA 3HUSC 5CBNA 1L2PA 1GU4A 4AYCA 1FDOA 1KILD 1Y9BA 3M9QA 4IL6X 3H1LE 4WY4C 1NJIQ 1VL2A 3VOPA 4EIJA 1EDJA 1UIIA 2FFDA 3WUVA 2K9JB 1FJPA 3L70E 1S2EA 3VMZA 3Q2YA 1L0LD 3B5NB 1YI2P 1KILA 4WVZA 1A02J 4H0LD 4BRYB 4H0LC 1JY2N 2H7HA 5CCHC 1A02F 2FFDB 4N78E 2BCCE 3KQGA 1URQD 3HUSA 1JY2P 3LIDA 1NTME 3P7KA 1ZMEC 1Q86Q 3GW6A 3MHVA 3RK2B 3ABVC 3CCRP 1IFIA 1LWUC 1K04A 2O1JA 4LC1A 1JOCA 4I7ZC 2IDBA 1T6AA 2WMMA 5BVZA 2Y0CA 5KJ7D 1N7SB 1OW6A 4I7ZB 1HJBA 1MZ9A 2OYOA 2FYZA 3IF4A 1OWAA 5APXA 3CCJP 3CD6P 4O9BA 1LTSC 2BEZF 3L71J 2B87B 3AE2C 1SQXE 1VF5B 1JCCA 1SP4A 1SQQE 4IL6E 3WMM0 4GKGA 2A06D 1U7JA 5AW5B 1FOSE 4H0LB 1LNQA 2FXMA 2KB7P 1M1JB 3HE5B 4HKZH 5M1BA 3V2RA 4WY4D 2ZJSE 5CCGD 4DT0A 1PPJG 2A45I 2GUVA 5H2FH 5KLVK 2OYHA 4RKUJ 3L73E 5DJUB 3SWYA 3E7KA 3FX0A 3C1LA 3WUUA 4DOJA 2W6JH 3BRTB 2WT7A 1EDLA 5AW0B 1RY3A 3RK3C 5TISE 4U3FD 3CX5I 1CI6A 3GMAA 3RK3B 3GHGC 3S9OA 1FZBA 3B5ND 1S3JA 1EDKA 1LP1B 1JUNA 1HUCA 1GL2D 1MFTA 1VQMP 4C7NB 5AW4B 3HD7A 1KYOH 1SFCC 1VF5D 2HFED 3FWNA 3L74D 1OZHA 3CX5H 1FDIA 5EFWB 3AEGC 5AVSB 2B89A 2W6AA 1BE3J 3HRNA 1W2BO 1FDMA 1S1CX 2OTLP 3RBZA 4F0AB 2G3AA 1NTKJ 1RF1B 4OVNF 1FZGA 2L91A 3VTPC 4NPEA 1SQXG 5TISH 2RN0A 1YJ9P 1FZCA 3TNUA 3JCUE 2J59M 2N9YB 1S72P 1SQXD 2XV5A 2P1JA 5GTHE 3CLQA 1DD4A 2A45H 4Y99C 3H1JJ 3TSIA 1FJKA 1PP9G 2QM7A 1GL2B 1X0TA 1M7LA 3VN0A 4A7PA 1KYOE 3Q5PA 4QMAA 2QE7H 2YKOA 3MUDC 1AV1A 1JY2O 1VQPP 1NTZJ 2HLOA 5KKZB 1EXJA 1VQLP 1BDDA 2ZYGA 2K37A 3GHGA 3CCEP 3BCCD 1X8YA 3GF3A 3O8ZA 5KLVJ 1YITP 2JP3A 2AEJA 2P67A 3CXHE 5AW6B 3C8VA 3OW2O 1T2KD 1GU5A 1AFOA 3D70A 5KAFH 1W5CE 1FC2C 4RO0A 3Q1MA 2YKPA 1USEA 2JWAA 2E75D 3KHUA 1KFNA 5GTHH 4C7RA 2OQQA 3A0HH 1X9VA 3B5NA 1CZQA 3FXDA 4U3FE 3G6EP 3AE5C 1NU1G 1OIPA 3B4SA 3HD7D 3WUTA 1IFDA 4EI2A 4DCKA 3Q5RA 1H8AA 1J1EC 4L76A 2QJKC 5BU5A 1EXIA 4EDFA 5KJ7A 2FBWC 3H1LG 3L36A 2K88A 3CXHH
chains in the Genus database with same CATH topology
3H1HD 1SQVD 4PD4D 1KB9D 2KNCB 3PTZA 3GVKA 5KLVD 1BGYD 1PP9D 2RMZA 1EZVD 3L72D 3GVLA 3GG2A 2Y0DA 2K9JB 2QJKB 1L0LD 1PPJD 3CXHD 1V0FA 3GW6A 3VMAA 3TGUD 2QJYB 3CX5D 2Y0CA 3L75D 1P84D 1L0ND 4HIZA 2A06D 2BCCD 1NTMD 1NTKD 3H1JD 1NU1D 2FYNB 3H1ID 3CWBD 3H1LD 2KS1A 3TDKA 3JU4A 4U3FD 1NTZD 3L71D 2IBZD 2QJPB 3L74D 3L70D 3GVJA 3L73D 2FYUD 1ZRTD 3TF5A 2L91A 2Q3EA 2RN0A 1V0EA 2YIUB 4RJTA 2N9YB 1BCCD 1SQXD 3PLNA 3PHLA 4A7PA 3H1KD 3ITKA 1KYOD 3FWLA 1BE3D 5KKZB 5KLIB 2Y0EA 3BCCD 3PRJA 1SQBD 5TJHA 3KHUA 2JWAA 1SQQD 2O3JA 1SQPD 2QG4A 4EDFA 4D6TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H D;  1SQV D;  4PD4 D;  1KB9 D;  2KNC B;  3PTZ A;  3GVK A;  5KLV D;  1BGY D;  1PP9 D;  2RMZ A;  1EZV D;  3L72 D;  3GVL A;  3GG2 A;  2Y0D A;  2K9J B;  2QJK B;  1L0L D;  1PPJ D;  3CXH D;  1V0F A;  3GW6 A;  3VMA A;  3TGU D;  2QJY B;  3CX5 D;  2Y0C A;  3L75 D;  1P84 D;  1L0N D;  4HIZ A;  2A06 D;  2BCC D;  1NTM D;  1NTK D;  3H1J D;  1NU1 D;  2FYN B;  3H1I D;  3CWB D;  3H1L D;  2KS1 A;  3TDK A;  3JU4 A;  4U3F D;  1NTZ D;  3L71 D;  2IBZ D;  2QJP B;  3L74 D;  3L70 D;  3GVJ A;  3L73 D;  2FYU D;  1ZRT D;  3TF5 A;  2L91 A;  2Q3E A;  2RN0 A;  1V0E A;  2YIU B;  4RJT A;  2N9Y B;  1BCC D;  1SQX D;  3PLN A;  3PHL A;  4A7P A;  3H1K D;  3ITK A;  1KYO D;  3FWL A;  1BE3 D;  5KKZ B;  5KLI B;  2Y0E A;  3BCC D;  3PRJ A;  1SQB D;  5TJH A;  3KHU A;  2JWA A;  1SQQ D;  2O3J A;  1SQP D;  2QG4 A;  4EDF A;  4D6T D; 
#chains in the Genus database with same CATH topology
 1OVR A;  4IOI H;  1EDI A;  2KLV A;  1SQQ K;  1N73 B;  3N4X A;  5B5E E;  3L71 G;  1M56 D;  3FXE A;  2P10 A;  1RQV A;  3TGU J;  2R3S A;  4N78 D;  1NKN A;  4CPG A;  2R44 A;  3GVK A;  1SQP J;  2PGD A;  1PP9 E;  1NTM G;  2I1J A;  3EFG A;  2ZVO B;  5CBO A;  1T2K C;  1JEK A;  1NHL A;  5AVW B;  1Q81 Q;  1FBM A;  2YIU C;  2K9Y A;  2Z5I A;  3L72 D;  1IJD B;  2I1K A;  1YTZ T;  2KXP B;  1GL2 A;  3BCC G;  1N7S A;  1QX8 A;  1KIL E;  3H1I G;  1RF1 C;  2FY8 A;  1BSH A;  2OYH B;  2JR8 A;  3RK3 D;  1L0N G;  2AEM A;  4R4M A;  3B71 A;  1QL1 A;  3A2A A;  1LTT C;  4KHX A;  3V2Q A;  3BCC J;  2WT7 B;  3BAS A;  3CXH D;  4H13 B;  4H44 B;  2SPZ A;  5APT A;  2OGU A;  1PPJ E;  3HTK B;  3LW5 J;  5GTI E;  3CCS P;  1PIX A;  4I1L A;  1Q2N A;  5CCG C;  1BGY J;  1SQV G;  3R4Y A;  5APV A;  4EYY Q;  2ZT9 C;  3VMA A;  1Z56 A;  1RE4 A;  3AE6 C;  3TGU D;  1FE6 A;  1YIJ P;  3HTK A;  5APU A;  4ZNC A;  3CX5 D;  4W7Y A;  2ZXE B;  3I5C A;  1DD3 A;  1KYO I;  3SSU A;  3V2N A;  3WU2 H;  4EOT A;  2HPC A;  2IYP A;  2AXT E;  2QVA A;  2WSE J;  1T3J A;  1N7L A;  2O1K A;  4XA4 A;  2Q3I A;  3H32 B;  1G2C A;  1PL5 A;  1DIP A;  4HIZ A;  4PD4 H;  1L0L E;  5APW A;  2WPQ A;  5C39 A;  2P7J A;  3VMX A;  2FYU K;  3U59 A;  2M5A A;  1UIX A;  2YMK A;  1URQ A;  1M90 Q;  2CK3 H;  1SFC D;  3CC2 P;  1NTM D;  2E75 C;  3CI9 A;  4D6T E;  4BXL A;  1QVF O;  2HOD A;  1G1J A;  5KAI E;  4U7J A;  3CWB G;  2JKV A;  2K9J A;  1S5L E;  3B5N C;  3I56 P;  1MUU A;  1VPC A;  1URQ B;  1X22 A;  4I6M C;  4JBZ A;  1KD1 Q;  3AED C;  3H1I D;  2G8Y A;  4UB8 H;  3CWB D;  3RL0 g;  3T97 B;  5CCH D;  2AXC A;  3VP9 A;  2CPS A;  5KKZ C;  1Q7Y Q;  2V4H A;  3CWB J;  3GLM A;  2ZXX A;  2XZR A;  2Q6Q A;  4LLH A;  4N6J A;  3HUS B;  2W8Z A;  3TDK A;  1IO4 A;  1YQ3 C;  3M0D A;  2Y9Y A;  2NZ2 A;  4OGQ C;  1GW3 A;  2H88 C;  1USD A;  1AVO A;  1KQF B;  3U1A A;  1L0N K;  1AA0 A;  2QM8 A;  2IBZ D;  4OH8 B;  1JM0 A;  2Q7C A;  3KDP B;  4DZO A;  1SQP K;  5KAI H;  1KQG B;  2JJL A;  1JTH A;  3GVJ A;  3L73 D;  1FS0 E;  1HVV A;  3M0A A;  2D2C B;  3PH0 A;  3G3Z A;  1ZRT D;  3GHG B;  4UB8 E;  4W7Z A;  3TGU E;  3CCM P;  4ASV A;  2R5D A;  1M1J A;  4IFM A;  3RBX A;  1SS1 A;  2JEE A;  2HYN A;  2LXB A;  1BCC J;  2YIU B;  1ZR4 A;  1AQT A;  1U7M A;  1BCC D;  2WPV B;  3L74 J;  3PLN A;  3H32 A;  2LXC B;  2AEF A;  3VP8 A;  1IC2 A;  2WWW A;  1SFC A;  3L71 E;  2K1A A;  1H0T B;  1BCC G;  1SQB K;  3CC7 P;  2WSE H;  2R5B A;  1SQP G;  3L74 G;  3ITK A;  1NTM J;  1JNM A;  2ZYD A;  1KIL C;  2NRG A;  3AE3 C;  4PJ0 E;  1JY3 P;  2W90 A;  5L8R J;  3M0D C;  1OW8 A;  5CHX A;  3H25 A;  2KLU A;  1N7S C;  1RF1 A;  1CI6 B;  1GMJ A;  2KK7 A;  2M3E A;  3H1I J;  3SWK A;  1IFP A;  2KZI A;  2E74 D;  1VQ6 P;  1N73 A;  1DX7 A;  1X79 B;  3MGN A;  3CCL P;  2OYH C;  2N9B A;  4ZMD A;  5APQ A;  5B66 H;  5AVU B;  2N1T A;  2C9N Y;  1J1D B;  2IYO A;  1JMM A;  2E5Y A;  3RK2 D;  1M1K Q;  3CPW O;  3H1K E;  1L0L K;  4K3A A;  4H13 D;  4H44 D;  1RHZ B;  1URQ C;  1XTC C;  2IX7 C;  1L0L J;  2O01 H;  2QIW A;  4PJ0 H;  1DEB A;  4Z1M H;  2KIK A;  3MIW A;  1HGV A;  1PFI A;  1H89 A;  2KZJ A;  4D6T D;  3IN6 A;  3HE5 A;  3O6Q B;  3A3Y B;  3P32 A;  1RQU A;  4IL6 H;  2YO2 A;  3I55 P;  1ZXG A;  1T3U A;  1KV4 A;  1KQL A;  1EC5 A;  1L4A D;  1T8Z A;  3EWK A;  2KNC B;  3BAT A;  2A45 G;  4GOD A;  1YYC A;  5AVZ B;  1ZLL A;  2QJP C;  2Q9I A;  3F89 A;  5AW2 B;  5K5G B;  4U3F G;  3AEF C;  2W6B A;  1BGY E;  4ASW A;  1LT9 A;  1HH0 A;  1NU1 E;  4N3Y B;  1N7S D;  3P8M C;  2RMZ A;  3UIA A;  1HF9 A;  2GM4 A;  1AVY A;  1PZQ A;  3OJA B;  1NOH A;  3RGU A;  3VMY A;  1KQS O;  1N73 C;  1R5S A;  5CCH A;  3GVL A;  1H0T A;  3CCV P;  2HOD B;  2Y0D A;  1Y47 A;  2W27 A;  3RK3 E;  2WIT A;  2J5U A;  2WPR A;  2OYI A;  5CJ0 A;  1VQ7 P;  2QJK B;  1FU1 A;  1LP1 A;  2OYI C;  3S1K A;  1PPJ D;  3T97 A;  3ZDM A;  3L37 A;  3AE7 C;  2K3R A;  1NAF A;  1SQB G;  1D7M A;  2QRX A;  3E1R A;  2WSF H;  3HD7 B;  1MFZ A;  1S9K E;  1DEE G;  1PP9 J;  2QEX P;  2NPS D;  3AE9 C;  1KIL B;  4XE5 B;  3IAO A;  3KYQ A;  1SQB J;  2KSE A;  3CX5 E;  1EZV E;  2QJY B;  3L72 G;  2PAJ A;  2N1T B;  2H8P D;  2HG5 D;  2NPS A;  1ZOY C;  3AEB C;  3L75 D;  1KFM A;  1VDF A;  3H1I E;  3USS A;  5KLV G;  1P84 D;  1BDC A;  1JTH B;  4WBA A;  2IPP A;  3D6Y A;  1L0N E;  1WRG A;  1NH4 A;  1LTB C;  3V6I A;  3JCU H;  2D2C D;  2KYV A;  1AJY A;  3HD7 C;  4YTP C;  1LTJ C;  1OXZ A;  3O6Q A;  1OW7 A;  3KPE A;  2V7Q H;  2MJZ A;  3V4Q A;  1GD2 E;  2B87 A;  1K05 A;  1PGJ A;  2FXO A;  2WZ7 A;  1NTK D;  1RH5 B;  5AVY B;  2J58 A;  4B86 A;  4KT0 J;  2N1T C;  1E5W A;  1R5L A;  3H1J D;  1NU1 D;  2KSJ A;  2N1T D;  2P2U A;  3GF7 A;  2B88 A;  4M3L A;  2FYN B;  4H13 C;  4H44 C;  1BSN A;  1LTI C;  1KMI Z;  3H1J G;  4LGD E;  1Q82 Q;  2E43 A;  1KN7 A;  5KAF E;  5AW7 B;  3MD0 A;  3SFD C;  3H1L D;  4NPF X;  2E74 B;  2KS1 A;  1KOR A;  2WSS H;  1P84 H;  1BCC E;  1NTZ D;  1HWT C;  4PD4 I;  2M5A B;  2KP8 A;  3RL0 B;  3KZI E;  3LIE A;  4IFD K;  3L71 D;  1GW4 A;  1K73 Q;  5AW1 B;  1SFC B;  1SLQ A;  2WQY C;  2IBZ E;  4L74 A;  1VQ8 P;  3U1C A;  1P84 I;  1U57 A;  2E75 B;  4D6T G;  3Q3D A;  1L0L G;  3PJS K;  1CSB A;  2YMY A;  1KB9 I;  4HH2 A;  2QA4 P;  3OAK A;  3CWB E;  2C0X A;  4MN4 C;  1JMB A;  1SQX K;  2HR3 A;  1NU1 J;  2MKV A;  2PP6 A;  3EFF K;  2KUB A;  4HJG H;  4TT3 H;  1P84 E;  1W2E A;  2ZFC A;  3AEE C;  4PV1 D;  1PGP A;  4YPC A;  3W68 A;  1L4A B;  4PV1 C;  1VQ4 P;  1M57 D;  3KZI H;  1OX3 A;  1NO4 A;  1FZF A;  1IK7 A;  3SFE C;  2E76 B;  3PHL A;  3L35 A;  3A7O A;  1YJW P;  3H1K D;  3P8C E;  4ZKP A;  2O01 J;  4JF7 A;  2OAR A;  5H2F E;  1NTK K;  1YBK A;  3FWL A;  1BE3 D;  1PGQ A;  3L73 G;  3LW5 H;  1J1E B;  3RL0 D;  1DH3 A;  3CCQ P;  1VQ9 P;  2FYU E;  2W83 C;  3TGU G;  2O01 N;  3EQ2 A;  1FAV A;  4OGQ B;  2FFD C;  1IFJ A;  1JB0 J;  3H1J E;  3H6P A;  4AUW A;  1MV8 A;  2L5G B;  4WY4 A;  1YTZ I;  2RH0 A;  3H1H G;  3W67 A;  1OVU A;  2WPS A;  1RE3 A;  1NVO A;  1SQB D;  5TJH A;  1RF0 C;  1LTA C;  1PGO A;  1S5L X;  3HE4 A;  1E79 H;  1ZV8 A;  2QSI A;  1GK4 A;  4K35 A;  5GTI H;  1LT9 C;  2GUS A;  2IFN A;  3AEA C;  3C9I A;  1MKM A;  3H1H J;  3E1I A;  1SQQ D;  4L75 A;  2O3J A;  2WSC H;  5AVT B;  1LT9 B;  5AVX B;  4BRY A;  2A06 E;  2RKL A;  1SQP D;  1TU3 F;  1QL2 A;  2XU6 A;  2E76 D;  2KI7 B;  5CJ4 A;  1ZP0 C;  3OA7 A;  3L72 J;  4JPZ B;  4C7N A;  5AVV B;  4OGQ D;  1SQV J;  4ZKU A;  1J1D C;  2QJY C;  1S4X A;  1LTG C;  1SQV D;  2BCC J;  4GOE A;  3N7N A;  4PD4 E;  5KJ7 C;  2E42 A;  2E5T A;  1EZV I;  1KB9 D;  1WT6 A;  2Q1K A;  3RL0 C;  3A5T A;  2ZT9 D;  1S9K D;  2B9B A;  3D71 A;  2BAS A;  2BCC G;  1EZV G;  1VF5 C;  3IR9 A;  1GDT A;  2YNY A;  1NKZ B;  4YXD C;  2ZYA A;  1RE4 C;  4XFJ A;  1BGY D;  5AW3 B;  2Y9Z A;  3H1K G;  2LR2 A;  5KTB A;  1JCD A;  1RF0 A;  1EZV D;  3TK1 A;  5KLV E;  2OTK E;  1S5L H;  5B5E H;  2WTY A;  3L75 E;  3GG2 A;  3MTU E;  4NPD A;  3H1K J;  1GK6 A;  3MP7 B;  4TLF A;  4Y28 J;  2YXQ B;  4OWF A;  1Q90 D;  2ZAE B;  3H1H E;  3CXH I;  1J2J B;  1QEX A;  1SQX J;  1FZE A;  2XKM A;  3IFM A;  1HTL C;  2PRR A;  1NGM B;  2KNC A;  1VQN P;  2JO1 A;  2V7Q J;  1HBW A;  1V0F A;  4C46 A;  1OMI A;  2E76 C;  4HB1 A;  4WY4 B;  2WVR A;  3A0H E;  5AVQ B;  1KB9 H;  1NTK E;  2UWJ E;  3HE4 B;  1JY3 O;  1ZRT E;  2JDI H;  3D6Z A;  2FYU J;  3AE8 C;  3F5H A;  3JSV C;  2E74 C;  1M1J C;  3VYI A;  1VQ5 P;  4WWI A;  3Q5S A;  1H88 A;  4WB4 A;  3QWO C;  1JY3 N;  1L0N D;  4JYB A;  3AE4 C;  3L70 G;  4D6T J;  2WSC J;  3BVH A;  2IZ0 A;  1FZA A;  3NXS A;  1YQ4 C;  3B8E B;  1N86 A;  1ZN5 A;  1NTZ E;  2ITA A;  3CL3 D;  2XND H;  3S4R A;  3L70 J;  2BCC D;  1KB9 E;  3M06 A;  2WSF J;  3CME P;  1OFC X;  1WMK A;  2IBZ I;  1SQB E;  2C0W A;  2XNX A;  3AEC C;  3L74 E;  5APS A;  3MZW B;  2Q5U A;  1NAY A;  1ZW0 A;  2XDJ A;  2C9L Y;  2OYI B;  2NPS B;  2BEQ D;  3L73 J;  3RK2 C;  1L4A C;  4PV1 B;  3H1L J;  3V2P A;  1RE3 C;  5DJT B;  3M9B A;  2DW3 A;  1IFN A;  3M91 A;  4HYT B;  3SWF A;  1SQQ J;  1SQV K;  2IFM A;  3AE1 C;  1FZC B;  3CC4 P;  2M3B A;  3QH9 A;  3G4S P;  3JU4 A;  1KZU B;  3NTN A;  5B66 E;  2LKM A;  1GZL A;  1SQQ G;  1LT1 A;  4U3F J;  1K9M Q;  1JO5 A;  4JQ0 D;  5APY A;  1LGH B;  2QJP B;  3MUD A;  4GT1 A;  2OTJ P;  2CPB A;  1OVV A;  1BE3 E;  3KXD A;  1NWQ A;  3L70 D;  4BWN A;  2Z4E A;  1AQ5 A;  5KLI C;  2FYU D;  2YKQ A;  3PP5 A;  2FXP A;  3WU2 E;  2D2C C;  3TF5 A;  1HGZ A;  1NU1 K;  1NTM K;  1PV3 A;  2AXT H;  1N2D C;  1GTW A;  2Q3E A;  1FZC C;  1L0N J;  2KS1 B;  1VQK P;  1V0E A;  2HPC B;  2M0B A;  4DJG A;  4JYC A;  4RJT A;  3G9R A;  5BU8 B;  1HJ0 A;  1LWU A;  2A06 G;  2ZT9 B;  1XTG B;  1QLE D;  2H89 C;  1G2C B;  1BGY G;  3II6 A;  3P8C D;  5CCG A;  3K5B A;  1YHQ P;  3CCU P;  1KC8 Q;  3G71 P;  1KYO D;  4UB6 E;  5CMZ A;  1YJN P;  4RES B;  1QGK B;  1IZN B;  3L75 J;  5KLI B;  2H43 A;  1G1I A;  2IBZ G;  2Y0E A;  2FYN C;  2YO3 A;  2Z5H A;  3PRJ A;  3A0B E;  2ZVN B;  4GOF A;  1GL2 C;  2YXR B;  2POH A;  3L75 G;  2R32 A;  4KJM A;  1CW5 A;  2JWD A;  1L4A A;  3CMA P;  4R4L A;  5AW8 B;  1SVF A;  1NTZ K;  4YXW H;  1LTJ B;  3NFQ A;  1NYH A;  3FGA D;  1M8O B;  2M8R A;  3M9H A;  4IFF A;  1LJ2 A;  4W80 A;  5E79 E;  1N8R Q;  1FOS F;  4UB6 H;  2KOG A;  1BE3 G;  3L72 E;  4AQR D;  2P58 A;  3R2P A;  2QG4 A;  1NTK G;  1LTJ A;  1IK9 A;  2FYU G;  2I8D A;  2R3C A;  3BCC E;  3JC2 2;  2PFX A;  3A0B H;  1QVG O;  3TNU B;  1EQ7 A;  3H1H D;  4Y99 B;  3V4W A;  1ZR2 A;  1K8A Q;  1SQV E;  1Y8A A;  2FKW B;  4PD4 D;  3TYY A;  3V5B A;  1KTM A;  2IZ1 A;  2GA1 A;  3PTZ A;  2NPS C;  1R8E A;  3NMD A;  4I2L C;  5E79 H;  1VQO P;  2VRS A;  1NTZ G;  5KLV D;  1PP9 D;  4GIF A;  1LWU B;  5AVR B;  1SQP E;  4L73 A;  3L4F A;  3BRV B;  5AW9 B;  4GDO A;  1IFM A;  3HUS C;  5CBN A;  1L2P A;  1GU4 A;  4AYC A;  1FDO A;  1KIL D;  1Y9B A;  3M9Q A;  4IL6 X;  3H1L E;  4WY4 C;  1NJI Q;  1VL2 A;  3VOP A;  4EIJ A;  1EDJ A;  1UII A;  2FFD A;  3WUV A;  2K9J B;  1FJP A;  3L70 E;  1S2E A;  3VMZ A;  3Q2Y A;  1L0L D;  3B5N B;  1YI2 P;  1KIL A;  4WVZ A;  1A02 J;  4H0L D;  4BRY B;  4H0L C;  1JY2 N;  2H7H A;  5CCH C;  1A02 F;  2FFD B;  4N78 E;  2BCC E;  3KQG A;  1URQ D;  3HUS A;  1JY2 P;  3LID A;  1NTM E;  3P7K A;  1ZME C;  1Q86 Q;  3GW6 A;  3MHV A;  3RK2 B;  3ABV C;  3CCR P;  1IFI A;  1LWU C;  1K04 A;  2O1J A;  4LC1 A;  1JOC A;  4I7Z C;  2IDB A;  1T6A A;  2WMM A;  5BVZ A;  2Y0C A;  5KJ7 D;  1N7S B;  1OW6 A;  4I7Z B;  1HJB A;  1MZ9 A;  2OYO A;  2FYZ A;  3IF4 A;  1OWA A;  5APX A;  3CCJ P;  3CD6 P;  4O9B A;  1LTS C;  2BEZ F;  3L71 J;  2B87 B;  3AE2 C;  1SQX E;  1VF5 B;  1JCC A;  1SP4 A;  1SQQ E;  4IL6 E;  3WMM 0;  4GKG A;  2A06 D;  1U7J A;  5AW5 B;  1FOS E;  4H0L B;  1LNQ A;  2FXM A;  2KB7 P;  1M1J B;  3HE5 B;  4HKZ H;  5M1B A;  3V2R A;  4WY4 D;  2ZJS E;  5CCG D;  4DT0 A;  1PPJ G;  2A45 I;  2GUV A;  5H2F H;  5KLV K;  2OYH A;  4RKU J;  3L73 E;  5DJU B;  3SWY A;  3E7K A;  3FX0 A;  3C1L A;  3WUU A;  4DOJ A;  2W6J H;  3BRT B;  2WT7 A;  1EDL A;  5AW0 B;  1RY3 A;  3RK3 C;  5TIS E;  4U3F D;  3CX5 I;  1CI6 A;  3GMA A;  3RK3 B;  3GHG C;  3S9O A;  1FZB A;  3B5N D;  1S3J A;  1EDK A;  1LP1 B;  1JUN A;  1HUC A;  1GL2 D;  1MFT A;  1VQM P;  4C7N B;  5AW4 B;  3HD7 A;  1KYO H;  1SFC C;  1VF5 D;  2HFE D;  3FWN A;  3L74 D;  1OZH A;  3CX5 H;  1FDI A;  5EFW B;  3AEG C;  5AVS B;  2B89 A;  2W6A A;  1BE3 J;  3HRN A;  1W2B O;  1FDM A;  1S1C X;  2OTL P;  3RBZ A;  4F0A B;  2G3A A;  1NTK J;  1RF1 B;  4OVN F;  1FZG A;  2L91 A;  3VTP C;  4NPE A;  1SQX G;  5TIS H;  2RN0 A;  1YJ9 P;  1FZC A;  3TNU A;  3JCU E;  2J59 M;  2N9Y B;  1S72 P;  1SQX D;  2XV5 A;  2P1J A;  5GTH E;  3CLQ A;  1DD4 A;  2A45 H;  4Y99 C;  3H1J J;  3TSI A;  1FJK A;  1PP9 G;  2QM7 A;  1GL2 B;  1X0T A;  1M7L A;  3VN0 A;  4A7P A;  1KYO E;  3Q5P A;  4QMA A;  2QE7 H;  2YKO A;  3MUD C;  1AV1 A;  1JY2 O;  1VQP P;  1NTZ J;  2HLO A;  5KKZ B;  1EXJ A;  1VQL P;  1BDD A;  2ZYG A;  2K37 A;  3GHG A;  3CCE P;  3BCC D;  1X8Y A;  3GF3 A;  3O8Z A;  5KLV J;  1YIT P;  2JP3 A;  2AEJ A;  2P67 A;  3CXH E;  5AW6 B;  3C8V A;  3OW2 O;  1T2K D;  1GU5 A;  1AFO A;  3D70 A;  5KAF H;  1W5C E;  1FC2 C;  4RO0 A;  3Q1M A;  2YKP A;  1USE A;  2JWA A;  2E75 D;  3KHU A;  1KFN A;  5GTH H;  4C7R A;  2OQQ A;  3A0H H;  1X9V A;  3B5N A;  1CZQ A;  3FXD A;  4U3F E;  3G6E P;  3AE5 C;  1NU1 G;  1OIP A;  3B4S A;  3HD7 D;  3WUT A;  1IFD A;  4EI2 A;  4DCK A;  3Q5R A;  1H8A A;  1J1E C;  4L76 A;  2QJK C;  5BU5 A;  1EXI A;  4EDF A;  5KJ7 A;  2FBW C;  3H1L G;  3L36 A;  2K88 A;  3CXH H; 
#chains in the Genus database with same CATH homology
 3H1H D;  1SQV D;  4PD4 D;  1KB9 D;  2KNC B;  3PTZ A;  3GVK A;  5KLV D;  1BGY D;  1PP9 D;  2RMZ A;  1EZV D;  3L72 D;  3GVL A;  3GG2 A;  2Y0D A;  2K9J B;  2QJK B;  1L0L D;  1PPJ D;  3CXH D;  1V0F A;  3GW6 A;  3VMA A;  3TGU D;  2QJY B;  3CX5 D;  2Y0C A;  3L75 D;  1P84 D;  1L0N D;  4HIZ A;  2A06 D;  2BCC D;  1NTM D;  1NTK D;  3H1J D;  1NU1 D;  2FYN B;  3H1I D;  3CWB D;  3H1L D;  2KS1 A;  3TDK A;  3JU4 A;  4U3F D;  1NTZ D;  3L71 D;  2IBZ D;  2QJP B;  3L74 D;  3L70 D;  3GVJ A;  3L73 D;  2FYU D;  1ZRT D;  3TF5 A;  2L91 A;  2Q3E A;  2RN0 A;  1V0E A;  2YIU B;  4RJT A;  2N9Y B;  1BCC D;  1SQX D;  3PLN A;  3PHL A;  4A7P A;  3H1K D;  3ITK A;  1KYO D;  3FWL A;  1BE3 D;  5KKZ B;  5KLI B;  2Y0E A;  3BCC D;  3PRJ A;  1SQB D;  5TJH A;  3KHU A;  2JWA A;  1SQQ D;  2O3J A;  1SQP D;  2QG4 A;  4EDF A;  4D6T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...