1EDKA

Staphylococcal protein a e-domain (-60), nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
56
structure length
56
Chain Sequence
AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the E-domain of staphylococcal protein A.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immunoglobulin-binding protein
molecule keywords STAPHYLOCOCCAL PROTEIN A
total genus 20
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1996-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1edkA00
1OVRA 3RGUA 4ZNCA 2KUBA 2JWDA 1U7MA 2M5AA 4JBZA 1H0TA 3MHVA 1DEEG 1EDJA 1SS1A 1ZXGA 3FXDA 4BXLA 2RKLA 4CPGA 4HJGH 1LP1B 2B89A 1H0TB 1Q2NA 5CBNA 1OVVA 2KS1B 2M0BA 2I8DA 5EFWB 2Q1KA 4NPFX 4IOIH 2HR3A 1NVOA 2KI7B 3PH0A 1EDIA 5DJTB 2LXCB 2QRXA 1EDLA 2LR2A 2QVAA 2B87B 1BDDA 1Y47A 1S3JA 3QWOC 4GODA 3ZDMA 2P58A 2KIKA 2KZJA 5DJUB 2K3RA 5K5GB 4K35A 1OVUA 4EYYQ 4WWIA 2B87A 3MZWB 1LP1A 1EC5A 2ZAEB 4HKZH 1U7JA 2UWJE 1X0TA 1JMBA 1ZW0A 1LT1A 5CBOA 4ASWA 4ASVA 2WMMA 4K3AA 2KZIA 4MN4C 5C39A 2M5AB 2SPZA 2B88A 4HB1A 4GOFA 1FC2C 1JM0A 4NPEA 3S1KA 4NPDA 4ZMDA 1EDKA 2LXBA 1BDCA 3FXEA 1MFTA 2R44A 2OTKE 4KJMA 4GOEA
chains in the Genus database with same CATH superfamily
2OYHA 3O6QA 2XV5A 3H1KE 2KYVA 5BU8B 1RF1A 1IO4A 1EQ7A 4ZNCA 2M8RA 2FYNC 3BCCG 5AW2B 2FFDA 5GTHH 2OYIB 1AFOA 5AW9B 5KLVJ 1FAVA 4UB8H 5APWA 1N2DC 2M5AA 2JJLA 2WPSA 3FWLA 1OW6A 2NPSD 2Z5HA 1LTJC 2Z5IA 3BCCJ 3L71E 2A06D 3NTNA 1H88A 2GUVA 4JYBA 2K9YA 3L74E 1VQPP 1AQTA 5CCGD 1EZVE 3RBXA 3BRTB 3HD7A 4U3FE 2HPCB 2KS1A 4GT1A 5KAIH 1Q82Q 2K88A 3AE7C 1ZXGA 3FX0A 4WB4A 1NTZK 2JP3A 1KB9I 1OWAA 3NFQA 5KLIC 3VOPA 2E75B 4BXLA 4N78D 1URQB 4CPGA 2PAJA 3RK2B 4HJGH 1LP1B 1ZP0C 1ZOYC 2HFED 4WY4C 4ZKPA 1FZCA 1VF5B 2G3AA 3G3ZA 3L36A 4OGQB 3AE3C 2WQYC 1LGHB 1KYOH 1NU1K 2H43A 1H0TB 2Q5UA 1Y9BA 3AE8C 3MTUE 5CCGC 3RK3B 1SQBG 1SQBE 2L91A 2FBWC 2IZ1A 2E75D 2I1KA 5AVYB 1GL2A 3PP5A 3B71A 4YXWH 1SLQA 1NU1D 2ZVOB 1BCCD 2FXMA 3CCEP 2K9JA 1JY3N 4OVNF 3Q1MA 4IOIH 1N8RQ 4UB8E 1KN7A 1P84H 5AVVB 3TGUD 1ZR2A 2KI7B 2J58A 3PH0A 1EDIA 3H1IJ 1NTKD 2LXCB 1CI6A 1AA0A 2QJPC 1LTIC 2Y0DA 5AW4B 3M06A 1SVFA 3MP7B 2PRRA 2OYOA 3IN6A 4AYCA 4IL6H 4Y99B 3HE4B 3L72G 4WY4B 1Y47A 3KZIE 5KLVE 2WSCH 3C1LA 4H44C 1HH0A 1VDFA 2QJKB 3AE1C 2WWWA 3QWOC 1IFIA 4GODA 2IYOA 3N7NA 1L0NE 1NTME 2A06G 3V5BA 5KKZC 4QMAA 1QGKB 2L5GB 3LIEA 3D6YA 4EI2A 4H0LB 1L4AB 1G2CB 1GK4A 2W90A 3L74J 1LWUA 4U3FG 4Y28J 1KQFB 4HYTB 2XNDH 1L0LK 2K3RA 1QEXA 1BGYE 5K5GB 1FZBA 3C8VA 3A7OA 3H1HG 3CXHI 2QJYC 1LT9A 1M1JB 1VQ5P 4EYYQ 1N7SD 4WWIA 2IZ0A 3GHGC 3H1HD 3BATA 1M8OB 4D6TD 1JY2N 1SQXE 3CCQP 1LP1A 2IBZG 5E79H 1QL1A 1YQ3C 3TNUB 1U7JA 1IFPA 3RBZA 1BCCE 2O01N 3V2QA 2BCCG 3KZIH 1PPJG 5B66E 3L73J 3SFEC 1SQVJ 1QX8A 1SQXG 1ZW0A 3JC22 2E5TA 3WUTA 3Q5PA 1YJNP 1KTMA 2WPQA 3KQGA 1ZN5A 4OGQD 1IFMA 2O01J 3SFDC 3CCUP 2D2CC 1X9VA 2YMYA 2N1TD 3L73G 4U7JA 4RJTA 1URQD 3CCVP 1GDTA 1GK6A 3RL0C 5CJ4A 1FZFA 3A0HE 3H1KJ 1YTZI 2FXPA 1BE3E 2E74B 4GIFA 1NTZD 3ITKA 3F5HA 4PD4H 1SFCA 2E76C 3MD0A 1KORA 1P84D 1NTMK 2KOGA 1M1JC 2O3JA 2Y9ZA 2G8YA 2OGUA 5AVZB 3T97A 1EZVI 1ZLLA 2B9BA 2P10A 2SPZA 3UIAA 3CWBE 4PV1B 3GHGB 4H0LC 3CCJP 3CCSP 2B88A 4HB1A 1VF5C 4N6JA 2P2UA 2M3BA 2HODB 4PV1C 2P7JA 1JOCA 2Y0CA 5AVTB 4AQRD 1IJDB 2E43A 1SFCD 4NPEA 4PJ0E 1FU1A 1SQQG 1EDKA 2POHA 3P8MC 3FXEA 4WVZA 1K05A 1KYOI 1YIJP 4C7NA 3IAOA 1BE3J 2J5UA 1SQBD 4KJMA 1PZQA 1DD4A 1HUCA 4R4MA 4D6TE 1OVRA 2FY8A 1OW8A 3GF7A 3VP8A 4I1LA 3RGUA 1R8EA 3G71P 2KUBA 4GKGA 2PGDA 2JWDA 1GW3A 1GZLA 2C0XA 1NKNA 2M3EA 3VTPC 1FJPA 3V2RA 1JCDA 1U7MA 1W2BO 2CK3H 1ZMEC 3B5NA 2E74C 2O1KA 2YXQB 3KPEA 3H1IG 1BCCJ 1HWTC 1VQ9P 3MIWA 1VQ6P 2R3SA 3E7KA 3RK2D 1VQ8P 2W6BA 2Q6QA 1H0TA 2IBZD 4N78E 1YI2P 3I55P 3CC2P 3L75G 1M56D 3VYIA 1U57A 4XFJA 3D70A 4IFDK 2N9BA 2H7HA 2PP6A 3CLQA 5KLVD 1SS1A 1NTZE 2RN0A 4PD4D 1K8AQ 3LW5H 4R4LA 3RK2C 3L70G 1J1EC 3U1AA 1DD3A 3FXDA 3GMAA 3MUDA 3H32A 5GTIE 3G4SP 3H1LD 1KYOE 1OFCX 3LW5J 4IFMA 3RK3C 4DZOA 2P1JA 2B89A 3A0BE 1VQOP 1OXZA 2IX7C 3EFGA 3HE4A 5AVXB 1Q86Q 2JDIH 3L35A 3AE2C 2Z4EA 1VQKP 2Q3EA 1KMIZ 2N9YB 4L75A 1JTHB 3HD7B 4W7YA 2M0BA 1LTJA 3RK3E 2KSJA 2I8DA 2NZ2A 2VRSA 4L76A 5EFWB 5KKZB 3GLMA 3R2PA 1K9MQ 1RHZB 2I1JA 1LT9B 2WVRA 2QRXA 3AEDC 2AXTH 2Y0EA 3TGUG 1SQVD 1JNMA 1NWQA 1EDLA 1NU1J 1IFNA 1NYHA 2MJZA 1IK7A 1OIPA 2W83C 3AECC 1YJWP 3HTKA 1GW4A 3AE6C 1N7LA 3HUSB 3V2PA 1RF0C 3H1ID 1KQLA 1NTKJ 5APXA 2N1TC 1S1CX 1KFMA 2CPSA 1NTZJ 1L0NJ 2P58A 3H1HE 2KZJA 1DH3A 1G1JA 3CC4P 2N1TB 2ZVNB 3KXDA 3PLNA 2PFXA 3CWBG 1KYOD 4WBAA 5CMZA 1R5SA 3S4RA 3WUVA 2QA4P 4OH8B 4EOTA 5TISE 5AW5B 4YTPC 1H89A 1BGYJ 4K35A 3AEFC 4OGQC 1EXIA 3M9HA 1DIPA 1OVUA 1BE3G 4PD4I 1OMIA 2XU6A 2IPPA 1SQBK 3MZWB 3CCRP 1PP9E 2WPVB 3A2AA 4PV1D 1YHQP 3S9OA 1S72P 1ZRTE 3SSUA 1NU1G 3RL0D 1BE3D 1P84I 1SQPE 3GHGA 3RK3D 3VN0A 3WU2E 2K37A 3Q5SA 2C9LY 5BU5A 1CW5A 3VMAA 1P84E 1J2JB 2NRGA 5M1BA 3IF4A 3D71A 3H1HJ 4IFFA 4KT0J 1JY2P 2IYPA 4H44B 1N86A 1S5LE 4ASVA 1N7SC 2IBZE 3MUDC 4H13B 1N73C 1JMMA 1RE4A 2WSEH 1URQA 2ZFCA 1JY2O 2E76B 1NHLA 2YO2A 3U59A 3Q2YA 1S9KD 2ZYGA 3L73D 2KZIA 4EIJA 4HH2A 1KILD 5APQA 5KJ7A 4RESB 1PV3A 2O1JA 3MGNA 2WT7B 2R32A 2R5DA 1T6AA 5APSA 1HF9A 2FYNB 3B5NB 3KHUA 3H1KD 2W27A 4L74A 1QLED 1A02F 3CX5E 1BSNA 4GOFA 5TJHA 4BRYA 3B5NC 1VQMP 1FS0E 4YPCA 1NAYA 3TDKA 2NPSB 2WITA 3WUUA 2K9JB 1MKMA 1SQQE 4NPDA 3S1KA 1KILB 4ZMDA 1BDCA 1MFTA 1QL2A 1FJKA 3AE4C 2E74D 3E1IA 2A45G 1HJ0A 2D2CD 1T3JA 2V7QH 4KHXA 3WMM0 5GTIH 3F89A 1ZR4A 1PP9D 1XTCC 4XA4A 4H0LD 3CMEP 2D2CB 4PD4E 3II6A 5APVA 5AW1B 2AEMA 3Q3DA 1KD1Q 2ZYAA 2BCCD 3T97B 3PTZA 3A5TA 5CCGA 5KJ7C 2AEJA 3CD6P 2KNCA 2KB7P 1SQBJ 4JBZA 1FZAA 2P67A 5GTHE 2KSEA 3N4XA 3TK1A 4C7NB 1RQVA 3BCCE 1K73Q 1RE4C 3SWKA 2AEFA 4RKUJ 1IK9A 1N7SA 4W80A 1S9KE 4IL6E 1JO5A 1EDJA 3VMZA 1SFCC 1HBWA 1VQNP 2QJYB 3BASA 3HD7C 3A3YB 4O9BA 2FYUK 4W7ZA 1IFJA 2YKPA 3V2NA 3G9RA 2E76D 3BRVB 1EXJA 1NAFA 1X22A 2FYUG 2YMKA 4I7ZB 4JPZB 4DJGA 3CX5H 1Z56A 1K04A 4TT3H 3CX5D 4H44D 5APTA 4ZKUA 1KB9H 1HJBA 1KFNA 3H1LG 4PJ0H 1YTZT 1ZV8A 1SQPK 1SQQD 2FYUD 5H2FE 4UB6E 2GM4A 2W6JH 3LIDA 3H1JG 3L71J 3H1LJ 1E5WA 1CSBA 1NO4A 3HRNA 1Q2NA 2LKMA 5APUA 5CBNA 1RF1C 1ZRTD 1MZ9A 1GMJA 1SQPD 1YJ9P 2N1TA 3L71G 2FKWB 2IDBA 1LT9C 4NPFX 2W6AA 3H1JE 2AXTE 1RF0A 1SFCB 1NVOA 1KQGB 1T8ZA 2HR3A 2WSFJ 3NXSA 4LGDE 2QEXP 1H8AA 3L72J 5DJTB 1GL2D 4UB6H 1GTWA 2XNXA 2OYHB 1LWUC 2LR2A 4M3LA 2QVAA 3E1RA 3L75J 2HYNA 2RH0A 3WU2H 2B87B 1L4AC 4AUWA 1L4AD 3M0DA 1BSHA 1PPJE 5CCHA 1DX7A 2YNYA 1WT6A 1G1IA 1S3JA 3ZDMA 5AW8B 3TGUE 1FDIA 3L4FA 1X8YA 1L0LD 1FDMA 3OA7A 5KJ7D 3W67A 1NTKE 2KIKA 4Y99C 1LTJB 2WSSH 3H1JJ 2GA1A 1S2EA 1WMKA 5KAFE 3W68A 2QJPB 1YQ4C 5AW7B 1KB9D 3BVHA 1PIXA 5AW3B 1PGJA 1L2PA 1JY3O 1L0ND 5BVZA 2YXRB 3RL0B 2KLUA 1SQVK 1VL2A 3M91A 3OJAB 1GU4A 2Q9IA 1FOSE 1J1DC 2H88C 3HD7D 4OWFA 3B5ND 1EC5A 2H89C 1NH4A 2ZAEB 1L0NG 4HKZH 1GD2E 1DEBA 1AVYA 1BGYD 1SQXK 1RE3A 2JWAA 4JYCA 4LLHA 1FOSF 3V6IA 3AE5C 2KP8A 5KLVG 1SP4A 1PP9J 3VP9A 3GW6A 3V4QA 1RE3C 1KC8Q 2ZYDA 1XTGB 1Y8AA 2BCCJ 1NTMJ 4TLFA 3L70D 1SQXD 3L74G 4U3FJ 2Q7CA 4C7RA 1OX3A 1M57D 3RL0g 1FE6A 2JKVA 2CPBA 5AVSB 2V7QJ 3L75E 3P8CE 4MN4C 1T3UA 1HTLC 3IR9A 3CCMP 1NTKG 2NPSC 1JB0J 4WY4D 3V4WA 2WTYA 1CI6B 3QH9A 2M5AB 5AVUB 2E5YA 5KLVK 4EDFA 3M9QA 2XDJA 1OW7A 3JCUE 2BASA 2BEQD 5AVWB 1S4XA 1JTHA 1IZNB 3CWBJ 2OTLP 3CI9A 2C9NY 2QG4A 1JM0A 2A45H 2QJKC 1KB9E 3HE5B 4IL6X 2YIUB 2J59M 5APYA 1OZHA 2QE7H 5KLIB 1AVOA 2JO1A 2Q3IA 1KQSO 2FFDC 1HVVA 1PP9G 4I6MC 2YIUC 1L4AA 4JF7A 2V4HA 2QM7A 2ZT9B 3BCCD 4GOEA 5B5EE 1S5LH 1SQQJ 2KLVA 3CX5I 2H8PD 5E79E 4GDOA 1VPCA 3NMDA 3A0HH 1X79B 2WT7A 2ZJSE 3HTKB 1VQ4P 2IFMA 3L70E 1M1JA 1MUUA 3SWYA 1EZVG 1LTGC 1Q90D 2Y9YA 1PGOA 1YYCA 1FZCB 1T2KD 4DT0A 2DW3A 3PRJA 4XE5B 3TYYA 1A02J 3EWKA 3H1LE 1FZEA 1JUNA 1J1EB 1FDOA 3MHVA 5B5EH 1KILA 3L72D 2O01H 5KTBA 1PPJD 1DEEG 1USEA 1NJIQ 2OTJP 3OW2O 1PFIA 1VQ7P 2FYUE 3B4SA 3L75D 1LNQA 3P8CD 4RO0A 1PGPA 3U1CA 1MV8A 1E79H 3M9BA 1KILC 3SWFA 5KAIE 2RKLA 1TU3F 2WZ7A 1LTTC 2YKQA 5H2FH 1T2KC 2FFDB 1L0LJ 2IBZI 2K1AA 1N73B 3H6PA 2MKVA 2FXOA 3H1JD 3H25A 1UIXA 3P7KA 2E42A 2KXPB 3FGAD 1JCCA 3I56P 4H13C 2W8ZA 1D7MA 2HG5D 2FYZA 2YKOA 1RH5B 1SQVE 3KYQA 3OAKA 4B86A 1NGMB 1M1KQ 2ZT9D 3CC7P 1AQ5A 2XZRA 1OVVA 2HODA 2ITAA 1YBKA 1HGZA 1LWUB 1BGYG 2KS1B 3AE9C 2FYUJ 2JR8A 3HE5A 2Q1KA 2OYIC 5AVRB 4Z1MH 5CCHC 1L0LE 1FZGA 3L71D 1SQQK 3AEBC 1Q7YQ 2GUSA 1NTMG 2A06E 2OQQA 3EQ2A 1NOHA 1NTKK 3AEGC 3GG2A 3IFMA 3L74D 1SQPJ 1W5CE 1PL5A 2IFNA 1L0NK 3TSIA 4DOJA 1BDDA 1S5LX 1MFZA 1VQLP 1GU5A 5AVQB 4BRYB 3L72E 1L0LG 1NTZG 1EZVD 3CXHD 4JQ0D 3C9IA 1YITP 2NPSA 1FBMA 3A0BH 3M0AA 4U3FD 5CCHD 1J1DB 1CZQA 2QIWA 3CCLP 3EFFK 1KV4A 2AXCA 1VF5D 1AJYA 3PJSK 1GL2C 1M7LA 2WSFH 5DJUB 2ZT9C 3O6QB 1RF1B 2ZXXA 1RQUA 4BWNA 1AV1A 2OYIA 3AEAC 3VMXA 3FWNA 3H1IE 2OARA 2R5BA 4A7PA 3TF5A 2KNCB 3USSA 5TISH 1FZCC 2B87A 1URQC 2WSCJ 1JY3P 4WY4A 3CL3D 1LTSC 3H32B 1M90Q 2XKMA 5CHXA 3G6EP 1N73A 3TGUJ 4I7ZC 4C46A 1N7SB 1SQPG 2UWJE 1NU1E 3O8ZA 3JSVC 4D6TG 2KK7A 2BEZF 3CMAP 3VMYA 1KILE 2WSEJ 1X0TA 3GF3A 1JMBA 1G2CA 1LT1A 2HPCA 2HLOA 5AW6B 4ASWA 5CBOA 3P32A 2WMMA 1KZUB 1UIIA 1HGVA 1IFDA 4H13D 3ABVC 3Q5RA 4I2LC 5CJ0A 1USDA 2ZXEB 2WPRA 2QM8A 2RMZA 2YO3A 3CXHE 4K3AA 4L73A 3AEEC 2JEEA 4N3YB 5C39A 1LJ2A 1LTBC 3B8EB 2QSIA 3JCUH 5L8RJ 4DCKA 1NTMD 4YXDC 5B66H 2C0WA 1SQVG 1SQXJ 2R3CA 3CXHH 3L70J 3M0DC 3R4YA 3KDPB 4LC1A 3TNUA 5KAFH 2OYHC 3D6ZA 1GL2B 3CPWO 1QVGO 1LTAC 1QVFO 1WRGA 1RY3A 1FC2C 1JEKA 3L73E 2BCCE 1IC2A 1BCCG 3HUSA 3PHLA 4D6TJ 2A45I 3H1KG 3I5CA 3L37A 2LXBA 5AW0B 1Q81Q 2E75C 3HUSC 3K5BA 2R44A 2OTKE 1NKZB 1R5LA 1PGQA 1W2EA 3CWBD
chains in the Genus database with same CATH topology
1OVRA 3RGUA 4ZNCA 2KUBA 2JWDA 1U7MA 2M5AA 4JBZA 1H0TA 3MHVA 1DEEG 1EDJA 1SS1A 1ZXGA 3FXDA 4BXLA 2RKLA 4CPGA 4HJGH 1LP1B 2B89A 1H0TB 1Q2NA 5CBNA 1OVVA 2KS1B 2M0BA 2I8DA 5EFWB 2Q1KA 4NPFX 4IOIH 2HR3A 1NVOA 2KI7B 3PH0A 1EDIA 5DJTB 2LXCB 2QRXA 1EDLA 2LR2A 2QVAA 2B87B 1BDDA 1Y47A 1S3JA 3QWOC 4GODA 3ZDMA 2P58A 2KIKA 2KZJA 5DJUB 2K3RA 5K5GB 4K35A 1OVUA 4EYYQ 4WWIA 2B87A 3MZWB 1LP1A 1EC5A 2ZAEB 4HKZH 1U7JA 2UWJE 1X0TA 1JMBA 1ZW0A 1LT1A 5CBOA 4ASWA 4ASVA 2WMMA 4K3AA 2KZIA 4MN4C 5C39A 2M5AB 2SPZA 2B88A 4HB1A 4GOFA 1FC2C 1JM0A 4NPEA 3S1KA 4NPDA 4ZMDA 1EDKA 2LXBA 1BDCA 3FXEA 1MFTA 2R44A 2OTKE 4KJMA 4GOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVR A;  3RGU A;  4ZNC A;  2KUB A;  2JWD A;  1U7M A;  2M5A A;  4JBZ A;  1H0T A;  3MHV A;  1DEE G;  1EDJ A;  1SS1 A;  1ZXG A;  3FXD A;  4BXL A;  2RKL A;  4CPG A;  4HJG H;  1LP1 B;  2B89 A;  1H0T B;  1Q2N A;  5CBN A;  1OVV A;  2KS1 B;  2M0B A;  2I8D A;  5EFW B;  2Q1K A;  4NPF X;  4IOI H;  2HR3 A;  1NVO A;  2KI7 B;  3PH0 A;  1EDI A;  5DJT B;  2LXC B;  2QRX A;  1EDL A;  2LR2 A;  2QVA A;  2B87 B;  1BDD A;  1Y47 A;  1S3J A;  3QWO C;  4GOD A;  3ZDM A;  2P58 A;  2KIK A;  2KZJ A;  5DJU B;  2K3R A;  5K5G B;  4K35 A;  1OVU A;  4EYY Q;  4WWI A;  2B87 A;  3MZW B;  1LP1 A;  1EC5 A;  2ZAE B;  4HKZ H;  1U7J A;  2UWJ E;  1X0T A;  1JMB A;  1ZW0 A;  1LT1 A;  5CBO A;  4ASW A;  4ASV A;  2WMM A;  4K3A A;  2KZI A;  4MN4 C;  5C39 A;  2M5A B;  2SPZ A;  2B88 A;  4HB1 A;  4GOF A;  1FC2 C;  1JM0 A;  4NPE A;  3S1K A;  4NPD A;  4ZMD A;  1EDK A;  2LXB A;  1BDC A;  3FXE A;  1MFT A;  2R44 A;  2OTK E;  4KJM A;  4GOE A; 
#chains in the Genus database with same CATH topology
 2OYH A;  3O6Q A;  2XV5 A;  3H1K E;  2KYV A;  5BU8 B;  1RF1 A;  1IO4 A;  1EQ7 A;  4ZNC A;  2M8R A;  2FYN C;  3BCC G;  5AW2 B;  2FFD A;  5GTH H;  2OYI B;  1AFO A;  5AW9 B;  5KLV J;  1FAV A;  4UB8 H;  5APW A;  1N2D C;  2M5A A;  2JJL A;  2WPS A;  3FWL A;  1OW6 A;  2NPS D;  2Z5H A;  1LTJ C;  2Z5I A;  3BCC J;  3L71 E;  2A06 D;  3NTN A;  1H88 A;  2GUV A;  4JYB A;  2K9Y A;  3L74 E;  1VQP P;  1AQT A;  5CCG D;  1EZV E;  3RBX A;  3BRT B;  3HD7 A;  4U3F E;  2HPC B;  2KS1 A;  4GT1 A;  5KAI H;  1Q82 Q;  2K88 A;  3AE7 C;  1ZXG A;  3FX0 A;  4WB4 A;  1NTZ K;  2JP3 A;  1KB9 I;  1OWA A;  3NFQ A;  5KLI C;  3VOP A;  2E75 B;  4BXL A;  4N78 D;  1URQ B;  4CPG A;  2PAJ A;  3RK2 B;  4HJG H;  1LP1 B;  1ZP0 C;  1ZOY C;  2HFE D;  4WY4 C;  4ZKP A;  1FZC A;  1VF5 B;  2G3A A;  3G3Z A;  3L36 A;  4OGQ B;  3AE3 C;  2WQY C;  1LGH B;  1KYO H;  1NU1 K;  2H43 A;  1H0T B;  2Q5U A;  1Y9B A;  3AE8 C;  3MTU E;  5CCG C;  3RK3 B;  1SQB G;  1SQB E;  2L91 A;  2FBW C;  2IZ1 A;  2E75 D;  2I1K A;  5AVY B;  1GL2 A;  3PP5 A;  3B71 A;  4YXW H;  1SLQ A;  1NU1 D;  2ZVO B;  1BCC D;  2FXM A;  3CCE P;  2K9J A;  1JY3 N;  4OVN F;  3Q1M A;  4IOI H;  1N8R Q;  4UB8 E;  1KN7 A;  1P84 H;  5AVV B;  3TGU D;  1ZR2 A;  2KI7 B;  2J58 A;  3PH0 A;  1EDI A;  3H1I J;  1NTK D;  2LXC B;  1CI6 A;  1AA0 A;  2QJP C;  1LTI C;  2Y0D A;  5AW4 B;  3M06 A;  1SVF A;  3MP7 B;  2PRR A;  2OYO A;  3IN6 A;  4AYC A;  4IL6 H;  4Y99 B;  3HE4 B;  3L72 G;  4WY4 B;  1Y47 A;  3KZI E;  5KLV E;  2WSC H;  3C1L A;  4H44 C;  1HH0 A;  1VDF A;  2QJK B;  3AE1 C;  2WWW A;  3QWO C;  1IFI A;  4GOD A;  2IYO A;  3N7N A;  1L0N E;  1NTM E;  2A06 G;  3V5B A;  5KKZ C;  4QMA A;  1QGK B;  2L5G B;  3LIE A;  3D6Y A;  4EI2 A;  4H0L B;  1L4A B;  1G2C B;  1GK4 A;  2W90 A;  3L74 J;  1LWU A;  4U3F G;  4Y28 J;  1KQF B;  4HYT B;  2XND H;  1L0L K;  2K3R A;  1QEX A;  1BGY E;  5K5G B;  1FZB A;  3C8V A;  3A7O A;  3H1H G;  3CXH I;  2QJY C;  1LT9 A;  1M1J B;  1VQ5 P;  4EYY Q;  1N7S D;  4WWI A;  2IZ0 A;  3GHG C;  3H1H D;  3BAT A;  1M8O B;  4D6T D;  1JY2 N;  1SQX E;  3CCQ P;  1LP1 A;  2IBZ G;  5E79 H;  1QL1 A;  1YQ3 C;  3TNU B;  1U7J A;  1IFP A;  3RBZ A;  1BCC E;  2O01 N;  3V2Q A;  2BCC G;  3KZI H;  1PPJ G;  5B66 E;  3L73 J;  3SFE C;  1SQV J;  1QX8 A;  1SQX G;  1ZW0 A;  3JC2 2;  2E5T A;  3WUT A;  3Q5P A;  1YJN P;  1KTM A;  2WPQ A;  3KQG A;  1ZN5 A;  4OGQ D;  1IFM A;  2O01 J;  3SFD C;  3CCU P;  2D2C C;  1X9V A;  2YMY A;  2N1T D;  3L73 G;  4U7J A;  4RJT A;  1URQ D;  3CCV P;  1GDT A;  1GK6 A;  3RL0 C;  5CJ4 A;  1FZF A;  3A0H E;  3H1K J;  1YTZ I;  2FXP A;  1BE3 E;  2E74 B;  4GIF A;  1NTZ D;  3ITK A;  3F5H A;  4PD4 H;  1SFC A;  2E76 C;  3MD0 A;  1KOR A;  1P84 D;  1NTM K;  2KOG A;  1M1J C;  2O3J A;  2Y9Z A;  2G8Y A;  2OGU A;  5AVZ B;  3T97 A;  1EZV I;  1ZLL A;  2B9B A;  2P10 A;  2SPZ A;  3UIA A;  3CWB E;  4PV1 B;  3GHG B;  4H0L C;  3CCJ P;  3CCS P;  2B88 A;  4HB1 A;  1VF5 C;  4N6J A;  2P2U A;  2M3B A;  2HOD B;  4PV1 C;  2P7J A;  1JOC A;  2Y0C A;  5AVT B;  4AQR D;  1IJD B;  2E43 A;  1SFC D;  4NPE A;  4PJ0 E;  1FU1 A;  1SQQ G;  1EDK A;  2POH A;  3P8M C;  3FXE A;  4WVZ A;  1K05 A;  1KYO I;  1YIJ P;  4C7N A;  3IAO A;  1BE3 J;  2J5U A;  1SQB D;  4KJM A;  1PZQ A;  1DD4 A;  1HUC A;  4R4M A;  4D6T E;  1OVR A;  2FY8 A;  1OW8 A;  3GF7 A;  3VP8 A;  4I1L A;  3RGU A;  1R8E A;  3G71 P;  2KUB A;  4GKG A;  2PGD A;  2JWD A;  1GW3 A;  1GZL A;  2C0X A;  1NKN A;  2M3E A;  3VTP C;  1FJP A;  3V2R A;  1JCD A;  1U7M A;  1W2B O;  2CK3 H;  1ZME C;  3B5N A;  2E74 C;  2O1K A;  2YXQ B;  3KPE A;  3H1I G;  1BCC J;  1HWT C;  1VQ9 P;  3MIW A;  1VQ6 P;  2R3S A;  3E7K A;  3RK2 D;  1VQ8 P;  2W6B A;  2Q6Q A;  1H0T A;  2IBZ D;  4N78 E;  1YI2 P;  3I55 P;  3CC2 P;  3L75 G;  1M56 D;  3VYI A;  1U57 A;  4XFJ A;  3D70 A;  4IFD K;  2N9B A;  2H7H A;  2PP6 A;  3CLQ A;  5KLV D;  1SS1 A;  1NTZ E;  2RN0 A;  4PD4 D;  1K8A Q;  3LW5 H;  4R4L A;  3RK2 C;  3L70 G;  1J1E C;  3U1A A;  1DD3 A;  3FXD A;  3GMA A;  3MUD A;  3H32 A;  5GTI E;  3G4S P;  3H1L D;  1KYO E;  1OFC X;  3LW5 J;  4IFM A;  3RK3 C;  4DZO A;  2P1J A;  2B89 A;  3A0B E;  1VQO P;  1OXZ A;  2IX7 C;  3EFG A;  3HE4 A;  5AVX B;  1Q86 Q;  2JDI H;  3L35 A;  3AE2 C;  2Z4E A;  1VQK P;  2Q3E A;  1KMI Z;  2N9Y B;  4L75 A;  1JTH B;  3HD7 B;  4W7Y A;  2M0B A;  1LTJ A;  3RK3 E;  2KSJ A;  2I8D A;  2NZ2 A;  2VRS A;  4L76 A;  5EFW B;  5KKZ B;  3GLM A;  3R2P A;  1K9M Q;  1RHZ B;  2I1J A;  1LT9 B;  2WVR A;  2QRX A;  3AED C;  2AXT H;  2Y0E A;  3TGU G;  1SQV D;  1JNM A;  1NWQ A;  1EDL A;  1NU1 J;  1IFN A;  1NYH A;  2MJZ A;  1IK7 A;  1OIP A;  2W83 C;  3AEC C;  1YJW P;  3HTK A;  1GW4 A;  3AE6 C;  1N7L A;  3HUS B;  3V2P A;  1RF0 C;  3H1I D;  1KQL A;  1NTK J;  5APX A;  2N1T C;  1S1C X;  1KFM A;  2CPS A;  1NTZ J;  1L0N J;  2P58 A;  3H1H E;  2KZJ A;  1DH3 A;  1G1J A;  3CC4 P;  2N1T B;  2ZVN B;  3KXD A;  3PLN A;  2PFX A;  3CWB G;  1KYO D;  4WBA A;  5CMZ A;  1R5S A;  3S4R A;  3WUV A;  2QA4 P;  4OH8 B;  4EOT A;  5TIS E;  5AW5 B;  4YTP C;  1H89 A;  1BGY J;  4K35 A;  3AEF C;  4OGQ C;  1EXI A;  3M9H A;  1DIP A;  1OVU A;  1BE3 G;  4PD4 I;  1OMI A;  2XU6 A;  2IPP A;  1SQB K;  3MZW B;  3CCR P;  1PP9 E;  2WPV B;  3A2A A;  4PV1 D;  1YHQ P;  3S9O A;  1S72 P;  1ZRT E;  3SSU A;  1NU1 G;  3RL0 D;  1BE3 D;  1P84 I;  1SQP E;  3GHG A;  3RK3 D;  3VN0 A;  3WU2 E;  2K37 A;  3Q5S A;  2C9L Y;  5BU5 A;  1CW5 A;  3VMA A;  1P84 E;  1J2J B;  2NRG A;  5M1B A;  3IF4 A;  3D71 A;  3H1H J;  4IFF A;  4KT0 J;  1JY2 P;  2IYP A;  4H44 B;  1N86 A;  1S5L E;  4ASV A;  1N7S C;  2IBZ E;  3MUD C;  4H13 B;  1N73 C;  1JMM A;  1RE4 A;  2WSE H;  1URQ A;  2ZFC A;  1JY2 O;  2E76 B;  1NHL A;  2YO2 A;  3U59 A;  3Q2Y A;  1S9K D;  2ZYG A;  3L73 D;  2KZI A;  4EIJ A;  4HH2 A;  1KIL D;  5APQ A;  5KJ7 A;  4RES B;  1PV3 A;  2O1J A;  3MGN A;  2WT7 B;  2R32 A;  2R5D A;  1T6A A;  5APS A;  1HF9 A;  2FYN B;  3B5N B;  3KHU A;  3H1K D;  2W27 A;  4L74 A;  1QLE D;  1A02 F;  3CX5 E;  1BSN A;  4GOF A;  5TJH A;  4BRY A;  3B5N C;  1VQM P;  1FS0 E;  4YPC A;  1NAY A;  3TDK A;  2NPS B;  2WIT A;  3WUU A;  2K9J B;  1MKM A;  1SQQ E;  4NPD A;  3S1K A;  1KIL B;  4ZMD A;  1BDC A;  1MFT A;  1QL2 A;  1FJK A;  3AE4 C;  2E74 D;  3E1I A;  2A45 G;  1HJ0 A;  2D2C D;  1T3J A;  2V7Q H;  4KHX A;  3WMM 0;  5GTI H;  3F89 A;  1ZR4 A;  1PP9 D;  1XTC C;  4XA4 A;  4H0L D;  3CME P;  2D2C B;  4PD4 E;  3II6 A;  5APV A;  5AW1 B;  2AEM A;  3Q3D A;  1KD1 Q;  2ZYA A;  2BCC D;  3T97 B;  3PTZ A;  3A5T A;  5CCG A;  5KJ7 C;  2AEJ A;  3CD6 P;  2KNC A;  2KB7 P;  1SQB J;  4JBZ A;  1FZA A;  2P67 A;  5GTH E;  2KSE A;  3N4X A;  3TK1 A;  4C7N B;  1RQV A;  3BCC E;  1K73 Q;  1RE4 C;  3SWK A;  2AEF A;  4RKU J;  1IK9 A;  1N7S A;  4W80 A;  1S9K E;  4IL6 E;  1JO5 A;  1EDJ A;  3VMZ A;  1SFC C;  1HBW A;  1VQN P;  2QJY B;  3BAS A;  3HD7 C;  3A3Y B;  4O9B A;  2FYU K;  4W7Z A;  1IFJ A;  2YKP A;  3V2N A;  3G9R A;  2E76 D;  3BRV B;  1EXJ A;  1NAF A;  1X22 A;  2FYU G;  2YMK A;  4I7Z B;  4JPZ B;  4DJG A;  3CX5 H;  1Z56 A;  1K04 A;  4TT3 H;  3CX5 D;  4H44 D;  5APT A;  4ZKU A;  1KB9 H;  1HJB A;  1KFN A;  3H1L G;  4PJ0 H;  1YTZ T;  1ZV8 A;  1SQP K;  1SQQ D;  2FYU D;  5H2F E;  4UB6 E;  2GM4 A;  2W6J H;  3LID A;  3H1J G;  3L71 J;  3H1L J;  1E5W A;  1CSB A;  1NO4 A;  3HRN A;  1Q2N A;  2LKM A;  5APU A;  5CBN A;  1RF1 C;  1ZRT D;  1MZ9 A;  1GMJ A;  1SQP D;  1YJ9 P;  2N1T A;  3L71 G;  2FKW B;  2IDB A;  1LT9 C;  4NPF X;  2W6A A;  3H1J E;  2AXT E;  1RF0 A;  1SFC B;  1NVO A;  1KQG B;  1T8Z A;  2HR3 A;  2WSF J;  3NXS A;  4LGD E;  2QEX P;  1H8A A;  3L72 J;  5DJT B;  1GL2 D;  4UB6 H;  1GTW A;  2XNX A;  2OYH B;  1LWU C;  2LR2 A;  4M3L A;  2QVA A;  3E1R A;  3L75 J;  2HYN A;  2RH0 A;  3WU2 H;  2B87 B;  1L4A C;  4AUW A;  1L4A D;  3M0D A;  1BSH A;  1PPJ E;  5CCH A;  1DX7 A;  2YNY A;  1WT6 A;  1G1I A;  1S3J A;  3ZDM A;  5AW8 B;  3TGU E;  1FDI A;  3L4F A;  1X8Y A;  1L0L D;  1FDM A;  3OA7 A;  5KJ7 D;  3W67 A;  1NTK E;  2KIK A;  4Y99 C;  1LTJ B;  2WSS H;  3H1J J;  2GA1 A;  1S2E A;  1WMK A;  5KAF E;  3W68 A;  2QJP B;  1YQ4 C;  5AW7 B;  1KB9 D;  3BVH A;  1PIX A;  5AW3 B;  1PGJ A;  1L2P A;  1JY3 O;  1L0N D;  5BVZ A;  2YXR B;  3RL0 B;  2KLU A;  1SQV K;  1VL2 A;  3M91 A;  3OJA B;  1GU4 A;  2Q9I A;  1FOS E;  1J1D C;  2H88 C;  3HD7 D;  4OWF A;  3B5N D;  1EC5 A;  2H89 C;  1NH4 A;  2ZAE B;  1L0N G;  4HKZ H;  1GD2 E;  1DEB A;  1AVY A;  1BGY D;  1SQX K;  1RE3 A;  2JWA A;  4JYC A;  4LLH A;  1FOS F;  3V6I A;  3AE5 C;  2KP8 A;  5KLV G;  1SP4 A;  1PP9 J;  3VP9 A;  3GW6 A;  3V4Q A;  1RE3 C;  1KC8 Q;  2ZYD A;  1XTG B;  1Y8A A;  2BCC J;  1NTM J;  4TLF A;  3L70 D;  1SQX D;  3L74 G;  4U3F J;  2Q7C A;  4C7R A;  1OX3 A;  1M57 D;  3RL0 g;  1FE6 A;  2JKV A;  2CPB A;  5AVS B;  2V7Q J;  3L75 E;  3P8C E;  4MN4 C;  1T3U A;  1HTL C;  3IR9 A;  3CCM P;  1NTK G;  2NPS C;  1JB0 J;  4WY4 D;  3V4W A;  2WTY A;  1CI6 B;  3QH9 A;  2M5A B;  5AVU B;  2E5Y A;  5KLV K;  4EDF A;  3M9Q A;  2XDJ A;  1OW7 A;  3JCU E;  2BAS A;  2BEQ D;  5AVW B;  1S4X A;  1JTH A;  1IZN B;  3CWB J;  2OTL P;  3CI9 A;  2C9N Y;  2QG4 A;  1JM0 A;  2A45 H;  2QJK C;  1KB9 E;  3HE5 B;  4IL6 X;  2YIU B;  2J59 M;  5APY A;  1OZH A;  2QE7 H;  5KLI B;  1AVO A;  2JO1 A;  2Q3I A;  1KQS O;  2FFD C;  1HVV A;  1PP9 G;  4I6M C;  2YIU C;  1L4A A;  4JF7 A;  2V4H A;  2QM7 A;  2ZT9 B;  3BCC D;  4GOE A;  5B5E E;  1S5L H;  1SQQ J;  2KLV A;  3CX5 I;  2H8P D;  5E79 E;  4GDO A;  1VPC A;  3NMD A;  3A0H H;  1X79 B;  2WT7 A;  2ZJS E;  3HTK B;  1VQ4 P;  2IFM A;  3L70 E;  1M1J A;  1MUU A;  3SWY A;  1EZV G;  1LTG C;  1Q90 D;  2Y9Y A;  1PGO A;  1YYC A;  1FZC B;  1T2K D;  4DT0 A;  2DW3 A;  3PRJ A;  4XE5 B;  3TYY A;  1A02 J;  3EWK A;  3H1L E;  1FZE A;  1JUN A;  1J1E B;  1FDO A;  3MHV A;  5B5E H;  1KIL A;  3L72 D;  2O01 H;  5KTB A;  1PPJ D;  1DEE G;  1USE A;  1NJI Q;  2OTJ P;  3OW2 O;  1PFI A;  1VQ7 P;  2FYU E;  3B4S A;  3L75 D;  1LNQ A;  3P8C D;  4RO0 A;  1PGP A;  3U1C A;  1MV8 A;  1E79 H;  3M9B A;  1KIL C;  3SWF A;  5KAI E;  2RKL A;  1TU3 F;  2WZ7 A;  1LTT C;  2YKQ A;  5H2F H;  1T2K C;  2FFD B;  1L0L J;  2IBZ I;  2K1A A;  1N73 B;  3H6P A;  2MKV A;  2FXO A;  3H1J D;  3H25 A;  1UIX A;  3P7K A;  2E42 A;  2KXP B;  3FGA D;  1JCC A;  3I56 P;  4H13 C;  2W8Z A;  1D7M A;  2HG5 D;  2FYZ A;  2YKO A;  1RH5 B;  1SQV E;  3KYQ A;  3OAK A;  4B86 A;  1NGM B;  1M1K Q;  2ZT9 D;  3CC7 P;  1AQ5 A;  2XZR A;  1OVV A;  2HOD A;  2ITA A;  1YBK A;  1HGZ A;  1LWU B;  1BGY G;  2KS1 B;  3AE9 C;  2FYU J;  2JR8 A;  3HE5 A;  2Q1K A;  2OYI C;  5AVR B;  4Z1M H;  5CCH C;  1L0L E;  1FZG A;  3L71 D;  1SQQ K;  3AEB C;  1Q7Y Q;  2GUS A;  1NTM G;  2A06 E;  2OQQ A;  3EQ2 A;  1NOH A;  1NTK K;  3AEG C;  3GG2 A;  3IFM A;  3L74 D;  1SQP J;  1W5C E;  1PL5 A;  2IFN A;  1L0N K;  3TSI A;  4DOJ A;  1BDD A;  1S5L X;  1MFZ A;  1VQL P;  1GU5 A;  5AVQ B;  4BRY B;  3L72 E;  1L0L G;  1NTZ G;  1EZV D;  3CXH D;  4JQ0 D;  3C9I A;  1YIT P;  2NPS A;  1FBM A;  3A0B H;  3M0A A;  4U3F D;  5CCH D;  1J1D B;  1CZQ A;  2QIW A;  3CCL P;  3EFF K;  1KV4 A;  2AXC A;  1VF5 D;  1AJY A;  3PJS K;  1GL2 C;  1M7L A;  2WSF H;  5DJU B;  2ZT9 C;  3O6Q B;  1RF1 B;  2ZXX A;  1RQU A;  4BWN A;  1AV1 A;  2OYI A;  3AEA C;  3VMX A;  3FWN A;  3H1I E;  2OAR A;  2R5B A;  4A7P A;  3TF5 A;  2KNC B;  3USS A;  5TIS H;  1FZC C;  2B87 A;  1URQ C;  2WSC J;  1JY3 P;  4WY4 A;  3CL3 D;  1LTS C;  3H32 B;  1M90 Q;  2XKM A;  5CHX A;  3G6E P;  1N73 A;  3TGU J;  4I7Z C;  4C46 A;  1N7S B;  1SQP G;  2UWJ E;  1NU1 E;  3O8Z A;  3JSV C;  4D6T G;  2KK7 A;  2BEZ F;  3CMA P;  3VMY A;  1KIL E;  2WSE J;  1X0T A;  3GF3 A;  1JMB A;  1G2C A;  1LT1 A;  2HPC A;  2HLO A;  5AW6 B;  4ASW A;  5CBO A;  3P32 A;  2WMM A;  1KZU B;  1UII A;  1HGV A;  1IFD A;  4H13 D;  3ABV C;  3Q5R A;  4I2L C;  5CJ0 A;  1USD A;  2ZXE B;  2WPR A;  2QM8 A;  2RMZ A;  2YO3 A;  3CXH E;  4K3A A;  4L73 A;  3AEE C;  2JEE A;  4N3Y B;  5C39 A;  1LJ2 A;  1LTB C;  3B8E B;  2QSI A;  3JCU H;  5L8R J;  4DCK A;  1NTM D;  4YXD C;  5B66 H;  2C0W A;  1SQV G;  1SQX J;  2R3C A;  3CXH H;  3L70 J;  3M0D C;  3R4Y A;  3KDP B;  4LC1 A;  3TNU A;  5KAF H;  2OYH C;  3D6Z A;  1GL2 B;  3CPW O;  1QVG O;  1LTA C;  1QVF O;  1WRG A;  1RY3 A;  1FC2 C;  1JEK A;  3L73 E;  2BCC E;  1IC2 A;  1BCC G;  3HUS A;  3PHL A;  4D6T J;  2A45 I;  3H1K G;  3I5C A;  3L37 A;  2LXB A;  5AW0 B;  1Q81 Q;  2E75 C;  3HUS C;  3K5B A;  2R44 A;  2OTK E;  1NKZ B;  1R5L A;  1PGQ A;  1W2E A;  3CWB D; 
#chains in the Genus database with same CATH homology
 1OVR A;  3RGU A;  4ZNC A;  2KUB A;  2JWD A;  1U7M A;  2M5A A;  4JBZ A;  1H0T A;  3MHV A;  1DEE G;  1EDJ A;  1SS1 A;  1ZXG A;  3FXD A;  4BXL A;  2RKL A;  4CPG A;  4HJG H;  1LP1 B;  2B89 A;  1H0T B;  1Q2N A;  5CBN A;  1OVV A;  2KS1 B;  2M0B A;  2I8D A;  5EFW B;  2Q1K A;  4NPF X;  4IOI H;  2HR3 A;  1NVO A;  2KI7 B;  3PH0 A;  1EDI A;  5DJT B;  2LXC B;  2QRX A;  1EDL A;  2LR2 A;  2QVA A;  2B87 B;  1BDD A;  1Y47 A;  1S3J A;  3QWO C;  4GOD A;  3ZDM A;  2P58 A;  2KIK A;  2KZJ A;  5DJU B;  2K3R A;  5K5G B;  4K35 A;  1OVU A;  4EYY Q;  4WWI A;  2B87 A;  3MZW B;  1LP1 A;  1EC5 A;  2ZAE B;  4HKZ H;  1U7J A;  2UWJ E;  1X0T A;  1JMB A;  1ZW0 A;  1LT1 A;  5CBO A;  4ASW A;  4ASV A;  2WMM A;  4K3A A;  2KZI A;  4MN4 C;  5C39 A;  2M5A B;  2SPZ A;  2B88 A;  4HB1 A;  4GOF A;  1FC2 C;  1JM0 A;  4NPE A;  3S1K A;  4NPD A;  4ZMD A;  1EDK A;  2LXB A;  1BDC A;  3FXE A;  1MFT A;  2R44 A;  2OTK E;  4KJM A;  4GOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...