1EDKA

Staphylococcal protein a e-domain (-60), nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
56
structure length
56
Chain Sequence
b'AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL PROTEIN A
publication title Solution structure of the E-domain of staphylococcal protein A.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immunoglobulin-binding protein
total genus 20
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1996-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1edkA00
2UWJE 1BDDA 1SS1A 4JBZA 3FXEA 4CPGA 1NVOA 2RKLA 3PH0A 1JM0A 4GOEA 3MHVA 1LP1A 1U7MA 1OVVA 1H0TA 4EYYQ 2M5AB 2KZJA 2KIKA 3ZDMA 2JWDA 4HJGH 4ASVA 4HB1A 2KZIA 5DJUB 2KUBA 2M0BA 5CBOA 1EDJA 1EDLA 2I8DA 1U7JA 4HKZH 4KJMA 4WWIA 1X0TA 1S3JA 5K5GB 2B87B 3MZWB 4K35A 1Q2NA 2OTKE 2QVAA 2Q1KA 4NPEA 2HR3A 5DJTB 2WMMA 2R44A 3FXDA 1OVUA 2B88A 1H0TB 2LXCB 3S1KA 2KI7B 2LR2A 4ASWA 3QWOC 2B87A 4GODA 1JMBA 1OVRA 2M5AA 2B89A 1MFTA 5C39A 4NPDA 1DEEG 4MN4C 2K3RA 4GOFA 1ZW0A 2LXBA 3RGUA 1EDKA 4BXLA 1BDCA 2QRXA 1EDIA 1EC5A 4ZNCA 2SPZA 4IOIH 1LP1B 1ZXGA 4NPFX 1FC2C 1LT1A 1Y47A 2KS1B 4K3AA 4ZMDA 2P58A 5EFWB 2ZAEB 5CBNA
chains in the Genus database with same CATH superfamily
1PPJG 1LT9B 1EZVD 2FYNC 2J58A 1NGMB 2H8PD 2ZFCA 1JTHB 1GD2E 3HE5B 2YXRB 3CD6P 3AE7C 1SQBE 4C7NB 4N78E 2FBWC 2AXTE 2M5AB 4LGDE 1N7SA 3HE4B 4UB8E 2KIKA 1QLED 1YHQP 3Q1MA 5KLVJ 2KZIA 5AW0B 4LC1A 3V2QA 4DCKA 3CCUP 3V6IA 3CX5H 3JCUH 4I2LC 3CC4P 4L76A 3BATA 3I5CA 2I1JA 5AVTB 1PPJD 5KTBA 3BASA 1GZLA 4H0LD 1SQVG 1JY2P 4D6TE 3CWBG 3BRTB 1CI6A 4H44B 3RK3D 2W6BA 2JEEA 1DD4A 3SWYA 4OVNF 3PTZA 3M0DC 2IPPA 1ZV8A 2FYUE 1MFTA 3A7OA 1PP9D 1QEXA 5TJHA 1BDCA 1URQC 2N1TD 2H89C 1L0NK 2NPSB 2M8RA 4PJ0E 1PGJA 5CCGC 1T3JA 4EDFA 2P58A 3WUUA 3CPWO 2YNYA 2LKMA 1GL2A 1AA0A 4ZKPA 3AEEC 1FDMA 5APTA 1S5LH 2IYOA 4H0LB 3II6A 3CX5I 3AE4C 1ZN5A 3LIDA 2WSSH 1PP9J 1RF0A 4W7YA 2R32A 3CI9A 5KJ7D 1BCCG 2E74C 1X79B 2P10A 3VMXA 3H1HE 1JCCA 1RQUA 3L4FA 3MGNA 1PV3A 1L0LG 5CBOA 1EDLA 2I8DA 1VQ7P 1U7JA 5AVUB 3CWBJ 4Y28J 3M06A 1GW3A 1KB9I 3RL0g 1VF5D 1E5WA 1CW5A 1YBKA 4M3LA 2ITAA 2R44A 2Z4EA 2WPQA 1NJIQ 3HD7A 3RL0D 3VYIA 1AFOA 1L0LD 4YXWH 1EC5A 4XA4A 1IFNA 5KLVE 1M1KQ 1LT1A 1RE3C 1QL2A 1KV4A 1JEKA 2WPSA 3SFEC 1NKNA 2OTJP 1SQXG 4GIFA 4IL6H 1X9VA 2H7HA 4U3FG 1EZVE 3RK2D 1BGYD 3G6EP 2L5GB 4PD4H 1NHLA 1KQGB 1Q86Q 1N7SD 1NU1K 1VF5B 5GTIH 1RQVA 4EYYQ 1L0LJ 5CCHC 3LW5H 2IFNA 4HB1A 1FDOA 3RL0B 3V4WA 1USEA 3MTUE 2V7QJ 3KXDA 3AE3C 4KJMA 4BRYA 3G4SP 1SQXD 1T6AA 2O1JA 1PPJE 3V2NA 1N73A 3F89A 4WY4C 2RH0A 4GDOA 3RK3E 2QJPC 2D2CD 3CX5D 5AW1B 3I56P 3M9HA 3LIEA 3K5BA 1J1EC 2WTYA 1PIXA 3KQGA 1SQQG 1YTZI 2A45I 1PP9E 2LXBA 3RGUA 1SQXJ 2Q6QA 4PD4I 4LLHA 3NMDA 2HG5D 3Q2YA 1GL2D 3VMAA 1KORA 2Q3IA 3AEAC 2KS1B 5CJ4A 4K3AA 1FAVA 3GF3A 5B5EH 1GK6A 3G3ZA 2KNCA 3PH0A 1SFCA 1NH4A 3AECC 1IK9A 3L74G 3H25A 1U7MA 3PRJA 2E76D 1ZLLA 3P8CD 1LTTC 1X22A 1SQQD 1N86A 2P1JA 2WITA 4D6TG 1GDTA 2WT7B 2OYIB 5BVZA 4YTPC 3CCEP 1RHZB 1MZ9A 2BCCD 2K9JA 1USDA 2OQQA 2E75D 1SVFA 1M90Q 3AE2C 1GL2B 2C0XA 1LTJC 1T3UA 3TK1A 2OTKE 2FYUG 1YQ4C 1UIXA 1E79H 1J1EB 4I7ZB 3L74D 2HR3A 3WUTA 2KLUA 3V4QA 1KFNA 3HD7D 4IFDK 3BCCD 1SQQJ 1OVUA 1FU1A 2LR2A 3I55P 1L4AC 1VQKP 2E76B 3FWLA 4XFJA 1KILC 3H6PA 2BCCJ 1L0LE 1M56D 1LWUC 1LP1B 3AE6C 1GTWA 1HUCA 1PGQA 1QL1A 2YKQA 3B4SA 3H1IG 3L74J 1NTKG 4A7PA 2PAJA 2W27A 2E75B 1OMIA 1NVOA 1BGYE 2O01H 4QMAA 4GOEA 3TSIA 2C9NY 3L73D 1H8AA 1K9MQ 4WBAA 2YIUC 1FZFA 2ZYDA 3IAOA 1P84H 3HD7B 5AW6B 1N8RQ 2Z5HA 2FXMA 4JF7A 1FBMA 2QEXP 1FZBA 1KTMA 5AW3B 4XE5B 4PD4D 3H1ID 1LT9C 1M1JA 5BU8B 1YIJP 4WVZA 1SQXE 2BEQD 1NTKD 3TYYA 3MZWB 1R5SA 1K05A 3L73J 2M3BA 2OARA 2RMZA 1OZHA 1GU5A 3EFGA 1FZGA 2K1AA 3MIWA 4I1LA 1ZOYC 2HFED 4OGQD 2E5TA 3CX5E 3B5NA 1S72P 2ZXEB 3JCUE 5AVRB 4ASWA 3TNUA 3EWKA 1OW6A 1VQ6P 2YKOA 1WT6A 1SQPK 3OJAB 4BXLA 3H1IJ 3L70D 2W83C 1NTKJ 2FXOA 2B9BA 1YYCA 4YXDC 1SFCD 3M9BA 3G71P 4U7JA 1P84I 4H44C 1NTMK 3M91A 3L37A 2H43A 4DOJA 2Q5UA 1VQ9P 2H88C 2CPSA 3HRNA 2YMKA 4C7RA 2RN0A 1FE6A 1HVVA 1H0TA 2QM8A 5TISH 3P8CE 4OGQB 3L70J 1LTSC 2BEZF 1SQQE 1RF1A 2KLVA 2NPSC 1NU1D 1JNMA 3B8EB 3H1LD 1LTAC 4R4LA 1S5LE 5KKZB 2BCCE 1KYOI 2J5UA 1LTIC 2FFDA 1KQLA 2MKVA 3NFQA 4H0LC 1ZRTD 2KNCB 1SFCB 3FGAD 1PP9G 2R3CA 3L74E 2PRRA 1CZQA 1EXJA 3VP9A 3BCCE 2J59M 4ZKUA 2HODA 1OVRA 1SQBK 1OW8A 1JMMA 4RESB 3H1LJ 3TGUD 1JUNA 2QRXA 4OH8B 1EDIA 1OW7A 2PFXA 2N1TC 1NAYA 2C9LY 4W80A 3H32B 2K9JB 1HGZA 3CCJP 2QA4P 2ZT9D 3PHLA 1KB9H 4JBZA 1SLQA 1JB0J 1NTZK 3FXEA 5B66H 2OYHC 4JPZB 5AW7B 3L73E 2C0WA 2XV5A 3ITKA 4DJGA 1KD1Q 1VQLP 1OX3A 3A0HE 3TGUJ 3VMZA 5KJ7C 3MUDA 1VQ5P 2Q7CA 2KK7A 4IL6E 3U1CA 4PD4E 3RK3B 1VPCA 1LTBC 1T2KD 3H1IE 1NTKE 1W2BO 5GTIE 1P84D 2K88A 5CMZA 3B5ND 1VF5C 1VQPP 1HTLC 2NRGA 2NZ2A 2HPCA 2N1TB 3GHGB 1S2EA 2QIWA 3RL0C 3HUSA 1FZCA 3KDPB 4JYCA 1A02F 2O01J 4OWFA 1BGYG 3L70E 1M1JB 1N2DC 2OYHB 4UB6H 1DIPA 1HWTC 3IF4A 2ZAEB 3H1KD 3VN0A 2Q9IA 1KMIZ 1WMKA 4L75A 3RK2C 3USSA 1JM0A 1X8YA 2KSEA 3T97A 3M9QA 3GG2A 1IFPA 1N7SC 1JO5A 3B5NB 2QE7H 2ZVNB 2YXQB 1AJYA 1HJ0A 3TNUB 1BSHA 4H13D 2A45H 4AUWA 1HBWA 5B5EE 4AQRD 3D6ZA 3H1LE 3H1KJ 3ABVC 1DH3A 4TLFA 2KOGA 4WWIA 2WQYC 5KLVK 2WSCH 1FOSF 1KFMA 2XDJA 4L74A 1ZRTE 1BE3D 4PV1D 1LNQA 1AQTA 1KILA 4KT0J 2WMMA 3NXSA 1AV1A 2JKVA 1H0TB 4I6MC 1RH5B 4GT1A 1BGYJ 2B87A 3QWOC 2QM7A 1PFIA 4IFFA 1TU3F 1RF1B 1DEEG 2ZYAA 2OYIC 3TF5A 3TGUE 4H13B 2SPZA 3CCLP 4EI2A 3RK2B 3Q5PA 2WSEH 1GL2C 2K37A 1RY3A 1H88A 3MD0A 4RO0A 2FFDB 1YQ3C 5EFWB 1IZNB 1BE3J 1OVVA 1N7SB 4I7ZC 3PJSK 4N3YB 2Y9YA 3QH9A 5AVVB 1GW4A 3SSUA 1JY2N 1PGPA 1QGKB 2OTLP 1RF0C 3JC22 1NTMD 4EOTA 1S5LX 2KB7P 2E76C 3P8MC 2HODB 2BCCG 3D6YA 2Q3EA 3CC2P 4HJGH 3V2PA 1OXZA 1CI6B 1KB9D 1JTHA 2V4HA 2FXPA 1JY3P 3IN6A 3BCCG 2E75C 2N9BA 3HE4A 1S9KD 4EIJA 2D2CB 1RE4A 1PGOA 2ZJSE 1SQVK 1P84E 1K04A 1NTMJ 2QJKB 5AVZB 3HD7C 3CL3D 2OGUA 3FXDA 1HH0A 2Y9ZA 3CLQA 1Q82Q 3CCRP 3OA7A 1VQNP 2KSJA 3H1JG 2OYOA 1IFIA 2HLOA 4ZNCA 3L36A 1L0NG 1NWQA 1FC2C 3L73G 5AVWB 5AVYB 3L72D 5H2FH 2JWAA 3H1KE 3AEFC 4DT0A 3N4XA 4IL6X 1VQMP 1AVOA 1OIPA 1VDFA 2NPSA 2A45G 1VQ4P 1NTZD 2GM4A 2YMYA 3G9RA 1K8AQ 1EZVI 3HUSB 3H1JD 1FZCB 5E79H 4ASVA 3E1IA 1G2CA 1W5CE 1L0ND 3BCCJ 3L72J 2PGDA 1L0LK 3KZIH 2IDBA 1N73C 1VL2A 3CMAP 1FJPA 1L4AD 2O1KA 2WPVB 1KILD 2GUVA 2JR8A 3A0BH 2N9YB 1LJ2A 4YPCA 5TISE 1BE3E 3T97B 1PZQA 1NTZJ 3L70G 4OGQC 3L75D 1IC2A 3H1JJ 2LXCB 3KPEA 1L0NJ 1IJDB 5M1BA 4NPDA 3M0DA 2FKWB 4MN4C 3CCQP 5AW9B 5KKZC 4IOIH 4RJTA 2Y0EA 1ZR4A 1KYOH 1URQA 4ZMDA 3C8VA 1SFCC 4R4MA 1SQXK 1GMJA 2R5BA 2P2UA 5CCGA 1DX7A 3L75J 5KAIH 2GA1A 3AE8C 3CXHH 1NU1G 1R5LA 3H1LG 4BRYB 1NTME 5CJ0A 2WSCJ 4RKUJ 3LW5J 2WSFH 1N73B 2JWDA 3L71D 5DJUB 1KB9E 4HKZH 2KXPB 1MUUA 3O6QA 5B66E 1J1DB 5K5GB 3N7NA 3S9OA 3WUVA 1S9KE 3Q5SA 1M8OB 5BU5A 2M3EA 2QVAA 3VTPC 1YITP 1JY2O 1Q81Q 2YO3A 4HH2A 2FYZA 3C9IA 3TGUG 2WSEJ 2AXCA 2GUSA 2W90A 2B88A 3VOPA 3L71J 2WVRA 4GODA 4HYTB 1S4XA 2WPRA 1SQQK 4WB4A 2IZ0A 3RK3C 4Y99B 5KAFH 2JJLA 3KHUA 3GW6A 3CXHI 3E1RA 2P67A 1IFDA 3L72E 1ZR2A 2ZT9C 1NU1J 1RE3A 3SWKA 2NPSD 2RKLA 1K73Q 2CPBA 1UIIA 2W8ZA 3C1LA 3VMYA 3GHGC 2KS1A 3M0AA 1A02J 2XNXA 1NTZE 3WU2H 5L8RJ 3ZDMA 3H1JE 3WMM0 2AEJA 1IK7A 4UB6E 5CCHA 1QVGO 1M1JC 3PLNA 1L0NE 3EQ2A 1HF9A 1GU4A 1KN7A 3V5BA 1X0TA 1FJKA 2W6AA 1T2KC 2G8YA 2WWWA 1LTGC 1Q2NA 2IBZI 5GTHH 5KLIC 1KILE 2JO1A 2FYUK 2W6JH 3AE9C 3MP7B 3B5NC 2HYNA 2FYNB 2WT7A 2OYIA 4WY4A 3AE1C 1HJBA 3L75E 1JOCA 3S1KA 3Q5RA 1SQVD 3CWBD 5AW8B 3H1KG 1G2CB 1KQSO 2ZT9B 1FZAA 1URQD 4JYBA 3A3YB 3S4RA 2AXTH 2YO2A 4UB8H 1IFMA 5CCGD 4B86A 1CSBA 1NKZB 1ZP0C 2UWJE 1SS1A 1NTKK 4KHXA 5AVXB 2IZ1A 3F5HA 3MHVA 3P7KA 1LP1A 1SQVJ 1NAFA 4TT3H 1W2EA 3RBZA 4O9BA 1RF1C 1Z56A 1KYOD 2E74D 1NOHA 4H13C 1QVFO 2A06G 3L71E 1R8EA 1GK4A 3TDKA 5AW5B 2M0BA 1BE3G 1G1JA 2FFDC 5KLIB 2O3JA 1BSNA 2CK3H 3E7KA 1URQB 2XZRA 3CXHD 1BCCD 4Z1MH 1MKMA 3O8ZA 4PJ0H 4PV1C 2E43A 1LTJA 2IBZG 3A0HH 1YJ9P 1NU1E 3Q3DA 2AEFA 1Y9BA 2AEMA 2A06D 5C39A 1SQPG 1DD3A 2IFMA 3V2RA 2E74B 1L4AA 2QG4A 4JQ0D 1BCCJ 3O6QB 3CC7P 1XTGB 2D2CC 1YI2P 1LWUA 2E42A 1SP4A 1NTMG 3CCVP 2WSFJ 5CBNA 1FS0E 2QJYC 1BDDA 2QJKC 2IBZD 1KZUB 3IFMA 1YJNP 3KYQA 3D71A 1JY3O 3MUDC 1IFJA 2MJZA 4U3FD 1S1CX 1EQ7A 2KZJA 5CCHD 1DEBA 2XNDH 1SQPD 4C46A 5H2FE 1AVYA 2R5DA 1EDJA 2DW3A 1N7LA 4PV1B 1S3JA 3HTKA 4K35A 2FY8A 1LT9A 1FOSE 3IR9A 4AYCA 3CMEP 4WY4D 4GKGA 3FWNA 4W7ZA 2KYVA 5E79E 5AVSB 5DJTB 3U59A 4U3FJ 3W67A 5AW2B 1SQPJ 3HE5A 3HUSC 3U1AA 1FZCC 4C7NA 1SQBG 3CCSP 1JMBA 1SQVE 2M5AA 3KZIE 2P7JA 1KC8Q 3L72G 3CWBE 2L91A 2QJYB 1ZXGA 3A0BE 2ZXXA 4NPFX 4DZOA 3R2PA 2IYPA 1Y47A 2E5YA 2POHA 1IO4A 2VRSA 1MV8A 3NTNA 4L73A 1NTZG 4CPGA 2JP3A 3PP5A 3W68A 2KP8A 3VP8A 4WY4B 3AEGC 5APQA 3H32A 3R4YA 1SQBD 4N78D 1FDIA 2QJPB 1KYOE 2O01N 3OW2O 2R3SA 2KUBA 3OAKA 3L35A 5CHXA 5APYA 3A2AA 2Y0CA 1VQOP 4BWNA 5KAIE 2ZYGA 2HPCB 3CXHE 3L75G 1XTCC 1J2JB 1D7MA 1BCCE 4D6TD 3JSVC 3BVHA 1FZEA 2Q1KA 1HGVA 2XU6A 1SQBJ 5AVQB 5APSA 2Y0DA 2I1KA 2ZVOB 2KI7B 1AQ5A 1OWAA 2FYUD 3D70A 2A06E 5APVA 4GOFA 4N6JA 1EDKA 1OFCX 2WZ7A 1J1DC 3H1HG 3CCMP 3GLMA 1ZMEC 1M57D 1MFZA 3P32A 3FX0A 4D6TJ 1KQFB 2N1TA 2XKMA 1U57A 3GHGA 5AW4B 2JDIH 1G1IA 2IBZE 1LTJB 3L71G 2QSIA 1YJWP 2Z5IA 1T8ZA 1Q90D 2G3AA 2FYUJ 3EFFK 2OYHA 5KAFE 2PP6A 4U3FE 3SWFA 3A5TA 1SQPE 4Y99C 3H1HD 3B71A 1LGHB 1H89A 1L4AB 5KJ7A 5APWA 3AEDC 1KILB 1Q7YQ 5APUA 1RE4C 1WRGA 5KLVG 3UIAA 1LWUB 3GMAA 2BASA 2B87B 3AE5C 1YTZT 3BRVB 1Y8AA 1EXIA 1EZVG 4NPEA 3WU2E 1NYHA 3SFDC 1VQ8P 2V7QH 1L2PA 1M7LA 3AEBC 3GF7A 3H1HJ 2YKPA 4IFMA 2YIUB 2B89A 2K9YA 1PL5A 2K3RA 1ZW0A 1NO4A 2IX7C 1QX8A 5KLVD 5GTHE 1JCDA 3HTKB 5APXA 3RBXA 1JY3N 4H44D
chains in the Genus database with same CATH topology
2UWJE 1BDDA 1SS1A 4JBZA 3FXEA 4CPGA 1NVOA 2RKLA 3PH0A 1JM0A 4GOEA 3MHVA 1LP1A 1U7MA 1OVVA 1H0TA 4EYYQ 2M5AB 2KZJA 2KIKA 3ZDMA 2JWDA 4HJGH 4ASVA 4HB1A 2KZIA 5DJUB 2KUBA 2M0BA 5CBOA 1EDJA 1EDLA 2I8DA 1U7JA 4HKZH 4KJMA 4WWIA 1X0TA 1S3JA 5K5GB 2B87B 3MZWB 4K35A 1Q2NA 2OTKE 2QVAA 2Q1KA 4NPEA 2HR3A 5DJTB 2WMMA 2R44A 3FXDA 1OVUA 2B88A 1H0TB 2LXCB 3S1KA 2KI7B 2LR2A 4ASWA 3QWOC 2B87A 4GODA 1JMBA 1OVRA 2M5AA 2B89A 1MFTA 5C39A 4NPDA 1DEEG 4MN4C 2K3RA 4GOFA 1ZW0A 2LXBA 3RGUA 1EDKA 4BXLA 1BDCA 2QRXA 1EDIA 1EC5A 4ZNCA 2SPZA 4IOIH 1LP1B 1ZXGA 4NPFX 1FC2C 1LT1A 1Y47A 2KS1B 4K3AA 4ZMDA 2P58A 5EFWB 2ZAEB 5CBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWJ E;  1BDD A;  1SS1 A;  4JBZ A;  3FXE A;  4CPG A;  1NVO A;  2RKL A;  3PH0 A;  1JM0 A;  4GOE A;  3MHV A;  1LP1 A;  1U7M A;  1OVV A;  1H0T A;  4EYY Q;  2M5A B;  2KZJ A;  2KIK A;  3ZDM A;  2JWD A;  4HJG H;  4ASV A;  4HB1 A;  2KZI A;  5DJU B;  2KUB A;  2M0B A;  5CBO A;  1EDJ A;  1EDL A;  2I8D A;  1U7J A;  4HKZ H;  4KJM A;  4WWI A;  1X0T A;  1S3J A;  5K5G B;  2B87 B;  3MZW B;  4K35 A;  1Q2N A;  2OTK E;  2QVA A;  2Q1K A;  4NPE A;  2HR3 A;  5DJT B;  2WMM A;  2R44 A;  3FXD A;  1OVU A;  2B88 A;  1H0T B;  2LXC B;  3S1K A;  2KI7 B;  2LR2 A;  4ASW A;  3QWO C;  2B87 A;  4GOD A;  1JMB A;  1OVR A;  2M5A A;  2B89 A;  1MFT A;  5C39 A;  4NPD A;  1DEE G;  4MN4 C;  2K3R A;  4GOF A;  1ZW0 A;  2LXB A;  3RGU A;  1EDK A;  4BXL A;  1BDC A;  2QRX A;  1EDI A;  1EC5 A;  4ZNC A;  2SPZ A;  4IOI H;  1LP1 B;  1ZXG A;  4NPF X;  1FC2 C;  1LT1 A;  1Y47 A;  2KS1 B;  4K3A A;  4ZMD A;  2P58 A;  5EFW B;  2ZAE B;  5CBN A; 
#chains in the Genus database with same CATH topology
 1PPJ G;  1LT9 B;  1EZV D;  2FYN C;  2J58 A;  1NGM B;  2H8P D;  2ZFC A;  1JTH B;  1GD2 E;  3HE5 B;  2YXR B;  3CD6 P;  3AE7 C;  1SQB E;  4C7N B;  4N78 E;  2FBW C;  2AXT E;  2M5A B;  4LGD E;  1N7S A;  3HE4 B;  4UB8 E;  2KIK A;  1QLE D;  1YHQ P;  3Q1M A;  5KLV J;  2KZI A;  5AW0 B;  4LC1 A;  3V2Q A;  4DCK A;  3CCU P;  3V6I A;  3CX5 H;  3JCU H;  4I2L C;  3CC4 P;  4L76 A;  3BAT A;  3I5C A;  2I1J A;  5AVT B;  1PPJ D;  5KTB A;  3BAS A;  1GZL A;  4H0L D;  1SQV G;  1JY2 P;  4D6T E;  3CWB G;  3BRT B;  1CI6 A;  4H44 B;  3RK3 D;  2W6B A;  2JEE A;  1DD4 A;  3SWY A;  4OVN F;  3PTZ A;  3M0D C;  2IPP A;  1ZV8 A;  2FYU E;  1MFT A;  3A7O A;  1PP9 D;  1QEX A;  5TJH A;  1BDC A;  1URQ C;  2N1T D;  2H89 C;  1L0N K;  2NPS B;  2M8R A;  4PJ0 E;  1PGJ A;  5CCG C;  1T3J A;  4EDF A;  2P58 A;  3WUU A;  3CPW O;  2YNY A;  2LKM A;  1GL2 A;  1AA0 A;  4ZKP A;  3AEE C;  1FDM A;  5APT A;  1S5L H;  2IYO A;  4H0L B;  3II6 A;  3CX5 I;  3AE4 C;  1ZN5 A;  3LID A;  2WSS H;  1PP9 J;  1RF0 A;  4W7Y A;  2R32 A;  3CI9 A;  5KJ7 D;  1BCC G;  2E74 C;  1X79 B;  2P10 A;  3VMX A;  3H1H E;  1JCC A;  1RQU A;  3L4F A;  3MGN A;  1PV3 A;  1L0L G;  5CBO A;  1EDL A;  2I8D A;  1VQ7 P;  1U7J A;  5AVU B;  3CWB J;  4Y28 J;  3M06 A;  1GW3 A;  1KB9 I;  3RL0 g;  1VF5 D;  1E5W A;  1CW5 A;  1YBK A;  4M3L A;  2ITA A;  2R44 A;  2Z4E A;  2WPQ A;  1NJI Q;  3HD7 A;  3RL0 D;  3VYI A;  1AFO A;  1L0L D;  4YXW H;  1EC5 A;  4XA4 A;  1IFN A;  5KLV E;  1M1K Q;  1LT1 A;  1RE3 C;  1QL2 A;  1KV4 A;  1JEK A;  2WPS A;  3SFE C;  1NKN A;  2OTJ P;  1SQX G;  4GIF A;  4IL6 H;  1X9V A;  2H7H A;  4U3F G;  1EZV E;  3RK2 D;  1BGY D;  3G6E P;  2L5G B;  4PD4 H;  1NHL A;  1KQG B;  1Q86 Q;  1N7S D;  1NU1 K;  1VF5 B;  5GTI H;  1RQV A;  4EYY Q;  1L0L J;  5CCH C;  3LW5 H;  2IFN A;  4HB1 A;  1FDO A;  3RL0 B;  3V4W A;  1USE A;  3MTU E;  2V7Q J;  3KXD A;  3AE3 C;  4KJM A;  4BRY A;  3G4S P;  1SQX D;  1T6A A;  2O1J A;  1PPJ E;  3V2N A;  1N73 A;  3F89 A;  4WY4 C;  2RH0 A;  4GDO A;  3RK3 E;  2QJP C;  2D2C D;  3CX5 D;  5AW1 B;  3I56 P;  3M9H A;  3LIE A;  3K5B A;  1J1E C;  2WTY A;  1PIX A;  3KQG A;  1SQQ G;  1YTZ I;  2A45 I;  1PP9 E;  2LXB A;  3RGU A;  1SQX J;  2Q6Q A;  4PD4 I;  4LLH A;  3NMD A;  2HG5 D;  3Q2Y A;  1GL2 D;  3VMA A;  1KOR A;  2Q3I A;  3AEA C;  2KS1 B;  5CJ4 A;  4K3A A;  1FAV A;  3GF3 A;  5B5E H;  1GK6 A;  3G3Z A;  2KNC A;  3PH0 A;  1SFC A;  1NH4 A;  3AEC C;  1IK9 A;  3L74 G;  3H25 A;  1U7M A;  3PRJ A;  2E76 D;  1ZLL A;  3P8C D;  1LTT C;  1X22 A;  1SQQ D;  1N86 A;  2P1J A;  2WIT A;  4D6T G;  1GDT A;  2WT7 B;  2OYI B;  5BVZ A;  4YTP C;  3CCE P;  1RHZ B;  1MZ9 A;  2BCC D;  2K9J A;  1USD A;  2OQQ A;  2E75 D;  1SVF A;  1M90 Q;  3AE2 C;  1GL2 B;  2C0X A;  1LTJ C;  1T3U A;  3TK1 A;  2OTK E;  2FYU G;  1YQ4 C;  1UIX A;  1E79 H;  1J1E B;  4I7Z B;  3L74 D;  2HR3 A;  3WUT A;  2KLU A;  3V4Q A;  1KFN A;  3HD7 D;  4IFD K;  3BCC D;  1SQQ J;  1OVU A;  1FU1 A;  2LR2 A;  3I55 P;  1L4A C;  1VQK P;  2E76 B;  3FWL A;  4XFJ A;  1KIL C;  3H6P A;  2BCC J;  1L0L E;  1M56 D;  1LWU C;  1LP1 B;  3AE6 C;  1GTW A;  1HUC A;  1PGQ A;  1QL1 A;  2YKQ A;  3B4S A;  3H1I G;  3L74 J;  1NTK G;  4A7P A;  2PAJ A;  2W27 A;  2E75 B;  1OMI A;  1NVO A;  1BGY E;  2O01 H;  4QMA A;  4GOE A;  3TSI A;  2C9N Y;  3L73 D;  1H8A A;  1K9M Q;  4WBA A;  2YIU C;  1FZF A;  2ZYD A;  3IAO A;  1P84 H;  3HD7 B;  5AW6 B;  1N8R Q;  2Z5H A;  2FXM A;  4JF7 A;  1FBM A;  2QEX P;  1FZB A;  1KTM A;  5AW3 B;  4XE5 B;  4PD4 D;  3H1I D;  1LT9 C;  1M1J A;  5BU8 B;  1YIJ P;  4WVZ A;  1SQX E;  2BEQ D;  1NTK D;  3TYY A;  3MZW B;  1R5S A;  1K05 A;  3L73 J;  2M3B A;  2OAR A;  2RMZ A;  1OZH A;  1GU5 A;  3EFG A;  1FZG A;  2K1A A;  3MIW A;  4I1L A;  1ZOY C;  2HFE D;  4OGQ D;  2E5T A;  3CX5 E;  3B5N A;  1S72 P;  2ZXE B;  3JCU E;  5AVR B;  4ASW A;  3TNU A;  3EWK A;  1OW6 A;  1VQ6 P;  2YKO A;  1WT6 A;  1SQP K;  3OJA B;  4BXL A;  3H1I J;  3L70 D;  2W83 C;  1NTK J;  2FXO A;  2B9B A;  1YYC A;  4YXD C;  1SFC D;  3M9B A;  3G71 P;  4U7J A;  1P84 I;  4H44 C;  1NTM K;  3M91 A;  3L37 A;  2H43 A;  4DOJ A;  2Q5U A;  1VQ9 P;  2H88 C;  2CPS A;  3HRN A;  2YMK A;  4C7R A;  2RN0 A;  1FE6 A;  1HVV A;  1H0T A;  2QM8 A;  5TIS H;  3P8C E;  4OGQ B;  3L70 J;  1LTS C;  2BEZ F;  1SQQ E;  1RF1 A;  2KLV A;  2NPS C;  1NU1 D;  1JNM A;  3B8E B;  3H1L D;  1LTA C;  4R4L A;  1S5L E;  5KKZ B;  2BCC E;  1KYO I;  2J5U A;  1LTI C;  2FFD A;  1KQL A;  2MKV A;  3NFQ A;  4H0L C;  1ZRT D;  2KNC B;  1SFC B;  3FGA D;  1PP9 G;  2R3C A;  3L74 E;  2PRR A;  1CZQ A;  1EXJ A;  3VP9 A;  3BCC E;  2J59 M;  4ZKU A;  2HOD A;  1OVR A;  1SQB K;  1OW8 A;  1JMM A;  4RES B;  3H1L J;  3TGU D;  1JUN A;  2QRX A;  4OH8 B;  1EDI A;  1OW7 A;  2PFX A;  2N1T C;  1NAY A;  2C9L Y;  4W80 A;  3H32 B;  2K9J B;  1HGZ A;  3CCJ P;  2QA4 P;  2ZT9 D;  3PHL A;  1KB9 H;  4JBZ A;  1SLQ A;  1JB0 J;  1NTZ K;  3FXE A;  5B66 H;  2OYH C;  4JPZ B;  5AW7 B;  3L73 E;  2C0W A;  2XV5 A;  3ITK A;  4DJG A;  1KD1 Q;  1VQL P;  1OX3 A;  3A0H E;  3TGU J;  3VMZ A;  5KJ7 C;  3MUD A;  1VQ5 P;  2Q7C A;  2KK7 A;  4IL6 E;  3U1C A;  4PD4 E;  3RK3 B;  1VPC A;  1LTB C;  1T2K D;  3H1I E;  1NTK E;  1W2B O;  5GTI E;  1P84 D;  2K88 A;  5CMZ A;  3B5N D;  1VF5 C;  1VQP P;  1HTL C;  2NRG A;  2NZ2 A;  2HPC A;  2N1T B;  3GHG B;  1S2E A;  2QIW A;  3RL0 C;  3HUS A;  1FZC A;  3KDP B;  4JYC A;  1A02 F;  2O01 J;  4OWF A;  1BGY G;  3L70 E;  1M1J B;  1N2D C;  2OYH B;  4UB6 H;  1DIP A;  1HWT C;  3IF4 A;  2ZAE B;  3H1K D;  3VN0 A;  2Q9I A;  1KMI Z;  1WMK A;  4L75 A;  3RK2 C;  3USS A;  1JM0 A;  1X8Y A;  2KSE A;  3T97 A;  3M9Q A;  3GG2 A;  1IFP A;  1N7S C;  1JO5 A;  3B5N B;  2QE7 H;  2ZVN B;  2YXQ B;  1AJY A;  1HJ0 A;  3TNU B;  1BSH A;  4H13 D;  2A45 H;  4AUW A;  1HBW A;  5B5E E;  4AQR D;  3D6Z A;  3H1L E;  3H1K J;  3ABV C;  1DH3 A;  4TLF A;  2KOG A;  4WWI A;  2WQY C;  5KLV K;  2WSC H;  1FOS F;  1KFM A;  2XDJ A;  4L74 A;  1ZRT E;  1BE3 D;  4PV1 D;  1LNQ A;  1AQT A;  1KIL A;  4KT0 J;  2WMM A;  3NXS A;  1AV1 A;  2JKV A;  1H0T B;  4I6M C;  1RH5 B;  4GT1 A;  1BGY J;  2B87 A;  3QWO C;  2QM7 A;  1PFI A;  4IFF A;  1TU3 F;  1RF1 B;  1DEE G;  2ZYA A;  2OYI C;  3TF5 A;  3TGU E;  4H13 B;  2SPZ A;  3CCL P;  4EI2 A;  3RK2 B;  3Q5P A;  2WSE H;  1GL2 C;  2K37 A;  1RY3 A;  1H88 A;  3MD0 A;  4RO0 A;  2FFD B;  1YQ3 C;  5EFW B;  1IZN B;  1BE3 J;  1OVV A;  1N7S B;  4I7Z C;  3PJS K;  4N3Y B;  2Y9Y A;  3QH9 A;  5AVV B;  1GW4 A;  3SSU A;  1JY2 N;  1PGP A;  1QGK B;  2OTL P;  1RF0 C;  3JC2 2;  1NTM D;  4EOT A;  1S5L X;  2KB7 P;  2E76 C;  3P8M C;  2HOD B;  2BCC G;  3D6Y A;  2Q3E A;  3CC2 P;  4HJG H;  3V2P A;  1OXZ A;  1CI6 B;  1KB9 D;  1JTH A;  2V4H A;  2FXP A;  1JY3 P;  3IN6 A;  3BCC G;  2E75 C;  2N9B A;  3HE4 A;  1S9K D;  4EIJ A;  2D2C B;  1RE4 A;  1PGO A;  2ZJS E;  1SQV K;  1P84 E;  1K04 A;  1NTM J;  2QJK B;  5AVZ B;  3HD7 C;  3CL3 D;  2OGU A;  3FXD A;  1HH0 A;  2Y9Z A;  3CLQ A;  1Q82 Q;  3CCR P;  3OA7 A;  1VQN P;  2KSJ A;  3H1J G;  2OYO A;  1IFI A;  2HLO A;  4ZNC A;  3L36 A;  1L0N G;  1NWQ A;  1FC2 C;  3L73 G;  5AVW B;  5AVY B;  3L72 D;  5H2F H;  2JWA A;  3H1K E;  3AEF C;  4DT0 A;  3N4X A;  4IL6 X;  1VQM P;  1AVO A;  1OIP A;  1VDF A;  2NPS A;  2A45 G;  1VQ4 P;  1NTZ D;  2GM4 A;  2YMY A;  3G9R A;  1K8A Q;  1EZV I;  3HUS B;  3H1J D;  1FZC B;  5E79 H;  4ASV A;  3E1I A;  1G2C A;  1W5C E;  1L0N D;  3BCC J;  3L72 J;  2PGD A;  1L0L K;  3KZI H;  2IDB A;  1N73 C;  1VL2 A;  3CMA P;  1FJP A;  1L4A D;  2O1K A;  2WPV B;  1KIL D;  2GUV A;  2JR8 A;  3A0B H;  2N9Y B;  1LJ2 A;  4YPC A;  5TIS E;  1BE3 E;  3T97 B;  1PZQ A;  1NTZ J;  3L70 G;  4OGQ C;  3L75 D;  1IC2 A;  3H1J J;  2LXC B;  3KPE A;  1L0N J;  1IJD B;  5M1B A;  4NPD A;  3M0D A;  2FKW B;  4MN4 C;  3CCQ P;  5AW9 B;  5KKZ C;  4IOI H;  4RJT A;  2Y0E A;  1ZR4 A;  1KYO H;  1URQ A;  4ZMD A;  3C8V A;  1SFC C;  4R4M A;  1SQX K;  1GMJ A;  2R5B A;  2P2U A;  5CCG A;  1DX7 A;  3L75 J;  5KAI H;  2GA1 A;  3AE8 C;  3CXH H;  1NU1 G;  1R5L A;  3H1L G;  4BRY B;  1NTM E;  5CJ0 A;  2WSC J;  4RKU J;  3LW5 J;  2WSF H;  1N73 B;  2JWD A;  3L71 D;  5DJU B;  1KB9 E;  4HKZ H;  2KXP B;  1MUU A;  3O6Q A;  5B66 E;  1J1D B;  5K5G B;  3N7N A;  3S9O A;  3WUV A;  1S9K E;  3Q5S A;  1M8O B;  5BU5 A;  2M3E A;  2QVA A;  3VTP C;  1YIT P;  1JY2 O;  1Q81 Q;  2YO3 A;  4HH2 A;  2FYZ A;  3C9I A;  3TGU G;  2WSE J;  2AXC A;  2GUS A;  2W90 A;  2B88 A;  3VOP A;  3L71 J;  2WVR A;  4GOD A;  4HYT B;  1S4X A;  2WPR A;  1SQQ K;  4WB4 A;  2IZ0 A;  3RK3 C;  4Y99 B;  5KAF H;  2JJL A;  3KHU A;  3GW6 A;  3CXH I;  3E1R A;  2P67 A;  1IFD A;  3L72 E;  1ZR2 A;  2ZT9 C;  1NU1 J;  1RE3 A;  3SWK A;  2NPS D;  2RKL A;  1K73 Q;  2CPB A;  1UII A;  2W8Z A;  3C1L A;  3VMY A;  3GHG C;  2KS1 A;  3M0A A;  1A02 J;  2XNX A;  1NTZ E;  3WU2 H;  5L8R J;  3ZDM A;  3H1J E;  3WMM 0;  2AEJ A;  1IK7 A;  4UB6 E;  5CCH A;  1QVG O;  1M1J C;  3PLN A;  1L0N E;  3EQ2 A;  1HF9 A;  1GU4 A;  1KN7 A;  3V5B A;  1X0T A;  1FJK A;  2W6A A;  1T2K C;  2G8Y A;  2WWW A;  1LTG C;  1Q2N A;  2IBZ I;  5GTH H;  5KLI C;  1KIL E;  2JO1 A;  2FYU K;  2W6J H;  3AE9 C;  3MP7 B;  3B5N C;  2HYN A;  2FYN B;  2WT7 A;  2OYI A;  4WY4 A;  3AE1 C;  1HJB A;  3L75 E;  1JOC A;  3S1K A;  3Q5R A;  1SQV D;  3CWB D;  5AW8 B;  3H1K G;  1G2C B;  1KQS O;  2ZT9 B;  1FZA A;  1URQ D;  4JYB A;  3A3Y B;  3S4R A;  2AXT H;  2YO2 A;  4UB8 H;  1IFM A;  5CCG D;  4B86 A;  1CSB A;  1NKZ B;  1ZP0 C;  2UWJ E;  1SS1 A;  1NTK K;  4KHX A;  5AVX B;  2IZ1 A;  3F5H A;  3MHV A;  3P7K A;  1LP1 A;  1SQV J;  1NAF A;  4TT3 H;  1W2E A;  3RBZ A;  4O9B A;  1RF1 C;  1Z56 A;  1KYO D;  2E74 D;  1NOH A;  4H13 C;  1QVF O;  2A06 G;  3L71 E;  1R8E A;  1GK4 A;  3TDK A;  5AW5 B;  2M0B A;  1BE3 G;  1G1J A;  2FFD C;  5KLI B;  2O3J A;  1BSN A;  2CK3 H;  3E7K A;  1URQ B;  2XZR A;  3CXH D;  1BCC D;  4Z1M H;  1MKM A;  3O8Z A;  4PJ0 H;  4PV1 C;  2E43 A;  1LTJ A;  2IBZ G;  3A0H H;  1YJ9 P;  1NU1 E;  3Q3D A;  2AEF A;  1Y9B A;  2AEM A;  2A06 D;  5C39 A;  1SQP G;  1DD3 A;  2IFM A;  3V2R A;  2E74 B;  1L4A A;  2QG4 A;  4JQ0 D;  1BCC J;  3O6Q B;  3CC7 P;  1XTG B;  2D2C C;  1YI2 P;  1LWU A;  2E42 A;  1SP4 A;  1NTM G;  3CCV P;  2WSF J;  5CBN A;  1FS0 E;  2QJY C;  1BDD A;  2QJK C;  2IBZ D;  1KZU B;  3IFM A;  1YJN P;  3KYQ A;  3D71 A;  1JY3 O;  3MUD C;  1IFJ A;  2MJZ A;  4U3F D;  1S1C X;  1EQ7 A;  2KZJ A;  5CCH D;  1DEB A;  2XND H;  1SQP D;  4C46 A;  5H2F E;  1AVY A;  2R5D A;  1EDJ A;  2DW3 A;  1N7L A;  4PV1 B;  1S3J A;  3HTK A;  4K35 A;  2FY8 A;  1LT9 A;  1FOS E;  3IR9 A;  4AYC A;  3CME P;  4WY4 D;  4GKG A;  3FWN A;  4W7Z A;  2KYV A;  5E79 E;  5AVS B;  5DJT B;  3U59 A;  4U3F J;  3W67 A;  5AW2 B;  1SQP J;  3HE5 A;  3HUS C;  3U1A A;  1FZC C;  4C7N A;  1SQB G;  3CCS P;  1JMB A;  1SQV E;  2M5A A;  3KZI E;  2P7J A;  1KC8 Q;  3L72 G;  3CWB E;  2L91 A;  2QJY B;  1ZXG A;  3A0B E;  2ZXX A;  4NPF X;  4DZO A;  3R2P A;  2IYP A;  1Y47 A;  2E5Y A;  2POH A;  1IO4 A;  2VRS A;  1MV8 A;  3NTN A;  4L73 A;  1NTZ G;  4CPG A;  2JP3 A;  3PP5 A;  3W68 A;  2KP8 A;  3VP8 A;  4WY4 B;  3AEG C;  5APQ A;  3H32 A;  3R4Y A;  1SQB D;  4N78 D;  1FDI A;  2QJP B;  1KYO E;  2O01 N;  3OW2 O;  2R3S A;  2KUB A;  3OAK A;  3L35 A;  5CHX A;  5APY A;  3A2A A;  2Y0C A;  1VQO P;  4BWN A;  5KAI E;  2ZYG A;  2HPC B;  3CXH E;  3L75 G;  1XTC C;  1J2J B;  1D7M A;  1BCC E;  4D6T D;  3JSV C;  3BVH A;  1FZE A;  2Q1K A;  1HGV A;  2XU6 A;  1SQB J;  5AVQ B;  5APS A;  2Y0D A;  2I1K A;  2ZVO B;  2KI7 B;  1AQ5 A;  1OWA A;  2FYU D;  3D70 A;  2A06 E;  5APV A;  4GOF A;  4N6J A;  1EDK A;  1OFC X;  2WZ7 A;  1J1D C;  3H1H G;  3CCM P;  3GLM A;  1ZME C;  1M57 D;  1MFZ A;  3P32 A;  3FX0 A;  4D6T J;  1KQF B;  2N1T A;  2XKM A;  1U57 A;  3GHG A;  5AW4 B;  2JDI H;  1G1I A;  2IBZ E;  1LTJ B;  3L71 G;  2QSI A;  1YJW P;  2Z5I A;  1T8Z A;  1Q90 D;  2G3A A;  2FYU J;  3EFF K;  2OYH A;  5KAF E;  2PP6 A;  4U3F E;  3SWF A;  3A5T A;  1SQP E;  4Y99 C;  3H1H D;  3B71 A;  1LGH B;  1H89 A;  1L4A B;  5KJ7 A;  5APW A;  3AED C;  1KIL B;  1Q7Y Q;  5APU A;  1RE4 C;  1WRG A;  5KLV G;  3UIA A;  1LWU B;  3GMA A;  2BAS A;  2B87 B;  3AE5 C;  1YTZ T;  3BRV B;  1Y8A A;  1EXI A;  1EZV G;  4NPE A;  3WU2 E;  1NYH A;  3SFD C;  1VQ8 P;  2V7Q H;  1L2P A;  1M7L A;  3AEB C;  3GF7 A;  3H1H J;  2YKP A;  4IFM A;  2YIU B;  2B89 A;  2K9Y A;  1PL5 A;  2K3R A;  1ZW0 A;  1NO4 A;  2IX7 C;  1QX8 A;  5KLV D;  5GTH E;  1JCD A;  3HTK B;  5APX A;  3RBX A;  1JY3 N;  4H44 D; 
#chains in the Genus database with same CATH homology
 2UWJ E;  1BDD A;  1SS1 A;  4JBZ A;  3FXE A;  4CPG A;  1NVO A;  2RKL A;  3PH0 A;  1JM0 A;  4GOE A;  3MHV A;  1LP1 A;  1U7M A;  1OVV A;  1H0T A;  4EYY Q;  2M5A B;  2KZJ A;  2KIK A;  3ZDM A;  2JWD A;  4HJG H;  4ASV A;  4HB1 A;  2KZI A;  5DJU B;  2KUB A;  2M0B A;  5CBO A;  1EDJ A;  1EDL A;  2I8D A;  1U7J A;  4HKZ H;  4KJM A;  4WWI A;  1X0T A;  1S3J A;  5K5G B;  2B87 B;  3MZW B;  4K35 A;  1Q2N A;  2OTK E;  2QVA A;  2Q1K A;  4NPE A;  2HR3 A;  5DJT B;  2WMM A;  2R44 A;  3FXD A;  1OVU A;  2B88 A;  1H0T B;  2LXC B;  3S1K A;  2KI7 B;  2LR2 A;  4ASW A;  3QWO C;  2B87 A;  4GOD A;  1JMB A;  1OVR A;  2M5A A;  2B89 A;  1MFT A;  5C39 A;  4NPD A;  1DEE G;  4MN4 C;  2K3R A;  4GOF A;  1ZW0 A;  2LXB A;  3RGU A;  1EDK A;  4BXL A;  1BDC A;  2QRX A;  1EDI A;  1EC5 A;  4ZNC A;  2SPZ A;  4IOI H;  1LP1 B;  1ZXG A;  4NPF X;  1FC2 C;  1LT1 A;  1Y47 A;  2KS1 B;  4K3A A;  4ZMD A;  2P58 A;  5EFW B;  2ZAE B;  5CBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...