1EDKA

Staphylococcal protein a e-domain (-60), nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
56
structure length
56
Chain Sequence
AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the E-domain of staphylococcal protein A.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immunoglobulin-binding protein
molecule keywords STAPHYLOCOCCAL PROTEIN A
total genus 20
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 1996-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1edkA00
1EC5A 4ASWA 1JM0A 2KS1B 1OVUA 5CBNA 1EDLA 1OVVA 4HKZH 4GODA 2B87B 4MN4C 3MZWB 2JWDA 2I8DA 4GOEA 1S3JA 2WMMA 1OVRA 1U7JA 2KZJA 4K3AA 2M0BA 2B89A 4HJGH 5DJUB 1NVOA 1LP1A 1BDCA 4WWIA 5EFWB 2LXBA 1DEEG 5CBOA 4KJMA 4BXLA 2RKLA 3ZDMA 2QRXA 1EDKA 5DJTB 1JMBA 2ZAEB 3FXDA 2P58A 2KUBA 3QWOC 2R44A 2LXCB 4IOIH 2OTKE 1H0TA 2Q1KA 2K3RA 2KZIA 1ZXGA 4ZNCA 1BDDA 3MHVA 2KI7B 2HR3A 1LT1A 1Y47A 1EDJA 2M5AB 4NPEA 4NPDA 2KIKA 3PH0A 1ZW0A 2UWJE 2LR2A 1SS1A 4GOFA 3RGUA 4K35A 4NPFX 4HB1A 5K5GB 1Q2NA 1X0TA 1U7MA 1MFTA 3FXEA 3S1KA 1EDIA 2B87A 4ZMDA 4JBZA 1FC2C 2SPZA 4CPGA 1H0TB 1LP1B 4EYYQ 2M5AA 5C39A 2QVAA 4ASVA 2B88A
chains in the Genus database with same CATH superfamily
1EC5A 3EFGA 1L4AA 1NTZD 2W8ZA 2ZYAA 3A0BH 2YO2A 5KJ7C 5KLVK 3D70A 2E5TA 1QL1A 1BGYE 1JCCA 1LTGC 1NU1G 1QGKB 1LTTC 1XTCC 2FYUK 2K37A 3L75G 4EIJA 2JJLA 3CCUP 1EZVG 3L74J 2GUVA 2E76B 2JWDA 4GDOA 1IFJA 2ZVOB 4XE5B 1OVRA 1EZVE 1SQQJ 1T3JA 1RE3C 2E75D 5TISE 1IJDB 1L0NE 2NPSC 1K8AQ 3JC22 3A0HH 3JCUH 3CXHD 1R5SA 3SFDC 4IFDK 3CCMP 1BE3D 5CCHC 1GK4A 4HJGH 5DJUB 3H1IG 4AQRD 3L75E 3HUSA 1PGJA 2FYUJ 2GA1A 4WWIA 3CLQA 5AW7B 5EFWB 3M91A 1AQTA 1KB9D 1DEEG 4PV1C 5KLVJ 5CBOA 3VN0A 3G71P 1VF5B 2K9JA 4KJMA 2E5YA 2Y9ZA 1T6AA 3WUUA 2WTYA 1FDMA 2C9LY 3GLMA 1T3UA 4I1LA 1VL2A 2BCCG 3C8VA 5AW3B 1HUCA 1LTJC 3B71A 1BGYJ 3M9BA 3VMAA 1ZR2A 1RF1C 1EDKA 1VQMP 2RMZA 1EZVI 3I55P 3CCJP 2YKQA 4PD4D 1VQ7P 2ZAEB 1TU3F 5CHXA 1WMKA 2A06D 3NFQA 2A06G 1SQXK 1FZGA 1VQNP 1NKNA 2FYUG 1JY3O 3FXDA 4W80A 1KC8Q 1AJYA 2P58A 5KLVG 4D6TJ 1YIJP 2KK7A 2KUBA 4C7RA 2KB7P 2Q3IA 3H1IE 2R44A 1PFIA 4RESB 3H1LE 1GW3A 2BCCD 1WT6A 4DOJA 1H0TA 4U3FE 2MJZA 2Q1KA 3MUDC 4AYCA 2QJYB 3CX5E 3M0DA 2IBZG 1USEA 1L0NG 2JDIH 4EOTA 3GHGB 1J1DC 2E42A 1SFCA 1PGPA 2V4HA 3CCQP 3MHVA 2WSCH 3L73D 5APWA 3L71E 1DX7A 2KI7B 2P2UA 3L73J 4H13B 3GF7A 4JF7A 1VQ9P 1VF5D 3VMYA 1M1JB 3Q1MA 1PPJG 5KJ7A 1BCCG 1FJPA 4NPEA 1PP9E 1SQPE 1KILD 3H25A 1N7SB 3OA7A 2G8YA 4U3FG 1NGMB 2P7JA 3P8CE 1RF1A 3RBZA 1OIPA 1NTKE 1RQUA 2ZXEB 4H44D 1VQPP 1VQ4P 4WY4A 1BE3J 3A7OA 1YTZT 1L4AC 2Z4EA 2LKMA 1SS1A 4GOFA 3CCEP 3KQGA 1OMIA 2KXPB 2Q9IA 5AW9B 4K35A 1E5WA 1HVVA 4NPFX 1FZCA 2HPCA 1KILB 1P84H 4N3YB 2ZXXA 1M57D 4DCKA 2FYUE 2HLOA 2O01N 3L75J 5K5GB 1Q2NA 1X79B 5KKZB 4RJTA 1GU5A 3L74D 2WVRA 3C1LA 2BASA 1T2KC 1JNMA 2YKPA 3AE7C 5KAIH 3TYYA 4XFJA 2YIUB 3LW5J 1SLQA 3BCCE 1VQ5P 1L0NJ 3HD7B 1FZAA 1KZUB 2D2CD 3CWBE 1URQA 1VF5C 2B87A 2FYNB 3E1RA 1XTGB 3H32A 4N6JA 2D2CB 4O9BA 4ZMDA 4R4LA 2POHA 3WU2E 2WSEH 4ZKPA 4DZOA 2R5DA 3AE9C 1ZRTE 1N7LA 1RF1B 2L91A 1W2BO 1FC2C 3VTPC 1MKMA 4PJ0H 1PGOA 2NRGA 4CPGA 1LP1B 4H0LC 1OX3A 4EYYQ 2N1TD 2ZYGA 1E79H 4BRYB 1S5LX 5TISH 3D71A 2OYIB 1WRGA 3M9QA 1KORA 1LTJA 3F89A 4HYTB 2XV5A 1SQVJ 2JR8A 1EQ7A 3AE8C 4DJGA 3SWKA 1OVUA 1SQBE 1BE3G 2H88C 2IX7C 3AE6C 4Y99B 3TGUD 1KQSO 3KPEA 3H1HG 2O3JA 1GL2D 4GODA 1NTZE 2NPSB 2B87B 3BRVB 4EDFA 3CD6P 1PV3A 1RE4A 2QJPC 1FZBA 4GOEA 2OGUA 4YXDC 4H44C 1N73B 1ZOYC 2FKWB 2E76D 4U7JA 3CCVP 1A02J 1KTMA 1U7JA 1VQ6P 2P1JA 1FOSF 2JKVA 1HF9A 1JEKA 1DEBA 1JCDA 1NU1D 2KZJA 3QH9A 4H13C 3TK1A 2OYHA 4K3AA 1LTJB 3WUTA 5B66E 1FZCB 1PIXA 1P84E 4EI2A 1NVOA 1JB0J 3H1HE 2WPSA 1OZHA 2W6BA 4LGDE 5AVXB 1VDFA 1LTBC 1J1EC 5CCGC 5BVZA 3CMAP 1AFOA 2QJKB 1HTLC 2E75B 1KYOD 3JSVC 2A45G 2FXOA 3CC2P 4BXLA 2WPRA 2RKLA 1Q90D 1R5LA 3E7KA 3G3ZA 1NHLA 3H1KD 3ZDMA 5GTHE 3GF3A 3PLNA 1IFNA 1G1JA 4WB4A 2H43A 3D6YA 2ZT9D 3AEDC 1LGHB 2M8RA 1NAYA 3BVHA 1N7SA 2C0WA 3HD7A 1LJ2A 1SVFA 3L4FA 1SQXE 3N7NA 2IYOA 3L72G 1NAFA 2JWAA 2RH0A 1JMBA 3B5NA 3L74G 1GL2C 2FXMA 4JYCA 5DJTB 1PGQA 1FS0E 3CXHI 1VQOP 3A0BE 5M1BA 1NTKK 2FXPA 1T8ZA 4R4MA 3CWBG 1L2PA 4PJ0E 3CCSP 1MFZA 4C7NB 1IO4A 3NMDA 3P7KA 3GHGA 3P8MC 2OQQA 2A06E 2Q3EA 3KZIE 5AVQB 3CCLP 2ZT9B 3B5NB 1J1DB 1N73A 3G6EP 1NTMJ 1MV8A 2WZ7A 2FFDA 4XA4A 3BATA 1JOCA 2FYNC 2K3RA 5L8RJ 1YBKA 3A5TA 3Q5SA 2WT7A 1ZN5A 2AEMA 1MZ9A 3HE4A 1NO4A 3V6IA 1L0LD 3WMM0 2IFNA 1QVGO 1K9MQ 1PPJD 2YMKA 1L4AB 2YMYA 1Q7YQ 2HR3A 1Q86Q 2WSSH 5CCHD 1SQQG 1BCCE 1Y47A 2W83C 1FZFA 1AQ5A 3CXHE 2OYIA 1HGZA 1S4XA 2V7QH 2WSFH 1OW7A 4NPDA 1NU1K 1ZLLA 2QEXP 3KDPB 4I6MC 1CW5A 1SQQD 3GG2A 1FDIA 3MIWA 4LLHA 3IAOA 5CMZA 1Y9BA 1USDA 2HG5D 2IBZD 3KZIH 3PRJA 2B9BA 1A02F 1IFMA 1ZW0A 1J2JB 5KKZC 2H7HA 1KFNA 4IFFA 2NPSD 2H8PD 1SQBG 1OW8A 3BCCJ 2BEZF 2W90A 1YI2P 2K88A 1RE3A 1DD4A 1NYHA 4RO0A 1JUNA 2N9BA 2QIWA 3RGUA 4H44B 3RK3C 1SQVG 2IYPA 3UIAA 3B4SA 3IR9A 4L76A 4OWFA 3HD7C 1NTZJ 3OAKA 3CMEP 4C7NA 3FWNA 1FZEA 4UB8H 2WPQA 4YTPC 1L0LJ 2N1TB 3N4XA 2W27A 2ZVNB 4PV1D 5AVZB 5KAFE 3L37A 5APSA 1SQVE 1LNQA 3EFFK 4UB6H 1NWQA 3P32A 3W68A 1Y8AA 1J1EB 1YJNP 1JY2N 1BSHA 3MTUE 1LWUC 1IFIA 1EDIA 3VP9A 3IFMA 3H1LD 3L72D 3C9IA 3M06A 4H0LB 5KAIE 2ZJSE 1URQD 1D7MA 2G3AA 1OXZA 3PP5A 2QG4A 3LIDA 1S5LE 2HFED 2YO3A 1URQB 1OWAA 4D6TD 1M90Q 1PP9J 3SSUA 5B66H 3CWBJ 2BCCJ 3GW6A 1FDOA 1SFCC 1X22A 2IFMA 2XKMA 3K5BA 4IFMA 1FJKA 3AEBC 4OH8B 1RH5B 5APUA 5BU8B 5GTIE 3WUVA 1GDTA 1UIXA 3L73E 4ASVA 2OYHB 3IN6A 1KQGB 5E79H 3VOPA 1VQ8P 1YTZI 1SQBK 2N1TA 4ASWA 1JM0A 1KD1Q 5KJ7D 4PD4E 1SQPK 2KS1B 3V5BA 1IFPA 1DD3A 4PD4I 1N73C 1DIPA 1L4AD 3E1IA 2HPCB 2QJYC 3H1KJ 4JQ0D 1S5LH 4GKGA 3RK3E 1KN7A 2K1AA 2XDJA 3M0DC 1CSBA 4MN4C 1FZCC 1BGYD 3L71G 4WY4D 3GHGC 1L0ND 2I8DA 3A0HE 3JCUE 5CJ0A 4TT3H 2QJKC 3U1CA 2E75C 3MP7B 4U3FD 3V2RA 2QA4P 4AUWA 1BE3E 1LTSC 2Z5IA 3U59A 3MD0A 3BRTB 3TGUG 2ZYDA 4IL6E 5AW8B 1GD2E 1KQFB 1AA0A 1FOSE 1SQPJ 2M3BA 1NTMG 4W7ZA 1SP4A 2IZ0A 2M0BA 3L73G 2FYUD 3VMZA 1YQ3C 2J58A 1LP1A 2P10A 3KXDA 3HE5B 4IL6X 3VP8A 3CC7P 2R5BA 3TSIA 2LXBA 4WY4C 1NTMK 2AEFA 2YXQB 1RY3A 3HE4B 2BEQD 3KHUA 1JY2O 2YXRB 3CX5I 2WSFJ 3L71J 1IZNB 1NOHA 1HBWA 2FYZA 2C0XA 3H1JD 1KYOE 2Y0CA 2FY8A 2KOGA 3CI9A 5KLVE 1YHQP 2FFDB 5KLIC 1KILC 2FBWC 4Y28J 1N7SD 1KQLA 4BWNA 1LTAC 1QVFO 3H1LJ 1LT9A 2PGDA 2VRSA 3CXHH 4WVZA 3H1IJ 3SFEC 3H1ID 2CPSA 4YPCA 3IF4A 1Q82Q 1NU1J 1BSNA 1RE4C 4I7ZC 1CI6B 2BCCE 2H89C 1GMJA 3AE3C 2LXCB 2OTKE 3T97B 1KB9H 1YJWP 3H1JG 3CCRP 3L35A 1NTZK 2WITA 3L70G 4KHXA 4L74A 1K05A 1NH4A 3L74E 3TGUE 2OTLP 3AE5C 1JO5A 2E76C 1IFDA 1UIIA 3L71D 3SWYA 3CX5D 5H2FE 3H32B 1KYOI 2AXTE 1BDDA 3TGUJ 3VMXA 1URQC 5KTBA 1FE6A 3L75D 3G4SP 2XNXA 2OYIC 2IPPA 1EXIA 1KB9E 1YJ9P 3Q5PA 1ZRTD 1M1JA 1NU1E 2N9YB 3P8CD 1EDJA 2XZRA 5CCHA 2M5AB 5B5EH 1L0LK 1IK9A 3A3YB 2KSJA 3L70E 4N78D 3NXSA 1X9VA 5AW4B 1GW4A 2KIKA 3PHLA 3RK3B 1KILA 1M7LA 1KILE 1G1IA 3RK2B 4GT1A 2N1TC 1BGYG 1RHZB 3I5CA 3W67A 1SQQE 1EZVD 2UWJE 1LT9C 2P67A 3O6QA 1LTIC 3EQ2A 1SQVK 4JPZB 1M56D 2NPSA 3H1LG 4RKUJ 3R4YA 1H89A 3OW2O 2I1JA 4L75A 2O01J 1JTHB 1LWUB 1OFCX 1OW6A 2K9YA 4L73A 1KV4A 1YYCA 1S9KE 1BCCJ 5B5EE 3Q5RA 1MUUA 2YNYA 3B8EB 5AVUB 1KB9I 1ZR4A 2E74C 4QMAA 5CCGA 1VQLP 4W7YA 3H1JJ 1T2KD 1U7MA 4D6TG 4WBAA 1MFTA 5AW6B 2Q5UA 3FXEA 3I56P 1ZMEC 2GUSA 2R3CA 2OYHC 1Z56A 3HTKB 2OTJP 5AVSB 1CZQA 3RL0B 1SFCB 4ZKUA 1NJIQ 1NTME 1NKZB 3FWLA 3VYIA 2QM7A 2R3SA 4IL6H 4BRYA 1GL2B 4JBZA 3L72E 3V4QA 1M8OB 3SWFA 2SPZA 1PP9D 2J59M 2V7QJ 3H1KE 1SQPD 3KYQA 3HUSB 2E74D 2I1KA 2M5AA 3BCCG 2AEJA 3FX0A 3LIEA 5APQA 3V4WA 2XU6A 3U1AA 1P84I 1Q81Q 1H0TB 2KYVA 1M1JC 2ZT9C 3MGNA 3V2QA 2W6JH 3B5NC 1GL2A 2KNCB 2WQYC 3AEEC 3HRNA 4OGQB 1JY3P 1HH0A 5E79E 5AVVB 3RBXA 3TNUB 3MUDA 1OVVA 1L0LG 4YXWH 4HKZH 5APVA 3RL0g 3USSA 1SQBD 1N86A 5APXA 2E43A 3HTKA 3MZWB 2KSEA 1KYOH 1QX8A 2OARA 2PP6A 3BASA 3RK2D 4DT0A 2IZ1A 1S3JA 1RF0C 2WMMA 2CK3H 2ZFCA 3H6PA 3R2PA 4WY4B 1AVYA 1VPCA 1S1CX 2K9JB 1CI6A 1ZP0C 3L36A 2XNDH 1K04A 3BCCD 2ITAA 2KLUA 1L0NK 2O1JA 1QL2A 2Y9YA 3OJAB 1PP9G 1AV1A 1JTHA 1NTZG 2B89A 3CWBD 5AVYB 1L0LE 2J5UA 1NTKD 5CCGD 1PPJE 1BDCA 1M1KQ 1GZLA 3M0AA 1IK7A 2KLVA 3O6QB 1N8RQ 1ZV8A 2CPBA 2PFXA 2W6AA 3Q2YA 1JMMA 3HD7D 5AW1B 2GM4A 1S2EA 1SQXG 2AXTH 2QRXA 1FBMA 2Z5HA 3H1KG 3LW5H 2WT7B 1QLED 3S1KA 4I2LC 1SQBJ 2YKOA 4I7ZB 1SQQK 2Y0EA 5GTHH 4D6TE 3CX5H 2Y0DA 4PV1B 5H2FH 3AE4C 1G2CA 2QSIA 3EWKA 3GMAA 4OVNF 4PD4H 3S4RA 3V2PA 1EDLA 1RQVA 1FU1A 2M3EA 2WSCJ 3AE2C 3CL3D 3ABVC 2NZ2A 5TJHA 1HJ0A 2E74B 2PAJA 3QWOC 1G2CB 1HJBA 3TDKA 3CPWO 1FAVA 1LWUA 4IOIH 4HH2A 2JEEA 2L5GB 3WU2H 1EXJA 1QEXA 1K73Q 1AVOA 1KFMA 4Y99C 3ITKA 4Z1MH 3PTZA 1SQVD 1H88A 1N2DC 1GTWA 1SFCD 3RL0C 2KZIA 2O1KA 3II6A 1ZXGA 2QJPB 3D6ZA 4C46A 3AE1C 1S72P 4ZNCA 2KNCA 1NTKG 1BCCD 3RK2C 3H1HD 1GU4A 1HGVA 3F5HA 5AW0B 1H8AA 4UB6E 5APYA 2QE7H 5AVTB 1LT1A 5BU5A 1LT9B 3AEGC 2O01H 3V2NA 2Q6QA 1KMIZ 1W2EA 2JP3A 3Q3DA 1R8EA 1JY3N 1DH3A 1VQKP 3AEAC 4H13D 1X8YA 5AW5B 1SQPG 3NTNA 4M3LA 3PH0A 1IC2A 1SQXJ 3AEFC 1JY2P 1HWTC 2A45H 2WSEJ 1W5CE 2A45I 3L70D 1RF0A 4JYBA 2IBZE 4N78E 3RL0D 2LR2A 2Q7CA 1NTKJ 4LC1A 2IDBA 3RK3D 5CBNA 3H1JE 5KLVD 5KAFH 2QM8A 1N7SC 3T97A 2AXCA 4HB1A 3G9RA 3TNUA 1P84D 3CC4P 3H1HJ 5CJ4A 2OYOA 1PZQA 1YITP 1X0TA 2DW3A 2C9NY 3PJSK 4UB8E 4A7PA 3A2AA 2R32A 1S9KD 3O8ZA 2JO1A 5APTA 5AVRB 3S9OA 4KT0J 4H0LD 3AECC 3TF5A 3L72J 3HUSC 2HODB 1U57A 2WWWA 4U3FJ 1PL5A 2HODA 5KLIB 2FFDC 1SQXD 1GK6A 2MKVA 2YIUC 3FGAD 2WPVB 3L70J 2IBZI 2KS1A 3B5ND 5GTIH 2RN0A 1YQ4C 4TLFA 5AW2B 1NTMD 4OGQD 4OGQC 2D2CC 5AVWB 3HE5A 2KP8A 3M9HA 2HYNA 5C39A 2QVAA 4B86A 4GIFA 2PRRA 2B88A
chains in the Genus database with same CATH topology
1EC5A 4ASWA 1JM0A 2KS1B 1OVUA 5CBNA 1EDLA 1OVVA 4HKZH 4GODA 2B87B 4MN4C 3MZWB 2JWDA 2I8DA 4GOEA 1S3JA 2WMMA 1OVRA 1U7JA 2KZJA 4K3AA 2M0BA 2B89A 4HJGH 5DJUB 1NVOA 1LP1A 1BDCA 4WWIA 5EFWB 2LXBA 1DEEG 5CBOA 4KJMA 4BXLA 2RKLA 3ZDMA 2QRXA 1EDKA 5DJTB 1JMBA 2ZAEB 3FXDA 2P58A 2KUBA 3QWOC 2R44A 2LXCB 4IOIH 2OTKE 1H0TA 2Q1KA 2K3RA 2KZIA 1ZXGA 4ZNCA 1BDDA 3MHVA 2KI7B 2HR3A 1LT1A 1Y47A 1EDJA 2M5AB 4NPEA 4NPDA 2KIKA 3PH0A 1ZW0A 2UWJE 2LR2A 1SS1A 4GOFA 3RGUA 4K35A 4NPFX 4HB1A 5K5GB 1Q2NA 1X0TA 1U7MA 1MFTA 3FXEA 3S1KA 1EDIA 2B87A 4ZMDA 4JBZA 1FC2C 2SPZA 4CPGA 1H0TB 1LP1B 4EYYQ 2M5AA 5C39A 2QVAA 4ASVA 2B88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EC5 A;  4ASW A;  1JM0 A;  2KS1 B;  1OVU A;  5CBN A;  1EDL A;  1OVV A;  4HKZ H;  4GOD A;  2B87 B;  4MN4 C;  3MZW B;  2JWD A;  2I8D A;  4GOE A;  1S3J A;  2WMM A;  1OVR A;  1U7J A;  2KZJ A;  4K3A A;  2M0B A;  2B89 A;  4HJG H;  5DJU B;  1NVO A;  1LP1 A;  1BDC A;  4WWI A;  5EFW B;  2LXB A;  1DEE G;  5CBO A;  4KJM A;  4BXL A;  2RKL A;  3ZDM A;  2QRX A;  1EDK A;  5DJT B;  1JMB A;  2ZAE B;  3FXD A;  2P58 A;  2KUB A;  3QWO C;  2R44 A;  2LXC B;  4IOI H;  2OTK E;  1H0T A;  2Q1K A;  2K3R A;  2KZI A;  1ZXG A;  4ZNC A;  1BDD A;  3MHV A;  2KI7 B;  2HR3 A;  1LT1 A;  1Y47 A;  1EDJ A;  2M5A B;  4NPE A;  4NPD A;  2KIK A;  3PH0 A;  1ZW0 A;  2UWJ E;  2LR2 A;  1SS1 A;  4GOF A;  3RGU A;  4K35 A;  4NPF X;  4HB1 A;  5K5G B;  1Q2N A;  1X0T A;  1U7M A;  1MFT A;  3FXE A;  3S1K A;  1EDI A;  2B87 A;  4ZMD A;  4JBZ A;  1FC2 C;  2SPZ A;  4CPG A;  1H0T B;  1LP1 B;  4EYY Q;  2M5A A;  5C39 A;  2QVA A;  4ASV A;  2B88 A; 
#chains in the Genus database with same CATH topology
 1EC5 A;  3EFG A;  1L4A A;  1NTZ D;  2W8Z A;  2ZYA A;  3A0B H;  2YO2 A;  5KJ7 C;  5KLV K;  3D70 A;  2E5T A;  1QL1 A;  1BGY E;  1JCC A;  1LTG C;  1NU1 G;  1QGK B;  1LTT C;  1XTC C;  2FYU K;  2K37 A;  3L75 G;  4EIJ A;  2JJL A;  3CCU P;  1EZV G;  3L74 J;  2GUV A;  2E76 B;  2JWD A;  4GDO A;  1IFJ A;  2ZVO B;  4XE5 B;  1OVR A;  1EZV E;  1SQQ J;  1T3J A;  1RE3 C;  2E75 D;  5TIS E;  1IJD B;  1L0N E;  2NPS C;  1K8A Q;  3JC2 2;  3A0H H;  3JCU H;  3CXH D;  1R5S A;  3SFD C;  4IFD K;  3CCM P;  1BE3 D;  5CCH C;  1GK4 A;  4HJG H;  5DJU B;  3H1I G;  4AQR D;  3L75 E;  3HUS A;  1PGJ A;  2FYU J;  2GA1 A;  4WWI A;  3CLQ A;  5AW7 B;  5EFW B;  3M91 A;  1AQT A;  1KB9 D;  1DEE G;  4PV1 C;  5KLV J;  5CBO A;  3VN0 A;  3G71 P;  1VF5 B;  2K9J A;  4KJM A;  2E5Y A;  2Y9Z A;  1T6A A;  3WUU A;  2WTY A;  1FDM A;  2C9L Y;  3GLM A;  1T3U A;  4I1L A;  1VL2 A;  2BCC G;  3C8V A;  5AW3 B;  1HUC A;  1LTJ C;  3B71 A;  1BGY J;  3M9B A;  3VMA A;  1ZR2 A;  1RF1 C;  1EDK A;  1VQM P;  2RMZ A;  1EZV I;  3I55 P;  3CCJ P;  2YKQ A;  4PD4 D;  1VQ7 P;  2ZAE B;  1TU3 F;  5CHX A;  1WMK A;  2A06 D;  3NFQ A;  2A06 G;  1SQX K;  1FZG A;  1VQN P;  1NKN A;  2FYU G;  1JY3 O;  3FXD A;  4W80 A;  1KC8 Q;  1AJY A;  2P58 A;  5KLV G;  4D6T J;  1YIJ P;  2KK7 A;  2KUB A;  4C7R A;  2KB7 P;  2Q3I A;  3H1I E;  2R44 A;  1PFI A;  4RES B;  3H1L E;  1GW3 A;  2BCC D;  1WT6 A;  4DOJ A;  1H0T A;  4U3F E;  2MJZ A;  2Q1K A;  3MUD C;  4AYC A;  2QJY B;  3CX5 E;  3M0D A;  2IBZ G;  1USE A;  1L0N G;  2JDI H;  4EOT A;  3GHG B;  1J1D C;  2E42 A;  1SFC A;  1PGP A;  2V4H A;  3CCQ P;  3MHV A;  2WSC H;  3L73 D;  5APW A;  3L71 E;  1DX7 A;  2KI7 B;  2P2U A;  3L73 J;  4H13 B;  3GF7 A;  4JF7 A;  1VQ9 P;  1VF5 D;  3VMY A;  1M1J B;  3Q1M A;  1PPJ G;  5KJ7 A;  1BCC G;  1FJP A;  4NPE A;  1PP9 E;  1SQP E;  1KIL D;  3H25 A;  1N7S B;  3OA7 A;  2G8Y A;  4U3F G;  1NGM B;  2P7J A;  3P8C E;  1RF1 A;  3RBZ A;  1OIP A;  1NTK E;  1RQU A;  2ZXE B;  4H44 D;  1VQP P;  1VQ4 P;  4WY4 A;  1BE3 J;  3A7O A;  1YTZ T;  1L4A C;  2Z4E A;  2LKM A;  1SS1 A;  4GOF A;  3CCE P;  3KQG A;  1OMI A;  2KXP B;  2Q9I A;  5AW9 B;  4K35 A;  1E5W A;  1HVV A;  4NPF X;  1FZC A;  2HPC A;  1KIL B;  1P84 H;  4N3Y B;  2ZXX A;  1M57 D;  4DCK A;  2FYU E;  2HLO A;  2O01 N;  3L75 J;  5K5G B;  1Q2N A;  1X79 B;  5KKZ B;  4RJT A;  1GU5 A;  3L74 D;  2WVR A;  3C1L A;  2BAS A;  1T2K C;  1JNM A;  2YKP A;  3AE7 C;  5KAI H;  3TYY A;  4XFJ A;  2YIU B;  3LW5 J;  1SLQ A;  3BCC E;  1VQ5 P;  1L0N J;  3HD7 B;  1FZA A;  1KZU B;  2D2C D;  3CWB E;  1URQ A;  1VF5 C;  2B87 A;  2FYN B;  3E1R A;  1XTG B;  3H32 A;  4N6J A;  2D2C B;  4O9B A;  4ZMD A;  4R4L A;  2POH A;  3WU2 E;  2WSE H;  4ZKP A;  4DZO A;  2R5D A;  3AE9 C;  1ZRT E;  1N7L A;  1RF1 B;  2L91 A;  1W2B O;  1FC2 C;  3VTP C;  1MKM A;  4PJ0 H;  1PGO A;  2NRG A;  4CPG A;  1LP1 B;  4H0L C;  1OX3 A;  4EYY Q;  2N1T D;  2ZYG A;  1E79 H;  4BRY B;  1S5L X;  5TIS H;  3D71 A;  2OYI B;  1WRG A;  3M9Q A;  1KOR A;  1LTJ A;  3F89 A;  4HYT B;  2XV5 A;  1SQV J;  2JR8 A;  1EQ7 A;  3AE8 C;  4DJG A;  3SWK A;  1OVU A;  1SQB E;  1BE3 G;  2H88 C;  2IX7 C;  3AE6 C;  4Y99 B;  3TGU D;  1KQS O;  3KPE A;  3H1H G;  2O3J A;  1GL2 D;  4GOD A;  1NTZ E;  2NPS B;  2B87 B;  3BRV B;  4EDF A;  3CD6 P;  1PV3 A;  1RE4 A;  2QJP C;  1FZB A;  4GOE A;  2OGU A;  4YXD C;  4H44 C;  1N73 B;  1ZOY C;  2FKW B;  2E76 D;  4U7J A;  3CCV P;  1A02 J;  1KTM A;  1U7J A;  1VQ6 P;  2P1J A;  1FOS F;  2JKV A;  1HF9 A;  1JEK A;  1DEB A;  1JCD A;  1NU1 D;  2KZJ A;  3QH9 A;  4H13 C;  3TK1 A;  2OYH A;  4K3A A;  1LTJ B;  3WUT A;  5B66 E;  1FZC B;  1PIX A;  1P84 E;  4EI2 A;  1NVO A;  1JB0 J;  3H1H E;  2WPS A;  1OZH A;  2W6B A;  4LGD E;  5AVX B;  1VDF A;  1LTB C;  1J1E C;  5CCG C;  5BVZ A;  3CMA P;  1AFO A;  2QJK B;  1HTL C;  2E75 B;  1KYO D;  3JSV C;  2A45 G;  2FXO A;  3CC2 P;  4BXL A;  2WPR A;  2RKL A;  1Q90 D;  1R5L A;  3E7K A;  3G3Z A;  1NHL A;  3H1K D;  3ZDM A;  5GTH E;  3GF3 A;  3PLN A;  1IFN A;  1G1J A;  4WB4 A;  2H43 A;  3D6Y A;  2ZT9 D;  3AED C;  1LGH B;  2M8R A;  1NAY A;  3BVH A;  1N7S A;  2C0W A;  3HD7 A;  1LJ2 A;  1SVF A;  3L4F A;  1SQX E;  3N7N A;  2IYO A;  3L72 G;  1NAF A;  2JWA A;  2RH0 A;  1JMB A;  3B5N A;  3L74 G;  1GL2 C;  2FXM A;  4JYC A;  5DJT B;  1PGQ A;  1FS0 E;  3CXH I;  1VQO P;  3A0B E;  5M1B A;  1NTK K;  2FXP A;  1T8Z A;  4R4M A;  3CWB G;  1L2P A;  4PJ0 E;  3CCS P;  1MFZ A;  4C7N B;  1IO4 A;  3NMD A;  3P7K A;  3GHG A;  3P8M C;  2OQQ A;  2A06 E;  2Q3E A;  3KZI E;  5AVQ B;  3CCL P;  2ZT9 B;  3B5N B;  1J1D B;  1N73 A;  3G6E P;  1NTM J;  1MV8 A;  2WZ7 A;  2FFD A;  4XA4 A;  3BAT A;  1JOC A;  2FYN C;  2K3R A;  5L8R J;  1YBK A;  3A5T A;  3Q5S A;  2WT7 A;  1ZN5 A;  2AEM A;  1MZ9 A;  3HE4 A;  1NO4 A;  3V6I A;  1L0L D;  3WMM 0;  2IFN A;  1QVG O;  1K9M Q;  1PPJ D;  2YMK A;  1L4A B;  2YMY A;  1Q7Y Q;  2HR3 A;  1Q86 Q;  2WSS H;  5CCH D;  1SQQ G;  1BCC E;  1Y47 A;  2W83 C;  1FZF A;  1AQ5 A;  3CXH E;  2OYI A;  1HGZ A;  1S4X A;  2V7Q H;  2WSF H;  1OW7 A;  4NPD A;  1NU1 K;  1ZLL A;  2QEX P;  3KDP B;  4I6M C;  1CW5 A;  1SQQ D;  3GG2 A;  1FDI A;  3MIW A;  4LLH A;  3IAO A;  5CMZ A;  1Y9B A;  1USD A;  2HG5 D;  2IBZ D;  3KZI H;  3PRJ A;  2B9B A;  1A02 F;  1IFM A;  1ZW0 A;  1J2J B;  5KKZ C;  2H7H A;  1KFN A;  4IFF A;  2NPS D;  2H8P D;  1SQB G;  1OW8 A;  3BCC J;  2BEZ F;  2W90 A;  1YI2 P;  2K88 A;  1RE3 A;  1DD4 A;  1NYH A;  4RO0 A;  1JUN A;  2N9B A;  2QIW A;  3RGU A;  4H44 B;  3RK3 C;  1SQV G;  2IYP A;  3UIA A;  3B4S A;  3IR9 A;  4L76 A;  4OWF A;  3HD7 C;  1NTZ J;  3OAK A;  3CME P;  4C7N A;  3FWN A;  1FZE A;  4UB8 H;  2WPQ A;  4YTP C;  1L0L J;  2N1T B;  3N4X A;  2W27 A;  2ZVN B;  4PV1 D;  5AVZ B;  5KAF E;  3L37 A;  5APS A;  1SQV E;  1LNQ A;  3EFF K;  4UB6 H;  1NWQ A;  3P32 A;  3W68 A;  1Y8A A;  1J1E B;  1YJN P;  1JY2 N;  1BSH A;  3MTU E;  1LWU C;  1IFI A;  1EDI A;  3VP9 A;  3IFM A;  3H1L D;  3L72 D;  3C9I A;  3M06 A;  4H0L B;  5KAI E;  2ZJS E;  1URQ D;  1D7M A;  2G3A A;  1OXZ A;  3PP5 A;  2QG4 A;  3LID A;  1S5L E;  2HFE D;  2YO3 A;  1URQ B;  1OWA A;  4D6T D;  1M90 Q;  1PP9 J;  3SSU A;  5B66 H;  3CWB J;  2BCC J;  3GW6 A;  1FDO A;  1SFC C;  1X22 A;  2IFM A;  2XKM A;  3K5B A;  4IFM A;  1FJK A;  3AEB C;  4OH8 B;  1RH5 B;  5APU A;  5BU8 B;  5GTI E;  3WUV A;  1GDT A;  1UIX A;  3L73 E;  4ASV A;  2OYH B;  3IN6 A;  1KQG B;  5E79 H;  3VOP A;  1VQ8 P;  1YTZ I;  1SQB K;  2N1T A;  4ASW A;  1JM0 A;  1KD1 Q;  5KJ7 D;  4PD4 E;  1SQP K;  2KS1 B;  3V5B A;  1IFP A;  1DD3 A;  4PD4 I;  1N73 C;  1DIP A;  1L4A D;  3E1I A;  2HPC B;  2QJY C;  3H1K J;  4JQ0 D;  1S5L H;  4GKG A;  3RK3 E;  1KN7 A;  2K1A A;  2XDJ A;  3M0D C;  1CSB A;  4MN4 C;  1FZC C;  1BGY D;  3L71 G;  4WY4 D;  3GHG C;  1L0N D;  2I8D A;  3A0H E;  3JCU E;  5CJ0 A;  4TT3 H;  2QJK C;  3U1C A;  2E75 C;  3MP7 B;  4U3F D;  3V2R A;  2QA4 P;  4AUW A;  1BE3 E;  1LTS C;  2Z5I A;  3U59 A;  3MD0 A;  3BRT B;  3TGU G;  2ZYD A;  4IL6 E;  5AW8 B;  1GD2 E;  1KQF B;  1AA0 A;  1FOS E;  1SQP J;  2M3B A;  1NTM G;  4W7Z A;  1SP4 A;  2IZ0 A;  2M0B A;  3L73 G;  2FYU D;  3VMZ A;  1YQ3 C;  2J58 A;  1LP1 A;  2P10 A;  3KXD A;  3HE5 B;  4IL6 X;  3VP8 A;  3CC7 P;  2R5B A;  3TSI A;  2LXB A;  4WY4 C;  1NTM K;  2AEF A;  2YXQ B;  1RY3 A;  3HE4 B;  2BEQ D;  3KHU A;  1JY2 O;  2YXR B;  3CX5 I;  2WSF J;  3L71 J;  1IZN B;  1NOH A;  1HBW A;  2FYZ A;  2C0X A;  3H1J D;  1KYO E;  2Y0C A;  2FY8 A;  2KOG A;  3CI9 A;  5KLV E;  1YHQ P;  2FFD B;  5KLI C;  1KIL C;  2FBW C;  4Y28 J;  1N7S D;  1KQL A;  4BWN A;  1LTA C;  1QVF O;  3H1L J;  1LT9 A;  2PGD A;  2VRS A;  3CXH H;  4WVZ A;  3H1I J;  3SFE C;  3H1I D;  2CPS A;  4YPC A;  3IF4 A;  1Q82 Q;  1NU1 J;  1BSN A;  1RE4 C;  4I7Z C;  1CI6 B;  2BCC E;  2H89 C;  1GMJ A;  3AE3 C;  2LXC B;  2OTK E;  3T97 B;  1KB9 H;  1YJW P;  3H1J G;  3CCR P;  3L35 A;  1NTZ K;  2WIT A;  3L70 G;  4KHX A;  4L74 A;  1K05 A;  1NH4 A;  3L74 E;  3TGU E;  2OTL P;  3AE5 C;  1JO5 A;  2E76 C;  1IFD A;  1UII A;  3L71 D;  3SWY A;  3CX5 D;  5H2F E;  3H32 B;  1KYO I;  2AXT E;  1BDD A;  3TGU J;  3VMX A;  1URQ C;  5KTB A;  1FE6 A;  3L75 D;  3G4S P;  2XNX A;  2OYI C;  2IPP A;  1EXI A;  1KB9 E;  1YJ9 P;  3Q5P A;  1ZRT D;  1M1J A;  1NU1 E;  2N9Y B;  3P8C D;  1EDJ A;  2XZR A;  5CCH A;  2M5A B;  5B5E H;  1L0L K;  1IK9 A;  3A3Y B;  2KSJ A;  3L70 E;  4N78 D;  3NXS A;  1X9V A;  5AW4 B;  1GW4 A;  2KIK A;  3PHL A;  3RK3 B;  1KIL A;  1M7L A;  1KIL E;  1G1I A;  3RK2 B;  4GT1 A;  2N1T C;  1BGY G;  1RHZ B;  3I5C A;  3W67 A;  1SQQ E;  1EZV D;  2UWJ E;  1LT9 C;  2P67 A;  3O6Q A;  1LTI C;  3EQ2 A;  1SQV K;  4JPZ B;  1M56 D;  2NPS A;  3H1L G;  4RKU J;  3R4Y A;  1H89 A;  3OW2 O;  2I1J A;  4L75 A;  2O01 J;  1JTH B;  1LWU B;  1OFC X;  1OW6 A;  2K9Y A;  4L73 A;  1KV4 A;  1YYC A;  1S9K E;  1BCC J;  5B5E E;  3Q5R A;  1MUU A;  2YNY A;  3B8E B;  5AVU B;  1KB9 I;  1ZR4 A;  2E74 C;  4QMA A;  5CCG A;  1VQL P;  4W7Y A;  3H1J J;  1T2K D;  1U7M A;  4D6T G;  4WBA A;  1MFT A;  5AW6 B;  2Q5U A;  3FXE A;  3I56 P;  1ZME C;  2GUS A;  2R3C A;  2OYH C;  1Z56 A;  3HTK B;  2OTJ P;  5AVS B;  1CZQ A;  3RL0 B;  1SFC B;  4ZKU A;  1NJI Q;  1NTM E;  1NKZ B;  3FWL A;  3VYI A;  2QM7 A;  2R3S A;  4IL6 H;  4BRY A;  1GL2 B;  4JBZ A;  3L72 E;  3V4Q A;  1M8O B;  3SWF A;  2SPZ A;  1PP9 D;  2J59 M;  2V7Q J;  3H1K E;  1SQP D;  3KYQ A;  3HUS B;  2E74 D;  2I1K A;  2M5A A;  3BCC G;  2AEJ A;  3FX0 A;  3LIE A;  5APQ A;  3V4W A;  2XU6 A;  3U1A A;  1P84 I;  1Q81 Q;  1H0T B;  2KYV A;  1M1J C;  2ZT9 C;  3MGN A;  3V2Q A;  2W6J H;  3B5N C;  1GL2 A;  2KNC B;  2WQY C;  3AEE C;  3HRN A;  4OGQ B;  1JY3 P;  1HH0 A;  5E79 E;  5AVV B;  3RBX A;  3TNU B;  3MUD A;  1OVV A;  1L0L G;  4YXW H;  4HKZ H;  5APV A;  3RL0 g;  3USS A;  1SQB D;  1N86 A;  5APX A;  2E43 A;  3HTK A;  3MZW B;  2KSE A;  1KYO H;  1QX8 A;  2OAR A;  2PP6 A;  3BAS A;  3RK2 D;  4DT0 A;  2IZ1 A;  1S3J A;  1RF0 C;  2WMM A;  2CK3 H;  2ZFC A;  3H6P A;  3R2P A;  4WY4 B;  1AVY A;  1VPC A;  1S1C X;  2K9J B;  1CI6 A;  1ZP0 C;  3L36 A;  2XND H;  1K04 A;  3BCC D;  2ITA A;  2KLU A;  1L0N K;  2O1J A;  1QL2 A;  2Y9Y A;  3OJA B;  1PP9 G;  1AV1 A;  1JTH A;  1NTZ G;  2B89 A;  3CWB D;  5AVY B;  1L0L E;  2J5U A;  1NTK D;  5CCG D;  1PPJ E;  1BDC A;  1M1K Q;  1GZL A;  3M0A A;  1IK7 A;  2KLV A;  3O6Q B;  1N8R Q;  1ZV8 A;  2CPB A;  2PFX A;  2W6A A;  3Q2Y A;  1JMM A;  3HD7 D;  5AW1 B;  2GM4 A;  1S2E A;  1SQX G;  2AXT H;  2QRX A;  1FBM A;  2Z5H A;  3H1K G;  3LW5 H;  2WT7 B;  1QLE D;  3S1K A;  4I2L C;  1SQB J;  2YKO A;  4I7Z B;  1SQQ K;  2Y0E A;  5GTH H;  4D6T E;  3CX5 H;  2Y0D A;  4PV1 B;  5H2F H;  3AE4 C;  1G2C A;  2QSI A;  3EWK A;  3GMA A;  4OVN F;  4PD4 H;  3S4R A;  3V2P A;  1EDL A;  1RQV A;  1FU1 A;  2M3E A;  2WSC J;  3AE2 C;  3CL3 D;  3ABV C;  2NZ2 A;  5TJH A;  1HJ0 A;  2E74 B;  2PAJ A;  3QWO C;  1G2C B;  1HJB A;  3TDK A;  3CPW O;  1FAV A;  1LWU A;  4IOI H;  4HH2 A;  2JEE A;  2L5G B;  3WU2 H;  1EXJ A;  1QEX A;  1K73 Q;  1AVO A;  1KFM A;  4Y99 C;  3ITK A;  4Z1M H;  3PTZ A;  1SQV D;  1H88 A;  1N2D C;  1GTW A;  1SFC D;  3RL0 C;  2KZI A;  2O1K A;  3II6 A;  1ZXG A;  2QJP B;  3D6Z A;  4C46 A;  3AE1 C;  1S72 P;  4ZNC A;  2KNC A;  1NTK G;  1BCC D;  3RK2 C;  3H1H D;  1GU4 A;  1HGV A;  3F5H A;  5AW0 B;  1H8A A;  4UB6 E;  5APY A;  2QE7 H;  5AVT B;  1LT1 A;  5BU5 A;  1LT9 B;  3AEG C;  2O01 H;  3V2N A;  2Q6Q A;  1KMI Z;  1W2E A;  2JP3 A;  3Q3D A;  1R8E A;  1JY3 N;  1DH3 A;  1VQK P;  3AEA C;  4H13 D;  1X8Y A;  5AW5 B;  1SQP G;  3NTN A;  4M3L A;  3PH0 A;  1IC2 A;  1SQX J;  3AEF C;  1JY2 P;  1HWT C;  2A45 H;  2WSE J;  1W5C E;  2A45 I;  3L70 D;  1RF0 A;  4JYB A;  2IBZ E;  4N78 E;  3RL0 D;  2LR2 A;  2Q7C A;  1NTK J;  4LC1 A;  2IDB A;  3RK3 D;  5CBN A;  3H1J E;  5KLV D;  5KAF H;  2QM8 A;  1N7S C;  3T97 A;  2AXC A;  4HB1 A;  3G9R A;  3TNU A;  1P84 D;  3CC4 P;  3H1H J;  5CJ4 A;  2OYO A;  1PZQ A;  1YIT P;  1X0T A;  2DW3 A;  2C9N Y;  3PJS K;  4UB8 E;  4A7P A;  3A2A A;  2R32 A;  1S9K D;  3O8Z A;  2JO1 A;  5APT A;  5AVR B;  3S9O A;  4KT0 J;  4H0L D;  3AEC C;  3TF5 A;  3L72 J;  3HUS C;  2HOD B;  1U57 A;  2WWW A;  4U3F J;  1PL5 A;  2HOD A;  5KLI B;  2FFD C;  1SQX D;  1GK6 A;  2MKV A;  2YIU C;  3FGA D;  2WPV B;  3L70 J;  2IBZ I;  2KS1 A;  3B5N D;  5GTI H;  2RN0 A;  1YQ4 C;  4TLF A;  5AW2 B;  1NTM D;  4OGQ D;  4OGQ C;  2D2C C;  5AVW B;  3HE5 A;  2KP8 A;  3M9H A;  2HYN A;  5C39 A;  2QVA A;  4B86 A;  4GIF A;  2PRR A;  2B88 A; 
#chains in the Genus database with same CATH homology
 1EC5 A;  4ASW A;  1JM0 A;  2KS1 B;  1OVU A;  5CBN A;  1EDL A;  1OVV A;  4HKZ H;  4GOD A;  2B87 B;  4MN4 C;  3MZW B;  2JWD A;  2I8D A;  4GOE A;  1S3J A;  2WMM A;  1OVR A;  1U7J A;  2KZJ A;  4K3A A;  2M0B A;  2B89 A;  4HJG H;  5DJU B;  1NVO A;  1LP1 A;  1BDC A;  4WWI A;  5EFW B;  2LXB A;  1DEE G;  5CBO A;  4KJM A;  4BXL A;  2RKL A;  3ZDM A;  2QRX A;  1EDK A;  5DJT B;  1JMB A;  2ZAE B;  3FXD A;  2P58 A;  2KUB A;  3QWO C;  2R44 A;  2LXC B;  4IOI H;  2OTK E;  1H0T A;  2Q1K A;  2K3R A;  2KZI A;  1ZXG A;  4ZNC A;  1BDD A;  3MHV A;  2KI7 B;  2HR3 A;  1LT1 A;  1Y47 A;  1EDJ A;  2M5A B;  4NPE A;  4NPD A;  2KIK A;  3PH0 A;  1ZW0 A;  2UWJ E;  2LR2 A;  1SS1 A;  4GOF A;  3RGU A;  4K35 A;  4NPF X;  4HB1 A;  5K5G B;  1Q2N A;  1X0T A;  1U7M A;  1MFT A;  3FXE A;  3S1K A;  1EDI A;  2B87 A;  4ZMD A;  4JBZ A;  1FC2 C;  2SPZ A;  4CPG A;  1H0T B;  1LP1 B;  4EYY Q;  2M5A A;  5C39 A;  2QVA A;  4ASV A;  2B88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...