1OZHA

The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
552
structure length
545
Chain Sequence
VRQWAHGADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLLDSSIRIIPVRHEANAAFMAAAVGRITGKAGVALVTSGPGCSNLITGMATANSEGDPVVALGGAVKRADKSMDTVAMFSPVTKYAIEVTAPDALAEVVSNAFRAAEQGRPGSAFVSLPQDVVDGPVSGKVLPASGAPQMGAAPDDAIDQVAKLIAQAKNPIFLLGLMASQPENSKALRRLLETSHIPVTSTYQAAGAVNQDNFSRFAGRVGLFNNQAGDRLLQLADLVICIGYSPVEYEPAMWNSGNATLVHIDVLPAYEERNYTPDVELVGDIAGTLNKLAQNIDHRLVLSPQAAEILRDRQHQRELLDRGAQLNQFALHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIARYLYTFRARQVMISNGQQTMGVALPWAIGAWLVNPERKVVSVSGDGGFLQSSMELETAVRLKANVLHLIWVDNGYNMVAIQEEKKYQRLSGVEFGPMDFKAYAESFGAKGFAVESAEALEPTLRAAMDVDGPAVVAIPVDYRDNPLLMGQLHLSQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structures of Klebsiella pneumoniae Acetolactate Synthase with Enzyme-bound Cofactor and with an Unusual Intermediate.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Lyase
molecule keywords Acetolactate synthase, catabolic
total genus 199
structure length 545
sequence length 552
chains with identical sequence B, C, D
ec nomenclature ec 2.2.1.6: Acetolactate synthase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ozhA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ozhA04
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ozhA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1ozhA02
2XT6A 2BP7A 1X7XA 4ZZIA 1PI3A 1V11B 1OZGA 3PKJA 5D7NA 2X7JA 2PDAA 1BFDA 4RJIA 4GP9A 2JIBA 1V1RA 3EYAA 2VBFA 4JT9A 3U3DA 2C31A 2H4JA 2IHTA 1OZFA 4F4UA 1UMCA 3D4BA 1O96B 2C3YA 1PTJC 3ZHQA 1IK6A 2BFBB 1V5FA 1V5EA 4UTVA 4MPPA 4UUAA 3AI7A 2WVHA 2JLCA 5C4IA 1POWA 4K9MA 4XEUA 1ITZA 4Q9DA 2JI7A 1SZCA 3JR3A 3IAEA 1U5BA 3PDHA 4Y6QA 3EXHB 4I5IA 1B0PA 4KXXA 1Q17A 4K9OA 2O01N 3CLRD 5HGXA 3CLTD 4MPJA 3AHDA 2O1SA 1OLXB 2JGDB 2Q5OA 2A1TR 4O8ZA 3IAFA 3M7IA 3D7KA 3PKIA 2BEVB 1T9DA 1Q6ZA 1N0HA 2G25A 3E9YA 3ZHVA 1AY0A 4K9KA 2VK4A 4UTZA 5I51A 2H4FA 4FEGA 4KXYA 1XLTC 4K9LA 1V1MA 3GLRA 2PANA 4RMGA 1UPCA 4RMIA 2BEVA 1V16B 5MF6A 4C7BA 3ZHSA 4TWIA 3EXFB 1T9AA 4GM0A 1OLSA 3AHJA 1WCIB 1PO7A 1U31A 1PT9A 2OORC 5I4IA 5DGDA 2EZ9A 3AHGA 5ERYA 1W85B 3RIYA 5EJ7A 2QQFA 4GG1A 3EXEB 1YI1A 4BUZA 3EXFA 2FRDC 2WVAA 1S7GA 3EY9A 1M2HA 1X7YB 4JUAA 4HD8A 1UPAA 1UMCB 1X80B 2IEAA 1YNOA 4MZXA 3KOMA 1Q14A 1TKBA 2BFBA 2AXCA 1OLUB 2NYRA 5EJMA 4BN4A 2XT9A 5EJ9A 5ERXA 1ICIA 1OLSB 4FVTA 2V3WA 4BV2A 3O6QB 2BEWA 1TKCA 1X7ZA 4Y6LA 3D81A 4QELA 3EXHA 2EZTA 4UTXA 2YICA 4UTRA 1Z8NA 1M2GA 3FZNA 3LPLA 2A1UA 5EJ6A 1GPUA 4C7XA 3DUFB 3ZGOA 4L2IA 2DJIA 1YD7A 4TWJA 4FEEA 1NGSA 2OD9A 3MOSA 4GM4A 4JU8A 4F56A 4IF6A 5EJAA 5DGTA 4RMJA 1OVMA 2BEUB 1DTWA 2C3UA 1UPBA 4MQ5A 3FSJX 4KXUA 3M6LA 4JD5A 2JI6A 5ESDA 4V1CB 1YC2A 1EFVA 5BWLA 1UMDA 1YBHA 2BFCA 2G67A 2PGOA 3HWX1 2OD2A 1DTWB 4X3OA 2YIDA 1T9CA 1MCZA 4C7VA 1MA3A 3CF4G 1X7WA 1M2JA 5EXEA 4D5GA 3JWPA 2BFCB 4KXQA 2BFEA 5I5GA 1TRKA 5EJ4A 1Y9DA 5MFZA 2G28A 3CLUD 3RIGA 1Q1AA 4JT8A 1ZPDA 2H4HA 5AHKA 2BP7B 4WBXC 1YC5A 1YI0A 1YHYA 2JGDA 1U28C 1R9JA 5EJ8A 4GPEA 2J9FA 2Q5LA 2VK8A 1PYDA 1T9BA 4RJKA 2FWNA 4G1CA 5MFPA 4ZP1A 1PNOA 4BV3A 4QPZA 2BFDB 5IMSA 1PNQA 4JUBA 3U31A 2C3OA 1D4OA 4UTNA 2C3PA 2IHVA 2UZ1A 4Y6OA 4KGDA 2R8OA 3AHFA 1X7XB 2WVGA 3HWWA 1M2NA 5MGNA 2BFFA 2JI9A 4R8MA 1UMBA 4JUDX 1W88B 3DVAA 2Q28A 2AG0A 3ZHRA 4UU8A 3ZHUA 3GLUA 5HJEA 4COKA 4HDAA 3LQ2A 4MPRA 5HYVA 1OZHA 4JUFA 2NXWA 2BFDA 1U5BB 2RH0A 3ZGVA 4KXVA 2R5NA 5BWOA 1JSCA 1W88A 3LQ1A 2VBIA 3K35A 1NI4B 5FYQA 4V1CA 3EXIB 2XTAA 3OOYA 2H2IA 2JI8A 1NM5C 1EFPA 1UMBB 3AHCA 4UUBA 1POXA 2AG1A 1X80A 2H2FA 1V5GA 3M49A 5EJ5A 4D5EA 2O1XA 4JSRA 1HZZC 3RIMA 2Y0PA 2Q5JA 3DVAB 1SZDA 1TKAA 4BN5A 1U2GC 4BVEA 2B4YA 3ZG6A 1OLUA 5EXDA 3UPTA 3LQ4A 1X7WB 1NI4A 2VJYA 2FSVC 3GLTA 2OZLB 1U2DC 2IHUA 4J16C 1WCIA 5K6RA 3DUFA 3F6EX 5DEIA 3EXHC 2OO5C 2W93A 5K2OA 2Q27A 1V16A 3EXIA 4JUCA 2C42A 4V1CI 2Q29A 4RMHA 2E6KA 4QQ8A 4X3PA 2EZ8A 1V1MB 2H2GA 1QPBA 1X7YA 3M34A 2VK1A 1W85A 4K9NA 3OE1A 4KPUA 3FLMA 3GLSA 3EXG2 2VBGA 3EA4A 3CLSD 3F6BX 1J8FA 1RP7A 4BVHA 4RJJA 1M2KA 2OZLA 2BFFB 3HYLA 2UZAA 1QS0B 3UK1A 2UZ1B 4K9QA 1UM9B 5I5EA 2C3MA 5K6TA 1DJLA 1UMDB 5HHTA 2PGNA 2BRUC 2BEWB 4C78A 2BEUA 2H2HA 5BWNA 1PVDA 2FR8C 1X7ZB 4JU9A 4UU7A 2FN3A 3DV0A 4K9PA 4BVGA 3AHEA 1S5PA 2QTAA 1QS0A 1YHZA 5K3SA 1UM9A 2JLAA 2HJHA 4IAOA 3ZHTA 4J1TC 2QQGA 1OLXA 1V11A 2R8PA 2Q5QA 5FEMA 4KXWA 3AHIA 4BVBA 2EZUA 4GM1A 1QGDA 3AHHA 4FZ3A 4IG9A 1KEKA 1YTLA 2H59A 2QTCA 4L3OA 2EZ4A 2H2DA 1L8AA 4BVFA 2BFEB 2OD7A 3L84A 3DV0B 1E3TA 2J9FB 1V1RB 1O97D 3EXG1 3EXEA
chains in the Genus database with same CATH superfamily
5CB4F 2OPBA 3DFFA 5E1BA 3SLRA 4EECA 1DWQA 3ADCA 2C7QA 1ID8A 4I0WB 5DNVA 3FVVA 3STTA 1TZCA 1Z2CA 3LK7A 4L5JA 3NVMB 4G5FA 1H2XA 4QBHA 3SX2A 2COEA 4PYJA 1W30A 2V58A 3ROKA 1L0ND 4C7JA 1JZQA 2XGGA 4RJIA 3WLSA 5KTYA 4KNWA 5IC4A 4K0RA 5DX8A 1D2NA 1TUBB 3U37A 1K05A 1AJYA 2PX5A 2QQEA 3CCMP 2ZRAA 3NBAA 2HREA 2IYXA 4QL3A 5DSZA 4EYYQ 3TNDA 3H1PA 4LJKA 1VG0B 2BGJA 2WHYA 4ZDIA 1RH5B 3RRYA 1MR3F 1IN8A 4KGXA 2IYSA 1JAIA 3ZJTA 1N5JA 2I3BA 4GYYA 4CMCA 1E1CB 3S8EA 2XGMA 2WWWA 1O3YA 3VKFA 3A6EA 2A5FA 3M3DA 4IZIA 1E32A 1TVCA 1E2EA 4B8ZA 4EK9A 1KILB 4O33A 4TV8A 1PDWA 1NU1K 2AFIB 3KTDA 3QYPA 1OBVA 4HB1A 2G80A 2Z9DA 1N4DA 4QJ5A 4BJ5A 1Y3CE 3SYMA 1DWUA 5AVXB 3BHIA 5JVDB 1NHGA 2RBEA 3RUCA 2E4AA 3UTCA 4KIJA 1EFUA 4OL0A 4X41A 2WC1A 2H1VA 3DYBA 1R66A 2CLKB 3GCXA 4R41A 1SLQA 5DEOA 3NRBA 2RMZA 4N3BA 4NXNB 3AVYA 1U3TA 1I9CA 4IIFA 4DV2B 2ZU6A 5IAAA 3PT9A 3N7UA 1NHLA 2ZVNB 1GNVA 4PBTA 1Y9JA 5CM2Z 3T7AA 1V1JA 1D2RA 1U3VA 1VJTA 1VCIA 3JY6A 2FY8A 2ZYVX 5AMXA 4ATNA 1H4VB 4OQLA 4AP5A 2RGNA 5KPJA 1ITZA 1NASA 1OFIA 3MCTA 5FOTA 1ND6A 4TKZA 3DXZA 2Y1KA 2O8EA 1DKPA 2NIPA 4OATA 1QP7A 3UZUA 1GYPA 2CBXA 2ACWA 5BNWA 4P8RA 3EXHB 4CPDA 4FP9A 2I6UA 1SVIA 4YCLA 4QM7A 2CHEA 3LHFA 4AKIA 2J3IA 3OQHA 1PGNA 2GRUA 1YB1A 1FFWA 3NG1A 5CNKA 2BY4A 2ZWOA 3ESAA 4MWSA 4PC6A 1BOOA 4OUDA 4EHIA 3F5QA 1SCKA 3BTUA 1RADA 2JLVA 1O9HA 4W5TA 1AGPA 3LT1A 1XCLA 1EFPB 3HA2A 4MA5A 3RTCA 1P2SA 3IAFA 4AJLA 3VR3D 1T9KA 2QSYA 4RTKA 1WM1A 2J5BA 1KYOH 5AKXA 1Q7EA 4GFDA 3BSYA 1ARZA 1GNRA 1JAZA 2L69A 3NHRA 1ATZA 5TGDA 1MKYA 3HSYA 5ULLA 1GFZA 1T10A 1EWQA 2GR9A 3KZ1E 1DZIA 3VR2A 1Z0FA 4C0SA 1KIAA 4N8SA 3ABIA 4DG5A 1JHDA 1XLTC 3QOYA 1IJDB 4EG1A 3LCJA 1GNPA 3MQ4A 5CB0A 1TZ2A 1UPFA 2BFWA 3OZWA 4EHJA 2P58A 4AK9A 2PX8A 1E2BA 3TECE 2GEJA 1ZZEA 1S02A 2WLTA 4OB8A 5CJJA 3RLFA 1WRBA 3W06A 3VPSA 3I53A 1XNRB 2NNLD 1BYUA 2QP4A 2ZBEA 3DZKA 4N6OA 4D82A 3OKCA 2GHRA 4RV5A 3V7WA 3E9EA 5I4IA 1RJ9B 2H18A 3QEJA 1UBFA 2ZJ6A 2JDID 4CTOA 3B36A 1SUBA 4DMRA 1W46A 3KV1A 1T91A 3PNLA 2I99A 2ZPAA 3MWDA 1ZMEC 1KH2A 3A27A 4E5VA 2LE0A 3T95A 4EL5A 2PL3A 2HWUA 3A6DA 3Q3HA 1HJBA 3N9IA 4L50A 1F17A 1TPZA 1PS0A 3O4IA 4JROA 3W67A 4BEVA 2G82A 3BK1A 1VKNA 2YC4C 1QEXA 2V7QJ 2K6GA 1EFHA 3EY9A 2Z2ZA 3A9VA 3GVXA 3VU3A 3ZJ5A 4Z5XA 5BV7A 1L5MA 4DMKA 5KAIH 1D3AA 4CIVA 5AT1A 4YDSA 5EZ6B 4ZQIA 4ZT4A 1ZNWA 3BIJA 4JP3A 1H2RS 5PGMA 2B98A 4BQSA 2PWBA 4N47A 1E2UA 1LP1A 1Z5OA 5DM4A 1RI1A 3I5AA 4XQEA 2ZRLA 1VA4A 3ND5A 3CX5D 1JIUA 1S2LA 3V32A 5FWYA 5ELMA 3UFXA 3HVJA 5COAA 4BE9A 3VDMA 4DGQA 3G6WA 3OTWA 3KXLA 4IS2A 3CLRC 3SVZA 1Q57A 5A4JA 4PLGA 2J9ZB 4P98A 3VJRA 1CJTC 3L4SO 5BV1A 1RLUA 3F3SA 2FPRA 1MF7A 3GJ6A 2IH5A 3HVHA 4N78D 2ID4A 3QEMA 4W7SA 2C2WA 3CY6A 3FSGD 2XKKA 3ERCA 4US0R 3H1KG 4Q4JA 1WSDA 2I7TA 2RKOA 4TN5A 2J5UA 3FYSA 2YKQA 4XIIA 3DBOB 4I46A 2AXNA 1MB3A 4W9RA 4R5HA 3MIIA 4ALLA 4EITA 1YFZA 2IBTA 3NDBB 4EJSA 3AVUA 2ONZA 3OHSX 3GFVA 3UBMA 2CL5A 1S96A 3EPPA 4IHQA 4WFKA 1SFCC 1Y47A 3QWBA 3WU2E 1SCAA 5KSOA 3OLXA 1HPLA 2Z8ZA 3QUSA 4I2VA 3RKSA 2O3JA 2BR4A 5T64A 4DQ0A 4OVNF 4BMYA 2MCFA 4MI3A 1R6DA 1HRKA 2HDHA 4XGRA 5FUWA 2OGWA 3WWDA 2I4IA 3EVGA 3G02A 4EMBA 3HPQA 4QOHA 4CL2A 4PBSA 2IS2A 3IT3A 2V3CC 5T4BA 2UV8A 5CFNA 4HOYA 1US8B 3PUKA 3ZDMA 3TEFA 3PWZA 1RJWA 3JD2A 4G81A 4DR7B 4HDCA 1N8SA 4IH1A 5CA1B 2UYCA 2GT1A 2BDUA 3T7SA 4HYTB 3IV7A 4BTVA 1M8FA 1PL6A 3DSRA 3JYLA 3PPYA 1T13A 1LWNA 4NVRA 5CM9C 1MZPA 1PV2A 5TGZA 4B9AA 3TMKA 2WA2A 3DE2X 3U4MA 1G1JA 2OENG 3QXSA 1LGHB 5IJXA 4CT4B 1G9TA 2OHGA 4RJLA 4URHA 2IF0A 1QO0A 4ZCSA 2ZQYA 1NDQA 3DDWA 1VQKP 4NHOA 5BNIA 4MWEA 1JQAA 5AW6A 3SN6A 4OLJA 1DRJA 2HSWA 4BKUA 2BBSA 4QOEA 3T3HA 4Q7KA 4WUTA 1DX6A 5JO0A 3OOJA 1KFJB 2UDPA 3V3TA 4F5YA 1TO2E 4QWWA 1QZTA 4X1IB 3JX9A 5KVVA 4O4LA 5B57C 3HU3A 1K5HA 3I09A 1MA3A 4WKNA 5DX0A 1BXZA 1OGYA 3DZGA 3H5WA 4WGFA 3P8CE 3UUGA 5TJHA 3W2GA 5BSHA 1SQPD 1SKAA 3QGMA 4X94A 2QF7A 4ZV9A 3WQBA 2IXBA 4BO0A 3B1KA 3H42B 2PJZA 5AVTA 1KJQA 2E87A 5AVSA 4BNKA 2XXAA 3O9ZA 1FYXA 4ZV7A 4HUQA 4H60A 1QQTA 3KAKA 1TRKA 1DXHA 1Z2EA 4LYEA 2H88C 3DEIA 1V4NA 3P2KA 4LCBA 4HMQA 2IA5A 2ZFCA 1TW3A 2RG7A 1UMKA 4RUKA 4V0LA 4MS1B 1XZNA 1ZFNA 3IIEA 1OREA 3KVVA 4JT8A 3CSDA 2H4HA 3O74A 1PK8A 4QQKA 3TRDA 1YC5A 2Q3EA 1NTME 1NVEA 1R9JA 1SXJA 1YAHA 3CPSA 2IQ5A 5JQGA 3OUTA 3LBYA 1G66A 5APXA 3P19A 2NO1A 3RODA 4Q9IA 4ARUA 1OVVA 4C4YA 2VPYA 1SBCA 1Q11A 1SY7A 5J23A 1KFEB 2G40A 2QTLA 3RFTA 5EC8A 3L71J 4IIYA 2WWGA 2J0EA 1PNOA 3B8EA 2I0FA 5ALHA 2X0KA 3IKLA 2ZUTA 2CXQA 2YBEA 5AM3A 5B7GA 4IX1A 1PNQA 4JUBA 1V47A 4JI7B 4U7PB 3KOXA 3TBKA 4TUYA 1NW4A 2F3SA 2Z09A 5BOVA 1N3BA 5A04A 2J7KA 3G79A 4M37A 1MX1A 3O8ZA 3FWZA 1T4DA 3KXDA 3IMFA 2XT0A 4NIMA 3MTIA 3UWMA 3A1UA 3ROPA 2QIWA 2CUKA 4EW2A 4ZOLF 1NG9A 1N5OX 3LUKA 3E03A 1YJCA 2M1XA 1RW4A 3JS5A 4PV7A 3GU3A 3ZEAA 1N7HA 4R8MA 1FX0B 5APSA 1UMBA 2A7XA 2P6MA 3QE2A 4J3JA 4L5YA 4M0UA 4X95A 3U4GA 1QQAA 2FJPA 5CU7A 4B48A 5JNVA 1FK8A 3TR6A 3WJ1A 3DEHA 3I12A 3KPVA 2VDUE 3ZHUA 1W9MA 3GLUA 3PF8A 2V7PA 5HMMA 4JQCA 2YDYA 4CQLA 1THMA 1FP4A 3WGGA 3FYCA 2LXCB 3ICVA 3LQ2A 4QKQA 1YNSA 2Q6LA 3G49A 3I4CA 3KJZA 3D3NA 2D4AA 3CKKA 4KMSA 5GPBA 5LDDC 1IN5A 2VP3A 3RWMB 3OG9A 2HRCA 4DIKA 3DCJA 4F6LA 2M6RA 2ZWIA 3FFTA 4ZRDA 4F4DA 4IIEA 2C99A 2WZDA 3ZLVA 4JJGA 2AUNA 2A0FA 4QQFA 3KSDO 1WMKA 2ITAA 3D6ZA 4JI4B 3R24A 5ITZB 2BTQB 2Y9PB 2NWQA 1VIVA 3KZVA 3WQQA 3S81A 1QRUA 5TMEA 4LFAB 2B8JA 1MC1A 4DZZA 4QDJA 4C0HA 4KQ1A 1G5PA 4O1HA 1TLFA 2W6OA 2NU8B 5GZ3A 1CUBA 1Q0PA 3DF7A 1ZW1A 3FMOB 3HA7A 3TTSA 4ITVA 4O2BF 1P4HA 2QRVA 2Q7DA 3AYXB 3L7CA 3KPJA 3QUTA 2YFKA 1FJGB 4NOJA 1SVNA 1B0AA 8AT1A 1K75A 5J2TB 3UAVA 1T25A 3M82A 5CEJA 4JSRA 4Z4HA 1WXIA 5T5QA 1UKEA 3KEOA 1SKYE 1M1NA 1KO1A 1Z5NA 2OHFA 1T3GA 4RPGA 1B1CA 2JBWA 4RZSA 5CNMA 4PG8A 1QAOA 2VPZA 4ALIA 3ODGA 2XITA 1GTVA 2YWFA 3PEFA 1USEA 4NZ9A 1M2FA 2QN1A 5DBOA 1FZTA 3DWGA 4HNRA 2J30A 2N0SA 4DC1A 2IDMA 2VP9A 4AZ0B 4YMSA 5JYBA 3BD6A 4JSYA 3ZTTA 4GX5A 3GJ4A 3OX4A 5HKKD 1EXVA 3ZZTA 1ZQ1A 5HM6A 2ISCA 3A2MA 1E96A 4LDZA 4MVJG 4QRDA 4RHUA 3ZU5A 2WD7B 5CLLA 4N0QA 1HG0A 5BN3B 1ZRNA 1J06A 1RLMA 2BHRA 2HD4A 5ITSA 1MPXA 3H9EO 2OYIB 2R7AA 1T2FA 5F5LA 5IM5A 1EX6A 3EXHC 4E33A 3R9XB 2NVOA 3KKNA 4F93B 1E3LA 2NTEA 1CVRA 1CR2A 2H9IA 2ZBGA 3NPAA 3PWTA 4FZ5A 3W5DA 5EWLA 5THXA 3H5VA 3UT5B 3IE1A 2I6QA 3OA0A 4CF4A 3VO1A 1L6RA 1SHZA 1L2PA 3DFZA 3H5RA 2ZT9C 4MCIA 3VVLA 4RPKA 4U7JA 1UAYA 1ZGGA 1ZEJA 2PU5A 2PZAA 3OFKA 4B6PA 1N25A 3EIHA 4LRSB 5HDQA 5ELLA 1EQAA 5BP7A 4D8UA 4XUEA 4FQ7A 4K9NA 4LV5B 5IKXA 3BRWD 3QF7A 1SXIA 4XZ3A 1TKRA 5F1OA 4QHTA 2QPOA 5FNVA 2NTVA 1JNXX 3B9QA 1IG3A 1OHHD 1XAGA 2VDQB 2ZPUA 1HQDA 1LUAA 1QOPB 1HUCA 1DEBA 3EGXB 2IBZG 2BFFB 2GBLA 1QYXA 1OROA 1UBEA 2UZAA 1EK5A 3DO6A 3V48A 1X94A 2XOKD 1GQFA 4GXNA 1PS8A 1Y48E 3IX7A 1BU5A 2NGRA 1WDMA 1JPUA 1KVQA 2A4KA 3K6KA 4HWKA 2H06A 4K9QA 1ZN9A 1WTAA 2PJUA 3GRFA 3PUHA 3UXMA 1N8TA 4BX3A 3TGLA 1VFNA 4QEZA 3O26A 4G1UC 1WVIA 1LLCA 2YH2A 3I2IA 4EY5A 4LY9A 2ZI9A 4LQ4A 1NTZD 2AN4A 3AEFC 2G9RA 4PZAA 5KYUA 1LTQA 1V6AA 3E7WA 3AE5C 1WZUA 4HGOA 1ZM7A 3AHEA 4TL7A 2BN4A 1UDAA 3VR5H 1CQPA 5C5CA 3NS7A 5K6AA 2D2FA 1H2AS 1P7WA 3X44A 4TQGA 6REQB 4OF4A 4FU0A 3OP4A 1MJNA 3ZQJA 1TQHA 4Z2AA 5EVCA 1ZCJA 3LUGA 2JS7A 2O8FB 3DLTA 5CEEA 3K0HA 5K3OA 1X0TA 4UOZA 1NY6A 4DCUA 5KTBA 1GSIA 3N07A 2XVXA 3CH4B 4PINA 3R3VA 3FTCA 4PYIA 3IPYA 1USGA 3QVMA 4MJ3A 5JY1A 1A2BA 2UAGA 4PICA 2CL7X 2XCIA 3ZDYB 2J7PD 2VCYA 1GZ5A 2NACA 3AHHA 4MHOA 5AW2B 3SWFA 3VR4A 1WZ2A 3DOFA 5A06A 5ALXA 1HV8A 1M83A 3ZTWA 3H2KA 5EQDA 4H35A 4K7JA 1XQ6A 3VMXA 3R9IA 1I7LA 3C8MA 4OFXA 4C29A 3DWFA 1G8PA 4IIXA 4CM7A 2QM7A 1TC1A 3BCCD 3PGXA 5HXAA 3UWSA 4BB9A 3GT4A 3GDOA 3UB3A 1E3TA 1QX4A 1BDHA 1V1RB 5K3DA 1HLGA 2CW5A 3R3JA 3WY9A 4A10A 1BTOA 4DZOA 1H5UA 4DG9A 1G6Q1 2EFYA 2PBLA 3EARA 3FPFA 3OICA 4UNNA 2PU7A 1ZI9A 3KJNA 3MWDB 3O4FA 4CF3A 2J46A 4CIYA 3J81A 1DBQA 3I2JA 3TEJA 4KV9A 4MVCA 1KYZA 1FUIA 2JFHA 1FNDA 3AFGA 3G2HA 2R6ZA 2ZBRA 4IUYA 3HP1A 3O4GA 4RD2A 5ALDA 4TKUA 3CUEF 3UJCA 1JHZA 1PW7A 2I34A 2RB4A 1ORWA 4GOJA 5JIBA 5DNCA 1GL2C 2I2XB 3BWDD 3EQ2A 4Y99B 2C7OA 4AMUA 1MHPA 4UMDA 1KE1A 2DHQA 1IH8A 1W4CA 1YB5A 4MPDA 4URFA 1YS6A 3NHSA 5EYPA 2O2SA 3AGPA 1LX7A 3ZS9A 2I9KA 4YY3B 1LFAA 1VLLA 1SS1A 1QCYA 3A70A 3HVKA 3Q7QA 4UCWA 1OKKD 4OSOA 3IP6A 3IUQA 3O03A 4PFKA 3T5TA 1RXCA 4BDSA 1I4WA 2ZIFA 4RFLA 3WTBA 4C08A 2CV0A 4NHEA 1CUCA 3AZQA 1Z6GA 4PF1A 4A5OA 3AG6A 1XV5A 3LDFA 2ZM6B 3QBTA 1ILEA 3HRKA 2C3YA 1JM0A 4HDKB 5AIAA 3UA4A 5KLVJ 1E5VA 2NXJA 5J2UF 3SWKA 5F23A 4C0QC 1V5EA 1S8OA 4EO9A 2P78A 1SQFA 3HDQA 3BZWA 4MPPA 1PEDA 1YZ3A 1WW3A 4FDUA 3IR5A 2W4MA 1QU3A 3EWSA 3H8JA 4DMUB 5EJEA 1N7LA 1J8YF 1JY2O 4N5IX 5HFJA 3KT3A 1KBOA 1D2GA 1EEXB 2EJCA 1G7RA 3CVJA 2OLKA 2WV9A 3D7MA 1B41A 1LBHA 2BVNA 3B38A 3JR3A 4JELA 4X1OA 2JCGA 5EE5B 2OECA 3S2YA 1UXOA 4QTXA 1IEWA 2WAXA 2HPCA 4Y6QA 2X8WA 4BU1A 3PJEA 3AR3A 5AM0A 3D6VA 3P71T 4WY4A 1LTGC 3R5HA 4AQDA 1JRLA 4TZKA 5H0IA 1E62A 1M1YB 4K9OA 1CY2A 4G1EB 3KNZA 3NO4A 4DQVA 1GPJA 1NU6A 2BI7A 2PKQO 4BFWA 3G8AA 4RABA 3AF5A 3PC2A 2VHQA 4K6KA 3SNHA 4CFZA 1I5EA 4XQ9A 4MMZB 2O1SA 1P2FA 1JDBC 5H3CA 2QG6A 4IOJA 4G0OA 1GDHA 1CUHA 3GFPA 2AFIE 2WOJA 4KW7A 5K4GA 4LDAA 4PVDA 1PQ4A 3RF7A 2A2ZA 5ITZA 1PGOA 4HKTA 4UFPA 2IP4A 3AU9A 4TS3A 4O2AB 1EHYA 4RW0A 3RABA 3GRKA 3Q2OA 3I8SA 4TTRA 4GQAA 3UK2A 4E13A 1VE9A 4LWOA 2EKZA 3C9IA 4ZC8A 2F4VB 1FOSF 1AKWA 1JB1A 1VIMA 2UUOA 4HNTA 3SFVA 2GN9A 3UOWA 3IQIX 4UTZA 4OIFA 5I51A 4AW9A 1OFTA 4JJ8A 2W6ID 4MQMA 2IPOA 3WWOA 3GB9A 4V24A 4MVJD 4G63A 5CW1A 2IX3A 3CVOA 1DC7A 4ND6A 2EX4A 3CCUP 3VYRB 1PR6A 3A3YA 3A1CA 3PL1A 1UPCA 4LWQA 1D1TA 1RRFA 2JD0A 2O05A 1P72A 4I55A 2OYCA 3NORA 3UJHA 5JSQA 3HNOA 1NKZB 1PT5A 1XZCA 3JQCA 5B64A 2OGTA 3FCXA 3PPXA 3COZA 4GRDA 1MG5A 3B5JA 2AJDA 4BECA 3ZVLA 4R7TA 1PZGA 1UP6A 4H0NA 4BKQA 4B4OA 1YO6A 2PNFA 2JK0A 1DBIA 4HJGH 4N1AA 4QEKA 1QU2A 3B5NB 1U3DA 1ZH4A 2ST1A 3MJHA 1VE6A 1R8EA 2QQFA 1ACMA 1OMIA 4C0BA 5A5DA 4LKRA 5BSVA 3KTAA 1Z2PX 4YQEA 1L0NE 5CB4B 4B86A 4ASWA 1GN8A 5JCOA 1Y9EA 2FFAA 1ESZA 1WDTA 4D0RA 5IJ9A 5MHTA 2C5LA 4JQ0D 2G5GX 1K1EA 1NOIA 1J8MF 2R2AA 2J5KA 3CWBG 4YJHB 2C2ZA 3JATB 1S7GA 1M2HA 3AEZA 3NMUF 1ENZA 1NG1A 1RM3A 2YFHA 4KWHA 4NPAA 3M5DA 3AR7A 4E5DA 2DH5A 1E69A 2WINI 3TD9A 5IT4A 2RKBA 2Y93A 2XB8A 4IIHA 3WP0A 4PAWA 4CUZA 5B1IA 5CDFE 1ZN5A 1QIIA 1YR3A 4I9GA 4Q1AA 3L74G 5BVGB 1EVJA 1VSBA 4KLCA 3DCYA 4C20A 3F7TA 4JYCA 2PQ0A 4CR7A 3UWDA 2NV6A 3B7GA 2GETA 3CRW1 3JAKA 1YBMA 1R5JA 2WTEA 1X1CA 3AF3A 3QKWA 2Q7OE 2NV0A 2BMVA 3CN9A 3ETGA 1XP8A 1DRWA 2R751 1P61B 3L4BA 1QYDA 3NTLA 1LSUA 3VJKA 2X0JA 1IHXA 3B3AA 4TLLB 3ZGNA 1VL8A 3RVLA 2O8FA 3DPSA 1S9KD 2VNAA 1KQOA 1WUJS 1U57A 2VSFA 1LS6A 3FR8A 3EGVA 3OTQA 1F7UA 2AK3A 1LT9C 1JWAB 3ZD7A 1GM5A 5EHZA 2QV0A 4S0XA 5AVZB 4Q21A 2GBGA 1PRYA 2FWRA 1FFXA 4L85A 1G64A 4MI1A 4PYRA 3ZOZA 5AESA 3VZBA 4QLOA 4PJ0H 4IOKA 2XNDA 5BQOA 2KNCB 4I6EA 3VI4B 3NONA 3OTOB 3ILVA 1QIGA 4TVSA 1N2GA 2I76A 2FP4B 2B82A 5GM2A 4NG5A 5FAXA 3R7WA 4EI8A 3IS3A 4CKCA 4GKJB 4R98A 5TS2A 3QY9A 1UR5A 2JASA 3KOZA 1AK9A 1U3WA 2B2CA 2ECOA 2KYRA 1LXCA 5JISA 2DT5A 4LY3A 5H3LA 4XIFA 1HY3A 5BYJA 2GVDC 2I8AA 3OIDA 4RZHA 1VOTA 1W1IA 3C5VA 3IDAA 4BNDB 2WU1A 3ADBA 1C0KA 5JBIA 5ECGC 2MMGA 2XNSA 3A9TA 4NZZA 6YASA 4XGIA 3ZWMA 4WOCA 1BGYD 2Y67A 3EW9A 4GKAA 1B74A 1W52X 3I83A 2PAAA 4YVFA 2CLDX 1BEEA 3I9MA 3RS8A 4JJKA 3SQLA 4CM8A 3B3JA 3U7JA 1BCCE 1XTZA 5DK4A 5EHNA 2AWOA 2UVPA 4K3AA 1L7NA 1UZAA 1XELA 3IPXA 3OPYI 4KXFB 1CZOA 5BQ3A 3LIEA 2QMQA 4YUWA 3OT5A 4V1CB 2H17A 5ADVA 3L5KA 3BOSA 2RONA 3CO5A 3NCTA 1CF4A 1RVDA 4DCCA 1F4VA 4DPLA 1A76A 2V7QA 3VP8A 2P3OA 3D3EA 4Z0NA 1RNLA 3C7CB 4ER0A 2PGOA 1TA4A 5DVZA 2KUBA 1ULHA 2WJAA 4J6EA 3IQWA 3KHSA 2ODNA 3TNLA 2JH8A 1V9CA 1W36C 2WHQA 1SHLA 2BLNA 3LX5A 3BVPA 5G53C 4ZGBA 1XMPA 5CVTA 2MJZA 4RORA 1UPUA 3RKRA 1EVLA 1VHQA 2CBGA 4JA2A 2AC4A 4RZXA 4HNSA 1BCSB 1TFUA 2WU4A 3DBRB 4PG6A 4D5GA 4B33A 3HE4A 1H6CA 4Z54A 2GSWA 4A8JA 3TW8A 2BFCB 3IQFA 5E6RA 2XXJA 1NBHA 3AVPA 4YCBA 3SHWA 1MRZA 1SVOA 2HA3A 1J09A 2D4HA 2B4RO 1EGHA 1IIBA 1ZGZA 2N1BA 3JARA 2KP8A 1D2AA 1ESNA 1WPRA 4JB2A 4WZBB 3RQSA 2E2WA 4HB0A 4U02A 3DL0A 1Z13A 1H8ED 2ZUSA 1DCMA 3FHLA 3GDWA 3HM2A 3K9GA 3ES9A 1EFVB 3LC7O 1YF3A 3DG9A 3S44A 1ZPDA 1PN3A 1M1YE 1YS2X 3EVEA 2YCLA 1JQLB 2FPMA 4EY7A 2QVGA 3BICA 1AF4A 4C6SA 3T9AA 3LHSA 3PQCA 1BNCA 1I2BA 2WPNA 4M1TA 4NE7A 4UXIA 3ZK7A 4DMCA 4Q03A 4IMIB 1TADA 1U4OA 1ZIYA 2AE1A 1M1YA 2C98A 2QYTA 2VK8A 3A6ZA 4PC3A 4B79A 5JNTA 1T9BA 3R5KA 5HQTA 1DKMA 3B3QA 4IUDS 4G1VA 4J0HA 4MYSA 3HWRA 1MP0A 3C15C 1E7WA 4CKWB 3WZ2A 1RMTA 4QECA 4L72A 5LM3A 1S4QA 3ZHBA 4JMLA 5K0BA 3W8RA 4DLXA 3WR5A 3KJGA 2IYVA 1FFBA 3BHNA 4M4SA 5K8LA 2CF5A 5BNFA 4PEVA 4RTOA 3D8HA 3QFCA 2DQ4A 3NYIA 1Y37A 4Z49A 5B66E 5COQA 3WS7A 4DV4B 3L8EA 3ELWA 4D9GA 3ZWPA 4ZT7A 2L17A 5J2UA 1P7YA 2Y1LA 3A06A 2FMXA 5CMLA 4LG1A 2D5BA 5HKLA 1LQUA 4O08A 5DT2A 1E60A 1TUEA 1QSGA 2KHZA 1IWBB 2EHJA 1NKSA 1EXIA 2NZYA 3KKQA 2H0RA 4LZPA 1R6XA 2GUWA 1XEFA 4GOLD 1UQTA 2ZJSE 3WMM0 3B2EA 5JZVA 3TOCA 1ZUD1 3KSRA 3C14C 4LQLA 3E3MA 4JX9A 4OXYA 1Z17A 2P68A 1OW8A 3ZDXB 3UJ8A 3LFHA 1JFVA 4GEGA 3LOQA 1SQXK 4ZYVA 3MWYW 3D0QA 3RHFA 1KILD 3HB5X 2Y6UA 4JS0A 3GA5A 3FUVA 3P1JA 2BFDA 1NAFA 5CBKA 5DLDA 5K45A 3LP6A 2DECA 4NWIA 2CEKA 5JS8A 3A28A 2PFKA 3U80A 2AJCA 3T12A 1JSCA 2FK7A 1EE1A 3PHGA 2VP4A 1MIHA 3HY6A 1NLYA 3KV3O 4Q3AA 3Q8MA 1KQ3A 1XVUA 1FSPA 2M0BA 3H2IA 2IU4A 5IM4A 1LP1B 5BR8B 3OOWA 5FCDA 3TIIA 4C7RA 1TM4E 5D51S 3VGPA 5G0UA 1IBLB 1UC5B 1DIBA 4UXJA 1V25A 1Z06A 2HEIA 3ER8A 3DE6X 1YB7A 3VI3B 4Y1GA 3I05A 3LO5A 3NJRA 4ZKUA 5HZKA 1A72A 1MJGM 2XLCA 3T7EA 4G2TA 3HH8A 4F4FA 4YRSA 4E6PA 1AA0A 2FW8A 4DAOA 2OM6A 2DFDA 2WM3A 2ZEJA 4MUEA 4EF6A 5KCMA 1P84H 1I6KA 3P0JA 1HZZC 2WSSA 3G0OA 5KYWA 2P1DA 3QPBA 2XH8A 4K3UA 3SICE 4F97A 2WJPA 2CJWB 3DM9B 2WIFA 1B6RA 4NH0A 5FL7A 1SUFA 4HT3B 5JDCA 3DVAB 1PTJA 3IBCA 4Q4JB 3P8CD 1MOQA 1ZXLA 1TRHA 1B14A 4MYUA 3LM8A 1VQ1A 3QLVC 4QYWA 5K5GB 1LQ2A 2WQZA 1QHFA 2CDAA 2W22A 3LT2A 1N92A 4HLUC 4AJPA 1GK6A 1F1JA 1Y3AA 2C4HA 3CNOA 3GG9A 3KWFA 3FAZA 3E3NA 4G5RA 3UPTA 4Y18A 5FUBA 1E0SA 2C07A 1VHTA 2YHIB 2Z98A 3OJCA 3KEMA 4EUFA 3VQTA 1TQ6A 3U81A 4HUTA 4IQGA 5IRCD 5DB4A 2J3LA 3OETA 1KI1A 2EQ5A 2QD2A 1ICEA 4JQYA 5AVZA 1SFRA 5JXJA 4OQMA 1JKIA 3DL7A 3ZWKA 4P4SB 4ARBA 4MJ7A 3D71A 1M2OB 2C20A 3LS2A 4R2LA 1QB7A 3ZY2A 3IURA 5HCNA 3K2EA 1AZSC 5ADHA 1RE0A 1VPCA 5AVRA 1WNFA 2Q1SA 1HFJA 2CBZA 1EDJA 3NIFB 2A5JA 2IVFA 2XPCA 3NTOA 2XEXA 1QPBA 4FE3A 4GBED 3BH6A 4PE5B 4WX2B 1RT9A 4XVCA 4ZZ0A 2ZRDA 1L0BA 1QE0A 3E23A 4ZALA 3GIDA 2WUDA 1WE2A 3FPCA 1EC5A 2ZAIA 4FCCA 1Q19A 3FMVA 1S3FA 3L6OO 1NTKD 3R6DA 4D0GA 1K86A 5GADl 4Z1MA 1X1SA 3MYRA 2F7SA 3D70A 4F11A 4JF7A 3EGWA 2F8SA 1ZJ6A 1N2XA 5K20A 1SO8A 1Z0KA 2NYAA 3LBHA 4IV0A 3LO8A 2YMKA 3ZDDA 4DBZA 1Z7WA 3RH0A 1W75A 2MSCB 4XUDA 2MINB 1ODCA 1QZZA 2X3UA 5KYNA 2Z1NA 1WCXA 3GJ5A 4WY4B 1XVAA 2JBAA 4HNUA 1MW8X 3FCAA 2RE8A 4L74A 3KR9A 2C3MA 1KZ4A 5AVWB 1JR3E 2VPPA 2DYKA 3KYJB 2C4NA 2X13A 2JAOA 3JQEA 3NRJA 4MUBA 3GHGA 4R1TA 2BRUC 2XUIA 1JMBA 5SZIA 4KV7A 2GK3A 3H1LJ 9LDBA 1RQ7A 3OLYA 4DLAA 5B3AA 3UXEA 1FFYA 1ILWA 1I2MA 2SCUA 2FN3A 1P1RA 3A26A 2HBYA 2WF6A 5ALVA 1MZ9A 1TYZA 1KY5A 4L5CA 1LS1A 1CR0A 1JFFB 3EVCA 2H7CA 3UN1A 1JP7A 3E9DA 4KUHA 2HR1A 4XJXA 2O8DA 3AQ4A 3P2IA 2HHCA 2PWZA 1M2WA 2QU8A 4IDNA 1VP3A 1E2FA 4NZPA 3OMWA 4CW7A 1UM9A 3ORHA 4V38A 1LDNA 3DAGA 3F73A 4J1TC 1IWOA 2BC9A 1KRHA 2H5IA 1OLXA 4I5DA 4AZTA 5KTOA 1VLZA 4GE3A 3CBQA 5KX5A 4U6SA 1TJ4A 1JUDA 1FVHA 1UJCA 2QE7A 4MVJA 3U3KA 5L3QB 1ZU4A 1DTSA 2NO5A 3GP3A 3G5MA 4PD4E 1CFJA 4PG7A 4ZQCB 2WTUA 2AHOA 4WAUA 4KJXA 4B32A 3NP9A 1RWVA 1QGDA 3GY0A 4K86A 1SZJG 1W47A 1DCKA 2GBLC 4RA9A 4A0GA 4F6RA 5JAIA 1PE0A 1TDJA 1QCZA 2OBXA 3HGQA 3BGOS 2WSEJ 2JIZD 3U40A 3C7DB 2XNJA 3H05A 4LNUB 4F21A 1XWFA 3IBYA 3EIFA 3X0DA 2FAXA 3FLAA 3MWEA 1W0KA 1N2OA 2F1IA 4ASUD 4YHHB 1OASA 2H51A 4O4HA 1RYNA 4NNJA 1FDOA 4OYRA 3LT4A 4TWZA 5IDYA 5JNLA 3J81k 3BD8A 3EW7A 2BYTA 2Y1XA 2QDXA 4ZARA 4BFCA 4ZAFA 2CZGA 1ESMA 3PYXA 5E4FA 1VQNP 1DQSA 1QRAA 2JFQA 4I4LA 5GGYA 4LF9B 2E75C 1G8FA 2DUNA 1KPHA 3C97A 4RNCA 2EHDA 5D7NA 3ZLTA 3FPKA 3TR0A 3GJTA 3OQ6A 4IFBA 4GP9A 3HY4A 5KLVG 2HAEA 3KR2A 1VRVA 4RD6A 3U1BA 1CX9B 4J0EA 3NGMA 3FXAA 1HFKA 3ZDBA 1UDCA 3T1NA 1BFUA 1MJFA 2Z2KA 1Z36A 2I87A 3GAAA 4RM2A 1G59A 2AYYA 5EIXA 2GZ1A 1JR6A 4YAUA 3FDFA 3WLHA 2IOYA 3LU1A 2BMFA 2I2WA 2IRWA 2SHKA 3PKZA 4RXTA 4DIEA 1REQA 5A3RA 1CKEA 4F1KA 5BMOA 4MXDA 2V7EA 4DRZA 4R2MA 2AZTA 2VA9A 3VPXA 5J4VA 1L8XA 1Z45A 4PPNA 1H0TA 1T4CB 3CPEA 4Q34A 2PMFA 4DA9A 1QH8B 4UEWA 5K3AA 1Y5LA 2P4UA 1GCGA 1KZYC 3MRTA 3KDPB 2JEZA 3TQTA 4QBFA 4D4HA 1E59A 1C30A 1EZ4A 4ABYA 1FSZA 1L4BA 3KEGA 3P0FA 4OAOA 5HE8A 4ZEWA 2YO3A 3ZV5A 3AV0B 4KFRA 2NU8A 3SWYA 4NJEA 4TRRA 1RHKA 5HA5A 5BT9A 4X61A 1SG0A 3DYVA 2NPSD 3IJPA 3LH5A 4QSHA 5F5NA 5TPWA 3FXDA 3ULKA 3PC8A 2DHRA 2PZLA 4P08A 4F9TA 5KOIA 1IY8A 2GPBA 3U56A 1V2GA 3K1ZA 1P74A 1XWIA 2AH5A 3R4VA 1FVOA 4IDPA 3OSUA 3RVQA 3WNQA 4DLWA 3BL5A 3LBNA 5CCEA 5JNUA 1CR6A 1SQQK 3JCUH 1WU8A 1BHSA 2N1MA 2AK2A 1U2RA 5JSZB 3B89A 2MSWA 2X4IA 3CF4A 3W78A 1V0JA 4GO1A 5K8IA 2FFHA 1SWWA 2W00A 3FB1A 3W0LB 3WNZA 121PA 1OJ7A 1DO2A 3EOBI 2L0XA 4FHEA 5L3SB 4QO8A 2G3AA 2QZ9A 4LYGA 3HNRA 1IFJA 5EXTA 4IJUA 5AW4A 2O1JA 4J7CA 4B5KA 1R15A 1L0LE 3L7YA 1W4ZA 8ABPA 4LV6A 1GPH1 1CY7A 3BA6A 4OL9A 1FOSE 2H1SA 5IXSA 3DMTC 4FUTA 4WK2B 4I3FA 4DUPA 4PJ0E 4TLMB 3E9YA 4WLEA 3TOXA 4H7EA 1MGOA 3FNQA 2VZ8A 2JB9A 2E9SA 2CLCX 4N5NA 3SAJA 1D5WA 1CR1A 2ZT8A 3LC0A 1GR0A 4Y2PA 4AYWA 3GLIB 1A2QA 1Z0DA 2PT6A 2BR3A 2YVUA 2Z9CA 2WHPB 1CLEA 2EWWA 2QQ5A 4KWCA 1KJ9A 1NUHA 3QITA 3JASA 4Y99C 2HPCB 4JL6A 5G02A 3F4LA 4K1XA 3GLRA 4ZOAA 5ICMA 4HWGA 3QVXA 4KQ9A 2YMYA 3RW9A 4N41A 2DB3A 3U4IA 1GPLA 5EWMA 2PIAA 2WT4A 3PE6A 4DSAA 1NMXA 2W4IA 3BT7A 3CYFA 3U3MA 4BQFA 4RX1A 4CQNA 4WASA 3DT9A 3MAAC 4P54A 2YYZA 3GFSA 3VU1A 3HDVA 4ZMBA 3KKZA 1J7JA 3TTXA 4WKOA 3P0EA 2ZSKA 4G23A 3ITNA 3AEKB 4HAWA 4EHLA 2CVHA 4F8EA 5JEEA 1KBQA 3WYEA 3IB3A 3DW1X 4LQCA 1O0SA 2K1AA 1LRLA 2ZAEB 2CFTA 2QRUA 2XQGA 3AF2A 2Q1YA 3BDAA 3L05A 3CX5H 2Q2OA 1T1JA 5EJ7A 1PHRA 3FSEA 2EWVA 3NWJA 4WESB 1IN4A 3KUKA 2ZE8A 4LYHA 1Z56C 3LHIA 1JVNA 4AX4A 3IUMA 4AY4A 4CETA 1JE1A 1BE3J 2WTYA 4KX3A 1T2AA 1S6YA 2XQJA 4U8GA 1PGJA 1GG8A 1VJ5A 2NPOA 1YQ4C 4KQWA 4B83A 3HM9A 2Y8EA 3EWKA 1KKMA 1NOHA 1FZEA 4H6WA 1N6RA 4X8OA 4DIOA 2JCBA 4KZKA 1JDPA 3LFTA 2Y4OA 5D6OA 1HE8B 3K9LA 4EGCB 2Q46A 3GFFA 4K3VA 1ADGA 1PTKA 5ALKA 4GYWA 5FTWA 1QIMA 3OT1B 5JC8A 1NZJA 2ZFUA 3I5UA 2DKOA 3OJWA 4KDFA 5HCIA 1TAHA 4BB0A 4NAUA 2O19A 3IOBA 4I08A 2YIUB 4QFBA 3S0JA 1IZNB 1T4GA 4DEVA 4R3UC 4XR9A 3D6NB 3SWWA 4YGXB 4Z4EA 2JARA 1Q12A 1SUWA 3SY8A 1R6UA 1OLSB 3E48A 4YS6A 2YXPX 2VJMB 3QMPA 1FZFA 3X1MA 1SKUA 1U9IC 2B3TA 3AIOA 2OZKA 1NJ5A 2WKWA 5F12A 4JXXA 2J0QA 1NBEA 4UHFA 5JXIA 5LP6A 2BM8A 4C6RA 4GW3A 5A1JA 3K71B 3D81A 1ZRTE 5FPYA 4XWAA 3RRFA 5C1OA 1IL0A 3FWPA 3EXHA 2GSDA 3HUSC 1KI6B 3OLZA 1SKMA 1KZHA 1E0AA 3MUDA 2V0NA 3H0KA 1NBMA 1JNYA 4FKBA 4MW6A 4KQEA 3R3XA 1YBVA 1PP9E 3QI2A 2IDJA 4YN3A 1YRAA 4PHFA 1KFCB 3TD6A 3UHOA 3I2KA 1V8FA 3LZ6A 2E43A 3V5BA 1HE1C 1Y8QA 2FMIA 2O0HA 2VLBA 2X77A 3DUFB 3KX2A 3PFCA 4P38A 1J8DA 4S2UA 5AM1A 3WK6A 1RF1A 3ZGOA 821PA 2I8LA 2RCNA 1IAQA 4CCSA 2F9FA 1JCDA 5B30A 2YZNA 1TU3A 5B7NA 2OTJP 3GJQA 1NTKJ 3DNPA 3QFFA 3VJMA 1U3GA 1QG4A 2FP3A 4GX2A 4M8IA 1SB8A 4ZNCA 5AJYA 2YDXA 3KD3A 5GM1A 1NGSA 4LMPA 4P6VF 4ISCA 2P0EA 2V45A 2J3HA 1L5GB 3I5YA 1EB9A 1E79D 1OLOA 1T3LA 1WDWB 1M76A 2I2AA 2PZEA 3DEKA 1CVIA 4IF6A 5DGTA 1KTIA 1NE7A 1NIPA 2JZNA 4IO0A 5AOAA 1MC5A 2BEUB 3I6BA 4KN6A 3EUEA 1WX1A 4HXYA 1ZSNA 3D4OA 5G4LA 3H1HG 1Y5MA 4EHKA 3ZDEA 1CUAA 3UJPA 4JUIA 1ZRTD 4M6WA 1Q7TA 1PYGA 1OW7A 3DA8A 1FUUA 4HX5A 2GM4A 4JP5A 4QYXA 5FJJA 3I45A 5AFSA 4GUAA 4UNQA 4NPCA 2FUG1 1C2YA 1I1HA 1Z83A 2OL4A 4WBNA 3TL2A 3A3NA 3JZDA 9ABPA 2OQ2A 3HVRA 2DUMA 1E1KA 1SB9A 4Y7CA 1IN6A 1P2TA 2PPVA 2YWRA 3DVSX 3L82B 1Y7PA 5C4MA 3A05A 1TEHA 4G0MA 3I9LA 4P36A 3N58A 3HB7A 3GOQA 1WQ3A 4NKRA 2YR0A 1AMUA 3VHXA 4D4JA 4YPFA 1GTG1 3PQ6A 1UKVY 4FYVA 1EZVI 1DAFA 5DU2A 3TLZA 2IC5A 3TB6A 2G06A 1RXSA 3B5EA 2KW5A 1JHXA 4UE2A 4TQAA 1CZNA 1LF5A 1JTEA 1HXHA 2QL9A 4LOKA 4RQBA 1W2HA 2EW8A 1XOIA 4S2EA 3UAGA 4CG1A 4BQEA 1N78A 13PKA 2ZW9A 4M3LA 1SUSA 3OU6A 3OFVA 5HBGA 1U9IA 2JFBA 2B7CA 3DMGA 5I4BA 1CJUC 4BZPA 2ODQA 2NPSA 3IKMB 2PMKA 2NU6A 2W2LA 3L7IA 3QVWA 3V4QA 1U7JA 1QG6A 3GLHE 4FT2A 5C8YA 2H89C 1FNNA 1U8UA 2PH3A 4JBGA 4M54A 2JI4A 3R0VA 1EB8A 2MTBA 4IL6X 1HKUA 2QYOA 4X7PA 4LY0A 2B83A 4PHTA 1YVPA 5LDGA 4CUKA 1JWLA 1FRZA 3GN2A 3BSFA 1MO6A 3PD7A 4PCAA 4Q48A 5HTKA 3GRYA 4E6EA 5B3JC 4JJZA 5L3SA 1V7PC 3NV7A 4XX1A 4OGLA 2WSLA 1CNMA 1KEEA 1KOGA 4WEOA 4UQLA 1HFEL 1JSRA 1N0UA 2B21A 3OLWA 1SA0B 2A9OA 3CLUC 1S3JA 4IEFB 4YRRA 4Z0HO 4PTYA 4CTKA 3FBGA 3PFBA 3TLAA 1SCDA 3QOFA 1Q84A 1BS2A 3QPAA 1UCFA 1IY0A 1M8KA 3EDMA 4KGDA 4X7BA 3EY4A 1UFQA 2EF0A 4RIIA 4UATA 3TCKA 4I6MC 3SZOA 3I2GA 2W6JD 4IHJA 4X5OA 4XE5A 3W1WA 2BELA 3F8SA 4OOEA 3ZDZB 3ZUPA 1NC3A 1KMHB 3MRVA 2C9ZA 3KR1A 4RF5A 2BZGA 4HKZH 2XCQA 3PXCX 3UO8B 2AG0A 1A2KC 2GYWA 4P33A 3L7DA 5JDIC 1E3JA 4YRTA 1ZM2A 3CR3C 4IL6E 4DWOA 3L1IA 3EPJA 2JPDA 5JATA 4HDAA 1K68A 1T8UA 2GAFA 4OOFA 1D7OA 2V6GA 4LNAA 4HNAB 1BKYA 3AB3A 3TIFA 1XVIA 4NEGA 4EDFA 3JVIA 3HP4A 4M76B 3VYUB 2ZTMA 1YFJA 2O8EB 4HS4A 2RH0A 1Y89A 2YIJA 1NXPA 2X22A 3TGUE 1W1WA 5KREA 4L22A 3QWOC 1ZJJA 1QKIA 2VBIA 1TTQB 2CCJA 2PKRA 1GPNA 2R4TA 2VYCA 3L8HA 1JX6A 1WETA 2BBTA 4UHCA 1KYVA 1UZMA 3WKBA 3UMFA 1L5OA 3GAMA 2O54A 4NARA 2CVOA 2UWJE 2EEZA 2KX7A 2QU7A 1CUSA 1D4FA 2XMGA 3KJFA 4PQEA 3RK3E 2RGYA 3RAEC 4CM6A 3TGUJ 4OXXA 1EFPA 4DWVA 4TN1A 1U65A 1FSGA 3CPHA 3V3KA 1VKHA 2PT5A 1E4YA 3WAKA 4YUAA 2RGAA 3SSNA 4EDHA 3MGKA 3W7VA 1P39A 4YJDA 3SJUA 4ZYXA 3CF2A 2O1XA 5EUCA 4KH1A 4EQ6A 4MKRA 3WFZA 2MYUA 2RHMA 1BXGB 4RY0A 2WVRA 4MS4B 3SSOA 3VOTA 4MWZA 5L7YA 4A92A 3O6VA 1MOPA 2O1KA 5GTIE 3DXFA 4Z4CA 1WBJB 2BEJA 2GVZC 1P0QA 2JFYA 3HBLA 5IAKA 3PR3A 3MG9A 4PPYA 3LC2O 3WVNA 2W0MA 2YWHA 1X9HA 2C58A 4GIFA 4LXXA 4I1IA 2VJMA 3CUSA 5CHYA 4ROTA 1QHXA 4KEAA 3VTFA 4MDEA 5CCHA 3LQYA 5FEUA 1VGVA 2Q6TA 1FSFA 2O0KA 5BN4B 4GGMX 3HTKA 1D9XA 2Q9IA 1RZ3A 2AXPA 2B2NA 1ISHA 2ALJA 2FUG6 2GFIA 2Z6QA 4MR9B 1L7XA 1RQXA 3F6EX 4MV0A 3HXQA 3G3EA 3ZGYA 2CNKA 3AF0A 4Z53A 3WK7A 1NVKA 3C5HA 4Q4HB 1V3UA 4KBYA 3R9WA 1PBTA 5JLAA 4PO3X 2PZGA 5CIYA 2OTLP 1R8XA 1GPDG 3KOOA 2C42A 4G0QA 1I5RA 3IHWA 4REQB 4RMHA 4XCXA 1O4VA 2F2TA 1I2ZA 3EULA 5DGHA 2QA4P 4E2ZA 4KQHA 3DOIA 5LQDA 4HB3A 1EI9A 5A7HA 4U4AA 4IZOA 4JWTA 3A0BE 4RQTA 2DWUA 5AKLA 5CITA 5BR1A 1KVTA 1ZM4A 1PFIA 1OUMA 1U1EA 2WABA 4BV8A 1Z4KA 1AQLA 1L3CA 2IELA 3EXG2 5IBQA 1XCPA 1XTKA 2FSUA 1OXTA 3DHWC 3JVVA 1ZX1A 4JA0A 4AFNA 3FR7A 4TZTA 4REOA 3IE2A 1OHHA 1SEVA 4GI7A 1ZWKA 2AT1A 1H65A 3ZDAA 1FQOA 1KO5A 1U8ZA 1XQWA 4MR7B 3RIXA 1YBAA 3CXHI 1AN9A 4CQJA 1RI4A 3A6HA 4JXZA 4UDNA 3H5IA 4Z3OA 3BWYA 4URZR 4IP0A 3O2QB 4AJHA 5AUPB 1PZEA 2AYXA 4B0OA 1D03A 1C8LA 1H9CA 1M1KQ 1QGAA 3WU2H 4Y8VA 1XQ1A 2ZYTX 3F3YA 2XAAA 1C0EA 1ISIA 4KH0A 2REXB 1XZJA 4OGFA 1JG4A 4FW9A 2VYVD 4CR8A 5E4JA 4YO7A 3T5MA 1ZD8A 3UEOA 5CDYA 4ENVA 3O0TA 1C3VA 3AOEC 2YWCA 1PKXA 3AOEA 1F3LA 4KFUA 3TM5A 3VR1A 2I78A 2ECQA 2P4QA 3VDXA 1W94A 2DKFA 5KQGA 1VKJA 1Y5NA 4XUCA 1HDRA 4OQQA 3H1JJ 1E2LA 1OX5A 2JLAA 5K3SA 1R8JA 4M36A 2UUCB 3NKVA 1N7SB 4RVNA 4W7ZA 1BHQ1 4J7AA 3GF3A 2VPIA 3JTEA 4G1MB 4N3NA 3K1JA 3WLLA 3DOHA 2Q3BA 2XYQA 1NV8A 3X1DA 5K3BA 5DYIA 5EMLA 1W5SA 4JFRA 3N53A 4ENUA 4O3MA 3D3JA 5AW8B 4O59O 4J7UA 2QJPB 3FDIA 1PP9J 3EZ6A 2VT6A 3GHYA 3ONFA 5DSTA 3IF4A 1DMSA 3D7SA 5KU1A 3EDQA 1YIAA 3MJFA 5E9QA 3KLPX 5EUQB 3BASA 2EL7A 3H1EA 2GD2A 2C7VA 3SEFA 3W5UA 3ZBUA 4MRMB 1AK1A 1V3TA 2CN1A 3HJNA 1PSDA 3COSA 4TSFA 5F7ZA 1OZAA 4RWZA 4XYMA 3WDSA 4Q7LA 2UUAB 2ONYA 4OXQA 1RQNA 2IZ6A 2NVUA 4QOJA 4DQXA 4CG2A 8LDHA 4EG5A 1Y9AA 1RPJA 5E4YA 1SUPA 2L18A 1WPXA 1H3NA 4L4UA 4RKYA 5KMGB 1A8PA 3BWBA 4RFVA 1TCCA 1U94A 5KYKA 4LHVA 3PQEA 2VQDA 1TMGE 2PCLA 5EGNA 3HWSA 1N33B 2BGUA 1VC2A 2VPWA 1E99A 2VNKA 3DFKA 3GZ4A 3V7UA 4MPTA 3U09A 3EH1A 1X3LA 2W2XA 1CRWG 1SUEA 1QLED 2C1EA 2DFTA 2HK6A 3CR8A 3FUTA 5EQJB 1ULSA 4MKIA 1H4SA 2PH5A 1I7SB 3D02A 3HUFA 5L6MB 4R9UC 3TNUA 2XQVA 3PNMA 3CFYA 2F3QA 3JQAD 3ME5A 1FJKA 1OXXK 2PNJA 4B43A 5EVJA 5ALOA 4BMPB 5HKBA 1Q0ZA 1Y42X 2UUPA 4OMUA 1JHVA 1NU1G 1M8JA 3F6CA 2FUCA 2ZI4A 4E5MA 2WA1A 3L41A 1CERA 1CIJA 1M54A 5B5EE 2RGNC 4UUPA 2FQXA 3THSA 1OZFA 1YCDA 1FVXA 2P3SA 2P5UA 1I6LA 3DHVA 3DKPA 1QPZA 4GWGA 4X20B 2OCXA 1KJYA 4AD8A 1BEZA 1FFDA 4DMLA 3VRHA 1FUYB 4MB6A 1O96B 1PYOA 3PTLA 1HG1A 2ZJAA 2FW6A 1XBTA 1V5FA 2F64A 2IODA 2XA1A 1XTVA 8ADHA 2OCLA 1WEKA 2C9YA 1OI4A 4BQPA 3IOCA 4UTVA 2J45A 3A1FA 1WW8A 2DFKB 1XJ0A 3DBVO 1ZI6A 1EEHA 5DRYA 2BKXA 4YCDA 1WBBA 2J0SA 4B35A 1IHUA 1YZVA 1C50A 4H0CA 1FYEA 4P53A 4IY1A 5C4IA 1ZK2A 4P7GA 1XL0A 3MFQA 4LA4A 4GUDA 1MTZA 4AJEA 3HXTA 4BKPA 2L19A 4QUAA 4DREA 1BH2A 4QU9A 3OCVA 4C0LA 2PKCA 2R68A 1L7AA 2PZMA 3H32A 4E7OA 4PS0A 4RKEA 5J4HA 5JFTA 1GW3A 4M8SA 3T7RA 2XUJA 1JXOA 3CHYA 2TMGA 3A4YA 4CLDA 1MHTA 1ZHHA 3OW2O 3QKSB 4OMDA 5D86A 2PL1A 1RJ9A 5IJAA 4EL0A 3L2OB 4ARAA 2NN3C 4I5IA 4OP1A 5BN5B 1Q17A 3D54D 1ZH6A 4RVFA 1Z3CA 2GLUA 3FTQA 4X60A 3SZ3A 1KDOA 4LHSA 3RFXA 5DN6D 4R16A 3SQNA 3K0FB 1KQLA 5CT9A 2QSIA 2A33A 1J07A 3GN1A 1OCEA 4WOJA 4AJKA 1E18A 2Q5OA 3DB1A 5J1SB 2JLQA 4PW0A 1CQJA 2QRHA 5TMPA 2IS4A 4OM8A 1VQPP 4FDMA 4RBNA 1G16A 1DT5A 3QBEA 1PZFA 5G3YA 8GPBA 4OMCA 1ZZGA 1MJHA 5DTEA 3CUVA 1A9SA 1U3CA 2BONA 3ZBPA 1AY0A 3QKRA 4B75A 1CHNA 4JP8A 2B1JA 1M2OA 1R3UA 3HA3A 4RIHA 5K2MA 2VK4A 3K7EA 1Z6AA 4PXYA 4TV9A 4MDFA 3EQ7A 1R12A 3E3LA 2PN1A 1A7AA 4H1TA 3CLTC 4AUMA 2NXEA 1O6ZA 1Z5ZA 3UMCA 1J00A 3CC2P 3WGOA 5EIBC 1I01A 3Q9UA 2ZWVA 4R1QA 3L8GA 3N05A 1FBNA 2FWIA 3E3AA 3PQ8A 2PCJA 4MGYR 5AO9A 5GONF 3WK9A 4GXTA 3LJKA 5BV0A 4OI2A 6GPBA 3PNPA 4BVLA 4OBBA 2YN2A 5GINE 1F60A 3KXKA 3VHXB 5B1HA 2VZEA 5A7GA 1Z0SA 1CEYA 3P8MC 1KAMA 3CZRA 1LRKA 3ELUA 3ILSA 7ADHA 3ACDA 1PNRA 4MLZA 2ZS7A 3NYWA 5JH7F 2C57A 2HPVA 4IGEA 4R1LA 2Z5LA 3UJAA 1NXVA 1NU1E 1L4AD 3L75J 2AJTA 2D7JA 3HDYA 1S01A 1M7HA 2XVMA 1HQYE 1ECPA 2WF9A 4TMKA 2EFDB 3RBZA 1FU7A 4N6JA 3RIYA 2CNDA 2IVZA 1DGQA 4FR0A 5JLJA 4GG1A 5LWHA 4PAQA 1NURA 3R7BA 1ZN7A 4FDLA 1A50B 2KXPB 1E9DA 1FNMA 1UBCA 1RSZA 4EEZA 3RFFA 4EI7A 1JYEA 5LFAA 1UFKA 4BUZA 5J2TA 4OHOA 2H65A 1K08A 1NRJB 1HZZA 1A82A 2G88A 2P2LA 3K09A 5DMXA 5HFNA 1WXQA 3TYXA 5EAIA 2QJYB 2Q2NA 1UPAA 4HPXB 4PHHA 5K8UA 4L9SA 1IQPA 4NCIA 4DBLC 3F3MA 2QIOA 3C3YA 3N2GB 3QWHA 4O4IF 2FLVA 2HZ7A 3ROEA 3CSSA 5SZJA 4UMEA 4DCVA 3MERA 5KYGA 2GVNA 3ZCPA 1XD2B 3GOHA 1NDUA 1WXWA 2TMDA 1KN7A 5IC5A 1X1RA 5KYWB 1R0BA 2H08A 3CWZA 2IPAB 5LZ9A 3DOCA 1IHDA 2C2OA 1UP7A 3SDBA 1QTQA 1NPTO 3AE7C 2JVIA 3AE9C 2VDPB 1BXKA 1Z5VA 3QWIA 1EFDN 4IM7A 2D8AA 2ORYA 3FZEA 3QQ5A 3UOGA 5FP0A 2WWTA 4W8OA 4IDBA 4PFSA 4ZVOA 4BNWA 1O57A 1GY8A 1VL5A 1FSSA 3FA2A 3HEMA 2KS1A 4WLFA 5EWLB 3CVVA 2B8EA 5J5CA 3ITKA 3H1TA 2IEDA 5FWNA 2ISSD 1HT3A 2A78A 2ZITA 2CHVA 4BX8A 5A7FA 1T5DX 1YTUA 2YJ5A 3CX3A 3P9KA 2XUGA 4TWRA 3ZCQA 2Q4BA 3WB9A 5BUCA 1RFLA 1T3JA 2AX4A 3T0FA 1A27A 2XUKA 4CODB 2ZBDA 5FTLA 4PZPA 5T8KA 4ESEA 1FZGA 3LPLA 3ZKWA 1WL8A 1MT0A 4XUGB 1CYDA 3GRAA 1F0KA 3WGUA 4QBIA 2ADFA 1MD9A 2I1LA 1C1XB 1YIJP 3IAM6 4B1FA 3ZJ4A 2JG3A 1NJSA 3ZGLA 3EGXA 1WCYA 4LXYA 4PSVA 5ALLA 5IN5A 4E30A 2HIAA 2IEIA 1GWNA 3MCUA 2XXAB 3WK4A 2FSGA 4ZN6A 1NVFA 3KJQA 2XYGA 4FYIA 5CDUA 1T5BA 1EM8A 3MF4A 4PLCA 4WOPA 3SP1A 1JBEA 3UYKA 5FUMA 2VTBA 1VLHA 1FFGA 3CNEA 3MOSA 3OJXA 3BFVA 1VQ8P 1CS0B 3CXRA 3ELDA 5EIHA 1M8OB 3H3FA 4MP6A 2DT8A 3UPUA 3BJIC 4MIOA 2R7NA 4ETWA 5HRCA 4WZBE 3U7HB 5KVSA 3QU9A 1OX6A 1QXSA 2D74A 1SK8A 3V42A 1EFRA 5EE9A 1WJGA 1TUIA 1KI9A 1EK2A 2I7CA 3DMDA 5HF6A 5HRUA 4GZ5A 1JQ5A 3ZBTA 4OU5A 2JI6A 2GYYA 4J4BA 5DHTA 1YBHA 1KJWA 1P5RA 4P4TA 1SBYA 2GN4A 3OZXA 1XA0A 1ZU5A 4D0NA 3CVYA 2QIPA 4HDRB 3QM1A 3IUSA 1Y1QA 4LYJA 2HBQA 4YTEA 1OW6A 2V7VA 2O2XA 5DJUB 1DTWB 3L73E 1G8JA 5LMNB 3PC4A 3G23A 3OCWA 4P0QB 3FUUA 1VPWA 1OIWA 2KQUA 1UJ6A 1CD5A 4LBZA 4LSGA 5BN4A 4HAOA 2IV2X 1OI2A 4YXWA 3OUZA 4CHTA 1YVEI 1GGFA 1EK1A 4ENQA 3FCYA 4Z4IA 4A1FA 4RHTA 3F2VA 2MJLA 1YQXA 4F0JA 2GYUA 1IOVA 1QHHA 5EJ2A 2PUCA 3OA2A 3WDLA 4R40A 5L40A 3W9YA 3GLMA 4Q66C 2IXGA 3T97B 4FOTA 4INPA 4L5IA 4UCXA 3ND6A 1Z7BA 4TLFA 4B4VA 2YVQA 4WH0A 1WKVA 2QPLA 5JADA 3SC3A 1JDTA 5A4FS 2NO9A 5HWSA 3LCRA 1LJUA 1SNYA 4PR3A 3D7RA 1VBFA 1TL7C 4YP9A 4CPGA 4G36A 4NE2A 4UUNA 1N57A 3NDJA 2PXAA 1N36B 3FN4A 4PC1A 1BJTA 4CKBA 3HO6A 5BN5A 1ZXXA 2QTFA 3EZYA 3RAFC 2JZOA 1T6BY 3CRZA 4QZVA 1CRPA 3C3PA 1Q15A 5KYTA 1P6XA 1QZ3A 3CXHE 2CLFB 2FWNA 2VJBA 2P9JA 2ZRKA 3E5MA 3K2BA 3M4XA 4L07A 4G1CA 3U4QB 5GZ6A 1NNUA 1UXJA 4M0DA 1Z26A 4JCOA 1T3TA 3EFBA 2RGGA 1KNQA 1JFLA 3U7RA 3OQNA 4D57A 1NBOA 1ZIOA 2ZGVA 4BNGA 3DMRA 4JL5A 4TTVA 3H11B 4QUDA 1WHTA 5PNTA 2Q4EA 5L8RJ 2E18A 2QX7A 4MV4A 5FHRA 3GFTA 4E70A 4U3JA 4NNPA 4M0EA 3LG2A 5I8WA 2ZWAA 5K4AA 5JCOC 5K99A 2BMEA 2RAFA 1C4WA 3F46A 4WNYA 4XARA 4REMA 4JLNA 4RLSA 4B47A 3P97A 4IJVA 2EC5A 4OQDA 1Z4IA 3T3IA 3U3JA 2XB9A 3I4FA 4PC7A 4NDZA 1QYVA 4PIPA 3RANA 1I2CA 1PK7A 3W68A 1URQC 2FZ4A 3AJ9A 1F0PA 3AFOA 1JJVA 4IZ6A 1WRGA 4U00A 3H1JE 2VRWA 1YB4A 3AXSA 3LECA 1TD1A 1DARA 5KNBD 2QI9F 1VXRA 4JK3A 3WBFA 4DLVA 4OAPA 2FSIA 2R96A 3HR7A 2M3BA 3ZE7A 1U2SA 4COKA 3PHHA 1ZH8A 1P2BA 1II0A 5HQ3B 2B4KA 4AIRA 2Z04A 2PX0A 2ZUUA 4C46A 2Q2QA 3DP7A 1C5KA 3EGEA 4MW9A 4XD7D 3K0AB 5K9ZA 3PVSA 2HR3A 5CBPB 1P84D 1E6MA 2IV7A 1P45A 2XTZA 2FHSA 4BWFB 5GWXA 1C3OB 4KXVA 4X66B 5BWOA 2XDQA 2ERCA 2NW6A 2CLOB 3SX4A 4MV7A 4DR1B 1FMCA 4ZVRA 1L4AA 2OCIA 3HXOA 3C1AA 3IHLA 2C94A 2E3JA 5H16A 1V5WA 1L4UA 1QTNA 2E4WA 3IXMA 2ZB4A 4PSKA 3UT6A 1RXVA 2WI8A 2J5XA 4DYHA 5I9LA 3OZFA 1IZ9A 1DKQA 1LVHA 1T36A 1UQUA 2C84A 3DLCA 3I52A 1TIPA 1WQ4A 4LJYA 4LNHA 5JBNA 1COZA 3FNGA 1OFGA 4UUBA 4JLVA 2P8SA 4M3NA 1POXA 3I9NA 1F5NA 4ERNA 2J0UA 3BX1A 5TF4A 5C7YA 2PGJA 4YJ3F 1E2IA 2I7XA 4JB0A 2O8BB 1V5GA 2ZU0C 3KYIB 4DDWA 1M6VA 1ZMXA 1H3FA 3COYA 3EFEA 3MD9A 4DBVO 1L9XA 2KZIA 3ZD9A 5U9CA 3R6LA 1Q74A 2ETXA 3A9RA 4M9ZA 2UYHA 1AM4D 1HGZA 4X71A 5JDIA 1KARA 4ZIRA 1ZW0A 5BQPA 1JYFA 3E7KA 1SZDA 5C32A 3I2FA 2GRAA 2AG6A 3IJRA 4NCBA 1YYCA 2E48A 3VR6D 4G09A 5HF8A 2AXQA 3LUAA 1TJNA 2B4YA 3BDIA 4Q47A 2ZR0A 3IR9A 4H16A 1EH5A 4WI1A 4YJKA 2VKQA 3C87A 1XEWX 4I4TF 4HH4A 1OXUA 5F3WB 2CFCA 2KWIA 2OYHB 3CA8A 3RVKA 4CM4B 1CK4A 3OIUA 4MGEA 2HGZA 4Q9DA 3N8IA 3ZDFA 4W8HA 3ZDCA 4C87A 3B4SA 1M6YA 1YJAA 2DPLA 4J16C 5JMPA 4NEQA 4E5UA 1YGYA 4LF4B 3VTZA 3L0BA 1D0VA 4CM1A 2BDEA 2IY9A 1UT8A 4X20A 3CMAP 1BJRE 2XKAA 3ZHXA 3DTVB 4AC9A 4EUSA 2V1UA 4P86A 4GHWA 5AW5B 4DMGA 2FUEA 2BEKA 3V1YA 3E22B 3VP9A 3RARA 3CT6A 3IBSA 4P9NA 1S7CA 4D9IA 4RYLA 3CH7A 3MILA 4RTJA 2ROQA 4LWPA 1FVFA 4XB6B 1KHTA 2J31A 2YYYA 5JS2A 3CPWO 1EUYA 5IK2A 4MS4A 4RK6A 4NP6A 4X3PA 3U4AA 1KP9A 4H0LD 3K0SA 2VSYA 2IGBA 1OAOA 4B6FA 4ZI7F 1YA4A 1Q1NA 4MB0A 1GU5A 2UVQA 1KB9D 3WBKA 1GITA 3CS3A 3S70A 4RM3A 4ACBA 5I7EA 3V00A 3AY7A 4HJRA 5JS1A 1GU7A 1ANKA 4HFRA 1R88A 5DTMA 4J0QA 2DQKA 5FI1B 5B1SA 1RE3A 3DE4X 5F9MA 4Z9AA 4H44D 1KQPA 4M1YA 5JAQA 4Z3DA 5DLQC 1GPBA 3G8BA 2VH2A 1NY5A 3RUFA 3U4DA 3WRXA 3FOWA 1KILC 2GPNA 3KE8A 3TNFA 1RLJA 3JAKB 3VDQA 4EG8A 2QVZX 1Q7RA 4P22A 1YB2A 1W6UA 3AI1A 4C4OA 5JPCA 4JDUA 3UK1A 4A0HA 3VHRA 1NQOA 3VR5D 1AKYA 1KVRA 3F5FA 1NTMK 1NNLA 4P3KA 2C61A 1SC4A 4B09A 4N03A 1C8VB 5K6TA 1MPTA 4JHLA 3M6FA 2DR0A 1AVTA 3I3SR 4KXLA 1J0AA 1NQXA 1UMDB 2VF5X 4YUXA 1LZLA 1G6HA 1MN6A 2BZ1A 2QJWA 1COWD 2W5UA 1RAIA 3F2IA 3BH0A 2FW1A 1ISSA 1OTYA 2PK3A 1RE1A 2FWAA 3GP5A 3L04A 3CMMA 1R74A 4OMFG 5EG5A 4FFPA 1WAMA 2RHRA 4Z8XA 4M55A 1R0XA 2VSQA 3KJIA 3AKDA 4FS3A 3SHFA 2DW3A 1XZBA 2DBVO 3C6ZA 5LLSA 4W1RA 1CDEA 2Q4TA 3PDIB 4K8OA 1XROA 1EXDA 2WPRA 4ZU3A 5IKPA 2HN9A 3VR0A 3IUEA 3WBJA 4EYSA 1CQWA 2Q9AA 2VJAA 1PUXA 4GI3A 3N0WA 5AKHA 4HAIA 4G01B 2C97A 2QL5A 2W9XA 3QVOA 3CV3A 1KY2A 3HYRA 5HVNA 1YQTA 5B6JA 2AYZA 3D0RA 4JHXA 3GRRA 4ZVSA 5I9IA 2EZ4A 1Z07A 3ZW9A 4JQZA 3TBFA 4K5QA 1WA5A 1FNBA 2BFEB 2JVJA 1LTIC 1FZQA 2EKDA 2GXQA 2LCIA 4ASVA 2OLJA 5AVQB 4JENA 1QOZA 1L4HA 1NVTA 4G4SP 4JB3A 3WV5A 2XADA 2A45H 1NJ8A 1ZEMA 1OVUA 2G17A 4ROSA 1DC8A 4N7BA 2R47A 3KQVA 4BE4A 1MG0A 3FKSD 5C80A 3N2IA 1KQFB 1PI3A 3P4YA 1OVRA 1U1CA 3RHZA 4INAA 4IHJB 1CJCA 2R87A 4W63A 5IWAB 1YXMA 2B36A 3H9JA 1LDBA 2X76A 2IHKA 4S1OA 2G63A 3BRWA 2ZS8A 1IEQA 4DCPA 1RJDA 3FYDA 4G0ZA 4H3VA 1J1ZA 5EMJA 1W581 3AJEA 4RKRA 4BLOA 2CVFA 3EEIA 4LZOA 4GVPA 3GC6A 4YP5A 2HDOA 4FOPA 3ASYA 3RNOA 2VPXA 3ZE6A 4Z1OA 1DUIA 2RIRA 4M86A 3UV6A 3VMMA 1YR1A 2IHTA 1FXWA 4UBNA 2JEYA 1S2IA 2GNAA 4HNAA 2HV9A 4HEA6 3L73J 3ILYA 3Q7IA 3EEQA 1UMCA 3WHIA 5DT9A 1Z2NX 5HUHA 1FJXA 2WYOA 1N1DA 2VXOA 2G4LA 3SJBA 2JFUA 1AN0A 4UBLA 1Y1SA 1U8XX 1FZCA 4EW3A 3PLAE 2CXRA 5FJIA 2ZJBA 2ZYSA 3C6KA 4ERXA 1P5FA 2W48A 3C1OA 4CYMA 3QPVA 5P21A 5CJ4A 2WWFA 4AWBA 3VH3A 1C3OA 3K9HA 1LBSA 1WOYA 2N1TB 3BWVA 3TL6A 4DR5B 3D7LA 2FZKA 4J16A 1HOTA 1FC2C 3M0AA 1QRRA 4FWIB 1YR9A 2BMDA 3ORFA 1HL3A 3E53A 2CUTA 4HEA1 4KPUB 1UBRS 4O4JA 1RWNA 4QDZA 1ZCZA 4W1PA 5FF9A 3ZH9B 3QLUA 4C6HA 2V98A 4FBLA 4Z2YA 4YCMA 5CJ0A 4L76A 1RYYA 2XMRA 2VDWB 3E8XA 3JYNA 3L9XA 4H7IA 3IAEA 5I8ZA 2PFGA 3L72G 1HYQA 1I10A 4HEHA 3X2EA 5JROA 1GW4A 1KKUA 4JBHA 1XZGA 2HC9A 1ZNZA 3QXCA 5TPZA 3L7BA 2P62A 1GPAA 4D6TD 2E76B 3HFJA 1G5HA 4KXXA 5JAMA 3OKAA 3QF4A 5B37A 2CFOA 4JCCA 1PAUA 2ID8A 1HH0A 3I34X 5KZMB 3CONA 5F51A 9GPBA 3M9QA 3AP1A 1XCJA 1AXEA 2HWXA 5HZMA 3BVHA 1OLXB 2RGWA 5EXXA 1DEOA 5DHQA 2Z4EA 2GA9A 3O95A 4HPJB 3RKUA 2R6AA 3UMGA 5JRDS 2ZB3A 2A3RA 3D8BA 2E4YA 3D7KA 4G5HA 2O4CA 1YACA 3BGVA 3B13B 4M1KA 4EHBA 1X19A 1A5BB 2J8ZA 3K1AB 1D2HA 3EVDA 1I7DA 3ZGZA 3G4SP 4RY8A 3IP9A 2IHJA 3M6WA 3OPVA 4P1ZA 4N5LA 1UIXA 2E55A 5FADA 1JV2B 1T8PA 1FUKA 4IRUB 1RXYA 3AU8A 4MVJI 3HU1A 4D3YA 5H2FE 3C16C 3LBFA 1A2OA 2CWDA 5FIUA 1G8GA 4YI5A 2EFJA 2H57A 2HJWA 3EDOA 3PQ4A 3OEHA 5CLHA 4EMUA 4G0WA 1MJGA 1NF3A 3AK4A 3KALA 3OO1A 3V1NA 1NP6A 1ZJYA 1ST2A 1GILA 3M5PA 2QRXA 1F6DA 3R0IA 3TL3A 4BKOA 3MMNA 5MF6A 4QE3A 4ZU6X 1RPZA 2JEOA 2PAJA 2P6PA 2Z4TA 1RJEA 4GDMA 1LDYA 2I80A 1Q95A 2OXRA 1V8OA 1N5LA 3DDNA 4H1HA 3R8FA 1SVFA 5AJVB 1PO7A 2HSZA 4S1WA 5JHHB 1BA2A 2OORC 1KQSO 2PG3A 1HDOA 4H6PA 1YZQA 2FHPA 3UKOA 4AULA 1AGRA 2F3PA 5BPHA 4CHGA 1WS6A 3VR4D 1Z9BA 5KVQA 4HXGA 2B87B 5KLVE 3WLPA 2J58A 3D7NA 5AHOA 2F3RA 2ZR8A 2ZVDA 4YCAA 3O9VA 3RTEA 3TGWA 5BURA 1IJKA 1IY9A 4GKBA 4JEUA 4C5AA 2QUBA 3G82C 5LBTA 1I24A 4X92A 4XAQA 5I9BA 5J2TF 2FX5A 3NM5A 2Q0QA 3KJEA 4UEJA 3PC7A 3SDSA 4C04A 4EHDA 1M6HA 2CJWA 4AZWA 3LGXA 4XVRA 2ASEA 3UAWA 4NYIR 4JB8A 2YJGA 2TS1A 2C1XA 1IZ7A 4KX5A 2DPXA 3CCSP 3HB1A 4M0LA 4R68A 4B3HA 2RHDA 4FHCA 1O77A 1A9TA 4QYIA 2RARA 3TJMA 3CKLA 1ENOA 4PSUA 2PFXA 3PK0A 3MJTA 4LXIA 3VBEA 2FZ5A 4D41A 2H92A 1ZNQO 3RTGA 1XXHB 1JEEA 5KQMA 2D13A 4J9UE 4K6MA 3GR6A 2GWRA 4BB5A 2WMOB 2HWKA 2ZAMA 3MMPA 3QI7A 1IONA 2PD6A 3IQGX 4K6CA 4L3VA 1GGVA 5CVUA 1SCJA 4FN4A 5IT0A 3B71A 1N9GA 1OIXA 1SUIA 1ECCA 1URPA 3L0IB 4MSUA 4RWEA 4XW2A 4BJHB 4BO4A 4DSNA 2QORA 3KVRA 2VLIA 5D7BA 5DGCA 1X1AA 5ERXA 2PSEA 1OFCX 3IIMA 3K6RA 4B7XA 3M3PA 5IVPA 2OXEA 1YU6A 4U3JB 4GOOD 3QVGA 2BEWA 3RGWS 3GP8A 3QWAA 4G9BA 3UMJA 3HHEA 1IBKB 1AXGA 1L5QA 2GZ2A 2GTIA 3H4TA 5TDHA 1E1MA 2WMYA 5BT8A 2IKSA 5I3CA 4NBTA 1LJ2A 4LKOA 1NTZK 1L4NA 1SZPA 3FIJA 1XDZA 4H3HB 4AS1A 1Q1GA 1ZN8A 1W44A 3TVDA 3UAZA 2V4UA 2W71A 2PQ6A 3O8OA 5DOZA 4WKCA 5GY7A 2IBSA 3ZX5A 3LRPA 3FGAD 2DR3A 2INGX 1VDFA 4H1VA 2RIPA 1Y8RB 3IVCA 3JQGA 3T1HB 4F71A 5HS4A 4Q6BA 4TXNA 4RKUJ 3WK5A 3HUDA 1M34A 4D9CA 4Q4CA 2WZQA 3HR4A 3K0CA 2DR2A 1EIZA 2QN2A 1RY3A 4TSKA 1MVOA 4HLUA 2WJIA 5LQKA 4LXUA 3G1WA 4L2IA 2IL1A 5EUMA 3GJYA 4HQLA 5KDLA 4GS5A 4HEQA 4I36A 4LAFA 5ES3A 1CG6A 2PWYA 1K7FB 3DDZX 4FEEA 1QDEA 4RF3A 5CD9A 2GBCA 5CEFA 4INJA 5LL6P 3PR2B 3SHTA 3BB4A 4RVOA 2COUA 4CV1A 2BL4A 2V7GA 3DZIA 4ENTA 2G1PA 3CQ9A 1B23P 5EESA 5CA0F 4YJ2B 4MNTA 2V9CA 2RGCA 3NTVA 3OESA 3UV7A 4YA6A 1H42A 4HH2A 1NV9A 4Y9DA 3ROMA 1U4NA 3I01M 2X2PA 2QRNA 3MSCA 4AN1A 5CA1F 2AUMA 1GUBA 1E2NA 4JY7A 3V4LA 2OHJA 4DILA 3W3AH 2FR8A 3HKDA 2H8PD 2HX1A 1FDSA 3DE3X 3GLHB 2ZUEA 2CJYA 2J3JA 4G89A 2P0YA 3UICA 3RYCA 5TISH 1H5NA 3H6KA 1USWA 2EP5A 3NHLA 3P45A 2QROA 3P7MA 3UUWA 3HO1A 3HRNA 3FHOA 2PJDA 4QDOA 5ESDA 3AR2A 4EW1A 2KZJA 2K3RA 1XDSA 5CX4A 3LQKA 2QLLA 3ROZA 2AJ8A 6AT1A 4OJTA 1EX7A 2FPIB 5LQCA 1ACLA 1J0EA 3I58A 1JECA 5AI6A 1A4UA 2J3MA 5M1BA 1LPAB 1NVXQ 1S8NA 2G67A 2WMDA 4G0YA 4QNRA 4ZAVA 3ETNA 2FQYA 4MLPA 5CCGD 2WW8A 1ODTC 1CJMA 4WDRA 3SC2B 4BMNA 1XNQB 3SFTA 4MVJP 1P18A 2AJBA 1ZO8A 3DB2A 1ADJA 1GG5A 2ZIGA 2O2EA 3G85A 4JLPA 3VVBA 4I2LC 4B7CA 1GMJA 3PR1A 2VCEA 4B31A 4FYKA 4YT4A 1NIJA 4M89A 1L4FA 2E21A 3QH4A 4TXJA 2WNSA 2OXTA 1R4NA 4EJSC 3BORA 3L71D 1NTZJ 2VCHA 3QBJA 1B16A 1YRWA 3I1IA 3STYA 3QEKA 2Q3IA 3Q7PA 3MUEA 1JEKA 3ZY6A 5B58C 3LX4A 4U3FD 1QVGO 3WLAA 2BZ0A 2OG1A 2EV9A 4MVYA 3CE9A 3IP5A 4GMHA 1GIAA 4J0GA 3V4RA 1T8YA 4QGFA 1BDBA 2JDIH 4O4LB 1U6KA 4N48A 1JHYA 1XZ8A 1RIFA 1Q86Q 2EF1A 2Q21A 4MWCA 2D5CA 4B3MB 4WBXC 4HLNA 3GRZA 4HTFA 4ON9A 1PQWA 4Y6PA 4ZC1A 4AJ4A 2JWAA 1YZUA 4J0CA 3KKOA 4MVJF 4DTIA 1CRLA 4FT4A 2W6JH 3S1AA 1ZAYA 3DV9A 4JL8A 1FS6A 5JANA 1WPGA 3C1LA 5KNDH 1C9NA 3PJRA 1KP2A 4DEYA 5TPZD 4L0MA 4YJ2F 2EVWX 5F98A 1FP7A 1LPMA 3II6X 3AY0A 5IX8A 4C07A 1HM5