1OZHA

The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
552
structure length
545
Chain Sequence
b'VRQWAHGADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLLDSSIRIIPVRHEANAAFMAAAVGRITGKAGVALVTSGPGCSNLITGMATANSEGDPVVALGGAVKRADKSMDTVAMFSPVTKYAIEVTAPDALAEVVSNAFRAAEQGRPGSAFVSLPQDVVDGPVSGKVLPASGAPQMGAAPDDAIDQVAKLIAQAKNPIFLLGLMASQPENSKALRRLLETSHIPVTSTYQAAGAVNQDNFSRFAGRVGLFNNQAGDRLLQLADLVICIGYSPVEYEPAMWNSGNATLVHIDVLPAYEERNYTPDVELVGDIAGTLNKLAQNIDHRLVLSPQAAEILRDRQHQRELLDRGAQLNQFALHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIARYLYTFRARQVMISNGQQTMGVALPWAIGAWLVNPERKVVSVSGDGGFLQSSMELETAVRLKANVLHLIWVDNGYNMVAIQEEKKYQRLSGVEFGPMDFKAYAESFGAKGFAVESAEALEPTLRAAMDVDGPAVVAIPVDYRDNPLLMGQLHLSQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Acetolactate synthase, catabolic
publication title The Crystal Structures of Klebsiella pneumoniae Acetolactate Synthase with Enzyme-bound Cofactor and with an Unusual Intermediate.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Lyase
total genus 199
structure length 545
sequence length 552
chains with identical sequence B, C, D
ec nomenclature ec 2.2.1.6: Acetolactate synthase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ozhA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ozhA04
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ozhA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1ozhA02
1U28C 1EFVA 1NI4A 2Q5LA 3CLUD 4WBXC 3M34A 2BFCB 3GLSA 4JUBA 5EJ6A 5EJ7A 2C3PA 2AG1A 4L2IA 1IK6A 4K9OA 2VK1A 3E9YA 2Q5OA 3EXEA 3EXFA 2Q28A 5HJEA 1X7WB 2R8PA 1Q14A 2JI9A 2O1SA 2BEVA 1L8AA 1UPBA 2Q5QA 1NM5C 1POXA 4X3OA 1YBHA 3PKJA 3EXEB 5C4IA 5HGXA 3EXFB 4RJIA 4K9NA 5D7NA 2YICA 1MA3A 1PYDA 2XT9A 2EZTA 3LQ1A 4XEUA 4J1TC 2IHTA 5HYVA 2UZAA 1M2NA 4RMJA 4UU7A 1NGSA 3FSJX 3M49A 3IAEA 4HDAA 4C78A 4BN4A 5I4IA 4UTVA 1BFDA 4F56A 4V1CB 1M2JA 1V16A 2FRDC 1PO7A 1DJLA 4MPPA 3AHIA 4MPRA 3JWPA 5I5GA 4MZXA 2BFDA 3GLTA 3AHJA 3EXG1 3HYLA 4GM1A 4BN5A 4I5IA 3DUFA 5BWOA 1UMDA 1ICIA 3HWWA 1YHZA 1T9CA 2JIBA 1V16B 1V11A 2XT6A 2OORC 2BEUA 1OVMA 2IHUA 3RIMA 4UTNA 1QPBA 5EJ8A 2C3UA 3LPLA 3DVAA 3AHDA 1V5GA 3DUFB 1U2DC 1UMDB 3EA4A 1QS0A 1PTJC 3LQ2A 1W88A 1M2HA 5MFPA 2E6KA 1X7ZB 1SZCA 1V11B 2OD2A 2YIDA 5MF6A 5MGNA 1UMCA 4KXVA 3DVAB 2BFFA 2DJIA 4GM4A 1YI1A 2VK4A 2C31A 3AI7A 1O97D 1X7XA 1W85A 4TWIA 2G67A 1S7GA 1U2GC 1RP7A 4K9KA 1YC2A 2IEAA 1JSCA 3ZHQA 5EXDA 2C3MA 1OLUA 3LQ4A 1M2GA 4UUBA 3RIYA 4ZP1A 2NXWA 1HZZC 3AHHA 1PNQA 2AG0A 1UMCB 2R5NA 1X80A 2BFFB 1Q1AA 1YD7A 4JSRA 4QQ8A 3D4BA 1X7XB 1W85B 4QPZA 2FWNA 1MCZA 4JU9A 2H59A 5ERYA 4UTRA 3ZHUA 4F4UA 1OLSA 4KPUA 1NI4B 4UUAA 2VK8A 4D5GA 1Q17A 1OLUB 2OZLA 3AHEA 1YC5A 3UK1A 2H2FA 4O8ZA 1V1RA 2VBIA 2V3WA 1PT9A 2H2IA 4J16C 4FZ3A 3ZGVA 2Q5JA 5ESDA 1TKBA 4UTZA 1OLSB 1ITZA 2QQGA 4JUAA 2BEVB 2OZLB 5K3SA 3EXHA 2H4FA 1YNOA 2EZ9A 4JT8A 2RH0A 3F6BX 4MQ5A 2QTAA 1U31A 3JR3A 4Y6QA 5AHKA 5DEIA 2JI6A 1TKCA 5FYQA 3EXG2 2BFEA 1TRKA 5EJ9A 5HHTA 1AY0A 4K9QA 3F6EX 2C42A 5EJAA 1QGDA 4JU8A 3M6LA 2FR8C 3CLRD 3IAFA 2BP7A 2H2HA 4MPJA 4IF6A 4ZZIA 2VJYA 3EYAA 4G1CA 1J8FA 2Q27A 2BFBA 2C3OA 2PDAA 3L84A 2BFEB 3M7IA 5EJ5A 3GLUA 4KGDA 1V5FA 2BFDB 4KXYA 3ZGOA 4KXXA 2EZ4A 2OD7A 4JUFA 3ZHTA 2OO5C 4BVGA 3U3DA 4COKA 4V1CI 3OOYA 4D5EA 1T9AA 1OLXA 4K9LA 2BFBB 1KEKA 1GPUA 2BEUB 2Y0PA 4JUCA 3AHFA 1UPAA 1R9JA 5BWLA 3OE1A 1UM9A 4GM0A 2IHVA 3PKIA 3ZHVA 2O01N 2A1UA 4GP9A 4GG1A 1X7YA 3GLRA 3UPTA 1B0PA 2PGNA 4C7VA 1YHYA 2H4JA 3EXHC 4R8MA 1QS0B 1W88B 4IAOA 4BV3A 1OLXB 2EZ8A 4QELA 1M2KA 1UMBA 2WVGA 1SZDA 5DGTA 5EJMA 1UM9B 2VBFA 1X7YB 1YTLA 1OZGA 3K35A 5K6RA 2G25A 2G28A 4JT9A 1U5BA 3RIGA 1ZPDA 4UU8A 4K9MA 2Q29A 1N0HA 1UMBB 2JGDA 5EXEA 3D81A 4Q9DA 1XLTC 4RMGA 1X80B 4BVBA 2JLAA 4BVHA 4RJJA 2BEWA 2J9FA 1U5BB 1OZFA 5ERXA 4RMIA 4X3PA 4BVFA 1PNOA 3DV0A 1TKAA 5IMSA 4UTXA 4L3OA 3MOSA 4HD8A 2JGDB 5K6TA 3ZG6A 3FLMA 2R8OA 3EY9A 1V1RB 2H2GA 2BEWB 1YI0A 2J9FB 3HWX1 3ZHRA 1PVDA 2WVAA 4BV2A 4C7XA 2WVHA 1V1MA 3DV0B 4KXUA 4V1CA 1POWA 5DGDA 2QTCA 4Y6OA 4RMHA 2B4YA 1UPCA 3AHGA 3CLTD 3D7KA 3EXHB 3ZHSA 2VBGA 1Z8NA 1S5PA 4BVEA 4K9PA 2C3YA 5K2OA 4JUDX 3U31A 1EFPA 4JD5A 1Y9DA 2JI8A 2NYRA 5MFZA 1V1MB 2H2DA 2EZUA 5I5EA 1OZHA 4KXQA 2PGOA 3FZNA 2XTAA 3PDHA 1V5EA 2BRUC 4TWJA 1DTWA 2BP7B 3EXIA 5FEMA 1O96B 2JLCA 2HJHA 1X7ZA 4BUZA 3AHCA 5BWNA 5EJ4A 4FEGA 3CF4G 1PI3A 2JI7A 2UZ1A 2X7JA 4FEEA 3O6QB 1D4OA 1DTWB 1Q6ZA 2W93A 5I51A 3EXIB 2AXCA 2H4HA 4RJKA 3CLSD 1WCIA 4Y6LA 2FSVC 3KOMA 2A1TR 1T9DA 4KXWA 2FN3A 1T9BA 2PANA 2UZ1B 2BFCA 4FVTA 4GPEA 2O1XA 1E3TA 2QQFA 4IG9A 1WCIB 1X7WA 4C7BA 2OD9A
chains in the Genus database with same CATH superfamily
2QW1A 4FFSA 1MC5A 5BVZA 4QDJA 4G0XA 1IBMB 4D26A 5KAFE 1IQPA 2HDWA 5L4LA 3MJCA 3CTMA 3H1LD 4OQZA 1JFFA 2HA3A 2W6ZA 2P79A 4IJWA 3A3KA 1P2TA 3PQCA 1KNQA 2JRLA 3PNVA 4C9BA 2I7TA 4M0CA 3LXXA 4O4LB 3EFBA 5FTKA 3COWA 2JANA 3TQIA 3WKAA 2ZM6B 2ZB7A 2W2OA 3G2JA 1BCRA 5CCHC 3L74G 1V4NA 4H16A 2GXSA 3UOGA 2FVXA 1Y7LA 3PHCA 1KOJA 4YJDA 1MQ8B 2YY7A 2VOJA 2XI4A 4HS9A 3H18A 4FKBA 3OA2A 1TLFA 4GM1A 3QYJA 2ZUDA 3WI7A 3HNOA 4WY4A 1BH2A 1OVMA 1GZHB 1MOZA 3LPLA 3UT5A 1DJPA 1NBWB 2YUIA 3HSSA 3FD8A 4P58A 3SHOA 5I9MA 1MU0A 5HIIA 4L07A 4IBOA 4Q18A 1UC9A 2P0EA 3IA7A 3NBQA 3G5TA 4LCBA 3GLVA 3LIIA 3L7IA 2M5AA 5IW8A 1VFNA 4JJEA 1QFJA 4K05A 1E0KA 1UAGA 1USDA 1XKQA 3ZV7A 3LQ4A 1IATA 3FSGD 1E0DA 1UBKS 4QD3A 3CX8A 4MQUA 1N0WA 2QUZA 4CG2A 2XKMA 1IEWA 3S2GA 5AW1A 3VNRA 4ZO4A 2DCUA 1MOQA 4LZJA 3C3CA 4Y0AA 2EF1A 4P81A 3JZAA 1CUHA 1KSFX 2P3OA 1V45E 5LB2A 1CUAA 1I2ZA 4TX1A 2QXYA 5A5VA 3DW3X 4A2WA 4UTZA 4L5YA 3CLRC 4YJGA 1H3NA 2PJZA 3DLAA 4X62B 3D7SA 1KI1A 4DBZA 2RCNA 4IVPA 2LE0A 3DBVO 1CUIA 1NF3A 3R3WA 1G5QA 1PE0A 1UXKA 3NX4A 4IOIH 2QIPA 3IAOA 4TSFA 1HJBA 2X8WA 5COQA 3M6LA 4BLPA 4A8HA 2Y8EA 2ZJ7A 2ZBPA 4HRAA 4AJLA 1J8FA 4GHWA 4KLZA 2RGWA 3N2GA 5EP4A 1ND5A 3DHYA 4KGDA 1P9LA 3NGXA 1SKQA 4LBYA 2XEDA 5TEVA 1XTTA 4JUFA 4AQ7A 1X7GA 3ENQA 1KEKA 4EI7A 2P9TA 2H7CA 1SOAA 1JDVA 2IU4A 3B1VA 4LTMA 4XRRA 1S4MA 1ZEJA 4LMBA 1YJ9P 3BJIC 1KRXA 2OQRA 5IH3A 2NZ2A 1B41A 5FOXA 3DMNA 4Q4CA 4ID3A 3GUZA 4DANA 2DUJA 3C8MA 3AYXB 3LW5J 1Y89A 3LLSA 1NV8A 2VNIA 3JQCA 3ZDFA 3F8TA 3KX2A 4JVOA 1QH1B 4EG5A 1FZFA 5KMGA 4FW8A 3VP9A 2Q0XA 7REQB 2XUFA 1MG0A 3I30X 1BE3D 2ZE7A 4F93B 3S9OA 4XJVA 5LQDA 1EXVA 3VYSB 3PWKA 4COOA 5AUNB 3SJCA 1JLLA 4PICA 4WZ6A 3OLCX 4GSKA 1EFDN 3S5JA 1ZEMA 4O4IF 5FTWA 2VSOA 3CEHA 1T8SA 2O8BA 1JYEA 4OH7A 1JLMA 4K1LA 3H32B 2P2SA 4CLDA 4U4AA 5ENDA 4YGXB 3SHTA 2GJAA 3VRHA 4CU5A 2G1AA 2YUTA 1U7MA 2QD1A 3DULA 2IUTA 2PH5A 3KOMA 4KPYA 1A9YA 1F8GA 2FMKA 1RH5B 4UOZA 3H97A 4M1SA 1TQ8A 1CUEA 4QXPA 3UJ3X 4GFDA 2W0SA 2MMCA 3ZXIA 3K1YA 2D0DA 1A1SA 3BHMA 2OP0A 3R3JA 4JX8A 3ZY6A 1LC0A 4JUBA 1SUDA 2FZCA 4WCFB 3QVGB 4CEHA 4BFWA 2IJGX 2IWRA 3ANXA 4MINA 1ONNA 3OZSA 1LKZA 2R8PA 4MROA 3E2MA 3UA4A 1RU3A 1VJCA 1RWBA 3ISJA 1SURA 3ZOKA 4GE3A 4YMLA 1G8MA 5HKLA 2QX9A 4DRXA 1SEVA 3BIXA 3CISA 1LT9B 5CA0A 1R0ZA 3JX9A 2QKYA 3C5VA 5J63A 3PDUA 1EDOA 3G2OA 2V58A 3X1YA 3NC4A 2UVDA 3G9QA 3WL6A 4KYTA 5DK4A 4HLCA 2REQA 3TAXA 3TR6A 4ERXA 4F71A 4LHEA 3DDHA 4X9XA 5CLIA 5IWCA 1MX1A 3ST7A 5LQJA 3FUTA 1TT5B 2ZKLA 3MGCA 4PVCA 1SVFA 5LB4A 2AHOA 5TARA 3L8ZA 5F2EA 2ATEA 3CXUA 1RRMA 5MGNA 4JJIA 1DKNA 1RWPA 5B55A 2OP1A 2H88C 3RUIA 3F90A 3CX3A 3DXYA 5E9JA 2BVNA 3DW1X 4BQIA 1ZHFA 3F78A 4KMOA 2X5KO 2NXWA 4QSHA 1PRYA 3QTTA 2F9MA 4ARIA 1YKGA 1ORWA 2GTIA 5KOIA 2YY6A 4INJA 3AEEC 3T3GA 3UJPA 1HORA 4D5GA 1ORTA 2GYUA 1D2GA 1KSJA 3I6QA 1IC6A 4CF3A 1V1RA 2OCIA 1I2DA 5BSMA 1XK6A 4JT2A 4O3MA 1SVKA 2ZGVA 1Z0DA 1E9VA 3UAZA 4OYYA 1YDFA 4X6YA 1NMEA 3ZE1B 3MWKA 1RQXA 1Z5VA 1IOZA 4V0LA 5CVVA 3W9YA 3CRW1 1KKUA 3EVTA 4C2TA 4TM7A 3KP1A 4PXSA 4F1KA 4GYYA 2JFWA 5EMKA 3DFFA 2WU3A 4I7ZB 5D1HA 2L91A 3UK6A 5AWFC 1U3FA 3B6ZA 4PTYA 1HYEA 1AOXA 4QUDA 2LNDA 3LBIA 2OV4A 4YECA 1JLRA 2M98A 4C87A 2C2OA 3A58B 4TLAA 3LVFO 1XVTA 3KZVA 4BECA 2OLEA 3W0LB 5GVSA 4UXHA 3NB0A 1P84D 5SY9A 4MXDA 3WSTA 3D2CA 1KMQA 2PVPA 1N6RA 3ADCA 3GLQA 1EVJA 1KK2A 2I4OA 2XWPA 3A9VA 2WZDA 1D7OA 1QIEA 4EY5A 4WVFA 5GWXA 4PYRA 3W2FA 1I1NA 1VI5A 2GARA 4DCOA 2BTEA 3AEBC 2YCBA 2QYTA 4R8KA 4RKEA 4ZYVA 1DV1A 1DAHA 4NS1A 3DEFA 1NDQA 4OXYA 4XGKA 3C8DA 3OHMA 1GTMA 1F4LA 5HZGA 4HUQB 2J3HA 4MMXB 3EDQA 1J1EC 3TD9A 4TS1A 1FLAA 2HF2A 1EAMA 4E0BA 3EY9A 1R4MA 3S5UA 3D6YA 4U7JA 3I4FA 1QGZA 2XUPA 4MKRA 1M5RA 2YS7A 4EHFA 4L4SA 4DV3B 5BW4A 2CYBA 4EENA 5B66H 3EG9B 1JVSA 2BMVA 2QRZA 3JQEA 4NV0A 3PQ5A 2CV1A 4P5EA 2WSSA 2WYOA 1QPZA 3UKJA 1XNJA 1JFTA 2EFGA 5SY4A 4RNDB 3INRA 4O4LF 1HFEL 4CM4A 3DO6A 1I14A 1SQPK 3JVVA 4EMUA 3FTQA 1PFQA 5JYBA 1E2KA 5EJIA 4GS5A 1VECA 2XZDA 3MUEA 2FUCA 5KTBA 2GA8A 5HRAA 5KNCH 4RH1A 2BBOA 5GONA 4C6SA 5JIBA 2PANA 2BFCA 4K3AA 1XTZA 2A14A 1PZNA 1ZL0A 3M6UA 1NI4A 1D2MA 2L69A 3B6KA 4OF4A 3ESDA 1DHTA 4LF8B 5CDYA 2YHAA 4MW6A 2YV5A 5KHLB 1N2JA 4ZK2A 4P3PA 3GRVA 1M1JA 3H4TA 4YJHA 1C3EA 4BQOA 2QT0A 4WWHA 3N0WA 4LY3A 2AOTB 2IYYA 1EDKA 5IDYA 3L6CA 4XSHA 1R9GA 1QF6A 1ICEA 1Y81A 1IY2A 3CR3C 3DG9A 4S12A 5T4HA 1QWOA 3LRTA 5CLHA 3ELYA 4ZAFA 1LBQA 3HJRA 4Q82A 3E48A 4XUEA 2WKQA 4WBAA 2HG5D 2OWDA 3KJIA 4WJKB 1C1HA 3G2IA 2XT0A 2W6JD 4QHSA 5C4GB 4EKYA 2B5WA 3CCRP 2VNJA 2R7MA 3CWBJ 1OKKD 1WB4A 3B2NA 1DQNA 3WGLA 4R0MA 2JBAA 2WDZA 2DB3A 2A3NA 3A9SA 2P2CA 4MW4A 3FMIA 5JYDA 4MR9B 1EBUA 2WOJA 3EGDA 4NK5A 3IAS6 1JWLA 3FBWA 3ZJUA 2OC4A 3NM6B 3SF8B 4UXIA 5DISB 1K6MA 4MVJG 1B7GO 2GPWA 1P73A 1J2JB 3GJXC 4DAOA 3LWDA 3P9ZA 1T0PA 3QTLA 5JATA 5CCBA 1BXGA 2G88A 3EN0A 4TZKA 4LSZA 4A2CA 4BKPA 1K97A 3LXUX 4GKJB 3DZ8A 4MRAA 4CIXA 1GTWA 3FR8A 4WVZA 3FYUC 2C5SA 5C7IO 4RZUA 1SHUX 1P19A 3UF0A 1G9XA 4XD7D 1DNPA 1EFCA 4EYGA 5AIBA 1KK3A 1UXIA 3NPMA 1V0JA 1A2OA 4Z9YA 5KLIB 2H1VA 3SX0A 4EATA 4IF6A 2V4ZA 3WAKA 3B3GA 1KI7A 1K9VF 1XYYA 2WYWA 5KYUA 1I6LA 3F8SA 3EEFA 4BGVA 3KSRA 4AMGA 3LWNA 4TL8A 4GPIB 1PJ3A 1URQC 2E48A 2CD9A 2VHVA 2J9XB 3AEKB 1M6HA 2V45A 1II0A 1NDHA 2IRWA 1P31A 1Z8DA 1DPFA 1VHWA 4PHCA 1QYRA 2VHUA 1Q6YA 4E5UA 4RBNA 3CINA 1A5AB 1G2CB 1NUUA 3CZMA 4N8SA 1FFYA 4ZRMA 3UV6A 3SR3A 3E70C 2Q3DA 1W8DA 3W5CA 1NBAA 4LVOA 4D9EA 2V8OA 4O3FA 3C5HA 1FW8A 2OCGA 3NUGA 2JLAA 2QN2A 1I24A 4I9UA 1AHIA 4D97A 4HLNA 1X2EA 3H1GA 1XZHA 2C61A 3QITA 4KJZA 4BRSA 1CSBA 3Q2IA 3SKVA 1AS0A 3QM1A 1D1SA 4R2WA 1CUXA 4R2XA 2B4YA 3OFKA 4M3NA 1KY4A 3UTDA 4NAUA 1M5TA 3TOXA 1AN0A 3FB4A 3U39A 3AC0A 1L4BA 5EP3A 2P9QA 2E4YA 2VT3A 4M6WA 3C45A 3E0XA 4AKSA 4A1OA 1IQ0A 1CUWA 4LEIA 5CH3A 3T7KA 2YOGA 3PZBA 2UZ1A 3RL0B 4UHFA 2VZ0A 1E3LA 3AFMA 2RMKA 3ZJTA 2FEAA 4A23A 1Y1QA 3BZBA 2PXHA 2GHRA 9ATCA 2Y76A 1VE1A 1NULA 4TMWA 2HU8A 1KQLA 3ROQA 2BRUA 4ZQIA 1DVRA 4QUEA 3ND9A 4K6FA 4YAUA 3EXEA 3IBFA 4LV6A 2ZSIA 2Z6AA 2M8RA 3GPDG 2H8GA 5KO2A 3F2IA 3L01A 4FN5A 3EEYA 3RBVA 2FYUG 1E4YA 3KD2A 1VBMA 3K0SA 1U90A 4GI2A 1PYDA 2F43B 2BMAA 1FP4B 3J80A 1M72A 1F8XA 4OGWA 1CQWA 1IZ0A 4CMJA 1M1NA 3IEUA 2W27A 2H1HA 3Q4GA 4FFWA 1BDHA 1E2HA 2LXBA 3NIFB 1VYTA 1FU1A 5BWOA 1W0CA 2I7DA 2F7SA 2O7NA 4KO1S 1W2GA 1B74A 2GYWA 5TMBA 4ESEA 3OX3A 5A0FA 4BRYA 1ZK4A 1ZMOA 4ATNA 1SC9A 5J59A 5KNBA 2AIRA 1WCXA 5EG5A 4O2LA 3TX2A 1NJ8A 3KL2A 1J07A 2Z0MA 4IUCS 3QV2A 2XD4A 3F7TA 1JPUA 5D7BA 2NSLA 5ITVA 4B7ZA 4N49A 4HYQA 4URYR 4Y3UA 4DMKA 4L72A 1OLSA 1NZDA 3AWIA 2WMYA 1G17A 3DB2A 2G17A 1A96A 2I2XB 4ZZ3A 2FWAA 1C9YA 1W29A 3SLRA 1JN0A 2ZUFA 2XUDA 4IOMA 1CERA 1TM2A 5JJCA 5JI3E 1KYOI 2P2GA 4C29A 4AY3A 3RADC 3CRNA 5H3LA 2WJWA 1EWQA 4DY4A 2B87A 2HLDA 2ANBA 3MB5A 3G9TA 1F2DA 4JYAB 4D8TA 2IE8A 3M4ZA 1O0SA 3E3OA 2LIPA 1O6ZA 4P7JA 4LVUA 1YUMA 4IWXA 4P84A 1ZAKA 3D8TA 3GCZA 2QUIA 1OIXA 5BSFA 4KGVA 4RKRA 4RY0A 5E95A 1QGDA 2JA2A 2Q1WA 2Y2VA 2C2KA 2Q1UA 2ZI4A 3A5TA 2FUG6 1NYTA 4A8JC 3GNLA 1BVHA 4L8YA 1DUSA 1UDRA 3PJDA 1T29A 4LJKA 3UYKA 2WD8A 3L4KA 4QDKA 1P9RA 4I2LC 1JQDA 1I80A 2OCLA 4LUCA 2ZBVA 3GQVA 3R44A 5AVXA 4KOEC 1ZXGA 3X1MA 1MTZA 3NWPA 4J3NA 4DV2B 5FWXB 2VAPA 5J5AA 4RX1A 1HGVA 4JBWA 4B8WA 2WTUA 3K9NA 1LTBC 5ALNA 4DV0B 4NHEA 1OVVA 2EW2A 5JC8A 3TE7A 3T0IA 4GAEA 3R1IA 2BUAA 1KV4A 1R2QA 3ORYA 4UU8A 3B1KA 2VO1A 3X2EA 1PNVA 3P5SA 5IM5A 3WGKA 3TPCA 1I4LD 5A2QA 1PYOA 1WY7A 5HE8A 2DHQA 1GY8A 5CT8A 3M06A 2Z6QA 4ZT5A 5J2UA 1ULSA 1TK3A 3JVIA 1WS6A 1TF2A 5I01A 1D2CA 3GLKA 4V0SA 1IIRA 1P4JA 1H0TA 5EE1A 1OIPA 2RAVA 2Y3IA 3AETA 2B0JA 3FWPA 1KDRA 1PSZA 4F2PA 2HRZA 4MKZA 3C5WP 1ADGA 2F64A 4PTZA 3KPWA 3LSYA 3CBQA 2XA1A 1JKIA 4FDAA 2HJRA 1MKYA 1CUBA 5FWNA 2OV8A 2DZDA 1I7QB 4DN6A 2HQ1A 1GP2A 4CMEA 3R4CA 3QFCA 2MR6A 4H17A 5G0WA 4D8VA 4NYIR 3TRKA 2ILTA 3KAPA 1O96B 3CH6A 4INOA 2JLCA 3G2QA 4OGGA 1UJ4A 1AMUA 3CNNA 3AE1C 2BMJA 1NW8A 3CLUC 2GYVA 1LSSA 3PR2B 1P3Y1 4BRZA 2AT1A 4CFYA 1IJDB 8LDHA 2FNAA 2R7NA 3DFIA 3Q7SA 5BW6B 3VSDA 3BE5A 1JCCA 3DF9A 3PI7A 4ZC1A 5B1DA 4YAKA 3ZCTA 3AVXA 2O3JA 5L40A 3NAQA 4URFA 4FGSA 1QO0D 3D3QA 4M1OA 1XTSA 1YZVA 3W5AA 1FYDA 4WA7A 3FNQA 2UYHA 3EFOB 4UCFA 2PYIA 3DV2A 2R48A 2JS7A 4QJBA 4HGPA 4E5VA 3T5MA 1B0AA 3BUSA 3RL0D 5LIRA 2A5GA 3GXOA 4AZ3B 1DOHA 2HPHA 4PCLA 4DCKA 2BCEA 4IIJA 1P5ZB 3SP1A 3L05A 4BLOA 3ZI4A 4IHKA 2XDAA 3OTIA 2YC2C 1BNCA 3DUFA 3B38A 4S35A 1ZP0C 4BPBA 4EJFA 4YRRA 4MWOA 3PB3A 3BRWA 5FL3A 4OXNA 2HMAA 3PDWA 2ZT9B 3IMGA 3EBOA 4N54A 1XELA 1YR7A 4I1OA 5LWHA 3WFIA 2NPSD 5KJEA 1QG4A 5JTUA 2HQOA 3A06A 4TN5A 4KNVA 3VVBA 1ISIA 5F9HA 1OU4A 1H5NA 3B3FA 1G8JA 3IVAA 1L7BA 3IMCA 4PLPA 1M76A 1KP3A 2C3MA 1NI5A 4ENWA 2AQ8A 3KDSE 3FPFA 1ZD9A 1WUYA 1KO5A 4B2PA 3D4BA 1KEEA 1C3LA 1KR5A 5IXYA 2G40A 3C98A 2OK7A 3FZYA 4M53A 7ADHA 2HJGA 1LFAA 4N40A 1H4SA 1IRIA 2KZIA 5IANA 3IP5A 2VDVE 1WG8A 3OOWA 3MAGA 1UT6A 1T4CA 1XCPA 4MEJA 2J3EA 3RJTA 4IYJA 2X2OA 5IK2D 1R18A 3UWOA 3ABIA 1N3BA 3LVQE 1BVYF 3V6LA 1Q7YQ 3G3EA 1QO9A 4X92A 5MN5A 2C5HA 1SVMA 2FY8A 2CJWA 1SEPA 3D0QA 5F1YA 1SXJB 3IDZA 4Q93A 3SBEA 2A5YB 2R79A 3VC3A 3B71A 2BFBB 3ZDYB 3ZY3A 1DC4A 1T1JA 3DHVA 3CJQA 3WWPA 2PSSA 1TTTA 1NFFA 1O1YA 3TTUA 1AJYA 4ZCTA 2LTAA 1SZDA 2ZKIA 3H1LE 5DGTA 1VOTA 2YR0A 3W5DA 2C8JA 3N8NA 1HLGA 3BRVB 3F7NA 3GN2A 5JDCA 3PTAA 1TW2A 1SB9A 1CUUA 2OO5A 1QGKB 3NRCA 4R05A 4RJJA 1GU0A 1M57D 4MYUA 4PYNA 4OHRA 5FH9A 3P9CA 1G59A 4IXMA 4B86A 3I53A 1LF5A 1WZNA 4YHHB 1E32A 2WAXA 4Y6OA 1SQPJ 3HE4B 1A4XA 1OFGA 2IEGA 1KEVA 4L3WA 3IN6A 8ABPA 1EFPA 4UARA 4IHJA 4JD5A 3AVTA 1P84I 2OBBA 4I2VA 1E1LA 1ZH4A 4IFBA 4P6VF 1ECBA 5FNVB 3MM4A 1QVGO 1W2EA 4CMGA 5FP0A 3KLBA 1LWOA 1IBSA 1AQLA 2JI7A 1RJFA 2Z2YA 4XA4A 3HUFA 2PGJA 4MITA 4KQXA 4UUQA 1FFWA 4F7DA 2FPGB 2ZUWA 3R41A 3M6WA 3ASZA 2N3ZA 3BRTB 3KVVA 4NDZA 1XLUA 4CTKA 2HH9A 3D2BA 4Z54A 4L8WB 1GNPA 1JAIA 4RVOA 2XCIA 3IQZA 1Z7GA 2CXSA 2QZJA 2IHKA 3O4VA 1QL1A 2RKWA 3WZMA 2I6SA 3OCCA 2H31A 3CH4B 1GUDA 2E49A 3RS4A 4YRSA 3BMCB 2EYUA 1PPJG 5FPPA 3IIMA 2J8ZA 1PP9G 1POXA 1ZC4A 2WYIA 1GDTA 4AUMA 3LUDA 2GNAA 4ZPXA 2QSJA 1NKTA 3TRJA 5CM8B 3ZCQA 4G8DA 3NC0C 4P22A 3K16A 3H5WA 1CUYA 3AL3A 1FJ2A 2BEKA 4J7UA 3A36A 3M49A 2YDYA 3MJVA 1ILWA 2Z3ZA 3RHZA 4DSUA 5C46F 4PPYA 3AHIA 5DHQA 5T8KA 3RS7A 2Z58A 4Q3AA 2DLCX 3SHVA 1W5EA 3KZIE 4JXKA 3EK2A 4EGCB 1WZUA 1QX8A 4CL3A 3ENVA 3SIWA 3P4YA 3HP7A 4NVRA 3CLHA 3FZEA 3K2QA 4H27A 1T0BA 3ZCSA 2C0CA 3S27A 1SKBA 3H3JA 3I3SR 1PBTA 1Z68A 3P71T 2XUHA 4U3FD 2C84A 3ZOZA 2XOKA 5CFZA 4S1VA 2CE2X 2O05A 3GJZA 1H8HA 4WINA 1GG5A 3H42B 3ZGLA 3E3LA 5KNLA 1FNCA 2J46A 2UXDB 4YH1A 3OZAA 2F8TA 4TV9B 3P1JA 4EI2A 3KJZA 3ZWDA 1BE6A 3HDJA 4Q9LA 3TL3A 2PUJA 1A72A 4N9QA 2Y1GA 1JQEA 2OQIA 4E32A 3THOA 4UHHA 4R71A 2J1LA 2HJWA 4PYMA 3LO8A 2JJ2A 4S1OA 1BE3E 3PC4A 1EZVD 4L5JA 5BRJA 2VTBA 4D43A 1EK6A 5CDTA 3DH0A 4MQFB 5ESRA 5M29A 2ZT9D 1GQQA 5EHIA 1K7FB 1JF8A 1U6IA 1OYWA 4J0DA 3NBXX 4X85A 5KYYB 4EJ6A 3RE1A 3TIVA 1C9MA 3GLGE 2QTAA 3FUXA 1FSSA 5AXDA 1OFUX 1XHLA 3LUFA 1F5SA 4QJIA 3NQ41 3T5BA 1Q90D 4PZ0A 3I9JA 4WV3A 1FX1A 4K6OA 3CG4A 3W3AA 1Z2OX 2FTKE 3VR3A 4GLBA 3P2MA 2E42A 5A62A 3LL4A 1Q5PA 2I2FA 4H0FA 1ZW6A 2ZIVB 5A3SA 1XSEA 1NTOA 4D46A 5DBGA 4XE5B 2BEUB 3BC1A 4MS4A 4CV2A 1YITP 3HRNA 4PCVA 4F84A 1IN7A 4NCJA 5A4KA 2FLWA 2SKCA 3O83A 5AW0B 5I8PA 2ABWA 1Z6ZA 2WYUA 1BXRB 3MCVA 3KOWA 3R74A 4W7SA 4G0VA 2YRFA 1JIQA 4ENRA 4RPHA 3X1XA 1TFRA 1KJZA 3R7SA 4MLZA 1P2FA 3K6SB 1N4DA 1RWMA 4EUHA 1E6KA 4JI7B 4WFIA 4UHBA 4PN7A 5EPOA 1A0OA 4OH8B 4C3UA 1E1MA 5FUYA 1NU1G 4GSYA 5IJ0B 1SXJD 1Q7RA 3AZPA 2NU8A 4YC7A 2QOEA 1XAIA 4MR8A 2IXTA 4WD3A 3LW7A 1PJTA 3C6XA 2HB6A 3B5ND 5K0EA 4PRYA 2YHSA 5JQWA 5K51A 4DQKA 5DSZA 3K9GA 3TSIA 5EIBC 3IA2A 5SZJA 1FFDA 2O0JA 3STVA 2H07A 3U7JA 2VPTA 3WBBA 2D1QA 1E9AA 1VG0B 1XRRA 4EGSA 3T7IA 3PDHA 1CY4A 1IZ8A 4G81A 3I72A 3H5AA 5AKEA 2OQ2A 2GCEA 3JYOA 1XXHA 1A7UA 4U2EA 3YASA 4KJMA 1H1LB 3UZUA 4IFTA 1A69A 3P8MC 1Q6ZA 3VU3A 4CL2A 2C4UA 1JEDA 4AN1A 1D6SA 5CJJA 1U7TA 1NAYA 2A1TR 1RZUA 2HXGA 1QHFA 5L95A 5ELXA 1JY2N 1YL7A 4D6TG 2AFRA 2DQYA 1PD1A 3ACDA 2C0QA 1ZH0A 3H5LA 3ETCA 3DCYA 5GADl 1IBLB 3O6VA 5G3ZA 5KWEA 2WQYC 2EWWA 4RC9A 3BMXA 4NENB 4CLRA 3KPVA 2A88A 2KYRA 1QP7A 3ZWCA 2FPMA 2ZDGA 4ZXPA 3HYTA 1R4NB 4EI8A 4G56A 2HR3A 3GF3A 1ZNQO 3RTDA 4BX0A 5JYCA 4PD4H 4ZYLA 1IZNB 4HPWA 5CPBA 1JEYB 3P2OA 4C89A 4NU8X 2MJZA 1Q0PA 5ALPA 3PA6A 1SQVD 2VUUA 2C04A 4RK6A 1II8B 4X93A 3T99A 1YK1A 3GGOA 4IIUA 1Y8RA 2PEZA 3ZWMA 1L5GB 3EISA 2D59A 4LHSA 4S2EA 1RLJA 3BJZA 3N0XA 1Y1SA 3C5EA 2PX3A 3S2SA 5FI1B 2PAAA 3S2EA 3OFSA 3U4DA 4YT8A 4R4JA 1P84E 3R75A 4C7OB 5EJ8A 1N2CE 2HNAA 4FR2A 2QN6A 1KJIA 4EPRA 4X5OA 4MGYR 4M4SA 2FPUA 5KTKA 1RQRA 4DCTA 1E92A 1S0UA 4DIKA 1NG9A 2ZT5A 1O3YA 1X6VA 1EGAA 2MTBA 2C9OA 1RMTA 4FOPA 4LKOA 1DMSA 3B20A 1CP2A 4OGQD 1WMDA 2PD6A 3E22B 1ND6A 4LJAA 2E37A 3GA7A 3MJHA 2G8LA 1RKXA 3UMSA 4F1WA 3BN3A 3DB1A 1L3BA 3RVBA 3RVQA 2H29A 3ULKA 4JQOA 4O8ZA 1FJXA 1DIBA 2CGEA 3GNSA 2E0IA 5JMTA 521PA 4AQYB 4R69A 4MA5A 4LNUB 5EC8A 1Z7WA 2FFDC 2JFHA 4I1SA 5FPTA 3OIYA 5F2OA 3H2IA 4ZAGA 3A2KA 1TU4A 2I4LA 1GV0A 4MUBA 3FRJA 1XTVA 4FCVA 3JRXA 2ZZNA 1ZJYA 2P4UA 5FO0A 4LOIA 4OHYA 3GARA 2W6PA 1NPYA 3Q1MA 3K7EA 1RTTA 2A4MA 5AK4A 3QA9A 1COWD 4UFPA 4CQMA 3KWFA 5CCEA 3D4OA 3QVXA 1CY7A 4E94A 4AUNA 3BCHA 1C1XB 3I4LA 3RSCA 3RU3A 3PFIA 1VPTA 1D0SA 2B92A 4P7KA 4I1VA 2GERA 2NN3C 3ZUGA 2XQKA 3VZDA 3FYUB 1FQJA 4KE9A 4AY6A 3ZZTA 4BJHB 5KINB 1ES9A 4E2WA 1K7SN 4JOCA 3FGNA 1XE3A 1T3LA 4CCYA 1AX9A 3E84A 3H5OA 4YIHA 1XWFA 5EGNA 3CW9A 2JFYA 2WTBA 1P7ZA 2PFXA 2HMWA 3A1WA 1DRWA 1UWVA 4AY5A 1L5YA 3HCEA 2B2CA 1RY3A 2J7KA 4JDUA 1P3DA 2QNIA 4POOA 3WGJA 1URQB 2IEZA 1FB5A 1XDWA 4R83A 1GQSA 4K81B 3VPHA 3VZPA 3ZHRA 2NAPA 2AW5A 1H05A 1IXRC 5FOTA 5AW4A 1XHEA 1WX1A 3L06A 2GK3A 4I6JA 5IBQA 5IDVA 2YO2A 1JNMA 5C3MA 3U44B 1GSAA 3OAAA 3DZHA 1YULA 1Y63A 5I7WA 2EZUA 3R7AA 5CVUA 5GJVC 3G5UA 5AOVA 3S8EA 4JC0A 3K9FC 5FUXA 4TLBA 2I29A 1KYOD 1WSBA 4HUTA 4ER5A 4BUZA 2XMCA 3MD0A 4HP8A 1KU6A 1QUEA 1FVOA 4LQCA 4LV8B 4YK7A 2X1HA 1H6CA 1A95A 3AE3C 2C1ZA 3FTCA 5SZKB 3TYXA 3QXJA 3JVDA 1WMEA 2CHVA 2O0HA 1X1CA 2X2EA 4CHTA 2CNWA 3IIIA 1L5HA 1LT1A 4QBKA 2E85A 4NZOA 1U8YA 4LE2A 1LI5A 5FOVA 4M83A 3KZ1E 4BYGA 3RFFA 2GTHA 3K5IA 4R16A 1UFRA 4RLHA 4MRRA 3TFWA 3DOIA 4BP8A 4D7AA 4MLCA 4ARBA 3FDJA 2W6ID 4HAWA 2AZXA 4R1MA 4R5HA 4TV9F 3B9RA 4ZHSA 1TZJA 3KCNA 1A8SA 1V8BA 2QX8A 3W3ZB 1MGOA 1MXHA 3O8NA 1Z7EA 4ASWA 3ZYCA 3FI0A 1ACLA 5LUBA 2DTXA 1ZWLA 1CT9A 4JCCA 1UMDA 2BGJA 3AX6A 1G16A 4WEQA 2B7CA 3I09A 2P9BA 1KOGA 2AOXA 5KYTA 2HBRA 3B6EA 3BXZA 3CMCO 1ZUHA 2JJ1A 3EVZA 1E4OA 4GXRA 1U0FA 1P1BA 4TTIA 3C5CA 3X1DA 3V1UA 1R8EA 1BDJA 2ZSEA 2NM0A 1WW2A 3IPLA 4FFOA 1TQHA 4KRGA 1J0CA 1W94A 4XQEA 3HCDA 3OT5A 3G13A 4N65A 1A4UA 2G67A 4WW0A 1GL2C 4F8YA 3N0VA 5A04A 4L4UA 2FWIA 4JS0A 2CXNA 4I8XA 3A0BH 4LFCB 1UP6A 3CCLP 3CWZA 2WBLC 2GQ0A 2Z5IA 4EDFA 1JIJA 1UOQA 1YC5A 3UK1A 1VG9B 4YACA 3UMFA 1GD1O 3L73J 1LTJA 2YC4C 1HUCA 1RHRA 3GGDA 3U3RA 4NKRA 1QCZA 2EBWA 4UATA 5KHAA 4ZJYA 1Z35A 4FYVA 4J7XA 5AHKA 1OXKB 1JR2A 3QU5A 4LI3X 1VG1A 1AVTA 3W6ZA 2XSZA 3H2ZA 4LDAA 3C8VA 3TPZA 1HFKA 1GGJA 3HKCA 3GZTB 3ZDBA 1MX3A 4F1JA 1A02F 4KPEC 2HPAA 1XQXA 2HUPA 3SXJA 1IG3A 3COJA 3M33A 3P8ZA 1IJEA 4KRXA 4K3UA 2JCVA 2P6OA 3D3EA 1OWPA 1RJDA 2HSWA 2QGNA 4ZT2A 5HFJA 1XQWA 1M0WA 3O9MA 3JQBC 4HEA6 2WJIA 3QLEA 1NW4A 1GTRA 1HYBA 5GZ1A 1VLMA 2HLHA 3TNDA 2AMYA 4OMUA 1ZKMA 1ZUD1 4K9MA 1NVXQ 5EWJA 1MRZA 1XLTC 1QOPB 1IONA 1Q0SA 1KKMA 1K3TA 3ZWWA 2QN9A 3OOHA 3GLFA 2CNLA 3LKZA 4XVRA 4DYVA 5FBKA 4DLNA 6LDHA 4JKIA 4X8LA 4DMRA 1Y7TA 4M9RA 2X40A 3GCGA 5DMXA 1C0IA 1H88A 2NADA 2HBYA 1JLSA 4ZOEA 4BMVA 3AHGA 5BURA 4TS4A 5JZ9A 1SH7A 2OWEA 2IITA 3GP8A 4ZAXA 1AGNA 3K0HA 2Z2ZA 1AZWA 1IUNA 1IHDA 3HB0A 4CEJB 4RK5A 4TT3H 2H7HA 2JFPA 1XVUA 3QBTA 4JLAA 4LC1A 1YZNA 2AN5A 3KYIB 4EHIA 4REQA 5KTOA 4E4RA 2PS0A 1FRNA 1MQ9A 2AFHB 4Z4GA 1KC8Q 2H9AA 1KB9I 1TJ4A 3ZWXA 5A2GA 2FW0A 1HZJA 3HH8A 4OXQA 5L51A 2BF4A 3N8DA 3FPGA 5IM4F 4OP2A 4RPGA 1WMAA 2HADA 2QAGA 1CQXA 4E4YA 2H89C 2BE9A 5I45A 1URQD 5EPEA 2DHEA 4IMIB 3TCXB 3O4IA 1GEEA 3BOSA 4R40A 8AT1A 3CF2A 1OXXK 1ADJA 3BFJA 3DE4X 3EDYA 2YHIB 2IOYA 2AG1A 1QGUB 1YRYE 3UWSA 3BK1A 2P5TB 4BC1A 4KJXA 4O2AA 1AMNA 4RHCA 1USVA 2VLIA 3WFZA 2D06A 1M1YB 2E9SA 4PLGA 4NU0A 5EZ5A 1WEHA 2XMQA 2KE5A 1OH8A 1E2NA 1P4GA 1QHXA 5DHSA 3GLHB 2ID8A 1E8DA 4AP5A 2Z5FA 1KP2A 3I76A 1MD9A 4GQBA 3M1IA 1DX7A 1XTRA 3CVXA 1TDJA 2FGJA 1MO5A 2HGZA 3JZMA 3HM9A 1EU1A 3RT1A 1VQ6P 1YS7A 4UBOA 4QAJA 2WSFH 3QELA 3RHSA 3Q9NA 1FZQA 3WDMA 3KSMA 1OJLA 1NW5A 4RWEA 1Y4UA 2MSEB 3ACCA 2TSYB 4YPOA 5HKKA 3G8BA 4YP6A 4A26A 1UBNA 3JRWA 3ZN2A 1KFNA 5C35A 2R60A 4PZ9A 1G3QA 3WU2H 3K1AB 3Q85A 4JZYA 3IVXA 4FI3C 5BYKA 1ESMA 1AUPA 5FWYB 5A7FA 2HFJA 3NTXA 4QO7A 2ZREA 3T95A 4RFVA 4IKEA 1LNZA 3ZE6A 3RRMA 1NW7A 3WHIA 2C98A 2DFTA 3F5QA 4B87A 2HHJA 5DFAA 1W52X 3DP9A 4WBSA 1N57A 2VNKA 1NPTO 3WLJA 3T7SA 3CQ9A 4RKWA 1E1CB 4YJ2B 2QN3A 1QE3A 2CNKA 4EL5A 1GUBA 5E1MA 1WPQA 1CY6A 1RQNA 1B76A 1TYCA 4MQ6A 1W48A 1Z12A 5F5NA 3KWJA 4I5GA 4RD1A 3WBJA 1ZD5A 4MV1A 1RKUA 1Y3FE 4B7AA 1KKLA 3JCUE 4DCUA 4LS3A 3TTYA 3C4VA 3DWIA 1YR3A 3IEPA 2H4XA 4D3YA 4YLYA 4HG2A 1E1YA 4IEFB 3Q2OA 3QPAA 2BTQA 3HY6A 3LG2A 2ZAMA 4Q4DA 1R74A 2WSIA 4XQCA 4BVGA 3UK7A 2G6BA 2GM4A 3AMVA 5E6RB 5BP7A 3T5TA 4BCBA 4EIWA 3H2JA 3QGMA 5BV2P 3DT6A 5DCUA 1A98A 1EZVI 4RPKA 4LV5B 1D0IA 1HBJA 5IF3A 1UM9B 3ZXXA 1W76A 4KIWA 5A9SA 4AP9A 4EHKA 4AYTA 4O5AA 4IGFA 3A6EA 4ERNA 4Q4AB 4RV9A 2VZEA 4YUAA 2JH8A 4UPEA 3SM9A 2ZUCA 4YRAA 2HDNB 2H17A 2NLOA 4MDYA 1JMYA 2Z1NA 5EERA 3H9CA 3OEWA 3FDXA 1U9CA 5EHZA 5AW2A 3N2KB 2RDMA 4TXJA 3HLTA 2LR0A 4Q1EA 3GVHA 1QBKC 3ZY2A 4X8MA 3A26A 2GM5A 2B4TO 2O8FA 1C9NA 5JBNA 2FEPA 3IERA 2WIFA 2B5OA 1HDRA 5L4SA 4E2FA 1C50A 4XYGA 5CVTA 1SKYB 4ZDJA 3KJNA 3H0EA 2PGXA 3QG5A 3EVDA 3FCOA 2XVMA 5TEWA 2GEJA 5KYWB 4KWCA 4IZOA 2R751 4WLUA 4WOBA 1G20A 1KGDA 3EBPA 4PHGA 2GAIA 4WGGA 2OGZA 1NOJA 5B2ZA 1GL3A 4YJ3B 4JUIA 4RKYA 1Y8QA 3CPHA 4J9VA 1YBMA 2DBYA 2PUTA 4Q3CA 2YIUB 5REQB 3EDMA 5ARCA 1NN0A 2V0GA 4EJSC 1TJ5A 1KYWA 1T3JA 4CUJA 3AGPA 2HA0A 2O3QA 5DHAA 1SBIA 2YNMA 2BFWA 2AQKA 2ZJAA 2GMWA 4QT4A 3O84A 3AT1A 4YJFB 1BCSB 4XLLA 3HDVA 4NU5A 2HZ7A 2VQSA 3WADA 4Q16A 1GQRA 4R8LA 4E2XA 3W8FA 3SHWA 2Z8YM 4CIYA 5AKZA 2GJKA 2DH6A 1K2VN 1Z83A 1VB3A 5ALLA 4OU5A 2QJKB 2W6BA 5AD1A 3QPDA 1ZUNB 4Q15A 4A9AA 1L4YA 3RYCB 2V7EA 2PL1A 2J9GA 3ZJ5A 4RJIA 1U6KA 2AYZA 1BD3A 2X23A 2FUKA 5DN6D 2GLTA 3DAYA 2C96A 4P92A 1TU3A 4CR8A 3OC0A 2I7VA 3E9RA 4J4HA 1XMJA 1NE2A 3HGQA 3TUJC 2ZWVA 5ALIA 3QVMA 3WNBA 2V8BA 1PDWA 1ICIA 3ZCXA 3PHHA 2BSQA 2C99A 1E3WB 4C4RA 2X9QA 4HDSB 3BHIA 3QP9A 3FSRA 4JR1A 4MUFA 3T9DA 5J23A 1P4HA 3SYMA 5DYTA 4KLNA 1F2VA 2WPDD 2RE8A 1YR9A 1X7ZB 5K0GA 2W43A 1NJFA 1JQLB 4PZEA 2WWTA 2RIPA 3CY6A 2VBCA 1G5RA 5F7JA 4JLBA 421PA 5CA1A 3DZGA 4KCGA 4I6GA 1JSCA 5JJ5A 5FR1A 1PJLA 2FZ4A 1Y6JA 3SX4A 1YL6A 3TO5A 2V3VA 4OTZA 3EZNA 1GCGA 2F67A 3JYHA 5GOZA 4CQLA 3WTBA 3VR2D 5A6VA 1YJ8A 1T10A 4WLFA 4A5OA 3L40A 5ELLA 5B6IA 4RTNA 1PT9A 2LKMA 1DLIA 3OG9A 4R1OA 2I3GA 3D0OA 3FWKA 5LQUA 4UPDA 1J22A 3PA8A 2Q4EA 4NSNA 1ZOIA 4CFZA 5D00A 5IAAA 2P35A 2WSCJ 2FUNB 4C4YA 1J0BA 1JR6A 4MB2A 5KU1A 4DG5A 2HWUA 1QG0A 4G1UC 4PJ0H 4S1WA 4DM7A 1C30A 1UBFA 3EAQA 1MJGA 1LD3A 4MN4C 4ODIA 5J5CA 3UHFA 5JC1A 1LRLA 2ZAEB 4GOKA 5IAKA 3WL3A 3CCJP 2DPXA 5BR4A 1UPAA 2HT1A 3EWKA 1I9GA 1AUVA 1QQBA 5IT9A 3IBGA 4MLDA 1JXAA 4BGEA 4EQZA 1DELA 4P0TA 5HE9A 3WX0A 4DS3A 2A5LA 4UJ3A 4WECA 4AJOA 1M2VA 5EEGA 3ZIDA 1R6VA 3E3NA 3OJCA 1YI2P 2A0UA 3K8QA 3KAQA 3CUWA 5LNK1 4PZZA 1CEXA 1D7AA 2IDBA 4GRIA 1ADCA 3CLTC 5C7YA 5GM2A 5TC4A 2PVSA 1H66A 4LPKA 4MVJA 1KL7A 3X1ZA 2O8VA 1FU8A 4N4AA 3PFKA 4LMAA 3HZZA 3C4JA 4KUHA 5GTIH 3GU3A 3R3UA 4JI4B 4QNMA 2X5OA 4ZALA 4ZCSA 2QE7A 3PICA 5H8WA 3OEHA 3LF2A 1CUVA 4CMAA 3V8RA 2NYRA 4HWKA 4GI5A 3HO8A 1OBVA 4UUNA 4U3FE 4DV7B 2R3CA 1Y9JA 1YKFA 3AF1A 2AR0A 1E6UA 4P4SA 2JEZA 4FGWA 4KAFA 2E7ZA 1DJNA 5APTA 3I5XA 1Q1GA 3LUBA 3TCKA 4B80A 1L5RA 4C0LA 5IUKC 3P7MA 3RUHA 1XZGA 3HVKA 1JDBB 4ML3A 5DASA 4P5DA 1CXZA 4Q9HA 3JQ8A 4GKGA 2NU9B 3LA8A 2Z5GA 5ILGA 1DV2A 1SHJA 3ENKA 4EYQA 1XF1A 2D2FA 3T38A 6Q21A 2PSFA 3LUJA 4FUTA 2I78A 3SEAA 3EXFA 3WGVA 4JYCA 2H5EA 4L78A 1TIKA 2SKDA 5DI3A 2WWIA 2BGMA 3MOGA 4J0FA 2GD6A 3UMVA 1OD6A 1MN6A 4Q05A 1U3TA 2B1RA 2C7BA 4OHMA 4UW9A 3X0DA 2VWPA 3DMDA 5JV5A 3V7FA 1JUNA 5DIFA 1NVGA 4RTQA 3H1JD 3KDPB 3DR5A 4XTCS 3DLHA 1S96A 2X6RA 1M2OB 5A5GA 3JQ7A 4G1MB 4GWGA 3FXDA 4QIHA 2XMPA 2JGNA 4BU0A 2CXPA 3V4QA 1UPTA 2YKPA 1T25A 4RGVA 4YJ2F 3F1LA 3CV3A 3I73A 1FE8A 3QOWA 4J16A 1O4VA 4MGZR 3ZGYA 4JNCA 5K7SA 4PLYA 4JGIA 3CKYA 1XVAA 4RORA 2C20A 1NNEA 1WCWA 1S8OA 4C0SA 5AM0A 1XRQA 2NUPB 1U3DA 2ZSFA 1YDHA 2WMMA 2Z08A 2ZROA 1OFIA 1QP4A 3HU2A 1CRZA 1SXJE 5AW5A 5KS2A 3V1MA 2PUEA 1HC7A 4IGEA 4KPUA 2WQZA 3H6HA 5AJYA 4L27A 1R16A 1BS2A 2IYNA 1WNFA 4C22A 2VFAA 3AUXA 3L93A 3P0JA 4Z8XA 1LW6E 1EK2A 1PZXA 3SR0A 1DQZA 4H15A 2AOWA 4JB2A 3JQGA 2B78A 1DXQA 2D1RA 1XD9A 1XALA 3X1WA 1SVWA 3HDTA 4BNMA 4M3LA 2Y1DA 1NNLA 1KILA 4Q1VA 5GTHH 1FU4A 5KSZA 5KWIA 3I55P 5D01A 3VBCA 2QX6A 4G1FA 2HPCA 4M0DA 3OHSX 4BQSA 1IN5A 3UHOA 7MDHA 4B3XA 1G2PA 2ACWA 3F49S 4RF5A 2HLNA 9ABPA 2PVCA 4IVRA 2IHNA 4D3SA 1Z06A 2KS1B 4DZRA 2O01N 1GCOA 4JJKA 1DD3A 3PG5A 3GR6A 3PYXA 3W67A 3JC22 1N0IA 2EG9A 3PRYA 3N28A 4RHYA 1PDOA 2FFDB 4IXWA 3VTPC 5E2IA 3D7NA 2DULA 2W2MA 1CRLA 3AFOA 4IFEA 4D4IA 1KS9A 1ECLA 4PFKA 1JQ3A 5F4ZA 1SQVE 2H52A 3I45A 1RXWA 4HNAA 1LJ8A 1VQ9P 3ZIAA 5B4VA 1WKVA 4YRPA 1R6TA 1IH8A 2A9RA 1KOFA 4FBMA 5T67A 2AB0A 3VR6D 1EX6A 3R0XA 1RP1A 3FRHA 3TLBA 5DM4A 3PUKA 3WK4A 3LECA 4K9PA 4WK2B 3L77A 4U2KA 1XV5A 4QDXA 3BMQA 3OCJA 3PLNA 3SDZA 4W9RA 2NPFA 3GH3A 3JWJA 3ZC3A 2VPPA 1NN1A 3EIXA 4GNRA 2YWXA 4L6IA 4F3CA 1ZMTA 3VOSA 5GGYA 4YXWD 3CCUP 3UJBA 1R00A 4E07A 2QRMA 4IRUB 3E2PA 5C53B 2XOEA 4MO9A 3SXUB 5AVRB 3DT9A 1I6WA 5I8ZA 4GKVA 2CUKA 2HIGA 1FNDA 4JELA 1GPNA 4Q39A 1TPYA 4OKIA 2GK7A 1ZX1A 5JHHB 2H92A 3C3EA 3X1KA 5L3QB 2PKYX 3UMMA 2HW8A 3AY6A 5ER6A 4G5GA 4ND5A 1IEQA 4MUGA 2PZBA 4DM3A 3R09A 4RY9A 3V1YA 1J1DC 2BBWA 1SIBE 5CB8A 1B3RA 1NOIA 4NOJA 1IFXA 4ZZ2A 2FFAA 4EKDA 3KAJA 1M0TA 1YBHA 2XRZA 3EGXB 1E94E 3TZEA 4H3SA 4OYLA 2BSAA 4DC9A 5AI8A 1CDDA 3GMDA 2YQZA 3NIBA 2HY7A 2ZRGA 1XRNA 2CLFB 3Q3VA 1DKUA 3ROZA 3K4HA 5C31A 4DYDA 5BXQC 1MGPA 1SG0A 3C1UA 1E1KA 3N6XA 4KBGA 3WNDA 4GEKA 2XE4A 3CTPA 3CONA 3WWOA 3LOQA 1VYUA 1H2WA 2BFDA 1QSGA 2LCIA 4YV7A 3V9PA 3WZLA 5BSKA 3RSSA 4DUZB 4R2KA 3SOPA 3II6A 3JSVC 3RSHA 3EFGA 4ZCQA 4CM7A 1NNSA 2PH1A 4D4MA 5C1BA 4DMUB 1DAIA 1XYGA 5AYVA 4EHJA 2BEJA 1Q92A 2H3HA 4J9UE 1U7JA 1V11B 1WHSA 2WAYA 1IM5A 3VU9B 3KB8A 3LP8A 4TLMB 3ORFA 3Q72A 1E5LA 5JZOA 3N0RA 2R2GA 5DEOA 2R1VB 4N5MA 1KAQA 2F3PA 4CMBA 2D2VA 2PGAA 3T3PB 3RVPA 1QBGA 3BCCD 5AVOA 1RRGA 2BCCJ 3QSYA 1B3BA 1V48A 1GKKA 3H6KA 2ZEJA 3AR7A 4MR7A 1IEXA 4P3KA 1ULHA 2ZDQA 5HDBB 1LWUA 3A6PC 2OK8A 3B8EA 2LVBA 4UNNA 1A4RA 1VLHA 1L6RA 1KB9D 3RS2A 3LMKA 3CWBG 1R5OA 1D9ZA 3NG1A 4RWZA 2W83C 3PFGA 4FZ3A 4OFBA 2DBVO 4DHWA 4AULA 1TQDA 4QVGA 4JUAA 2CFSA 4KO2S 2BFAA 3GJ0A 1EUDB 1KYOE 3ZJ4A 4TTSA 2WI8A 2DWUA 1TECE 5CLQA 4BO1A 4ZYYA 1KRHA 4D6XA 1JPNA 3PQ6A 4J6EA 2R6DA 4HEQA 3UXEA 2PTHA 3OWXA 4HNVA 4UEWA 3RUPA 5KIAA 3D3KA 1W0KD 3ESZA 2C2XA 1S02A 3NYWA 2A1TS 2P2ZA 1AA9A 2P5SA 5AVSB 4ND8A 4Y1FA 4RTKA 1U9ZA 4WQMA 1V7ZA 4UOEA 2P2LA 3ER8A 3NFYA 4DJJA 4KL8S 5AW8B 2AGVA 1SC4A 4FJ2A 4W8GA 1MW8X 4HYEA 4CEIB 4RABA 3HBAA 4MDFA 2OKCA 3A11A 2DM6A 4RJLA 5L6MB 2ZQZA 4PV1C 3AEQB 4OH1A 1UC4B 4YMSA 1N2HA 3BTVA 2RJNA 1OE0A 1YS9A 5HEKA 1FTYA 1P74A 5G41A 4CDRA 1SQSA 5HCUA 1MT3A 4I55A 4L9AA 3A37A 4ESVA 4MRSA 1C8BA 3MK31 1K7XB 3GNTA 3GGJA 4ZOBA 4F86A 1KE1A 2CFTA 1ZK1A 2HCJB 1K4YA 3PNMA 5IKEA 5BT8A 1U7UA 3BSWA 2FYTA 4V3BA 4DWWA 5E4YA 1CI6A 3T9BA 3AUSA 2IEYA 3RSOA 1PCXA 1VL2A 4FHEA 2GVZC 4AMBA 2BONA 1SULA 1YZGA 3RVDA 1ZH2A 3UFBA 1EGHA 3CCCA 3URMA 4TMVA 2XXAB 4ZT4A 3WYAA 1P81A 5LM3A 5FD8A 5BMOA 4EF6A 4BBJA 5KNDH 3G2NA 1NT2A 3EPHA 4RSMA 2PRYA 2AD5A 4OOFA 5K3EA 4R3UC 3KQTA 4H7IA 1ODCA 4FZJA 3RCBA 1WCIA 3ZJYA 1GT91 1MO2A 1YH3A 1XHFA 3ZVNA 4TXMA 5DO9A 1GTJ1 3UH1A 2ZT6A 1N2EA 5EQDA 2KI5A 2IYEA 3AKEA 2PRRA 1MEOA 3H16A 3UA3A 2IDJA 4TMKA 2MWMA 2TMGA 5GP1A 3T8YA 3JPWA 2VJCA 3IUNA 4BTLA 2C78A 3BCRA 4G86A 1X7WB 3CRMA 2J5XA 2OXRA 1ETHA 3GEHA 2HRQA 3SLGA 3BWYA 2F2TA 1L8OA 4ZHQB 3D7LA 3GEBA 1TF7A 4OIMA 2X19A 5A4MS 1ZIYA 5DCYA 2CV0A 3C1TA 2O7RA 2CLHB 2IYTA 3TW6A 4BN0A 3CC2P 4TVKA 1EGVB 4YV0A 4KHPB 3RV3A 3H1KG 3LHFA 4LE0A 1QZ3A 4MPPA 5AVTA 3S2FA 4XVHA 3GT7A 5JD4A 5B2FA 5TISE 3KVOA 3PFBA 5CCHD 3AR2A 5ICCA 2GJSA 3G23A 3PVCA 3AHDA 4XI9A 1RQPA 3DVLA 4LQLA 3RO7A 4F3NA 4XFJA 2C4TA 3QMMA 3NJ8A 2VI5A 4LRYA 2CNBA 3NWJA 3BXHA 2QRVA 2IH2A 2YMPA 3C3JA 3HDYA 1VP9A 3W04A 5AW9A 4RTPA 5A7GA 4RZXA 4C7NA 2QL5A 4C6RA 4PWZA 3CFYA 5IYZA 3AE5C 3EBLA 1D1PA 3QKIA 3SCZA 4LYEA 3WLEA 2PPVA 1IBCA 1MB3A 5IT5A 2CXUA 1KYYA 4R68A 1W35A 4EB8A 1KZ4A 2N0SA 2XNDH 3EZ2A 4OLBA 3RQIA 4N5LA 3EXHA 3JARB 5DGXA 1A9QA 4QRDA 2CYAA 4YALA 2RGYA 4U39A 3L7OA 4TLEA 5LZ2A 3WTCA 5IT0A 1XLWA 1ZRMA 4Z0PA 4JBYA 3T54A 1TD9A 5DHFA 4B09A 1L4UA 3UB3A 1AKRA 3CLRD 2FDRA 1TXGA 4ZZIA 2WUGA 2Y1EA 1P6XA 1T91A 3U7FB 3O94A 2O3SA 4M76B 1FXSA 1W4AA 5CPFA 1ZXLA 3INYA 3HA3A 1TGVA 4RDIA 3ROGA 4E22A 3U1VA 3I9NA 3HYRA 3WGYA 3JYPA 4FBGA 3ITNA 1RPNA 2LZ0A 4ZYZA 1PF7E 1ZLLA 2CUZA 4NPDA 4R1TA 1QU2A 3F4BA 4OHFA 3JWGA 4R8MA 3ELDA 4HDRB 3TB6A 3PDCA 3TVTA 3CX5H 1J1EB 4YRFA 1VG8A 2QTNA 1D5CA 1L5LA 2YV1A 5CXXA 5K6RA 4DLLA 2V7QD 1ZW1A 3OZIA 1JA1A 3LC1O 3GJSA 3L6UA 4AZVA 2R68A 1GPBA 4QPNA 2BEQD 4LYAA 4JYMA 4BRUA 3A05A 3L75D 4C0AC 1ODFA 2G5TA 4QDZA 3RBZA 2PWBA 1TX4B 3KKMA 2A45H 1YGPA 4DWVA 4C0KA 1MLDA 1U1CA 2NUBA 1RE3A 2PLFA 3HA2A 4G67A 3HLYA 3LP5A 2RSLA 3KDAA 4Z0HO 5BSGA 4YGYA 4B17A 3STHA 3TOVA 1J0EA 5KNCA 1MV5A 3R5JA 1G0NA 1V5EA 2XNJA 4BKRA 5JWRA 1JFSA 1OFHA 3FF1A 4LDPA 5IASA 2DH5A 3ZWKA 1X7HA 1W0JD 5CCGA 3B5IA 1KK1A 4HKTA 3SC3A 3IAUA 5G1NA 1L0BA 4MICA 2ZSDA 1I2AA 3U4CA 1RRCA 4IJMA 3DOCA 3I58A 3AVQA 4TGLA 5LZ9A 2ACEA 1I51A 1JEQB 4OGFA 2QQFA 4KIUA 1TZKA 1EFVA 1CZNA 3L6OO 1AB6A 2DPLA 3IR5A 5BNTA 2Q1SA 1NVTA 3L8GA 4LI0A 2PR7A 1G21B 3ELWA 5AI5A 5HF5A 4MVWA 5EQFA 2ZVQX 1O6CA 1ZRSA 2QRLA 1VQ1A 3LW5H 4XX0A 1E9EA 3PI6A 4MW9A 1KS2A 2MMGA 1N6IA 3VV2A 2ZAYA 2X7XA 2P11A 1U2EA 2XITA 4CMIB 2E1PA 4V1CB 2CBXA 4R41A 5IAJA 2QTBA 1YRLA 2KI7B 4EOTA 2KWIA 1JE0A 3EC1A 3H9UA 2FOIA 4EO7A 2ZTSA 5EXPA 3C7CB 4HVLA 3LT0A 4Y9TA 3WLFA 1D6JA 3I2KA 4NICA 3C3KA 5CLGA 2GD1O 3ZE0B 4X97A 1J2RA 3L7CA 3U4AA 1BCCJ 1LSOA 4I4LA 1YFJA 4AJHA 5DWVA 1G8HA 2VXYA 2ZXUA 4W5TA 4WESB 1GIAA 2Z8XA 3UKOA 1JY2P 5JZBA 2FPPA 5KX5A 4ZV4A 5JE8A 3AJ8A 2YX1A 3HCNA 5FNVF 2ZCUA 3C4QA 1L0LD 2YWJA 3TEJA 1P2UA 5HCNA 4OQ4A 2VJPA 4L8GA 3C6BA 4YR9A 4PCUA 4EFDA 1U3VA 1IRXA 4LYFA 3H8JA 5EWLB 2ETXA 2DPYA 3DOJA 3HYNA 4Q3LA 4QULA 3H1HG 3E23A 5I8WA 2BGGA 6PFKA 4EL0A 1M8PA 3O0DA 4H1HA 2PKQO 1G5FA 4G8CA 2JO1A 1Q50A 1NMXA 2FPSA 1YDMA 3B6MA 3FYHA 2XLCA 3H1LJ 4FDMA 1WHTB 4Z9FA 2Q1XA 3IUSA 3M81A 4EGQA 4GO1A 3LKBA 4R5MA 4BO5A 2KOGA 2P0AA 5JCJD 4PNEA 1U3CA 2W58A 2GVDC 3B1JA 2BZ0A 2WFLB 1N7JA 4B8ZA 3QA3E 1KIFA 4W5NA 1QVAA 3SFDC 5H80A 2A1UA 2ZM5A 4NBTA 1XMQB 3UPTA 1B42A 3AV0B 2HJ9A 4YASA 1OX4A 1QS0B 4IAOA 3PJRA 2JLYA 4B8YA 4FWIB 3NAGA 1VDFA 4NNPA 1DADA 4AG6A 3PR3A 2BM0A 4PPQA 4WMLA 1TB4A 4DIUA 5KCMA 4BQFA 4NE9A 4GR4A 4DBLE 4Q9DA 1DX4A 1WXDA 2WT7A 1CE8A 2BV3A 4RVDA 3J81k 4OQQA 5CUQA 1NVBA 5E7IA 1IHYA 3SSMA 4KU4A 1LLQA 1VQOP 3FOBA 1HDXA 1YUNA 4ZYWA 4YDHB 2HC9A 2B3TA 4QM7A 1AUQA 5HIJA 3ABRB 1T5HX 4X71A 1DEAA 1NHWA 1DBRA 2O5RA 5AUQA 2EARA 4Q9AA 4RFSA 2JI8A 4DLZA 5APVA 2FZKA 2V1UA 2ZTMA 3O1LA 1S5LX 1C1DA 5EEHA 4N5DA 2PV0A 3M2TA 2HFED 3SZLA 2I6GA 1FFCA 1BOFA 4ZHQF 3AE2C 4F4DA 1S1CA 1JJVA 3FVVA 3OLYA 5DHTA 5CJ2A 3PRJA 2JZNA 2C9DA 2O3TA 2PLNA 1FDSA 1CUGA 4OFWA 1CVIA 4DPKA 1F0KA 3PUIA 2BGUA 4WZBA 4WERA 3IHKA 2XVZA 1VTKA 3FOFC 3KHTA 1KYZA 5E4FA 2IHZA 2BFOA 4ZYXA 3LO5A 1BJKA 3NIDB 2GD2A 3C6KA 4FS8A 4K9OA 2VK1A 4D96A 4UM5A 4XCQA 1ZESA 4N7JA 4YUVA 4CODB 2NP7A 2AI3A 3DBLB 2ZWOA 1IUPA 1TTQB 2VYCA 5FUMA 3T97A 3RRNA 5COBA 3DZKA 4YCCA 4LWQA 4MYCA 5KREA 3T52A 2VDUE 1ZJ6A 2EBUA 3D1VA 1CTQA 2QA5A 3TPFA 4U9HS 2ZJ4A 3MIZA 3VSBA 2JVKA 1WUHS 1KAEA 4I50A 1MIOA 1PQ4A 2CE7A 5LDHA 1CQPA 4W9NC 2DHCA 1NBMA 4B5LA 4OKSA 2ZSBA 1B16A 3PC3A 1SNYA 1SO8A 4HQLA 1RKQA 1FIUA 3PUWA 3L70D 1E7YA 3NHZA 1NT4A 4ER0A 2GN0A 4H1TA 1X3LA 4OK3A 1DU4A 2YXNA 1Y34E 2V4HA 1EIWA 1GA1A 4XYLA 3W6NA 2HGSA 3NYRA 3ZHQA 2ASEA 4K9RA 4NR0A 1LDEA 1QCDA 2IQIA 3M5PA 1OVUA 1GNVA 4FI3F 3I42A 2R5NA 3AEUB 3LDHA 3VC1A 3RWMB 4X54A 2AUTA 1KTIA 1JKXA 1NXOA 4Q03A 1U0BB 4IDFA 2VQDA 5AVUA 5D3MA 3UHAA 3ITKA 1BS1A 2FPXA 4A8JB 3OFNA 1YIOA 1NU6A 3NHMA 1T4BA 5DIZA 5K8VA 4XIYA 2NZXA 2VVTA 3O8LA 1H2AS 2X1VA 4A36A 2KZJA 4Y6PA 4LZZA 2A06G 4MRMB 3CSDA 1U0NA 2X4IA 2PBLA 4B6QA 3EEIA 7MHTA 1OX6A 4RA6B 3MQ2A 4BXOA 3T7CA 1T2VA 1TGYA 4RV4A 5BT9A 3GD5A 4GUDA 1N5DA 4C6TB 4M1KA 2V7UA 3FYDA 1QE0A 1SOMA 3P0RA 3RAPR 2JF0A 3SR4A 4MS1B 3O5AA 5KAFH 2ODEA 5B6JA 2G3YA 2JVJA 4WL0A 1EXIA 2ZXFA 3HKEB 3EMKA 2ZWMA 1H93A 3HR8A 4GLJA 4YMTA 2X41A 4CCSA 3P8CD 2ZJOA 3TGUD 2CMGA 1SKYE 2HMTA 2O8DA 2LXNA 1A9RA 4KVAA 2EERA 2KLBA 3MTDA 2QMYA 3PWTA 3DDOA 3QUSA 4L6AA 3PSHA 3QWAA 4IV5A 4O4JB 3R6LA 1E1DA 1L2PA 1F8UA 4V0OA 4HX5A 2NX2A 4E09A 1EX7A 3HV2A 3JAKA 2R8RA 2WTEA 5JSZA 3HKBB 3ZWPA 3BQ9A 4M60A 2KLUA 2DFNA 3ZCRA 4EYKA 2OR3A 4BO3A 3UW1A 1Q2NA 3H1JE 4BP1A 4FNOA 1IZ7A 1X38A 2BEWB 3CXHH 1S4XA 3RWOA 4ZVRA 2BKAA 2QGZA 2FPKA 4EF4A 4HBZA 5MN4A 4MAMA 1TA0A 3QE0A 4EHNA 4C1NA 2C59A 4L02A 4I3HA 1PYGA 1KTMA 1G5HA 3U31A 4V39A 5IKMA 1WD5A 5HKBA 3V46A 2V9CA 2PUCA 3OJOA 5DWQA 3QKRA 4RFLA 1JKJB 5CP8A 1JY3O 2MINB 2YW2A 1XZDA 2GBFA 3KQPA 4IJKA 1YZ3A 4UAVA 4WCVA 3USZA 3BORA 1ISSA 1W4RA 1NXSA 1YU6A 5EZSA 1NBOA 3DHEA 1UC8A 5JEDA 4BOYA 1RJGA 2ECKA 3OE5A 2R8XA 5BVGB 1QTNA 4UBLA 3FWHA 2H4HA 5J9FA 4OU4A 1NOHA 4ITUA 3ONEA 4UC0A 1ZD8A 3LX6A 2YJ6A 1D09A 2VJNA 4FVTA 2Y1OA 3FPLA 4BGIA 4NCBA 2FPOA 4Q5IA 1JQ5A 1UJ5A 2X14A 1WD7A 4LDRA 1EB9A 5EJ7A 3KUDA 4LGDE 2ZRAA 2O7SA 3V1LA 4G9BA 1YZFA 2XMSA 3E9ZA 3GMIA 5CK5A 1M2EA 1QYDA 3SS9X 2JI9A 5DU2A 3N6RA 1O8BA 4KC0A 4Z7NB 2G71A 3CCMP 1TEXA 1E77A 1D9XA 1HEUA 1MC1A 5EMNA 2ODNA 2CL6X 1PDVA 1AA6A 3TZQA 1QNLA 4JJ8A 4PHFA 2ZCJA 3Q7RA 2KNCA 3DQQA 1FSZA 3MWFA 4H6WA 2JI4A 4R51A 2YINC 3L7KA 1WKCA 5E6UA 1Y6FA 2AHRA 4UTPA 2YASA 1VCIA 3JPYA 1V16A 4YXDC 4S24A 3DE3X 4IKOA 2QROA 4JSYA 4CF4A 2WSCH 4TMXA 5B3KA 3TNUB 4OUDB 5TVGA 5DXFA 4TKVB 1SUFA 3EGIA 4L8FA 3G0GA 2PA3A 1QR2A 1DTEA 2P9HA 2QI9C 4IDGA 3TLXA 1X1SA 2W2VA 3KWLA 1J0AA 1R3DA 1J1DB 2B9VA 3H3FA 5DX0A 1SB8A 4LJ7A 1GARA 3HE5A 2DQSA 2NV0A 4U3JB 3ZW7A 4I4IA 2XCTB 5AW6B 4MH0R 2BJWA 5U4QA 2QM8A 1F5NA 4D4LA 5DHRA 1F0YA 1OTXA 1NUPA 3NHSA 3IUBA 1H2BA 3N6VA 2GXUA 2FG5A 1BX0A 2BFFB 5JAPA 1ZGBA 1UM8A 4FQ8A 3OIGA 3AM4A 2VHTA 1T15A 4Y18A 3JAWA 4DR7B 1JAZA 4BKUA 1T2AA 4WY4C 2PU7A 4DR2B 1VIVA 4PVDA 4DCMA 3DAPA 4RXMA 4BMYA 3WIBA 3QBVA 4FYYA 3IQEA 4DADA 3HTKA 1Z5OA 5IHPA 1LTKA 1QV7A 4US0R 3QI7A 1QF7A 2Q3FA 4IL5A 4HH4A 4PPNA 4D0GA 1GRQA 4W7ZA 4XGNA 3WYBA 4URXR 1FFBA 2FW7A 5TRTA 3P4UA 1UBGA 4D1YA 4QJ3A 4MI9A 3OCUA 1NMZA 4HZUB 4D4JA 4DQVA 2IHJA 2PT6A 4LHVA 2VL7A 2HYNA 3DPIA 1M7GA 2W7TA 5HMMA 3ZGOA 3P9KA 1I5RA 2ODBA 1M6VA 1K2WA 4UM9B 1CJMA 3SJ7A 1U2RA 3CZCA 3DOOA 4E5DA 2PGLA 1SBNE 4QRIA 4UCWA 2Q49A 4ESHA 3HDHA 4JBLA 3FOCA 3G1WA 4BE4A 2WOOA 2XTZA 1YV9A 1UMBA 2R4UA 2I1KA 4C4TA 1V9SA 4F5DA 5FAXA 1XIVA 2HCTA 1TJPB 1Z37A 1NWHA 2QNRA 3HFRA 3BGVA 3Q11A 1JDZA 1U8EA 3USSA 4EKEA 3QVWA 1SQQD 1HSOA 3MGAA 5EZYB 1WETA 1NV9A 1YFKA 1BVUA 1JEKA 3L0IB 3MINB 2BW0A 1J90A 4OBWA 1V6AA 1BX3A 1CJBA 4R9VA 1E60A 1GFWA 4NH4A 5KAIE 1N8KA 5DVZA 1SY7A 5A4JA 3DV0B 4WKNA 1YI8A 1RI2A 1L4AA 4B3MB 3FTDA 3RSGA 3OO1A 5J4HA 3H87A 4FCCA 1TLTA 1E4EB 3EQ9A 4NNOA 5A02A 4HDCA 3I9V6 3O2JA 2P1JA 3NGLA 3VGPA 4ZKDA 1OZHA 3O75A 2EF0A 1F48A 2DETA 1YB7A 2GEBA 3I5CA 1D4FA 5K8IA 2Y99A 3UEOA 5FTMA 3GF4A 1Z45A 4IS3A 3L5OA 2YJ4A 4MGEA 2EQ5A 1UANA 3DEYX 2BZSA 4PFJA 3E58A 3I6MA 1LQTA 3BCCE 4PG8A 1E7SA 3Q15C 1SPBS 3B1FA 3KUUA 1LRKA 2SPZA 1CY2A 2X9GA 2CN1A 5AT1A 4AIIA 1GAQA 1CF4A 1WTAA 4FZ5A 1KB9E 3AP1A 3AECC 2VDQB 3CLUD 3M34A 3UJ7A 4NHOA 4OI4A 2FPWA 3B53X 3ZD9A 1XL0A 1WCV1 1RD4A 5HUJA 2NPIA 4OMDA 1I1QB 4PZDA 4BZQA 2Y1CA 5AHOA 3NHBA 3NBKA 2QD4A 4DQ0A 2BWJA 4QXOA 1ZBQA 1P0FA 2ZRIA 4WBNA 1K0FA 4YRTA 5JXJA 1W59A 4IV0A 4UBNA 1XO1A 5AJTA 4UTVA 2QLNA 1ONOA 3ZZNA 4O0LA 4PFQA 1PU2A 1K04A 5CITA 1SCDA 2KLHA 2VTDA 4YRMA 3KOOA 3L35A 2JBHA 4TLFA 1PGPA 1DAFA 1OH6A 2ACKA 1K8XB 1NM5A 3MPUA 2SECE 1ZLYA 2DLDA 4UEKA 4OX9Y 2Q7DA 4Y2XA 3EF1A 3MQ4A 4A0GA 2DUMA 2PT9A 1JUDA 1I4OA 1VJ0A 2A45G 2RI0A 1AK1A 2XADA 1CY8A 1KPHA 1NY6A 1W9HA 1FFEA 5EYPB 3CUUA 3CX6A 4EABA 2KBEA 3N8KA 4DAEA 4C6HA 2OGUA 4NPFX 5NLLA 2ASVA 2IVZA 4JL8A 1PQUA 3KEMA 1O9HA 1XZEA 1XRMA 4NCIA 4GR5A 2WE8A 3LUHA 4CF6A 1W85B 1NIJA 3A27A 3PCTA 4NZ9A 5D5PA 4B71A 4ISCA 1SVNA 3DONA 3NZEA 3SIPA 4ARSA 5ILOA 1IHOA 3F89A 3CRVA 2DWOA 5HZMA 1II9A 2RHGB 3D0RA 1JYFA 1EVQA 1SC6A 1XEXB 4ND3A 1GU1A 1VMDA 3G6WA 5SYAA 4O4JF 1Q1QA 4MI1A 2V9PA 4PN3A 3S70A 5I7FA 2R11A 4OAQA 4MW1A 3KQQA 4YUXA 3I34X 4LSWA 1JX6A 2QEQA 4DLPA 4ZN6A 2L0XA 1GKUB 3ETDA 5D3QA 4PZLA 1SBTA 1E7RA 2P1RA 5IXJA 3H1EA 4A1FA 4DJAA 3S0JA 4EP1A 2FQYA 2OM2A 1DG1G 3BGOS 5HZHA 1QO7A 3AE9C 4QFCA 3OMLA 1N1GA 1FUYB 4XCXA 3E3AA 3ND8A 1NJGA 3PD1A 1H2ZA 5B36A 4QXAA 3SVTA 4A6DA 1TMKA 4Y2RA 4Q7LA 3UXMA 4QJ5A 3JASB 3RNOA 1SQVK 1WRGA 2XEXA 4ZV7A 2Y9MB 2I6QA 4L7VA 3T41A 4B2YA 3Q8LA 1DB3A 1EZVE 3IXQA 4MKXA 2MSCB 3GFGA 4X6UA 5YASA 2WPRA 1B1AA 3B5EA 1I6MA 4I7EA 3GT0A 4PBRA 3EAFA 3OH8A 4HNGA 4OQNA 5IUJC 2RHBA 1JDSA 3EIHA 4B31A 2VP0A 4HXEB 5LOVB 2AXQA 4GDOA 1A2QA 5FQOA 3ICVA 2VJAA 4BTVA 5KOHB 4QNRA 2I8CA 5D3KA 4JEUA 1GNQA 2JZOA 3M70A 2AOVA 5F76A 3REGA 3ZNNA 1UKBA 4BNDB 5TMEA 4LWPA 4AYXA 3L4EA 3NIWA 3USCS 3D59A 3FFXA 1KC1A 5FUWA 5I7SA 2E87A 1L5QA 2VYVD 2PY6A 1M66A 3O6QA 5BN4A 4PLTA 4H31A 1J42A 3PPXA 2H1WA 2FF5A 2QUKA 4G3XA 4B3CA 3EZFA 1ELOA 4D0LB 4NDNE 3ZE9A 5AVQB 3MJEA 2BKUA 3LGAA 4HAIA 4PQFA 3UFXB 2CZGA 3JY6A 4M55A 2DSNA 3WRYC 1XWIA 2FSVC 4ZO9A 5DSXA 3Q5PA 4P33A 3KIPA 1EA5A 1C7RA 4G1BA 3M4XA 3U1BA 4JLPA 2NTYC 1QG6A 3UM9A 2IE0A 3EHDA 5D3ZA 3VMZA 2BYTA 4FFPA 1UAYA 2DTDA 3QJ5A 2BOVA 3H11B 4BC0A 2G4CA 4AKGA 1X13A 2IY7A 1U2PA 4MULA 3V4RA 1L5SA 1Z2EA 1EDEA 4FEYA 3TB4A 2QRJA 4MQEB 3PL5A 4J0GA 3EZGA 5DZSA 3V4FA 1M1ZA 1J20A 4C2AA 4KYVA 3A2NA 3VI4B 5CIWA 4B7XA 2XF2A 5TQ0B 1GM5A 4OX9B 4RADA 3KZMA 2AKEA 2CUNA 5I5GA 2ENUA 2VHXA 2VJMA 4EW2A 1TTHA 4MYRA 4KW7A 3S81A 1Q2UA 1WMSA 2AJCA 1W5BA 4BNVA 3P9RA 2VF5X 5E0OA 1THZA 2KSEA 2AWOA 5ABPA 3BMNA 2DF8A 1QFYA 1N7IA 1P39A 2IOFK 1L0LK 1RBMA 1YE8A 3RU9A 1M2HA 4WSOA 1I2CA 2N9BA 3A14A 3G02A 2ODQA 1JSZA 4JASB 2O01J 3RASA 1S7GA 1BDIA 2OYRA 1LBSA 4C4AA 3G7NA 1CK4A 1STOA 4UUBA 5AJZA 3R9XB 3L75E 3QHQA 3NM4A 4YI5A 1A7JA 1H9BA 4CYMA 3QFSA 4PSUA 4J0CA 1R8XA 4LYHA 5IUNC 3W5HA 1U57A 2Z83A 3SZUA 4YJ3F 3ZGNA 1Q17A 2FSSA 3HL0A 2AEMA 2PAJA 3OWOA 2Y93A 4GDFA 3V5NA 1WO8A 2VJOA 3LW8A 1YU9A 5FV4A 5TQJA 5ESDA 3UVEA 2RGGA 3MJRA 3T15A 4AJKA 2J0EA 3GEDA 2DUNA 2CYCA 4DIEA 3HCFA 3SQLA 2QMZA 1FRZA 1ZN8A 1JDUA 2BFEA 4HDOB 2C4WA 4I66A 5H7XA 3DMTA 2WJ3A 3OFVA 5EZYF 4TVOA 3WISA 2ECPA 2HK8A 4MEBA 2BCJQ 3O2SB 2M6KA 1GAEO 5I7VA 4UASA 2D74A 4ETWA 4Z51A 4L73A 4JBGA 1CULC 3KXKA 2HDHA 2CMFA 1PT8A 4V1CI 2Y1KA 1TAHA 4BVAA 4MSUA 4KQMA 3DDZX 4Z9XA 4JI5B 3ED1A 3CEAA 1KQGB 1BJTA 1L5MA 1IDN1 3AR8A 1IL0A 2IPAB 2RAPA 2ZI9A 1OASA 3KVYA 3WC4A 5B1EA 1M2KA 3UB2A 1JWBB 2ZPUA 2WP8J 4XDZA 3GQBA 5HW0A 3DTVA 1FUUA 1IJBA 2QF7A 4EVRA 2IVFA 2UZIR 4C5AA 3V2UA 1LY1A 2QLTA 4GOFA 5IFLA 1JIVA 4DCCA 3QHAA 1AQYA 3U3MA 1TZ2A 5I9LA 3O1JC 1H2XA 4ZRDA 5DYWA 4E2YA 4EB6A 2IDMA 2DPHA 4LBWA 5KAPA 3FGAD 1ZGGA 4UHKA 1JG2A 3IRVA 4HO1X 5G3YA 3RV4A 2WAOA 5J2TB 5CDGA 4L1KA 4DLUA 2F9FA 2Y0EA 4FYMA 3ZDXB 4C88A 5HK8A 3D7KA 2VBGA 1ODIA 4TVSA 5BOSB 1MENA 2JJYA 2KJQA 2HPVA 1WSDA 2XZPA 2J08A 4EMBA 4AAYA 1SU4A 1GTL1 5J4YA 3MWDA 5DLEA 3TZCA 3OE7A 4RELA 4ZFNA 4OSEA 5K0TA 1X8XA 3LY9A 4MIOA 5FEMA 5EIBD 3WLHA 2BMEA 3DAHA 3KPEA 3E9QA 3VBEA 4CKWB 4UFNA 4WN9B 5AI0A 2PLWA 3KK0A 1UADA 4N0MA 5IXSA 3H13A 2FN3A 1L0LE 1AGYA 1CF2O 1KZUB 8GPBA 1SFCC 1E3TA 2LD4A 2AWNA 2O20A 4Z99A 5TF0A 1Z13A 2H1CA 4Q19A 3ZIUA 4LISA 3ZUPA 1PG2A 1T9GR 4UEQA 2I8DA 1K63A 2FCAA 3VC7A 1HGXA 3MJDA 1HQKA 1PZFA 4P98A 1T43A 1ZVMA 2P58A 1CJKC 2DR3A 5CHXA 4FONA 4JKYA 4Y0VA 2ZRKA 1NC1A 5KQRA 4U02A 3CVOA 1REQA 4FFBA 2JEEA 3AEZA 1GUFA 5BQOA 4M0EA 1GDDA 3CH5A 4CF7A 3WLKX 2FW9A 4HH3C 5LXTB 3P9NA 2J3MA 4CKBB 3U1TA 3SFZA 3RYTC 1N9GA 1GL2B 2HYIC 4BNZA 4FKZA 3CMAP 2FKAA 3U4MA 3D02A 1E1RA 3TD6A 1U0EA 4XPZA 1J7JA 3HE3A 5JXWA 2VAWA 3C43A 1B15A 1DQPA 2W8BB 3EZLA 4YAEA 1R0LA 1F6BA 5KTPA 1MMFB 3L0YA 3GX1A 1IQUA 3O8ZA 2B30A 4LX8A 5C8DA 2K3RA 4K9KA 3D6MA 2Q2QA 2AKYA 1OLUA 1GA4A 3KKNA 3NWEA 3BRCA 1EQAA 1CHNA 3RC1A 3QQPA 4EQ6A 3PCXA 2AC7A 1Y6GA 1C2TA 1SD2A 3OPNA 3MT8A 3Q7QA 1XNRB 4TV8B 1PFGA 2OKGA 2GJ8A 4L08A 3GPLA 2V3WA 1USEA 2H2WA 3O4GA 1H3FA 1Y1RA 2Q5IA 4OXKA 1ITZA 4C3VA 4RLSA 2XGSA 2C97A 1IY0A 3GROA 1ZITA 4HX9A 2W98A 1ZA2A 4EG1A 3NP9A 1I0IA 3P0HA 4C4PA 4IMPA 4LZLA 4XPIA 2VNSA 1PJBA 1KY2A 1Y1LA 4HVTA 4JU8A 3TDNA 4IL6H 2JAHA 3AJEA 3NT2A