1OZHA

The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
552
structure length
545
Chain Sequence
VRQWAHGADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLLDSSIRIIPVRHEANAAFMAAAVGRITGKAGVALVTSGPGCSNLITGMATANSEGDPVVALGGAVKRADKSMDTVAMFSPVTKYAIEVTAPDALAEVVSNAFRAAEQGRPGSAFVSLPQDVVDGPVSGKVLPASGAPQMGAAPDDAIDQVAKLIAQAKNPIFLLGLMASQPENSKALRRLLETSHIPVTSTYQAAGAVNQDNFSRFAGRVGLFNNQAGDRLLQLADLVICIGYSPVEYEPAMWNSGNATLVHIDVLPAYEERNYTPDVELVGDIAGTLNKLAQNIDHRLVLSPQAAEILRDRQHQRELLDRGAQLNQFALHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIARYLYTFRARQVMISNGQQTMGVALPWAIGAWLVNPERKVVSVSGDGGFLQSSMELETAVRLKANVLHLIWVDNGYNMVAIQEEKKYQRLSGVEFGPMDFKAYAESFGAKGFAVESAEALEPTLRAAMDVDGPAVVAIPVDYRDNPLLMGQLHLSQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Acetolactate synthase, catabolic
publication title The Crystal Structures of Klebsiella pneumoniae Acetolactate Synthase with Enzyme-bound Cofactor and with an Unusual Intermediate.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Lyase
total genus 199
structure length 545
sequence length 552
chains with identical sequence B, C, D
ec nomenclature ec 2.2.1.6: Acetolactate synthase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ozhA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ozhA04
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ozhA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1ozhA02
3O6QB 3EY9A 1X7XA 2HJHA 1BFDA 3FZNA 4V1CI 2BEVA 5DEIA 2DJIA 1V16A 2JI8A 1O97D 4HDAA 2VBFA 5HHTA 2O1SA 2BFFA 4D5GA 2AG1A 2G28A 4GM4A 1M2GA 1O96B 2PGNA 1RP7A 1YHZA 2YICA 5EJ9A 3AHHA 3ZG6A 1YD7A 2AG0A 1N0HA 3PKJA 2Q5JA 5K6TA 5MF6A 1OLXA 1OLSA 2BP7A 2JI7A 3CF4G 1W85B 4L3OA 1UPBA 3EYAA 3DUFA 1Q6ZA 2YIDA 4K9NA 1V5FA 2FR8C 1YHYA 5MGNA 1YC5A 2BFEB 4ZZIA 3ZHTA 3M49A 5ERYA 2EZUA 2JGDB 3EXHB 3EXEB 2OORC 1V11A 2C3YA 1D4OA 3EXFA 4K9MA 2OD2A 1PYDA 4K9LA 4D5EA 2QTCA 2BEWA 2W93A 3EXG1 1X7ZA 1U28C 1OZGA 1V1RA 4TWIA 2H2HA 1DJLA 2Q27A 3GLUA 1QS0A 4F4UA 2H2FA 4COKA 4JU9A 2EZ9A 4BV2A 2IHVA 3ZGOA 4X3PA 1V5GA 4V1CA 1QGDA 4BN4A 4JT9A 1YBHA 1PI3A 5I5EA 2J9FA 1M2HA 4K9KA 3RIMA 3M34A 3GLTA 4X3OA 3EXHC 4RMHA 4JUAA 2B4YA 3DVAA 4BVBA 4BVEA 2UZ1B 3AHDA 4KXVA 2IEAA 3EXIB 3LQ4A 2C3UA 5K3SA 3IAEA 1U5BA 4C7XA 5C4IA 1W88A 1R9JA 2Q5LA 4JSRA 2BFDB 4GM1A 2A1UA 2WVGA 5EJMA 4Y6QA 3M6LA 5HGXA 4GP9A 3LQ2A 5BWNA 1M2JA 1GPUA 3RIYA 1UPCA 1V1MB 2A1TR 2EZ8A 4FZ3A 1PNOA 3ZGVA 1L8AA 4UU7A 3AHFA 3PDHA 1ITZA 1WCIB 2EZ4A 3M7IA 5MFZA 1PNQA 1T9AA 2FN3A 2RH0A 2XTAA 4J1TC 2BFCA 2QTAA 1AY0A 5FYQA 2H2IA 1OLUB 1S7GA 1UM9B 2Q28A 2Q5OA 2UZAA 4KXQA 1PO7A 1DTWB 3DV0B 1UMDB 2H4HA 4K9PA 4UTRA 1X80B 2OO5C 2H59A 3JR3A 2H4FA 2X7JA 2VBGA 3AHIA 5EJ6A 5K2OA 3OE1A 1SZCA 1QPBA 3F6BX 1NM5C 5ERXA 3EXG2 4GPEA 2NYRA 1UMBA 4F56A 2BFBB 4BVHA 3ZHQA 2AXCA 1Y9DA 4K9QA 4JU8A 1PTJC 2XT6A 4UUAA 1X7WB 2VJYA 1U31A 1SZDA 4RJJA 4ZP1A 4O8ZA 2C3PA 2OZLB 1TRKA 1X7YB 4BVFA 2Q5QA 3HWWA 4FEGA 2VBIA 4IF6A 1MCZA 2BFDA 1NI4A 4Y6OA 3RIGA 3OOYA 2WVHA 2NXWA 2BEUB 1YNOA 1UMCB 1OZHA 4C78A 1M2KA 4RJIA 3D81A 4HD8A 4UTZA 2C42A 1X7XB 2VK1A 4JUBA 3GLRA 2BEVB 1T9BA 2E6KA 1E3TA 4JD5A 3F6EX 4K9OA 1OLUA 5DGTA 1J8FA 4UTNA 1UM9A 4C7VA 3AI7A 2JLCA 3GLSA 2BFFB 5EXEA 3AHGA 1DTWA 1MA3A 3EA4A 2G25A 4KXXA 2JLAA 3LPLA 1Q1AA 1X80A 4UTVA 1OLXB 3L84A 1OLSB 1Z8NA 1W85A 2VK4A 2BP7B 5EJAA 1YC2A 4R8MA 1UPAA 4GG1A 1U2GC 3CLRD 2OD9A 1EFVA 3AHCA 2PGOA 2BFEA 1PT9A 4WBXC 3AHEA 1ZPDA 3DUFB 3LQ1A 2JGDA 4BN5A 2C3OA 3EXHA 3EXEA 4JUCA 4Y6LA 1PVDA 4JT8A 3UPTA 1TKBA 2Y0PA 5HJEA 1U2DC 2O1XA 5D7NA 1POWA 3HYLA 1Q17A 1V11B 4FVTA 3EXFB 3D4BA 4BUZA 2BEUA 4FEEA 5EXDA 2OD7A 3ZHSA 4KXUA 2BEWB 2XT9A 3ZHUA 1X7ZB 4BVGA 5FEMA 2JI6A 1S5PA 1V1RB 2PDAA 4MPPA 3PKIA 5EJ4A 1QS0B 4RMIA 2R8OA 2FSVC 3FLMA 5EJ7A 4BV3A 1TKCA 4RMGA 5HYVA 4V1CB 2C3MA 4G1CA 4Q9DA 3UK1A 3CLTD 2J9FB 1XLTC 1OVMA 2UZ1A 2R8PA 1Q14A 3EXIA 2Q29A 4XEUA 1T9CA 3DVAB 4KXYA 4J16C 2IHTA 3E9YA 1HZZC 3ZHVA 5EJ5A 1POXA 4QPZA 4UUBA 4MQ5A 4I5IA 1B0PA 1U5BB 2H2DA 4MPRA 3K35A 5DGDA 1M2NA 5BWOA 3AHJA 1W88B 5I5GA 5K6RA 2QQGA 2JIBA 2BRUC 2O01N 1V1MA 4TWJA 1IK6A 1WCIA 2EZTA 5AHKA 1YI1A 1YI0A 1V16B 1V5EA 4RMJA 2QQFA 2FWNA 2R5NA 4L2IA 1EFPA 5BWLA 1YTLA 3FSJX 2WVAA 3IAFA 1TKAA 2IHUA 5I4IA 3KOMA 2BFCB 3DV0A 4GM0A 5EJ8A 2VK8A 1UMDA 2G67A 1NGSA 4JUDX 3U3DA 3HWX1 1ICIA 3CLUD 2C31A 1KEKA 2H2GA 4MZXA 1T9DA 2BFBA 3ZHRA 5IMSA 5ESDA 4KXWA 1JSCA 3CLSD 1UMBB 4QQ8A 3JWPA 2V3WA 4KGDA 1X7WA 4UU8A 2FRDC 1OZFA 5MFPA 2OZLA 1X7YA 4RJKA 4UTXA 3U31A 4KPUA 5I51A 4QELA 2PANA 3D7KA 4JUFA 2H4JA 2JI9A 1UMCA 4IG9A 1NI4B 3MOSA 4IAOA 4C7BA 4MPJA
chains in the Genus database with same CATH superfamily
4DJDC 3L0CA 1DT5A 3TDMA 1Q74A 3FFWA 2YXDA 4RQBA 1UKVY 3WGUA 5B4UA 3UC9A 4RD2A 3ES9A 1JXMA 2IYEA 4M9UA 4JQOA 4RU1A 4B48A 4C7RA 2FMXA 5TT1A 2PBRA 2Q6QA 1JTHB 1N2DC 5AP9A 5KYYA 1WUYA 4INPA 2QW1A 4DLKA 2PX6A 3DZDA 2GPAA 1AK2A 4AYTA 3IPAA 2WP0A 1Z25A 3PTZA 1J9EA 4RSRA 5LUBA 1HE2A 4TMYA 1Q6ZA 3DEFA 1XTGB 3HCBA 3PSAA 4NCXA 3ZW9A 1UODA 2AFIB 5I4KA 5ER9A 4DTCA 5DWQA 4UEKA 4IDBA 2HSZA 3NOQA 3SKVA 3L72G 2AOTB 1KJNA 3NDJA 3PJRA 1YQDA 4LRQA 2XOXA 5ALXA 1JWBB 1QCDA 2L5GB 2F3TA 3TF5A 4C7JA 1VE6A 4DC9A 3PHLA 2ATCA 4TYYA 2B35A 1QVAA 5DULA 2O1JA 5MDHA 1QGDA 1UOOA 1E2FA 3B82A 3QBJA 2W70A 3CGWA 4XXHA 3MWDB 5AXDA 3WTCA 4ZZ1A 1BA2A 2HMTA 1YR8A 2QYTA 2P4UA 3ZDYB 4ITRC 1BG6A 1W25A 3SE0A 4CV1A 4JB8A 4GM1A 4NPAA 3QVMA 4ZIRA 1ZIYA 3K0SA 3WS7A 3TZKA 2ZIEA 1AXGA 2EZ8A 3LPNA 1R8YA 5KPDA 3H1KD 1F8FA 3CC4P 5SV2A 5HK9A 4MQMA 3LJKA 2FFQA 4GZ3A 1MIOA 1KEWA 4HLUA 1KNQA 2UZAA 4TTVA 1SB9A 1NA5A 4YUYA 4YAWA 1I2CA 1MDBA 1HYEA 2H07A 1G2QA 3KXLA 1H2HA 2JHFA 4KLCA 1YKGA 2NU8B 2VG8A 3PXUA 3HCRA 4M0KA 4NBVA 4PAMA 5J2TB 1N57A 1AKVA 2ZT8A 3FKQA 4WNIA 2OV1A 1V5WA 3UWMA 2R86A 1Z13A 5B7NA 3ENQA 1ZRMA 4WEQA 2ISCA 3THYB 3I56P 3GWZA 3S44A 2GZSA 2ZAIA 4E2ZA 4LNUB 1B6TA 3QBEA 4B81A 1E1LA 3O5AA 2QLBA 3DMTC 3BRQA 4CLDA 3MHVA 4KAJA 5F5NA 3R09A 3HJAA 4MB6A 3RVMA 3WK5A 1J8MF 5KKZC 5FOVA 3C6YA 3EWKA 1UDRA 5EGNA 4PV1D 4TV8A 5TY0A 1Q7BA 4CM4B 4JI3B 1OBHA 3JQ9A 4OJKA 1GPKA 4WJZA 3LIIA 1Z5ZA 4Y99C 3L18A 2WKSA 2JF0A 1STOA 1SR8A 2COEA 4KIJA 5JOQA 4HGRA 4V3BA 2HQBA 2J87A 1IN5A 1G98A 3UXMA 1CULC 1AZWA 2C8JA 1RWPA 4MKHA 1OX4B 3CH4B 2R8OA 2V6IA 4P3YA 3N4XA 4PX2A 3ITNA 2G88A 1GUYA 1J42A 2J9FB 1F0YA 1E9DA 1YR6A 4JN6B 1MX1A 1Q14A 4ER5A 2YTZA 3OMLA 1XL0A 4FD3A 4QPZA 4CR6A 3WU2H 2WPSA 4ZFNA 4N78E 3T4PA 3E7PA 2OYIB 2VA8A 4HAVA 4D43A 3P7MA 5IN4A 1DAHA 2LR2A 2FUKA 4QVKA 2QGZA 2I1LA 2QAGC 1WCIA 4AZWA 1NBEA 3TW6A 2WIBA 2J7PD 1JR3A 5KOJB 1MOSA 3WDKA 2VS1A 1BYUA 4MW9A 2GN8A 4I9GA 5CIYA 2H6EA 1PZHA 2XOKA 1N2OA 5AVYB 5KJ6A 2AGVA 5AVZB 2V3WA 5FYDA 3PJSK 3Q2OA 4KGDA 3DTNA 1L5KA 3LYHA 3VDQA 4HWRA 1M8GA 3K0AA 2WJVA 3SEAA 1FRNA 2IVZA 5AW2A 3QG1A 4OGWA 1P7ZA 4PYNA 1NXPA 3KEQA 1VE5A 3HUSC 2D54A 3EFHA 1VJGA 2FPRA 4E3ZA 1XVLA 2R47A 3HM9A 3IBTA 4CXMA 2NZJA 1PR1A 1GR1A 3U4HA 4TLMB 1YD7A 5JCPA 4A0HA 2HLPA 2Y71A 4A9AA 4FNMA 1Z06A 1ZN7A 3LLVA 5DJTB 3I1FA 3M1AA 1KOLA 4R9RA 2EAUA 3OFND 3P2JA 2Y0BA 1JHXA 1YK0A 4M37A 5CB0A 1SQBD 4HO1X 3CXHH 1QJCA 2VZLA 3RTBA 2EEZA 1E1NA 1DAFA 3CJQA 3FHLA 4DNOA 3ZZUA 3HGTA 4YAFA 1AQJA 1RE3A 3H04A 3UAVA 4H6XA 3WLMA 1ZJYA 1C1DA 3GLTA 2O2EA 1ORHA 4BKUA 1RF0A 1J0XO 1IEWA 4YMGA 3GDFA 5ALWA 1C29B 4M36A 1VHDA 5KYWB 1F7VA 4G0ZA 3OZGA 4MW4A 1ECLA 4YAUA 3KZ1E 2BC9A 3PVZA 1W2GA 4JR1A 4EIJA 4TTQA 3ESBA 5JVDB 5HGXA 1MC4A 4IOMA 1JDBB 1WUIS 5ES3A 1ZIPA 4A3SA 1ZXXA 3QF4B 1XZPA 3KZOA 1V5IA 3JU3A 5G53C 5HKAA 3GRKA 3AEEC 3GJTA 4GX0A 1YDEA 1UIXA 3ZNQA 2NO4A 4GUAA 3G9TA 4LNAA 3MAJA 4RWEA 1WXXA 4C0SA 4WZAA 2F8LA 6PFKA 2JIDA 2ZCVA 4DM7A 3EN0A 1RHMA 1LF5A 1E59A 1X3SA 5AVQA 4HFMA 2IBZG 3G9ZA 2CKMA 3PS9A 2VYQA 5FR1A 3C97A 1UK9A 3AYZB 1WMBA 1PJ3A 5FOUA 3TKAA 3I2KA 3JTMA 2HA3A 4FSXA 5AW7B 4XIIA 2G63A 2B4KA 4M88A 3RT9A 1JEOA 3L0DA 3L7MA 4L0DA 2LXCB 3LYLA 2QZSA 2PKRA 2F55A 1PNVA 3MUOA 3TDNA 4C3ZA 5BXQC 1Q57A 4PR3A 2H4WA 2EKBA 1ZPDA 2FX3A 4XUDA 4WT7A 1SQQJ 4IBOA 3BWDD 3FYUB 4OH8B 4HQRA 3EXFB 1A97A 2O4CA 1E6UA 4G8CA 5KTRA 2IHZA 5AVTA 4BFSA 5EXXA 2XT9A 5EQJB 1E1CA 3L9WA 2F1RA 1BDBA 3OFVA 1B8PA 1THMA 2LCIA 1B2RA 3PT9A 5BSWA 1SQSA 1F2DA 1J33A 3BMNB 5DLDA 3QFSA 4MW6A 4Q7JB 1YS6A 5JY1A 4PJ0E 5CBPA 3O8OB 3CSSA 1NX9A 3DAOA 1FBTA 2ZUUA 1FY2A 2OV2A 3DP7A 3X43A 5ULLA 3EFGA 4DMHA 3FYCA 1IBLB 1BE3G 2ICAA 4FB4A 2PGXA 2VH2A 2QRXA 3EUFA 3UGKA 3MVEA 3ADPA 2PWZA 4ECAA 1IXZA 1JT9A 1SK9A 4JC4A 1ISJA 2REQB 5DB4A 4ER3A 5JZMA 2NVOA 4G3XA 1KOGA 2MSCB 3I23A 3RPEA 2QT1A 1RP1A 3T1HB 2XDQB 4XM1A 3DMGA 4HB0A 3ZVMA 1US8A 1ZMOA 1T5DX 4LX0A 3Q5DA 1USUA 4Y98A 3DKKA 3BFXA 2H2GA 6REQA 1NQVA 3VPDA 1ADCA 5A06A 4LXGA 1NW4A 4D0RA 4KHZA 3QMMA 4UU8A 3H65A 2KS1B 1J1IA 2GWRA 3UW1A 3LBAA 1PG2A 5BN4B 3RYHA 2FYUJ 1U5AA 4AURA 4GF5A 2IFNA 3QF7A 1ZD8A 2E5LB 2AZMA 5GADl 3LIDA 4QUIA 3IKJA 3HV2A 3OD1A 1NO4A 1A0OA 1TZBA 2M8RA 3MUDC 4RVFA 3L49A 4EO9A 5GTIE 2PCJA 1M2VA 1JR2A 4ACBA 1TLLA 1YE3A 3QU5A 1IY1A 1M8KA 4CEIB 1FFWA 1XC7A 1NSYA 4HH2A 1SK8A 2RI6A 4TTSA 2KP8A 5KJCA 4UDNA 2VH1A 4CW7A 5DBOA 4C06A 4E70A 1E61A 2X13A 3WLKX 4HN4B 3MGNA 1P8JA 1FXUA 5A9SA 5DK6A 5F2NA 4YVFA 3TZEA 1I3NA 4DJJA 4B1FA 4XOUA 5AW0B 5KVCA 2A9VA 2A9OA 3WP1B 2UDPA 3EOAI 4Q48A 1Z28A 1CRZA 4RZXA 4B2PA 3FE2A 1DO2A 1AQ6A 4P0QB 2WTYA 3S40A 1PI3A 3A3NA 1GKUB 3WGJA 3IPCA 1S2OA 3LX8A 1EA5A 4DCGA 1IIBA 1WZNA 1YBMA 2JAWA 3KOZA 2Y9ZA 1XMIA 3CHYA 2EKQA 4MB2A 2BFDB 1WLYA 4OREX 1GM5A 5CEEA 4PS0A 3COJA 3PVCA 4ZXPA 4CWAA 1ZFNA 3B6JA 5SY6A 4JGBA 2VXCA 5ALHA 2BCGY 4Q47A 4W9RA 3RYIA 3KJQA 3OZ7A 1PV1A 2WZCA 4HNSA 1BXGB 4YIHA 4KDCA 1KI7A 1ISHA 3R2PA 3FTPA 1KILE 1NRXA 5KJ7A 4Q03A 1KJ9A 4MI1A 4D6TG 2AOUB 2V5AA 2NQTA 1X2EA 4Q4DA 3GL9A 2X3UA 1QYIA 1DTSA 5AJVB 4YJ2A 1NNUA 3IOMA 2J9RA 3HUEA 3LCVB 4WFJA 2PVCA 4H0CA 1SVKA 5TVGA 4NJMB 4DUZB 1QH8A 1K8RA 2D1QA 3VNVA 3ER6A 4EFNA 4D25A 1N0VC 2FW7A 3IAOA 4PBTA 5AVVA 2XD4A 1J0BA 3IHTA 2QQ0A 2ZJ8A 4IX1A 3CWBE 2D5BA 5JH7A 2YASA 4MXDA 1AA6A 1DV1A 3HL4A 3L1KA 3GT4A 1RMYA 3B48A 1OLSB 5GVRA 2VN8A 2ISQA 2BW0A 1ZK4A 4FJ0A 3EBOA 3O84A 2D1SA 3IULA 3LXMA 3HCAA 2ZWPA 4CLXA 1DRVA 2YINC 1XK6A 2CN1A 3BTOA 1E1QA 2H7YA 5M2QA 4E5PA 4MR8A 5APUA 4LOIA 2K9JA 3ORFA 1OIWA 2YKQA 5CYGA 3EHEA 4HQKA 5GV8A 4NP6A 1Y5MA 5IUNC 2GHRA 4XCXA 2P5TB 2CNBA 1Z6YA 3UMVA 2WE7A 2ZDHA 4LGCA 1EVZA 4G5GA 4BXOB 2XYHA 4XIFA 1V48A 4KNVA 2BUAA 4ZV4A 3AY6A 5AKHA 1MT0A 4JQCA 1ZXGA 1Z2AA 2NX2A 4D02A 5DVZA 2IP1A 3TCNA 2C57A 4UTOA 3LYUA 1LWNA 1UFRA 1U3GA 3V4LA 1R15A 4QUAA 1SKYB 1GD1O 1H6CA 3HDGA 2RG1A 3KYJB 1U81A 4H7DA 1K1EA 3CVYA 1V37A 1BE6A 1QQ6A 1QIKA 1NVFA 4JKYA 2R7AA 4WN9B 5HKOA 4WK4B 1XTVA 4HN2A 4KKXB 3EOBI 2VNKA 2ZRPA 1YZ3A 1BCSB 5DNEA 2JZNA 1EK5A 5CAEB 4GOFA 3I5XA 2Z8YA 3H1PA 2O2XA 1GT6A 4YP9A 1N2CE 1RTTA 5CVTA 2C2GA 3WGZA 3AEGC 1G20A 3FPAA 4MWZA 2CT8A 4JB0A 5FOTA 3ADBA 3ZCUA 3OHSX 3VPXA 2GRUA 1JB1A 4AXXA 2DGDA 1TYAE 2JBAB 3ZD6A 4I7EA 2QSYA 4POAA 3ZCSA 4TTAA 4MUAA 2IHYA 3RC9A 5AHWA 3M5DA 4TWBA 4BP3A 2R8EA 4N5NA 3SN6A 4ZHSA 2OP0A 2HNAA 2YFKA 3ND5A 3P2KA 4D8VA 1UOQA 3QX3A 2VI5A 1RM3A 2ZR7A 2KW5A 2YIDA 4CV2A 3D0KA 4RY8A 5EE9A 4IO0A 3VZRA 4O08A 3VR1A 4OM7A 3CBQA 3UG7A 3VNRA 4X7RA 5CM2Z 2GJSA 1RQRA 1XDZA 3HCPA 3JAKB 1S9KE 1AMUA 1X8JA 2WSIA 3OT5A 2I03A 2AN9A 3MILA 2P75A 1FYEA 4Z3KA 4ZI7B 3VKFA 1CE8A 2J67A 5TEWA 4FWBA 1HNWB 2O3SA 5BVGB 3S8EA 1GPAA 1EK1A 4LK3A 5DBEX 1Y0BA 2ZB7A 4QYIB 1DUVG 4G0VA 3KKQA 1WY7A 4DLLA 4L6CA 1FQJA 2KHZA 1V6CA 4H3KB 2JJ2D 3RHSA 4BJHB 4AQDA 2XRYA 4GPZA 3RIEA 2QN8A 2XMCA 4EKEA 5HEKA 3WV4A 3LBFA 4LFBB 1N2BA 2REBA 3IHLA 4CTMA 5HUQA 1U0JA 1NT2A 1YJ5A 3EB9A 2GBCA 3GXBA 1L8AA 2Q3BA 1FRQA 1S4QA 1ZZGA 2E48A 4NDNE 4KX3A 2OYCA 3A6DA 3VKWA 4NXMB 1N8NA 4RVOA 2KWIA 5KKCA 5AVSA 4G67A 2CXRA 1KRXA 1GTVA 4DMLA 2WAYA 3FTNA 3MINA 1O1YA 2BL4A 3IEUA 5CT4A 1VZ3A 4BNYA 1K6MA 3KQQA 3M9WA 5DCUA 1AHHA 4WA8A 1ZCZA 3Q5GA 2OYSA 4JJGA 3PQFA 3LUBA 1DT3A 3PH0A 1L0LG 2R6HA 4LZNA 4BQSA 4WINA 5HUHA 2BDUA 5DSZA 4XQGA 4TRNA 3N8IA 3LT4A 3B1FA 3EPKA 1HFJA 2SKCA 2P4HX 2OBMA 3L71G 1E5TA 2Q7CA 1DTWA 4YJ3B 4KXXA 4H7HA 4ZU1X 1ZDMA 1SQPE 3KD3A 4PPGA 3SMQA 1XLUA 3IJEB 3RUFA 3Q88A 1CQWA 4LF5B 1C7IA 4GX2A 1H6AA 1Q11A 3TTWA 1II8B 1FZTA 1ZGBA 2OD9A 5KCZA 5KAPA 4F8EA 4TT3A 5AI5A 4BEWA 3SIWA 1JEAA 2E7ZA 3GY0A 3CF4A 4ZOLF 2AOWA 2PA3A 3ZQJA 3QPBA 2H92A 2DUNA 3K8YA 1GRRA 2OB1A 4HXEB 4MUMA 1KSGA 4MH0R 1JDNA 1WRGA 3L7BA 3STTA 2ATIA 1Z6ZA 1Z88A 1KL7A 1U3FA 3MOGA 3F6YA 4Q7MB 2O6LA 1E4EA 3HVIA 4G5YA 1TF2A 3UJPA 1OFGA 1M34E 4LHXA 5KKZB 3TW8A 3QMWA 3B9BA 4JBGA 2DWUA 3ST7A 1FZQA 3Q41A 1S2MA 3QV1A 4C88A 4LI0A 1G59A 5G4KB 4MDHA 5CNIA 3GGPA 3REFA 2X7XA 1NGMB 4C22A 4ND4A 2XTMA 5AK4A 4MRRA 1SJ9A 1XMPA 3G2OA 4MA4A 2BM1A 2OAGA 3AOEA 2VJPA 3PL1A 2GXQA 4G0PA 2BVNA 1M6HA 4U3FJ 2NVBA 4WLVA 2NM0A 1L0NJ 5JG7A 5CD1A 4H7KA 1QCCA 2HF2A 1TEZA 1IHXA 1KPHA 2CSXA 2X0DA 1JZTA 3HCWA 2D06A 5IUJC 3C45A 5REQB 4UNQA 4QLOA 4C9BA 4NG5A 3IPRA 5I51A 3DE2X 1FUEA 3CZ9A 3HN2A 4E14A 1SXIA 1DQYA 2RN0A 4IAOA 4C7BA 1RXWA 2BSQA 3PC8A 3R9IA 4RTSA 4OHFA 5J1SB 2QAGB 3K9FC 4OMFG 3V7NA 2WUGA 5CFZA 4G86A 1FC0A 2W6IA 5JSZA 3OEWA 3W2FA 5BT9A 2ZSKA 1RZUA 4W1PA 2OBLA 1EBFA 4RD0A 1JP7A 3L1HA 3Q8WA 4ZO4A 2XEDA 2YXRB 1ZOYC 1YHYA 3GLMA 3NKVA 1UFQA 3EXHB 2YW9A 3DOCA 3WUUA 2D62A 4IJWA 4H0FA 1UKEA 4M38A 1CJVC 4JJ6A 3IDOA 4I55F 4KUHA 1J7JA 2E82A 4BLOA 3SC4A 1EBUA 1R16A 1T43A 3FGAD 3ZTTA 3HUSB 1KI3A 5KSZA 1U1EA 3ZGZA 3L7JA 1EXVA 2BTQB 3VPSA 1CSEE 3ZVNA 1A8PA 2HJWA 2BMAA 721PA 1D5CA 4PZPA 5CG1A 4GBJA 3SHVA 3U1CA 4M0EA 1MVOA 2AR9A 4V0QA 2YVKA 4C0WA 3B1WA 2ZIUB 3DDNA 3SVZA 3ZTYA 4QGHA 3ZV6A 3G5UA 3M81A 3LCJA 1CUCA 3E61A 3EIWA 1QVVA 1TT5B 5JYBA 4X41A 4NPFX 3TTYA 4FFRA 4M86A 1JJFA 3VP9A 2MJLA 2Y3IA 4IM7A 3GLIE 1PK9A 3AB3A 5BNTA 1E5DA 5GAJA 4IIJA 3O21A 5T64A 4LNHA 3TIIA 4GSLA 5LQRA 2C7GA 1GYPA 3NGMA 3L73E 1NMYA 4H0LC 5BU8B 1XX6A 5C35A 3ABZA 3H5VA 3OAKA 3ANYB 2HMUA 3QV2A 2JGNA 3MGKA 4AJNA 1XP5A 2WJYA 2VBGA 1E0AA 4QHSA 2FXIA 3F6BX 4JNKA 4QLBA 3EQZA 3O75A 3SC6A 3UOAB 5FBWB 4WY4A 3GHHA 1E9CA 2PUJA 4MUBA 1X7WB 3AZQA 1SZDA 2FH5B 5A1TA 4JMLA 4EG5A 3LIPA 3A05A 3CX5D 4NS1A 4A16A 1JRLA 2EWMA 5JRZA 2E75C 2KNCB 4K35A 3R3UA 4G2TA 3BH7A 3UN1A 2FWRA 4R8RA 3OZEA 3GLRA 3O8RA 4S24A 1XEAA 1JM0A 4PLZA 3EQ8A 2BFFB 1NVXQ 2B2CA 5FUQA 4E07A 4G2NA 1EFKA 3LV8A 2C98A 3C39A 1J2JA 1J1ZA 3LHFA 3MUFA 1P5HA 4OXYA 4E2WA 4B3FX 4GMKA 1CP2A 1FX1A 4J3FA 1NVUQ 4D3ZA 3S2SA 3IL2A 2W6PA 1JO5A 5D7NA 3KM0A 1JKIA 4RA9B 1X86B 4HK4A 3MJEA 3UMBA 5F2KA 4CCWA 2WZBA 4DE5A 2QORA 1QGOA 3EDQA 3DCIA 3RBZA 3DPUA 3EDCA 1M0EA 3QX9A 3ROMA 4L9AA 2I80A 2HLDD 1PZXA 1N7SA 4ZA2A 4FC7A 3VU8A 4CM7A 2TMYA 1CJUC 1O5OA 4KVAA 5CLLA 1I1OA 3NM4A 1NOJA 4JGIA 4URZR 3DFKA 4CTJA 1F06A 1E7QA 1CW2B 3FZQA 2AKYA 2J45A 1KYOE 1KIFA 1A4UA 1LTBC 4XZ3A 3K70B 3BMQB 1MO3A 3DB2A 3DTVB 5KLVJ 2NTEA 1G8PA 2ZRAA 4CJXA 5G40A 1A02J 4WZAE 1NTZK 4MAMA 4RABA 1VHQA 1TCUA 4ITVA 4NVRA 5HCNA 3B5EA 4BRUA 2J0SA 4ZC1A 1XCJA 3NT5A 4XH9B 2HPCA 1IBCA 3CLUD 1AB5A 2Q1XA 4C7NA 3ZHRA 1Q2NA 1FTGA 2OHIA 4HQNA 4IICA 2XZOA 1D4AA 4ZVQA 10MHA 2QG4A 1KI4A 1AX9A 1VQPP 1JAIA 1FNDA 3TRDA 1P0QA 4IL6X 1D6JA 1ADJA 1XAJA 3RC7A 3C8MA 2CPSA 5FUXA 4U7TB 3QG5A 1RZ3A 3D6YA 4YC7A 2OLJA 2JI4A 4WXPA 1AQTA 1E9AA 4KDRA 4LWPA 1Y81A 1P4AA 5GIOE 2RC6A 3FWLA 2XZDA 2X23A 5TQ0A 2B6NA 3O8QA 3BGOS 4QX6A 3AERB 1OPXA 1W85B 1ZVVA 1H9BA 4Z0NA 5AKZA 3PHGA 4ZZIA 1AS3A 4WZ6A 3TIFA 1XD9A 1ULZA 3OZVA 4KH0A 4B4OA 3DAYA 2EEPA 1XZNA 4CQMB 1N7GA 2X1HA 2A6PA 3AX6A 1XVTA 3JSAA 4LJRA 2JRLA 3NV7A 4BKRA 1LRJA 1OIXA 1GNPA 4CUZA 4B2LA 2VF7A 1WD5A 4H16A 3LXUX 3HTKB 1KEEB 2UUOA 2WF7A 2NV2B 5GONA 4BCDA 2H7XA 1AKRA 3EPLA 1YQWA 3LQ4A 2P40A 1LSUA 9ATCA 1GKLA 4KYVA 3ZW8A 1UZAA 4WLFA 2BDEA 2W2TA 2HEIA 2ODEA 5E7JA 1KJ8A 3WLSA 2ZIGA 4I6MC 2X42A 1J49A 2QMZA 3T9BA 2PKQP 5FHQA 1X0TA 3TEMA 2A1TR 4L22A 4ZO9A 2CVFA 3X2EA 2Z83A 3VUEA 4J1TC 1NFQA 4MWOA 4JLWA 4RHEA 3FKSD 1VQOP 4YV7A 4MHOA 3D59A 4MA0A 4YMSA 3CWZA 4YXFA 5DEOA 1P4GA 4Q24A 1DOZA 3GVXA 3HP4A 1OE0A 4ETMA 3EUWA 3KQYA 4R8KA 1DO8A 4EUEA 1I4EB 3UK6A 5J2UA 2P6NA 4CLHA 1WDKA 4HD8A 3CKLA 3C3YA 2DF8A 5BMVF 3THRA 1GNTA 3KCNA 3E53A 5JJIA 3MCUA 4O5AA 3SLKA 5BSUA 1SCNE 1U9ZA 1ZOPA 3U37A 3KVRA 2AK3A 3Q3IA 4W5HA 4LF9B 1U2GC 4NK5A 5BSHA 1P3Y1 2UUCB 3G79A 2ZVPX 1KILA 2Q49A 3CM0A 2RIPA 2DQSA 3WGKA 3PFKA 4MVJE 4GWKA 2HPAA 1W75A 2FA9A 4IUBS 1Q21A 1SD5A 1PS0A 3DO5A 4ZCTA 4DUGA 4E51A 3DWGA 5JSFA 1P31A 4BATA 2XB8A 2QUHA 1IRIA 1KQFB 1S9DA 1TPZA 4EOTA 5BMOA 5I7EA 1QV9A 1G19A 3HKEB 1S2NA 3BKWA 1R0ZA 3AUUA 5D2CA 4TQAA 1JR6A 3BD9A 1UJCA 5H5JA 4PG4A 1K6EA 1S3FA 4KMOA 4D96A 1SLQA 1BE0A 4EEKA 5JRDS 4KTVE 4M54A 3UTDA 1G3MA 3FOBA 1YS7A 3WXBA 5BNIA 5DKFA 2FHPA 3ZDRA 2AG6A 3MJFA 1KK0A 2PEYA 4HG2A 5JI2E 3UGQA 4JC8A 4K7JA 2WNIA 2E55A 5T4FA 1ELOA 1UBNA 2X2OA 1GD2E 3CW9A 2CFTA 2GO1A 3DLPX 4K81B 4BNDA 2EFEB 3KT3A 2KB7P 1HA3A 2ZTHA 4BZQA 2XYQA 4DG5A 5IAAA 1RE4C 1VCOA 4ILKA 1OSNA 5BVHB 1V6SA 2IYLD 3SWFA 4BNUA 1U7PA 1SCQA 2J4CA 2YOFA 2J3EA 4KV9A 1SVWA 1EUCB 3EFOB 4Q02A 3LD9A 1TJ4A 2CLIB 1E7SA 2G9QA 3GNTA 521PA 4AIRA 3L1VA 2FSHA 2C04A 2FPSA 1YFJA 3CZQA 1O94D 3FETA 4IXWA 1RXEA 2EBFX 2P91A 1D6NA 4F3KA 4WEOA 3JYPA 4DCCA 3A1DA 3S27A 2G1JA 4PSUA 1T3TA 5JYCA 2YV1A 4CI0B 5AR1A 2ZM5A 4HC4A 1F2UB 2N46A 1ACJA 4YAIA 2F8SA 4A0RA 4IFMA 1LJ8A 3GGCA 3SFZA 4F3CA 2C9MA 1U9JA 3SWYA 5LJIA 2EGUA 3KOOA 3EIUA 4QULA 3DVSX 4P54A 4FLFA 3E1IA 1G0NA 1P44A 1N2CA 2H1WA 3DHVA 2WM9B 3CONA 1OFTA 3GGDA 4JJEA 2G5PA 3A58B 3TWOA 3M2TA 4MYSA 3GLUA 4BC1A 3EVBA 3RQSA 2AA3A 2O59A 1KDYA 2IYOA 3ZN2A 5TIIA 1UANA 3TMAA 4C2UA 1BKSB 2P6PA 2W5UA 3V4ZA 4JDUA 3BRWA 1ZMBA 1M5UA 4KO4S 1BSHA 4E94A 3WZLA 1T8SA 5A3SA 4X64B 4HAIA 1ORVA 1BVRA 5C8YB 1M1YE 5TPWB 1U0RA 2QZJA 2G0NA 2QX9A 3DBLA 3DE3X 4RSMA 3FOAA 5EJMA 4J1SA 3WWYA 4NZOA 1EM8A 3H2ZA 3I28A 3QKWA 2NUBA 4BMXA 1J25A 1M0WA 2AF3C 1PX0A 1KYIA 1JHOA 1DB3A 4HDNA 4C29A 2XNSA 3C3XA 3KKZA 3RVRA 2OO5C 1I0IA 3MLAA 1C4KA 1WG8A 3ICWA 3GP8A 1SZCA 3H2GA 4H1VA 4GSKA 3G71P 2K6GA 3UWKA 2D74A 1UIRA 2A8YA 2FLVA 4MV6A 1DP4A 2R60A 1V41E 2GILA 1TFRA 5L4LA 4MKRA 4N6JA 1E18A 4XYMA 3C98A 2WKWA 4OL9A 1W5TA 3MBKA 4ML3A 1W2WB 5HJ2A 4PM4A 1FFXA 3SZRA 2C4VA 1QX4A 5I7VA 1OAAA 3ZD8A 1TMKA 3LFUA 2IZ5A 1MGOA 2OXRA 3RG8A 3D4OA 5DU2A 4IL6E 3ZQ4A 1ENPA 3QJGA 4ER7A 3NOVA 1P2VA 3QLUA 2DPXA 3MBIA 1D1QA 1LPSA 1CUFA 4ZYUA 2VK4A 1C8VB 3L4JA 1QVZA 3JYLA 4QQRA 4I1OA 5EAIA 1WW2A 2JC3A 3CEMA 2RGDA 4LYDA 3VKHA 1XU9A 1SCUB 4PRYA 4ZQEA 5KYXB 3KT8A 4A2PA 3K9LA 5K6AA 1W4ZA 2VNSA 3HEAA 3ZEIA 3CNLA 1WV1A 4HHEA 3FPHA 3BL8A 2OV8A 2ONZA 4FFWA 3I52A 3Q5EA 5IYZF 1YJBA 1IDN1 4RMIA 3AKCA 2J3LA 1E5WA 2PUGA 1WF6A 3EMKA 2VPZA 4KL8S 5CLJA 3UOWA 3E81A 5AVXB 1ZJ6A 3O8BA 3HYRA 4PZZA 3V8MA 4FYPA 1YR7A 3LVBA 1J00A 2E3JA 3RJZA 2B83A 1CY2A 1LTTC 2VQ3A 1BE8A 1HKHA 1CP3A 1E5XA 5AXBA 2C54A 4RV4A 5CX1A 2Q3LA 1U6JA 2Y1OA 2FUG1 2MSDB 4YRAA 1JJ7A 2R8XA 3UJAA 1TZJA 3VR6D 2FWNA 3JQAD 5EIEA 5HM8A 3QH9A 3O3OB 3KOMA 2Z2JA 4PC3A 3D6NB 1PLKA 2WPVB 1IG3A 2XUZA 3KS9A 3IDSA 4PNEA 4HKZH 1KAGA 2WIJA 4CMBA 3KKNA 2C4TA 5AVUA 5GJCA 1I3CA 4OHZA 2JASA 3LAWA 1GV1A 2YMPA 4LBVA 1M7BA 4AP6A 1GZVA 3ZE1B 2A0UA 1CZLA 3S2ZA 4RJKA 1LDEA 2W4MA 2J3IA 4ADSG 5K0GA 4EUNA 3H1IJ 5E79H 1Q1BA 3WNCA 1J8VA 4RF3A 3LNTA 5B7PA 1HWYA 4UB6E 2J3HA 1H5UA 4EIWA 3MEQA 1M34A 1Y4AE 2WD7A 3KU4A 1UZUA 3HB5X 2FE4A 4L27A 3ADDA 1CS4C 3EVGA 4RD6A 4Q6BA 3HABA 1NYLA 3L07A 1H3FA 5MN5A 5FR2A 3ZV7A 1NE7A 2ZU0C 3EDMA 3LT0A 4ZQFA 4QPNA 2RFLA 1UIMA 3L0YA 1QHYA 4FHFA 3THXA 4NCIA 5HTOA 5BUZA 1O57A 3O4JA 4WCFA 4Q4AB 1DKQA 2HJSA 3GN2A 3PC3A 4MIOA 2Y66A 5KIAA 1GSHA 2R4TA 4G0NA 2IYWA 4HOYA 4ESHA 4IWXA 3ND6A 3M2PA 2HF9A 4S1VA 1CD5A 2IIBA 1FVFA 1I6MA 1ADYA 2C9DA 3QKSB 5I8PA 3SNHA 2BZGA 1JMMA 1WMDA 1D9ZA 4BBAA 2QOEA 2JVJA 4M4SA 4CIXA 4AZ3B 3AEXA 2GS9A 1I2DA 3V2UA 2NPFA 2O07A 2AJLI 2ZUEA 2CB9A 4HCJA 2DHEA 4MV5A 1NLFA 2EHJA 3BMXA 2ZBRA 4IIXA 3EW9A 1TTPB 1Q44A 3AM5A 2FPXA 1Z0FA 1XDGA 5CHXA 2N9BA 2FFDC 2ZEJA 1U8FO 1G3UA 2QRMA 3ANTA 3KWLA 3H05A 3UAGA 1SUFA 3V1NA 4IXMA 5DXAA 3O7MA 5LP6A 1PWEA 4Q34A 1JNMA 2AFIE 2PZFA 1PN3A 2I8LA 3BC1A 1C7FA 1Z5UA 1M33A 2F64A 4K9PA 1W52X 1YTUA 1KSHA 4YP6A 2PGJA 2WF8A 5T3YA 4RF5A 1A95A 4NFYA 5K0FA 2EGHA 2WHEA 5IAKA 4PZLA 3ZYZA 2A1IA 3H18A 5F77A 3LP5A 4OGQD 1OWNA 3TGPA 1P60A 1VLQA 1TLTA 3QE9Y 1X7YB 4BO3A 4RH0A 3SK0A 5EE0A 1MAWA 1KPGA 5JALA 3RK2B 3QSGA 3E1GA 3JY6A 3BAFA 4WFIA 2KSQA 5CLGA 2PH7A 1AK1A 4QBFA 3T5TA 1JHPA 4PIMA 3B36A 2Z43A 1CEXA 1K4KA 3A9UA 1UP4A 4DJFC 4MDEA 4CKWB 3BICA 4AYXA 4OHUA 4L8LA 4XUEA 2P9EA 1O7JA 4I1VA 3GLIA 5J5VA 3OQIA 1JLLA 5BWBA 3ETCA 2C4UA 2REOA 4G25A 1GCIA 5K3BA 4KAXA 3WKDA 4EG1A 1HQYE 3EIQA 1XRRA 1I7DA 3T5GA 4XJSA 3Q0EA 4C0JA 3RU9A 1V35A 4BVJA 1E3WB 4QUDA 4YA6A 3IAAA 1NTKK 3HVHA 3ASVA 2JLUA 2HWKA 4AMVA 2B25A 4DF3A 5DASA 2KBFA 1NTME 2KIKA 1XPOA 3KR2A 3T1OA 1L8XA 2GJ4A 4MMXB 1QGUA 3F7TA 1TX4B 1A5TA 2H5EA 3KYIB 2B61A 2QSZA 1JXOA 4TV8F 2C1EA 5I9BA 2ACWA 3N5CA 3HBMA 1KY4A 1ZCFA 3HYSA 4YT8A 3JD1A 4B82A 2OORA 4GKAA 2I71A 1ZMTA 3JVUA 5LZ5A 1N36B 5C5DA 4QM7A 3ONFA 2ZRDA 4FE7A 4JLMA 4I3HA 1YRHA 2F43A 1VBMA 3EZYA 2EYUA 3I3OA 4MP6A 2LCQA 1B0ZA 3B8EA 5F3RA 2WSBA 1EXMA 1H2XA 1P2FA 4YY3B 2JP3A 1IG0A 2JAXA 1Z22A 4IHAA 4I1IA 2LTAA 4K8OA 4HNHA 5KWSA 3FSEA 4JS0A 4TMXA 2JIMA 4CMIB 4K9DA 4A8JC 3DC7A 5LQUA 4UFPA 2XKBA 3DOHA 3HEMA 3KTDA 3OIUA 5AUOB 3WFIA 4BO8A 1AD2A 5A5VA 2Q0HA 3HRIA 1AKWA 1JQ5A 4OQZA 1M5TA 3LS2A 3VR5A 4QUEA 1YHZA 4R8LA 3ETGA 1N6LA 1YTZT 1T3GA 1J7KA 4XAQA 5MF6A 1G7TA 2QD4A 2BGWA 1FTYA 2C95A 2CL6X 5DYTA 3RNLA 1FYXA 4FEAA 5G0SA 1C41A 2ZYSA 1AHIA 2D2VA 3WMXA 1Y7IA 4AYCA 3H1BA 3WYEA 1NDUA 1D0VA 3EJ6A 3PPXA 5EPEA 3OTQA 4EI7A 4G01B 4DIDA 2JJ1D 4NARA 2QLFA 4IIEA 3DV2A 4LE1A 1F48A 1BJRE 3NNSA 4W5RA 3IMFA 1ABFA 3H1HJ 3NH6A 3I58A 4RA6B 1TNDA 3V3KA 1JY2P 3LQKA 2OILA 3FA2A 3TI7A 3C70A 4LBYA 2O20A 3BWEA 4GR4A 4G89A 1W8IA 1RHUA 2C59A 3F8WA 3FWKA 5CM9C 3AM4A 4QVIA 4KYIB 4PONA 4B7CA 4D82A 4OVKA 2ZQZA 3CX4A 4RVDA 4YHHB 2XDJA 3A4IA 3IKMB 2QTHA 5ELMA 1WMFA 4MRPA 4CF7A 1C5KA 4CL8A 3CEHA 4AYWA 5JV5A 4QSMA 2HSEA 3WLLA 5DM2A 1L3IA 2H1FA 5E7IA 2PSFA 3U48A 4BEBA 3OQ1A 3USES 1P2UA 4YWJA 2AE1A 1OW6A 4N5MA 1DAGA 2POCA 1RLUA 3KE9A 4HFNA 1UEIA 4Y2QA 4B83A 2BH2A 5KTOA 1QMPA 1HF9A 1NQXA 1CI6B 3WLHA 3C6BA 4HXYA 3REGA 1KP3A 3O4HA 3CWBG 1YB6A 3I5AA 4EYSA 4UMDA 1YCGA 1UPUA 2WUVA 5D6NA 4N3BA 1YJ8A 5AHRA 3H5WA 5FBHA 5F7XA 4M7PA 4RIFA 1FVOA 1VI2A 3EMDA 1YQGA 4FI3C 1BA3A 5KZMB 4CMCA 3ZWNA 2Q1YA 4DQ0A 2C96A 1IUPA 3WO1A 2O7SA 2V7QA 1PHRA 3CZAA 2OYHC 3FNIA 3QKUA 1VLZA 1NXWA 1E9BA 4IFBA 4NS4A 2JFQA 3QGMA 3CR7A 3C5WP 2XBUA 4G5RA 1USDA 3FNBA 1GNRA 1VDMA 2VDKB 2I3AA 1QS0B 5EKUA 4FNAA 1OBOA 3FLMA 2GZ3A 4YGYA 1PYOA 7MHTA 1MQ9A 1OVVA 1MT3A 1Z83A 2AXQA 5A7FA 3RT7A 1L7DA 5A7GA 3HPQA 1ZNWA 4Z99A 4C7OA 1N7HA 4KXYA 4LCBA 4WNAA 3OLZA 5T4BA 1DJPA 4L3VA 1U3DA 1ZC3A 1QIGA 5C39A 2IYQA 3CNHA 3SHQA 1GNLA 1SQVJ 2CY0A 4AG6A 3G68A 5FWYB 1L4AD 3TRIA 3GPCA 3QPDA 3OPYA 2GZ2A 1EPUA 1CIVA 1X9VA 1Y1LA 1YNSA 1VF5C 3THWB 4TWRA 5DT2A 4MVJA 4PLCA 5TRTA 2VJNA 4HUJA 4OIFA 4M8KA 4EUHA 3H9CA 4H31A 3ROTA 3G1TA 1IXRC 5ESDA 4DQVA 2NGRA 1Z4LA 221PA 5F23A 4EZIA 4BNZA 2D4AA 2BBOA 1HNZB 3U0VA 4CDMA 2FWMX 3O7WA 1S8AA 1KQOA 5KOHB 1QAQA 1M1JB 4HDRB 4JXJA 1UDWA 3C3AA 3TOZA 2BEVA 2GRJA 3HKCB 1JH9A 4YJFA 1ZUWA 4NJOA 1P62B 2CJYA 3H1LE 4P9NA 1GP2A 1CTQA 4XIGS 4ZEMA 4YMTA 4M99A 3GFBA 3PKJA 4PNPA 1JDPA 4F96A 3GGJA 3ZI4A 3UW3A 3U62A 5CH8A 1NBIA 5DNAA 1XU7A 4ANFA 2Q9BA 4BX2A 3OCZA 2WC1A 5KQGA 1Z45A 3GNQA 4ZYTA 4UUMA 1NLUA 1A2KC 3JVIA 4YDRA 3OC0A 3QELB 1QCYA 3BCSA 4IJ6A 2HG5D 3SJCA 3G8DA 5IH7A 1NU1J 1HYHA 4KBYA 4A15A 1WETA 2NPOA 3LY7A 2JGKA 1KQNA 2ZBQA 4WKCA 1C0PA 1Z15A 1SQXJ 5BSVA 4WW0A 1LZKA 2EJUA 1VSBA 3HWRA 3R40A 3FPKA 2JGFA 5LU9A 2J0EA 1KDZA 1P75A 4UW9A 5CXXA 1N9ZA 2B4AA 1MO4A 3RLIA 5AW5A 2GFQA 2ODPA 1PR2A 3M6LA 4JJAA 1LWOA 2FRDA 2ZCJA 1T4GA 1MRZA 1FNCA 1GSAA 4B3IA 4INZA 1KI2A 2WSFH 3UK7A 3GQVA 1NNI1 4URHA 4MPTA 1A04A 4P98A 4ZU6X 2W8BB 4IILA 2ODTX 4Q12A 4YAOA 2J8ZA 2FZCA 5K3EA 1RWBA 4OQFA 3VU9A 1TFUA 5GTIH 1XD8A 3VTAA 3T9AA 4LG1A 3JQ8A 2JKZA 1I80A 2TSYB 4QU5A 3VGPA 1QHFA 2Q46A 3RIXA 5AW3A 1F4VA 1DDGA 5CXSA 1TUBA 1IM2A 4IF6A 1E2QA 2IF0A 1VCNA 5ESWA 2JZCA 4PAGA 3UKJA 1CIPA 1T2CA 1DVRA 2ETXA 5IABA 4LXTA 2PMDA 4UTZA 3H2JA 3R5TA 4CM5A 1T2UA 2ZUSA 4ENSA 1L1EA 4MRAA 2ZQ5A 3BG5A 1M1YA 3G13A 2PBFA 1X79B 1CNEA 5ER6A 5FBLB 2JHPA 2IX3A 4P4UA 1Z68A 2P90A 1X80A 1SQPG 4R4LA 3V6LA 5KQMA 2O8CB 3V1KA 1YZKA 1RY3A 1NF2A 1GTL1 1E5QA 2B89A 5JBIA 3ANSA 2IPAB 4AMZA 4PPYA 1P7VA 2YRXA 4YJ2F 3ADCA 2XRZA 4C30A 4KDFA 1X3LA 3RS4A 2ZRLA 3P9IA 4MDYA 1K8ZB 3BCUA 1OHHA 4RPLA 4S1NA 4JBNA 1XBTA 1PZNA 4D74A 2VP0A 3X1DA 5J9FA 4DR4B 3H86A 4PFKA 5GTHE 3OFKA 5JH7F 1KWGA 4UAJA 4A1OA 3CCEP 1VMAA 3QEMB 2QG9A 4GKKB 3UJ6A 5IJ0A 1ZRNA 2OBXA 1HZZC 1GZUA 1VQ7P 5EJ5A 3GN1A 3OIFA 3SICE 2MSEB 4ALJA 2LXBA 5K3DA 2OFXA 5K5GB 2ZB4A 1N2EA 2L42A 4KQJA 2XV5A 5DGCA 2RHJA 4RADA 5AICA 4EKYA 2XGJA 3KEGA 2OUIA 1G3QA 3K53A 1V5EA 4MQBA 3P0HA 3VJKA 4O4IB 3CNQS 5CVDA 1AS0A 4UD2A 2E4VA 4MJ3A 3EUAA 2P2ZA 1U57A 1VGQA 4LCJA 1J0AA 3BKXA 4YMLA 5L7WA 3LW7A 2R1TA 1CY7A 2C9ZA 5IT9A 2P6UA 2G09A 4EF6A 3O9VA 3TL6A 3K09A 3ZWKA 3ICEA 4NV0A 1Z7GA 3JYOA 2OHJA 1Z2EA 3BAZA 1E98A 5HM6A 3TXXA 2WQ6A 3ENNA 2IHJA 3T54A 2M9MA 3LT1A 1DQPA 2XVMA 1YZTA 4OK6A 5IWCA 4F21A 2HWUA 1WZCA 3NMUF 4B74A 4JYBA 1BMQA 3CN7A 1UFVA 2I91A 3E2IA 1GZ3A 3LFTA 4OBWA 4Q9AA 2B69A 2NUTB 2I4LA 1AURA 3GH1A 2PGNA 3NHRA 2IHNA 5EJ9A 3SBOA 4U0KA 5TMDA 3E5MA 4BNFA 1HLGA 1FUIA 2PIDA 2R6R1 1XRJA 4L73A 1GXSA 2BHSA 4U4AA 1YVDA 3L75D 3OE5A 3Q9NA 1BGVA 4KQ6A 3VTPC 4ID3A 3QMPA 3OA0A 2GX6A 3AF3A 4UM8B 1ADBA 5DSTA 3B6EA 3W2TA 3WRXA 3N76A 4QDUA 1R3UA 3SWWA 3Q9SA 2LRHA 3P52A 1P2BA 5D7BA 5CJ4A 3D2AA 2HRBA 3FWZA 3ROFA 4CLOA 2NZYA 5U4QA 2FW9A 3F7MA 3HRHA 2Y9YA 1EBBA 3M3DA 2WFLA 3GV0A 4NECA 1L7BA 2QLJA 3DOEA 1ZGHA 1KB9D 2DSNA 3HWSA 2W2PA 4DT1A 2AZTA 3E58A 3U13A 1QYRA 1V1MB 3LOPA 2NT4A 5CB4A 1YQ3C 4E5DA 3R3XA 3C5HA 1R10A 1RRVA 3L73G 1CU1A 1LPPA 3BZUA 4F93B 3AGPA 3JQRA 1YIOA 5KOIA 4TZ6A 5LMUB 1MAHA 3ASYA 1FP2A 2XXAB 1UFKA 4NU6A 3KSAC 1NW5A 2HB6A 4OX9B 1Q0PA 4LF6B 1OTYA 4BFVA 3GJ8A 3AXTA 3VMMA 4ZP1A 3A1VA 4A27A 3HWWA 4HDQB 3RIGA 3WB0A 5ICCA 1ZRTE 4Y99B 3IQWA 2EW2A 4A91A 2Q6TA 4O2BB 3V2HA 3RANA 1FTWA 3K9NA 1VQ4P 2X9GA 4A8PA 1JTHA 3V8EA 3DEIA 3AY3A 3W3AD 4BN0A 2C4MA 2V6GA 2I33A 2BD0A 5CEJA 3W9YA 5JCZA 1OROA 2IYXA 1ODCA 2FI1A 1B7GO 1QTQA 5JDCA 4KUEA 4TKZA 3KWJA 4UKDA 5JYDA 3URKA 3FTDA 2AFIA 1GPMA 4UEJA 4ZEXA 2CNKA 4M76B 1DE0A 2AOTA 4BUZA 4M0LA 5HRUA 3RL0C 3K2IA 5EXDA 3TLGB 1FL9A 4GYYA 4EF5A 1O8BA 2UVPB 4AKHA 2CHGA 2R96A 3LGXA 4N39A 1GGVA 1RWNA 4TZ0A 4EG0A 1TECE 4MROA 2OHGA 4UCXA 4L8YA 4D3YA 2YN2A 2SECE 2WSEJ 4E1BA 4HVLA 1ZH0A 4BTEA 3FVWA 3MWDA 2GZHA 3PLAE 4IVRA 2Q41A 4NG4A 2VJMB 4JY7A 5KC8A 4QICA 1T36B 3UWPA 3F0TA 3INRA 3I05A 2JAOA 1NM5A 5CMLA 2ZT5A 1KQLA 5IC5A 1C3OB 1B74A 1JX6A 1ND6A 2D5AA 3VSDA 2W37A 3A7OA 4FIDA 1XTBA 5EQTA 3HBLA 1E63A 5AI4A 2ZR8A 1IVSA 2E74C 3EVEA 1R4MB 1BSNA 1VPEA 4U6SA 2J5QA 1A9OA 5AW1B 1SCKA 4ALNA 2O2GA 4EL5A 3D2BA 5ADWA 3OU2A 3TSYA 2XMZA 2NU8A 4DG9A 1EXWA 5J2TA 4Y2YA 1IATA 3PWTA 3M4NA 1I10A 1W5BA 2EQAA 1K9VF 5K4GA 3F7OA 3GMTA 1G63A 4EKIA 1DLJA 1G8FA 4LVCA 4U7FA 2ZKLA 3WYCA 3DZIA 5FWDA 3THYA 4C4PA 5HUJA 3O6QB 2H88C 3R7SA 1I4DD 4LNUA 3QU9A 1XTQA 4GODA 4R69A 1M2OB 3DKVA 4GRDA 3EGOA 1QJ4A 3U7QB 2VEOA 1IUOA 2IH5A 2DHCA 1SCBA 4P7FA 3LA6A 4YLEA 3TBKA 4K1LA 4QQFA 2NV6A 4U9IS 3W34A 3WMGA 1CRLA 5LZ9A 1R8QA 2Y1XA 2VZ8A 1V9SA 4IDPA 2KI7B 4D3FA 4CM4A 4Q7QA 4BO9A 1UT6A 1K75A 2ONCA 4LK2A 3K0CA 4PSVA 3EEQA 5DI9A 1EG7A 1XCOA 1EGVB 3KLOA 4FXPA 3MD9A 1EQUA 5I9SA 2B88A 5ITZA 4J6EA 5E2IA 1OX4A 1TMGE 1V6AA 3DBOB 5KNDD 2FETA 3RR2A 4DBZA 1GYQA 2W4QA 1BDHA 1D04A 2OWEA 3UMGA 5CYOA 1W47A 3ZJVA 2J9FA 4S12A 1GW3A 4LHYA 4U2KA 3V97A 4BZXA 3Q8MA 4MEBA 4NMHA 2VPPA 1TK2A 2GF9A 1CRQA 4RGBA 3O1JC 1U0BB 3L7YA 2IUYA 2OYIA 4RHUA 2YVQA 4IMJB 4E12A 2IE0A 5JW6A 1RZVA 4ZHQB 1UJ5A 5DN6D 4FE3A 4AM8A 3O1HB 5KOJA 5BR1A 2IXGA 1YGYA 4J94A 4Z3DA 3V42A 1QIHA 1NBHA 4F4HA 5IT4A 4OKSA 2G0TA 4NPCA 2PQMA 1JEQB 1RYEA 1GGEA 1IU9A 2FW8A 2C2BA 2RH9B 1WBBA 2ZWOA 2XVYA 4UHDA 2G36A 5AVYA 1OAOC 3VMAA 1IB0A 1SMKA 1SQ6A 5ERXA 5AVZA 3JSXA 4MVCA 4YRPA 2ZAMA 1W9MA 2GEVA 4EYYQ 4BX9A 4OHKA 2NAPA 3AM3A 3HJBA 1OWPA 2I5PO 3BXGA 5A4JA 2BLLA 2SKDA 4TLLB 2OR3A 2VYVA 1MEEA 2YNMD 1ZW6A 2BGJA 4EQ6B 3QVXA 5HFJA 1QPZA 3V6IA 1KQSO 3WIDA 4ME6A 4JDPA 1KGSA 3F73A 2JLWA 5ALGA 3IT3A 4KE9A 1JY3P 1R6XA 5H7XA 1RKUA 2WPDD 1KE2A 4P1ZA 1T0IA 1QV6A 5B2ZA 1YBFA 4IIJF 2CUZA 1KEUA 3KYBA 2CV2A 2ZFUA 4JITA 4LGVA 4D6XA 3T41A 3NTVA 3OPNA 4OU5A 4OHBA 4CDGA 1FW8A 3AB7A 4IFDK 1CQXA 1EZZA 3CNEA 1V7QA 5FL3A 3V9PA 2WDPA 4MGHA 5JHHB 2PJZA 1T5OA 4MVJG 3VZCA 4JBXA 2G6TA 1CZOA 2RGWA 1COZA 4NYIR 5C1IA 2YC2C 2V6BA 1RKVA 2QPAA 3VX4A 1VMIA 4LW8A 3R5KA 2WAXA 4AICA 3GROA 2IXBA 3WDSA 5EWLB 4RTRA 4NABA 1Y42X 1E1MA 3LT2A 3D7RA 5BPFA 2ZSHA 4H7PA 1ZESA 3Q3GE 3L8MA 5KYWA 1KZ6A 4KWEA 1OY1A 5L4SA 4YTEA 3UMYA 3ELYA 2DHQA 4IH4A 1EP2B 4B6GA 5JVDA 1P0CA 1YAJA 1SOAA 5IZCA 1OTXA 1MN6A 3TPZA 3N2IA 4EZEA 1IAQA 1UXGA 4OEHA 5FB3A 5LLDA 1ZD3A 4GGOA 1SFCC 4OHRA 1ESCA 3QF4A 1ODSA 1YI1A 4FD2A 4YQZA 4RMJA 1KP9A 3NYIA 2OYHB 3GDGA 3RW9A 4C1NA 3JVDA 2YCBA 4CM6A 1JHRA 1PE0A 4BYGA 1S96A 2YQ5A 1P77A 3GVCA 1OKKA 3EWSA 4CM9A 4OK3A 1NKNA 3PI6A 2VT7A 3IEXA 3R7BA 1OFHA 2QJPC 1LT1A 4IIDA 3O93A 1AB6A 4BB6A 1QZZA 3KUXA 4FW8A 2IUUA 3VH3A 5EMHA 1FZAA 1XLVA 4OLAA 4Y9RA 2ZPAA 1KVSA 1WDMA 1N2SA 1RYDA 1LSJA 1SU6A 2IS1A 4K05A 4FBLA 2XKMA 2E5WA 3LCRA 1Z8FA 3SE7A 1F6DA 5AW7A 3QOXA 4WV3A 2P0YA 5DX0A 2R4QA 4ROTA 2IXFA 2GHQA 1JUDA 1JEKA 1RRPA 1RP7A 2WJGA 3HVRA 1L5QA 3BCCD 3ETDA 1TC1A 1EVIA 5LIRA 2D8MA 1EXDA 1YR2A 5EMNA 1MQAA 3OM1A 2CPBA 1KMCA 2XGMA 3VZQA 3ZQ6A 1VP9A 4B3MB 4NK4A 3B1KA 3FYUA 5GINE 3EXFA 4QOIA 5JSHA 3P5SA 2IFMA 1L7EA 1ZNXA 5BN3B 1QVWA 1KYOH 4LYFA 2C77A 3FDFA 3N2GA 2Y05A 2X40A 3ME5A 2XDAA 4CODB 3DEYX 4F8JA 3LX5A 2Y77A 3AWIA 4OHVA 1PEAA 1HG1A 4QVGA 5BR4A 3BMNA 3R3WA 5EJFA 1PP9E 4H0NA 2B2NA 2Q6KA 2HK8A 4G85A 3O8OA 4DR5B 3LHSA 3UMJA 3A31A 5BY2A 1L5OA 3F2IA 4W7HA 3F2VA 2ZUTA 3IA7A 4X8HA 1DJOA 1NAYA 4FN4A 4M46A 5D87A 1XNJA 1XKLA 1TTHA 3TH5A 3TI9A 2D4HA 3NETA 3N0TA 3KR1A 3A2KA 3K8QA 3H8SA 3DJFA 2X4DA 2BUBA 2REQA 4LDRA 2HJGA 2XDQA 4BE7B 1A5SB 1CYEA 4O4JB 4KQ9A 2BKAA 4GAEA 1HEIA 1LTGC 3G7NA 1GPJA 3E4CA 3EIHA 4KPGA 3AUSA 1NUQA 3NEYA 4HH0A 4EJMA 5IF3A 3V8NA 4AXBA 1IJKA 4FEYA 3WBBA 1UXJA 5FPTA 2CNLA 2AG8A 3GI1A 5GONF 1MENA 2IYTA 2KS1A 1NQAO 1PV3A 4IVQA 1RC1A 1IOVA 4G4JA 4OL0A 5BN4A 1DWUA 3FFBA 4P2GA 5AUQA 4C4YA 2H1VA 5FTKA 2I78A 4G37A 3UFBA 4ABTA 5BUCA 1RVV1 2HOQA 3R0QA 2ZYDA 3FNEA 3IP7A 3AC0A 4F7DA 1T9BA 3N0WA 2EJWA 2JAHA 1N3IA 3S1LA 5A4AA 1NBME 4OQPA 5F2OA 2MMGA 4D9CA 1DQNA 1KD1Q 4U7JA 4CEIA 1G2OA 4CV3A 1GUDA 4I1YA 2E42A 4W6ZA 3AHCA 1IH8A 5CDTA 1JVSA 3DQPA 2KZIA 1JA9A 4EY8A 2VYNA 5HJEA 1KFMA 4X66B 3HXPA 4INJA 2H1SA 4FVTA 3BDIA 3V4WA 4KK3A 3D43A 5AW0A 4QUBA 3L37A 2HCBA 3TG8A 1X7ZB 2X2FA 5J2UF 2ZZKA 4DADA 4UHCA 1OWAA 2A9FA 2V7WA 2KSEA 5JNSA 2XD9A 3AR6A 4DNPA 2OZEA 3BTSA 1NJ5A 2HDNB 3J7AC 2O0MA 421PA 3ZE9A 1W94A 3KKLA 4ENVA 2Y2VA 4E46A 4YPCA 2IYRA 1NTKD 1T91A 4KQ2A 3KHUA 1T6ZA 4JB3A 4M7RA 3BJMA 5COAA 4D9KA 1V3UA 4BKMA 4FFVA 2A45I 4MLPA 1MW8X 2QGFA 1X9IA 2R2GA 3H8WA 3A0BH 3IUMA 5JROA 3WICA 3LG2A 1J0DA 4R5HA 1T1GA 4X3CA 3K0BA 3TQIA 1BXGA 5LYJF 4XSHA 1I6LA 4Q39A 3UXEA 2C97A 3ED5A 4RK7A 2Z6QA 2AOUA 1FUKA 3DEZA 1VLMA 4D1YA 1TDJA 1K97A 5KWVA 4QRHA 2R32A 1E1RD 4UVHA 3AEZA 5CCHC 2FJ0A 3FUXA 4UE2A 1R6BX 2FNAA 4NJMA 4MKGA 4WZBE 4AJEA 3P8CD 1JSZA 2BR3A 4QOHA 1RHRA 3Q5PA 1CKEA 4BP1A 1N8TA 2RHDA 3LNCA 4IWYA 1PG0A 2HQ1A 4G5QA 2CXNA 1XDDA 3JQ7B 2J0QA 4EJSC 3CKMA 3A0UA 3ROQA 3F6RA 4XPZA 2QA5A 1BEUB 2LBPA 2R7KA 3EWAA 2BFMA 3TIGA 3KXIA 3Q2KA 2XECA 1OLSA 4QPDA 3O94A 3RGUA 2HCFA 1H1TA 2NACA 3CF4G 3L0SA 1P9OA 4DMRA 3ESQA 4LY0A 1NP7A 4MR7B 4NBLA 2BZ1A 2VDNB 4YRIA 4HB4A 3ESCA 3JZIA 1CUBA 1BHO1 4AG5A 4UM5A 3AJDA 3KSDO 2ZIZA 3W6OA 5B1YA 3S55A 1VXRA 2D5CA 2GLXA 1I33A 4UTPA 5KSYA 1HH4A 2PKCA 3U7FB 3TGUD 4EI9A 3ZTWA 1ZM7A 4I08A 3DMYA 2H18A 4BXOA 2QTVB 1YJQA 1IZ0A 3SZLA 4WXYB 5JD6A 5B7GA 2FPIB 3KOUA 4UNPA 2DETA 1Q2UA 5I45A 2OUKA 4AK9A 2OA0A 1JPNA 2Q7OE 2WHXA 3WG9A 3ROEA 2CFSA 2XOEA 4HP8A 2PKQO 4U3JB 2OFPA 3OAAA 2EZ4A 1XZGA 3HKBA 5IAGA 4FFPA 3NTLA 1PNQA 3FMPB 4WN9A 1AY0A 2WICA 3X2SA 1KYQA 4YJKA 1LBTA 1H1LB 4PQYA 1BCSA 3RSCA 4R2WA 4J6FA 4IXTA 4L74A 5CAEA 1BGYJ 2A35A 2G1AA 4H1TA 4DN6A 3IHKA 5AWFC 4ZVRA 3PFHA 3A6EA 3PD0A 5GZ6A 3JAWB 3QVSA 3ZBTA 2V98A 2PMBA 5L95A 3PYXA 1CC1S 1JYFA 2FBWC 2WV9A 2OV6A 4DGQA 2BV3A 4G8DA 5C53B 2JBAA 2O19A 4LZPA 4D9MA 4XCQA 1IE3A 4ZKPA 5IKOA 3UHFA 5EKSA 2ADMA 2R3CA 2PHZA 3WL5A 4DHEA 2ISSD 5KTNA 4FMCF 4L5YA 3IQGX 3NB0A 3D1VA 4YRRA 2WG0A 3UENA 2WINI 3M82A 3DYVA 4ISBA 3V1UA 3W06A 2P79A 3SQMA 3UKDA 1GLVA 4XRRA 1GDTA 4R1SA 1IUNA 4KFTA 3V9AA 4W5WA 2XY4A 2H17A 2DVMA 2RJ3A 3PE4A 2AXEA 2PCLA 3Q2IA 1XQXA 2HBYA 1T5IA 1U2DC 3FWYA 5DBFA 1QP8A 3AI1A 4UB8E 1FTNA 4ZI7A 4AJKA 1Y9BA 4N3NA 1TM1E 1KI6B 1HUCA 4REOA 2IDZA 1QKKA 5BVGA 2UUAB 1RQLA 4QYIA 1S4MA 4MTLA 3A4MA 1SA0B 3DO8A 1VE1A 3K2QA 1A9RA 3DHNA 1P91A 1NTMG 3CXUA 3D6MA 5TQ2A 3K72B 3K5IA 1G7SA 2XB6A 5J63A 4LE0A 2WHYA 1MB3A 3FXDA 1A76A 3KZCA 1R5JA 2Q6VA 1T35A 3NBFA 3LZDA 3JASB 5BQXA 5ALEA 3FG9A 2ZSEA 3TAXA 4M22A 3C1LA 3UIEA 5C2JB 2VBCA 1HDYA 2W2KB 1QOQB 3B1ZA 4K3UA 5CW1A 2B87B 2ZYUX 1H2RS 1H85A 3UB3A 2XQIA 4I1SA 1TQ2A 5FLKA 5I9IA 1P0PA 1BS2A 4MA5A 3L8DA 5CK5A 2IOFA 3SZOA 4QXPA 1I2ZA 4KIUA 4UUQA 4CKYA 1TKRA 1RJGA 2PTGA 1Z0AA 1XZBA 3AV0B 5KC9A 1BWSA 1XXHB 4FHZA 4E5YA 4YMWA 5AVKA 3IAUA 1BCCJ 1NW7A 2AVNA 1EX9A 1TO2E 4JYAB 3OOSA 3UFXB 4IS3A 5EJ2A 3N2YA 5JXWA 3IVCA 1GOTA 3E18A 1CUIA 3D0QA 1YDGA 2PY6A 1VL5A 4KQGA 1D9XA 2X1VA 3VFDA 5IPFA 4YJ3A 1PR4A 1U7MA 3P8ZA 3ILYA 1E32A 1GITA 3GYBA 4L4RA 3B9QA 2XEXA 3O2JA 4K2AA 3MQ2A 1II8A 3ZWDA 4C5CA 2DB3A 5EIFA 3JQ6A 3M49A 2WPRA 4PV1C 2LW7A 2WLSA 1J09A 2UYCA 2ODAA 2J0VA 2JGRA 1T8WA 4EZBA 1C3JA 4HWGA 4X54A 2GEUA 1KAHA 1Q3HA 4F4UA 4FN5A 1VQ6P 4AWAA 3TEJA 1WAMA 3QTTA 5EUCA 3GT3A 5EXPA 1V5GA 5AKLA 2NOAA 3ASZA 3DKPA 1D6SA 2ZXUA 5DTQA 2D2CD 4UOEA 4H0LB 1L5GB 1IN4A 3AHDA 4GU5A 3SIRA 3GLHB 4D4IA 4BLSA 2YY6A 3G2KA 4U63A 5G4KA 3NTXA 4MS1A 3PQCA 1VJDA 4Q3KA 4BGVA 2ONYA 3H9UA 1DXHA 3GRUA 1DFIA 1UJ2A 1Y6QA 1D4ZA 4N5LA 4PBSA 4RCVA 2YXBA 3NAMA 3CNNA 2E75B 2HA5A 4XGIA 5C1DA 5AIAA 3HFJA 2HODB 4JJZA 4ZALA 2NUAB 3CCBA 1C14A 1UWVA 4CGYA 4TT3H 5REQA 4L6AA 5E6UB 3ZHQA 1ODIA 3F97A 3LECA 1WMSA 4P3OA 3ZE6A 3LX4A 4D44A 5PGMA 2OCKA 1KMMA 4E09A 1RBYA 4IEFB 3V8BA 1A8HA 1Z0UA 3OQOA 2ABWA 2WI8A 1F5NA 1PJAA 4RTPA 1SU7A 4JUBA 2YOGA 3S28A 5ELLA 5AVJA 4UDXX 2VP2A 4WVLA 4ZRDA 1OYWA 5LP6F 1LV8A 2NPSD 2QM0A 4DZTA 3A14A 3OF3A 3QE2A 4HNTA 1KV4A 3K9BA 5LA6B 1P8AA 3GEHA 1RI2A 3CLRD 2N1TD 3NHMA 2XB2A 4UQLA 1DDIA 3EXHA 2JDIA 4Q00A 3KT0A 2QUBA 5TR9A 2IY8A 5LJLA 2F1KA 2ZRGA 2MIIA 3EFFK 4ISCA 2OD7A 1VQ9P 1C3VA 4FFSA 2LDBA 3UAOA 4O29A 2ZB3A 4OHMA 2Q6LA 3KG2A 3DE5X 2BTQA 1PDWA 4OGKA 1G64A 2D1YA 2Y0EA 4AJJA 1I3OA 4FDTA 4RX1A 5KTYA 5HIAA 4YO8A 2QAIA 4EY7A 3LGAA 1YZHA 3ANNA 3USCS 3VC7A 1EXJA 4MQ5A 4I4IA 1IY8A 3LBNA 2DFVA 2G9RA 1A9QA 3H32B 3U4IA 3GNLA 3GMAA 1G2IA 1NRIA 4OVNF 2AJCA 2BGLA 3EC2A 3RUAA 2HSGA 4NFLA 5I4IA 3CVOA 3SJAA 2ZVOB 2H0RA 2R66A 3BRTB 4X20B 1G7RA 1NGSA 5M3BA 4GLFA 2AXNA 2V45A 1W0CA 3HG7A 1WKVA 3GBSA 2XCRB 1XCBA 1XNHA 1X7WA 4RPGA 3MAAC 1OZFA 2CUKA 3ESZA 2V97A 3U4CA 4ZVNA 4B0PA 5F1OA 2IH2A 4B6JA 2XCLA 3RTGA 4OHWA 2WU8A 2W2LD 2JGMA 1TL7C 2VZ0A 2KNCA 3HP7A 3NV9A 1Y3HA 4ZOBA 4RIGA 3FCXA 4ZKUA 2DJIA 1PFGA 4U0JA 2FV8A 3QI7A 3U3OA 3H1LG 2BFFA 3RS0A 3KIPA 2FXMA 3HCCA 5IK2D 5KNCA 5EZSA 1XA0A 2Z95A 3L1JA 1YACA 4EG6A 5BV2P 4ZO6A 1IZ7A 2CK3A 4E5NA 2F1IA 5BVZA 1DWPA 3VGJA 1A98A 2NO1A 3L8HA 3DYIA 4W8OA 5K0LA 1VKNA 3VYTB 3RUEA 1E6MA 2Q50A 1VL0A 4Q3AA 3E8SA 1F6BA 3RTDA 1LS1A 3ZKAA 3I5MA 1M73E 3L82B 3EF3A 3ZU3A 2Q9AA 4Z1MD 1GCAA 1KMQA 3OMXA 1C1XB 1PDVA 1KETA 1K27A 1YQQA 1R88A 3PRHA 3LDAA 1FSFA 2BH9A 3RAFC 1XNQB 3UHOA 1RCUA 3G6KA 2QA4P 3QE0A 1OH5A 5D3MB 5LL6P 5FNVB 4NFSA 4QDJA 1F6WA 4GEKA 3KZMA 2AZDA 1XTSA 5BP7A 3DLBA 1SIOA 4XFKA 3PGXA 3EVZA 4KR0A 1ZU4A 3HJNA 2VKTA 4BVBA 1Z0DA 3T1QA 1MB2A 4F6RB 1HETA 3NKFA 5H4GA 2HV9A 1XRQA 3VPBA 4EJ2A 1T2KD 3BMQA 3PGJA 3DTVA 1XIVA 3TGWA 2PUDA 4EG3A 3QNUA 2IV2X 1XALA 4HLCA 3W9UA 5L45A 1C0EA 5AKKA 2V9PA 3MTQA 3H1KJ 3G1UA 1H42A 4PQGA 3AILA 1BWRA 3OY7A 2CBXA 3C8DA 1D1PA 1JG4A 5B3JC 5LLSA 1T3UA 1EU1A 1EK6A 3HS3A 2D5IA 2J7KA 3WLNA 3TX6A 2RHHA 3GFVA 5DHSA 2NN3C 1NNEA 3P32A 3L70D 3C6QA 1GZ5A 4XDHA 3GDHA 2FZWA 5AVWB 2XBLA 1ZK2A 2HR3A 2AZ4A 1XK7A 1KYWA 5EIXA 1FZEA 4C46A 3AERA 4H15A 3T5MA 1W85A 2BP7B 5APVA 3SY8A 1PS8A 1O58A 3COWA 5IASA 5DBGA 5B36A 5E6SB 1GPYA 4JV5B 5TPZD 2OAQ1 3OPMA 3GZNA 4CQMA 4E5SA 4IQ8A 2NZXA 1JHZA 2F3RA 3GA5A 4BGDA 5K5EA 2KLHA 3E22B 4K9SA 4W99A 2BEWB 4QUJA 4BNLA 1FSZA 3VNQA 2I65A 3NRCA 3TB4A 5F7JA 1NR1A 3L8ZA 4HT3B 5J59A 3JVVA 1IO4A 2AVDA 3KD2A 3F98A 3HTKA 1KEEA 3SZ3A 3QA3E 3FTCA 1R5SA 2XBMA 2OHHA 4MLZA 4DMGA 5JO9A 2QT0A 5AJWA 5DGXA 3DKRA 2GTIA 2BLNA 3JQFA 4EL0A 4PJ0H 4R0NA 1HDGO 2VTKA 3U49A 5CCGA 3RYCB 2JD0A 3M06A 1XQYA 5JDIA 1NBMA 3CG4A 3KLMX 4ODIA 1A4XA 3GZTB 5EINA 3R7WB 3TINA 5CH3A 1LGYA 3T4EA 4I8DA 2HA6A 5E4YA 4RW0A 1LK5A 4LBZA 1E79D 4PCVA 2FLWA 5A3JA 3R44A 2IHUA 1KZHA 3ED1A 1JBEA 3N8DA 1AUXA 4LCEA 2G04A 4S1PA 3UYLA 3C4JA 1DCFA 3TFWA 3QRWA 2BCJQ 1AMNA 2HMYB 2IS4A 1GTZA 5DJUB 5EZYB 4MHSA 4R3NA 1MRNA 1UXIA 1JSCA 4TMWA 3DW1X 3CCSP 2NVUB 2IOQA 2L19A 1ADGA 4Q93A 2WT8A 1GLNA 4W5TA 3NANA 3QTBA 1A9SA 1WHTB 1P74A 2X6QA 1NYQA 4RZ2A 1TYZA 3I5CA 3G8AA 2ZPUA 3WNDA 3N6RA 4MQLA 4CV0A 2CLLB 1D6MA 1ZJZA 4YRBA 1XTPA 4WVZA 1Z12A 2DWPA 3Q9LA 1VIAA 3UF0A 3L6RA 5LC1A 2PTHA 2G5GX 2YS6A 4W5QA 4LWQA 4RC9A 4X24A 3HZRA 4Y6RA 1P39A 4MVJF 3PNOA 1KR2A 2XJ9A 4UATA 4WH0A 1Q1QA 3F8SA 3SQXA 2C9YA 3R7FA 3PC2A 2VVTA 2IS2A 2BM0A 3WKBA 1GPLA 4EPWA 2QI9C 4V0KA 2A5YB 2JK1A 2D1FA 4ZZ0A 1DWOA 2NU7B 2QN3A 2H0QA 3A1TA 2ANCA 1TU3A 1M8JA 1NX6A 3T5DA 1NYHA 1CR6A 2GK7A 2H5IA 3GD7A 2RH5A 4JLVA 4YLGA 1KQFA 4WZBA 1SQBJ 5JY6A 3QPCA 4EJSB 2VSYA 1KFCB 3HKEA 3PNLA 3OJEA 1ILWA 1M2HA 2C82A 5BR8B 1B8NA 3FJYA 4BWGA 3BEDA 3A25A 1JY2O 3IDFA 4N0EA 1K68A 1Y9AA 4KO2S 4G9BA 1HSZA 3TRKA 2HAEA 2XUKA 3PF9A 2YJTD 3P45A 1PFKA 5JWHA 4C89A 4Q4JB 4N0DA 3WLEA 4XUGB 5DW0A 3WJ2A 3NGLA 3STWA 4F91B 1DQZA 2ZAGA 1CR0A 1WO8A 3BS4A 4LZOA 4S0XA 4DLWA 2JGAA 3S3TA 1QTRA 1G16A 1T2NA 1ZN5A 2ZXEB 3L7IA 3QYAA 3C3WA 5IJ9B 2B98A 1AKYA 2FUG6 1KC8Q 4AROA 4B09A 2O3RA 2O52A 3M6FA 1X0VA 5L3QB 3CB4A 4LQ4A 1W2EA 2L17A 3GFRA 2BFBB 1XJQA 3MLBA 2YV2A 3LWDA 3OKPA 3DQZA 5BVHA 2EX0A 2EKZA 2RGUA 4D9GA 2P2GA 4D46A 1FDVA 1EUCA 3C3BA 5ITVA 3UHPA 2G6BA 4QECA 2PFSA 2UYQA 4TOIA 5HW0A 2OFWA 4UTNA 1NJIQ 1QKJA 3GLSA 3VTKA 3DT6A 1C3EA 5EIBD 4LEIA 3X1YA 4UTVA 1X14A 3R24A 3MJDA 3HUUA 5FTJA 4O02B 4IQ4A 1F2UA 2ES4A 2WB4A 5DNWA 2VUHB 3PT5A 5K1ZA 3TTTA 1NTZD 2Q8PA 1NMSA 4G4GA 3RBAA 1JLMA 3TS1A 4R9VA 2VDJA 5ALMA 1QDUA 2ZSBA 4EVSA 1S3IA 4IV5A 1ZMEC 4LV5B 4RXUA 3GFQA 5I9TA 5AKJA 3O4VA 1YMUA 4ZI3A 3BJEA 1U0SY 4EPXA 4RYDA 3ABSB 2OQRA 4QFBA 3VDNB 3TXYA 2R4UA 3T4XA 1GARA 1ZHFA 1MKMA 4DJTA 3MYRA 1WVIA 4OBXA 3BHNA 1SKYE 4L9SA 4MUGA 4ETWA 5T57A 1KERA 1I2MA 1NZDA 4C4TA 5C8YA 1ZGJA 3ZS8A 5TPWA 4URXR 2O5EA 2NQ2C 3TL2A 4K6FA 3CE9A 3WWDA 3ORSA 4GNRA 2CXQA 1N5KA 1E9RA 1C1HA 1Q0RA 1GFSA 2MINA 2R6GA 5EJIA 5C81A 4GEGA 4B6OA 4ROSA 3SR0A 1BD3A 4UJ5A 2IHKA 1JDSA 3PHJA 1G2CB 1XKTA 2Q3DA 2QVCA 2A5FA 3R3VA 3T4UA 3P4UA 1K06A 2C8KA 3LL7A 4BMSA 1PFYA 2XMRA 2W43A 4F6CA 1MOPA 4US2R 4DBVO 4ABYA 5MN4A 1KZUB 2Q7XA 4QTZA 1EKXA 5C80A 3SIPA 4JJ8A 3BEOA 2QS9A 2JRCA 3NVDA 1YB7A 1N6HA 5AK6A 1KB9I 3VZBA 4GQBA 3WAKA 1T3JA 3T7JA 3CUSA 4Q1EA 1LPMA 3ZU2A 1VQNP 1G5QA 1UP6A 3SJUA 3SBXA 4EHAA 3RVKA 1P84D 4PC1A 5P21A 1XZ8A 5BPHA 16PKA 4Z4FA 4GMGA 2G70A 4L95C 3TOVA 2VRBA 4O63O 4QHYA 4LOHA 1N0IA 2ZROA 3HBNA 3COSA 4OI4A 2PVPA 1QRRA 2V7EA 5DMHA 4QYTA 5FTMA 5DNCA 1R8XA 1SCUA 5KYXA 2WHRA 3B5ND 3L6OO 1VL1A 4RXTA 1ZWKA 3R41A 5I7HA 1DMSA 4M21A 3L92A 1U28C 3P4XA 1ARZA 1HFKA 2PS3A 1NC3A 4N49A 2Y68A 4WWIA 1Q0LA 2FFDB 4MWBA 1K4MA 1RBQA 1SQQE 1Z5VA 2GESA 2WIAA 3FUCA 1PLJA 2MHCA 3M83A 3LVFO 3LBHA 1P33A 2PXCA 4O33A 1I7LA 2BYTA 2BZ0A 3NM5A 3U4QB 5IULC 4FYIA 1JL3A 4JSYA 4B44A 1ESMA 4RL6A 1ECFA 2WSCJ 3DHYA 2AKEA 4FZRA 1NUTA 3IEPA 3AEKB 1TUEA 1I0LA 4P92A 3VR3D 3FGZA 1DIAA 4MQFB 4GI7A 3M9HA 1DXQA 4Z9FA 3TLKA 2CWDA 2ZLBA 1R0YA 1TLFA 4RK6A 1OGJA 4PO9A 2XNXA 1GSIA 2IU0A 4BVHA 4EYQA 1U65A 1P45A 2NRGA 3K3PA 1Z2NX 2JD2A 4HYEA 4F9FA 2W00A 2RGXA 5ARBA 1NIJA 4OYRA 1E4VA 1NRWA 3GJYA 3U1VA 1R5LA 1CUEA 1XHFA 2O01J 1P1IA 1JQDA 1DKRA 4A6XA 3AETB 5TT0A 4NONA 2J9GA 1UK8A 2MYPA 4RJIA 3VRHA 2B8EA 2KYVA 3GFSA 3T7IA 4EW1A 5CB4F 5CLQA 1TI7A 1XEWX 3HR4A 3MIWA 2JHCA 1J8QA 2Z9DA 4QEZA 5EKXA 3ER9A 3OE7D 2FYUE 5LBUA 2QTGA 5KSWB 2IPNA 4RWZA 4RKEA 4HAXA 1NQOA 2WKPA 3H1TA 2WSMA 1BNCA 2WYIA 4Q4AA 4W1RA 3FF4A 2V6MA 4UHKA 5DNUA 4BNNA 5JI3E 2KK7A 5FFNA 1ISMA 2GD2A 1VYUA 1SB8A 4HLQB 1SBZA 4B4DA 1Q82Q 5D6OA 1DGQA 3DOIA 1SOVA 3L41A 4DSUA 5TS2A 3PCTA 1OCEA 3AM1A 3UUGA 2VCYA 3QSYA 1NMZA 3LUJA 5IARA 1VMDA 5TC4A 2VPYA 4EMTA 1JH8A 4GOXA 5C4GB 3N0RA 4AZ3A 1EWTA 4I9FA 1L2TA 2G7ZA 1KP2A 4MRNA 3RG2A 3AEBC 4TWAA 1G9TA 3B7GA 4YUXA 5AJTA 2BRUC 4Z49A 3R0VA 4B9AA 3CZCA 1WOYA 4U2FA 3T3EA 4Y0VA 2VDMB 3DF7A 2R5NA 3CX5I 2VA9A 3C4QA 2OHFA 4OO3A 1MABB 3G0OA 2B94A 4A8JB 2YZKA 1ZK3A 4MI9A 3IBGA 2FN9A 3MJCA 3K1JA 4E6PA 2D0DA 2G07A 4CL0A 4OG2A 4EARA 3I62A 1WUJS 4OMCA 4ED9A 2QRZA 2DX7A 4KXWA 2IYPA 4O9BA 4G0QA 4PLVA 3QITA 1LDGA 4QBKA 1DIOB 1X7YA 1XTUA 4FHDA 1HE8B 4BQNA 3P0FA 1YHNA 1EZ1A 2XI4A 3GR6A 5ECDA 4PSKA 4BO6A 1D7MA 2VAPA 1CVRA 1EFCA 4TZKA 1OZ0A 5AOAA 4PD4E 2YHSA 1W4RA 1F60A 1BU5A 4GD3Q 1EQ7A 1PWXA 2BE7A 3LC1O 2A06E 4R9SA 1N2JA 3S1SA 2JVIA 5T41A 1SVFA 4CKWA 1IOLA 5KNLA 4Z5XA 3Q6IA 3OCUA 1BH2A 1I94B 1SXQA 4BYMA 1DELA 4MYHA 2GSDA 1NBWB 2P41A 4A8HA 4B8ZA 4Z4EA 1VPTA 2OXCA 4B4WA 4JHLA 3UZUA 4DLRA 5J2TF