1OZHA

The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
552
structure length
545
Chain Sequence
VRQWAHGADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLLDSSIRIIPVRHEANAAFMAAAVGRITGKAGVALVTSGPGCSNLITGMATANSEGDPVVALGGAVKRADKSMDTVAMFSPVTKYAIEVTAPDALAEVVSNAFRAAEQGRPGSAFVSLPQDVVDGPVSGKVLPASGAPQMGAAPDDAIDQVAKLIAQAKNPIFLLGLMASQPENSKALRRLLETSHIPVTSTYQAAGAVNQDNFSRFAGRVGLFNNQAGDRLLQLADLVICIGYSPVEYEPAMWNSGNATLVHIDVLPAYEERNYTPDVELVGDIAGTLNKLAQNIDHRLVLSPQAAEILRDRQHQRELLDRGAQLNQFALHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIARYLYTFRARQVMISNGQQTMGVALPWAIGAWLVNPERKVVSVSGDGGFLQSSMELETAVRLKANVLHLIWVDNGYNMVAIQEEKKYQRLSGVEFGPMDFKAYAESFGAKGFAVESAEALEPTLRAAMDVDGPAVVAIPVDYRDNPLLMGQLHLSQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structures of Klebsiella pneumoniae Acetolactate Synthase with Enzyme-bound Cofactor and with an Unusual Intermediate.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Lyase
molecule keywords Acetolactate synthase, catabolic
total genus 199
structure length 545
sequence length 552
chains with identical sequence B, C, D
ec nomenclature ec 2.2.1.6: Acetolactate synthase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ozhA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ozhA04
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ozhA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1ozhA02
2JI9A 1X7ZA 3IAEA 1UM9B 4J1TC 1M2GA 1Y9DA 1T9AA 3AHJA 5EJ4A 1NGSA 1UMBB 3AHIA 1AY0A 4V1CI 3CLRD 4BVBA 1PTJC 3MOSA 3ZGOA 4MPPA 1HZZC 3EY9A 1V1RB 3DUFB 1TKBA 4BN5A 1V1RA 4UTRA 2J9FB 2Q28A 3FLMA 1OLXB 2Q5JA 1NM5C 3EXFA 1OZFA 4KXXA 2C3MA 4UTVA 3EA4A 5MFPA 3AHGA 1YC2A 2BRUC 1NI4A 1QS0A 2V3WA 1DJLA 1PYDA 2PDAA 3HYLA 1U5BA 2QQGA 3AHHA 1UMDB 2OORC 4JSRA 4C78A 1TKAA 1X80A 4J16C 5DEIA 5BWLA 1UMDA 1UPBA 2VK1A 2R8OA 4Q9DA 4RMIA 2BEVA 5EXDA 4F4UA 1PNOA 4BVFA 5I51A 1L8AA 4RJIA 2BFBA 1UMCB 5HJEA 1V5GA 4UTZA 1SZCA 4Y6LA 5IMSA 1UMCA 1V1MA 2QQFA 1OVMA 2JI8A 2BEUA 2OZLA 4UUAA 3LQ1A 3ZHTA 2EZ4A 1V11B 5I5EA 2IHUA 1DTWB 4WBXC 2RH0A 1YI0A 4KXWA 3EXIB 1X7XB 5FYQA 5DGDA 4BN4A 1DTWA 3OOYA 3O6QB 2G28A 5HHTA 4K9NA 2BFFA 3DV0A 1W85A 1U2GC 1O96B 4FEEA 1UM9A 2H2IA 2PANA 1POXA 2EZ9A 1OLUA 4JUFA 1Q1AA 2JIBA 2C31A 4JT9A 3RIYA 5BWOA 1V5EA 1OZGA 1Q6ZA 1YNOA 1X7XA 1MCZA 4MQ5A 2PGNA 5EXEA 5ESDA 3ZHUA 4R8MA 3CLTD 2QTAA 4X3PA 3EXEB 2H4HA 4JT8A 1YTLA 1D4OA 3CLUD 2BFEA 2C3YA 3EXEA 4FVTA 1T9BA 3L84A 2Q27A 1TKCA 3ZHRA 4GG1A 3EYAA 1J8FA 1M2NA 1X7YA 2NXWA 2AG1A 2BP7B 2W93A 4K9QA 5K3SA 3EXHB 2H2GA 1V5FA 1YHZA 3DUFA 5EJ8A 2O1XA 1UPAA 1BFDA 2R5NA 1WCIB 4BV3A 1W88A 3ZG6A 4ZZIA 1V16A 4XEUA 4JUAA 2BFEB 1W85B 1ITZA 2IHVA 4GM1A 1PVDA 2JLAA 3AHDA 3LPLA 4C7XA 2BFCB 1IK6A 1B0PA 3ZGVA 4GM4A 1U31A 2PGOA 3IAFA 1M2JA 3RIGA 3EXIA 3RIMA 2BP7A 2G25A 2FR8C 4UTNA 2UZ1A 1S5PA 2R8PA 1OLSB 1U5BB 2O1SA 4BVGA 2JI6A 1ICIA 4QQ8A 3EXG1 4V1CB 4RJKA 1RP7A 1YD7A 3GLUA 5EJ7A 4HDAA 2BFDA 2OD9A 2VBIA 1W88B 4MPRA 2C3OA 1V16B 2VK8A 2JLCA 3EXG2 2BFBB 4K9LA 2BFFB 4RMJA 2FSVC 3AHFA 4X3OA 3D81A 4BVHA 2Q5OA 3M7IA 1PO7A 1QGDA 1X7YB 4K9PA 2H59A 1GPUA 1JSCA 4K9KA 1EFPA 2A1UA 1PNQA 4JUCA 5DGTA 2OO5C 2BFDB 1ZPDA 2EZ8A 4KXVA 4KXYA 2XTAA 4IF6A 2EZUA 1YC5A 1X7WA 3JR3A 3PKJA 2NYRA 5I5GA 4D5GA 2Y0PA 4KPUA 4MPJA 1YBHA 2JI7A 1YHYA 3JWPA 4F56A 5FEMA 4COKA 1T9DA 3ZHVA 1PT9A 1OZHA 3DVAA 5HGXA 1NI4B 1T9CA 1WCIA 4BVEA 2H2FA 4JD5A 3DVAB 4FEGA 2E6KA 3K35A 4IG9A 1YI1A 2VJYA 3EXFB 2FRDC 4IAOA 5EJMA 3AHEA 1Z8NA 4K9MA 1UPCA 3U3DA 2H2HA 2VK4A 1XLTC 5MFZA 5D7NA 3M49A 3PKIA 1V11A 2UZ1B 1KEKA 5ERYA 2AG0A 2BFCA 2C3UA 2B4YA 3GLTA 5EJ5A 4JUDX 4QELA 3CF4G 2HJHA 5ERXA 4GPEA 4KGDA 1M2KA 3UK1A 4GM0A 1U28C 3M34A 4RMGA 5EJAA 5MGNA 1M2HA 2AXCA 2IEAA 4GP9A 2Q5LA 2Q29A 4UU8A 2DJIA 1S7GA 5MF6A 3HWWA 1O97D 1UMBA 1TRKA 2OZLB 3HWX1 3FSJX 4FZ3A 1OLUB 4UTXA 2QTCA 4L2IA 3EXHC 1Q17A 5I4IA 1X7ZB 2VBFA 2G67A 4BUZA 3F6BX 4V1CA 2WVAA 2UZAA 3OE1A 2EZTA 2A1TR 2H4FA 2WVHA 4QPZA 3DV0B 4I5IA 3FZNA 4UU7A 1MA3A 5K6TA 2JGDB 4RJJA 5K2OA 4O8ZA 2J9FA 4UUBA 4KXUA 4D5EA 3ZHSA 3AI7A 1QS0B 4C7VA 1SZDA 4KXQA 3D4BA 1V1MB 2H2DA 2XT6A 1POWA 3UPTA 2VBGA 2BEWA 2BEUB 4JUBA 2Q5QA 4HD8A 1Q14A 2OD2A 3U31A 1E3TA 2BEWB 4K9OA 5AHKA 2X7JA 5EJ9A 2YIDA 4JU9A 3LQ4A 2BEVB 4JU8A 3EXHA 3GLRA 2H4JA 1OLXA 1EFVA 4TWIA 5K6RA 1X80B 2JGDA 5EJ6A 4G1CA 3E9YA 2WVGA 3ZHQA 2FN3A 2C42A 4L3OA 1R9JA 1N0HA 2XT9A 4MZXA 4BV2A 3PDHA 4Y6OA 3CLSD 2IHTA 3F6EX 3D7KA 3LQ2A 3KOMA 1OLSA 3M6LA 4RMHA 3AHCA 1U2DC 4C7BA 4ZP1A 2YICA 3GLSA 4Y6QA 2OD7A 2C3PA 2O01N 5BWNA 5HYVA 5C4IA 4TWJA 1X7WB 1PI3A 2FWNA 1QPBA
chains in the Genus database with same CATH superfamily
4LDJA 1URQB 1R0SA 2Y6UA 3QITA 4QDXA 4G65A 1WUTA 5KS2A 3FGPA 1CJMA 1FCJA 3IAEA 3RJ5A 4DABA 2DHEA 2JL1A 4L5IA 4FEAA 4JSTA 3DO5A 2B8EA 4EFNA 2X8LA 4P81A 4M1MA 2J46A 3OU7A 2VJPA 4AKTA 1KIAA 1VLLA 4FHGA 2WIBA 2X8JB 4O5AA 3OQIB 3H1JG 3CW9A 2IV7A 1Z5GA 3CXHD 5E6RB 4CM6A 4M0KA 3Q8KA 4Q9NA 1TKBA 2P4HX 3ROKA 4E07A 2JRLA 1KI7A 4KODA 1KI8A 4YACA 4NOJA 4WXHA 1R6TA 5C8YA 3RUHA 2XXAA 1PSZA 3NHBA 4HZUA 3FLMA 1SFRA 3NNNA 1YUMA 5CX1B 3ZUPA 5M3BA 2P7JA 1MGOA 4GRDA 2VDQB 4EB6A 1T1EA 1Y7IA 3WTBA 4P22A 5KNBD 1XZKA 4ZQEA 1JEDA 3UK0A 4UVHA 1TK2A 3EZLA 4HNHA 3U3OA 3MINA 3E5HA 4KLNA 1DAMA 1MJ5A 1JFTA 6YASA 1RJFA 3CVYA 3M70A 1G8SA 3P0FA 4AMYA 4N5IX 1QC5B 1W36D 3IE0A 1XTZA 3M9WA 4IWYA 4PSAA 3QVLA 5DM70 1NOKA 1QRSA 2R11A 4P4NA 5EY5B 1L5LA 2A30A 3EQZA 1AG9A 1GCGA 2DZDA 3IAS1 4PIVA 4EOGA 2QN2A 5C8DA 1BVHA 2WICA 5DO9A 2DT5A 2W5UA 2PAAA 2WR8A 3SC4A 2F3QA 1AQJA 1QEXA 4C05A 3KU1A 4HNRA 3MWEB 3AIMA 4GOJA 4QO7A 5DEIA 5BWLA 3WICA 2DBRA 2PG3A 3L7DA 1RZVA 2BEVA 2G88A 1FYXA 2RKWA 3WGTA 5FJIA 3BBLA 3STHA 3R7FA 2JFPA 5JJLA 2ZUUA 3E7WA 4I14A 3HY3A 2OG1A 4MRAA 1ZHHA 2FPIB 3N2LA 3OUZA 4WJLA 5KMGA 1ZUD1 1Z2AA 1KQFB 2YXNA 4TV9F 1J97A 2M2IA 3PTLA 4FFPA 1L5RA 1ZC4A 4BGUA 3ACDA 4J0KA 1YTUA 1FZBA 3UUEA 4ZVNA 5GONA 3FN4A 2NN3C 4UUAA 2W2XA 4AVYA 5LJLA 1V41E 2L82A 1WEHA 4IH9A 2RH9B 3C15C 3DAOA 5KINB 3BH7A 2DTDA 2DWOA 5G1PA 1ONBA 1QFSA 5ALLA 3MD0A 3D8UA 3CCMP 3C6QA 4GC9A 5CA0F 2YNMC 2HCFA 3DTTA 2GRAA 2D3WA 4UZSA 5EMJA 4BASA 4U0JA 2F90A 5A71A 4E2ZA 4JIMA 3FXAA 4PS1A 1NVVQ 3WJAA 2OQQA 2PBRA 3JTEA 2QSZA 2AMFA 3WWOA 2G9ZA 3M82A 3FWYA 4PG5A 2VNSA 1XTQA 4KNVA 4G5OA 3VAAA 1EM6A 3P8ZA 2P67A 2FFQA 2WAOA 4Z9AA 5HUJA 5CBPB 2CDBA 1UJ4A 4NQZA 5I7HA 1O58A 5JQWA 3NH6A 4R2MA 5B66H 3OJ0A 3U4IA 1JTFA 3FDZB 3TTUA 2RMKA 5DI9A 5GVSA 2BMEA 1N73B 2GOYA 3L73E 3KJNA 1M0SA 4JMLA 5BV8A 2AI2A 4NOLA 1SK9A 1Z5UA 3HEBA 2PX4A 4RHCA 4ZJYA 2FJ0A 3AO0B 2Y0CA 1NOIA 1TW3A 1RCUA 2G0NA 1N9KA 3MERA 2NZVG 5E3JA 3RYFB 5B7QA 4HBGA 5ALRA 8LDHA 1NTZK 3MCAA 4CF7A 1W35A 5AJXA 4BNFA 2GERA 2QZ9A 2VF2A 1ZMEC 1FW8A 1YZKA 5IT5A 2P10A 3SIXA 5FWDA 3CH5A 1WSWA 3D6NB 4RD1A 4NCAA 5CVDA 3B8EA 1CB7A 1Y1SA 4MVJF 2IOQA 1NYTA 1ZIXA 2WHYA 4R7ZA 2UZ0A 5ER6A 3VKVA 2XZDA 3ZWWA 3ZHUA 5KPDA 3VAZA 2NPSC 7ADHA 1CRLA 4ZXFA 1JUNA 1PDOA 4KE8A 3I5MA 4KDEA 4H44C 1YBFA 4ONEA 5K51A 4ARSA 5FA6A 3K2IA 4M0CA 4P8RA 3GP5A 3KQGA 2H2AA 2BGWA 3LUFA 1GG8A 3C3YA 1CF4A 1VBMA 3C3AA 3UHAA 2ZT5A 1URQA 4UB6E 1E32A 2HHLA 2OBBA 4TSFA 3GRCA 4U2CA 1TEVA 1GAEO 3I04A 1HT2E 1QU3A 4DNQA 1QZ3A 3EBPA 4QXRA 2RAVA 2TS1A 1QIDA 1XRPA 1ZA2A 2QMEA 1M6NA 1D0SA 5IKMA 2IDMA 1X3SA 4EY8A 3LCJA 1IJDB 1NTMG 3KWLA 4M1OA 4DQXA 4E6PA 1NTOA 1DJQA 4Z4GA 3C97A 2CE7A 1SG9A 2HEIA 1YR8A 1LU9A 1GYQA 1UBNA 1QLED 1SQPD 2AZTA 1WXGA 2RGNA 4GX5A 1T8YA 1Z0FA 4KQIA 5F2KA 1GTG1 4L07A 3FKSA 3QHPA 3ABSB 4RYDA 3Q2OA 2R68A 4EPRA 5AVZB 4Y2TA 2Y3IA 4HLCA 4UD2A 3R3XA 1VHJA 1XTVA 1FUKA 3UJ6A 2GUSA 2B1GA 4PV1C 3ZG6A 2IYOA 4CG3A 1MENA 2WEKA 4PICA 1N7LA 2IHVA 4BFZA 1ZH8A 4XWGA 2FETA 4BFXA 3IERA 3NANA 4WOJA 1N6NA 4GEGA 1Q0LA 4DEYA 3CUEF 3DDWA 2ZBPA 3TCNA 1I7QB 3ZNNA 3CA8A 4Z4HA 1FUEA 1JFFA 3IRVA 1VMIA 2XVZA 4E5MA 3P2IA 2BDUA 3AEAC 5FQNA 4IYRA 1OA0A 2FBWC 4I4CA 4LK2A 3EZFA 3FI0A 4XM1A 2ONCA 3VZPA 5B3KA 2PR2A 3VZDA 4ZDIA 4JC4A 2C2XA 3TEFA 3OWHA 1T5DX 1ZJZA 1MQAA 1ABFA 2CFOA 3INRA 3K0FB 3M0EA 3THRA 2C8JA 1U3FA 2NV0A 2CD7A 3GX1A 1YJNP 5HP4A 3FBGA 2PA3A 4O0LA 1YSCA 5B12A 2AX3A 2PSEA 2RHRA 2GF2A 5AK3A 5IJWA 3NMUF 3BYZA 4EM6A 1ODSA 2Y0BA 3CLQA 3FD8A 2OD9A 2RIRA 5CLQA 3V8VA 5M34A 1AX9A 3DF9A 1EUYA 5JASA 2B89A 2GZ3A 5C39A 3C3JA 2NUPB 3GDWA 4HN4B 4G0UA 4K9LA 5LJIA 1DGQA 3BERA 3IH5A 1G41A 2BFFB 2Y99A 3G2IA 3NV9A 4QDUA 4XDHA 3HL0A 3OPVA 5LBUA 3Q8LA 5JD4A 1AZSC 1V4NA 3AFHA 1O89A 3UGJA 3FPJA 3FNEA 3FY4A 3U81A 5DNWA 1JG3A 1T0BA 3E81A 2HF9A 3NLLA 5AI8A 5EJ2A 4H13C 4AMUA 4RM3A 1WEKA 2R6CA 3R7DA 2GUWA 2ROQA 3BMQB 2H59A 1QIFA 2YV3A 1JTHA 1M8KA 3LXUX 2A94A 5AVKA 4F1KA 5K20A 5T41A 4ZT2A 4J43A 1WMAA 1UKZA 1VMDA 1SVLA 1RC0A 1XEXA 2H5LA 2RAFA 2WNHA 4HTAA 1W0KA 4JYAB 5D1HA 1Z35A 1E4VA 4M6WA 1CUWA 2AOXA 1Y4ZA 2X4GA 3PHHA 5AJTA 1VHTA 5E4YA 1TZBA 2QTNA 4M1SA 2YVAA 5DPMA 1N3BA 3SOPA 3ZK9A 3QKUA 5HF6A 1P73A 1XEWY 4JDPA 1GDHA 4H17A 3A0BH 5DHFA 2QE6A 4D82A 1NHGA 3R4CA 2GJ4A 2ZXEB 2DFTA 4YTEA 3MTJA 1Y7HA 4IMRA 2JFZA 1M67A 3JR3A 4X20B 4BJ1A 3AR5A 1AS3A 3NS7A 1U2DA 2OORA 4GPBA 1L5HA 3PITA 1HTBA 2Z5GA 3QA3E 1P84H 1N4AA 4EPTA 4L4YA 2A8YA 1A95A 2V7QH 3A70A 4UJ5A 3ZE2B 4M37A 4CUKA 5HTOA 2NTNA 1I1NA 3FHJA 3QF4B 4IV8A 5D1NA 4E11A 5JFGA 5G4LA 4XGNA 4K2AA 2WKPA 3WA6A 2VKQA 2G4LA 3DCNA 2C7PA 3DCIA 4JBZA 4WY4B 3JWPA 2QRVB 3LH5A 2DFKB 2FZGA 1EX6A 2MT9A 4M87A 4DHWA 3AU9A 5IDWA 5JJBA 3QE9Y 5EIBD 1FP7A 2DY1A 2XOKD 1QG4A 3CVXA 3ZHVA 4CR7A 1A02F 1D5WA 4QRHA 4NX2A 5HGXA 5HJ5A 5LM3A 2X1HA 2KWIA 4HTFA 2V45A 3GLMA 3NV7A 2GZ1A 4Q4HB 2G09A 2CMGA 5GAJA 3VAYA 1C5KA 1DX9A 2GAIA 4IIXA 5IN4A 4HOYA 3F78A 2V5AA 2W4IA 3X2EA 1SC4A 4RTJA 4BZPA 3ZBPA 4G5GA 5H82A 2JEYA 3EXFB 4H1TA 4LSWA 2GD6A 2FWBA 5B7NA 1CULC 3AECC 1CP3A 1ONNA 1A1SA 2VDNB 4RVGA 1SG0A 4RELA 4EG1A 3QVSA 4S0ZA 4OHFA 2QAGA 1EX7A 2GTHA 3H1IE 2J0EA 2O4CA 4NBRA 4W7SA 1N2ZA 4Q9LA 1DT5A 5EE9A 1JZSA 1P0IA 2JBHA 1NRWA 1FOSE 2FX2A 1GZSA 4OBWA 1KB9E 1B6SA 4PFQA 2XTMA 3UXMA 3SS9X 5HKKD 4G1FA 3E6AA 1EK1A 1EB9A 4HNAB 3BCCE 3RWMB 3IE1A 3DMNA 2QJWA 2C4TA 1AVOA 4N3BA 3IQIX 3NAMA 4D79A 3OE7D 3TH5A 2X2OA 1AVTA 5AVQB 2OAP1 3AVVA 3NYQA 1NQVA 3ZVNA 3U40A 5K4GA 1E9FA 3CX4A 5HF5A 2QV0A 3FCAA 4G01B 3VFDA 3AM1A 3K9GA 2C83A 3L8CA 1P7CA 5EJAA 4WLUA 1FLNA 3KZIE 1PSDA 1PZFA 2YHAA 1P9WA 1FUIA 1XVAA 4EJSB 3ZVMA 1U7HA 5EIXA 4LSMA 4DJDC 1PBTA 4RKFA 4IHAA 5KWIA 2F8MA 4B3JA 2PRYA 1V5WA 1F60A 3WNZA 4MW5A 5LQCA 1J07A 1WAMA 3A4LA 3JRWA 1DBVO 3DMFA 1R10A 5APQA 1C3VA 4BXLA 1XCMA 4FFDA 1YVDA 2I99A 2PBLA 4JVNA 4PU0A 5T7BA 4I2LC 4MVXA 4P35A 4JQ0D 3QFSA 3GLFB 1XU7A 3W0LB 4CTKA 4RABA 2JKVA 3DE7X 4ZVUA 1VQ9P 1TB4A 1X2EA 4ZU1X 4ZVKA 3R77A 3U37A 1CVRA 4EG4A 3D02A 4X8LA 5I45A 2UZIR 2A1IA 1I0ZA 4U7JA 1KERA 2GZRA 1D2EA 2TMYA 3C3EA 1PVVA 3I92A 3LDUA 1JLHA 3WSWA 1G2CB 3NUQA 1SU4A 1EVKA 3D6JA 3Q9NA 2PJZA 1K7SN 2NZYA 3E7KA 4AZ0B 1V7CA 1UBMS 1I4TD 2BUCA 3JQGB 1QOPB 1SC1A 4F8EA 2C7OA 3R6DA 4KMRA 4YFYA 3UXEA 1LSJA 2D0OB 2UZAA 1FFXA 3H1LD 2GARA 1XWWA 2ZJ8A 4EFDA 2O7VA 3B7GA 2ZYWX 3SLRA 3HE5B 1KYZA 1W5EA 2XA9A 1U7DA 2HRBA 3CXHE 4JXJA 4QPZA 1H8AA 3CRNA 4AL4A 1PVOA 4BRYA 5T3UA 4IEEA 3WLEA 1WUIS 2VHJA 3O8ZA 4EKEA 1EVIA 3DR3A 4DR7B 2PUVA 2VCYA 2Z9CA 5CB8A 1ATIA 3H9QA 4BO1A 2E4ZA 2CN1A 3TCKA 3U19A 2JS7A 3M4NA 1IFPA 1XL1A 2IUUA 1YQGA 4KPFC 3TOSA 4YJHB 2J41A 1C2TA 1EJ6A 1T6ZA 1YR2A 3DM9B 2QNBA 3NCTA 4N0DA 1F8FA 1NUQA 2ET6A 1JWAB 1UBOS 2VJCA 3A31A 3TLEA 1KTIA 3H97A 1SZDA 2A0YA 5AK0A 5KUTA 1PLJA 2AN5A 3CXHH 1N73C 1I9CA 1N9ZA 1O8CA 1POWA 2XT6A 3B3FA 3KQQA 3O8QB 1T5OA 4DS3A 1ZJJA 2KI7B 2QR3A 2W6OA 1Y37A 4HD8A 4PCVA 5EKTA 5JSYA 2HDNB 4XWAA 1G6HA 3L71G 1TO1E 2W37A 2HODB 4W8GA 5C8VA 2C5SA 2XHEA 2QTMA 5JVDF 2IZ6A 4JLDA 1JNXX 3OOJA 4CIWA 3AR2A 1ZVKA 1A2BA 3OCYA 1SKUA 2P77A 4R8VA 4X92A 3L92A 2B87A 4ZYWA 2YFYA 1D1PA 2ZTLA 3IQZA 3L0CA 1A5SB 1EYZA 5A6VA 1SHJA 4CIVA 4CV0A 1NN0A 1E5TA 3CY6A 2A45I 3DZGA 1HYQA 4ZOLA 3A2AA 1MC4A 4CWAA 5HJ7A 2JGDA 4UQOA 4BMXA 4JXKA 3SJAA 4OMFG 5EJ6A 5AVTB 1Z82A 1IPFA 1FFEA 3O83A 5FPTA 4QL3A 3D6FA 1SKYE 3G2NA 3AI2A 2W2QA 3JYOA 3STUA 2FN3A 3WFJA 1KP2A 1ID8A 3H1EA 1A82A 2AHOA 4XM2A 3PL1A 3UXHA 1CY8A 2GFHA 3J81A 2HK8A 2VRSA 1FZCA 1LTSC 3KAQA 1JEOA 1K3TA 4MGKR 5AYVA 3F2VA 5IVIA 1KFBB 1U80A 3K9FC 3G5AA 2ONJA 1Y5RA 3FPKA 4A8JA 1Y8QA 4C7OB 1RJGA 1GFSA 4PAMA 2E76C 1WULS 4RQUA 4IFIA 1UDAA 4ZRMA 2XRYA 1HYBA 2ZBVA 2C2ZA 2A06D 3TOZA 5AQEA 2Q9BA 2KYRA 3EPRA 2IYYA 2FFDB 2NU9A 2E87A 2PO5A 1YCDA 2JNWA 4U7GA 4BO4A 2ECPA 1KJ8A 1V43A 3ACCA 4GLLA 1XR3A 2WFAA 3HU5A 4S3MA 5B7GA 3EMDA 1W36B 1NL3A 1J2JA 2ZM5A 1Z17A 4UOQA 4E03A 10MHA 2V7VA 1ATZA 3HYCA 3RNOA 3ADPA 4HGPA 1EFTA 3BN3A 4IWXA 1A0OA 2PMWB 1IZ8A 1O94C 4DNOA 1QV6A 1O0CA 2D5IA 2F64A 3BXZA 3EZXA 2NUPA 3ZE0B 2H29A 1W96A 1Z7GA 5FL3A 3VR5H 2P9TA 5C4GB 3TRDA 1FDVA 1P2TA 3VH2A 4TYMA 4B34A 2N9BA 5I48A 4B6FA 3H4TA 3LA6A 1F2TB 3K4HA 3EVGA 1T9AA 2QENA 3NHSA 2QHXA 1NGSA 3B5EA 3IPYA 5TR9A 3GJ3A 1I7SB 3N6VA 4AY4A 4ZYYA 3ORYA 3MBKA 3W9SA 4D3YA 1OH6A 2C88A 2IYZA 1WABA 1MGPA 3V4ZA 4BX9A 1JJAA 2O2HA 4O2AB 4KREA 3PUWA 1RBQA 1WF3A 1XB2A 3EY9A 3C1UA 1RY3A 3R0VA 1TFRA 3NDJA 5L53A 2O7QA 1Q2XA 3ZJTA 5E9AA 4OWFA 3A25A 3IESA 1IXSB 4Q37A 1U99A 5EPOA 4EFKA 2YXDA 2DHQA 4TVOA 2G1JA 1AQYA 4YQZA 1IJBA 3WYEA 4ZAXA 3NHPA 4ZEOA 4QNNA 1RXYA 1Z13A 4B8ZA 4XEHA 4BZZA 1UXJA 4D81A 2XQIA 2FI1A 1CUGA 3CCEP 1P1BA 2JFYA 2ZJFA 1BMFA 1MB2A 2I2XB 3CKKA 3MJEA 3RF6A 3SIPA 1H4QA 3TR0A 2BKVA 1EM8A 3PR2B 2VPIA 4QLOA 3K30A 4RKEA 3PGXA 4UTVA 4KDFA 3GUVA 3AHGA 2ZJ7A 1UP7A 4CM4B 4QOHA 2V4ZA 3JCUE 3M33A 1FX0B 1NMSA 3BSYA 1II0A 3GG9A 5L6MB 2QVGA 3L0IB 1A9ZA 3LT2A 5BT9A 4PYMA 3AHHA 2QKYA 1H0SA 4JSRA 1C30B 5LDHA 3W5AA 3OURA 1GGEA 3BT7A 3MUDC 4L5AA 1A7JA 4TXHA 3RTAA 4HNUA 3QYPA 2CVHA 4D42A 1AQUA 2I1WA 2PQ0A 2NRGA 4ZT4A 4N8SA 3RTEA 1BS2A 1MV8A 5KTTA 3HE3A 3I53A 1JKIA 1HSZA 2QROA 3BIJA 3PU6A 1JSZA 1L8AA 5DTQA 5G0UA 3GUHA 4KUGA 3T3PB 1SUBA 4Y2YA 2G63A 2PRRA 2VUHB 5HJEA 1XYYA 1A9XA 1L9XA 1MP0A 3A1DA 4D9NA 3SIWA 2C78A 1ZHOA 4P0PB 4MGYR 2Q0SA 3L73D 5ELLA 3GMTA 1U1GA 1XAHA 1U2ZA 4MN4C 1DOZA 2PN1A 3GRZA 4S12A 1USWA 2J59A 3AUKA 3HKEB 2O8VA 5PGMA 1VQMP 2GYWA 2JI8A 4U7FA 2HYNA 1SUWA 3V4WA 2MSEB 1ONOA 3ZZUA 4XPZA 3DZFA 5FO0A 2XE7A 3HR4A 5JXWA 1LY1A 4YI3A 4YRRA 3L43A 1OFVA 5KJ6A 1Z29A 4MWEA 3PUXA 3RLFA 3N2YA 3U7QA 2PRJA 3FPAA 1GPJA 2RH0A 1L4AC 1ZSVA 1TMOA 5CCHC 3MGNA 3PC4A 4P4TA 5DBFA 3RYIA 1D2CA 4EG5A 3BA6A 2WUWE 1DHTA 1RRGA 4OG2A 5DCUA 1F12A 3H1JE 5C80A 4H0CA 4L4XA 4Q02A 4N8DA 2WQ7A 1SC3A 2IYAA 2QV7A 3EZ2A 5CMZA 1RU3A 3RWBA 4HSEA 2XW6A 3QX3A 3V5NA 2BFFA 1M7GA 1OX5A 2FP3A 2WKWA 1UAAA 2WMMA 1T2AA 4ZXPA 4BWYA 4Q7MB 1RI4A 2FUG6 3V80A 2M98A 1T6BY 4CKBB 4IDOA 4IJUA 5KC8A 4QFDA 3H1LJ 1VSTA 2ZI6A 3EY4A 5FBZA 4F3RA 1OZAA 1YJQA 4U8HA 5JNUA 3MP7B 1CIVA 1WE2A 2VH1A 3FCSB 4U1RA 3V2RA 1LNQA 1FZCB 2ZU6A 3GZ4A 4BRUA 3DE5X 4POOA 1JTHB 4ER3A 2EWMA 4O59O 4MUIA 3HV2A 1JR2A 1PFUA 1UF9A 1MVNA 1XTKA 3OZUA 2Z6UA 1HDYA 2QE7D 3S2UA 4PC6A 5F73A 4B86A 1E1YA 2PJUA 4OQNA 3W8EA 3ZXSA 5A9SA 1ID1A 1PYOA 1NW5A 1UDWA 1Q0RA 2G5PA 4IRXA 5IZCC 5TB5A 1SOUA 1IVYA 3FDJA 3OJOA 1DKLA 1GPWB 2ZSIA 2LUOA 3PIIA 2Q4EA 1DMRA 1YVUA 4Q18A 4URWR 4ZQBA 4ZAZA 4F60A 4B45A 1SEPA 2JLYA 3PXEA 3PDCA 2A9QA 3U4CA 4A9AA 4KR3A 3DMHA 4LF8B 4HC4A 4YJGA 1LDEA 3ABOB 4MS4B 2J3LA 2A06G 4B4KA 1VA5A 2HJVA 1APBA 4HNGA 4QQKA 4ZAGA 2P27A 4CQJA 1T9BA 2QRHA 4FT2A 2Q07A 2QLFA 1LUAA 5F4BA 3RS7A 2RK3A 4PHFA 3CH4B 4WLFA 1HL7A 5IXSA 1LV8A 2BEJA 4TKUA 3B1KA 1M6HA 3TJRA 5DP1A 5EQDA 3CCFA 1FLAA 4DG5A 3OM9A 1ZMXA 3WGMA 4HGYA 1WX1A 1MH1A 5ELMA 5EUBA 2VYCA 3DO6A 4DPKA 1GZLA 3E7PA 3JSVC 5EIFA 4DZTA 4B3GA 1U4NA 4OLFA 1CR6A 4NY1A 1NXSA 2G36A 4MUNA 4PO3X 4RHUA 1N5LA 2OFOA 3BATA 3GVHA 5F78A 4KAJA 3WA7A 1TECE 4DDVA 2X3FA 3ZDDA 4RA9B 3FWLA 3D0KA 2WG1A 1WB4A 2ZBFA 3N70A 4L4RA 4WK6A 1C1XB 1H2XA 4RFLA 1SXQA 1KARA 3BWMA 4Y28J 4XLTA 2RHGB 2OP1A 3KHUA 4UEJA 5KKZC 5GZ3A 1C8BA 5KC9A 3JARB 1P84E 1V95A 1ETUA 5JQGF 4C7XA 5ISMA 3OFSA 2PZKA 1Y7TA 1SQBG 5BN3B 1YRWA 3RQSA 2Z2YA 4AKIA 2QAGB 2ETXA 1P3DA 3K8YA 4LF6B 2I4LA 5M5BA 2ZJ3A 5HA5A 1M2JA 3E05A 2HSGA 3FJYA 4LRXA 4NESA 3QI2A 3A2LA 3G8CA 5F5NA 1Y3CE 2EFJA 4DLAA 2HGZA 1S5PA 3GNQA 1FTGA 2C5BA 4QUHA 1M83A 2J48A 1GTJ1 1R5NA 3G0OA 3Q8XB 4EAQA 3CVJA 1Z8DA 4OGKA 5DISB 4DJTA 3U3XA 3F7MA 4HXEB 3LTEA 3WGYA 1Z5PA 4RJKA 2OHHA 1ISPA 2GEKA 3ROFA 1TAGA 1TM2A 1ZN9A 1KYWA 2H9YA 2OWEA 3AIKA 3I4CA 1JXQA 2W83C 3KLBA 4JB2A 2BMWA 5AKKA 1SQQJ 3WRWA 5IT4A 4P33A 3W8RA 2C3OA 4ATNA 3JPYA 2IC5A 4S1OA 4EA6A 1WKVA 3DZCA 2EYQA 1XPUA 2PR7A 4MMYB 13PKA 4TLDA 3ZV4A 1ZRNA 4RMJA 4ZCQA 1ZL2A 4ZMSA 3AR7A 1LLCA 3H1JD 3DTVB 2WSSD 3JYQA 3KU4A 4LQCA 1DXOA 1KAOA 1SXGA 2PH7A 3HCNA 3R2JA 1NRIA 4UB8E 1L1EA 2F43A 2M6RA 3JCZA 3NBMA 5I7AA 3SPXA 3WB9A 4YPOA 2OCLA 3H6PA 3ONNA 4BVHA 2XKMA 1B1CA 2P2NA 2FR8A 3E7FA 1ZK1A 3LA8A 3TQRA 5DN9A 4B79A 3PWZA 3OC0A 3M4JA 3UOWA 4HLNA 3KZMA 1DUSA 1O7JA 4X91A 2J31A 4KJMA 3CJTA 3JQCA 1JA1A 4FKZA 4V2UA 5DXJA 2G1AA 3G2KA 1ISRA 1L8QA 1N6PA 1SKQA 2R4UA 1PEYA 1JAZA 1PT8A 1Q84A 3BAFA 1LPOA 4F3CA 1JH8A 1NTKJ 3KALA 3SD7A 5KIAA 4PFJA 4E5DA 2YMYA 2M5AB 1G8JA 3TE6A 4OM7A 1KP3A 1PL5A 3L37A 3KQKA 3VR5A 1G6KA 2I3ZA 1ORIA 2HMWA 2EF1A 3T4XA 5CFQA 2GEJA 3PE6A 5B1SA 3B5ND 1FFWA 2YS7A 2EARA 4RHEA 4RF5A 4E22A 1Q0PA 3F49S 1N2XA 1FSFA 3OIDA 1VP3A 4YO7A 2B88A 3N0XA 4BNUA 2QMUA 3SFZA 1SZPA 3U1TA 4GYJA 5LB4A 1ULUA 1CF2O 2P69A 1JLLA 4YT4A 5MDHA 2ONZA 2NO4A 2RFLA 3D6UA 3OJFA 4JJAA 4O0MA 2HA7A 5E6SB 1MBZA 3Q41A 1SCKA 4TRNA 2PPVA 1NX6A 3Q98A 1JU9A 4JEIA 4M7RA 1CB0A 3BL5A 1D6JA 5DWQA 4RVCA 3TQCA 3TQOA 1A8PA 2HO4A 3ESYA 3QM1A 4AMBA 3SVLA 1BN6A 3PC8A 3RVSA 2JGLA 3BL8A 2IZZA 3HKDB 3JQ8A 3MS7A 1C9JA 2O8NA 1LS1A 2YV2A 3ZWDA 1XTBA 1YVEI 1YH3A 2VRCD 4D9JA 4DG8A 3BL6A 4C7RA 3EVDA 1XF9A 5HZKA 3VTFA 2LP4Y 1AV6A 3HTXA 4WZ6A 1GCUA 4JD5A 3HTKB 1IQRA 2X9VA 3VC3A 2H88C 3DVAB 4IDGA 5GQSA 3EJ6A 2VZEA 4NQRA 2O3SA 5K3CA 5DLQC 3PK0A 3TUIC 2VYVD 1XMPA 3DDSA 4DIKA 3TOXA 1T8RA 4Q6BA 5AW9A 1E9DA 2I34A 5EJMA 1TM1E 2FZLA 3MNFA 4YEDA 3TGUJ 5IJ9B 3EPJA 1BMFD 2WK1A 1PZXA 1XLWA 2NXJA 3N3BC 3C6KA 1A9TA 1CEEA 4DNFA 5AVTA 3LDAA 4E7OA 5LOVB 1BFKA 1JEYB 3QVTA 5JCJD 4YMIA 4TKUB 4XQCA 4TT3H 1QIJA 3LLSA 4AG3A 4PYRA 5AW8A 2IZ5A 5IH7A 3MHVA 1SQXK 2YJ6A 1UWKA 2F3TA 4OYHA 1TCUA 2QTBA 3HN6A 1YR6A 2HHAA 5AW6B 1MOSA 1T1GA 2HJHA 4KH1A 3PFBA 4U7HA 1C29B 1PR2A 4N3CA 4RPHA 4Y7DA 2NU6A 4W5HA 4LE1A 1P0PA 4RAOA 1Y8QB 1AH2A 1P17A 2YXEA 4QVKA 1OC4A 2GN6A 3MRVA 5DNAA 4HH4A 4BGEA 1RPTA 5TNXA 1IN8A 3GU3A 4FQ8A 2JHFA 5H4GA 2YV1A 3O82A 1MZ9A 5CMLA 4IFDK 2ZTHA 3MXOA 1NQUA 4XW2A 5AM5A 4EZIA 4F6LA 4EARA 5KEIA 1EQUA 2KB0A 4YTPC 3K0EA 4X1YA 2VA9A 1NJ5A 4ITRC 1X92A 521PA 3KCNA 1V3TA 1I51A 3H2BA 2RMZA 4CM9A 3G9ZA 1E1NA 3HYSA 3NIFB 1NKVA 3GFOA 4CDMA 4CM8B 2O8FB 1JQBA 2P40A 2QN6A 2WUEA 4IDEA 4TYQA 4UMVA 3GF7A 2DEUA 1O97D 1YZFA 4XGKA 4JL5A 1H2WA 4M9RA 2NSLA 3K0BA 1W75A 2C9MA 4PAWA 4K03A 3HZZA 1JMBA 2VWPA 3I12A 1K6JA 3HUFA 2AR0A 1QTQA 3KSUA 4W5WA 4C01A 2CVOA 1V4BA 2QTCA 4UFNA 4WNIA 2PUGA 3RK2D 4ZKUA 1NYHA 2J59M 1DELA 1F2TA 2DQ4A 1KMMA 1H2YA 2OCXA 3OTWA 1IMOA 5H0IA 4CLHA 4QG3A 4FE4A 3OBBA 4UBNA 3EEBA 3STXA 1L4AB 3W2HA 3UFBA 5APXA 4MUFA 5BW4A 1AIPA 3ZU4A 1JHZA 1SVWA 3D3WB 2A88A 4JASB 1N6RA 3BRTB 1JUDA 3VPHA 3D5QA 5H4HA 3U62A 2F59A 2P0YA 3KCQA 4PLVA 1DQPA 2HIGA 3N1UA 3N28A 2B7LA 2ZEJA 2XUQA 3LM8A 2JLVA 3VR6A 1QUEA 2JGAA 3B1JA 4O8ZA 1L7PA 3ICPA 4RXUA 4IIBA 1YJCA 3MD9A 5TSDA 4C9BA 5IX8A 1W5TA 1J0BA 2QD4A 5LUAA 3GGCA 5DWDA 4HPWA 3H87A 3HCPA 4Z7OB 4AUWA 3RK3B 1XKQA 3DS8A 4RNDB 1GKYA 3RC9A 1FTYA 3B3AA 4ENPA 2WE7A 1PJQA 2HU8A 2W2OA 4KR0A 3T4UA 1CU1A 3L6BA 3A10A 1EQ2A 1PJAA 2H2DA 2SNIE 2BI7A 3K0HA 1HORA 1KDTA 3RE1A 4JUBA 1XALA 2MSCB 4QDZA 4ETIA 1J8YF 3GBVA 1G0OA 2VCHA 3H1TA 3LFUA 1Q14A 4UMFA 1MOPA 1QG2A 2Z1DA 1FDRA 3MRTA 3WKBA 4PWZA 2ZJBA 3JYHA 1KZGB 4B5LA 1PNRA 5ALSA 3BCHA 3DEFA 3ZD9A 1O6CA 4F9GA 4OI0A 4KAFA 5DV9A 5JI2E 3WRYA 1DIGA 4GXRA 1R6XA 3BIFA 4WWHA 3QUSA 4P0TA 1HDRA 3RYHA 2XJ4A 3GDOA 2JHCA 3PUIA 4B46A 5J4YA 4OAPA 1EK2A 2Q6OA 4V0QA 3HN7A 3NGXA 3DQQA 2IFNA 3WWPA 1EFVB 3GR6A 3QFRA 1LBTA 1T9KA 4OH1A 1VSVA 5THQA 2CMFA 4F8JA 1C4WA 3H1LE 2BMDA 2XD9A 1FYWA 4N0EA 3PUJA 1WZCA 4M38A 2GHQA 1LSSA 4H77A 4OP3A 5BSUA 3VVCA 3MJFA 4DADA 4OK3A 4DDHA 1U6JA 2R751 1ZWLA 3GQVA 3OHSX 4P7JA 1NV8A 3SYMA 1YIOA 4TWBA 2XB4A 3CLSD 2CY0A 2TSYB 4MJXA 1T6AA 1RYBA 3IRUA 5EHNA 3WLOA 4TN1A 2A14A 2R6JA 4QREA 5B6PA 1AKUA 2P3LA 5HFJA 4G6ZA 3GH1A 2NG1A 4H0LD 1HLGA 1HF3A 5ADUS 1BDIA 4LX8A 2EQ5A 5FEUA 3G0HA 2XB8A 3PD1A 3MWEA 3TAXA 2Q7DA 1AK1A 5AICA 3PEEA 3WJ7A 5L3SB 5BR8B 3PC6A 5DYIA 2HF8A 1QE3A 4O1HA 2VTBA 2BDTA 1CUVA 1GU5A 2PUTA 4JI1B 2QLNA 4N0MA 4A1OA 3OTHA 2O01N 3TSOA 1OFUX 1LQUA 2C7RA 5HQTA 1KYOD 4BFYA 2E18A 3RC1A 2YHBA 5ESRA 3GJQA 2AKEA 2QRQA 3ZBTA 4MW0A 1S2OA 1QPBA 5JS8A 3EIEA 1NMZA 3EFEA 3QLJA 2CB9A 2GPAA 4RKWA 3T1QA 2HMUA 5EZSA 1DLIA 4JVMA 2O54A 1EESA 4IX1A 2NQTA 1ZU4A 1UPTA 4J75A 5I7RA 2PL5A 5BQ3A 1DXQA 2NV6A 3BCCD 2DUMA 3GF3A 3TD9A 2D2CB 2OHFA 1UKVY 4WUTA 1QAMA 2NSYA 1X38A 2AYZA 1KB9D 2GCEA 5JWHA 1O1YA 4V1CI 1WVMA 2EWVA 3JVIA 3S1AA 4Q19A 4CDGA 1SXJB 5EHIA 2UUCB 3H1ID 3HB5X 3OT4A 1KOLA 1H5UA 2XA1A 1DIHA 3FYDA 1TA9A 2J5KA 1QGOA 3CF6R 4FX2A 4C1BA 1XMQB 1RC1A 1GNPA 2PGJA 2J9FB 3ZDXB 4JP1A 2KBFA 3UN1A 3AR4A 2XE8A 2NM0A 3QWIA 4ZRDA 3ZEIA 2E4AA 2YY7A 4AJLA 5CYGA 3DMTC 2VNAA 2OYIC 3EVFA 2IT1A 1ZH6A 4EHDA 5EIOA 1NJGA 5JRZA 5K8IA 1ZBQA 4LIPD 3BA1A 3VYTB 3HA5A 5JAPA 4C1NA 4D98A 1Z28A 1E4EA 1P6QA 2VAMA 4PX2A 4UAJA 1G0NA 4LJLA 3ICVA 1RTTA 4GGOA 3GN2A 2VOJA 2ZIUB 5ESXA 1Y63A 5JEEA 3O4IA 3T94A 3E5MA 4BAZA 4ZDKA 2ZYDA 4IUBS 2PZ8A 3ZBQA 2O5VA 1FSPA 1WZUA 4Z99A 4RHYA 2BRUC 4FR2A 2ACKA 3E35A 5FBRB 1E2IA 4MRPA 1QJCA 1NNI1 4BS9A 3CUWA 4D92A 1AMNA 5LDGA 4Z1MA 1GN8A 1CJTC 3ELUA 4IDAA 4PLFA 4B9AA 1YT5A 5F5LA 1G8HA 1HXHA 4GPAA 1P5FA 4NAUA 4RSGA 3VU1A 3FF4A 4QM7A 1U2TA 4M0LA 3CM0A 4C4XA 2C1XA 3LSYA 4LQLA 4PGHA 1FFCA 2A9VA 4P7KA 1PFQA 5KTBA 1Q50A 4LDAA 4LSGA 9MHTA 1SFCB 2C9NY 1KY5A 5AVYA 4LK3A 2XU6A 2C4UA 2Q6IA 5APVA 3DE3X 2FMIA 2DOKA 3IKMB 2YV4A 4EUKA 3GFBA 2A58A 1MIOB 2PK3A 5ENDA 5A4AA 4B82A 5DVZA 3MQ2A 5G4KA 4G1MB 1BOOA 1XE3A 1BKSB 1C1XA 2HA0A 1PG5A 2OZVA 2YOFA 2Q6VA 3JALB 3S7TA 3RAEC 2PX5A 2ZUVA 3OM0A 4XE5B 1L7QA 3LAWA 1O6ZA 1XZNA 4PLHA 1USEA 1QVGO 1QJ4A 1QWSA 2QI9F 2VQSA 1TCBA 3DBHB 2WA1A 2ZVOB 3WWCA 1PZGA 3D2BA 1M0TA 3R41A 3JASB 3G79A 1X42A 1GTRA 3PD7A 3ORRA 1JMMA 4OHWA 2IYSA 3DAHA 1XJ0A 3NC1C 3IEMA 2R1TB 2YJ5A 5JCZA 5HVNA 3SC2A 5CX4A 2VZ8A 3NTXA 2WLTA 1ZKMA 4M1QA 4ARAA 5AM0A 2XKAA 2ZAIA 2C7GA 3R1IA 2PO7A 2C2MA 2ZJ0A 4ZFNA 4UHJA 1GSAA 1WRGA 2DPXA 4UB8H 2O6LA 1U02A 4FFLA 4ZK6A 3RS3A 1CW5A 4K9DA 2G28A 2J9GA 4NKRA 9ATCA 3VI4B 4LXQA 4KN5A 4L50A 4LF4B 1I5OA 5EPUA 1ZD9A 2QR5A 4UEQA 2R6GA 4Y2GA 2L2QA 4V0NA 1NW9B 5G0SA 4ARBA 2CLDX 3D43A 4L16A 5TDHA 1W19A 4WBSA 1NWCA 3GRAA 1LPPA 3SBDA 5HPYB 1ND6A 2ZUWA 3ABZA 3F7TA 4B3SB 4YP5A 1BTOA 1W47A 4CKEA 4Z7JA 1NQ5A 2SKDA 4XH9B 3IP7A 2FRVA 1T4DA 2P1JA 4KQMA 5EQJB 2YJGA 1CQIA 5BSKA 3WMGA 1GAWA 3L71E 3BCUA 3W77A 4BVJA 1QF6A 2BZ0A 1E2DA 1LTTC 2KNCA 3CT4A 2GYVA 3SWFA 3ELYA 2V7PA 5JVDA 3N75A 3A11A 4R2KA 2FZ4A 1MDFA 2XZLA 4XDGA 3IKLA 3I37X 1VDZA 5D7BA 3RYFA 3U3MA 3UHOA 5HX7A 5L3SA 2VHVA 1HQKA 4D99A 1JKJB 1RE0A 3T35A 4G0NA 4L6IA 1W1WA 4M0MA 1BD4A 3KEQA 1SHLA 2WSFH 3N2IA 2ZS7A 2J4FA 4MYCA 4NYIR 4MIYA 2FMUA 5E9WA 1N5RA 5KJ1A 2H4HA 1AKVA 1DQYA 3L0SA 1U28A 1O54A 1XEWX 4GZMA 5DNDA 1NUAA 5C1BA 4ND8A 5B3LA 2QT9A 2CFCA 3EA0A 4QM6A 1SQPE 1KDPA 4R5HA 4EJMA 3H11B 1XI2A 5T8KC 2WSSH 1GKKA 3FOCA 1T26A 3GLHA 3GAAA 5FI1B 3ZHRA 2RG7A 4D9KA 1SQVG 3GRVA 3K0AA 2ZRIA 4F4JA 2E89A 3D8NA 4J1NA 2V54A 3QQPA 2OV4A 4XJTA 2VC2B 4G9EA 2E37A 3F46A 2FN7A 3GJ5A 1WS6A 1CZNA 3IMGA 2OQRA 4LBZA 4YECA 1IRXA 3T7SA 4CKWB 3GNLA 4QEZA 1P7YA 2DKOA 3MUNA 4QARA 1M34A 3S1AB 3A9TA 1Y42X 2X0FA 1XKLA 1OR8A 1YU9A 3WYGA 1B16A 1V6AA 2ST1A 3QYJA 4A5SA 3MTBA 3ZE9A 1KVQA 4DMFA 1CUXA 1N2EA 4WNAA 1DX4A 1FDSA 3DXYA 5DGXA 3T1YB 1FPMA 5HS4A 3T7KA 4ASUD 3G9RA 1RFGE 4LWQA 3FPFA 5LFAA 1KV4A 3BWDD 4G36A 4DC1A 3A1CA 5HRCA 1RZRA 3TQIA 1JDNA 3QHQA 4AICA 2DFNA 1T13A 3MC1A 4RJLA 3N7NA 1I2CA 1P4SA 1W85B 1WPGA 2GM9A 2PMKA 3KOWA 4M86A 4RZUA 4WZBE 4CZ2A 4IFFA 4PJ0H 1V4VA 2FPWA 4N49A 1YI2P 3AVXA 3T1OA 5CCXA 4OFBA 1EAYA 3GVXA 3EC2A 1XP8A 1ARZA 2PGOA 5E2IA 1P7PA 2FPPA 4H60A 3JSAA 3KQMA 4AO8A 1HX7A 3EXIA 4GZ6A 2BP7A 2Z04A 3ZWCA 2Y93A 4GMHA 3TJZA 4YXWA 2QT1A 1LDMA 4YWJA 3NWEA 3EGXA 2DWCA 1F4LA 2QW1A 2OBFA 2JI6A 3IVAA 1NJIQ 3II6X 1N2GA 3QW4B 4XI9A 3PJFA 1B2LA 1O5OA 3OEEA 5B4VA 5F51A 4MV8A 2WYOA 1QVWA 4UEWA 4LE0A 1KMCA 1OXVA 2J0UB 3C0KA 3W90A 4KUEA 4JQCA 2VBIA 4RZSA 3FETA 1ESEA 3M9LA 3L79A 1UINA 1V16B 1YMVA 3L46A 4G97A 5LN1A 2JLCA 4ALLA 3MT7A 3RSSA 2IDJA 4P08A 2BE7A 4H0LC 5DCLA 3QH4A 1L4AD 4TMTA 3TAHA 3TSYA 2OWDA 1IY0A 4HB4A 1JMVA 1YS4A 3ETJA 4ZVOA 1B3BA 1DBRA 2EF0A 4RORA 4QWWA 1LDBA 2VHTA 3M4ZA 4G56A 4ZQHA 4BB5A 1RF1A 2IDKA 2VK2A 2V65A 1R0LA 2JCGA 4LJ9A 1K8YB 5BSVA 3M6UA 4CTMA 1JEQB 3H5LA 4EY3A 3TNUA 5FTMA 2A0XA 2OQVA 4XCXA 1UODA 2REXB 3F9CA 4BLOA 3I73A 1RC8A 3IILA 1B2RA 1PNQA 1SVOA 2RJNA 1G2PA 2XZPA 3BWEA 1I0LA 1E2HA 1TZMA 3BREA 4BJ6A 4C7NA 4G1EB 3KQVA 2E74B 1A3CA 3A58B 3VR2D 2E4WA 2AMVA 2FYTA 2OV3A 4PD4E 2IYNA 1DFGA 2R6ZA 1IIBA 1EE9A 2V7BA 3BIXA 3QKRA 4LOAA 2CBGA 3KQLA 4LKRA 3A4YA 1REQA 4FJ1A 4RQAA 3A37A 1EXMA 2WDPA 4EUSA 2A4KA 1UCFA 2MR6A 2C94A 2IY8A 4ZMDA 1L5HB 3WDMA 4KV9A 1H93A 3QWAA 1NJ8A 4N40A 5TVKA 3WLJA 3E8MA 4OXQA 1A96A 1RYNA 2Y66A 3FW1A 4KRFA 1WOMA 1P7WA 3WNVA 3ITKA 1JA9A 5C35A 1P3JA 4JITA 3INTA 3TSIA 4MQLA 1EQAA 1YO6A 2WYWA 1A8HA 2WSSA 4NMHA 2ZBUA 5SY4A 4CFSA 5IRCD 1NI4B 1E96A 1NTRA 1SCDA 4OGQB 2IX7C 1C0EA 3HI6A 1OU4A 1RF1C 3F3KA 4B35A 1CW2B 1P75A 3ZNPA 5JFOA 4BAGA 2QUJA 3QQ5A 5JZVA 2XYVA 2HU5A 2KM1A 3VMAA 5E4FA 1QORA 1WB5A 2AWNA 3TINA 3SU8A 2CT8A 4DLNA 2WPQA 4P9NA 1GIAA 3AEQB 1XQVA 1J2RA 3VYSB 2DE0X 5A9RA 4KQEA 1O6GA 1OJ7A 2J07A 4UZEA 2LTAA 2HG5D 1UPCA 1R1DA 4NWIA 2YMQA 1II8A 3EARA 3IBTA 3MMZA 4X1KB 6NULA 2VPQA 3H7IA 2Q3HA 3ZE1B 4E4TA 3H16A 3CEJA 1OIXA 4EGJA 3K0AB 3CTMA 4PD4I 2HI0A 4ZANA 4GQIA 1QOQB 3U44B 1GW4A 3OQBA 4OJNA 1YS1X 3ABIA 2C00A 2FG6C 3EGOA 4TS9A 4X71A 1RRKA 2LR0A 1E2NA 2XDQA 3EH2A 3RSZA 4Z1MH 2AN3A 3RRXA 2G80A 3ZV7A 4EF5A 2OG2A 5HFAA 5JH7F 4K86A 3GEBA 5ERXA 4Q1AA 1Y6FA 3DAFA 2Y05A 1TZJA 3WIVA 1SCQA 1B42A 3IV7A 2XGOA 4YPFA 1L0LD 4YFVA 4C3VA 1ML4A 2WIAA 4DY6A 2ZBDA 5JTTA 2HFED 4IO0A 1ISJA 5AW4A 3A3PA 4G0PA 4CKCB 2DSTA 4QWMA 3RJTA 5FA8A 2E5FA 2COUA 3QKIA 3LL4A 3AW9A 3AWIA 3PFNA 2LWIA 3HFRA 4MO9A 2QN7A 2WPRA 4MS3A 1YYCA 4G84A 1FSSA 2AJLI 1SFCC 1EA5A 1I01A 1DG9A 2D62A 3RBAA 2F6RA 1J5PA 5C53B 4CQMD 2O50A 4CI0B 1BE1A 1JIUA 1FQOA 1S7GA 1X8LA 4EB3A 5IBRA 1S2EA 3OTIA 1NLZA 2I4NA 4LTNA 1EFDN 5ARDA 4TUYA 4BFUA 1EXVA 4LISA 2HMVA 3LGSA 5JZBA 3NHWA 4HK4A 3HE4A 1LTJA 1LVGA 1SCBA 4QPCA 4OO3A 4QTYA 5MHTA 3QPCA 1H85A 1AGRA 3STVA 5EMLA 4MEBA 1IK4A 4H1VA 4N12A 5EI5A 3VMFA 1IZ7A 4G41A 5ALOA 3EGCA 3IHKA 4HAZA 3OQPA 2R6AA 1CWUA 3AOGA 1AZWA 3ID6C 1URPA 3KJHA 4FGLA 3LY7A 4JLPA 5K3DA 5KAPA 3U7JA 2OFPA 3WLNA 3F6BX 2PZMA 3AFIA 3LIDA 2G0TA 3D1LA 3OEWA 4I5DA 2ZZKA 1SVSA 1QL1A 2DX7A 3FRHA 4N7JA 4PAQA 3WQHA 3AEKB 4JKIA 1IUKA 4S1PA 3A0UA 6REQA 2JF0A 2WKQA 3TO5A 3QUCA 3GGPA 1OYYA 3KYQA 1D0IA 1R6VA 1XCBA 1ZN7A 2IPLA 2PV0A 3H1HD 2N47A 3GDFA 2X5XA 1A5TA 3M83A 4TTQA 3VZCA 4I81A 5D51S 3KIPA 4GX0A 3PV0A 4G81A 3I56P 2P9QA 2J9FA 2Y9ZA 3NZEA 2AEFA 3D7LA 1L1FA 3WVNA 1SBHA 4D9GA 4O5OA 1CNEA 1NNUA 2AVDA 2UVPA 2GBLA 1PP9J 2R8EA 3R74A 1EDKA 4DWJA 1FP6A 1DRWA 2OGSA 3IB6A 3F6SA 3OJXA 4FMDF 2GCPA 1Q2UA 4HAOA 3ZY4A 4BVLA 4EFMA 2JCVA 3PCRB 3S29A 3MCUA 2WTUA 4IUCS 1LJ2A 2C4KA 1CEYA 3FFWA 1M76A 4UPDA 3RVBA 5J59A 5IHXA 2BEUB 2ERXA 2YQZA 2P8JA 5SY6A 5HKOA 2B2XA 2KMLA 3W3AA 1QKKA 2FQXA 3TW8A 3IVRA 1W6RA 4JOBA 1UBTS 2UUOA 4ED9A 4R71A 4HWKA 4M9QA 1UWCA 4TV8A 1L0NG 4AIIA 1GR0A 3FMIA 1NQTA 4BX0A 1H4TA 1WUYA 2XCSB 3PRYA 1WD5A 2P9YA 1E2JA 5LB2A 3FTFA 2WMOB 5M2QA 4IEIA 3RL0g 1KJNA 3MN1A 4KSBA 5JLJA 2QVXX 4W8HA 3DDOA 1JQEA 1NFQA 2EYUA 1NTZE 1MJGA 2OZKA 3WIEA 1JSXA 4NE2A 1AK2A 1CQJB 3K9BA 5ENZA 5LA6F 1UR5A 2ZT7A 3C5VA 3C3CA 3COVA 2HSEA 3UCXA 3E9ZA 4HH3C 1ZRHA 3PLNA 5FBQB 5CHYA 4GRIA 4OHPA 3VMYA 1GUAA 3OMWA 4D6YA 5BORA 3L8YA 2ZRPA 2PAFA 5G4KB 2Q6LA 4BV2A 2Z4RA 2F4VB 5U1PA 4OOFA 4TTPA 4TTVA 4Z0NA 1U2GA 2H1LA 2JIOA 3C14C 3H1HE 2WYIA 3JQBA 4GE3A 1HBWA 4JJIA 3F6EX 1QIEA 4LS3A 4LV6A 4KP7A 3VH1A 4PPQA 2W0MA 1G19A 4BV9A 1UXHA 4Z4CA 1P7VA 3O1LA 1EBUA 3TLKA 5LC1A 1R00A 2QNRA 2RGRA 5I8ZA 4WW0A 2B5OA 4WZBB 1H2FA 5D85A 4C7BA 3NTOA 2D7DA 3WSVA 3E53A 3OQOA 3QUQA 2QMOA 4TKLA 4H44D 1N57A 1DD3A 2PX0A 1N0VC 1HFWA 5JCOC 4Q82A 1W1IA 2R00C 3N76A 1IU9A 1PNVA 2PH1A 4J2TA 1SUPA 1FU8A 4ARVA 4QPPA 4F4UA 4LKOA 2X41A 1N9GB 3AI3A 2YDXA 1QFYA 1Z0IA 4GECA 4NCBA 2JGRA 3ZN2A 3HD7D 1XDUA 2X9NA 1MC5A 3AU8A 3FR7A 3AB7A 4JVSB 4Y9RA 3QVJA 4YUZA 5ECYA 3DOJA 3BCCJ 1UM9B 3KWMA 1KZYC 2XZRA 1H5NA 4Q7EA 1PGPA 1NFFA 4W8OA 2A6PA 3USSA 3JVUA 5FJJA 4OFXA 2DU8A 2JAHA 1IOLA 3MWGA 3KNZA 3KSBC 4CV3A 1Y98A 1OU0A 1BSNA 1R5JA 1Y0BA 2EIXA 1L0LE 1GG2A 2HQOA 2R7MA 4OSOA 4Y2SA 2ODPA 3D7NA 3LOUA 4FMPA 4N54A 2RH5A 4C88A 1TPZA 1J1DB 2V6IA 1HDXA 3HBNA 4AIRA 3GFTA 1K66A 4FZJA 5AMXA 1KBZA 1O08A 1BKYA 5A6SA 1LEHA 4QYIA 3TVDA 4DR4B 5REQA 5KNDD 1YUBA 2ERYA 4FT4A 1I3KA 3K72B 4JGBA 5HGJA 4JVOA 3WLFA 4KFUA 1J09A 2Q4DA 2EKDA 2AEEA 3LWZA 1JVSA 3T7TA 1WBDA 2QN1A 1JY3P 1YQ9A 2WD8A 1NRJB 3P5BA 3FROA 1FBTA 1LB1B 1CVIA 2QGZA 3KQSA 3QKRB 3V32A 1COWA 1R0BA 2XBLA 1SQPK 5AXBA 3NXSA 1Z62A 1H2HA 3QU4A 3A9SA 4OPMA 3ZWKA 2WJWA 3DT8A 3O84A 5CVCA 4BB0A 2EHJA 2RC5A 4ACBA 1GG9A 2E5YA 2ZRCA 3QPWA 5BW6B 2IU4A 1Z22A 1HDIA 2C4NA 3UWSA 4C08A 4J4HA 1B8PA 3HYLA 3F96A 5DKFA 5FAKA 2YVQA 3KKPA 4MMXB 5GWXA 6ABPA 4XWOA 1GKLA 3L0PA 5TGZA 1IWBB 1FC0A 1M9NA 2NZJA 2IIBA 4J8PA 4R51A 1DO2A 1RJEA 3BMNA 4C78A 4R5MA 1CZKA 4IVQA 1Y3IA 4TTRA 4EHHA 3NYRA 2C0WA 4RMIA 1BJKA 4JR0A 2BWJA 2FEAA 3L6DA 1E2UA 2JFXA 4M2LA 3L7JA 1LRLA 2PMCA 3MQFA 5H59A 1UMCB 3UJAA 1SN7A 3MINB 3IMCA 2I71A 2OAEA 1PJ8A 3KKZA 4C4ZA 1XROA 4KIJA 2V9PA 4RPIA 1USVA 5DOVA 2IBTA 9ABPA 1DXYA 4GLBA 1D7MA 5IYZA 1JJ7A 5K0TA 4XTCS 2CZCA 4XJSA 5CPBA 4B7ZA 5KQRA 2BEUA 4UQLA 4W5QA 1VQ5P 2CUKA 4PD4D 2E0IA 2ISSD 2J9ZB 3H8JA 3ITEA 1BEEA 4J0JA 4HVCA 5KDDA 1RF0A 4L8GA 4LWOA 5IKOA 1ADBA 3U44A 5FPQA 1KOGA 3TB6A 4I1OA 1E79D 1KY4A 4AY6A 4FBLA 1Q7GA 3BZBA 4N5HX 4EKNB 1LNSA 2VI5A 3AESA 4MA4A 1ZW0A 3DC7A 2QXTA 3IR7A 1G21A 2JKYA 3MJDA 4Y2UA 3TZEA 5EFZA 4D2IA 5B3JC 1WSDA 2AEMA 1PEDA 2JK0A 1XNQB 4K3VA 3KBBA 2R4TA 3QIAA 4DJFC 2H8KA 2HLOA 4K9NA 5JY1A 4HO1X 1H3FA 3OOSA 3T3EA 1KZ6A 4YK7A 4Q1CA 3C8DA 3V4PB 1BDHA 1OYOA 2Z5FA 5IPFA 2JANA 1KS2A 1SQ5A 3DZKA 2WM2A 3IB3A 1OVRA 3FOBA 4YJ2A 1NVXQ 5L7WA 2NMVA 1GQQA 4URVR 2J9XB 3HCWA 3OEHA 4TTSA 4JI2B 4A0SA 4DA9A 2CDRA 1A9RA 1FYVA 1U3DA 3HR7A 1SR8A 5LKAA 1ZM3A 4CKBA 5AM3A 4WJZA 3ZH2A 5A2QA 1YVPA 3QVVA 5BYAA 2H5EA 2O8BA 2BOVA 1IFDA 3PTAA 1Z68A 1KU6A 4AJHA 2XB6A 4RYLA 4E70A 5CYOA 2BW0A 3CNQS 5A04A 5CCHA 2WSLA 3H1FA 4XQ0A 3F9IA 3NWPA 2VYNA 1IO4A 1KYIA 1OXSC 1YNOA 2J33A 2VWGA 5K05A 2BEQD 3HI4A 8MHTA 3TQFA 4AQ7A 1BCRB 4F3KA 1NTKG 2XKJE 3VOSA 5JIBA 3EDMA 2EFDB 4J7AA 3B5NA 2UZ3A 3V7WA 1XRRA 1HQCA 1UAGA 2CXHA 5AUOB 4K3UA 4BO3A 2F9LA 1STOA 5K4HA 2PL1A 4CM9D 2X76A 1PT6A 3VI3B 1J33A 3F8TA 6REQB 1CUHA 2G8LA 1Z6AA 2D5BA 2DPGA 4FWBA 4Y1GA 5BO5A 5KWSA 1TEZA 2V03A 4FP9A 4MICA 5F77A 4MRRA 1K97A 2HWWA 3PQCA 4URFA 3RIEA 3BDAA 4DUZB 3S9OA 3RC2A 1KYOI 1GOTA 3UMGA 4JP2A 4MDFA 3UQZA 1IRIA 4PN3A 1GK4A 2LKDA 3IDSA 4EELA 1OW6A 2OYIA 1E98A 1T1RA 4EENA 1IG0A 3MA0A 3JVEA 2IDBA 4LY0A 4U2BA 5EVCA 4Z2YA 5LBTA 2BISA 3IAM1 4REQA 4F4IA 3GB9A 1LRKA 1OX3A 1OH7A 4EUHA 3GN1A 3B1XA 5LLSA 2Z1MA 1P4JA 3NHLA 2KPOA 4ENWA 3RJZA 1F4VA 3WHIA 1B41A 1SXIA 5KSOA 4A1FA 5LXTB 4CLDA 1J49A 1ZGAA 4JR2A 4RF3A 2PZBA 1WG8A 2YX1A 3I52A 3LT1A 4GWGA 4I55A 4Y9SA 3B3QA 4QYMA 4LNUB 1BXGA 3SIRA 2V6BA 1BFDA 3AEQA 4TKZA 2KLUA 3E0XA 3GFRA 3PQDA 4R3UC 4URHA 4TV8B 3ZVRA 3IUYA 1XMIA 1KYYA 3UAVA 4O4HF 3DBVO 3V2NA 3Q7QA 4Y0VA 4X90A 2HQRA 4LMPA 5KYVA 1YJXA 4Q03A 3UB4A 3ZJ5A 1N0UA 3TAUA 5BPFA 2WPSA 5AW5A 2CHEA 1YL7A 1ZD1A 3CX7A 3VKUA 3R5KA 3L36A 5CT9A 3AUYA 4V24A 1M72A 2B4KA 3Q5RA 2XDQB 3LX4A 4EKDA 5CLJA 1OV4A 1RWKA 3C7DB 4QKQA 1LGYA 3ZLJA 2YIUC 3INYA 1MORA 3N5CA 3Q3CA 2JJMA 1TF5A 1T2KC 2EXXA 4MUMA 5ALNA 1XDBA 1DWUA 1W0JA 1Q86Q 2O1SA 2WWXA 1TQHA 2YFHA 3LPDA 1HJBA 4U0KA 4MQEB 5BWCA 3RU3A 4CKCA 2RHHA 1ZGJA 3V9PA 1NQWA 2PU5A 2IGTA 4ZO9A 3BRWA 2P2GA 2GD0A 5ALJA 3A6PC 4GBMA 1YD7A 3HBAA 1FTNA 2QEQA 1KE2A 4NBLA 1QHYA 2JAWA 1P77A 2A7XA 1EWYA 2DAPA 3EC1A 2H11A 2OHJA 1A98A 4NK4A 4NMWA 5DHTA 3V3KA 4G26A 1SHZA 5CDUA 4HDCA 2I3BA 3TRHA 4DV6B 1U4OA 2GH1A 5F7ZA 1ISFA 2QT0A 4Q4AB 4O4IF 4ON9A 3UFXB 4G37A 4ACAA 2CVPA 4JQSA 4QYWA 3E1RA 3T52A 1N2IA 2IU0A 3LW7A 3SHWA 3UGTA 4S1NA 5DYYA 4TKVA 5LKRA 2XE6A 2NLOA 2FP4B 3CV3A 3GZJA 4PSDA 1YFZA 1T5SA 1NG1A 2J1LA 2F43B 3RD5A 5THXA 1P3Y1 3HVKA 2XUPA 4DV2B 4JKYA 1ZAYA 3GBSA 5ALVA 2FN9A 4H7EA 3ILYA 3KPYA 1HBJA 4RULA 1RJ9B 1S8AA 1XA4A 2BL4A 4MW4A 2AFIE 2KZJA 3BXXA 1FZCC 3HCRA 3U1AA 1ELOA 3CEAA 2B98A 3HUEA 4LYFA 4O29A 4XPIB 1PFVA 3BUSA 3G6WA 3VR4H 3WZMA 2HBYA 621PA 2AZXA 1IJKA 2BELA 2DFDA 2D13A 1XN4A 3DVRX 3LU1A 5DMXA 4F6RA 1TT5B 3BBPA 4U6QA 3A7OA 4LHSA 4BKPA 2JWDA 4G25A 1QO0D 4O8CA 1BAPA 1L0BA 2BAGA 2QJTA 1QGAA 2NZ8A 3SXUB 3PHBE 3WIDA 1XV5A 3T95A 3ZCTA 4A8JC 2FVXA 4X7RA 2FW1A 1MAVA 2VHEA 3A6HA 3JQFA 2Q50A 1Q91A 2IYUA 3SM3A 1E99A 3F98A 5TQ0A 3HABA 3OJLA 5AXCA 4ZYZA 3OKFA 4OA5A 3EZ7A 4NZOA 1X15A 4XIGS 4DLSA 2J0SA 1NXQA 1V35A 3EZ6A 2XYPA 1JY2N 3HCAA 3BJEA 3V4FA 4DREA 1MA0A 2O4UX 3ZY3A 3KVYA 2SCUA 3TL3A 1SVFA 4JBXA 1L4AA 1P9NA 3A7EA 2O20A 3F6RA 4NPAA 3D6YA 2R2AA 4QT0A 4PCLA 3PICA 4BQFA 3L75D 4DNXA 2VWQA 2ASEA 4MA5A 5JJKA 4MUEA 1SVIA 4QJIA 1XTJA 1U0SY 2VR1A 1A69A 4UVGA 1GPNA 3CRMA 3PFHA 3V4OA 3WL4A 4BNJA 1JXMA 3AG5A 1Y6GA 2IITA 1PFGA 1H3NA 2QQEA 2NT3A 3UJDA 4CMIA 1XPJA 4R1NA 3TL2A 3AVUA 2H2HA 1G18A 1E64A 2VK4A 1BEZA 3FNQA 2BFWA 3JQAA 3P9XA 4NJMA 5BQPA 1V45E 1V6SA 3QK7A 3CX5E 1UQTA 3CVOA 4WGFA 4GSYA 3MAGA 1UH5A 5DEOA 1RE3C 3PQ3A 1OXZA 1GGHA 3QUBA 3UJPA 5ERYA 1K1EA 1ZU5A 3CCLP 3S5JA 3OT5A 1X8XA 4AROA 5TGDA 3FKQA 1BCCD 5C7YA 4BGVA 2YWXA 3SK0A 5DNCA 2BYTA 4KN9S 4HXFB 2EFGA 1VM6A 4QELA 5H2FH 2PS0A 2QZ4A 3PNYA 4FNGA 1EFAA 1QP7A 4DCMA 2BONA 2W4QA 1P45A 1KILC 3ZW9A 3JATA 1HNWB 2YIVX 3DW3X 2P65A 4Q4HA 4RMGA 4WKCA 3V1KA 4ZCMA 1Y9ZA 4IIEA 5FNZA 3TZHA 1HE3A 1DX6A 2DMRA 1AXRA 2I0FA 3O90A 1WHTA 3WJ1A 1I2BA 1EGHA 1U3VA 1ZONA 2AF4C 3K05A 2QIOA 1G5RA 4RTMA 1AKMA 3COSA 1LF5A 1UBKS 1LXCA 2WFLA 3U9SA 3VNSA 3WB0A 1R66A 4MYSA 5EIEA 3GEGA 2V5UA 4JJEA 2OYHA 1OCEA 2AMLA 2AW3A 3M1YA 3B1ZA 5A3VA 3K96A 4PNEA 1L5KA 2OSBA 5A4IS 4DR1B 4BX2A 4C0HA 2BVNA 1T2CA 2OL4A 2XUFA 2FJPA 5WRFA 3TECE 2R8BA 1CE8A 1ZCJA 3FR8A 5IWCA 5HK8A 1NBEA 4C4PA 3S1LA 4RTSA 1MOQA 5DFAA 3P97A 1W2WB 3CCRP 4I5EA 1ZOYC 2H63A 4JHLA 5T6BA 3RSHA 1E9AA 1SKYB 1OB2A 4G4SO 2A5GA 1JXAA 2C1EA 1N5DA 4R8SA 2H9AA 4G4GA 4BCDA 2Q45A 2COEA 1J42A 3IURA 3EVZA 4WFQA 4H7FA 4QUIA 1QL2A 4C43A 4KZKA 3R0JA 4WKPA 1Y8ZA 4KR6A 3SN6A 1ABBA 4RX1A 2DC1A 1A9OA 2EBUA 2WJIA 2XOXA 4HADA 4PXSA 4HDMB 5TXGA 3T5BA 4CG2A 2XEDA 2P9BA 1KC1A 2H4FA 2JBAA 3CCVP 1FX1A 3DV0B 4JI6B 4FFNA 1MG0A 1KSGA 5TMPA 2G8YA 4PRZA 4WXRA 4KAXA 4XVQA 3I9NA 1R5SA 4OAQA 1EXJA 1TK9A 3NHRA 4JC0A 3ULKA 1TQ6A 2CJFA 1J0DA 3QU9A 3WZ2A 4RJJA 5A6SB 3K5HA 4TPKA 1QP4A 4B8WA 3E18A 4LJ6A 2PBZA 5B6JA 3ZGXA 1OT5A 1Y34E 3EPLA 4LJ7A 1EUQA 4TKVB 5HKLA 3OCXA 3S2ZA 4EITA 2HFKA 4ZYVA 3OCCA 3PG5A 2HK9A 3PXBA 1SAYA 1V1MB 3MOIA 2BTQA 1TCCA 2OO3A 2QD5A 3Q3HA 5ITZB 3GCGA 4YP1A 1L4MA 4PTZA 2V58A 3A9VA 3CB2A 3C85A 2Y1WA 3MWDA 5IHPA 1QCCA 1T5BA 1SWVA 1YRQA 1JP7A 2D5CA 5FLEX 2NU8B 3PGA1 1FS5A 1MB3A 3AYZB 3PXXA 4ZOAA 2GFQA 4ISCA 3C6ZA 1NOJA 2RHOA 4WOKA 4IPTA 4WNCA 3V4SA 1DVRA 2DFLA 3MTGA 3WTCA 4YCLA 5GV8A 1TC1A 1R15A 2ZLBA 1G9TA 1K0UA 1QVFO 3BMNB 3GFVA 4RJ2A 4ZAWA 3TX2A 1EVJA 3WLQA 3UCEA 3SFEC 4C89A 1IUNA 1U8TA 1XLTA 4G0QA 1U2PA 1V71A 1EDIA 4GI7A 4QOGA 2EJCA 3TLBA 1CUIA 1U90A 2OY0A 1I6WA 2VDKB 3A28A 4GBGA 5B5EE 2WJYA 1JF8A 4GT1A 5KLVE 1W48A 2J3EA 1LPBB 2R5WA 3BTVA 3NM4A 4OHVA 4GKBA 4PNHA 4L3OA 3TI9A 1G2IA 1OFCX 4ZKEA 2A45G 2DUWA 2NUTB 2WIFA 3DV9A 4G1VA 4WPGA 1WETA 2N1TC 1Z36A 3U1CA 5AKLA 1WL8A 2JJYA 4I66A 1KQSO 4X7BA 2AC2A 2NUBA 3D6HA 1VRCA 4WK4B 1TNDA 4JI3B 1M2VB 3FX2A 4MSUA 4BC1A 4Y2HA 5JZSA 2PXAA 3F4BA 3P32A 2XHZA 2QPAA 2GCIA 1YB5A 3CC8A 3DEIA 3SZLA 1PWXA 1VKZA 1BDDA 3AHCA 3F5QA 4WA8A 5AT1A 4L6AA 3M1IA 4HCJA 3VHRA 1VE1A 3IXMA 5K0CA 3NOVA 4GKKB 1YBVA 5HCUA 4BV8A 3RK0A 2Q8QA 4FHDA 4TM8A 4BCBA 2UKDA 3BXGA 1NKSA 1NMYA 4I9UA 4PGMA 4BVAA 2HMYB 3BZWA 1RKVA 4IQ0A 1O0BA 2CJPA 4Z9YA 4B4OA 1KNQA 4JLWA 5CAEA 1GTMA 3QSGA 2REBA 1YS9A 2IYEA 2ZI9A 2WJJA 2ZAOA 4GL2A 3QA9A 4WI1A 3DMDA 2VNJA 4H7PA 4YJ2B 2VHUA 3RRMA 2AXNA 5C1OA 1DAEA 2EBWA 2POCA 7AT1A 4EQ6B 3CD6P 1J22A 1M2FA 2VO1A 1E94E 2G72A 2E21A 4LC9A 5SYMA 4HF7A 1VHWA 3AHJA 3PNOA 4TZKA 4JLKA 4E6EA 2XZOA 1P5ZB 1G291 2VH2A 1J1ZA 1KZ1A 4ZTUB 3E4DA 2O5EA 1AGPA 1C7ZA 2VP5A 3ZGOA 4MKHA 3GHGA 1AC5A 1EZZA 4MVJE 4LYEA 2WIJA 1CUSA 4MW7A 2CZQA 2IUSA 1QQTA 3GCXA 4Z3DA 5NULA 2FWRA 3WI7A 5GADl 5C7IO 1IN4A 1YL5A 4HMPA 1JY3O 3PNMA 1J2JB 2IFTA 2KBEA 2Q28A 2C5GA 1IM5A 2JEEA 4JJFA 2VT3A 2FW8A 5AVRA 2Q3MA 4N78E 1D7AA 2CEAA 4IEFB 1JH9A 4D3SA 1Q3HA 5KVCA 2JRCA 1HEYA 2I76A 3O2NA 3HUTA 3IPXA 3NAZA 2K7FA 3IOEA 1MEOA 5JS6A 4AKHA 4LVCA 2DCMA 2YKQA 2WU4A 4BLRA 1N7SC 1E3IA 1K5DA 1NW4A 3LGXA 4KIFA 4KWTA 2C2OA 3DOOA 3PLAE 2H1CA 3M81A 5GM2A 5BW8A 1GZHB 3Q9SA 1UIMA 2YRWA 4J0EA 4WZBA 3KZNA 1VYHA 2RHCA 4PC2A 2R44A 1TYZA 1T8PA 4BE4A 5JZMA 1H1LA 3BB3A 1NWHA 4BX8A 2VHWA 4UZFA 5K8JB 4HAUA 4TT8A 1UL1X 3MJRA 4PZLA 3OEHD 4MKXA 2MKVA 1OWPA 3HCFA 4LRYA 2O7SA 2FK7A 3LDHA 4XSVA 2HPHA 5DI3A 1JQ3A 1N1GA 4NYJQ 2HWXA 3Q11A 4P4SB 4MUAA 4S2UA 2Y9YA 1LX6A 1VJDA 1YQEA 4HDRA 4DV7B 2PT9A 2VK1A 4C0LA 2GSWA 2OCGA 5FP0A 4F92B 2IVZA 3GLIA 3GIWA 3OZIA 3HP1A 1Z4NA 2HXSA 2VHCA 4U3FD 2YNYA 4NMLA 4P3NA 4EJSC 3JD1A 1PEKE 3PFWO 1RPJA 1T3TA 1V5GA 4BMDA 2CLHB 1QZTA 3PNSA 2PMDA 3PDWA 4R0MA 1JE0A 1TIPA 2F1HA 3AM5A 5DYWA 4ZICA 3HY4A 4AKGA 5JXIA 3AEYA 5F21A 3M0DC 1CP2A 2ATEA 2O07A 4HGZA 1R4MB 4ZCTA 1RWNA 5H3LA 4HRAA 2IPPA 4MQEA 3ZQ6A 1L5OA 2HHHB 4A4DA 1C7FA 3GGGA 5I5EA 1ZIYA 2ZI5A 4LZLA 3U6BA 1VCHA 2YC4C 3V4RA 3O6QA 1DRVA 3PXGA 4N5NA 1T5IA 4HQOA 1C1YA 1AUPA 1KTVA 3ANTA 3KQTA 3R7BA 3RK2B 3ZR4B 3L1HA 4K6FA 3HZRA 4ER6A 8ABPA 2ZDQA 3KQWA 3R6GA 1RQPA 1CS0B 2JLQA 1YZTA 3SC2B 1F4PA 3HUDA 4JLOA 4RH0A 4XB6B 1J0AA 4EDFA 3IR9A 2CJYA 5HHTA 1RYMA 3MVEA 4YV1A 2GXQA 4ZI3A 1ESNA 2J3KA 5IJ0B 3UFXA 1W85A 1S2DA 2PRKA 6GPBA 4AY5A 2O01J 4Q15A 5IAGA 2V0GA 4GVXA 5DCWA 2NPOA 3PPXA 5ENVA 1HJ0A 1A9XB 2NPFA 2N1TB 1PIWA 2AIRA 4A6DA 1T10A 1UKAA 5HW0A 3ZXXA 1YFLA 3IIEA 3TGUG 4O2AF 5BPHA 2F9MA 3AE6C 1ACMA 3T54A 3OIVA 3FPSA 4RF2A 1W4BA 3OFVA 5BXQC 1EBBA 1NSFA 4LSZA 2HY7A 1T0UA 2HSWA 4JT9A 4XXHA 5DYGA 1HF9A 1YQQA 2G08A 4I1YA 4RY9A 4WASA 3RIYA 3TPFA 4HI0E 2IWRA 4CQLA 3N0TA 1JDUA 2V7QA 2FP4A 3UAYA 3GLHE 2XDAA 3MZ0A 1CUAA 2VHQA 1SOAA 3C8HA 1BDMA 1I6LA 1QK4A 3PRJA 1RWVA 4EYQA 1F8XA 2QORA 3SEZA 3N8KA 2XRMA 3NHFA 1N32B 1LT1A 3N0WA 3FCEA 3VKHA 1QF7A 3NTRA 1IHYA 3KOOA 3WFIA 2H7HA 2K4MA 2I2CA 2V7UA 2X19A 3D4PA 3PIDA 4IDHA 4KGXA 5DBIA 1FDUA 4IFEA 5ESDA 1H66A 4GDMA 3HKBA 4Q93A 1OAKA 1KFKB 2D5AA 3IBGA 1I24A 1TVMA 2GHRA 3EZNA 3HJAA 2PD6A 3MS4A 4Y6GB 4EPVA 4KEAA 5AI6A 1QRTA 3MSXA 4QQNA 3QH9A 3QTTA 4KBGA 2RI0A 4JC8A 3HJUA 1P1RA 1D4OA 1RQVA 1PV2A 2ZUTA 3B1YA 3GJRA 3O74A 1R64A 1HT1E 1NVMB 5AXDA 3I3OA 3VX4A 5CCGA 1DEXA 2WF8A 1AUQA 1C3OB 1AQ6A 3OEED 3LY5A 3VU9B 4HYEA 2I9KA 3Q9LA 4NH0A 4KK4A 4EUNA 1RF1B 1XFAA 1OWNA 2G70A 4M9UA 4UASA 1DOAA 4RGYA 2AW5A 1OMIA 3NETA 1PBNA 1X0XA 4QICA 2WSFJ 4F9TA 3HRHA 4OHCA 7YASA 4D4GA 3T4PA 4CBVA 1JR3A 1Q1EA 3JR7A 2IYWA 1O77A 4TVSA 1VCOA 1P44A 2WT9A 4C4TA 2QSYA 2XT0A 2CHUA 4W6ZA 1KMHB 2N75A 4RFSA 1BCCG 2Q2VA 4XGQA 3R24A 2FK8A 2E74C 4FI3C 4J07A 2WYVA 1FNDA 3VMZA 1Q1QA 2GWHA 2CDCA 1OFTA 4ZZIA 1QX8A 3WO0A 3LVQE 4LJYA 1G8YA 1PJ2A 2BKAA 5DNVA 5JQGA 5IDYA 3C1AA 5SICE 1LP1A 4YJ3A 3VQTA 1NBME 3CEPB 2GB4A 3RU7A 1ECGA 3A9UA 4D43A 3LRXA 4OBBA 1JHPA 1PJCA 1USUA 2QPOA 3DEYX 3IQEA 3PGJA 3UXYA 5D01A 2FZKA 4NMXB 3UTCA 4C0AC 4YCCA 1D3AA 1ZK2A 4JCOA 4LCBA 4ZV7A 3RGWS 5HNKA 3THWB 4MQBA 2QEXP 2G25A 3EGDA 2Y77A 4M0UA 3AUSA 3OLXA 3PXCX 3TMAA 2P1RA 3G0GA 3LNTA 4E51A 1NH4A 2A4MA 3DJYA 2ZAMA 1XZBA 3B2EA 3BH0A 3HV0A 3TLCA 3CBGA 4ZTZB 1L7DA 1L9KA 4FYJA 3EZYA 4V1CB 3VZQA 1I1OA 1J06A 5D8DA 1ZK4A 1C1DA 1MTZA 3SFDC 5KLIC 1TX4B 2C04A 2Z9DA 4LJAA 4HWSA 3A3YB 5H68A 3G49A 3GGDA 2CCGA 4M7PA 4A2WA 2ZRBA 4XWWA 1NN5A 4OH7A 3BFXA 3KT6A 3BZUA 2JVIA 3N2ZB 1TDJA 3ORFA 1WXWA 3V4VB 1M54A 4C3UA 1NLYA 3UWMA 1FMLA 1JIIA 1CBUA 3NB0A 4OOEA 3V9AA 1JEAA 1SG6A 1RTKA 1X1DA 2JATA 2Q5OA 2B8WA 2JGMA 3AGQA 1GHTA 3FA2A 4KX5A 4G0VA 4MVJP 4FX5A 1NYLA 1PCXA 4P5DA 4YRDA 4JLUA 1ZVJA 4N76A 4GI1A 4Y2JA 4D3DA 5LQMA 3OBIA 1NYRA 4OMUA 1HTLC 1N86A 1OFUA 3BFPA 1EFRD 2R84A 4HPXB 4K26A 5CG1A 2SICE 5A62A 1LZLA 3I01M 4ZMRA 4AXBA 3KG2A 5LIRA 3TG8A 3ZKWA 1EP3B 1BG6A 1G5TA 4JUCA 4J4TA 4NYMR 1L7EA 1MIHA 3EASA 2Y8EA 3ZEAA 1AUOA 1AD2A 3P2KA 4KVZA 3KYDB 4YMSA 1KQNA 4IL6X 2DERA 2HIAA 3BGDA 2DB3A 3OIFA 4DBLE 1BHJA 1GZUA 3FHCB 4AS3A 3VTPC 3EGWA 4YRKA 4OEHA 1F48A 2WOJA 1KU0A 3P96A 4ID3A 3M0AA 2MCFA 3TLAA 2ZQ5A 4R31A 4MCIA 2EX0A 1XSEA 3QPDA 3WV5A 1ZRTE 1US8A 5BVHB 1FZGA 5GJBA 3HE4B 1BO6A 1TJ4A 2HCRA 1NY6A 4MR7B 2AFHB 4FYVA 4PHHA 5DIZA 1SP4A 1YHNA 2VT6A 4HGOA 3TQHA 2I03A 1NIPA 4GNKA 2Z8XA 1KGSA 1THTA 5TX7A 3UOAB 1XQ6A 1K7CA 2R5DA 1ENZA 3BF7A 3JQDA 4JHXA 1OAAA 3RTCA 4H6XA 2F3RA 1TC2A 4C3OB 3EQ6A 4X62B 1WZ2A 3CSUA 1T36A 2RBEA 2XQFA 5J1TB 3FOEC 1U4SA 1GD1O 4DDTA 2IOFK 3FH0A 4MITA 3MTIA 4G5HA 3ZDZB 2O57A 1AMUA 2JH3A 3P4UA 1MV5A 3ZH9B 4QHSA 1XWFA 2O3JA 2P9GA 3JZIA 5C7OO 5JWOA 2OO7A 3FPBA 1VSQA 2MMCA 1DC8A 1O4WA 3L41A 4UCWA 3ZQ4A 4LMBA 2X6RA 4IG9A 4UBKA 2HAEA 3ROEA 2C8L