1H89A

Crystal structure of ternary protein-dna complex2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
64
structure length
64
Chain Sequence
EYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1h89A00
2P7JA 1SLQA 1FAVA 3V5BA 2Z5IA 1GD2E 5AW4B 3HE4B 2QM8A 5AW1B 2H7HA 2WT7B 1T2KD 2WPQA 3TYYA 2R32A 3NTNA 4RESB 2C9LY 1GU5A 3V4QA 1H88A 2R5DA 1H8AA 3IR9A 1CSBA 2XZRA 3MD0A 5AW5B 1OXZA 2WPRA 3A2AA 4M3LA 2P67A 5AW3B 3L37A 5APVA 1JUNA 1G2CB 2ZXEB 1CZQA 1GK6A 1SP4A 5APXA 1JNMA 5APWA 2WTYA 2R3CA 4EOTA 5AVVB 5AVTB 2XV5A 4XE5B 2XU6A 4HYTB 4LC1A 3P7KA 2P2UA 2YO2A 3MGNA 2E42A 2IPPA 3HE5B 2W6AA 1HWTC 1A02F 3VYIA 1X8YA 5AVXB 2KP8A 2R5BA 4AUWA 1YYCA 3TK1A 3L35A 2W27A 5AW0B 4AQRD 5AW8B 3TNUA 1FOSE 5AVRB 4JYBA 5AVQB 2C9NY 4GKGA 1GK4A 1DH3A 3KDPB 5APUA 3VMYA 3HE5A 5AVZB 1FOSF 1GTWA 3HTKA 1KQLA 3M9BA 3T97A 4JYCA 3TNUB 1HJBA 1MFZA 2JJLA 2YNYA 3NXSA 3OAKA 3M06A 2Q7CA 3UIAA 5APQA 1GZLA 4GT1A 1MV8A 3A5TA 5APSA 5AVSB 3LIEA 3A7OA 2E43A 3M91A 3B8EB 2WWWA 3M0DA 2N9BA 4KHXA 1S9KE 1MUUA 1A02J 1T2KC 5APTA 2Z5HA 3NMDA 4B86A 5AVUB 4C7NB 1H89A 3VMXA 2BASA 4AYCA 5AVWB 3I5CA 5AVYB 3V4WA 4I2LC 2QM7A 1CI6A 3LIDA 3VTPC 5CMZA 2ZFCA 3KQGA 3NFQA 1GU4A 1S9KD 5APYA 5AW7B 1NWQA 1OWAA 3P8MC 5AW9B 2YO3A 1HBWA 3VN0A 3M0AA 1CI6B 2VRSA 4C7NA 3VMZA 2Q3IA 3O8ZA 3P32A 3A3YB 3L36A 5AW6B 4DZOA 3SWFA 3HE4A 2WPSA 4C46A 1IO4A 3M9HA 1HUCA 4I6MC 2Q5UA 1NAFA 2WT7A 1J2JB 5AW2B
chains in the Genus database with same CATH superfamily
1HH0A 1FZFA 4LGDE 3RK3C 3HE4B 5AW1B 1AVYA 1BSNA 1PZQA 4D6TJ 1RE3C 2K37A 2IBZD 2WSSH 1Y9BA 1FS0E 2B87A 3W68A 1H88A 3H1IE 1P84E 1H8AA 1ZRTE 2ZXEB 1P84D 4I7ZC 1ZRTD 3HE5B 1A02F 1E79H 5AVXB 1EZVI 2ZT9D 1SQQG 2W27A 1SQVJ 2D2CD 1SQBE 1S5LH 3AE6C 1RF0A 1YJ9P 1PGJA 3BCCE 3HTKA 2OTJP 1USEA 2Q9IA 3HUSA 1NTMJ 3MTUE 1CW5A 3G9RA 1KQSO 1NGMB 1JTHA 3A7OA 2KSJA 3M91A 3MIWA 3BCCD 4U7JA 3JCUH 3FXDA 3AE8C 1M8OB 2KXPB 1SQXG 3H1HJ 3H1KJ 4YPCA 1FZCA 2P1JA 4UB8E 3CCRP 3A0BH 3S4RA 3L4FA 2GUSA 5CJ4A 4C7NA 3ZDMA 4OVNF 1VQLP 3CC4P 1VQ8P 1GL2C 1NAFA 2NZ2A 5KKZC 1IK9A 1SLQA 1FAVA 3USSA 1GD2E 4RJTA 1EDKA 1SQPJ 3L74J 1KFMA 2AXCA 1NTZE 3CXHI 1U7MA 1EDIA 1QLED 2WZ7A 1KILC 2O01N 4HB1A 3I56P 2YO2A 1OVUA 2BCCE 2KYVA 2E5YA 3PJSK 5KLIC 1JMBA 1YYCA 2OQQA 1NU1G 4OGQB 1QL1A 5BU8B 4GKGA 2BCCD 2NRGA 3C9IA 3VMYA 1FDMA 1RE3A 2PRRA 2QJPB 3CWBJ 1KQLA 1HJBA 3CPWO 3RK3E 4NPDA 1T8ZA 4WY4C 2Y9ZA 4YTPC 2KOGA 1MFTA 1BE3J 4GDOA 1MUUA 3QWOC 2KI7B 3L70J 2YIUC 4C7NB 2I1JA 1LT9B 4AYCA 3AE4C 1L4AB 2ZFCA 1HVVA 2KK7A 2A06G 3CMAP 1NTKE 4N78D 4RKUJ 3KZIH 4C46A 3MUDC 2PP6A 3Q1MA 3RGUA 1NTKD 3SFDC 3U59A 3C1LA 1OFCX 2NPSC 1LNQA 2E76D 5EFWB 2O1JA 4H0LB 1L0LK 3AEEC 1TU3F 1LP1A 1KTMA 3A2AA 2ZXXA 3JSVC 1SQVG 3R4YA 2Y0DA 3RK3B 3I55P 2MJZA 3WMM0 2LR2A 2LXBA 1IJDB 1KYOH 4HH2A 1GL2A 4OWFA 1VQ7P 4PV1C 3VYIA 1H0TA 1OW6A 5KAFH 3CCUP 1S5LE 3FWLA 1NTMG 2YMYA 1L2PA 1FOSE 2GM4A 1KYOI 3CCMP 5APUA 1LTJA 3D70A 3CX5I 1L0NJ 4JYCA 1QL2A 3G3ZA 3H1HG 3H1KG 1GL2D 1FZAA 3AE7C 1KB9I 3RBXA 1KILA 1BCCE 2JDIH 4KHXA 1A02J 3L73E 2QSIA 3B71A 2WSCH 2FYZA 3O6QB 5KLVE 1KILE 5CMZA 1SFCB 2E5TA 3VN0A 3H1JE 1CI6B 3H1LJ 5KLVD 2Q6QA 3B4SA 3CC2P 2L91A 1ZN5A 2WPSA 1SQPG 1EQ7A 4H44D 3H1JD 2WSEH 3TGUD 2QG4A 2E75B 4L74A 1JY2O 1T2KD 1N86A 1PP9J 3L75J 2R32A 3NTNA 1NJIQ 3GG2A 2YXQB 1H0TB 2O01J 1OVVA 5KKZB 3S1KA 2YXRB 1AJYA 3SWYA 1G2CB 3M0DC 4L75A 1KD1Q 1YIJP 1RF1C 2XV5A 3CWBG 1IZNB 4KT0J 3MUDA 1NU1D 1GDTA 2IBZI 2IX7C 2Y9YA 1NO4A 2OTLP 2M3EA 1KILB 1BE3G 1P84H 1VQMP 3L70G 3TNUB 3SFEC 2KNCA 2JJLA 1KC8Q 5KLIB 1P84I 4XA4A 3GF3A 1BGYJ 3B8EB 1VQNP 2RN0A 2K9YA 1ZOYC 1HGVA 1ZW0A 3VP9A 4I1LA 4WY4B 4ASWA 5CJ0A 4D6TD 1SQQJ 3M0AA 3H1IG 4BXLA 3VMZA 1PFIA 3KZIE 2IFNA 4DZOA 2QE7H 2YIUB 4JQ0D 1U57A 4PV1D 2ZYGA 1EXIA 2H7HA 3KXDA 3B5NC 3HD7C 2C9LY 4W80A 1GU5A 3MD0A 2SPZA 1JMMA 1L0LJ 1DEEG 2J5UA 5APVA 1JY3P 4BRYA 3Q3DA 1URQB 3GMAA 5KAFE 3BRVB 2E74D 1NTMD 2K9JA 2NPSB 4U3FJ 2KS1B 1J1DC 1FZBA 3HUSC 5AVQB 2QJKC 5C39A 2K88A 5K5GB 2O3JA 3PP5A 2Q7CA 4GT1A 3L72J 3LW5H 5DJTB 2M8RA 3WUUA 3M0DA 1S9KE 1VPCA 3H1LG 1RF1A 1UIXA 3ABVC 3I5CA 3AE3C 1S9KD 1Z56A 5B5EE 2YO3A 1JB0J 1SQPD 3L74D 1PP9G 4HJGH 3L75G 5CCGA 3M9HA 2M3BA 2Q5UA 3K5BA 1ZV8A 1YITP 2P7JA 4N6JA 3P8CE 5GTIH 5CBOA 4Y99C 2N1TB 4IFDK 4BRYB 4JBZA 4RESB 1PL5A 1JY3N 1FJKA 5CCGD 4IFFA 3GHGA 3IAOA 3CWBD 2CPBA 1GK6A 4TLFA 2B9BA 3D6ZA 2HG5D 2KZJA 1R8EA 1X8YA 1NYHA 5KJ7D 3BASA 3L70D 2AEFA 4RO0A 1BGYG 3B5NA 2FYUE 3HD7A 3G6EP 1SQBK 2H8PD 1JM0A 4OH8B 2QJYB 3CCJP 3R2PA 1N7SC 3FGAD 3CCEP 2FYUD 5AVSB 1SVFA 2E43A 4B86A 3AEGC 1FJPA 3B5ND 2E76C 2CPSA 3HD7D 3KQGA 2V7QJ 1OWAA 3L71E 4NPFX 5L8RJ 1KV4A 1EZVG 2ZVOB 2PGDA 1AV1A 2AEMA 4H13C 1IO4A 5B66H 2AXTE 4I6MC 3L71D 1L0LG 2OYHB 1VQKP 1PPJG 2XNXA 4IOIH 2IDBA 3GF7A 3Q5SA 3H32A 1WT6A 1EXJA 1VQPP 4U3FG 2WPRA 2ZT9B 1G1IA 1JUNA 1YQ4C 2B87B 1NTZK 1L0ND 2D2CB 1JNMA 5APWA 2C0XA 4HYTB 2E42A 1YI2P 2WQYC 1LTJC 3M9QA 4Y28J 2IFMA 2XNDH 3TK1A 3PRJA 3L72G 1EC5A 4UB6E 1M56D 1W2EA 2WSCJ 3M06A 1K04A 4H44C 1IFDA 3RK2C 3HTKB 1N73A 2FY8A 1J1DB 1LTSC 1T2KC 3HUSB 1JTHB 1FC2C 5AVYB 1R5SA 1KQGB 2G3AA 1FZCB 3SSUA 1FU1A 3L36A 4QMAA 1YTZI 4JF7A 2PAJA 2WT7A 1NTKK 1N7SA 1LJ2A 1WMKA 5E79E 5GTIE 3V6IA 4N78E 1RHZB 3TYYA 2DW3A 3AECC 3E1RA 2M0BA 3CLQA 1CSBA 3L37A 1N7SD 2FBWC 4IL6X 3H1IJ 4Y99B 3RL0D 1IFNA 2W6AA 4DOJA 2B88A 1BGYD 1T3JA 1YJNP 3L35A 4AQRD 3CL3D 1QVGO 3KDPB 4CPGA 1HGZA 1QGKB 4GOFA 4BWNA 1SQBJ 4H13D 1GZLA 1SQQD 3V2NA 1VQ6P 3BCCJ 4WVZA 2Z5HA 2QVAA 3TSIA 3PHLA 2N9YB 5GTHE 2OYOA 1SQXE 2ZAEB 3Q5RA 4I7ZB 1EZVD 3P8MC 1OVRA 5KLVK 2IZ0A 5B66E 5KAIE 1SQXD 2E74C 2E76B 1PPJD 5TISH 3AEBC 5AW4B 3S9OA 2PFXA 4A7PA 2WPQA 2BEQD 2JP3A 1FZGA 2P58A 4NPEA 4ZMDA 1AQ5A 5B5EH 1VQ9P 3TGUE 4H13B 2WPVB 1S72P 1QX8A 2A45H 3RK2D 1LP1B 2R3CA 1LGHB 1NTZJ 1IFIA 1DX7A 1HWTC 1PIXA 3KPEA 2A45I 2OARA 1NAYA 2POHA 5AW0B 1OZHA 1GL2B 2HYNA 3F89A 2BCCJ 2H43A 5M1BA 1NU1E 2QA4P 3CI9A 2R3SA 1ZP0C 2XDJA 3ITKA 2FXMA 1LTJB 5CCHC 1UIIA 3LIEA 3CXHD 4YXWH 2H89C 5TJHA 2N9BA 1S2EA 1X79B 5DJUB 3FX0A 3V2QA 1Q82Q 3A0HH 1OW7A 5CCGC 1OW8A 3EFGA 4H44B 2WSFJ 5APYA 1NWQA 1OIPA 3GLMA 1IK7A 1NVOA 2XKMA 3O8ZA 2A06E 5AW6B 2IBZG 2J59M 1J1EC 1M1JA 4D6TE 1NTKJ 3V5BA 5KJ7C 2A06D 1YHQP 3AE2C 1LWUA 3GHGC 1NOHA 2QEXP 3HRNA 2XZRA 3E1IA 2M5AA 1KN7A 2AXTH 2HPCA 1SQVE 1VF5C 2P2UA 4W7YA 2WVRA 2IPPA 2C0WA 2KP8A 2R5BA 1SQBG 1SQVD 3BCCG 1NTME 1DH3A 2V4HA 5AVZB 2GA1A 2O1KA 3T97A 2YNYA 2W90A 4GODA 4ZKUA 3H1HE 3H1KE 2KNCB 3EWKA 5AVUB 5AVWB 4EIJA 4I2LC 1GW3A 4DT0A 3H1HD 3H1KD 1BCCJ 4UB6H 3L73J 4PV1B 4PD4E 2VRSA 4K35A 5KLVJ 4IL6H 2HFED 1M1KQ 3IFMA 2QIWA 3HE4A 1FZEA 3CX5D 1MZ9A 2UWJE 5TISE 2RMZA 3H1JJ 1SQPE 3E7KA 4PD4D 2QJPC 3L74E 5CCHA 3AE9C 1EDLA 1T3UA 1ZR2A 1KB9D 1G1JA 1NTZG 1DIPA 2O01H 1IFJA 4R4MA 1M57D 2E74B 3AEFC 1OXZA 4M3LA 1K9MQ 5AW3B 2Y0EA 5CCHD 2WITA 2BCCG 5E79H 3P7KA 1N2DC 1S4XA 2CK3H 2KUBA 3CMEP 3CWBE 3C8VA 3Q2YA 1E5WA 4AUWA 5KJ7A 5AW8B 1D7MA 4K3AA 2K9JB 2OGUA 1Q81Q 3N7NA 1W2BO 1GTWA 1N73C 1ZMEC 1BE3E 3L70E 2FYUK 3EFFK 2FXPA 2OYIC 5APSA 1YJWP 1BE3D 1OX3A 3OJAB 3A0HE 1LTIC 1WRGA 5APTA 1W5CE 3NMDA 2KIKA 3RBZA 1FBMA 3Q5PA 1GU4A 1IC2A 4LLHA 1RF1B 5CBNA 1OMIA 5AW9B 1NTKG 1Q86Q 2W6BA 3IF4A 1Y8AA 3RL0C 3BRTB 3AE1C 1VF5D 4JPZB 3CCSP 2B89A 1IFMA 1U7JA 2JWAA 3H1ID 2QM8A 4Z1MH 1JY3O 5GTHH 1ZR4A 2AEJA 1JOCA 1FDIA 3W67A 1J1EB 1LT1A 2JKVA 1L0NK 5KAIH 1Q2NA 2BEZF 1HTLC 2WTYA 1SFCC 4EOTA 2RH0A 1SQBD 4PJ0H 3GHGB 1YTZT 3VOPA 1BDCA 3CD6P 1L0NE 2IYPA 5AVRB 1X22A 3BATA 5BVZA 2C9NY 3H6PA 1DD4A 1MKMA 4N3YB 3F5HA 3D6YA 1VF5B 3OA7A 1NH4A 3NXSA 2E75C 3B5NB 4OGQD 1BCCG 3HD7B 1BDDA 1LT9A 4L73A 3L73G 3U1AA 1L4AA 2ITAA 5KLVG 1Q90D 3OW2O 3H1LE 3WU2H 2LKMA 3G71P 1ZLLA 1RE4C 3CXHH 3H1JG 5AW7B 3TGUG 4IL6E 3H1LD 2KLVA 1AVOA 1AFOA 1SS1A 1L4AD 3WUTA 1PP9E 2JO1A 2R44A 2QJKB 3L75E 1HBWA 5CHXA 2OYIA 3II6A 3CCVP 3TF5A 1NTZD 4ZKPA 2WSEJ 1PP9D 1BSHA 3L75D 1PGQA 1FDOA 1Q7YQ 5KTBA 2HLOA 2P67A 3SWKA 1JY2P 3RL0g 2W6JH 3H32B 4DCKA 5APXA 3QH9A 4H0LD 2YKPA 1JEKA 4XE5B 3FWNA 4C7RA 2K3RA 1AA0A 2FFDC 4WB4A 1K8AQ 3RK3D 1GK4A 1LTTC 1FOSF 1BGYE 3M9BA 2ZYDA 1SQQK 5H2FH 3UIAA 5BU5A 3D71A 1KMIZ 2YKOA 2FYUJ 3O6QA 1RY3A 2W8ZA 4D6TG 1LTAC 1SFCA 1QEXA 1SQQE 2V7QH 1N73B 1CI6A 1URQC 1HJ0A 4L76A 3AEDC 2IYOA 1QVFO 1M1JC 1XTCC 2OYIB 4GIFA 1SQXK 3AEAC 1SFCD 1EZVE 3L71J 1LWUC 1NKNA 1JCCA 3KYQA 1RQUA 1KORA 1L0LE 1PGPA 3V2PA 2WT7B 2FYNC 1N7SB 1PPJE 3BVHA 3CX5H 4EI2A 1G2CA 3GW6A 3RL0B 1JY2N 3V4QA 4PD4H 3IR9A 3N4XA 1AQTA 1RE4A 1L0LD 2E75D 4U3FE 1KB9H 4TT3H 1RQVA 4R4LA 1DD3A 1M90Q 4KJMA 4PJ0E 4PD4I 5AVTB 3PTZA 4LC1A 1DEBA 3JCUE 4U3FD 2HR3A 2I1KA 3TNUA 1YQ3C 4JYBA 3IN6A 3L72E 3A0BE 1BCCD 3FXEA 3L73D 1X9VA 1NU1K 2N1TC 2P10A 1VQ5P 1MV8A 3L72D 1KILD 2ZVNB 2WWWA 4XFJA 3KHUA 3L74G 2K1AA 3LW5J 3WU2E 4WY4A 3VMXA 3V4WA 1KZUB 3CXHE 3G4SP 2FFDA 2QM7A 2FXOA 1NHLA 3TDKA 1YBKA 1VQOP 3JC22 3CC7P 3CCLP 1S5LX 2A45G 3A3YB 1GMJA 4EYYQ 4WY4D 2QJYC 3EQ2A 3RK2B 1FE6A 2RKLA 2YMKA 2YKQA 2Q3EA 1LTGC 1URQA 2MKVA 2JR8A 1JCDA 2NPSA 1CZQA 1SP4A 1N7LA 2KS1A 2KLUA 2JWDA 5AVVB 1S3JA 3MGNA 2OTKE 1SQVK 3CCQP 1ZXGA 2G8YA 2L5GB 2W83C 1URQD 2FYUG 2JEEA 5H2FE 2NPSD 4WWIA 2Y0CA 2OYHC 1MFZA 2H88C 1NTMK 3OAKA 4GOEA 1HF9A 2FFDB 3A5TA 2HODA 2Q1KA 2ZJSE 1H89A 2BASA 3PH0A 2ZT9C 2LXCB 3LIDA 3VTPC 3L71G 2D2CC 3NFQA 1S1CX 4UB8H 2Q3IA 3SWFA 1SQXJ 2IZ1A 1R5LA 1HUCA 2N1TA 1J2JB 3H25A 1K73Q 1KYOE 2J58A 2Z5IA 1M7LA 1M1JB 4WBAA 1SQPK 1L0NG 3CX5E 4MN4C 4EDFA 3V2RA 1RF0C 1PGOA 3VMAA 1KYOD 2ZYAA 1USDA 2R5DA 1IFPA 1EDJA 1NKZB 1Y47A 5AW5B 1KB9E 1LWUB 4OGQC 2N1TD 3U1CA 4O9BA 4HKZH 1PV3A 3TGUJ 2M5AB 2FYNB 2XU6A 4YXDC 1VQ4P 3PLNA 4ASVA 1FZCC 2QRXA 2HPCB 2KZIA 3MP7B 3MZWB 2WMMA 1VL2A 1KFNA 2HODB 1LT9C 3HE5A 1T6AA 3WUVA 1L4AC 1XTGB 1GW4A 5APQA 1NU1J 1RH5B 2Z4EA 4IFMA 3T97B 2I8DA 1N8RQ 2KSEA 1KQFB 2GUVA 3MHVA 2WSFH 1K05A 1LTBC 1X0TA 3VP8A 1JO5A 2KB7P 4W7ZA 4ZNCA 1VDFA 2FKWB 3P32A 4H0LC 2OYHA 4DJGA 3P8CD 3AE5C 2IBZE 5AW2B
chains in the Genus database with same CATH topology
1HH0A 5CHXA 1FZFA 2OYIA 3II6A 4LGDE 5AW4B 3RK3C 3HE4B 5AW1B 2H7HA 4ZKPA 2WPQA 3B5NC 1FZGA 1RE3C 3HD7C 1AQ5A 2C9LY 4W80A 1GU5A 1H88A 1H8AA 3MD0A 1JMMA 5KTBA 2HLOA 2P67A 1JY2P 5APVA 1JY3P 2A45H 3RK2D 2ZXEB 3H32B 1URQB 5APXA 2R3CA 2YKPA 1LGHB 4XE5B 1IFIA 3BRVB 1DX7A 3HE5B 4C7RA 2NPSB 1HWTC 3KPEA 1A02F 2A45I 2OARA 2FFDC 5AVXB 4WB4A 2POHA 5AW0B 2W27A 1J1DC 3RK3D 1FZBA 1GL2B 2HYNA 3HUSC 5AVQB 1GK4A 2H43A 1LTTC 1RF0A 3PP5A 1FOSF 3HTKA 3M9BA 1SQQK 3CI9A 3UIAA 2Q7CA 5BU5A 2Q9IA 2XDJA 3HUSA 4GT1A 1CW5A 3MTUE 2YKOA 2FXMA 1LTJB 1JTHA 3LW5H 5CCHC 3LIEA 3A7OA 2M8RA 2KSJA 3M91A 3MIWA 1RY3A 3M0DA 1LTAC 2N9BA 1S9KE 1VPCA 1SFCA 1X79B 1RF1A 3V2QA 3I5CA 1N73B 1CI6A 1URQC 1FZCA 5CCGC 3EFGA 1S9KD 2P1JA 1Z56A 5APYA 1NWQA 1M1JC 2YO3A 1XTCC 2OYIB 3L4FA 2GUSA 4GIFA 5CJ4A 4C7NA 1SQXK 2XKMA 3O8ZA 5AW6B 5CCGA 2J59M 1SFCD 1J1EC 1GL2C 1M1JA 2M3BA 3M9HA 2Q5UA 1LWUC 1NAFA 1ZV8A 1NKNA 2P7JA 1IK9A 1SLQA 1JCCA 1FAVA 3V5BA 5KJ7C 1GD2E 4N6JA 3KYQA 3P8CE 4Y99C 2N1TB 3V2PA 2WT7B 4IFDK 1N7SB 1LWUA 3GHGC 1NOHA 3BVHA 1G2CA 1KFMA 3RL0B 4RESB 1JY2N 3V4QA 1JY3N 1FJKA 3HRNA 3IR9A 2XZRA 3E1IA 3N4XA 5CCGD 1RE4A 4IFFA 3GHGA 2WZ7A 1KILC 2CPBA 1GK6A 2HPCA 2HG5D 5AVTB 4LC1A 2P2UA 2YO2A 4W7YA 1DEBA 2IPPA 2KYVA 1X8YA 2C0WA 2KP8A 2R5BA 1YYCA 5KJ7D 2I1KA 3BASA 3TNUA 4JYBA 1QL1A 5BU8B 4GKGA 1DH3A 3B5NA 3C9IA 3VMYA 1FDMA 1RE3A 5AVZB 3HD7A 1SQBK 1KQLA 2O1KA 3T97A 1HJBA 2H8PD 4OH8B 2YNYA 3R2PA 1T8ZA 1X9VA 1NU1K 2N1TC 1N7SC 4WY4C 1MV8A 4ZKUA 5AVSB 1KILD 1SVFA 2E43A 2KOGA 2WWWA 1MUUA 4B86A 5AVUB 4C7NB 4WY4A 3VMXA 2I1JA 1FJPA 1LT9B 4AYCA 5AVWB 3B5ND 4EIJA 2CPSA 3V4WA 1KZUB 4I2LC 1GW3A 2FFDA 2QM7A 3HD7D 1L4AB 2ZFCA 3KQGA 1HVVA 1NHLA 1OWAA 1HBWA 2VRSA 2A45G 3A3YB 4N78D 2HFED 3IFMA 3HE4A 4C46A 1IO4A 4I6MC 2PP6A 1FZEA 1MZ9A 4WY4D 5CCHA 2OYHB 3U59A 1T3UA 2XNXA 1ZR2A 3EQ2A 1G1JA 3RK2B 2NPSC 2YKQA 2O1JA 2O01H 1IFJA 1LTGC 1L0LK 3H32A 1URQA 1WT6A 1OXZA 2WPRA 3A2AA 4M3LA 5AW3B 1JCDA 1G1IA 2NPSA 1JUNA 1CZQA 1NTZK 1SP4A 5CCHD 3RK3B 1N7LA 5APWA 2MJZA 2WITA 3WMM0 1JNMA 2C0XA 5AVVB 4HYTB 1IJDB 3P7KA 1N2DC 4HH2A 3MGNA 2E42A 1GL2A 3VYIA 1SQVK 1LTJC 1E5WA 4AUWA 3M9QA 3TK1A 2IFMA 2L5GB 5KJ7A 5AW8B 2YMYA 1URQD 1FOSE 2GM4A 2JEEA 5APUA 3N7NA 2NPSD 1GTWA 1LTJA 1W2EA 1N73C 2OYHC 4JYCA 1MFZA 1NTMK 3OAKA 3M06A 2FYUK 1QL2A 1IFDA 3G3ZA 3RK2C 2FFDB 1GL2D 1FZAA 2OYIC 3A5TA 3HTKB 5APSA 2HODA 1KILA 1N73A 1J1DB 4KHXA 3OJAB 1LTSC 1A02J 3HUSB 1LTIC 1WRGA 5APTA 1T2KC 3NMDA 2WSCH 1H89A 2BASA 2FYZA 1JTHB 5AVYB 3LIDA 3VTPC 1FBMA 5CMZA 3NFQA 1GU4A 1IC2A 1SFCB 4LLHA 1RF1B 5AW9B 2W6BA 3VN0A 1CI6B 1FZCB 2Q3IA 1FU1A 3L36A 3RL0C 1YTZI 1ZN5A 3BRTB 3SWFA 4JF7A 2WPSA 1HUCA 1EQ7A 2PAJA 2N1TA 2WT7A 1NTKK 1J2JB 1N7SA 1IFMA 2WSEH 2J58A 2Z5IA 4N78E 1M7LA 2QM8A 1M1JB 4WBAA 1JY2O 1T2KD 1SQPK 1JY3O 1N86A 3TYYA 3V2RA 1ZR4A 1RF0C 2R32A 3NTNA 1JOCA 2R5DA 1J1EB 3CLQA 1CSBA 1NKZB 5AW5B 1LWUB 1L0NK 2N1TD 3U1CA 3L37A 1N7SD 4O9BA 3SWYA 1G2CB 3M0DC 1HTLC 2WTYA 1SFCC 4EOTA 1RF1C 4Y99B 3RL0D 2XV5A 2XU6A 3GHGB 1IFNA 1YTZT 3MUDA 2W6AA 3VOPA 4DOJA 1T3JA 2HPCB 1FZCC 1GDTA 3L35A 4AQRD 2IX7C 5AVRB 1NO4A 3BATA 3CL3D 5BVZA 2C9NY 1KFNA 3KDPB 2HODB 1KILB 3H6PA 4N3YB 1LT9C 3HE5A 3OA7A 1HGZA 1NH4A 3TNUB 1L4AC 1XTGB 2JJLA 3NXSA 1GW4A 5APQA 3B5NB 1GZLA 3V2NA 4XA4A 3HD7B 1LT9A 2Z4EA 4IFMA 3U1AA 3B8EB 1L4AA 2Z5HA 2GUVA 3TSIA 2WSFH 1LTBC 2LKMA 3VP8A 1ZLLA 1HGVA 1RE4C 3VP9A 4I1LA 5AW7B 4WY4B 1JO5A 2KB7P 3P8MC 5KLVK 5CJ0A 4W7ZA 3M0AA 1VDFA 3VMZA 1PFIA 2FKWB 2KLVA 3P32A 1AFOA 2OYHA 2IFNA 4DZOA 1L4AD 3P8CD 5AW2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P7J A;  1SLQ A;  1FAV A;  3V5B A;  2Z5I A;  1GD2 E;  5AW4 B;  3HE4 B;  2QM8 A;  5AW1 B;  2H7H A;  2WT7 B;  1T2K D;  2WPQ A;  3TYY A;  2R32 A;  3NTN A;  4RES B;  2C9L Y;  1GU5 A;  3V4Q A;  1H88 A;  2R5D A;  1H8A A;  3IR9 A;  1CSB A;  2XZR A;  3MD0 A;  5AW5 B;  1OXZ A;  2WPR A;  3A2A A;  4M3L A;  2P67 A;  5AW3 B;  3L37 A;  5APV A;  1JUN A;  1G2C B;  2ZXE B;  1CZQ A;  1GK6 A;  1SP4 A;  5APX A;  1JNM A;  5APW A;  2WTY A;  2R3C A;  4EOT A;  5AVV B;  5AVT B;  2XV5 A;  4XE5 B;  2XU6 A;  4HYT B;  4LC1 A;  3P7K A;  2P2U A;  2YO2 A;  3MGN A;  2E42 A;  2IPP A;  3HE5 B;  2W6A A;  1HWT C;  1A02 F;  3VYI A;  1X8Y A;  5AVX B;  2KP8 A;  2R5B A;  4AUW A;  1YYC A;  3TK1 A;  3L35 A;  2W27 A;  5AW0 B;  4AQR D;  5AW8 B;  3TNU A;  1FOS E;  5AVR B;  4JYB A;  5AVQ B;  2C9N Y;  4GKG A;  1GK4 A;  1DH3 A;  3KDP B;  5APU A;  3VMY A;  3HE5 A;  5AVZ B;  1FOS F;  1GTW A;  3HTK A;  1KQL A;  3M9B A;  3T97 A;  4JYC A;  3TNU B;  1HJB A;  1MFZ A;  2JJL A;  2YNY A;  3NXS A;  3OAK A;  3M06 A;  2Q7C A;  3UIA A;  5APQ A;  1GZL A;  4GT1 A;  1MV8 A;  3A5T A;  5APS A;  5AVS B;  3LIE A;  3A7O A;  2E43 A;  3M91 A;  3B8E B;  2WWW A;  3M0D A;  2N9B A;  4KHX A;  1S9K E;  1MUU A;  1A02 J;  1T2K C;  5APT A;  2Z5H A;  3NMD A;  4B86 A;  5AVU B;  4C7N B;  1H89 A;  3VMX A;  2BAS A;  4AYC A;  5AVW B;  3I5C A;  5AVY B;  3V4W A;  4I2L C;  2QM7 A;  1CI6 A;  3LID A;  3VTP C;  5CMZ A;  2ZFC A;  3KQG A;  3NFQ A;  1GU4 A;  1S9K D;  5APY A;  5AW7 B;  1NWQ A;  1OWA A;  3P8M C;  5AW9 B;  2YO3 A;  1HBW A;  3VN0 A;  3M0A A;  1CI6 B;  2VRS A;  4C7N A;  3VMZ A;  2Q3I A;  3O8Z A;  3P32 A;  3A3Y B;  3L36 A;  5AW6 B;  4DZO A;  3SWF A;  3HE4 A;  2WPS A;  4C46 A;  1IO4 A;  3M9H A;  1HUC A;  4I6M C;  2Q5U A;  1NAF A;  2WT7 A;  1J2J B;  5AW2 B; 
#chains in the Genus database with same CATH topology
 1HH0 A;  1FZF A;  4LGD E;  3RK3 C;  3HE4 B;  5AW1 B;  1AVY A;  1BSN A;  1PZQ A;  4D6T J;  1RE3 C;  2K37 A;  2IBZ D;  2WSS H;  1Y9B A;  1FS0 E;  2B87 A;  3W68 A;  1H88 A;  3H1I E;  1P84 E;  1H8A A;  1ZRT E;  2ZXE B;  1P84 D;  4I7Z C;  1ZRT D;  3HE5 B;  1A02 F;  1E79 H;  5AVX B;  1EZV I;  2ZT9 D;  1SQQ G;  2W27 A;  1SQV J;  2D2C D;  1SQB E;  1S5L H;  3AE6 C;  1RF0 A;  1YJ9 P;  1PGJ A;  3BCC E;  3HTK A;  2OTJ P;  1USE A;  2Q9I A;  3HUS A;  1NTM J;  3MTU E;  1CW5 A;  3G9R A;  1KQS O;  1NGM B;  1JTH A;  3A7O A;  2KSJ A;  3M91 A;  3MIW A;  3BCC D;  4U7J A;  3JCU H;  3FXD A;  3AE8 C;  1M8O B;  2KXP B;  1SQX G;  3H1H J;  3H1K J;  4YPC A;  1FZC A;  2P1J A;  4UB8 E;  3CCR P;  3A0B H;  3S4R A;  3L4F A;  2GUS A;  5CJ4 A;  4C7N A;  3ZDM A;  4OVN F;  1VQL P;  3CC4 P;  1VQ8 P;  1GL2 C;  1NAF A;  2NZ2 A;  5KKZ C;  1IK9 A;  1SLQ A;  1FAV A;  3USS A;  1GD2 E;  4RJT A;  1EDK A;  1SQP J;  3L74 J;  1KFM A;  2AXC A;  1NTZ E;  3CXH I;  1U7M A;  1EDI A;  1QLE D;  2WZ7 A;  1KIL C;  2O01 N;  4HB1 A;  3I56 P;  2YO2 A;  1OVU A;  2BCC E;  2KYV A;  2E5Y A;  3PJS K;  5KLI C;  1JMB A;  1YYC A;  2OQQ A;  1NU1 G;  4OGQ B;  1QL1 A;  5BU8 B;  4GKG A;  2BCC D;  2NRG A;  3C9I A;  3VMY A;  1FDM A;  1RE3 A;  2PRR A;  2QJP B;  3CWB J;  1KQL A;  1HJB A;  3CPW O;  3RK3 E;  4NPD A;  1T8Z A;  4WY4 C;  2Y9Z A;  4YTP C;  2KOG A;  1MFT A;  1BE3 J;  4GDO A;  1MUU A;  3QWO C;  2KI7 B;  3L70 J;  2YIU C;  4C7N B;  2I1J A;  1LT9 B;  4AYC A;  3AE4 C;  1L4A B;  2ZFC A;  1HVV A;  2KK7 A;  2A06 G;  3CMA P;  1NTK E;  4N78 D;  4RKU J;  3KZI H;  4C46 A;  3MUD C;  2PP6 A;  3Q1M A;  3RGU A;  1NTK D;  3SFD C;  3U59 A;  3C1L A;  1OFC X;  2NPS C;  1LNQ A;  2E76 D;  5EFW B;  2O1J A;  4H0L B;  1L0L K;  3AEE C;  1TU3 F;  1LP1 A;  1KTM A;  3A2A A;  2ZXX A;  3JSV C;  1SQV G;  3R4Y A;  2Y0D A;  3RK3 B;  3I55 P;  2MJZ A;  3WMM 0;  2LR2 A;  2LXB A;  1IJD B;  1KYO H;  4HH2 A;  1GL2 A;  4OWF A;  1VQ7 P;  4PV1 C;  3VYI A;  1H0T A;  1OW6 A;  5KAF H;  3CCU P;  1S5L E;  3FWL A;  1NTM G;  2YMY A;  1L2P A;  1FOS E;  2GM4 A;  1KYO I;  3CCM P;  5APU A;  1LTJ A;  3D70 A;  3CX5 I;  1L0N J;  4JYC A;  1QL2 A;  3G3Z A;  3H1H G;  3H1K G;  1GL2 D;  1FZA A;  3AE7 C;  1KB9 I;  3RBX A;  1KIL A;  1BCC E;  2JDI H;  4KHX A;  1A02 J;  3L73 E;  2QSI A;  3B71 A;  2WSC H;  2FYZ A;  3O6Q B;  5KLV E;  1KIL E;  5CMZ A;  1SFC B;  2E5T A;  3VN0 A;  3H1J E;  1CI6 B;  3H1L J;  5KLV D;  2Q6Q A;  3B4S A;  3CC2 P;  2L91 A;  1ZN5 A;  2WPS A;  1SQP G;  1EQ7 A;  4H44 D;  3H1J D;  2WSE H;  3TGU D;  2QG4 A;  2E75 B;  4L74 A;  1JY2 O;  1T2K D;  1N86 A;  1PP9 J;  3L75 J;  2R32 A;  3NTN A;  1NJI Q;  3GG2 A;  2YXQ B;  1H0T B;  2O01 J;  1OVV A;  5KKZ B;  3S1K A;  2YXR B;  1AJY A;  3SWY A;  1G2C B;  3M0D C;  4L75 A;  1KD1 Q;  1YIJ P;  1RF1 C;  2XV5 A;  3CWB G;  1IZN B;  4KT0 J;  3MUD A;  1NU1 D;  1GDT A;  2IBZ I;  2IX7 C;  2Y9Y A;  1NO4 A;  2OTL P;  2M3E A;  1KIL B;  1BE3 G;  1P84 H;  1VQM P;  3L70 G;  3TNU B;  3SFE C;  2KNC A;  2JJL A;  1KC8 Q;  5KLI B;  1P84 I;  4XA4 A;  3GF3 A;  1BGY J;  3B8E B;  1VQN P;  2RN0 A;  2K9Y A;  1ZOY C;  1HGV A;  1ZW0 A;  3VP9 A;  4I1L A;  4WY4 B;  4ASW A;  5CJ0 A;  4D6T D;  1SQQ J;  3M0A A;  3H1I G;  4BXL A;  3VMZ A;  1PFI A;  3KZI E;  2IFN A;  4DZO A;  2QE7 H;  2YIU B;  4JQ0 D;  1U57 A;  4PV1 D;  2ZYG A;  1EXI A;  2H7H A;  3KXD A;  3B5N C;  3HD7 C;  2C9L Y;  4W80 A;  1GU5 A;  3MD0 A;  2SPZ A;  1JMM A;  1L0L J;  1DEE G;  2J5U A;  5APV A;  1JY3 P;  4BRY A;  3Q3D A;  1URQ B;  3GMA A;  5KAF E;  3BRV B;  2E74 D;  1NTM D;  2K9J A;  2NPS B;  4U3F J;  2KS1 B;  1J1D C;  1FZB A;  3HUS C;  5AVQ B;  2QJK C;  5C39 A;  2K88 A;  5K5G B;  2O3J A;  3PP5 A;  2Q7C A;  4GT1 A;  3L72 J;  3LW5 H;  5DJT B;  2M8R A;  3WUU A;  3M0D A;  1S9K E;  1VPC A;  3H1L G;  1RF1 A;  1UIX A;  3ABV C;  3I5C A;  3AE3 C;  1S9K D;  1Z56 A;  5B5E E;  2YO3 A;  1JB0 J;  1SQP D;  3L74 D;  1PP9 G;  4HJG H;  3L75 G;  5CCG A;  3M9H A;  2M3B A;  2Q5U A;  3K5B A;  1ZV8 A;  1YIT P;  2P7J A;  4N6J A;  3P8C E;  5GTI H;  5CBO A;  4Y99 C;  2N1T B;  4IFD K;  4BRY B;  4JBZ A;  4RES B;  1PL5 A;  1JY3 N;  1FJK A;  5CCG D;  4IFF A;  3GHG A;  3IAO A;  3CWB D;  2CPB A;  1GK6 A;  4TLF A;  2B9B A;  3D6Z A;  2HG5 D;  2KZJ A;  1R8E A;  1X8Y A;  1NYH A;  5KJ7 D;  3BAS A;  3L70 D;  2AEF A;  4RO0 A;  1BGY G;  3B5N A;  2FYU E;  3HD7 A;  3G6E P;  1SQB K;  2H8P D;  1JM0 A;  4OH8 B;  2QJY B;  3CCJ P;  3R2P A;  1N7S C;  3FGA D;  3CCE P;  2FYU D;  5AVS B;  1SVF A;  2E43 A;  4B86 A;  3AEG C;  1FJP A;  3B5N D;  2E76 C;  2CPS A;  3HD7 D;  3KQG A;  2V7Q J;  1OWA A;  3L71 E;  4NPF X;  5L8R J;  1KV4 A;  1EZV G;  2ZVO B;  2PGD A;  1AV1 A;  2AEM A;  4H13 C;  1IO4 A;  5B66 H;  2AXT E;  4I6M C;  3L71 D;  1L0L G;  2OYH B;  1VQK P;  1PPJ G;  2XNX A;  4IOI H;  2IDB A;  3GF7 A;  3Q5S A;  3H32 A;  1WT6 A;  1EXJ A;  1VQP P;  4U3F G;  2WPR A;  2ZT9 B;  1G1I A;  1JUN A;  1YQ4 C;  2B87 B;  1NTZ K;  1L0N D;  2D2C B;  1JNM A;  5APW A;  2C0X A;  4HYT B;  2E42 A;  1YI2 P;  2WQY C;  1LTJ C;  3M9Q A;  4Y28 J;  2IFM A;  2XND H;  3TK1 A;  3PRJ A;  3L72 G;  1EC5 A;  4UB6 E;  1M56 D;  1W2E A;  2WSC J;  3M06 A;  1K04 A;  4H44 C;  1IFD A;  3RK2 C;  3HTK B;  1N73 A;  2FY8 A;  1J1D B;  1LTS C;  1T2K C;  3HUS B;  1JTH B;  1FC2 C;  5AVY B;  1R5S A;  1KQG B;  2G3A A;  1FZC B;  3SSU A;  1FU1 A;  3L36 A;  4QMA A;  1YTZ I;  4JF7 A;  2PAJ A;  2WT7 A;  1NTK K;  1N7S A;  1LJ2 A;  1WMK A;  5E79 E;  5GTI E;  3V6I A;  4N78 E;  1RHZ B;  3TYY A;  2DW3 A;  3AEC C;  3E1R A;  2M0B A;  3CLQ A;  1CSB A;  3L37 A;  1N7S D;  2FBW C;  4IL6 X;  3H1I J;  4Y99 B;  3RL0 D;  1IFN A;  2W6A A;  4DOJ A;  2B88 A;  1BGY D;  1T3J A;  1YJN P;  3L35 A;  4AQR D;  3CL3 D;  1QVG O;  3KDP B;  4CPG A;  1HGZ A;  1QGK B;  4GOF A;  4BWN A;  1SQB J;  4H13 D;  1GZL A;  1SQQ D;  3V2N A;  1VQ6 P;  3BCC J;  4WVZ A;  2Z5H A;  2QVA A;  3TSI A;  3PHL A;  2N9Y B;  5GTH E;  2OYO A;  1SQX E;  2ZAE B;  3Q5R A;  4I7Z B;  1EZV D;  3P8M C;  1OVR A;  5KLV K;  2IZ0 A;  5B66 E;  5KAI E;  1SQX D;  2E74 C;  2E76 B;  1PPJ D;  5TIS H;  3AEB C;  5AW4 B;  3S9O A;  2PFX A;  4A7P A;  2WPQ A;  2BEQ D;  2JP3 A;  1FZG A;  2P58 A;  4NPE A;  4ZMD A;  1AQ5 A;  5B5E H;  1VQ9 P;  3TGU E;  4H13 B;  2WPV B;  1S72 P;  1QX8 A;  2A45 H;  3RK2 D;  1LP1 B;  2R3C A;  1LGH B;  1NTZ J;  1IFI A;  1DX7 A;  1HWT C;  1PIX A;  3KPE A;  2A45 I;  2OAR A;  1NAY A;  2POH A;  5AW0 B;  1OZH A;  1GL2 B;  2HYN A;  3F89 A;  2BCC J;  2H43 A;  5M1B A;  1NU1 E;  2QA4 P;  3CI9 A;  2R3S A;  1ZP0 C;  2XDJ A;  3ITK A;  2FXM A;  1LTJ B;  5CCH C;  1UII A;  3LIE A;  3CXH D;  4YXW H;  2H89 C;  5TJH A;  2N9B A;  1S2E A;  1X79 B;  5DJU B;  3FX0 A;  3V2Q A;  1Q82 Q;  3A0H H;  1OW7 A;  5CCG C;  1OW8 A;  3EFG A;  4H44 B;  2WSF J;  5APY A;  1NWQ A;  1OIP A;  3GLM A;  1IK7 A;  1NVO A;  2XKM A;  3O8Z A;  2A06 E;  5AW6 B;  2IBZ G;  2J59 M;  1J1E C;  1M1J A;  4D6T E;  1NTK J;  3V5B A;  5KJ7 C;  2A06 D;  1YHQ P;  3AE2 C;  1LWU A;  3GHG C;  1NOH A;  2QEX P;  3HRN A;  2XZR A;  3E1I A;  2M5A A;  1KN7 A;  2AXT H;  2HPC A;  1SQV E;  1VF5 C;  2P2U A;  4W7Y A;  2WVR A;  2IPP A;  2C0W A;  2KP8 A;  2R5B A;  1SQB G;  1SQV D;  3BCC G;  1NTM E;  1DH3 A;  2V4H A;  5AVZ B;  2GA1 A;  2O1K A;  3T97 A;  2YNY A;  2W90 A;  4GOD A;  4ZKU A;  3H1H E;  3H1K E;  2KNC B;  3EWK A;  5AVU B;  5AVW B;  4EIJ A;  4I2L C;  1GW3 A;  4DT0 A;  3H1H D;  3H1K D;  1BCC J;  4UB6 H;  3L73 J;  4PV1 B;  4PD4 E;  2VRS A;  4K35 A;  5KLV J;  4IL6 H;  2HFE D;  1M1K Q;  3IFM A;  2QIW A;  3HE4 A;  1FZE A;  3CX5 D;  1MZ9 A;  2UWJ E;  5TIS E;  2RMZ A;  3H1J J;  1SQP E;  3E7K A;  4PD4 D;  2QJP C;  3L74 E;  5CCH A;  3AE9 C;  1EDL A;  1T3U A;  1ZR2 A;  1KB9 D;  1G1J A;  1NTZ G;  1DIP A;  2O01 H;  1IFJ A;  4R4M A;  1M57 D;  2E74 B;  3AEF C;  1OXZ A;  4M3L A;  1K9M Q;  5AW3 B;  2Y0E A;  5CCH D;  2WIT A;  2BCC G;  5E79 H;  3P7K A;  1N2D C;  1S4X A;  2CK3 H;  2KUB A;  3CME P;  3CWB E;  3C8V A;  3Q2Y A;  1E5W A;  4AUW A;  5KJ7 A;  5AW8 B;  1D7M A;  4K3A A;  2K9J B;  2OGU A;  1Q81 Q;  3N7N A;  1W2B O;  1GTW A;  1N73 C;  1ZME C;  1BE3 E;  3L70 E;  2FYU K;  3EFF K;  2FXP A;  2OYI C;  5APS A;  1YJW P;  1BE3 D;  1OX3 A;  3OJA B;  3A0H E;  1LTI C;  1WRG A;  5APT A;  1W5C E;  3NMD A;  2KIK A;  3RBZ A;  1FBM A;  3Q5P A;  1GU4 A;  1IC2 A;  4LLH A;  1RF1 B;  5CBN A;  1OMI A;  5AW9 B;  1NTK G;  1Q86 Q;  2W6B A;  3IF4 A;  1Y8A A;  3RL0 C;  3BRT B;  3AE1 C;  1VF5 D;  4JPZ B;  3CCS P;  2B89 A;  1IFM A;  1U7J A;  2JWA A;  3H1I D;  2QM8 A;  4Z1M H;  1JY3 O;  5GTH H;  1ZR4 A;  2AEJ A;  1JOC A;  1FDI A;  3W67 A;  1J1E B;  1LT1 A;  2JKV A;  1L0N K;  5KAI H;  1Q2N A;  2BEZ F;  1HTL C;  2WTY A;  1SFC C;  4EOT A;  2RH0 A;  1SQB D;  4PJ0 H;  3GHG B;  1YTZ T;  3VOP A;  1BDC A;  3CD6 P;  1L0N E;  2IYP A;  5AVR B;  1X22 A;  3BAT A;  5BVZ A;  2C9N Y;  3H6P A;  1DD4 A;  1MKM A;  4N3Y B;  3F5H A;  3D6Y A;  1VF5 B;  3OA7 A;  1NH4 A;  3NXS A;  2E75 C;  3B5N B;  4OGQ D;  1BCC G;  3HD7 B;  1BDD A;  1LT9 A;  4L73 A;  3L73 G;  3U1A A;  1L4A A;  2ITA A;  5KLV G;  1Q90 D;  3OW2 O;  3H1L E;  3WU2 H;  2LKM A;  3G71 P;  1ZLL A;  1RE4 C;  3CXH H;  3H1J G;  5AW7 B;  3TGU G;  4IL6 E;  3H1L D;  2KLV A;  1AVO A;  1AFO A;  1SS1 A;  1L4A D;  3WUT A;  1PP9 E;  2JO1 A;  2R44 A;  2QJK B;  3L75 E;  1HBW A;  5CHX A;  2OYI A;  3II6 A;  3CCV P;  3TF5 A;  1NTZ D;  4ZKP A;  2WSE J;  1PP9 D;  1BSH A;  3L75 D;  1PGQ A;  1FDO A;  1Q7Y Q;  5KTB A;  2HLO A;  2P67 A;  3SWK A;  1JY2 P;  3RL0 g;  2W6J H;  3H32 B;  4DCK A;  5APX A;  3QH9 A;  4H0L D;  2YKP A;  1JEK A;  4XE5 B;  3FWN A;  4C7R A;  2K3R A;  1AA0 A;  2FFD C;  4WB4 A;  1K8A Q;  3RK3 D;  1GK4 A;  1LTT C;  1FOS F;  1BGY E;  3M9B A;  2ZYD A;  1SQQ K;  5H2F H;  3UIA A;  5BU5 A;  3D71 A;  1KMI Z;  2YKO A;  2FYU J;  3O6Q A;  1RY3 A;  2W8Z A;  4D6T G;  1LTA C;  1SFC A;  1QEX A;  1SQQ E;  2V7Q H;  1N73 B;  1CI6 A;  1URQ C;  1HJ0 A;  4L76 A;  3AED C;  2IYO A;  1QVF O;  1M1J C;  1XTC C;  2OYI B;  4GIF A;  1SQX K;  3AEA C;  1SFC D;  1EZV E;  3L71 J;  1LWU C;  1NKN A;  1JCC A;  3KYQ A;  1RQU A;  1KOR A;  1L0L E;  1PGP A;  3V2P A;  2WT7 B;  2FYN C;  1N7S B;  1PPJ E;  3BVH A;  3CX5 H;  4EI2 A;  1G2C A;  3GW6 A;  3RL0 B;  1JY2 N;  3V4Q A;  4PD4 H;  3IR9 A;  3N4X A;  1AQT A;  1RE4 A;  1L0L D;  2E75 D;  4U3F E;  1KB9 H;  4TT3 H;  1RQV A;  4R4L A;  1DD3 A;  1M90 Q;  4KJM A;  4PJ0 E;  4PD4 I;  5AVT B;  3PTZ A;  4LC1 A;  1DEB A;  3JCU E;  4U3F D;  2HR3 A;  2I1K A;  3TNU A;  1YQ3 C;  4JYB A;  3IN6 A;  3L72 E;  3A0B E;  1BCC D;  3FXE A;  3L73 D;  1X9V A;  1NU1 K;  2N1T C;  2P10 A;  1VQ5 P;  1MV8 A;  3L72 D;  1KIL D;  2ZVN B;  2WWW A;  4XFJ A;  3KHU A;  3L74 G;  2K1A A;  3LW5 J;  3WU2 E;  4WY4 A;  3VMX A;  3V4W A;  1KZU B;  3CXH E;  3G4S P;  2FFD A;  2QM7 A;  2FXO A;  1NHL A;  3TDK A;  1YBK A;  1VQO P;  3JC2 2;  3CC7 P;  3CCL P;  1S5L X;  2A45 G;  3A3Y B;  1GMJ A;  4EYY Q;  4WY4 D;  2QJY C;  3EQ2 A;  3RK2 B;  1FE6 A;  2RKL A;  2YMK A;  2YKQ A;  2Q3E A;  1LTG C;  1URQ A;  2MKV A;  2JR8 A;  1JCD A;  2NPS A;  1CZQ A;  1SP4 A;  1N7L A;  2KS1 A;  2KLU A;  2JWD A;  5AVV B;  1S3J A;  3MGN A;  2OTK E;  1SQV K;  3CCQ P;  1ZXG A;  2G8Y A;  2L5G B;  2W83 C;  1URQ D;  2FYU G;  2JEE A;  5H2F E;  2NPS D;  4WWI A;  2Y0C A;  2OYH C;  1MFZ A;  2H88 C;  1NTM K;  3OAK A;  4GOE A;  1HF9 A;  2FFD B;  3A5T A;  2HOD A;  2Q1K A;  2ZJS E;  1H89 A;  2BAS A;  3PH0 A;  2ZT9 C;  2LXC B;  3LID A;  3VTP C;  3L71 G;  2D2C C;  3NFQ A;  1S1C X;  4UB8 H;  2Q3I A;  3SWF A;  1SQX J;  2IZ1 A;  1R5L A;  1HUC A;  2N1T A;  1J2J B;  3H25 A;  1K73 Q;  1KYO E;  2J58 A;  2Z5I A;  1M7L A;  1M1J B;  4WBA A;  1SQP K;  1L0N G;  3CX5 E;  4MN4 C;  4EDF A;  3V2R A;  1RF0 C;  1PGO A;  3VMA A;  1KYO D;  2ZYA A;  1USD A;  2R5D A;  1IFP A;  1EDJ A;  1NKZ B;  1Y47 A;  5AW5 B;  1KB9 E;  1LWU B;  4OGQ C;  2N1T D;  3U1C A;  4O9B A;  4HKZ H;  1PV3 A;  3TGU J;  2M5A B;  2FYN B;  2XU6 A;  4YXD C;  1VQ4 P;  3PLN A;  4ASV A;  1FZC C;  2QRX A;  2HPC B;  2KZI A;  3MP7 B;  3MZW B;  2WMM A;  1VL2 A;  1KFN A;  2HOD B;  1LT9 C;  3HE5 A;  1T6A A;  3WUV A;  1L4A C;  1XTG B;  1GW4 A;  5APQ A;  1NU1 J;  1RH5 B;  2Z4E A;  4IFM A;  3T97 B;  2I8D A;  1N8R Q;  2KSE A;  1KQF B;  2GUV A;  3MHV A;  2WSF H;  1K05 A;  1LTB C;  1X0T A;  3VP8 A;  1JO5 A;  2KB7 P;  4W7Z A;  4ZNC A;  1VDF A;  2FKW B;  3P32 A;  4H0L C;  2OYH A;  4DJG A;  3P8C D;  3AE5 C;  2IBZ E;  5AW2 B; 
#chains in the Genus database with same CATH homology
 1HH0 A;  5CHX A;  1FZF A;  2OYI A;  3II6 A;  4LGD E;  5AW4 B;  3RK3 C;  3HE4 B;  5AW1 B;  2H7H A;  4ZKP A;  2WPQ A;  3B5N C;  1FZG A;  1RE3 C;  3HD7 C;  1AQ5 A;  2C9L Y;  4W80 A;  1GU5 A;  1H88 A;  1H8A A;  3MD0 A;  1JMM A;  5KTB A;  2HLO A;  2P67 A;  1JY2 P;  5APV A;  1JY3 P;  2A45 H;  3RK2 D;  2ZXE B;  3H32 B;  1URQ B;  5APX A;  2R3C A;  2YKP A;  1LGH B;  4XE5 B;  1IFI A;  3BRV B;  1DX7 A;  3HE5 B;  4C7R A;  2NPS B;  1HWT C;  3KPE A;  1A02 F;  2A45 I;  2OAR A;  2FFD C;  5AVX B;  4WB4 A;  2POH A;  5AW0 B;  2W27 A;  1J1D C;  3RK3 D;  1FZB A;  1GL2 B;  2HYN A;  3HUS C;  5AVQ B;  1GK4 A;  2H43 A;  1LTT C;  1RF0 A;  3PP5 A;  1FOS F;  3HTK A;  3M9B A;  1SQQ K;  3CI9 A;  3UIA A;  2Q7C A;  5BU5 A;  2Q9I A;  2XDJ A;  3HUS A;  4GT1 A;  1CW5 A;  3MTU E;  2YKO A;  2FXM A;  1LTJ B;  1JTH A;  3LW5 H;  5CCH C;  3LIE A;  3A7O A;  2M8R A;  2KSJ A;  3M91 A;  3MIW A;  1RY3 A;  3M0D A;  1LTA C;  2N9B A;  1S9K E;  1VPC A;  1SFC A;  1X79 B;  1RF1 A;  3V2Q A;  3I5C A;  1N73 B;  1CI6 A;  1URQ C;  1FZC A;  5CCG C;  3EFG A;  1S9K D;  2P1J A;  1Z56 A;  5APY A;  1NWQ A;  1M1J C;  2YO3 A;  1XTC C;  2OYI B;  3L4F A;  2GUS A;  4GIF A;  5CJ4 A;  4C7N A;  1SQX K;  2XKM A;  3O8Z A;  5AW6 B;  5CCG A;  2J59 M;  1SFC D;  1J1E C;  1GL2 C;  1M1J A;  2M3B A;  3M9H A;  2Q5U A;  1LWU C;  1NAF A;  1ZV8 A;  1NKN A;  2P7J A;  1IK9 A;  1SLQ A;  1JCC A;  1FAV A;  3V5B A;  5KJ7 C;  1GD2 E;  4N6J A;  3KYQ A;  3P8C E;  4Y99 C;  2N1T B;  3V2P A;  2WT7 B;  4IFD K;  1N7S B;  1LWU A;  3GHG C;  1NOH A;  3BVH A;  1G2C A;  1KFM A;  3RL0 B;  4RES B;  1JY2 N;  3V4Q A;  1JY3 N;  1FJK A;  3HRN A;  3IR9 A;  2XZR A;  3E1I A;  3N4X A;  5CCG D;  1RE4 A;  4IFF A;  3GHG A;  2WZ7 A;  1KIL C;  2CPB A;  1GK6 A;  2HPC A;  2HG5 D;  5AVT B;  4LC1 A;  2P2U A;  2YO2 A;  4W7Y A;  1DEB A;  2IPP A;  2KYV A;  1X8Y A;  2C0W A;  2KP8 A;  2R5B A;  1YYC A;  5KJ7 D;  2I1K A;  3BAS A;  3TNU A;  4JYB A;  1QL1 A;  5BU8 B;  4GKG A;  1DH3 A;  3B5N A;  3C9I A;  3VMY A;  1FDM A;  1RE3 A;  5AVZ B;  3HD7 A;  1SQB K;  1KQL A;  2O1K A;  3T97 A;  1HJB A;  2H8P D;  4OH8 B;  2YNY A;  3R2P A;  1T8Z A;  1X9V A;  1NU1 K;  2N1T C;  1N7S C;  4WY4 C;  1MV8 A;  4ZKU A;  5AVS B;  1KIL D;  1SVF A;  2E43 A;  2KOG A;  2WWW A;  1MUU A;  4B86 A;  5AVU B;  4C7N B;  4WY4 A;  3VMX A;  2I1J A;  1FJP A;  1LT9 B;  4AYC A;  5AVW B;  3B5N D;  4EIJ A;  2CPS A;  3V4W A;  1KZU B;  4I2L C;  1GW3 A;  2FFD A;  2QM7 A;  3HD7 D;  1L4A B;  2ZFC A;  3KQG A;  1HVV A;  1NHL A;  1OWA A;  1HBW A;  2VRS A;  2A45 G;  3A3Y B;  4N78 D;  2HFE D;  3IFM A;  3HE4 A;  4C46 A;  1IO4 A;  4I6M C;  2PP6 A;  1FZE A;  1MZ9 A;  4WY4 D;  5CCH A;  2OYH B;  3U59 A;  1T3U A;  2XNX A;  1ZR2 A;  3EQ2 A;  1G1J A;  3RK2 B;  2NPS C;  2YKQ A;  2O1J A;  2O01 H;  1IFJ A;  1LTG C;  1L0L K;  3H32 A;  1URQ A;  1WT6 A;  1OXZ A;  2WPR A;  3A2A A;  4M3L A;  5AW3 B;  1JCD A;  1G1I A;  2NPS A;  1JUN A;  1CZQ A;  1NTZ K;  1SP4 A;  5CCH D;  3RK3 B;  1N7L A;  5APW A;  2MJZ A;  2WIT A;  3WMM 0;  1JNM A;  2C0X A;  5AVV B;  4HYT B;  1IJD B;  3P7K A;  1N2D C;  4HH2 A;  3MGN A;  2E42 A;  1GL2 A;  3VYI A;  1SQV K;  1LTJ C;  1E5W A;  4AUW A;  3M9Q A;  3TK1 A;  2IFM A;  2L5G B;  5KJ7 A;  5AW8 B;  2YMY A;  1URQ D;  1FOS E;  2GM4 A;  2JEE A;  5APU A;  3N7N A;  2NPS D;  1GTW A;  1LTJ A;  1W2E A;  1N73 C;  2OYH C;  4JYC A;  1MFZ A;  1NTM K;  3OAK A;  3M06 A;  2FYU K;  1QL2 A;  1IFD A;  3G3Z A;  3RK2 C;  2FFD B;  1GL2 D;  1FZA A;  2OYI C;  3A5T A;  3HTK B;  5APS A;  2HOD A;  1KIL A;  1N73 A;  1J1D B;  4KHX A;  3OJA B;  1LTS C;  1A02 J;  3HUS B;  1LTI C;  1WRG A;  5APT A;  1T2K C;  3NMD A;  2WSC H;  1H89 A;  2BAS A;  2FYZ A;  1JTH B;  5AVY B;  3LID A;  3VTP C;  1FBM A;  5CMZ A;  3NFQ A;  1GU4 A;  1IC2 A;  1SFC B;  4LLH A;  1RF1 B;  5AW9 B;  2W6B A;  3VN0 A;  1CI6 B;  1FZC B;  2Q3I A;  1FU1 A;  3L36 A;  3RL0 C;  1YTZ I;  1ZN5 A;  3BRT B;  3SWF A;  4JF7 A;  2WPS A;  1HUC A;  1EQ7 A;  2PAJ A;  2N1T A;  2WT7 A;  1NTK K;  1J2J B;  1N7S A;  1IFM A;  2WSE H;  2J58 A;  2Z5I A;  4N78 E;  1M7L A;  2QM8 A;  1M1J B;  4WBA A;  1JY2 O;  1T2K D;  1SQP K;  1JY3 O;  1N86 A;  3TYY A;  3V2R A;  1ZR4 A;  1RF0 C;  2R32 A;  3NTN A;  1JOC A;  2R5D A;  1J1E B;  3CLQ A;  1CSB A;  1NKZ B;  5AW5 B;  1LWU B;  1L0N K;  2N1T D;  3U1C A;  3L37 A;  1N7S D;  4O9B A;  3SWY A;  1G2C B;  3M0D C;  1HTL C;  2WTY A;  1SFC C;  4EOT A;  1RF1 C;  4Y99 B;  3RL0 D;  2XV5 A;  2XU6 A;  3GHG B;  1IFN A;  1YTZ T;  3MUD A;  2W6A A;  3VOP A;  4DOJ A;  1T3J A;  2HPC B;  1FZC C;  1GDT A;  3L35 A;  4AQR D;  2IX7 C;  5AVR B;  1NO4 A;  3BAT A;  3CL3 D;  5BVZ A;  2C9N Y;  1KFN A;  3KDP B;  2HOD B;  1KIL B;  3H6P A;  4N3Y B;  1LT9 C;  3HE5 A;  3OA7 A;  1HGZ A;  1NH4 A;  3TNU B;  1L4A C;  1XTG B;  2JJL A;  3NXS A;  1GW4 A;  5APQ A;  3B5N B;  1GZL A;  3V2N A;  4XA4 A;  3HD7 B;  1LT9 A;  2Z4E A;  4IFM A;  3U1A A;  3B8E B;  1L4A A;  2Z5H A;  2GUV A;  3TSI A;  2WSF H;  1LTB C;  2LKM A;  3VP8 A;  1ZLL A;  1HGV A;  1RE4 C;  3VP9 A;  4I1L A;  5AW7 B;  4WY4 B;  1JO5 A;  2KB7 P;  3P8M C;  5KLV K;  5CJ0 A;  4W7Z A;  3M0A A;  1VDF A;  3VMZ A;  1PFI A;  2FKW B;  2KLV A;  3P32 A;  1AFO A;  2OYH A;  2IFN A;  4DZO A;  1L4A D;  3P8C D;  5AW2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...