1H89A

Crystal structure of ternary protein-dna complex2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
64
structure length
64
Chain Sequence
EYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
publication title Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 31
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1h89A00
2XV5A 2R32A 3L35A 3NTNA 1GTWA 1H8AA 1S9KE 1CZQA 1GZLA 2R3CA 3A5TA 3V4QA 3IR9A 3NFQA 3P8MC 2W6AA 2QM8A 3MGNA 1T2KC 4I2LC 5AVXB 5APYA 5AW1B 5AW7B 1KQLA 3NMDA 3I5CA 3M0AA 5AVRB 3UIAA 2P67A 5AW2B 4C7NA 2XZRA 1CSBA 3KQGA 5AW5B 5AVUB 1GU4A 4M3LA 1HWTC 1H89A 2E42A 2ZXEB 2WTYA 4XE5B 1IO4A 2KP8A 3L36A 2IPPA 2VRSA 2Q7CA 5APQA 5AW9B 1T2KD 3HE4A 3M91A 3V5BA 3OAKA 1NAFA 1SLQA 1YYCA 4AUWA 3TNUB 4GKGA 1FOSE 1DH3A 3KDPB 4DZOA 5APXA 1SP4A 4AYCA 4EOTA 5AVZB 4KHXA 5AVSB 2WWWA 1J2JB 3HE4B 3P7KA 2Z5HA 3HE5A 3M06A 3T97A 2C9LY 1CI6A 3P32A 1JUNA 5APUA 1GK6A 2WPSA 5AVTB 2WT7A 1G2CB 4B86A 2Q5UA 2P7JA 4LC1A 2JJLA 1A02J 1HBWA 5APTA 4RESB 4GT1A 5APSA 3VYIA 1A02F 1H88A 2P2UA 5AVVB 2N9BA 3SWFA 2Z5IA 3VMXA 4HYTB 2WPRA 4C7NB 1GU5A 1OXZA 1HUCA 1GK4A 1S9KD 2R5BA 2R5DA 3B8EB 2QM7A 3O8ZA 5APVA 5AW0B 1GD2E 3LIEA 2YO2A 1MV8A 3LIDA 2BASA 2YNYA 5AVYB 3A3YB 2XU6A 3L37A 3M9BA 5APWA 2E43A 3MD0A 3A7OA 5AW3B 1FOSF 5AW4B 1HJBA 1NWQA 5AVQB 1MFZA 2Q3IA 3VMZA 3M0DA 3NXSA 3TK1A 1X8YA 1OWAA 3HE5B 4AQRD 3HTKA 1CI6B 2YO3A 2ZFCA 5AW6B 2WT7B 4I6MC 5AW8B 2C9NY 3VTPC 4JYCA 1JNMA 3VMYA 3A2AA 2H7HA 5AVWB 4JYBA 5CMZA 1FAVA 3V4WA 3TYYA 3M9HA 3TNUA 1MUUA 4C46A 2W27A 3VN0A 2WPQA
chains in the Genus database with same CATH superfamily
2IBZD 1JY2P 1FBMA 1RF0A 1T6AA 1RF1A 1K73Q 3GHGA 4OGQC 1NTZJ 4R4LA 2G8YA 1G2CA 1SQPE 3L72E 4N78E 1P84I 1QVFO 3L75D 1GMJA 4TLFA 4D6TE 1MZ9A 4WWIA 4Y28J 1S5LX 1RH5B 4IOIH 4WBAA 3M06A 3PP5A 1BDCA 5E79H 3AE5C 2WT7A 1UIIA 1Q7YQ 3GLMA 2JJLA 1GW3A 4GT1A 5KLVJ 1BE3G 1H88A 2WZ7A 3W67A 3SWFA 3BRVB 4HYTB 1HTLC 5CCGA 2E75D 5CBOA 2R5BA 4U3FJ 5APVA 1BCCD 3A7OA 1RE3C 5CCGD 1OW8A 2ZYGA 3M0DC 3I55P 2IFMA 1BSNA 1T3JA 1OFCX 2D2CD 2FBWC 1N2DC 1LT9A 2WMMA 1J1EB 1LTJC 3A2AA 3EFGA 3L71J 1NTKK 4D6TJ 2OYHA 3KYQA 2QRXA 1LTGC 1HF9A 1SQQE 2KI7B 3BASA 1H8AA 1ZR2A 2IDBA 3E1RA 3A5TA 4ASVA 1NTKD 3AE2C 1T2KC 1SQXG 1KQLA 1LT1A 3CL3D 1RF1B 1GL2C 1L2PA 1G1JA 3GHGB 3O6QA 5AW2B 2JO1A 2E76B 3V2RA 2QE7H 2M3EA 2GUVA 1NAFA 1SLQA 4PD4H 5DJTB 2FYNB 4IL6H 2A45G 1FDMA 5M1BA 3H1JG 4OGQB 4GOFA 1RE4C 1SFCA 1L0NJ 3S9OA 2HR3A 1PGQA 2Z5IA 1PPJG 1WMKA 3PLNA 5CJ0A 3CLQA 1IFPA 1IFNA 2QM7A 3MTUE 1PP9E 1SFCD 1MV8A 3L73E 3B5NA 2YMYA 2BASA 3L37A 3RK3B 1KB9D 1U57A 5B5EE 5L8RJ 1PGJA 2WPVB 3TK1A 3AECC 4TT3H 1KORA 3B5ND 2HFED 2H8PD 2KLUA 1QX8A 3RL0C 1FZCA 1EZVD 1SQXK 4L73A 3MHVA 1QEXA 2K9JA 1LT9B 5GTHE 1YI2P 3C9IA 4JF7A 3CCEP 3BCCE 2Q3EA 3H1LD 3EFFK 3NFQA 3SFDC 2HLOA 2WVRA 2IBZI 2ZVOB 2M5AA 2SPZA 5KAIE 3MUDA 3OA7A 1Y8AA 3H1IJ 1X9VA 2FYUE 4H0LD 1LTJB 2MJZA 3V5BA 1IK9A 3CX5E 4U3FG 1IZNB 3T97A 3L4FA 2BEQD 3V2PA 3L70G 1YQ4C 4ZNCA 2NPSA 3A0HE 1GL2B 3F89A 1WRGA 1KV4A 2ZJSE 1VQMP 5AW0B 1NOHA 1XTGB 1M1JA 3FWNA 4I1LA 2NPSD 3H32A 4BXLA 1VQLP 1LP1B 2CPSA 3Q5SA 2AXTE 1OWAA 4IFDK 1VQ4P 3OJAB 1KILC 5KKZC 2KS1A 2ZAEB 1NU1J 3HUSC 3GF3A 4UB6H 2P10A 2K3RA 3D6YA 1DX7A 4GODA 3AE4C 3S1KA 4I2LC 3CXHD 4L75A 2E74D 1JY3O 4DOJA 4Z1MH 2AEFA 1JY2N 1ZN5A 3CCVP 1JMMA 2IPPA 2Q7CA 2Y0EA 3M91A 2J59M 1EXIA 4GKGA 3KDPB 5EFWB 1L0LG 1ZP0C 5AVZB 2Q6QA 5KAFH 1FDOA 3V6IA 3G6EP 1NTME 3AEBC 2Q5UA 1SQPK 4YPCA 3A0BE 2WPRA 3ZDMA 4WB4A 3V2QA 1URQB 4Y99C 1VPCA 1M90Q 1GD2E 3O8ZA 2NPSB 1SQPD 2JP3A 3L72D 3AEAC 1MFZA 2OTKE 2YIUC 1X8YA 2JEEA 1DD3A 3HTKA 3H32B 3E1IA 4WVZA 1KB9I 1E5WA 3L74G 3LW5J 4HJGH 1N86A 2H7HA 2JR8A 5CMZA 2K1AA 1LWUA 1QGKB 2N9YB 2AEMA 3VMAA 3H1IG 1BE3J 5KJ7D 1EDKA 1Q2NA 1CZQA 3GG2A 1BGYE 2IYPA 3USSA 1S2EA 2N1TA 2ZT9D 4YXWH 1SQBE 1JY3P 1N7SC 1MFTA 4ZKUA 1SQVK 1KQGB 2N1TD 3N7NA 1X0TA 3CCLP 5AW9B 1KILB 2YKOA 5KKZB 3CCSP 1PV3A 3PH0A 2KXPB 3HUSB 1AQTA 4LLHA 1SQVD 1EDJA 3CI9A 4KHXA 1PL5A 3P32A 2Q1KA 1USEA 3L75G 1U7JA 1DD4A 4RESB 1A02F 2KSEA 3H1HE 2V4HA 4O9BA 1SQQD 2XDJA 4RKUJ 1SQXJ 1OMIA 4PD4E 4H44C 3WU2H 4IL6E 5H2FH 2YNYA 1NTZE 5AW3B 3VMZA 1AA0A 2O01J 1HGZA 2M0BA 3H6PA 4JQ0D 3VTPC 3VMYA 3H1JJ 3CWBD 3IN6A 3M9QA 3M9HA 2C0XA 1BCCG 3G3ZA 3F5HA 3AE1C 1HGVA 4RJTA 1RF0C 1RF1C 3GHGC 4Y99B 4ASWA 3G4SP 2E76C 3GF7A 2ZT9B 4RO0A 3V4QA 1FJKA 3FXEA 5KLVE 2FFDA 3TF5A 1IFDA 2WSCH 1HH0A 1PP9D 3L73D 3CXHI 4U3FE 3AEGC 5CBNA 4AUWA 2OARA 2FYZA 1NTKG 2E75C 4R4MA 4LC1A 3L71E 3RK3C 1IFMA 5CCGC 1N7SB 3BCCD 2HG5D 1R8EA 1KYOH 2R5DA 3AEFC 3LIDA 1JTHA 2J5UA 1FOSF 2Q3IA 1VL2A 2NZ2A 1AJYA 3H25A 3I56P 2I8DA 3HE5B 1CI6B 1LT9C 1XTCC 4H13D 2FYUD 3CX5D 3Q5PA 3TYYA 3CMEP 4BRYA 2L5GB 3L70J 5KLIC 2KSJA 3PHLA 3NTNA 1M1KQ 4H44B 3VP8A 1PZQA 1VQNP 4JPZB 2O01H 1L0NE 5AW1B 5AW7B 1OVRA 4NPFX 5AVRB 3UIAA 4C7NA 2A45H 1CSBA 1EZVG 1H89A 1L0LE 2JWAA 4UB6E 3R2PA 2VRSA 1VF5D 1JEKA 2I1KA 1JB0J 4C7RA 3OAKA 3TNUB 1VQPP 2Q9IA 1MKMA 3H1KD 3H1LG 2KLVA 2Z5HA 3P7KA 2B87A 1JUNA 4PJ0H 1SFCC 1G2CB 4XA4A 1NH4A 4YTPC 4EDFA 1A02J 2WSSH 3G9RA 1GU5A 1HUCA 3B71A 1FC2C 3B5NC 3LIEA 4ZMDA 1KD1Q 4EIJA 2W6JH 1H0TA 1GW4A 3A3YB 5APWA 2GUSA 2QJYB 1K9MQ 5KAFE 2OYIA 3U1AA 2YXRB 1PIXA 1JM0A 4H13B 1U7MA 2E75B 2YO3A 2ZFCA 3H1IE 2JKVA 2WT7B 1FZCC 1HVVA 5B66H 1L0LJ 5TISH 1SQVJ 3EQ2A 3CXHH 2J58A 3WMM0 1GDTA 2HYNA 1NTMD 1OX3A 3C1LA 3PJSK 2D2CB 1RQUA 4UB8H 2A06E 4H0LC 1OZHA 3M0AA 3V2NA 3AE8C 1P84H 3PTZA 3ABVC 3MUDC 1KFMA 3MZWB 1OVUA 2E42A 1EQ7A 1VF5B 2ZXEB 4XE5B 3JC22 1IO4A 2K9YA 5GTIH 5BU8B 3D71A 3VP9A 5K5GB 3HD7A 2OYHB 1M57D 3L74J 2KB7P 1JY3N 2LR2A 5KTBA 3WUUA 5KLIB 1Y9BA 2AXCA 1URQC 1FDIA 3CWBJ 3HD7D 1ZOYC 5APTA 2NPSC 2P2UA 2RH0A 1NU1E 5AVVB 2BCCJ 3O6QB 2B87B 1OXZA 1L4AA 1GK4A 1BGYD 1CW5A 1M1JC 1JMBA 2H88C 3SFEC 3TGUD 1SQBD 2E43A 4IFFA 3TSIA 1ZLLA 1YIJP 1L4AD 1PGPA 2FKWB 4GOEA 1VQOP 1QLED 3CMAP 3AE3C 3N4XA 1SFCB 3RK3E 1SVFA 4JYBA 3WU2E 1EC5A 2E74C 2IFNA 3L75J 2WPQA 1SQPG 1N73A 3L72G 3S4RA 1GTWA 1EDLA 3CX5I 3B5NB 1AVOA 3MGNA 3H1HD 2KNCA 1M8OB 4OH8B 3U59A 4N3YB 2KOGA 5AW5B 4PD4D 3RBZA 3Q1MA 1NTKE 1NTZD 2KP8A 3L36A 3Q5RA 1FZCB 3AE6C 1VDFA 1FZAA 2K9JB 2HPCA 1R5SA 3IF4A 4EOTA 3RK2D 5BU5A 3KPEA 2WQYC 3RL0g 1N8RQ 1BCCJ 1IJDB 3D6ZA 2KIKA 2NRGA 1G1IA 1AFOA 4H0LB 2LKMA 2BEZF 4I7ZB 2FXMA 2M5AB 1YJNP 2PAJA 1EDIA 1BE3E 1S4XA 5CCHA 1Q81Q 2YO2A 3WUTA 3M9BA 1SQVG 5KLVD 1LTAC 3MD0A 1DEEG 5AW4B 2QIWA 3NXSA 2O01N 2PRRA 5CCHD 4U3FD 3T97B 3GMAA 1NTKJ 3AE7C 1SQQG 2ZT9C 2YKQA 1KYOE 3KZIH 2AEJA 3H1KJ 2GM4A 4W7YA 4N78D 5E79E 3BRTB 1M1JB 3FXDA 1EZVE 2N1TC 3IR9A 3L71D 2WSCJ 4D6TD 4W80A 5AVXB 2H43A 4PV1D 5KJ7A 2PP6A 4M3LA 1SQXE 3CWBG 1KQFB 2KS1B 1NAYA 2BCCG 5APXA 3RK2B 2E74B 5AVSB 1J2JB 2V7QJ 2C9LY 1LTBC 3MP7B 4DCKA 4NPEA 5C39A 4K35A 4W7ZA 2P7JA 1L0NK 3H1JE 1PP9G 4BWNA 2IBZG 3B8EB 1PPJE 1SQQK 1L0ND 3Q2YA 1ZXGA 1NWQA 2K88A 3CX5H 2QVAA 1VQ6P 2CK3H 2B9BA 3H1LJ 3JCUH 2ZYAA 3V4WA 2RMZA 2FXPA 1NJIQ 1NVOA 1K05A 1JOCA 5TJHA 2XV5A 1PFIA 1LTIC 2ZYDA 1RY3A 2WSFJ 1NHLA 3II6A 3NMDA 2YMKA 5B66E 3KQGA 5TISE 1GU4A 5AVUB 2OTLP 3HTKB 1S5LH 3WUVA 3B4SA 3SWKA 1T8ZA 1EXJA 4JBZA 2KZJA 2KYVA 1LWUB 1S72P 4PD4I 4DZOA 4UB8E 2Y0DA 2WWWA 2O1KA 3H1ID 1OW7A 4YXDC 1LNQA 2JDIH 1P84E 1Q90D 1KILE 2N1TB 2QEXP 2QJYC 5GTIE 1FZEA 4GDOA 2W83C 1AV1A 3L70E 1J1DB 4H13C 1OVVA 2A06D 1QL1A 3MIWA 3OW2O 3E7KA 3H1KG 3RGUA 2V7QH 2POHA 2W6BA 2RKLA 5AW8B 1KB9H 1JNMA 2ZXXA 5AVWB 1FAVA 2D2CC 3RBXA 4CPGA 1NU1K 2FYUK 2WSEJ 2E76D 3VN0A 3A0BH 4WY4A 1X79B 2R32A 3L35A 1IFIA 1VF5C 1NU1D 2Y0CA 5APYA 3CCJP 2GA1A 4WY4D 2OYHC 2XZRA 4OGQD 2WTYA 1NYHA 2KK7A 3EWKA 1NTMG 2K37A 4AYCA 1YBKA 2Z4EA 2WSFH 2KZIA 3RK3D 1QVGO 1KTMA 1FU1A 1SQPJ 2M8RA 3P8CE 3L72J 1T3UA 1SQVE 2FFDB 2N9BA 1KC8Q 4KJMA 2QJKC 1LTSC 1QL2A 2C0WA 1KN7A 2Y9YA 1FZFA 2OYIC 2R44A 1RE3A 1NGMB 3M0DA 2QSIA 5CHXA 4N6JA 3K5BA 4I6MC 3KXDA 2XKMA 3SSUA 1ZRTE 1LTJA 3FX0A 1LGHB 1BGYG 1OW6A 4XFJA 3L74E 1KFNA 3TGUG 1SQBG 2PGDA 2M3BA 1S9KE 1GZLA 3CC4P 1FJPA 4HB1A 1JTHB 3CWBE 1JCCA 2HODA 1NTMK 4WY4B 3I5CA 1JO5A 2BCCE 1BDDA 1GL2A 1BE3D 3KZIE 2B89A 2WSEH 1T2KD 3HD7C 1YYCA 4DT0A 1FOSE 1GL2D 1LP1A 2O1JA 4BRYB 1SP4A 2Y9ZA 3BATA 2O3JA 1SQQJ 1WT6A 1AQ5A 4I7ZC 2XNXA 3H1HG 2FY8A 1KQSO 2IBZE 5APUA 5AVTB 1BSHA 3IAOA 4B86A 1KYOD 1RE4A 1HBWA 3VYIA 1N7LA 1FZBA 3U1CA 1PGOA 2L91A 3VMXA 1W5CE 4C7NB 1L4AC 1NTZG 3L75E 2ZVNB 1Q82Q 2PFXA 1E79H 1HJBA 1TU3F 4IL6X 1SQBK 1SQXD 2B88A 2IYOA 1NKZB 3SWYA 2C9NY 4GIFA 1FE6A 4ZKPA 2YKPA 1N73C 2QJKB 1ZW0A 4EI2A 1PP9J 5KLVG 3L73J 2XNDH 2LXBA 3RL0D 2UWJE 1H0TB 1BCCE 3H1JD 2W6AA 2JWDA 4DJGA 2OYIB 3FGAD 4MN4C 4L74A 2R3SA 4EYYQ 1VQ9P 3FWLA 2P67A 3JCUE 3RK2C 1URQA 5H2FE 1DEBA 1PPJD 2HODB 1M56D 1VQKP 4LGDE 1DH3A 1NTZK 4HH2A 2W8ZA 1URQD 1JCDA 3AEDC 3BCCJ 3L71G 2QJPC 1Q86Q 4D6TG 2OYOA 2WPSA 1IFJA 3CC2P 1S5LE 3KHUA 3H1KE 2E5TA 1R5LA 5CJ4A 5CCHC 1S1CX 2FYUJ 1X22A 1Z56A 2XU6A 3HD7B 4U7JA 5AVQB 1AVYA 5KLVK 3W68A 4AQRD 3Q3DA 3CCQP 1S3JA 1DIPA 2QA4P 1YITP 1KILA 3GW6A 2P1JA 2IX7C 1OIPA 3ITKA 4PV1C 1IK7A 3HUSA 1L4AB 1L0NG 3JSVC 3RL0B 1P84D 2RN0A 4KT0J 1KILD 2R3CA 2G3AA 3P8MC 3QWOC 2QM8A 5KJ7C 1VQ7P 3R4YA 1KB9E 1YHQP 1LWUC 2IZ0A 3L70D 1KZUB 1RHZB 3CPWO 1RQVA 3CCMP 1W2EA 1ZR4A 3HE4A 2FXOA 2MKVA 5DJUB 1IC2A 1N73B 1FS0E 5B5EH 4A7PA 1GK6A 1J1DC 2KNCB 5APSA 3H1LE 2LXCB 2CPBA 2W90A 1LJ2A 1KMIZ 4L76A 1YQ3C 1KYOI 1YTZT 1YJ9P 2P58A 2OQQA 3CD6P 5AVYB 5GTHH 2KUBA 1Y47A 2OGUA 3IFMA 1EZVI 2HPCB 2E5YA 2H89C 3L73G 3VOPA 2QJPB 3TGUE 5AW6B 1NTMJ 1D7MA 4JYCA 3HRNA 1L0LK 5KAIH 3AEEC 2I1JA 4C46A 1UIXA 3CC7P 2A06G 1JY2O 4PJ0E 1L0LD 2OTJP 3P8CD 3PRJA 1FZGA 3AE9C 3CCUP 2A45I 1VQ8P 1HJ0A 1N7SA 3BCCG 4IFMA 1HWTC 1ZMEC 1M7LA 5BVZA 5APQA 3A0HH 2DW3A 1N7SD 4NPDA 4HKZH 4PV1B 2ITAA 2FFDC 3HE4B 3HE5A 1NU1G 1BGYJ 1CI6A 2FYUG 3CCRP 1J1EC 1ZRTD 3TGUJ 3D70A 2AXTH 1SQBJ 3L74D 3CXHE 1USDA 3C8VA 3BVHA 3QH9A 2QG4A 1NO4A 1S9KD 1SS1A 1K04A 3TDKA 1W2BO 1NKNA 4QMAA 1LTTC 2BCCD 1YJWP 4K3AA 4OWFA 2IZ1A 4H44D 2WITA 4OVNF 1VQ5P 1YTZI 1K8AQ 3H1HJ 3LW5H 2YIUB 2FYNC 3TNUA 1MUUA 2YXQB 3G71P 1ZV8A 2W27A 4WY4C
chains in the Genus database with same CATH topology
1JY2P 1N73A 5KJ7D 1FBMA 2M3BA 1RF0A 1GTWA 1RF1A 1S9KE 1CZQA 3GHGA 1GZLA 3B5NB 1FJPA 1JTHB 1G2CA 2N1TA 1JCCA 3MGNA 2HODA 1NTMK 4WY4B 3I5CA 1JO5A 4N78E 1JY3P 1N7SC 4OH8B 3U59A 4N3YB 2KOGA 1GL2A 5AW5B 4ZKUA 1SQVK 2N1TD 2KP8A 3N7NA 3L36A 1FZCB 5AW9B 1KILB 2WSEH 1T2KD 2YKOA 3HD7C 1MZ9A 1YYCA 1VDFA 1FOSE 3HUSB 1GL2D 2O1JA 1FZAA 4LLHA 1SP4A 2HPCA 3BATA 4EOTA 3CI9A 1WT6A 3RK2D 4KHXA 1AQ5A 5BU5A 3KPEA 2XNXA 4WBAA 3M06A 3P32A 3PP5A 5APUA 5AVTB 2WT7A 1IJDB 4B86A 1RE4A 2JJLA 1HBWA 1GW3A 4RESB 4GT1A 3VYIA 1A02F 1G1IA 1AFOA 1H88A 2LKMA 1N7LA 1FZBA 2WZ7A 3U1CA 3SWFA 3BRVB 2FXMA 3VMXA 4HYTB 1HTLC 4O9BA 5CCGA 4C7NB 1L4AC 2PAJA 2XDJA 2R5BA 5APVA 5CCHA 2YO2A 2YNYA 3M9BA 1LTAC 3A7OA 3MD0A 1RE3C 5AW3B 5CCGD 5AW4B 1HJBA 3M0DC 3VMZA 3NXSA 1SQBK 2IFMA 5CCHD 1HGZA 1T3JA 3H6PA 1NKZB 3SWYA 2C9NY 1N2DC 4GIFA 1LT9A 3VTPC 1J1EB 1LTJC 3VMYA 3A2AA 3EFGA 1NTKK 2YKQA 3M9QA 2OYHA 3M9HA 3KYQA 4ZKPA 4W7YA 2GM4A 2C0XA 2YKPA 1LTGC 3G3ZA 4N78D 1HGVA 1N73C 1RF0C 1RF1C 3BRTB 3GHGC 4Y99B 3BASA 1H8AA 1ZR2A 1M1JB 3RL0D 3A5TA 2N1TC 3V4QA 3IR9A 2W6AA 1FJKA 1T2KC 4W80A 5AVXB 2OYIB 2H43A 5KJ7A 1KQLA 3CL3D 2FFDA 1IFDA 2WSCH 1RF1B 1GL2C 1G1JA 2P67A 3GHGB 5AW2B 1HH0A 2PP6A 4M3LA 3RK2C 1URQA 3V2RA 1DEBA 2HODB 2GUVA 1NAFA 1SLQA 4AUWA 2OARA 4LGDE 1DH3A 5APXA 1NTZK 4HH2A 3RK2B 1URQD 2A45G 2FYZA 1FDMA 5AVSB 1JCDA 1J2JB 2C9LY 1LTBC 2WPSA 1RE4C 4W7ZA 1IFJA 2P7JA 4LC1A 1SFCA 1L0NK 3RK3C 1IFMA 5CCGC 2Z5IA 1N7SB 5CJ0A 5CJ4A 2HG5D 3CLQA 5CCHC 1IFNA 2R5DA 3B8EB 2QM7A 3MTUE 1SFCD 1MV8A 3LIDA 3B5NA 1Z56A 1SQQK 2BASA 2YMYA 2XU6A 1JTHA 3L37A 3RK3B 3HD7B 1FOSF 1NWQA 5AVQB 2Q3IA 3TK1A 5KLVK 3HE5B 4AQRD 1CI6B 3B5ND 1LT9C 1XTCC 2HFED 2H8PD 3RL0C 1FZCA 1KILA 1SQXK 2P1JA 3V4WA 2IX7C 3TYYA 3HUSA 2L5GB 1LT9B 1JOCA 1L4AB 2KSJA 3C9IA 4JF7A 2XV5A 1PFIA 3RL0B 1LTIC 3NTNA 1KILD 3VP8A 2R3CA 3NFQA 3P8MC 1RY3A 2QM8A 5KJ7C 2O01H 1NHLA 3II6A 5AW1B 2HLOA 5AW7B 3NMDA 1LWUC 5AVRB 3UIAA 4C7NA 2A45H 1CSBA 3KQGA 1GU4A 5AVUB 1KZUB 3HTKB 3MUDA 3OA7A 1H89A 1T8ZA 3R2PA 2VRSA 1W2EA 1X9VA 1ZR4A 2I1KA 1LTJB 3HE4A 4C7RA 2MJZA 3V5BA 2KYVA 3OAKA 1LWUB 1IK9A 3TNUB 4DZOA 2Q9IA 1IC2A 2WWWA 2O1KA 1N73B 2KLVA 2Z5HA 3P7KA 3T97A 3L4FA 1JUNA 1GK6A 3V2PA 1J1DC 1SFCC 1G2CB 2N1TB 1NH4A 4XA4A 1A02J 5APSA 2CPBA 2NPSA 1FZEA 1GL2B 1GU5A 1WRGA 1HUCA 1J1DB 5AW0B 1YTZT 1NOHA 1XTGB 3B5NC 3LIEA 1M1JA 4EIJA 4I1LA 5AVYB 1GW4A 3A3YB 1QL1A 5APWA 2GUSA 2NPSD 3H32A 3MIWA 2OYIA 3U1AA 2CPSA 3IFMA 2POHA 2HPCB 2W6BA 1OWAA 4IFDK 3VOPA 2YO3A 3OJAB 2ZFCA 5AW6B 2WT7B 5AW8B 1FZCC 1HVVA 1KILC 4JYCA 1JNMA 3HRNA 1L0LK 5AVWB 1FAVA 3HUSC 1NU1K 2I1JA 2FYUK 4C46A 3EQ2A 3VN0A 2J58A 3WMM0 1GDTA 1DX7A 1JY2O 4WY4A 1X79B 2HYNA 2R32A 3L35A 1IFIA 3P8CD 4I2LC 1FZGA 5APYA 3M0AA 3V2NA 1JY3O 4DOJA 4WY4D 2OYHC 2A45I 1N7SA 2XZRA 1KFMA 4IFMA 1HWTC 2E42A 1JY2N 1EQ7A 1M7LA 2ZXEB 2WTYA 4XE5B 1ZN5A 1IO4A 1JMMA 2IPPA 5BVZA 2Q7CA 5APQA 5BU8B 3M91A 2J59M 3VP9A 2OYHB 3HD7A 4GKGA 1N7SD 3KDPB 2KB7P 1JY3N 4AYCA 2FFDC 5AVZB 2Z4EA 5KTBA 3HE4B 3HE5A 2WSFH 1CI6A 1URQC 3RK3D 1J1EC 3HD7D 2Q5UA 1FU1A 5APTA 2M8RA 3P8CE 2NPSC 1SQPK 2P2UA 1T3UA 2FFDB 5AVVB 2N9BA 2WPRA 4WB4A 1OXZA 3BVHA 3V2QA 1L4AA 1URQB 1GK4A 1S9KD 1LTSC 1NO4A 4Y99C 1CW5A 1QL2A 1VPCA 1GD2E 1M1JC 2C0WA 3O8ZA 2NPSB 1FZFA 2E43A 2OYIC 4IFFA 1NKNA 3TSIA 1LTTC 1ZLLA 1RE3A 1L4AD 1MFZA 3M0DA 1X8YA 2JEEA 2FKWB 5CHXA 3HTKA 2WITA 4N6JA 3H32B 3E1IA 3N4XA 4I6MC 1YTZI 1E5WA 1N86A 2XKMA 1SFCB 2H7HA 1SVFA 1LTJA 4JYBA 5CMZA 3LW5H 1LWUA 1LGHB 3TNUA 1MUUA 1ZV8A 2IFNA 2W27A 1KFNA 2WPQA 4WY4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XV5 A;  2R32 A;  3L35 A;  3NTN A;  1GTW A;  1H8A A;  1S9K E;  1CZQ A;  1GZL A;  2R3C A;  3A5T A;  3V4Q A;  3IR9 A;  3NFQ A;  3P8M C;  2W6A A;  2QM8 A;  3MGN A;  1T2K C;  4I2L C;  5AVX B;  5APY A;  5AW1 B;  5AW7 B;  1KQL A;  3NMD A;  3I5C A;  3M0A A;  5AVR B;  3UIA A;  2P67 A;  5AW2 B;  4C7N A;  2XZR A;  1CSB A;  3KQG A;  5AW5 B;  5AVU B;  1GU4 A;  4M3L A;  1HWT C;  1H89 A;  2E42 A;  2ZXE B;  2WTY A;  4XE5 B;  1IO4 A;  2KP8 A;  3L36 A;  2IPP A;  2VRS A;  2Q7C A;  5APQ A;  5AW9 B;  1T2K D;  3HE4 A;  3M91 A;  3V5B A;  3OAK A;  1NAF A;  1SLQ A;  1YYC A;  4AUW A;  3TNU B;  4GKG A;  1FOS E;  1DH3 A;  3KDP B;  4DZO A;  5APX A;  1SP4 A;  4AYC A;  4EOT A;  5AVZ B;  4KHX A;  5AVS B;  2WWW A;  1J2J B;  3HE4 B;  3P7K A;  2Z5H A;  3HE5 A;  3M06 A;  3T97 A;  2C9L Y;  1CI6 A;  3P32 A;  1JUN A;  5APU A;  1GK6 A;  2WPS A;  5AVT B;  2WT7 A;  1G2C B;  4B86 A;  2Q5U A;  2P7J A;  4LC1 A;  2JJL A;  1A02 J;  1HBW A;  5APT A;  4RES B;  4GT1 A;  5APS A;  3VYI A;  1A02 F;  1H88 A;  2P2U A;  5AVV B;  2N9B A;  3SWF A;  2Z5I A;  3VMX A;  4HYT B;  2WPR A;  4C7N B;  1GU5 A;  1OXZ A;  1HUC A;  1GK4 A;  1S9K D;  2R5B A;  2R5D A;  3B8E B;  2QM7 A;  3O8Z A;  5APV A;  5AW0 B;  1GD2 E;  3LIE A;  2YO2 A;  1MV8 A;  3LID A;  2BAS A;  2YNY A;  5AVY B;  3A3Y B;  2XU6 A;  3L37 A;  3M9B A;  5APW A;  2E43 A;  3MD0 A;  3A7O A;  5AW3 B;  1FOS F;  5AW4 B;  1HJB A;  1NWQ A;  5AVQ B;  1MFZ A;  2Q3I A;  3VMZ A;  3M0D A;  3NXS A;  3TK1 A;  1X8Y A;  1OWA A;  3HE5 B;  4AQR D;  3HTK A;  1CI6 B;  2YO3 A;  2ZFC A;  5AW6 B;  2WT7 B;  4I6M C;  5AW8 B;  2C9N Y;  3VTP C;  4JYC A;  1JNM A;  3VMY A;  3A2A A;  2H7H A;  5AVW B;  4JYB A;  5CMZ A;  1FAV A;  3V4W A;  3TYY A;  3M9H A;  3TNU A;  1MUU A;  4C46 A;  2W27 A;  3VN0 A;  2WPQ A; 
#chains in the Genus database with same CATH topology
 2IBZ D;  1JY2 P;  1FBM A;  1RF0 A;  1T6A A;  1RF1 A;  1K73 Q;  3GHG A;  4OGQ C;  1NTZ J;  4R4L A;  2G8Y A;  1G2C A;  1SQP E;  3L72 E;  4N78 E;  1P84 I;  1QVF O;  3L75 D;  1GMJ A;  4TLF A;  4D6T E;  1MZ9 A;  4WWI A;  4Y28 J;  1S5L X;  1RH5 B;  4IOI H;  4WBA A;  3M06 A;  3PP5 A;  1BDC A;  5E79 H;  3AE5 C;  2WT7 A;  1UII A;  1Q7Y Q;  3GLM A;  2JJL A;  1GW3 A;  4GT1 A;  5KLV J;  1BE3 G;  1H88 A;  2WZ7 A;  3W67 A;  3SWF A;  3BRV B;  4HYT B;  1HTL C;  5CCG A;  2E75 D;  5CBO A;  2R5B A;  4U3F J;  5APV A;  1BCC D;  3A7O A;  1RE3 C;  5CCG D;  1OW8 A;  2ZYG A;  3M0D C;  3I55 P;  2IFM A;  1BSN A;  1T3J A;  1OFC X;  2D2C D;  2FBW C;  1N2D C;  1LT9 A;  2WMM A;  1J1E B;  1LTJ C;  3A2A A;  3EFG A;  3L71 J;  1NTK K;  4D6T J;  2OYH A;  3KYQ A;  2QRX A;  1LTG C;  1HF9 A;  1SQQ E;  2KI7 B;  3BAS A;  1H8A A;  1ZR2 A;  2IDB A;  3E1R A;  3A5T A;  4ASV A;  1NTK D;  3AE2 C;  1T2K C;  1SQX G;  1KQL A;  1LT1 A;  3CL3 D;  1RF1 B;  1GL2 C;  1L2P A;  1G1J A;  3GHG B;  3O6Q A;  5AW2 B;  2JO1 A;  2E76 B;  3V2R A;  2QE7 H;  2M3E A;  2GUV A;  1NAF A;  1SLQ A;  4PD4 H;  5DJT B;  2FYN B;  4IL6 H;  2A45 G;  1FDM A;  5M1B A;  3H1J G;  4OGQ B;  4GOF A;  1RE4 C;  1SFC A;  1L0N J;  3S9O A;  2HR3 A;  1PGQ A;  2Z5I A;  1PPJ G;  1WMK A;  3PLN A;  5CJ0 A;  3CLQ A;  1IFP A;  1IFN A;  2QM7 A;  3MTU E;  1PP9 E;  1SFC D;  1MV8 A;  3L73 E;  3B5N A;  2YMY A;  2BAS A;  3L37 A;  3RK3 B;  1KB9 D;  1U57 A;  5B5E E;  5L8R J;  1PGJ A;  2WPV B;  3TK1 A;  3AEC C;  4TT3 H;  1KOR A;  3B5N D;  2HFE D;  2H8P D;  2KLU A;  1QX8 A;  3RL0 C;  1FZC A;  1EZV D;  1SQX K;  4L73 A;  3MHV A;  1QEX A;  2K9J A;  1LT9 B;  5GTH E;  1YI2 P;  3C9I A;  4JF7 A;  3CCE P;  3BCC E;  2Q3E A;  3H1L D;  3EFF K;  3NFQ A;  3SFD C;  2HLO A;  2WVR A;  2IBZ I;  2ZVO B;  2M5A A;  2SPZ A;  5KAI E;  3MUD A;  3OA7 A;  1Y8A A;  3H1I J;  1X9V A;  2FYU E;  4H0L D;  1LTJ B;  2MJZ A;  3V5B A;  1IK9 A;  3CX5 E;  4U3F G;  1IZN B;  3T97 A;  3L4F A;  2BEQ D;  3V2P A;  3L70 G;  1YQ4 C;  4ZNC A;  2NPS A;  3A0H E;  1GL2 B;  3F89 A;  1WRG A;  1KV4 A;  2ZJS E;  1VQM P;  5AW0 B;  1NOH A;  1XTG B;  1M1J A;  3FWN A;  4I1L A;  2NPS D;  3H32 A;  4BXL A;  1VQL P;  1LP1 B;  2CPS A;  3Q5S A;  2AXT E;  1OWA A;  4IFD K;  1VQ4 P;  3OJA B;  1KIL C;  5KKZ C;  2KS1 A;  2ZAE B;  1NU1 J;  3HUS C;  3GF3 A;  4UB6 H;  2P10 A;  2K3R A;  3D6Y A;  1DX7 A;  4GOD A;  3AE4 C;  3S1K A;  4I2L C;  3CXH D;  4L75 A;  2E74 D;  1JY3 O;  4DOJ A;  4Z1M H;  2AEF A;  1JY2 N;  1ZN5 A;  3CCV P;  1JMM A;  2IPP A;  2Q7C A;  2Y0E A;  3M91 A;  2J59 M;  1EXI A;  4GKG A;  3KDP B;  5EFW B;  1L0L G;  1ZP0 C;  5AVZ B;  2Q6Q A;  5KAF H;  1FDO A;  3V6I A;  3G6E P;  1NTM E;  3AEB C;  2Q5U A;  1SQP K;  4YPC A;  3A0B E;  2WPR A;  3ZDM A;  4WB4 A;  3V2Q A;  1URQ B;  4Y99 C;  1VPC A;  1M90 Q;  1GD2 E;  3O8Z A;  2NPS B;  1SQP D;  2JP3 A;  3L72 D;  3AEA C;  1MFZ A;  2OTK E;  2YIU C;  1X8Y A;  2JEE A;  1DD3 A;  3HTK A;  3H32 B;  3E1I A;  4WVZ A;  1KB9 I;  1E5W A;  3L74 G;  3LW5 J;  4HJG H;  1N86 A;  2H7H A;  2JR8 A;  5CMZ A;  2K1A A;  1LWU A;  1QGK B;  2N9Y B;  2AEM A;  3VMA A;  3H1I G;  1BE3 J;  5KJ7 D;  1EDK A;  1Q2N A;  1CZQ A;  3GG2 A;  1BGY E;  2IYP A;  3USS A;  1S2E A;  2N1T A;  2ZT9 D;  4YXW H;  1SQB E;  1JY3 P;  1N7S C;  1MFT A;  4ZKU A;  1SQV K;  1KQG B;  2N1T D;  3N7N A;  1X0T A;  3CCL P;  5AW9 B;  1KIL B;  2YKO A;  5KKZ B;  3CCS P;  1PV3 A;  3PH0 A;  2KXP B;  3HUS B;  1AQT A;  4LLH A;  1SQV D;  1EDJ A;  3CI9 A;  4KHX A;  1PL5 A;  3P32 A;  2Q1K A;  1USE A;  3L75 G;  1U7J A;  1DD4 A;  4RES B;  1A02 F;  2KSE A;  3H1H E;  2V4H A;  4O9B A;  1SQQ D;  2XDJ A;  4RKU J;  1SQX J;  1OMI A;  4PD4 E;  4H44 C;  3WU2 H;  4IL6 E;  5H2F H;  2YNY A;  1NTZ E;  5AW3 B;  3VMZ A;  1AA0 A;  2O01 J;  1HGZ A;  2M0B A;  3H6P A;  4JQ0 D;  3VTP C;  3VMY A;  3H1J J;  3CWB D;  3IN6 A;  3M9Q A;  3M9H A;  2C0X A;  1BCC G;  3G3Z A;  3F5H A;  3AE1 C;  1HGV A;  4RJT A;  1RF0 C;  1RF1 C;  3GHG C;  4Y99 B;  4ASW A;  3G4S P;  2E76 C;  3GF7 A;  2ZT9 B;  4RO0 A;  3V4Q A;  1FJK A;  3FXE A;  5KLV E;  2FFD A;  3TF5 A;  1IFD A;  2WSC H;  1HH0 A;  1PP9 D;  3L73 D;  3CXH I;  4U3F E;  3AEG C;  5CBN A;  4AUW A;  2OAR A;  2FYZ A;  1NTK G;  2E75 C;  4R4M A;  4LC1 A;  3L71 E;  3RK3 C;  1IFM A;  5CCG C;  1N7S B;  3BCC D;  2HG5 D;  1R8E A;  1KYO H;  2R5D A;  3AEF C;  3LID A;  1JTH A;  2J5U A;  1FOS F;  2Q3I A;  1VL2 A;  2NZ2 A;  1AJY A;  3H25 A;  3I56 P;  2I8D A;  3HE5 B;  1CI6 B;  1LT9 C;  1XTC C;  4H13 D;  2FYU D;  3CX5 D;  3Q5P A;  3TYY A;  3CME P;  4BRY A;  2L5G B;  3L70 J;  5KLI C;  2KSJ A;  3PHL A;  3NTN A;  1M1K Q;  4H44 B;  3VP8 A;  1PZQ A;  1VQN P;  4JPZ B;  2O01 H;  1L0N E;  5AW1 B;  5AW7 B;  1OVR A;  4NPF X;  5AVR B;  3UIA A;  4C7N A;  2A45 H;  1CSB A;  1EZV G;  1H89 A;  1L0L E;  2JWA A;  4UB6 E;  3R2P A;  2VRS A;  1VF5 D;  1JEK A;  2I1K A;  1JB0 J;  4C7R A;  3OAK A;  3TNU B;  1VQP P;  2Q9I A;  1MKM A;  3H1K D;  3H1L G;  2KLV A;  2Z5H A;  3P7K A;  2B87 A;  1JUN A;  4PJ0 H;  1SFC C;  1G2C B;  4XA4 A;  1NH4 A;  4YTP C;  4EDF A;  1A02 J;  2WSS H;  3G9R A;  1GU5 A;  1HUC A;  3B71 A;  1FC2 C;  3B5N C;  3LIE A;  4ZMD A;  1KD1 Q;  4EIJ A;  2W6J H;  1H0T A;  1GW4 A;  3A3Y B;  5APW A;  2GUS A;  2QJY B;  1K9M Q;  5KAF E;  2OYI A;  3U1A A;  2YXR B;  1PIX A;  1JM0 A;  4H13 B;  1U7M A;  2E75 B;  2YO3 A;  2ZFC A;  3H1I E;  2JKV A;  2WT7 B;  1FZC C;  1HVV A;  5B66 H;  1L0L J;  5TIS H;  1SQV J;  3EQ2 A;  3CXH H;  2J58 A;  3WMM 0;  1GDT A;  2HYN A;  1NTM D;  1OX3 A;  3C1L A;  3PJS K;  2D2C B;  1RQU A;  4UB8 H;  2A06 E;  4H0L C;  1OZH A;  3M0A A;  3V2N A;  3AE8 C;  1P84 H;  3PTZ A;  3ABV C;  3MUD C;  1KFM A;  3MZW B;  1OVU A;  2E42 A;  1EQ7 A;  1VF5 B;  2ZXE B;  4XE5 B;  3JC2 2;  1IO4 A;  2K9Y A;  5GTI H;  5BU8 B;  3D71 A;  3VP9 A;  5K5G B;  3HD7 A;  2OYH B;  1M57 D;  3L74 J;  2KB7 P;  1JY3 N;  2LR2 A;  5KTB A;  3WUU A;  5KLI B;  1Y9B A;  2AXC A;  1URQ C;  1FDI A;  3CWB J;  3HD7 D;  1ZOY C;  5APT A;  2NPS C;  2P2U A;  2RH0 A;  1NU1 E;  5AVV B;  2BCC J;  3O6Q B;  2B87 B;  1OXZ A;  1L4A A;  1GK4 A;  1BGY D;  1CW5 A;  1M1J C;  1JMB A;  2H88 C;  3SFE C;  3TGU D;  1SQB D;  2E43 A;  4IFF A;  3TSI A;  1ZLL A;  1YIJ P;  1L4A D;  1PGP A;  2FKW B;  4GOE A;  1VQO P;  1QLE D;  3CMA P;  3AE3 C;  3N4X A;  1SFC B;  3RK3 E;  1SVF A;  4JYB A;  3WU2 E;  1EC5 A;  2E74 C;  2IFN A;  3L75 J;  2WPQ A;  1SQP G;  1N73 A;  3L72 G;  3S4R A;  1GTW A;  1EDL A;  3CX5 I;  3B5N B;  1AVO A;  3MGN A;  3H1H D;  2KNC A;  1M8O B;  4OH8 B;  3U59 A;  4N3Y B;  2KOG A;  5AW5 B;  4PD4 D;  3RBZ A;  3Q1M A;  1NTK E;  1NTZ D;  2KP8 A;  3L36 A;  3Q5R A;  1FZC B;  3AE6 C;  1VDF A;  1FZA A;  2K9J B;  2HPC A;  1R5S A;  3IF4 A;  4EOT A;  3RK2 D;  5BU5 A;  3KPE A;  2WQY C;  3RL0 g;  1N8R Q;  1BCC J;  1IJD B;  3D6Z A;  2KIK A;  2NRG A;  1G1I A;  1AFO A;  4H0L B;  2LKM A;  2BEZ F;  4I7Z B;  2FXM A;  2M5A B;  1YJN P;  2PAJ A;  1EDI A;  1BE3 E;  1S4X A;  5CCH A;  1Q81 Q;  2YO2 A;  3WUT A;  3M9B A;  1SQV G;  5KLV D;  1LTA C;  3MD0 A;  1DEE G;  5AW4 B;  2QIW A;  3NXS A;  2O01 N;  2PRR A;  5CCH D;  4U3F D;  3T97 B;  3GMA A;  1NTK J;  3AE7 C;  1SQQ G;  2ZT9 C;  2YKQ A;  1KYO E;  3KZI H;  2AEJ A;  3H1K J;  2GM4 A;  4W7Y A;  4N78 D;  5E79 E;  3BRT B;  1M1J B;  3FXD A;  1EZV E;  2N1T C;  3IR9 A;  3L71 D;  2WSC J;  4D6T D;  4W80 A;  5AVX B;  2H43 A;  4PV1 D;  5KJ7 A;  2PP6 A;  4M3L A;  1SQX E;  3CWB G;  1KQF B;  2KS1 B;  1NAY A;  2BCC G;  5APX A;  3RK2 B;  2E74 B;  5AVS B;  1J2J B;  2V7Q J;  2C9L Y;  1LTB C;  3MP7 B;  4DCK A;  4NPE A;  5C39 A;  4K35 A;  4W7Z A;  2P7J A;  1L0N K;  3H1J E;  1PP9 G;  4BWN A;  2IBZ G;  3B8E B;  1PPJ E;  1SQQ K;  1L0N D;  3Q2Y A;  1ZXG A;  1NWQ A;  2K88 A;  3CX5 H;  2QVA A;  1VQ6 P;  2CK3 H;  2B9B A;  3H1L J;  3JCU H;  2ZYA A;  3V4W A;  2RMZ A;  2FXP A;  1NJI Q;  1NVO A;  1K05 A;  1JOC A;  5TJH A;  2XV5 A;  1PFI A;  1LTI C;  2ZYD A;  1RY3 A;  2WSF J;  1NHL A;  3II6 A;  3NMD A;  2YMK A;  5B66 E;  3KQG A;  5TIS E;  1GU4 A;  5AVU B;  2OTL P;  3HTK B;  1S5L H;  3WUV A;  3B4S A;  3SWK A;  1T8Z A;  1EXJ A;  4JBZ A;  2KZJ A;  2KYV A;  1LWU B;  1S72 P;  4PD4 I;  4DZO A;  4UB8 E;  2Y0D A;  2WWW A;  2O1K A;  3H1I D;  1OW7 A;  4YXD C;  1LNQ A;  2JDI H;  1P84 E;  1Q90 D;  1KIL E;  2N1T B;  2QEX P;  2QJY C;  5GTI E;  1FZE A;  4GDO A;  2W83 C;  1AV1 A;  3L70 E;  1J1D B;  4H13 C;  1OVV A;  2A06 D;  1QL1 A;  3MIW A;  3OW2 O;  3E7K A;  3H1K G;  3RGU A;  2V7Q H;  2POH A;  2W6B A;  2RKL A;  5AW8 B;  1KB9 H;  1JNM A;  2ZXX A;  5AVW B;  1FAV A;  2D2C C;  3RBX A;  4CPG A;  1NU1 K;  2FYU K;  2WSE J;  2E76 D;  3VN0 A;  3A0B H;  4WY4 A;  1X79 B;  2R32 A;  3L35 A;  1IFI A;  1VF5 C;  1NU1 D;  2Y0C A;  5APY A;  3CCJ P;  2GA1 A;  4WY4 D;  2OYH C;  2XZR A;  4OGQ D;  2WTY A;  1NYH A;  2KK7 A;  3EWK A;  1NTM G;  2K37 A;  4AYC A;  1YBK A;  2Z4E A;  2WSF H;  2KZI A;  3RK3 D;  1QVG O;  1KTM A;  1FU1 A;  1SQP J;  2M8R A;  3P8C E;  3L72 J;  1T3U A;  1SQV E;  2FFD B;  2N9B A;  1KC8 Q;  4KJM A;  2QJK C;  1LTS C;  1QL2 A;  2C0W A;  1KN7 A;  2Y9Y A;  1FZF A;  2OYI C;  2R44 A;  1RE3 A;  1NGM B;  3M0D A;  2QSI A;  5CHX A;  4N6J A;  3K5B A;  4I6M C;  3KXD A;  2XKM A;  3SSU A;  1ZRT E;  1LTJ A;  3FX0 A;  1LGH B;  1BGY G;  1OW6 A;  4XFJ A;  3L74 E;  1KFN A;  3TGU G;  1SQB G;  2PGD A;  2M3B A;  1S9K E;  1GZL A;  3CC4 P;  1FJP A;  4HB1 A;  1JTH B;  3CWB E;  1JCC A;  2HOD A;  1NTM K;  4WY4 B;  3I5C A;  1JO5 A;  2BCC E;  1BDD A;  1GL2 A;  1BE3 D;  3KZI E;  2B89 A;  2WSE H;  1T2K D;  3HD7 C;  1YYC A;  4DT0 A;  1FOS E;  1GL2 D;  1LP1 A;  2O1J A;  4BRY B;  1SP4 A;  2Y9Z A;  3BAT A;  2O3J A;  1SQQ J;  1WT6 A;  1AQ5 A;  4I7Z C;  2XNX A;  3H1H G;  2FY8 A;  1KQS O;  2IBZ E;  5APU A;  5AVT B;  1BSH A;  3IAO A;  4B86 A;  1KYO D;  1RE4 A;  1HBW A;  3VYI A;  1N7L A;  1FZB A;  3U1C A;  1PGO A;  2L91 A;  3VMX A;  1W5C E;  4C7N B;  1L4A C;  1NTZ G;  3L75 E;  2ZVN B;  1Q82 Q;  2PFX A;  1E79 H;  1HJB A;  1TU3 F;  4IL6 X;  1SQB K;  1SQX D;  2B88 A;  2IYO A;  1NKZ B;  3SWY A;  2C9N Y;  4GIF A;  1FE6 A;  4ZKP A;  2YKP A;  1N73 C;  2QJK B;  1ZW0 A;  4EI2 A;  1PP9 J;  5KLV G;  3L73 J;  2XND H;  2LXB A;  3RL0 D;  2UWJ E;  1H0T B;  1BCC E;  3H1J D;  2W6A A;  2JWD A;  4DJG A;  2OYI B;  3FGA D;  4MN4 C;  4L74 A;  2R3S A;  4EYY Q;  1VQ9 P;  3FWL A;  2P67 A;  3JCU E;  3RK2 C;  1URQ A;  5H2F E;  1DEB A;  1PPJ D;  2HOD B;  1M56 D;  1VQK P;  4LGD E;  1DH3 A;  1NTZ K;  4HH2 A;  2W8Z A;  1URQ D;  1JCD A;  3AED C;  3BCC J;  3L71 G;  2QJP C;  1Q86 Q;  4D6T G;  2OYO A;  2WPS A;  1IFJ A;  3CC2 P;  1S5L E;  3KHU A;  3H1K E;  2E5T A;  1R5L A;  5CJ4 A;  5CCH C;  1S1C X;  2FYU J;  1X22 A;  1Z56 A;  2XU6 A;  3HD7 B;  4U7J A;  5AVQ B;  1AVY A;  5KLV K;  3W68 A;  4AQR D;  3Q3D A;  3CCQ P;  1S3J A;  1DIP A;  2QA4 P;  1YIT P;  1KIL A;  3GW6 A;  2P1J A;  2IX7 C;  1OIP A;  3ITK A;  4PV1 C;  1IK7 A;  3HUS A;  1L4A B;  1L0N G;  3JSV C;  3RL0 B;  1P84 D;  2RN0 A;  4KT0 J;  1KIL D;  2R3C A;  2G3A A;  3P8M C;  3QWO C;  2QM8 A;  5KJ7 C;  1VQ7 P;  3R4Y A;  1KB9 E;  1YHQ P;  1LWU C;  2IZ0 A;  3L70 D;  1KZU B;  1RHZ B;  3CPW O;  1RQV A;  3CCM P;  1W2E A;  1ZR4 A;  3HE4 A;  2FXO A;  2MKV A;  5DJU B;  1IC2 A;  1N73 B;  1FS0 E;  5B5E H;  4A7P A;  1GK6 A;  1J1D C;  2KNC B;  5APS A;  3H1L E;  2LXC B;  2CPB A;  2W90 A;  1LJ2 A;  1KMI Z;  4L76 A;  1YQ3 C;  1KYO I;  1YTZ T;  1YJ9 P;  2P58 A;  2OQQ A;  3CD6 P;  5AVY B;  5GTH H;  2KUB A;  1Y47 A;  2OGU A;  3IFM A;  1EZV I;  2HPC B;  2E5Y A;  2H89 C;  3L73 G;  3VOP A;  2QJP B;  3TGU E;  5AW6 B;  1NTM J;  1D7M A;  4JYC A;  3HRN A;  1L0L K;  5KAI H;  3AEE C;  2I1J A;  4C46 A;  1UIX A;  3CC7 P;  2A06 G;  1JY2 O;  4PJ0 E;  1L0L D;  2OTJ P;  3P8C D;  3PRJ A;  1FZG A;  3AE9 C;  3CCU P;  2A45 I;  1VQ8 P;  1HJ0 A;  1N7S A;  3BCC G;  4IFM A;  1HWT C;  1ZME C;  1M7L A;  5BVZ A;  5APQ A;  3A0H H;  2DW3 A;  1N7S D;  4NPD A;  4HKZ H;  4PV1 B;  2ITA A;  2FFD C;  3HE4 B;  3HE5 A;  1NU1 G;  1BGY J;  1CI6 A;  2FYU G;  3CCR P;  1J1E C;  1ZRT D;  3TGU J;  3D70 A;  2AXT H;  1SQB J;  3L74 D;  3CXH E;  1USD A;  3C8V A;  3BVH A;  3QH9 A;  2QG4 A;  1NO4 A;  1S9K D;  1SS1 A;  1K04 A;  3TDK A;  1W2B O;  1NKN A;  4QMA A;  1LTT C;  2BCC D;  1YJW P;  4K3A A;  4OWF A;  2IZ1 A;  4H44 D;  2WIT A;  4OVN F;  1VQ5 P;  1YTZ I;  1K8A Q;  3H1H J;  3LW5 H;  2YIU B;  2FYN C;  3TNU A;  1MUU A;  2YXQ B;  3G71 P;  1ZV8 A;  2W27 A;  4WY4 C; 
#chains in the Genus database with same CATH homology
 1JY2 P;  1N73 A;  5KJ7 D;  1FBM A;  2M3B A;  1RF0 A;  1GTW A;  1RF1 A;  1S9K E;  1CZQ A;  3GHG A;  1GZL A;  3B5N B;  1FJP A;  1JTH B;  1G2C A;  2N1T A;  1JCC A;  3MGN A;  2HOD A;  1NTM K;  4WY4 B;  3I5C A;  1JO5 A;  4N78 E;  1JY3 P;  1N7S C;  4OH8 B;  3U59 A;  4N3Y B;  2KOG A;  1GL2 A;  5AW5 B;  4ZKU A;  1SQV K;  2N1T D;  2KP8 A;  3N7N A;  3L36 A;  1FZC B;  5AW9 B;  1KIL B;  2WSE H;  1T2K D;  2YKO A;  3HD7 C;  1MZ9 A;  1YYC A;  1VDF A;  1FOS E;  3HUS B;  1GL2 D;  2O1J A;  1FZA A;  4LLH A;  1SP4 A;  2HPC A;  3BAT A;  4EOT A;  3CI9 A;  1WT6 A;  3RK2 D;  4KHX A;  1AQ5 A;  5BU5 A;  3KPE A;  2XNX A;  4WBA A;  3M06 A;  3P32 A;  3PP5 A;  5APU A;  5AVT B;  2WT7 A;  1IJD B;  4B86 A;  1RE4 A;  2JJL A;  1HBW A;  1GW3 A;  4RES B;  4GT1 A;  3VYI A;  1A02 F;  1G1I A;  1AFO A;  1H88 A;  2LKM A;  1N7L A;  1FZB A;  2WZ7 A;  3U1C A;  3SWF A;  3BRV B;  2FXM A;  3VMX A;  4HYT B;  1HTL C;  4O9B A;  5CCG A;  4C7N B;  1L4A C;  2PAJ A;  2XDJ A;  2R5B A;  5APV A;  5CCH A;  2YO2 A;  2YNY A;  3M9B A;  1LTA C;  3A7O A;  3MD0 A;  1RE3 C;  5AW3 B;  5CCG D;  5AW4 B;  1HJB A;  3M0D C;  3VMZ A;  3NXS A;  1SQB K;  2IFM A;  5CCH D;  1HGZ A;  1T3J A;  3H6P A;  1NKZ B;  3SWY A;  2C9N Y;  1N2D C;  4GIF A;  1LT9 A;  3VTP C;  1J1E B;  1LTJ C;  3VMY A;  3A2A A;  3EFG A;  1NTK K;  2YKQ A;  3M9Q A;  2OYH A;  3M9H A;  3KYQ A;  4ZKP A;  4W7Y A;  2GM4 A;  2C0X A;  2YKP A;  1LTG C;  3G3Z A;  4N78 D;  1HGV A;  1N73 C;  1RF0 C;  1RF1 C;  3BRT B;  3GHG C;  4Y99 B;  3BAS A;  1H8A A;  1ZR2 A;  1M1J B;  3RL0 D;  3A5T A;  2N1T C;  3V4Q A;  3IR9 A;  2W6A A;  1FJK A;  1T2K C;  4W80 A;  5AVX B;  2OYI B;  2H43 A;  5KJ7 A;  1KQL A;  3CL3 D;  2FFD A;  1IFD A;  2WSC H;  1RF1 B;  1GL2 C;  1G1J A;  2P67 A;  3GHG B;  5AW2 B;  1HH0 A;  2PP6 A;  4M3L A;  3RK2 C;  1URQ A;  3V2R A;  1DEB A;  2HOD B;  2GUV A;  1NAF A;  1SLQ A;  4AUW A;  2OAR A;  4LGD E;  1DH3 A;  5APX A;  1NTZ K;  4HH2 A;  3RK2 B;  1URQ D;  2A45 G;  2FYZ A;  1FDM A;  5AVS B;  1JCD A;  1J2J B;  2C9L Y;  1LTB C;  2WPS A;  1RE4 C;  4W7Z A;  1IFJ A;  2P7J A;  4LC1 A;  1SFC A;  1L0N K;  3RK3 C;  1IFM A;  5CCG C;  2Z5I A;  1N7S B;  5CJ0 A;  5CJ4 A;  2HG5 D;  3CLQ A;  5CCH C;  1IFN A;  2R5D A;  3B8E B;  2QM7 A;  3MTU E;  1SFC D;  1MV8 A;  3LID A;  3B5N A;  1Z56 A;  1SQQ K;  2BAS A;  2YMY A;  2XU6 A;  1JTH A;  3L37 A;  3RK3 B;  3HD7 B;  1FOS F;  1NWQ A;  5AVQ B;  2Q3I A;  3TK1 A;  5KLV K;  3HE5 B;  4AQR D;  1CI6 B;  3B5N D;  1LT9 C;  1XTC C;  2HFE D;  2H8P D;  3RL0 C;  1FZC A;  1KIL A;  1SQX K;  2P1J A;  3V4W A;  2IX7 C;  3TYY A;  3HUS A;  2L5G B;  1LT9 B;  1JOC A;  1L4A B;  2KSJ A;  3C9I A;  4JF7 A;  2XV5 A;  1PFI A;  3RL0 B;  1LTI C;  3NTN A;  1KIL D;  3VP8 A;  2R3C A;  3NFQ A;  3P8M C;  1RY3 A;  2QM8 A;  5KJ7 C;  2O01 H;  1NHL A;  3II6 A;  5AW1 B;  2HLO A;  5AW7 B;  3NMD A;  1LWU C;  5AVR B;  3UIA A;  4C7N A;  2A45 H;  1CSB A;  3KQG A;  1GU4 A;  5AVU B;  1KZU B;  3HTK B;  3MUD A;  3OA7 A;  1H89 A;  1T8Z A;  3R2P A;  2VRS A;  1W2E A;  1X9V A;  1ZR4 A;  2I1K A;  1LTJ B;  3HE4 A;  4C7R A;  2MJZ A;  3V5B A;  2KYV A;  3OAK A;  1LWU B;  1IK9 A;  3TNU B;  4DZO A;  2Q9I A;  1IC2 A;  2WWW A;  2O1K A;  1N73 B;  2KLV A;  2Z5H A;  3P7K A;  3T97 A;  3L4F A;  1JUN A;  1GK6 A;  3V2P A;  1J1D C;  1SFC C;  1G2C B;  2N1T B;  1NH4 A;  4XA4 A;  1A02 J;  5APS A;  2CPB A;  2NPS A;  1FZE A;  1GL2 B;  1GU5 A;  1WRG A;  1HUC A;  1J1D B;  5AW0 B;  1YTZ T;  1NOH A;  1XTG B;  3B5N C;  3LIE A;  1M1J A;  4EIJ A;  4I1L A;  5AVY B;  1GW4 A;  3A3Y B;  1QL1 A;  5APW A;  2GUS A;  2NPS D;  3H32 A;  3MIW A;  2OYI A;  3U1A A;  2CPS A;  3IFM A;  2POH A;  2HPC B;  2W6B A;  1OWA A;  4IFD K;  3VOP A;  2YO3 A;  3OJA B;  2ZFC A;  5AW6 B;  2WT7 B;  5AW8 B;  1FZC C;  1HVV A;  1KIL C;  4JYC A;  1JNM A;  3HRN A;  1L0L K;  5AVW B;  1FAV A;  3HUS C;  1NU1 K;  2I1J A;  2FYU K;  4C46 A;  3EQ2 A;  3VN0 A;  2J58 A;  3WMM 0;  1GDT A;  1DX7 A;  1JY2 O;  4WY4 A;  1X79 B;  2HYN A;  2R32 A;  3L35 A;  1IFI A;  3P8C D;  4I2L C;  1FZG A;  5APY A;  3M0A A;  3V2N A;  1JY3 O;  4DOJ A;  4WY4 D;  2OYH C;  2A45 I;  1N7S A;  2XZR A;  1KFM A;  4IFM A;  1HWT C;  2E42 A;  1JY2 N;  1EQ7 A;  1M7L A;  2ZXE B;  2WTY A;  4XE5 B;  1ZN5 A;  1IO4 A;  1JMM A;  2IPP A;  5BVZ A;  2Q7C A;  5APQ A;  5BU8 B;  3M91 A;  2J59 M;  3VP9 A;  2OYH B;  3HD7 A;  4GKG A;  1N7S D;  3KDP B;  2KB7 P;  1JY3 N;  4AYC A;  2FFD C;  5AVZ B;  2Z4E A;  5KTB A;  3HE4 B;  3HE5 A;  2WSF H;  1CI6 A;  1URQ C;  3RK3 D;  1J1E C;  3HD7 D;  2Q5U A;  1FU1 A;  5APT A;  2M8R A;  3P8C E;  2NPS C;  1SQP K;  2P2U A;  1T3U A;  2FFD B;  5AVV B;  2N9B A;  2WPR A;  4WB4 A;  1OXZ A;  3BVH A;  3V2Q A;  1L4A A;  1URQ B;  1GK4 A;  1S9K D;  1LTS C;  1NO4 A;  4Y99 C;  1CW5 A;  1QL2 A;  1VPC A;  1GD2 E;  1M1J C;  2C0W A;  3O8Z A;  2NPS B;  1FZF A;  2E43 A;  2OYI C;  4IFF A;  1NKN A;  3TSI A;  1LTT C;  1ZLL A;  1RE3 A;  1L4A D;  1MFZ A;  3M0D A;  1X8Y A;  2JEE A;  2FKW B;  5CHX A;  3HTK A;  2WIT A;  4N6J A;  3H32 B;  3E1I A;  3N4X A;  4I6M C;  1YTZ I;  1E5W A;  1N86 A;  2XKM A;  1SFC B;  2H7H A;  1SVF A;  1LTJ A;  4JYB A;  5CMZ A;  3LW5 H;  1LWU A;  1LGH B;  3TNU A;  1MUU A;  1ZV8 A;  2IFN A;  2W27 A;  1KFN A;  2WPQ A;  4WY4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...