4IFMA

Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 angstroms resolution x-ray fibre diffraction data
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF1 FILAMENTOUS BACTERIOPHAGE
publication title Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre diffraction data.
pubmed doi rcsb
molecule tags Virus
total genus 17
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1995-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4ifmA00
1IFNA 2IFMA 2KLVA 2KSJA 2IFNA 1ZN5A 1IFMA 4IFMA 1QL1A 2XKMA 1QL2A 1PFIA 3IFMA
chains in the Genus database with same CATH superfamily
1M1JA 2FFDA 3Q2YA 3R2PA 3V2PA 1S5LE 2XZRA 1NU1G 2J58A 3BATA 3BCCG 1W2EA 3KPEA 1NH4A 3U1CA 3JCUE 4OH8B 1QVGO 4N78D 3L37A 3FXDA 1DIPA 1PGQA 4IL6E 2V7QJ 3TDKA 1CSBA 1NJIQ 1KB9D 5AVQB 2IZ1A 1L0NJ 3L75D 3H1LD 1JM0A 3MHVA 4H13C 2Y0DA 2J5UA 1HJ0A 4I7ZC 1HTLC 3I56P 4IFDK 4PD4D 1R5LA 1SLQA 1EDJA 1EQ7A 3AE9C 3H1HE 3M06A 1XTCC 1NU1D 1ZXGA 3S4RA 3LW5H 4WWIA 1NAFA 1ZR4A 4O9BA 3WMM0 2MJZA 5AVRB 1J1DC 3OJAB 1EDIA 3P8CE 1L0NK 3V4WA 1SQQD 4L75A 4I2LC 2E74B 1JY2O 2E75D 1KYOE 3GHGC 3CMEP 1X0TA 3T97B 3B5NB 1IC2A 3PLNA 1BGYE 3HUSC 3AE3C 2ZVOB 1NTME 4UB8E 5KLIB 1N73C 4TLFA 1LJ2A 1YHQP 1BE3G 1KN7A 4L74A 4GT1A 1USDA 2WSFJ 5TISH 2QG4A 3RK3D 3HE5B 3V2NA 3CL3D 1SFCB 3JSVC 2FXPA 1GD2E 4HB1A 1J2JB 5AW0B 3I55P 3HTKA 1PIXA 5DJTB 1VQ7P 1JOCA 3RK3E 1HF9A 5KKZC 3RGUA 2A06D 2FKWB 1L0LG 4HKZH 3G9RA 1VQNP 2JO1A 1GZLA 1YYCA 2A45H 5TJHA 2BEQD 1L4AB 4C7RA 4H44D 1LTJC 1RHZB 2E43A 2D2CD 2Y0EA 3OAKA 4W7ZA 1X22A 1KTMA 2YNYA 3WUVA 2P1JA 1VPCA 4GOFA 2FYUD 2ZT9D 2K9JB 4EIJA 1URQA 1KILD 3AEBC 4U7JA 1SQPG 2FY8A 1GL2C 1L0NE 1GK4A 2ZAEB 4EI2A 1EZVE 2OYHC 2QJPB 1KILE 3CCQP 3L4FA 3E1RA 2FBWC 5M1BA 2OYIC 4OGQC 2L5GB 3W67A 2R5BA 2JEEA 1OWAA 2ZXEB 3GHGA 3RL0D 4PD4H 3GF3A 3L74J 2IDBA 1FZEA 1D7MA 4W80A 5AW4B 2RKLA 3BRVB 3HUSA 2Q3EA 1GU4A 1N73A 3MGNA 4YXDC 2P7JA 1S1CX 1FC2C 2Q5UA 4AYCA 3B8EB 3USSA 5APXA 4RJTA 2Q3IA 1PPJD 1HGVA 3HRNA 1OX3A 1ZN5A 2KSEA 1JY3P 2B89A 1OMIA 3ZDMA 3TF5A 4H0LC 2YKPA 1U57A 1YI2P 1OW6A 1P84E 3H1KJ 3HD7D 1LTGC 3G3ZA 1YTZT 3H1JJ 3L35A 2K37A 2WWWA 1Q90D 1LTAC 2W6AA 2GUVA 5AW5B 2IFMA 1BCCJ 1LT9B 2IPPA 2ZXXA 3L71J 2KS1A 3VMZA 3L72J 1GL2A 1VQKP 1T6AA 1NTKJ 3H25A 2GUSA 1H8AA 4H44B 2BCCD 4Y99C 2D2CB 2BEZF 1M1KQ 2KP8A 1RY3A 2G8YA 4TT3H 2QJYB 2NPSC 4ASWA 1SQBD 2OYIA 3EQ2A 2KUBA 3CCLP 1ZV8A 2R44A 1VQMP 2ZT9B 1S9KD 3H1IE 1AA0A 4PV1D 2BCCE 1A02J 4DZOA 1CI6A 1NTZG 1NTKK 4JYBA 5KJ7D 1FBMA 3CWBJ 4AQRD 3CC2P 3QWOC 3CXHI 4KHXA 3IAOA 1LTIC 4HYTB 5KAFE 4GDOA 3V6IA 1FU1A 2B87B 3IF4A 4U3FG 5KLVD 1FDMA 2YKOA 1VDFA 1KV4A 1AFOA 1X79B 3CX5E 1IFNA 3M9QA 4RKUJ 3L73E 1FOSE 4WBAA 1OZHA 1SQVG 3RL0B 5B5EE 2Z5IA 1SVFA 3WU2H 1H0TA 3N7NA 3CCVP 1Q86Q 1GW4A 2AXTH 3VTPC 2O01N 1VQPP 3L75J 3H1LJ 4NPDA 2FYNB 1KD1Q 5AW7B 4GKGA 1QLED 2J59M 2H7HA 2R3SA 5AW2B 3L70G 3KXDA 3S9OA 1RF1B 3Q3DA 2KOGA 4WY4C 1NU1J 2WPVB 1KZUB 1KYOI 2KZJA 1X9VA 2IX7C 2WSSH 4GIFA 5GTHH 3H1JE 2W8ZA 1BGYJ 1FJPA 4OVNF 2IBZD 1OW7A 1SQQJ 3CCRP 1FE6A 2H43A 1BCCE 3MP7B 2NZ2A 2Z5HA 1ZMEC 5APUA 1PP9G 2CPBA 2W6BA 3L71E 1OVUA 1NU1K 4LC1A 3HD7B 3P8MC 5AVZB 2PGDA 3L72E 3L70D 4GODA 4C7NB 1NTKE 1YQ4C 3CLQA 5APTA 2NPSA 3KQGA 2E76D 3MZWB 1N8RQ 2E75C 1SQQK 5CJ0A 3FWLA 3V4QA 3U59A 3KDPB 4W7YA 4KJMA 3MTUE 1Z56A 1JMBA 1PP9D 3KZIH 1VQ6P 1VQLP 3TGUD 4EOTA 3H1HG 4DCKA 4L76A 1USEA 2MKVA 5BVZA 3CWBE 3RK3C 2YO2A 1N7LA 4DOJA 1FZCC 3CXHE 5AVTB 2KXPB 3AE6C 1Y8AA 3M9BA 4NPEA 2JWDA 5B66E 2ZJSE 1LP1A 4PV1B 1NWQA 3PP5A 3RBZA 1NAYA 3HE4A 2PFXA 1JCCA 1EZVI 1JTHA 1OIPA 3D70A 2FYUJ 4ZNCA 2JR8A 5CCGC 1RF0A 4N78E 4I1LA 5APQA 1NTMG 1AJYA 1KB9E 2OQQA 3H32A 3BCCD 4OWFA 5GTIH 3L75E 3H1LE 1MUUA 4WY4A 3WUTA 1IFMA 2V4HA 1SQXG 1LTBC 4PD4E 3VMAA 2FYUK 3O8ZA 1K8AQ 1KILC 1NU1E 2M5AB 3CC4P 3CD6P 2YKQA 3E7KA 1G2CA 3AEGC 1Q2NA 2WSCJ 1KMIZ 1X8YA 3A3YB 4ZKPA 2WSEJ 4JBZA 2O01H 1SQQE 3IR9A 2HODA 3TSIA 1OW8A 1AQTA 2KI7B 1ZLLA 2AEMA 2ZYDA 2C0XA 3C1LA 4R4MA 1H89A 2N9BA 3RL0C 3G71P 2VRSA 1N86A 5E79H 2I1JA 1IK9A 2IFNA 2POHA 1UIIA 1P84I 2FXMA 1N7SC 2KB7P 1T8ZA 5H2FH 2N1TC 1J1EC 1UIXA 1EDKA 2P58A 1L0NG 1HVVA 2KSJA 1YBKA 1K9MQ 2QJKC 3WUUA 4IFMA 1FZCA 3I5CA 1BE3D 2PAJA 2E76B 3TNUB 3A0BH 5AVUB 2A06E 1VF5C 1URQD 1S2EA 4H13D 2CPSA 3O6QA 1NYHA 1M1JB 2IYOA 2FFDB 2R3CA 1BE3E 2KNCA 4ASVA 1LWUC 1S5LH 3IN6A 2C9LY 5CCGA 2YIUC 4AUWA 1M90Q 1L0LD 1BDCA 2H89C 3JCUH 3R4YA 2Y0CA 1G1JA 2FYUE 1T2KD 4IL6H 1NHLA 3CMAP 1YITP 3A0HH 5CCHC 2M8RA 3QH9A 3H1IJ 2BCCJ 2C9NY 5KTBA 4UB6E 3RK2D 4Z1MH 1MFTA 3Q5SA 3GMAA 3SFEC 3NTNA 1SQBJ 1T3JA 1S4XA 2P10A 4LLHA 3VMXA 1VQOP 2DW3A 3RL0g 1SQPD 2OTJP 2B9BA 3CX5I 2HPCA 2Q9IA 2IZ0A 1FZAA 1NO4A 3L73J 2FXOA 1SS1A 1M7LA 1VL2A 2NRGA 5KLVJ 1KYOH 1SQBK 2XDJA 5KAIE 3V2QA 2H88C 5KJ7C 1KQGB 2HODB 3LW5J 1U7JA 1PGJA 1IFDA 1N7SA 1QEXA 1NKNA 2N1TA 1K05A 1PPJE 5KLVK 1RE3C 2G3AA 2KK7A 5AVVB 4B86A 2LXCB 1KFMA 5AW3B 1W2BO 1LTJA 2QE7H 3UIAA 3G4SP 3HTKB 4RESB 1ZRTD 1JCDA 1PV3A 1S5LX 2HFED 3AE7C 1K73Q 4CPGA 2E74C 2GA1A 4PJ0H 1GL2D 5C39A 1N2DC 2P67A 1LWUA 2L91A 3B4SA 3SWKA 3B5NC 3Q1MA 1E5WA 1EXJA 2JJLA 3AEEC 4I6MC 3L74G 4WVZA 5KLIC 2OYHA 3N4XA 1EDLA 5CCHA 3EWKA 4OGQD 5AW1B 5BU8B 1URQB 1AVYA 4D6TG 1SFCC 3VN0A 4H13B 4I7ZB 2RN0A 1M8OB 2V7QH 2WITA 2RH0A 2E5TA 2CK3H 2HLOA 3PTZA 4YTPC 4WB4A 1J1DB 2WZ7A 1ZR2A 2QM8A 1SQBE 1Q82Q 4NPFX 4R4LA 3KYQA 1HH0A 2O1JA 2P2UA 3SWFA 1S9KE 2O1KA 3TYYA 1IFPA 1QVFO 1L4AC 1PP9J 2OARA 3TGUJ 2PRRA 3RK2B 3GHGB 1QL1A 2QM7A 4D6TD 1OVRA 1BSHA 3H1KG 3HUSB 1Q81Q 4YPCA 4EYYQ 4H0LD 1RE4C 2M3BA 5KLVE 3H1JG 1VQ4P 4BXLA 1NTZD 1N73B 1YJNP 1KB9I 3CCMP 1BCCG 4HJGH 1LTSC 2WMMA 3L71G 1RE3A 3ABVC 3A7OA 2W90A 2QJPC 4U3FD 3L72G 4PD4I 5APVA 2WSFH 2YMYA 1A02F 5KKZB 2LXBA 3BCCJ 1RH5B 3H1KD 3CCSP 2XNDH 1SQVD 1IFJA 1TU3F 3RBXA 3VMYA 3T97A 1KORA 3B5NA 5AW8B 3H6PA 1P84H 3LIEA 2OGUA 1U7MA 2IYPA 4JF7A 1JB0J 2QVAA 2NPSD 3CI9A 3CWBG 1OFCX 5TISE 1RQUA 3HE5A 2IBZE 2KS1B 1SFCA 5APWA 3GLMA 4IFFA 4BRYA 5E79E 1GL2B 3MUDC 3L70E 4MN4C 3JC22 4JQ0D 3E1IA 1W5CE 3LIDA 3OW2O 1AVOA 3OA7A 2WT7A 2XKMA 2OYIB 2R32A 1L4AA 4OGQB 1JY3N 2WPSA 4HH2A 3A0BE 3F5HA 3G6EP 3NXSA 4XFJA 1ZOYC 1AQ5A 1CI6B 3L75G 2Q7CA 5CBNA 1KC8Q 2I8DA 1BE3J 1PP9E 3VOPA 1HBWA 3TGUE 1LT9C 2K9JA 2K3RA 1RE4A 5KAFH 2QEXP 5AVYB 4K35A 3MD0A 3V5BA 2N9YB 2C0WA 1JY2P 1GDTA 1GTWA 3IFMA 1BGYG 4WY4D 3CX5H 3H1HD 2Q1KA 4N6JA 3A0HE 4H44C 1SQQG 2D2CC 1L0LJ 2JP3A 1Y9BA 5B5EH 3AE1C 1MV8A 1URQC 1DX7A 2QJYC 1H0TB 3P8CD 1NGMB 2ZT9C 4H0LB 5EFWB 1IO4A 1DEEG 1E79H 1KYOD 3BCCE 1EXIA 2W83C 3D6ZA 1L0LK 1YJ9P 1HGZA 3AECC 1PGOA 1BGYD 4XA4A 1T2KC 3PRJA 1NTMD 2O3JA 1SQPJ 1DEBA 3RK2C 3VP9A 1IK7A 2A06G 1IJDB 1GW3A 1SQXD 1LT1A 1QX8A 3S1KA 3MUDA 1VQ5P 1KQSO 1R8EA 4Y99B 3D6YA 4EDFA 1SQPK 3FWNA 2M3EA 1SQXE 2FYNC 2NPSB 3VYIA 1BSNA 1GMJA 3B71A 4BRYB 1EZVG 3A2AA 2FYUG 1RF1C 5CMZA 3AE5C 4K3AA 1ZP0C 1FDIA 5APYA 3AEAC 3FX0A 2OYOA 4PJ0E 2QA4P 1LT9A 5APSA 3GG2A 5CCGD 2WT7B 2Q6QA 2YMKA 2AXCA 5CBOA 3BRTB 2JDIH 2KLUA 1JEKA 3CXHH 3PHLA 1HJBA 1EC5A 1FAVA 3PJSK 3HD7C 1L0ND 2HYNA 1LP1B 5B66H 1EZVD 5CHXA 3HE4B 2SPZA 1FZFA 1S3JA 2M0BA 1JTHB 4JPZB 5CJ4A 1L0LE 1KQLA 1KILA 5AW9B 3BVHA 2H8PD 2KZIA 4N3YB 2XU6A 2KLVA 3H32B 2ZYAA 1KB9H 3F89A 2YXQB 1VQ9P 2XV5A 4ZMDA 3D71A 1YQ3C 2B88A 4WY4B 3A5TA 3FXEA 1ZW0A 1GK6A 2B87A 2R5DA 1PPJG 3U1AA 3TK1A 1PFIA 1JMMA 3SSUA 3AE8C 3P7KA 5DJUB 2W27A 2ZFCA 3CCJP 1JUNA 3M91A 1SQPE 4PV1C 1G2CB 3WU2E 2Y9ZA 2GM4A 2OTLP 4D6TJ 2HG5D 1N7SD 2N1TD 2AXTE 1DD3A 1NOHA 4LGDE 1HWTC 3FGAD 1OXZA 4UB8H 4ZKUA 2E42A 1NTZJ 2E75B 3M0DC 1YTZI 1VF5D 2LKMA 1RF1A 1P84D 2Y9YA 1LNQA 1JY2N 1CZQA 2OTKE 2AEFA 4U3FJ 1IZNB 1PZQA 5K5GB 2JKVA 5GTHE 2RMZA 3H1IG 1NTZK 2BCCG 2O01J 2QIWA 3EFFK 3RK3B 3W68A 1MFZA 1WRGA 1KFNA 1SQVJ 1FZBA 4IOIH 2ZYGA 4XE5B 3C8VA 1FZCB 1Y47A 1ZRTE 1K04A 4IL6X 5CCHD 1VQ8P 2KIKA 1SQBG 2IBZI 3HD7A 2LR2A 1FOSF 1JY3O 5BU5A 4C7NA 1S72P 3O6QB 2XNXA 5AVWB 4KT0J 3SFDC 2PP6A 2KNCB 3V2RA 3L70J 2BASA 1SQVK 1GU5A 3L73G 3CCUP 1T3UA 3H1ID 1FJKA 3K5BA 5KLVG 1AV1A 2I1KA 2A45I 1MZ9A 1NVOA 1L2PA 2WPRA 1FS0E 5L8RJ 2UWJE 3KZIE 2K1AA 4RO0A 3L74D 2W6JH 4UB6H 1R5SA 2K88A 3CPWO 2WVRA 1KILB 4GOEA 2E76C 4DJGA 1YJWP 1CW5A 3CX5D 2QSIA 2FYZA 1BDDA 3L73D 3ITKA 4C46A 1DD4A 3L74E 5KJ7A 1SP4A 1MKMA 1M1JC 1OVVA 1Q7YQ 4L73A 2FFDC 3BASA 2HPCB 1H88A 3AEDC 4JYCA 3AE4C 1IFIA 1PL5A 1DH3A 2QRXA 5AW6B 1M56D 2AEJA 2WSCH 4D6TE 3KHUA 4QMAA 2WSEH 3M0AA 4YXWH 3GF7A 3M0DA 1JNMA 5AVSB 1NKZB 1KQFB 5GTIE 1FZGA 5KAIH 1WMKA 2HR3A 1NTZE 3H1HJ 2E74D 2IBZG 1NTKG 3II6A 3M9HA 1FDOA 2JWAA 2YXRB 1N7SB 1RF0C 2N1TB 1J1EB 3B5ND 3VP8A 2WTYA 3Q5RA 4BWNA 2M5AA 4U3FE 3H1JD 1M57D 3PH0A 2QJKB 1LTJB 4Y28J 1BCCD 1QL2A 1PGPA 3H1KE 1VF5B 1HUCA 1XTGB 3L71D 2A45G 3NFQA 5AVXB 1SQVE 2ITAA 1SFCD 1LGHB 3SWYA 3L72D 3GW6A 2Z4EA 2KYVA 1G1IA 1NTMJ 1NTKD 1LWUB 1WT6A 2YIUB 3TGUG 4M3LA 1RQVA 1JO5A 2WPQA 1SQXJ 3AEFC 1YIJP 2YO3A 2OYHB 5H2FE 3L36A 1L4AD 4DT0A 2K9YA 3MIWA 1NTMK 3Q5PA 3C9IA 2ZVNB 3CWBD 2WQYC 3AE2C 3TNUA 3CC7P 1QGKB 3CCEP 4A7PA 3CXHD 3EFGA 3H1LG 1LTTC 1SQXK 3P32A 2E5YA 3NMDA
chains in the Genus database with same CATH topology
1IFNA 1M1JA 3M9QA 2FFDA 1RF1C 3R2PA 1IFDA 1N7SA 3V2PA 5CMZA 2XZRA 1NKNA 2N1TA 4WBAA 1FOSE 2J58A 5APYA 3BATA 3RL0B 2Z5IA 1SVFA 5KLVK 1W2EA 1RE3C 3KPEA 1NH4A 3U1CA 4OH8B 5AVVB 1LT9A 3N7NA 5APSA 4B86A 1GW4A 4N78D 1KFMA 3L37A 5AW3B 5CCGD 1LTJA 2WT7B 3UIAA 3VTPC 3HTKB 1CSBA 3BRTB 4RESB 5AVQB 1JCDA 5AW7B 4GKGA 2HFED 2J59M 2H7HA 5AW2B 1HJBA 1FAVA 3HD7C 1RF1B 1GL2D 1HTLC 2HYNA 1N2DC 2P67A 2KOGA 4WY4C 4IFDK 1KZUB 1LWUA 1SLQA 1X9VA 1EQ7A 3M06A 2IX7C 4GIFA 3B5NC 1XTCC 5CHXA 3HE4B 1E5WA 2JJLA 3LW5H 4I6MC 1NAFA 1FZFA 1ZR4A 4O9BA 1JTHB 3WMM0 5CJ4A 2MJZA 1FJPA 5AVRB 1J1DC 1KQLA 3OJAB 2OYHA 3N4XA 3P8CE 1KILA 1L0NK 5CCHA 5AW9B 3BVHA 2H8PD 2H43A 4N3YB 2Z5HA 3V4WA 5APUA 5AW1B 2XU6A 5BU8B 4I2LC 1URQB 2CPBA 2KLVA 2W6BA 3H32B 1SFCC 2XV5A 1JY2O 1NU1K 3VN0A 4LC1A 3HD7B 3P8MC 5AVZB 3GHGC 2WITA 4WY4B 3A5TA 1GK6A 2R5DA 4C7NB 3U1AA 3B5NB 1IC2A 3TK1A 3CLQA 5APTA 1PFIA 3HUSC 1JMMA 2NPSA 3KQGA 3P7KA 2HLOA 1SQQK 2W27A 2ZFCA 5CJ0A 4WB4A 1J1DB 1N73C 2WZ7A 1ZR2A 2QM8A 1JUNA 3V4QA 3U59A 3M91A 4GT1A 3KYQA 3KDPB 1HH0A 2O1JA 1G2CB 2P2UA 3RK3D 3SWFA 1S9KE 2O1KA 3HE5B 3TYYA 3V2NA 1L4AC 2GM4A 2HG5D 1N7SD 2OARA 3CL3D 1SFCB 2N1TD 4W7YA 3RK2B 3GHGB 3MTUE 1Z56A 1QL1A 1NOHA 2QM7A 4LGDE 1HWTC 1GD2E 1J2JB 5AW0B 4EOTA 1OXZA 4ZKUA 2E42A 3HTKA 5BVZA 3RK3C 2YO2A 3HUSB 1JOCA 1N7LA 4DOJA 1FZCC 1RE4C 2M3BA 5AVTB 3M0DC 2FKWB 3M9BA 1YTZI 1N73B 2LKMA 1RF1A 1JY2N 1NWQA 3PP5A 1CZQA 1GZLA 1YYCA 2A45H 1L4AB 1LTSC 4C7RA 1LTJC 2E43A 1RE3A 3HE4A 3A7OA 3OAKA 4W7ZA 1JCCA 1JTHA 2YNYA 2P1JA 5APVA 1NTZK 2WSFH 1VPCA 5CCGC 2YMYA 3RK3B 1RF0A 4N78E 1MFZA 1WRGA 1A02F 1KFNA 4I1LA 1FZBA 5APQA 4XE5B 1FZCB 4EIJA 1URQA 3H32A 1KILD 5CCHD 3HD7A 1IFJA 1FOSF 1MUUA 4WY4A 1JY3O 5BU5A 1GL2C 3VMYA 1IFMA 3T97A 4C7NA 2XNXA 3B5NA 5AW8B 1GK4A 3H6PA 5AVWB 1LTBC 3LIEA 2OYHC 2FYUK 3O8ZA 1KILC 2PP6A 3V2RA 4JF7A 3L4FA 2BASA 1SQVK 2NPSD 3CI9A 1GU5A 2YKQA 1T3UA 1FJKA 1G2CA 3HE5A 2OYIC 2L5GB 2I1KA 2A45I 1MZ9A 2R5BA 1X8YA 2WPRA 2JEEA 3A3YB 4ZKPA 1SFCA 1OWAA 5APWA 2ZXEB 3GHGA 4IFFA 3RL0D 2O01H 3IR9A 2HODA 3TSIA 1FZEA 1GL2B 4W80A 5AW4B 1ZLLA 3BRVB 3HUSA 2C0XA 1KILB 1H89A 2N9BA 3E1IA 3RL0C 1GU4A 1N73A 3MGNA 1CW5A 2VRSA 1N86A 3LIDA 2P7JA 3OA7A 2FYZA 2WT7A 2I1JA 2XKMA 2Q5UA 2OYIB 2R32A 1L4AA 1JY3N 4AYCA 2WPSA 4C46A 4HH2A 3B8EB 5KJ7A 1SP4A 3NXSA 1IK9A 2IFNA 2POHA 5APXA 1M1JC 1AQ5A 2FFDC 2FXMA 3BASA 2Q3IA 1CI6B 2HPCB 1N7SC 2KB7P 2Q7CA 1T8ZA 1H88A 2N1TC 4JYCA 1J1EC 1HGVA 1IFIA 3HRNA 1HVVA 1DH3A 2KSJA 1ZN5A 5AW6B 2WSCH 1JY3P 3VOPA 1HBWA 1LT9C 2WSEH 3M0AA 4IFMA 1FZCA 1RE4A 3I5CA 2PAJA 3M0DA 1JNMA 5AVSB 3TNUB 1NKZB 2YKPA 5AVYB 1FZGA 5AVUB 3MD0A 3V5BA 2C0WA 1JY2P 1URQD 1GDTA 1GTWA 3IFMA 3HD7D 2CPSA 3II6A 1M1JB 3M9HA 4WY4D 4N6JA 1LTGC 2FFDB 3G3ZA 1YTZT 1N7SB 2R3CA 1RF0C 2N1TB 1J1EB 3B5ND 1LWUC 3VP8A 2WTYA 3L35A 2C9LY 2WWWA 5CCGA 1LTAC 2W6AA 1MV8A 1URQC 2GUVA 4AUWA 1DX7A 5AW5B 2IFMA 1LT9B 2IPPA 3P8CD 1LTJB 1G1JA 1QL2A 3VMZA 1T2KD 1IO4A 1NHLA 1HUCA 1XTGB 2M8RA 2A45G 5CCHC 3NFQA 5AVXB 1GL2A 1SFCD 2C9NY 5KTBA 3RK2D 1LGHB 2GUSA 3SWYA 1H8AA 2Z4EA 2KYVA 1G1IA 1L0LK 1HGZA 4Y99C 4XA4A 1T2KC 1LWUB 2KP8A 3NTNA 1T3JA 1WT6A 1RY3A 4M3LA 2NPSC 4LLHA 1DEBA 3RK2C 3VMXA 1JO5A 2OYIA 3EQ2A 3VP9A 2WPQA 1ZV8A 2YO3A 1S9KD 2OYHB 1A02J 4DZOA 1CI6A 2HPCA 3L36A 1IJDB 2Q9IA 1L4AD 1GW3A 1NTKK 1FZAA 1NO4A 4JYBA 5KJ7D 3MIWA 1FBMA 4AQRD 1NTMK 1M7LA 3MUDA 4KHXA 4Y99B 1LTIC 3C9IA 4HYTB 1SQBK 1FU1A 2XDJA 3TNUA 1SQPK 3V2QA 5KJ7C 3EFGA 1FDMA 2YKOA 2NPSB 3VYIA 1LTTC 1SQXK 1VDFA 3P32A 1AFOA 1X79B 3NMDA 2HODB 3A2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFN A;  2IFM A;  2KLV A;  2KSJ A;  2IFN A;  1ZN5 A;  1IFM A;  4IFM A;  1QL1 A;  2XKM A;  1QL2 A;  1PFI A;  3IFM A; 
#chains in the Genus database with same CATH topology
 1M1J A;  2FFD A;  3Q2Y A;  3R2P A;  3V2P A;  1S5L E;  2XZR A;  1NU1 G;  2J58 A;  3BAT A;  3BCC G;  1W2E A;  3KPE A;  1NH4 A;  3U1C A;  3JCU E;  4OH8 B;  1QVG O;  4N78 D;  3L37 A;  3FXD A;  1DIP A;  1PGQ A;  4IL6 E;  2V7Q J;  3TDK A;  1CSB A;  1NJI Q;  1KB9 D;  5AVQ B;  2IZ1 A;  1L0N J;  3L75 D;  3H1L D;  1JM0 A;  3MHV A;  4H13 C;  2Y0D A;  2J5U A;  1HJ0 A;  4I7Z C;  1HTL C;  3I56 P;  4IFD K;  4PD4 D;  1R5L A;  1SLQ A;  1EDJ A;  1EQ7 A;  3AE9 C;  3H1H E;  3M06 A;  1XTC C;  1NU1 D;  1ZXG A;  3S4R A;  3LW5 H;  4WWI A;  1NAF A;  1ZR4 A;  4O9B A;  3WMM 0;  2MJZ A;  5AVR B;  1J1D C;  3OJA B;  1EDI A;  3P8C E;  1L0N K;  3V4W A;  1SQQ D;  4L75 A;  4I2L C;  2E74 B;  1JY2 O;  2E75 D;  1KYO E;  3GHG C;  3CME P;  1X0T A;  3T97 B;  3B5N B;  1IC2 A;  3PLN A;  1BGY E;  3HUS C;  3AE3 C;  2ZVO B;  1NTM E;  4UB8 E;  5KLI B;  1N73 C;  4TLF A;  1LJ2 A;  1YHQ P;  1BE3 G;  1KN7 A;  4L74 A;  4GT1 A;  1USD A;  2WSF J;  5TIS H;  2QG4 A;  3RK3 D;  3HE5 B;  3V2N A;  3CL3 D;  1SFC B;  3JSV C;  2FXP A;  1GD2 E;  4HB1 A;  1J2J B;  5AW0 B;  3I55 P;  3HTK A;  1PIX A;  5DJT B;  1VQ7 P;  1JOC A;  3RK3 E;  1HF9 A;  5KKZ C;  3RGU A;  2A06 D;  2FKW B;  1L0L G;  4HKZ H;  3G9R A;  1VQN P;  2JO1 A;  1GZL A;  1YYC A;  2A45 H;  5TJH A;  2BEQ D;  1L4A B;  4C7R A;  4H44 D;  1LTJ C;  1RHZ B;  2E43 A;  2D2C D;  2Y0E A;  3OAK A;  4W7Z A;  1X22 A;  1KTM A;  2YNY A;  3WUV A;  2P1J A;  1VPC A;  4GOF A;  2FYU D;  2ZT9 D;  2K9J B;  4EIJ A;  1URQ A;  1KIL D;  3AEB C;  4U7J A;  1SQP G;  2FY8 A;  1GL2 C;  1L0N E;  1GK4 A;  2ZAE B;  4EI2 A;  1EZV E;  2OYH C;  2QJP B;  1KIL E;  3CCQ P;  3L4F A;  3E1R A;  2FBW C;  5M1B A;  2OYI C;  4OGQ C;  2L5G B;  3W67 A;  2R5B A;  2JEE A;  1OWA A;  2ZXE B;  3GHG A;  3RL0 D;  4PD4 H;  3GF3 A;  3L74 J;  2IDB A;  1FZE A;  1D7M A;  4W80 A;  5AW4 B;  2RKL A;  3BRV B;  3HUS A;  2Q3E A;  1GU4 A;  1N73 A;  3MGN A;  4YXD C;  2P7J A;  1S1C X;  1FC2 C;  2Q5U A;  4AYC A;  3B8E B;  3USS A;  5APX A;  4RJT A;  2Q3I A;  1PPJ D;  1HGV A;  3HRN A;  1OX3 A;  1ZN5 A;  2KSE A;  1JY3 P;  2B89 A;  1OMI A;  3ZDM A;  3TF5 A;  4H0L C;  2YKP A;  1U57 A;  1YI2 P;  1OW6 A;  1P84 E;  3H1K J;  3HD7 D;  1LTG C;  3G3Z A;  1YTZ T;  3H1J J;  3L35 A;  2K37 A;  2WWW A;  1Q90 D;  1LTA C;  2W6A A;  2GUV A;  5AW5 B;  2IFM A;  1BCC J;  1LT9 B;  2IPP A;  2ZXX A;  3L71 J;  2KS1 A;  3VMZ A;  3L72 J;  1GL2 A;  1VQK P;  1T6A A;  1NTK J;  3H25 A;  2GUS A;  1H8A A;  4H44 B;  2BCC D;  4Y99 C;  2D2C B;  2BEZ F;  1M1K Q;  2KP8 A;  1RY3 A;  2G8Y A;  4TT3 H;  2QJY B;  2NPS C;  4ASW A;  1SQB D;  2OYI A;  3EQ2 A;  2KUB A;  3CCL P;  1ZV8 A;  2R44 A;  1VQM P;  2ZT9 B;  1S9K D;  3H1I E;  1AA0 A;  4PV1 D;  2BCC E;  1A02 J;  4DZO A;  1CI6 A;  1NTZ G;  1NTK K;  4JYB A;  5KJ7 D;  1FBM A;  3CWB J;  4AQR D;  3CC2 P;  3QWO C;  3CXH I;  4KHX A;  3IAO A;  1LTI C;  4HYT B;  5KAF E;  4GDO A;  3V6I A;  1FU1 A;  2B87 B;  3IF4 A;  4U3F G;  5KLV D;  1FDM A;  2YKO A;  1VDF A;  1KV4 A;  1AFO A;  1X79 B;  3CX5 E;  1IFN A;  3M9Q A;  4RKU J;  3L73 E;  1FOS E;  4WBA A;  1OZH A;  1SQV G;  3RL0 B;  5B5E E;  2Z5I A;  1SVF A;  3WU2 H;  1H0T A;  3N7N A;  3CCV P;  1Q86 Q;  1GW4 A;  2AXT H;  3VTP C;  2O01 N;  1VQP P;  3L75 J;  3H1L J;  4NPD A;  2FYN B;  1KD1 Q;  5AW7 B;  4GKG A;  1QLE D;  2J59 M;  2H7H A;  2R3S A;  5AW2 B;  3L70 G;  3KXD A;  3S9O A;  1RF1 B;  3Q3D A;  2KOG A;  4WY4 C;  1NU1 J;  2WPV B;  1KZU B;  1KYO I;  2KZJ A;  1X9V A;  2IX7 C;  2WSS H;  4GIF A;  5GTH H;  3H1J E;  2W8Z A;  1BGY J;  1FJP A;  4OVN F;  2IBZ D;  1OW7 A;  1SQQ J;  3CCR P;  1FE6 A;  2H43 A;  1BCC E;  3MP7 B;  2NZ2 A;  2Z5H A;  1ZME C;  5APU A;  1PP9 G;  2CPB A;  2W6B A;  3L71 E;  1OVU A;  1NU1 K;  4LC1 A;  3HD7 B;  3P8M C;  5AVZ B;  2PGD A;  3L72 E;  3L70 D;  4GOD A;  4C7N B;  1NTK E;  1YQ4 C;  3CLQ A;  5APT A;  2NPS A;  3KQG A;  2E76 D;  3MZW B;  1N8R Q;  2E75 C;  1SQQ K;  5CJ0 A;  3FWL A;  3V4Q A;  3U59 A;  3KDP B;  4W7Y A;  4KJM A;  3MTU E;  1Z56 A;  1JMB A;  1PP9 D;  3KZI H;  1VQ6 P;  1VQL P;  3TGU D;  4EOT A;  3H1H G;  4DCK A;  4L76 A;  1USE A;  2MKV A;  5BVZ A;  3CWB E;  3RK3 C;  2YO2 A;  1N7L A;  4DOJ A;  1FZC C;  3CXH E;  5AVT B;  2KXP B;  3AE6 C;  1Y8A A;  3M9B A;  4NPE A;  2JWD A;  5B66 E;  2ZJS E;  1LP1 A;  4PV1 B;  1NWQ A;  3PP5 A;  3RBZ A;  1NAY A;  3HE4 A;  2PFX A;  1JCC A;  1EZV I;  1JTH A;  1OIP A;  3D70 A;  2FYU J;  4ZNC A;  2JR8 A;  5CCG C;  1RF0 A;  4N78 E;  4I1L A;  5APQ A;  1NTM G;  1AJY A;  1KB9 E;  2OQQ A;  3H32 A;  3BCC D;  4OWF A;  5GTI H;  3L75 E;  3H1L E;  1MUU A;  4WY4 A;  3WUT A;  1IFM A;  2V4H A;  1SQX G;  1LTB C;  4PD4 E;  3VMA A;  2FYU K;  3O8Z A;  1K8A Q;  1KIL C;  1NU1 E;  2M5A B;  3CC4 P;  3CD6 P;  2YKQ A;  3E7K A;  1G2C A;  3AEG C;  1Q2N A;  2WSC J;  1KMI Z;  1X8Y A;  3A3Y B;  4ZKP A;  2WSE J;  4JBZ A;  2O01 H;  1SQQ E;  3IR9 A;  2HOD A;  3TSI A;  1OW8 A;  1AQT A;  2KI7 B;  1ZLL A;  2AEM A;  2ZYD A;  2C0X A;  3C1L A;  4R4M A;  1H89 A;  2N9B A;  3RL0 C;  3G71 P;  2VRS A;  1N86 A;  5E79 H;  2I1J A;  1IK9 A;  2IFN A;  2POH A;  1UII A;  1P84 I;  2FXM A;  1N7S C;  2KB7 P;  1T8Z A;  5H2F H;  2N1T C;  1J1E C;  1UIX A;  1EDK A;  2P58 A;  1L0N G;  1HVV A;  2KSJ A;  1YBK A;  1K9M Q;  2QJK C;  3WUU A;  4IFM A;  1FZC A;  3I5C A;  1BE3 D;  2PAJ A;  2E76 B;  3TNU B;  3A0B H;  5AVU B;  2A06 E;  1VF5 C;  1URQ D;  1S2E A;  4H13 D;  2CPS A;  3O6Q A;  1NYH A;  1M1J B;  2IYO A;  2FFD B;  2R3C A;  1BE3 E;  2KNC A;  4ASV A;  1LWU C;  1S5L H;  3IN6 A;  2C9L Y;  5CCG A;  2YIU C;  4AUW A;  1M90 Q;  1L0L D;  1BDC A;  2H89 C;  3JCU H;  3R4Y A;  2Y0C A;  1G1J A;  2FYU E;  1T2K D;  4IL6 H;  1NHL A;  3CMA P;  1YIT P;  3A0H H;  5CCH C;  2M8R A;  3QH9 A;  3H1I J;  2BCC J;  2C9N Y;  5KTB A;  4UB6 E;  3RK2 D;  4Z1M H;  1MFT A;  3Q5S A;  3GMA A;  3SFE C;  3NTN A;  1SQB J;  1T3J A;  1S4X A;  2P10 A;  4LLH A;  3VMX A;  1VQO P;  2DW3 A;  3RL0 g;  1SQP D;  2OTJ P;  2B9B A;  3CX5 I;  2HPC A;  2Q9I A;  2IZ0 A;  1FZA A;  1NO4 A;  3L73 J;  2FXO A;  1SS1 A;  1M7L A;  1VL2 A;  2NRG A;  5KLV J;  1KYO H;  1SQB K;  2XDJ A;  5KAI E;  3V2Q A;  2H88 C;  5KJ7 C;  1KQG B;  2HOD B;  3LW5 J;  1U7J A;  1PGJ A;  1IFD A;  1N7S A;  1QEX A;  1NKN A;  2N1T A;  1K05 A;  1PPJ E;  5KLV K;  1RE3 C;  2G3A A;  2KK7 A;  5AVV B;  4B86 A;  2LXC B;  1KFM A;  5AW3 B;  1W2B O;  1LTJ A;  2QE7 H;  3UIA A;  3G4S P;  3HTK B;  4RES B;  1ZRT D;  1JCD A;  1PV3 A;  1S5L X;  2HFE D;  3AE7 C;  1K73 Q;  4CPG A;  2E74 C;  2GA1 A;  4PJ0 H;  1GL2 D;  5C39 A;  1N2D C;  2P67 A;  1LWU A;  2L91 A;  3B4S A;  3SWK A;  3B5N C;  3Q1M A;  1E5W A;  1EXJ A;  2JJL A;  3AEE C;  4I6M C;  3L74 G;  4WVZ A;  5KLI C;  2OYH A;  3N4X A;  1EDL A;  5CCH A;  3EWK A;  4OGQ D;  5AW1 B;  5BU8 B;  1URQ B;  1AVY A;  4D6T G;  1SFC C;  3VN0 A;  4H13 B;  4I7Z B;  2RN0 A;  1M8O B;  2V7Q H;  2WIT A;  2RH0 A;  2E5T A;  2CK3 H;  2HLO A;  3PTZ A;  4YTP C;  4WB4 A;  1J1D B;  2WZ7 A;  1ZR2 A;  2QM8 A;  1SQB E;  1Q82 Q;  4NPF X;  4R4L A;  3KYQ A;  1HH0 A;  2O1J A;  2P2U A;  3SWF A;  1S9K E;  2O1K A;  3TYY A;  1IFP A;  1QVF O;  1L4A C;  1PP9 J;  2OAR A;  3TGU J;  2PRR A;  3RK2 B;  3GHG B;  1QL1 A;  2QM7 A;  4D6T D;  1OVR A;  1BSH A;  3H1K G;  3HUS B;  1Q81 Q;  4YPC A;  4EYY Q;  4H0L D;  1RE4 C;  2M3B A;  5KLV E;  3H1J G;  1VQ4 P;  4BXL A;  1NTZ D;  1N73 B;  1YJN P;  1KB9 I;  3CCM P;  1BCC G;  4HJG H;  1LTS C;  2WMM A;  3L71 G;  1RE3 A;  3ABV C;  3A7O A;  2W90 A;  2QJP C;  4U3F D;  3L72 G;  4PD4 I;  5APV A;  2WSF H;  2YMY A;  1A02 F;  5KKZ B;  2LXB A;  3BCC J;  1RH5 B;  3H1K D;  3CCS P;  2XND H;  1SQV D;  1IFJ A;  1TU3 F;  3RBX A;  3VMY A;  3T97 A;  1KOR A;  3B5N A;  5AW8 B;  3H6P A;  1P84 H;  3LIE A;  2OGU A;  1U7M A;  2IYP A;  4JF7 A;  1JB0 J;  2QVA A;  2NPS D;  3CI9 A;  3CWB G;  1OFC X;  5TIS E;  1RQU A;  3HE5 A;  2IBZ E;  2KS1 B;  1SFC A;  5APW A;  3GLM A;  4IFF A;  4BRY A;  5E79 E;  1GL2 B;  3MUD C;  3L70 E;  4MN4 C;  3JC2 2;  4JQ0 D;  3E1I A;  1W5C E;  3LID A;  3OW2 O;  1AVO A;  3OA7 A;  2WT7 A;  2XKM A;  2OYI B;  2R32 A;  1L4A A;  4OGQ B;  1JY3 N;  2WPS A;  4HH2 A;  3A0B E;  3F5H A;  3G6E P;  3NXS A;  4XFJ A;  1ZOY C;  1AQ5 A;  1CI6 B;  3L75 G;  2Q7C A;  5CBN A;  1KC8 Q;  2I8D A;  1BE3 J;  1PP9 E;  3VOP A;  1HBW A;  3TGU E;  1LT9 C;  2K9J A;  2K3R A;  1RE4 A;  5KAF H;  2QEX P;  5AVY B;  4K35 A;  3MD0 A;  3V5B A;  2N9Y B;  2C0W A;  1JY2 P;  1GDT A;  1GTW A;  3IFM A;  1BGY G;  4WY4 D;  3CX5 H;  3H1H D;  2Q1K A;  4N6J A;  3A0H E;  4H44 C;  1SQQ G;  2D2C C;  1L0L J;  2JP3 A;  1Y9B A;  5B5E H;  3AE1 C;  1MV8 A;  1URQ C;  1DX7 A;  2QJY C;  1H0T B;  3P8C D;  1NGM B;  2ZT9 C;  4H0L B;  5EFW B;  1IO4 A;  1DEE G;  1E79 H;  1KYO D;  3BCC E;  1EXI A;  2W83 C;  3D6Z A;  1L0L K;  1YJ9 P;  1HGZ A;  3AEC C;  1PGO A;  1BGY D;  4XA4 A;  1T2K C;  3PRJ A;  1NTM D;  2O3J A;  1SQP J;  1DEB A;  3RK2 C;  3VP9 A;  1IK7 A;  2A06 G;  1IJD B;  1GW3 A;  1SQX D;  1LT1 A;  1QX8 A;  3S1K A;  3MUD A;  1VQ5 P;  1KQS O;  1R8E A;  4Y99 B;  3D6Y A;  4EDF A;  1SQP K;  3FWN A;  2M3E A;  1SQX E;  2FYN C;  2NPS B;  3VYI A;  1BSN A;  1GMJ A;  3B71 A;  4BRY B;  1EZV G;  3A2A A;  2FYU G;  1RF1 C;  5CMZ A;  3AE5 C;  4K3A A;  1ZP0 C;  1FDI A;  5APY A;  3AEA C;  3FX0 A;  2OYO A;  4PJ0 E;  2QA4 P;  1LT9 A;  5APS A;  3GG2 A;  5CCG D;  2WT7 B;  2Q6Q A;  2YMK A;  2AXC A;  5CBO A;  3BRT B;  2JDI H;  2KLU A;  1JEK A;  3CXH H;  3PHL A;  1HJB A;  1EC5 A;  1FAV A;  3PJS K;  3HD7 C;  1L0N D;  2HYN A;  1LP1 B;  5B66 H;  1EZV D;  5CHX A;  3HE4 B;  2SPZ A;  1FZF A;  1S3J A;  2M0B A;  1JTH B;  4JPZ B;  5CJ4 A;  1L0L E;  1KQL A;  1KIL A;  5AW9 B;  3BVH A;  2H8P D;  2KZI A;  4N3Y B;  2XU6 A;  2KLV A;  3H32 B;  2ZYA A;  1KB9 H;  3F89 A;  2YXQ B;  1VQ9 P;  2XV5 A;  4ZMD A;  3D71 A;  1YQ3 C;  2B88 A;  4WY4 B;  3A5T A;  3FXE A;  1ZW0 A;  1GK6 A;  2B87 A;  2R5D A;  1PPJ G;  3U1A A;  3TK1 A;  1PFI A;  1JMM A;  3SSU A;  3AE8 C;  3P7K A;  5DJU B;  2W27 A;  2ZFC A;  3CCJ P;  1JUN A;  3M91 A;  1SQP E;  4PV1 C;  1G2C B;  3WU2 E;  2Y9Z A;  2GM4 A;  2OTL P;  4D6T J;  2HG5 D;  1N7S D;  2N1T D;  2AXT E;  1DD3 A;  1NOH A;  4LGD E;  1HWT C;  3FGA D;  1OXZ A;  4UB8 H;  4ZKU A;  2E42 A;  1NTZ J;  2E75 B;  3M0D C;  1YTZ I;  1VF5 D;  2LKM A;  1RF1 A;  1P84 D;  2Y9Y A;  1LNQ A;  1JY2 N;  1CZQ A;  2OTK E;  2AEF A;  4U3F J;  1IZN B;  1PZQ A;  5K5G B;  2JKV A;  5GTH E;  2RMZ A;  3H1I G;  1NTZ K;  2BCC G;  2O01 J;  2QIW A;  3EFF K;  3RK3 B;  3W68 A;  1MFZ A;  1WRG A;  1KFN A;  1SQV J;  1FZB A;  4IOI H;  2ZYG A;  4XE5 B;  3C8V A;  1FZC B;  1Y47 A;  1ZRT E;  1K04 A;  4IL6 X;  5CCH D;  1VQ8 P;  2KIK A;  1SQB G;  2IBZ I;  3HD7 A;  2LR2 A;  1FOS F;  1JY3 O;  5BU5 A;  4C7N A;  1S72 P;  3O6Q B;  2XNX A;  5AVW B;  4KT0 J;  3SFD C;  2PP6 A;  2KNC B;  3V2R A;  3L70 J;  2BAS A;  1SQV K;  1GU5 A;  3L73 G;  3CCU P;  1T3U A;  3H1I D;  1FJK A;  3K5B A;  5KLV G;  1AV1 A;  2I1K A;  2A45 I;  1MZ9 A;  1NVO A;  1L2P A;  2WPR A;  1FS0 E;  5L8R J;  2UWJ E;  3KZI E;  2K1A A;  4RO0 A;  3L74 D;  2W6J H;  4UB6 H;  1R5S A;  2K88 A;  3CPW O;  2WVR A;  1KIL B;  4GOE A;  2E76 C;  4DJG A;  1YJW P;  1CW5 A;  3CX5 D;  2QSI A;  2FYZ A;  1BDD A;  3L73 D;  3ITK A;  4C46 A;  1DD4 A;  3L74 E;  5KJ7 A;  1SP4 A;  1MKM A;  1M1J C;  1OVV A;  1Q7Y Q;  4L73 A;  2FFD C;  3BAS A;  2HPC B;  1H88 A;  3AED C;  4JYC A;  3AE4 C;  1IFI A;  1PL5 A;  1DH3 A;  2QRX A;  5AW6 B;  1M56 D;  2AEJ A;  2WSC H;  4D6T E;  3KHU A;  4QMA A;  2WSE H;  3M0A A;  4YXW H;  3GF7 A;  3M0D A;  1JNM A;  5AVS B;  1NKZ B;  1KQF B;  5GTI E;  1FZG A;  5KAI H;  1WMK A;  2HR3 A;  1NTZ E;  3H1H J;  2E74 D;  2IBZ G;  1NTK G;  3II6 A;  3M9H A;  1FDO A;  2JWA A;  2YXR B;  1N7S B;  1RF0 C;  2N1T B;  1J1E B;  3B5N D;  3VP8 A;  2WTY A;  3Q5R A;  4BWN A;  2M5A A;  4U3F E;  3H1J D;  1M57 D;  3PH0 A;  2QJK B;  1LTJ B;  4Y28 J;  1BCC D;  1QL2 A;  1PGP A;  3H1K E;  1VF5 B;  1HUC A;  1XTG B;  3L71 D;  2A45 G;  3NFQ A;  5AVX B;  1SQV E;  2ITA A;  1SFC D;  1LGH B;  3SWY A;  3L72 D;  3GW6 A;  2Z4E A;  2KYV A;  1G1I A;  1NTM J;  1NTK D;  1LWU B;  1WT6 A;  2YIU B;  3TGU G;  4M3L A;  1RQV A;  1JO5 A;  2WPQ A;  1SQX J;  3AEF C;  1YIJ P;  2YO3 A;  2OYH B;  5H2F E;  3L36 A;  1L4A D;  4DT0 A;  2K9Y A;  3MIW A;  1NTM K;  3Q5P A;  3C9I A;  2ZVN B;  3CWB D;  2WQY C;  3AE2 C;  3TNU A;  3CC7 P;  1QGK B;  3CCE P;  4A7P A;  3CXH D;  3EFG A;  3H1L G;  1LTT C;  1SQX K;  3P32 A;  2E5Y A;  3NMD A; 
#chains in the Genus database with same CATH homology
 1IFN A;  1M1J A;  3M9Q A;  2FFD A;  1RF1 C;  3R2P A;  1IFD A;  1N7S A;  3V2P A;  5CMZ A;  2XZR A;  1NKN A;  2N1T A;  4WBA A;  1FOS E;  2J58 A;  5APY A;  3BAT A;  3RL0 B;  2Z5I A;  1SVF A;  5KLV K;  1W2E A;  1RE3 C;  3KPE A;  1NH4 A;  3U1C A;  4OH8 B;  5AVV B;  1LT9 A;  3N7N A;  5APS A;  4B86 A;  1GW4 A;  4N78 D;  1KFM A;  3L37 A;  5AW3 B;  5CCG D;  1LTJ A;  2WT7 B;  3UIA A;  3VTP C;  3HTK B;  1CSB A;  3BRT B;  4RES B;  5AVQ B;  1JCD A;  5AW7 B;  4GKG A;  2HFE D;  2J59 M;  2H7H A;  5AW2 B;  1HJB A;  1FAV A;  3HD7 C;  1RF1 B;  1GL2 D;  1HTL C;  2HYN A;  1N2D C;  2P67 A;  2KOG A;  4WY4 C;  4IFD K;  1KZU B;  1LWU A;  1SLQ A;  1X9V A;  1EQ7 A;  3M06 A;  2IX7 C;  4GIF A;  3B5N C;  1XTC C;  5CHX A;  3HE4 B;  1E5W A;  2JJL A;  3LW5 H;  4I6M C;  1NAF A;  1FZF A;  1ZR4 A;  4O9B A;  1JTH B;  3WMM 0;  5CJ4 A;  2MJZ A;  1FJP A;  5AVR B;  1J1D C;  1KQL A;  3OJA B;  2OYH A;  3N4X A;  3P8C E;  1KIL A;  1L0N K;  5CCH A;  5AW9 B;  3BVH A;  2H8P D;  2H43 A;  4N3Y B;  2Z5H A;  3V4W A;  5APU A;  5AW1 B;  2XU6 A;  5BU8 B;  4I2L C;  1URQ B;  2CPB A;  2KLV A;  2W6B A;  3H32 B;  1SFC C;  2XV5 A;  1JY2 O;  1NU1 K;  3VN0 A;  4LC1 A;  3HD7 B;  3P8M C;  5AVZ B;  3GHG C;  2WIT A;  4WY4 B;  3A5T A;  1GK6 A;  2R5D A;  4C7N B;  3U1A A;  3B5N B;  1IC2 A;  3TK1 A;  3CLQ A;  5APT A;  1PFI A;  3HUS C;  1JMM A;  2NPS A;  3KQG A;  3P7K A;  2HLO A;  1SQQ K;  2W27 A;  2ZFC A;  5CJ0 A;  4WB4 A;  1J1D B;  1N73 C;  2WZ7 A;  1ZR2 A;  2QM8 A;  1JUN A;  3V4Q A;  3U59 A;  3M91 A;  4GT1 A;  3KYQ A;  3KDP B;  1HH0 A;  2O1J A;  1G2C B;  2P2U A;  3RK3 D;  3SWF A;  1S9K E;  2O1K A;  3HE5 B;  3TYY A;  3V2N A;  1L4A C;  2GM4 A;  2HG5 D;  1N7S D;  2OAR A;  3CL3 D;  1SFC B;  2N1T D;  4W7Y A;  3RK2 B;  3GHG B;  3MTU E;  1Z56 A;  1QL1 A;  1NOH A;  2QM7 A;  4LGD E;  1HWT C;  1GD2 E;  1J2J B;  5AW0 B;  4EOT A;  1OXZ A;  4ZKU A;  2E42 A;  3HTK A;  5BVZ A;  3RK3 C;  2YO2 A;  3HUS B;  1JOC A;  1N7L A;  4DOJ A;  1FZC C;  1RE4 C;  2M3B A;  5AVT B;  3M0D C;  2FKW B;  3M9B A;  1YTZ I;  1N73 B;  2LKM A;  1RF1 A;  1JY2 N;  1NWQ A;  3PP5 A;  1CZQ A;  1GZL A;  1YYC A;  2A45 H;  1L4A B;  1LTS C;  4C7R A;  1LTJ C;  2E43 A;  1RE3 A;  3HE4 A;  3A7O A;  3OAK A;  4W7Z A;  1JCC A;  1JTH A;  2YNY A;  2P1J A;  5APV A;  1NTZ K;  2WSF H;  1VPC A;  5CCG C;  2YMY A;  3RK3 B;  1RF0 A;  4N78 E;  1MFZ A;  1WRG A;  1A02 F;  1KFN A;  4I1L A;  1FZB A;  5APQ A;  4XE5 B;  1FZC B;  4EIJ A;  1URQ A;  3H32 A;  1KIL D;  5CCH D;  3HD7 A;  1IFJ A;  1FOS F;  1MUU A;  4WY4 A;  1JY3 O;  5BU5 A;  1GL2 C;  3VMY A;  1IFM A;  3T97 A;  4C7N A;  2XNX A;  3B5N A;  5AW8 B;  1GK4 A;  3H6P A;  5AVW B;  1LTB C;  3LIE A;  2OYH C;  2FYU K;  3O8Z A;  1KIL C;  2PP6 A;  3V2R A;  4JF7 A;  3L4F A;  2BAS A;  1SQV K;  2NPS D;  3CI9 A;  1GU5 A;  2YKQ A;  1T3U A;  1FJK A;  1G2C A;  3HE5 A;  2OYI C;  2L5G B;  2I1K A;  2A45 I;  1MZ9 A;  2R5B A;  1X8Y A;  2WPR A;  2JEE A;  3A3Y B;  4ZKP A;  1SFC A;  1OWA A;  5APW A;  2ZXE B;  3GHG A;  4IFF A;  3RL0 D;  2O01 H;  3IR9 A;  2HOD A;  3TSI A;  1FZE A;  1GL2 B;  4W80 A;  5AW4 B;  1ZLL A;  3BRV B;  3HUS A;  2C0X A;  1KIL B;  1H89 A;  2N9B A;  3E1I A;  3RL0 C;  1GU4 A;  1N73 A;  3MGN A;  1CW5 A;  2VRS A;  1N86 A;  3LID A;  2P7J A;  3OA7 A;  2FYZ A;  2WT7 A;  2I1J A;  2XKM A;  2Q5U A;  2OYI B;  2R32 A;  1L4A A;  1JY3 N;  4AYC A;  2WPS A;  4C46 A;  4HH2 A;  3B8E B;  5KJ7 A;  1SP4 A;  3NXS A;  1IK9 A;  2IFN A;  2POH A;  5APX A;  1M1J C;  1AQ5 A;  2FFD C;  2FXM A;  3BAS A;  2Q3I A;  1CI6 B;  2HPC B;  1N7S C;  2KB7 P;  2Q7C A;  1T8Z A;  1H88 A;  2N1T C;  4JYC A;  1J1E C;  1HGV A;  1IFI A;  3HRN A;  1HVV A;  1DH3 A;  2KSJ A;  1ZN5 A;  5AW6 B;  2WSC H;  1JY3 P;  3VOP A;  1HBW A;  1LT9 C;  2WSE H;  3M0A A;  4IFM A;  1FZC A;  1RE4 A;  3I5C A;  2PAJ A;  3M0D A;  1JNM A;  5AVS B;  3TNU B;  1NKZ B;  2YKP A;  5AVY B;  1FZG A;  5AVU B;  3MD0 A;  3V5B A;  2C0W A;  1JY2 P;  1URQ D;  1GDT A;  1GTW A;  3IFM A;  3HD7 D;  2CPS A;  3II6 A;  1M1J B;  3M9H A;  4WY4 D;  4N6J A;  1LTG C;  2FFD B;  3G3Z A;  1YTZ T;  1N7S B;  2R3C A;  1RF0 C;  2N1T B;  1J1E B;  3B5N D;  1LWU C;  3VP8 A;  2WTY A;  3L35 A;  2C9L Y;  2WWW A;  5CCG A;  1LTA C;  2W6A A;  1MV8 A;  1URQ C;  2GUV A;  4AUW A;  1DX7 A;  5AW5 B;  2IFM A;  1LT9 B;  2IPP A;  3P8C D;  1LTJ B;  1G1J A;  1QL2 A;  3VMZ A;  1T2K D;  1IO4 A;  1NHL A;  1HUC A;  1XTG B;  2M8R A;  2A45 G;  5CCH C;  3NFQ A;  5AVX B;  1GL2 A;  1SFC D;  2C9N Y;  5KTB A;  3RK2 D;  1LGH B;  2GUS A;  3SWY A;  1H8A A;  2Z4E A;  2KYV A;  1G1I A;  1L0L K;  1HGZ A;  4Y99 C;  4XA4 A;  1T2K C;  1LWU B;  2KP8 A;  3NTN A;  1T3J A;  1WT6 A;  1RY3 A;  4M3L A;  2NPS C;  4LLH A;  1DEB A;  3RK2 C;  3VMX A;  1JO5 A;  2OYI A;  3EQ2 A;  3VP9 A;  2WPQ A;  1ZV8 A;  2YO3 A;  1S9K D;  2OYH B;  1A02 J;  4DZO A;  1CI6 A;  2HPC A;  3L36 A;  1IJD B;  2Q9I A;  1L4A D;  1GW3 A;  1NTK K;  1FZA A;  1NO4 A;  4JYB A;  5KJ7 D;  3MIW A;  1FBM A;  4AQR D;  1NTM K;  1M7L A;  3MUD A;  4KHX A;  4Y99 B;  1LTI C;  3C9I A;  4HYT B;  1SQB K;  1FU1 A;  2XDJ A;  3TNU A;  1SQP K;  3V2Q A;  5KJ7 C;  3EFG A;  1FDM A;  2YKO A;  2NPS B;  3VYI A;  1LTT C;  1SQX K;  1VDF A;  3P32 A;  1AFO A;  1X79 B;  3NMD A;  2HOD B;  3A2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...