4IFMA

Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 angstroms resolution x-ray fibre diffraction data
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PF1 FILAMENTOUS BACTERIOPHAGE
publication title Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre diffraction data.
pubmed doi rcsb
total genus 17
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1995-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4ifmA00
2KLVA 3IFMA 1IFNA 1QL2A 4IFMA 1QL1A 2IFNA 1ZN5A 2KSJA 1PFIA 2IFMA 2XKMA 1IFMA
chains in the Genus database with same CATH superfamily
1FU1A 3HD7A 3B4SA 3MP7B 1R5LA 1L0NK 2M3EA 1JY2N 2YIUB 5APSA 1LP1A 1SLQA 2E76D 1Q82Q 4YXWH 1SFCC 3L35A 4A7PA 2OYIB 3H1IG 2XNXA 2KYVA 1EZVE 1SQXK 3IN6A 2O3JA 3PRJA 4WY4C 3CWBE 3JSVC 3VOPA 1EXIA 3S4RA 3SWFA 2KK7A 1WT6A 1KQLA 1QLED 5KLVD 1NTMG 1OW8A 4H44B 3SSUA 1IFPA 2POHA 3GLMA 2E74C 3H1HE 2QJPC 1FDMA 2L5GB 2ZFCA 2ZT9B 4I1LA 4HH2A 3LW5H 5GTIE 3CPWO 2R3SA 2KSEA 1X79B 2E5YA 1ZP0C 1S5LX 4NPDA 1IFJA 1KFMA 5BVZA 3OA7A 1AVOA 3QH9A 3VYIA 2W6AA 1NKNA 1KYOI 3FWNA 1VQ7P 3U1AA 3RK2D 1KB9D 2V7QJ 4L75A 3D6YA 4PV1C 1E5WA 2JP3A 2KI7B 5APVA 2KOGA 2OTJP 1OXZA 3L37A 1DD4A 2Z5IA 2AXTE 2O1KA 1SFCD 1BDDA 1LNQA 1YYCA 3PH0A 3B71A 1KB9H 3Q5SA 2Q7CA 3CCUP 2M3BA 4UB6H 1OVVA 3TF5A 3A0HH 1HVVA 5CCHD 3RK2B 1SQVJ 1GU4A 3KYQA 2WSFH 2H88C 1YTZI 3H1LE 3V4WA 5KKZB 1GU5A 4DT0A 1DIPA 2E74D 2HPCA 3A3YB 3S1KA 2HODB 1VQ4P 5AVXB 4CPGA 3CI9A 4NPFX 2O01H 1PL5A 1S9KE 1KD1Q 2KUBA 5KAIH 1DEBA 2IPPA 3M91A 3CWBD 3L4FA 1VQ9P 2KZJA 3WUUA 4W7ZA 1KILA 4GODA 2AEFA 1MZ9A 3WUTA 3MIWA 2Q9IA 1GW3A 3L74E 3CCQP 2VRSA 4BWNA 3CCLP 1KILE 1EDKA 3H25A 1SQBJ 2ZXEB 1NU1G 2KSJA 3CCEP 1KYOD 1CSBA 2RH0A 3FXEA 1SQQE 3VP9A 3U1CA 2BCCG 1UIXA 4B86A 3CXHH 4NPEA 1USDA 1LTAC 2HR3A 3H1JE 1P84E 3CWBG 1RQUA 2O1JA 3JCUE 2XZRA 1URQB 2ZYAA 2K9JB 1N73C 3I55P 2HYNA 2RKLA 1L2PA 2M5AA 1KILC 1JTHB 1ZR4A 3V5BA 4XE5B 5AW5B 1M1JA 4Y28J 3TYYA 4DJGA 1NTZD 3A7OA 3AEGC 3T97A 1SQQK 2KS1B 3GG2A 1FDOA 5H2FE 1H0TB 1Y9BA 2GUSA 1EXJA 1JM0A 3SWKA 2R5DA 5APYA 3H1IJ 1J1DC 2K88A 1S5LH 3PTZA 1HGZA 2XDJA 1NTMJ 1H8AA 2IBZI 4RKUJ 3CMEP 1RY3A 1NTZG 1PIXA 1K8AQ 1VQ6P 1LWUC 1E79H 3CD6P 1M1JC 2OYOA 2L91A 2OYHA 1U57A 3P8MC 5KJ7C 1KQGB 3SFDC 4U3FD 3GHGA 2ZAEB 2V7QH 3IFMA 1KILD 1CW5A 1N7LA 4BRYB 4N78E 3L71D 1Q90D 1K9MQ 1GK6A 4HYTB 4M3LA 3HTKB 2Q1KA 3A0BE 3H6PA 2WITA 2FFDB 1USEA 1JMBA 1LT9C 3H1JD 1NTKE 5KLVJ 2XV5A 1L4AC 1GD2E 2B88A 1VQ8P 2C9NY 4OVNF 4R4MA 1JY3P 1N73B 2WPVB 2B9BA 3RBZA 1JY2O 1PPJD 2OYHC 2CK3H 4U3FG 5AVZB 5CHXA 3MGNA 5APUA 2QIWA 3GHGC 4GKGA 1LTBC 2WTYA 3L71G 1BE3E 2CPBA 3G71P 1KQFB 1OWAA 1AJYA 1L0NJ 2H7HA 2IYOA 1RF1A 1NTKK 2KNCB 3MHVA 1ZW0A 2NPSB 5KJ7D 1LTIC 2IBZD 2OQQA 1HBWA 3BCCE 3AEDC 4Y99B 2GUVA 3BASA 4D6TE 3L70J 5TISH 1PPJG 1Q81Q 3RL0g 2QJYC 2ZXXA 1SQPE 2WWWA 2ZYGA 3O6QB 2I8DA 4BXLA 2YKPA 2WPQA 1W5CE 2XKMA 2YXQB 3GW6A 2BASA 1L4AD 3CLQA 2E75C 2IYPA 1LTSC 2P58A 2P7JA 5AVQB 3VN0A 3I56P 1RE4A 4EI2A 3CCSP 1RF1C 4H0LB 1LTGC 1VQLP 1CZQA 1YQ4C 2IBZG 2WT7B 1VQKP 1NAYA 1H89A 3RK3B 1PGQA 1SQPK 3D70A 1CI6A 3CWBJ 3ZDMA 2FYNB 1BCCE 1RE3A 3H1KE 1J1EB 2Y9ZA 3P7KA 1R8EA 4R4LA 2W90A 5B66H 3HUSA 2OTKE 3L72D 1L0LK 3CC7P 4PD4E 1ZR2A 3LIEA 2BEZF 2BEQD 2PRRA 1G2CA 1IFNA 2PGDA 3CMAP 3CCRP 2N1TA 3B5NA 5C39A 3Q1MA 2FBWC 3WMM0 3A0HE 1RE4C 1PGPA 3HRNA 5B5EE 1BE3D 4I7ZC 1IK9A 2P10A 4IL6E 4ZNCA 3OW2O 4H13C 4ASVA 3AEFC 5DJUB 1FZBA 1RE3C 4AQRD 3M0DA 2K1AA 2E75D 2JJLA 3L72G 5KAIE 2LXBA 3NFQA 4EIJA 4ZKUA 3HUSC 3AEAC 4D6TD 4JYCA 1HH0A 3CX5E 2FYZA 4PJ0E 5AW6B 1NTZJ 5CBNA 3WU2H 3MTUE 3VTPC 4L74A 4RO0A 5CMZA 2W8ZA 1EZVI 1JB0J 4U7JA 3TGUE 2N1TC 5M1BA 1PP9D 3B5NC 3HD7C 1R5SA 3IR9A 2RMZA 1OVUA 2E76B 1NTMD 1NWQA 1L0LD 3CX5I 3NXSA 1Q86Q 3TDKA 3M9HA 1UIIA 3Q3DA 3KZIE 1GL2A 2QJKB 1BDCA 4RESB 3CXHE 1L0ND 1MUUA 3M0DC 3FX0A 1FOSF 4D6TG 2B87A 2WPRA 2JR8A 5KLVG 5GTHH 1IO4A 4WWIA 3LIDA 1FZGA 1PP9G 3CCVP 3E1IA 3L70D 1Z56A 4K3AA 1L0LG 4UB8E 1SQXD 4U3FJ 5EFWB 1NO4A 3H32B 2QE7H 4XA4A 5L8RJ 3VP8A 1LTJA 2KIKA 4JQ0D 4WY4D 4Z1MH 3L71J 2I1KA 4AUWA 1SQQJ 1FAVA 5DJTB 1GL2C 1L0NG 2OGUA 1ZN5A 2WSEJ 1KN7A 3HE5B 3CCMP 3H1JJ 1VF5C 1HGVA 1Y8AA 3HD7D 1QVGO 1SFCB 2NZ2A 5AW8B 2P1JA 1EZVD 2LXCB 1JO5A 3ABVC 4WY4B 3L70G 2JWDA 3V6IA 4OH8B 3Q5RA 1SQXG 4YXDC 3E7KA 1G1JA 1SVFA 3CX5D 3A5TA 2WQYC 1ZMEC 4C7NB 3TGUD 2YO3A 2Y0DA 3HD7B 2E74B 1LTJC 2QJPB 1N7SA 3H1HD 3TNUA 1QGKB 1NHLA 4W80A 1AV1A 1YTZT 4PV1D 1N8RQ 2HG5D 2QVAA 1LP1B 5APXA 3II6A 1A02J 1M90Q 2KB7P 3VMZA 2E5TA 4C7RA 3OAKA 1GZLA 2C0XA 1EZVG 5GTIH 3IAOA 3I5CA 1FJPA 2MJZA 3S9OA 1KYOH 2UWJE 4JBZA 1T8ZA 1M57D 3F5HA 1SQVE 2FXOA 4PV1B 1BGYE 3TGUG 1M1KQ 1VF5D 2AEMA 1P84I 3H1HG 1FZCA 1N7SC 2XNDH 2Z5HA 3RGUA 5AVWB 3L73E 2Q3IA 2IFNA 3ITKA 1Q2NA 1N86A 5KLIC 3V2QA 3L36A 2PFXA 3AE4C 3H1LD 1VF5B 2FKWB 5AVVB 2QM7A 1VPCA 3BRTB 3L72J 2WSSH 2V4HA 3L75E 2W6BA 1NYHA 5TISE 1JEKA 1S9KD 2YXRB 1S1CX 2R44A 1SQBE 2WPSA 1OFCX 4YTPC 1ZRTE 4EYYQ 2YKQA 2D2CC 1QEXA 2M0BA 2B89A 2O01N 3VMXA 3M0AA 1BE3J 2A45I 3L74D 1T2KC 3EQ2A 3V2RA 3KDPB 3AE5C 5CCGA 2A06E 3H1LG 2H43A 1MKMA 5CBOA 3O8ZA 3PP5A 2J58A 1DD3A 1VQ5P 1YJ9P 3MUDA 1SQQD 2HPCB 2AXCA 2I1JA 2ZJSE 1N7SD 1SQBK 2R32A 4D6TJ 1ZV8A 1Y47A 1SQPJ 2KXPB 4GOFA 1P84D 1S4XA 1JY3N 4GIFA 1X22A 3F89A 1PP9J 1KV4A 2GM4A 1KILB 2WSEH 1BGYD 3AECC 3L74G 1L0LJ 1PFIA 2OYIA 3RL0C 3JCUH 2LKMA 1RHZB 3AEEC 3H1IE 5KAFH 2ZYDA 1JCDA 5CCGC 1GK4A 1HJBA 1MV8A 3BRVB 3P8CE 4JF7A 1EQ7A 3L73D 1SQQG 4JPZB 2QA4P 3NMDA 1NTME 4IFDK 3B8EB 1Q7YQ 3MUDC 3USSA 1MFZA 3G9RA 1A02F 1JNMA 3H1JG 5AW1B 3SWYA 4OGQC 2D2CD 2J59M 2DW3A 1YJNP 1GDTA 2FYUE 1DX7A 1J1DB 1KZUB 2WZ7A 5H2FH 2HLOA 3JC22 1FS0E 1BGYG 2N9BA 2Q5UA 3AE9C 1SQXJ 2M5AB 1ZOYC 1IZNB 3AEBC 1DH3A 4OWFA 2ZVNB 1K73Q 2OYIC 1XTGB 5APQA 2C0WA 4KJMA 1LWUB 1M1JB 1LJ2A 1H88A 2JWAA 4LGDE 5CJ0A 1NTMK 3L73G 3T97B 3GF7A 1RH5B 2RN0A 2JKVA 1YBKA 4DZOA 4H44C 2FYUK 3A2AA 1DEEG 3R4YA 2OTLP 1VQOP 5AW2B 2IZ1A 3PJSK 2K3RA 4N78D 2ZT9C 1KC8Q 3IF4A 3RL0D 4IFFA 4IL6X 1QVFO 1YI2P 2NRGA 5AVSB 5CJ4A 1FZFA 1LT9B 1IJDB 1T3JA 3W67A 1NTKD 1AA0A 2YMYA 1L4AB 1WRGA 1M56D 1IC2A 3TGUJ 3V4QA 2HODA 2R5BA 4OGQD 2WVRA 3H1HJ 1FBMA 1SFCA 2OYHB 1S3JA 1FOSE 1KB9E 3RL0B 3KQGA 4UB6E 3GHGB 3CCJP 5CCHA 1HJ0A 1PGJA 2Z4EA 4PD4I 3P8CD 4GDOA 2IDBA 5E79H 3PHLA 2C9LY 5AVRB 4OGQB 1NTKG 2J5UA 2YO2A 4HKZH 1ZXGA 3RK2C 4GOEA 2FYUD 1YJWP 2QEXP 2MKVA 1JY2P 2ZVOB 3AE3C 3C1LA 5KKZC 4H44D 3BCCD 3OJAB 1NOHA 3BATA 4DCKA 1NU1E 2QJYB 1SQPD 2ZT9D 1X8YA 2BCCE 3EFFK 2IX7C 2QG4A 4GT1A 2H8PD 4AYCA 3NTNA 4WBAA 1URQA 3R2PA 4KT0J 1T3UA 1BE3G 2K9JA 5CCHC 1OW7A 2E75B 3H1LJ 1JTHA 4YPCA 5AVUB 2K37A 2QM8A 1NVOA 1RF1B 2YMKA 5AW3B 3M9BA 4QMAA 3C9IA 2FYUG 4N3YB 3N4XA 4EDFA 4ZKPA 3D71A 3D6ZA 3KHUA 1EDLA 1NU1K 1VQMP 3BCCG 1LTTC 2N9YB 5AVYB 2KS1A 1NGMB 1KYOE 1SQPG 2CPSA 2W6JH 1BCCD 3BVHA 1H0TA 3H1KD 1LGHB 3CXHI 1N2DC 3TK1A 1BSNA 1NAFA 1OVRA 1YQ3C 3AE7C 4LC1A 4H13D 3L74J 3GMAA 1URQC 2AEJA 4PD4D 2WSCJ 4WVZA 3VMAA 3HE4B 4I2LC 4L73A 1VQNP 5TJHA 1YITP 2ITAA 2Q3EA 2PP6A 2E42A 4PD4H 2Y0EA 3EFGA 4I7ZB 1NTZE 3AE1C 1YHQP 1FDIA 3MZWB 2N1TD 4W7YA 3B5ND 1BCCG 4H13B 5AW0B 3H1KG 1CI6B 4TT3H 3AE2C 2KZIA 1S5LE 5B5EH 1BGYJ 4BRYA 3HUSB 1X0TA 4IL6H 1RQVA 4KHXA 1RF0A 1NU1D 3GF3A 1S2EA 1OW6A 3HTKA 1JUNA 1GMJA 3Q5PA 1HUCA 2BCCD 2FFDA 4IFMA 1G2CB 1K05A 2GA1A 2N1TB 3L73J 3B5NB 2HFED 1KMIZ 1EC5A 3SFEC 1NTZK 2QRXA 2W83C 1N73A 1FE6A 5KTBA 3CC2P 3CX5H 4PJ0H 1VDFA 3VMYA 1M8OB 1JY3O 4DOJA 1XTCC 1NH4A 1NKZB 1URQD 3MD0A 4U3FE 3L75J 3CXHD 1HF9A 2JDIH 2LR2A 1K04A 2FY8A 2K9YA 3L71E 1RF0C 5BU5A 1W2EA 1YIJP 2KNCA 3KZIH 1GL2D 2NPSA 1W2BO 1FJKA 3G3ZA 4EOTA 2FFDC 2M8RA 1T6AA 1OMIA 3WUVA 2Y0CA 2Q6QA 2KLVA 5KAFE 2YNYA 3O6QA 1JMMA 1MFTA 1PPJE 1S72P 1IFIA 4LLHA 4UB8H 1GL2B 1LWUA 2AXTH 4L76A 1HTLC 3Q2YA 3FGAD 5KJ7A 1NTKJ 1SQVK 2B87B 1KQSO 1U7JA 5AW9B 3UIAA 3W68A 1BSHA 5BU8B 1PV3A 2NPSC 2WT7A 2KP8A 1FZCC 2IBZE 1VQPP 1EDJA 1JOCA 4Y99C 2FXPA 3KPEA 1LT9A 2R3CA 2G3AA 2IZ0A 3M06A 1L4AA 1LTJB 1PGOA 2WMMA 3RK3E 3KXDA 3C8VA 1KTMA 5AW4B 1D7MA 2IFMA 5APTA 2FYUJ 1JCCA 4MN4C 3G4SP 3BCCJ 2WSCH 1KFNA 3E1RA 4H0LC 3CL3D 3N7NA 1M7LA 5B66E 3RK3C 1SQVD 2G8YA 3TSIA 2FYNC 3M9QA 3V2NA 1OIPA 1SP4A 3LW5J 4HJGH 1P84H 1G1IA 1AVYA 1J1EC 1QL2A 1N7SB 1GW4A 3L72E 4TLFA 3TNUB 3AE8C 2NPSD 3FWLA 4O9BA 1X9VA 4K35A 1FZAA 4IOIH 1FZEA 5AW7B 3RBXA 2JO1A 5E79E 5AVTB 2OARA 1AFOA 5KLIB 3QWOC 4RJTA 2H89C 1BCCJ 3H1KJ 4N6JA 4WB4A 2YIUC 1OX3A 1T2KD 3EWKA 1IFDA 3PLNA 1SQVG 3L75D 1SS1A 2SPZA 3U59A 2FXMA 1QX8A 1SQBD 3WU2E 1FZCB 1TU3F 1ZRTD 2PAJA 4XFJA 1IK7A 2XU6A 2D2CB 4H0LD 1IFMA 2WSFJ 5KLVE 1AQ5A 2A45H 3V2PA 5K5GB 1HWTC 1ZLLA 3RK3D 1AQTA 2A06D 1PP9E 3P32A 1NJIQ 2P2UA 1LT1A 1VL2A 2E76C 1L0LE 3H32A 2O01J 3HE4A 2JEEA 3L75G 3AE6C 4C7NA 1J2JB 3FXDA 2P67A 5CCGD 1NU1J 1SQBG 5GTHE 4ASWA 2A45G 4I6MC 3K5BA 2QSIA 2QJKC 2BCCJ 2YKOA 3HE5A 2E43A 1L0NE 3G6EP 1EDIA 1QL1A 5APWA 5KLVK 4HB1A 2W27A 3A0BH 1WMKA 2KLUA 3CC4P 1KORA 4JYBA 2Y9YA 2A06G 4WY4A 3H1ID 1GTWA 1PZQA 3L70E 1FC2C 1OZHA 1SQXE 1U7MA 1KB9I 4C46A 4ZMDA
chains in the Genus database with same CATH topology
3GHGC 4GKGA 2E42A 1FU1A 1LTBC 2Q3IA 2IFNA 3HD7A 3EFGA 2WTYA 1N86A 2CPBA 1L0NK 1OWAA 3V2QA 2N1TD 3L36A 4W7YA 3B5ND 2H7HA 5AW0B 1JY2N 1RF1A 1CI6B 5APSA 1NTKK 2FKWB 5AVVB 2NPSB 2QM7A 1VPCA 3BRTB 5KJ7D 1SLQA 1LTIC 3HUSB 2W6BA 4KHXA 1RF0A 1S9KD 1SFCC 3L35A 1HBWA 4Y99B 2GUVA 3BASA 2OYIB 2XNXA 2WPSA 3HTKA 2KYVA 1JUNA 1SQXK 1HUCA 2FFDA 2WWWA 4WY4C 4IFMA 3VOPA 1G2CB 2YKQA 3SWFA 1WT6A 2N1TB 1KQLA 2YKPA 2WPQA 3B5NB 2HFED 1NTZK 3VMXA 3M0AA 1N73A 2A45I 5KTBA 2XKMA 1VDFA 1T2KC 2POHA 3EQ2A 2BASA 3V2RA 3VMYA 1L4AD 3KDPB 3CLQA 1FDMA 5CCGA 2L5GB 2H43A 2ZFCA 1JY3O 4I1LA 1LTSC 5AVQB 2P7JA 4HH2A 3VN0A 4DOJA 1XTCC 3O8ZA 1NH4A 1NKZB 3LW5H 1RE4A 2J58A 3PP5A 1URQD 3MD0A 1RF1C 1LTGC 3MUDA 2HPCB 1CZQA 1X79B 2I1JA 1N7SD 2WT7B 1SQBK 2R32A 1H89A 3RK3B 1ZV8A 1SQPK 1IFJA 1KFMA 5BVZA 1CI6A 1RF0C 3OA7A 5BU5A 1W2EA 1GL2D 1RE3A 1JY3N 3VYIA 2W6AA 2NPSA 1NKNA 4GIFA 1J1EB 3P7KA 1FJKA 3G3ZA 4EOTA 2FFDC 3U1AA 2M8RA 3HUSA 2GM4A 3RK2D 1KILB 2WSEH 1L0LK 1PFIA 2OYIA 1E5WA 3RL0C 2KLVA 5APVA 2KOGA 2YNYA 1ZR2A 2LKMA 3LIEA 1OXZA 3L37A 2Z5IA 1JMMA 1G2CA 1IFNA 2O1KA 1IFIA 1SFCD 2N1TA 1JCDA 5CCGC 1GK4A 1YYCA 3B5NA 1HJBA 1MV8A 3BRVB 3WMM0 3P8CE 4JF7A 2Q7CA 4LLHA 1EQ7A 1RE4C 1GL2B 1LWUA 1HTLC 3NMDA 2M3BA 4IFDK 3B8EB 3HRNA 5KJ7A 1HVVA 1MFZA 5CCHD 1A02F 3RK2B 1SQVK 5AW1B 1JNMA 1IK9A 3SWYA 1GU4A 3KYQA 2J59M 2WSFH 1GDTA 1YTZI 3V4WA 5AW9B 1DX7A 1GU5A 3UIAA 1FZBA 1RE3C 1J1DB 1KZUB 2HPCA 3A3YB 4AQRD 2WZ7A 5BU8B 2HLOA 3M0DA 2NPSC 2HODB 2JJLA 2WT7A 2N9BA 2Q5UA 3NFQA 5AVXB 4EIJA 2KP8A 4ZKUA 3HUSC 3CI9A 1FZCC 2O01H 1S9KE 4JYCA 1HH0A 1DH3A 1DEBA 1JOCA 4Y99C 2IPPA 3KPEA 2OYIC 1LT9A 2R3CA 2FYZA 3M91A 3M06A 1XTGB 5AW6B 3L4FA 2C0WA 5APQA 1LWUB 1L4AA 3MTUE 3VTPC 1M1JB 1H88A 1LTJB 4LGDE 5CJ0A 1NTMK 5CMZA 4W7ZA 1KILA 2N1TC 3B5NC 3HD7C 3IR9A 1MZ9A 5AW4B 3MIWA 1NWQA 2Q9IA 1GW3A 2IFMA 5APTA 4DZOA 2FYUK 3A2AA 3NXSA 2VRSA 5AW2B 1JCCA 3M9HA 4N78D 3RL0D 4IFFA 2WSCH 1GL2A 2ZXEB 1KFNA 2KSJA 4RESB 1CSBA 5AVSB 3U1CA 3VP9A 3CL3D 5CJ4A 1MUUA 3M0DC 1M7LA 3N7NA 1FZFA 1LT9B 1IJDB 4B86A 1FOSF 1T3JA 1LTAC 2YMYA 1L4AB 3RK3C 2WPRA 1WRGA 2O1JA 1IO4A 3LIDA 3TSIA 1IC2A 2XZRA 1URQB 3M9QA 3V2NA 1SP4A 3V4QA 2HODA 1G1IA 1FZGA 2R5BA 1J1EC 1QL2A 1N73C 1FBMA 1SFCA 1N7SB 3E1IA 2HYNA 2OYHB 1FOSE 1GW4A 1KILC 1Z56A 3RL0B 1JTHB 1ZR4A 3TNUB 3V5BA 3KQGA 2NPSD 4XE5B 4O9BA 1X9VA 1NO4A 3H32B 5AW5B 1FZAA 3GHGB 4XA4A 1FZEA 5CCHA 5AW7B 1M1JA 2Z4EA 3VP8A 1LTJA 5AVTB 3TYYA 4WY4D 3A7OA 2OARA 3P8CD 1AFOA 3T97A 1SQQK 2I1KA 4AUWA 2C9LY 1FAVA 1GL2C 4N6JA 1ZN5A 5AVRB 4WB4A 3HE5B 1HGVA 1T2KD 2YO2A 2GUSA 1IFDA 3HD7D 3RK2C 1JY2P 1SFCB 2R5DA 3U59A 5APYA 2FXMA 3OJAB 5AW8B 1NOHA 2P1JA 3BATA 1J1DC 1FZCB 1JO5A 4WY4B 1X8YA 4OH8B 2PAJA 2IX7C 1HGZA 1G1JA 1SVFA 2XU6A 2XDJA 4GT1A 2H8PD 4AYCA 1H8AA 3A5TA 3NTNA 1IFMA 4WBAA 1URQA 1AQ5A 1RY3A 3R2PA 4C7NB 2A45H 3V2PA 1T3UA 1HWTC 1LWUC 1ZLLA 2YO3A 3HD7B 5CCHC 1M1JC 3RK3D 1LTJC 1N7SA 2OYHA 3P32A 3P8MC 1JTHA 5KJ7C 5AVUB 3TNUA 2QM8A 1NHLA 2P2UA 1RF1B 4W80A 1YTZT 2HG5D 3H32A 5AW3B 3GHGA 3M9BA 3C9IA 3HE4A 5APXA 4N3YB 3II6A 2JEEA 3N4XA 3IFMA 4ZKPA 1KILD 1J2JB 1CW5A 1N7LA 1A02J 2KB7P 3VMZA 4N78E 2P67A 4C7RA 1NU1K 3OAKA 1LTTC 5CCGD 1GZLA 2C0XA 5AVYB 2A45G 4I6MC 3I5CA 2YKOA 1GK6A 2CPSA 4HYTB 3BVHA 3HE5A 4M3LA 3HTKB 2E43A 1FJPA 1LGHB 2MJZA 3H6PA 2WITA 2FFDB 1QL1A 1LT9C 1N2DC 5APWA 3TK1A 5KLVK 2W27A 1T8ZA 1NAFA 2XV5A 1L4AC 1GD2E 4LC1A 2C9NY 1JY3P 1N73B 1URQC 4JYBA 1FZCA 4WY4A 1JY2O 1GTWA 1N7SC 3HE4B 4I2LC 2OYHC 2Z5HA 5AVWB 5AVZB 5CHXA 3MGNA 5APUA 4C46A 2PP6A 4C7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLV A;  3IFM A;  1IFN A;  1QL2 A;  4IFM A;  1QL1 A;  2IFN A;  1ZN5 A;  2KSJ A;  1PFI A;  2IFM A;  2XKM A;  1IFM A; 
#chains in the Genus database with same CATH topology
 1FU1 A;  3HD7 A;  3B4S A;  3MP7 B;  1R5L A;  1L0N K;  2M3E A;  1JY2 N;  2YIU B;  5APS A;  1LP1 A;  1SLQ A;  2E76 D;  1Q82 Q;  4YXW H;  1SFC C;  3L35 A;  4A7P A;  2OYI B;  3H1I G;  2XNX A;  2KYV A;  1EZV E;  1SQX K;  3IN6 A;  2O3J A;  3PRJ A;  4WY4 C;  3CWB E;  3JSV C;  3VOP A;  1EXI A;  3S4R A;  3SWF A;  2KK7 A;  1WT6 A;  1KQL A;  1QLE D;  5KLV D;  1NTM G;  1OW8 A;  4H44 B;  3SSU A;  1IFP A;  2POH A;  3GLM A;  2E74 C;  3H1H E;  2QJP C;  1FDM A;  2L5G B;  2ZFC A;  2ZT9 B;  4I1L A;  4HH2 A;  3LW5 H;  5GTI E;  3CPW O;  2R3S A;  2KSE A;  1X79 B;  2E5Y A;  1ZP0 C;  1S5L X;  4NPD A;  1IFJ A;  1KFM A;  5BVZ A;  3OA7 A;  1AVO A;  3QH9 A;  3VYI A;  2W6A A;  1NKN A;  1KYO I;  3FWN A;  1VQ7 P;  3U1A A;  3RK2 D;  1KB9 D;  2V7Q J;  4L75 A;  3D6Y A;  4PV1 C;  1E5W A;  2JP3 A;  2KI7 B;  5APV A;  2KOG A;  2OTJ P;  1OXZ A;  3L37 A;  1DD4 A;  2Z5I A;  2AXT E;  2O1K A;  1SFC D;  1BDD A;  1LNQ A;  1YYC A;  3PH0 A;  3B71 A;  1KB9 H;  3Q5S A;  2Q7C A;  3CCU P;  2M3B A;  4UB6 H;  1OVV A;  3TF5 A;  3A0H H;  1HVV A;  5CCH D;  3RK2 B;  1SQV J;  1GU4 A;  3KYQ A;  2WSF H;  2H88 C;  1YTZ I;  3H1L E;  3V4W A;  5KKZ B;  1GU5 A;  4DT0 A;  1DIP A;  2E74 D;  2HPC A;  3A3Y B;  3S1K A;  2HOD B;  1VQ4 P;  5AVX B;  4CPG A;  3CI9 A;  4NPF X;  2O01 H;  1PL5 A;  1S9K E;  1KD1 Q;  2KUB A;  5KAI H;  1DEB A;  2IPP A;  3M91 A;  3CWB D;  3L4F A;  1VQ9 P;  2KZJ A;  3WUU A;  4W7Z A;  1KIL A;  4GOD A;  2AEF A;  1MZ9 A;  3WUT A;  3MIW A;  2Q9I A;  1GW3 A;  3L74 E;  3CCQ P;  2VRS A;  4BWN A;  3CCL P;  1KIL E;  1EDK A;  3H25 A;  1SQB J;  2ZXE B;  1NU1 G;  2KSJ A;  3CCE P;  1KYO D;  1CSB A;  2RH0 A;  3FXE A;  1SQQ E;  3VP9 A;  3U1C A;  2BCC G;  1UIX A;  4B86 A;  3CXH H;  4NPE A;  1USD A;  1LTA C;  2HR3 A;  3H1J E;  1P84 E;  3CWB G;  1RQU A;  2O1J A;  3JCU E;  2XZR A;  1URQ B;  2ZYA A;  2K9J B;  1N73 C;  3I55 P;  2HYN A;  2RKL A;  1L2P A;  2M5A A;  1KIL C;  1JTH B;  1ZR4 A;  3V5B A;  4XE5 B;  5AW5 B;  1M1J A;  4Y28 J;  3TYY A;  4DJG A;  1NTZ D;  3A7O A;  3AEG C;  3T97 A;  1SQQ K;  2KS1 B;  3GG2 A;  1FDO A;  5H2F E;  1H0T B;  1Y9B A;  2GUS A;  1EXJ A;  1JM0 A;  3SWK A;  2R5D A;  5APY A;  3H1I J;  1J1D C;  2K88 A;  1S5L H;  3PTZ A;  1HGZ A;  2XDJ A;  1NTM J;  1H8A A;  2IBZ I;  4RKU J;  3CME P;  1RY3 A;  1NTZ G;  1PIX A;  1K8A Q;  1VQ6 P;  1LWU C;  1E79 H;  3CD6 P;  1M1J C;  2OYO A;  2L91 A;  2OYH A;  1U57 A;  3P8M C;  5KJ7 C;  1KQG B;  3SFD C;  4U3F D;  3GHG A;  2ZAE B;  2V7Q H;  3IFM A;  1KIL D;  1CW5 A;  1N7L A;  4BRY B;  4N78 E;  3L71 D;  1Q90 D;  1K9M Q;  1GK6 A;  4HYT B;  4M3L A;  3HTK B;  2Q1K A;  3A0B E;  3H6P A;  2WIT A;  2FFD B;  1USE A;  1JMB A;  1LT9 C;  3H1J D;  1NTK E;  5KLV J;  2XV5 A;  1L4A C;  1GD2 E;  2B88 A;  1VQ8 P;  2C9N Y;  4OVN F;  4R4M A;  1JY3 P;  1N73 B;  2WPV B;  2B9B A;  3RBZ A;  1JY2 O;  1PPJ D;  2OYH C;  2CK3 H;  4U3F G;  5AVZ B;  5CHX A;  3MGN A;  5APU A;  2QIW A;  3GHG C;  4GKG A;  1LTB C;  2WTY A;  3L71 G;  1BE3 E;  2CPB A;  3G71 P;  1KQF B;  1OWA A;  1AJY A;  1L0N J;  2H7H A;  2IYO A;  1RF1 A;  1NTK K;  2KNC B;  3MHV A;  1ZW0 A;  2NPS B;  5KJ7 D;  1LTI C;  2IBZ D;  2OQQ A;  1HBW A;  3BCC E;  3AED C;  4Y99 B;  2GUV A;  3BAS A;  4D6T E;  3L70 J;  5TIS H;  1PPJ G;  1Q81 Q;  3RL0 g;  2QJY C;  2ZXX A;  1SQP E;  2WWW A;  2ZYG A;  3O6Q B;  2I8D A;  4BXL A;  2YKP A;  2WPQ A;  1W5C E;  2XKM A;  2YXQ B;  3GW6 A;  2BAS A;  1L4A D;  3CLQ A;  2E75 C;  2IYP A;  1LTS C;  2P58 A;  2P7J A;  5AVQ B;  3VN0 A;  3I56 P;  1RE4 A;  4EI2 A;  3CCS P;  1RF1 C;  4H0L B;  1LTG C;  1VQL P;  1CZQ A;  1YQ4 C;  2IBZ G;  2WT7 B;  1VQK P;  1NAY A;  1H89 A;  3RK3 B;  1PGQ A;  1SQP K;  3D70 A;  1CI6 A;  3CWB J;  3ZDM A;  2FYN B;  1BCC E;  1RE3 A;  3H1K E;  1J1E B;  2Y9Z A;  3P7K A;  1R8E A;  4R4L A;  2W90 A;  5B66 H;  3HUS A;  2OTK E;  3L72 D;  1L0L K;  3CC7 P;  4PD4 E;  1ZR2 A;  3LIE A;  2BEZ F;  2BEQ D;  2PRR A;  1G2C A;  1IFN A;  2PGD A;  3CMA P;  3CCR P;  2N1T A;  3B5N A;  5C39 A;  3Q1M A;  2FBW C;  3WMM 0;  3A0H E;  1RE4 C;  1PGP A;  3HRN A;  5B5E E;  1BE3 D;  4I7Z C;  1IK9 A;  2P10 A;  4IL6 E;  4ZNC A;  3OW2 O;  4H13 C;  4ASV A;  3AEF C;  5DJU B;  1FZB A;  1RE3 C;  4AQR D;  3M0D A;  2K1A A;  2E75 D;  2JJL A;  3L72 G;  5KAI E;  2LXB A;  3NFQ A;  4EIJ A;  4ZKU A;  3HUS C;  3AEA C;  4D6T D;  4JYC A;  1HH0 A;  3CX5 E;  2FYZ A;  4PJ0 E;  5AW6 B;  1NTZ J;  5CBN A;  3WU2 H;  3MTU E;  3VTP C;  4L74 A;  4RO0 A;  5CMZ A;  2W8Z A;  1EZV I;  1JB0 J;  4U7J A;  3TGU E;  2N1T C;  5M1B A;  1PP9 D;  3B5N C;  3HD7 C;  1R5S A;  3IR9 A;  2RMZ A;  1OVU A;  2E76 B;  1NTM D;  1NWQ A;  1L0L D;  3CX5 I;  3NXS A;  1Q86 Q;  3TDK A;  3M9H A;  1UII A;  3Q3D A;  3KZI E;  1GL2 A;  2QJK B;  1BDC A;  4RES B;  3CXH E;  1L0N D;  1MUU A;  3M0D C;  3FX0 A;  1FOS F;  4D6T G;  2B87 A;  2WPR A;  2JR8 A;  5KLV G;  5GTH H;  1IO4 A;  4WWI A;  3LID A;  1FZG A;  1PP9 G;  3CCV P;  3E1I A;  3L70 D;  1Z56 A;  4K3A A;  1L0L G;  4UB8 E;  1SQX D;  4U3F J;  5EFW B;  1NO4 A;  3H32 B;  2QE7 H;  4XA4 A;  5L8R J;  3VP8 A;  1LTJ A;  2KIK A;  4JQ0 D;  4WY4 D;  4Z1M H;  3L71 J;  2I1K A;  4AUW A;  1SQQ J;  1FAV A;  5DJT B;  1GL2 C;  1L0N G;  2OGU A;  1ZN5 A;  2WSE J;  1KN7 A;  3HE5 B;  3CCM P;  3H1J J;  1VF5 C;  1HGV A;  1Y8A A;  3HD7 D;  1QVG O;  1SFC B;  2NZ2 A;  5AW8 B;  2P1J A;  1EZV D;  2LXC B;  1JO5 A;  3ABV C;  4WY4 B;  3L70 G;  2JWD A;  3V6I A;  4OH8 B;  3Q5R A;  1SQX G;  4YXD C;  3E7K A;  1G1J A;  1SVF A;  3CX5 D;  3A5T A;  2WQY C;  1ZME C;  4C7N B;  3TGU D;  2YO3 A;  2Y0D A;  3HD7 B;  2E74 B;  1LTJ C;  2QJP B;  1N7S A;  3H1H D;  3TNU A;  1QGK B;  1NHL A;  4W80 A;  1AV1 A;  1YTZ T;  4PV1 D;  1N8R Q;  2HG5 D;  2QVA A;  1LP1 B;  5APX A;  3II6 A;  1A02 J;  1M90 Q;  2KB7 P;  3VMZ A;  2E5T A;  4C7R A;  3OAK A;  1GZL A;  2C0X A;  1EZV G;  5GTI H;  3IAO A;  3I5C A;  1FJP A;  2MJZ A;  3S9O A;  1KYO H;  2UWJ E;  4JBZ A;  1T8Z A;  1M57 D;  3F5H A;  1SQV E;  2FXO A;  4PV1 B;  1BGY E;  3TGU G;  1M1K Q;  1VF5 D;  2AEM A;  1P84 I;  3H1H G;  1FZC A;  1N7S C;  2XND H;  2Z5H A;  3RGU A;  5AVW B;  3L73 E;  2Q3I A;  2IFN A;  3ITK A;  1Q2N A;  1N86 A;  5KLI C;  3V2Q A;  3L36 A;  2PFX A;  3AE4 C;  3H1L D;  1VF5 B;  2FKW B;  5AVV B;  2QM7 A;  1VPC A;  3BRT B;  3L72 J;  2WSS H;  2V4H A;  3L75 E;  2W6B A;  1NYH A;  5TIS E;  1JEK A;  1S9K D;  2YXR B;  1S1C X;  2R44 A;  1SQB E;  2WPS A;  1OFC X;  4YTP C;  1ZRT E;  4EYY Q;  2YKQ A;  2D2C C;  1QEX A;  2M0B A;  2B89 A;  2O01 N;  3VMX A;  3M0A A;  1BE3 J;  2A45 I;  3L74 D;  1T2K C;  3EQ2 A;  3V2R A;  3KDP B;  3AE5 C;  5CCG A;  2A06 E;  3H1L G;  2H43 A;  1MKM A;  5CBO A;  3O8Z A;  3PP5 A;  2J58 A;  1DD3 A;  1VQ5 P;  1YJ9 P;  3MUD A;  1SQQ D;  2HPC B;  2AXC A;  2I1J A;  2ZJS E;  1N7S D;  1SQB K;  2R32 A;  4D6T J;  1ZV8 A;  1Y47 A;  1SQP J;  2KXP B;  4GOF A;  1P84 D;  1S4X A;  1JY3 N;  4GIF A;  1X22 A;  3F89 A;  1PP9 J;  1KV4 A;  2GM4 A;  1KIL B;  2WSE H;  1BGY D;  3AEC C;  3L74 G;  1L0L J;  1PFI A;  2OYI A;  3RL0 C;  3JCU H;  2LKM A;  1RHZ B;  3AEE C;  3H1I E;  5KAF H;  2ZYD A;  1JCD A;  5CCG C;  1GK4 A;  1HJB A;  1MV8 A;  3BRV B;  3P8C E;  4JF7 A;  1EQ7 A;  3L73 D;  1SQQ G;  4JPZ B;  2QA4 P;  3NMD A;  1NTM E;  4IFD K;  3B8E B;  1Q7Y Q;  3MUD C;  3USS A;  1MFZ A;  3G9R A;  1A02 F;  1JNM A;  3H1J G;  5AW1 B;  3SWY A;  4OGQ C;  2D2C D;  2J59 M;  2DW3 A;  1YJN P;  1GDT A;  2FYU E;  1DX7 A;  1J1D B;  1KZU B;  2WZ7 A;  5H2F H;  2HLO A;  3JC2 2;  1FS0 E;  1BGY G;  2N9B A;  2Q5U A;  3AE9 C;  1SQX J;  2M5A B;  1ZOY C;  1IZN B;  3AEB C;  1DH3 A;  4OWF A;  2ZVN B;  1K73 Q;  2OYI C;  1XTG B;  5APQ A;  2C0W A;  4KJM A;  1LWU B;  1M1J B;  1LJ2 A;  1H88 A;  2JWA A;  4LGD E;  5CJ0 A;  1NTM K;  3L73 G;  3T97 B;  3GF7 A;  1RH5 B;  2RN0 A;  2JKV A;  1YBK A;  4DZO A;  4H44 C;  2FYU K;  3A2A A;  1DEE G;  3R4Y A;  2OTL P;  1VQO P;  5AW2 B;  2IZ1 A;  3PJS K;  2K3R A;  4N78 D;  2ZT9 C;  1KC8 Q;  3IF4 A;  3RL0 D;  4IFF A;  4IL6 X;  1QVF O;  1YI2 P;  2NRG A;  5AVS B;  5CJ4 A;  1FZF A;  1LT9 B;  1IJD B;  1T3J A;  3W67 A;  1NTK D;  1AA0 A;  2YMY A;  1L4A B;  1WRG A;  1M56 D;  1IC2 A;  3TGU J;  3V4Q A;  2HOD A;  2R5B A;  4OGQ D;  2WVR A;  3H1H J;  1FBM A;  1SFC A;  2OYH B;  1S3J A;  1FOS E;  1KB9 E;  3RL0 B;  3KQG A;  4UB6 E;  3GHG B;  3CCJ P;  5CCH A;  1HJ0 A;  1PGJ A;  2Z4E A;  4PD4 I;  3P8C D;  4GDO A;  2IDB A;  5E79 H;  3PHL A;  2C9L Y;  5AVR B;  4OGQ B;  1NTK G;  2J5U A;  2YO2 A;  4HKZ H;  1ZXG A;  3RK2 C;  4GOE A;  2FYU D;  1YJW P;  2QEX P;  2MKV A;  1JY2 P;  2ZVO B;  3AE3 C;  3C1L A;  5KKZ C;  4H44 D;  3BCC D;  3OJA B;  1NOH A;  3BAT A;  4DCK A;  1NU1 E;  2QJY B;  1SQP D;  2ZT9 D;  1X8Y A;  2BCC E;  3EFF K;  2IX7 C;  2QG4 A;  4GT1 A;  2H8P D;  4AYC A;  3NTN A;  4WBA A;  1URQ A;  3R2P A;  4KT0 J;  1T3U A;  1BE3 G;  2K9J A;  5CCH C;  1OW7 A;  2E75 B;  3H1L J;  1JTH A;  4YPC A;  5AVU B;  2K37 A;  2QM8 A;  1NVO A;  1RF1 B;  2YMK A;  5AW3 B;  3M9B A;  4QMA A;  3C9I A;  2FYU G;  4N3Y B;  3N4X A;  4EDF A;  4ZKP A;  3D71 A;  3D6Z A;  3KHU A;  1EDL A;  1NU1 K;  1VQM P;  3BCC G;  1LTT C;  2N9Y B;  5AVY B;  2KS1 A;  1NGM B;  1KYO E;  1SQP G;  2CPS A;  2W6J H;  1BCC D;  3BVH A;  1H0T A;  3H1K D;  1LGH B;  3CXH I;  1N2D C;  3TK1 A;  1BSN A;  1NAF A;  1OVR A;  1YQ3 C;  3AE7 C;  4LC1 A;  4H13 D;  3L74 J;  3GMA A;  1URQ C;  2AEJ A;  4PD4 D;  2WSC J;  4WVZ A;  3VMA A;  3HE4 B;  4I2L C;  4L73 A;  1VQN P;  5TJH A;  1YIT P;  2ITA A;  2Q3E A;  2PP6 A;  2E42 A;  4PD4 H;  2Y0E A;  3EFG A;  4I7Z B;  1NTZ E;  3AE1 C;  1YHQ P;  1FDI A;  3MZW B;  2N1T D;  4W7Y A;  3B5N D;  1BCC G;  4H13 B;  5AW0 B;  3H1K G;  1CI6 B;  4TT3 H;  3AE2 C;  2KZI A;  1S5L E;  5B5E H;  1BGY J;  4BRY A;  3HUS B;  1X0T A;  4IL6 H;  1RQV A;  4KHX A;  1RF0 A;  1NU1 D;  3GF3 A;  1S2E A;  1OW6 A;  3HTK A;  1JUN A;  1GMJ A;  3Q5P A;  1HUC A;  2BCC D;  2FFD A;  4IFM A;  1G2C B;  1K05 A;  2GA1 A;  2N1T B;  3L73 J;  3B5N B;  2HFE D;  1KMI Z;  1EC5 A;  3SFE C;  1NTZ K;  2QRX A;  2W83 C;  1N73 A;  1FE6 A;  5KTB A;  3CC2 P;  3CX5 H;  4PJ0 H;  1VDF A;  3VMY A;  1M8O B;  1JY3 O;  4DOJ A;  1XTC C;  1NH4 A;  1NKZ B;  1URQ D;  3MD0 A;  4U3F E;  3L75 J;  3CXH D;  1HF9 A;  2JDI H;  2LR2 A;  1K04 A;  2FY8 A;  2K9Y A;  3L71 E;  1RF0 C;  5BU5 A;  1W2E A;  1YIJ P;  2KNC A;  3KZI H;  1GL2 D;  2NPS A;  1W2B O;  1FJK A;  3G3Z A;  4EOT A;  2FFD C;  2M8R A;  1T6A A;  1OMI A;  3WUV A;  2Y0C A;  2Q6Q A;  2KLV A;  5KAF E;  2YNY A;  3O6Q A;  1JMM A;  1MFT A;  1PPJ E;  1S72 P;  1IFI A;  4LLH A;  4UB8 H;  1GL2 B;  1LWU A;  2AXT H;  4L76 A;  1HTL C;  3Q2Y A;  3FGA D;  5KJ7 A;  1NTK J;  1SQV K;  2B87 B;  1KQS O;  1U7J A;  5AW9 B;  3UIA A;  3W68 A;  1BSH A;  5BU8 B;  1PV3 A;  2NPS C;  2WT7 A;  2KP8 A;  1FZC C;  2IBZ E;  1VQP P;  1EDJ A;  1JOC A;  4Y99 C;  2FXP A;  3KPE A;  1LT9 A;  2R3C A;  2G3A A;  2IZ0 A;  3M06 A;  1L4A A;  1LTJ B;  1PGO A;  2WMM A;  3RK3 E;  3KXD A;  3C8V A;  1KTM A;  5AW4 B;  1D7M A;  2IFM A;  5APT A;  2FYU J;  1JCC A;  4MN4 C;  3G4S P;  3BCC J;  2WSC H;  1KFN A;  3E1R A;  4H0L C;  3CL3 D;  3N7N A;  1M7L A;  5B66 E;  3RK3 C;  1SQV D;  2G8Y A;  3TSI A;  2FYN C;  3M9Q A;  3V2N A;  1OIP A;  1SP4 A;  3LW5 J;  4HJG H;  1P84 H;  1G1I A;  1AVY A;  1J1E C;  1QL2 A;  1N7S B;  1GW4 A;  3L72 E;  4TLF A;  3TNU B;  3AE8 C;  2NPS D;  3FWL A;  4O9B A;  1X9V A;  4K35 A;  1FZA A;  4IOI H;  1FZE A;  5AW7 B;  3RBX A;  2JO1 A;  5E79 E;  5AVT B;  2OAR A;  1AFO A;  5KLI B;  3QWO C;  4RJT A;  2H89 C;  1BCC J;  3H1K J;  4N6J A;  4WB4 A;  2YIU C;  1OX3 A;  1T2K D;  3EWK A;  1IFD A;  3PLN A;  1SQV G;  3L75 D;  1SS1 A;  2SPZ A;  3U59 A;  2FXM A;  1QX8 A;  1SQB D;  3WU2 E;  1FZC B;  1TU3 F;  1ZRT D;  2PAJ A;  4XFJ A;  1IK7 A;  2XU6 A;  2D2C B;  4H0L D;  1IFM A;  2WSF J;  5KLV E;  1AQ5 A;  2A45 H;  3V2P A;  5K5G B;  1HWT C;  1ZLL A;  3RK3 D;  1AQT A;  2A06 D;  1PP9 E;  3P32 A;  1NJI Q;  2P2U A;  1LT1 A;  1VL2 A;  2E76 C;  1L0L E;  3H32 A;  2O01 J;  3HE4 A;  2JEE A;  3L75 G;  3AE6 C;  4C7N A;  1J2J B;  3FXD A;  2P67 A;  5CCG D;  1NU1 J;  1SQB G;  5GTH E;  4ASW A;  2A45 G;  4I6M C;  3K5B A;  2QSI A;  2QJK C;  2BCC J;  2YKO A;  3HE5 A;  2E43 A;  1L0N E;  3G6E P;  1EDI A;  1QL1 A;  5APW A;  5KLV K;  4HB1 A;  2W27 A;  3A0B H;  1WMK A;  2KLU A;  3CC4 P;  1KOR A;  4JYB A;  2Y9Y A;  2A06 G;  4WY4 A;  3H1I D;  1GTW A;  1PZQ A;  3L70 E;  1FC2 C;  1OZH A;  1SQX E;  1U7M A;  1KB9 I;  4C46 A;  4ZMD A; 
#chains in the Genus database with same CATH homology
 3GHG C;  4GKG A;  2E42 A;  1FU1 A;  1LTB C;  2Q3I A;  2IFN A;  3HD7 A;  3EFG A;  2WTY A;  1N86 A;  2CPB A;  1L0N K;  1OWA A;  3V2Q A;  2N1T D;  3L36 A;  4W7Y A;  3B5N D;  2H7H A;  5AW0 B;  1JY2 N;  1RF1 A;  1CI6 B;  5APS A;  1NTK K;  2FKW B;  5AVV B;  2NPS B;  2QM7 A;  1VPC A;  3BRT B;  5KJ7 D;  1SLQ A;  1LTI C;  3HUS B;  2W6B A;  4KHX A;  1RF0 A;  1S9K D;  1SFC C;  3L35 A;  1HBW A;  4Y99 B;  2GUV A;  3BAS A;  2OYI B;  2XNX A;  2WPS A;  3HTK A;  2KYV A;  1JUN A;  1SQX K;  1HUC A;  2FFD A;  2WWW A;  4WY4 C;  4IFM A;  3VOP A;  1G2C B;  2YKQ A;  3SWF A;  1WT6 A;  2N1T B;  1KQL A;  2YKP A;  2WPQ A;  3B5N B;  2HFE D;  1NTZ K;  3VMX A;  3M0A A;  1N73 A;  2A45 I;  5KTB A;  2XKM A;  1VDF A;  1T2K C;  2POH A;  3EQ2 A;  2BAS A;  3V2R A;  3VMY A;  1L4A D;  3KDP B;  3CLQ A;  1FDM A;  5CCG A;  2L5G B;  2H43 A;  2ZFC A;  1JY3 O;  4I1L A;  1LTS C;  5AVQ B;  2P7J A;  4HH2 A;  3VN0 A;  4DOJ A;  1XTC C;  3O8Z A;  1NH4 A;  1NKZ B;  3LW5 H;  1RE4 A;  2J58 A;  3PP5 A;  1URQ D;  3MD0 A;  1RF1 C;  1LTG C;  3MUD A;  2HPC B;  1CZQ A;  1X79 B;  2I1J A;  1N7S D;  2WT7 B;  1SQB K;  2R32 A;  1H89 A;  3RK3 B;  1ZV8 A;  1SQP K;  1IFJ A;  1KFM A;  5BVZ A;  1CI6 A;  1RF0 C;  3OA7 A;  5BU5 A;  1W2E A;  1GL2 D;  1RE3 A;  1JY3 N;  3VYI A;  2W6A A;  2NPS A;  1NKN A;  4GIF A;  1J1E B;  3P7K A;  1FJK A;  3G3Z A;  4EOT A;  2FFD C;  3U1A A;  2M8R A;  3HUS A;  2GM4 A;  3RK2 D;  1KIL B;  2WSE H;  1L0L K;  1PFI A;  2OYI A;  1E5W A;  3RL0 C;  2KLV A;  5APV A;  2KOG A;  2YNY A;  1ZR2 A;  2LKM A;  3LIE A;  1OXZ A;  3L37 A;  2Z5I A;  1JMM A;  1G2C A;  1IFN A;  2O1K A;  1IFI A;  1SFC D;  2N1T A;  1JCD A;  5CCG C;  1GK4 A;  1YYC A;  3B5N A;  1HJB A;  1MV8 A;  3BRV B;  3WMM 0;  3P8C E;  4JF7 A;  2Q7C A;  4LLH A;  1EQ7 A;  1RE4 C;  1GL2 B;  1LWU A;  1HTL C;  3NMD A;  2M3B A;  4IFD K;  3B8E B;  3HRN A;  5KJ7 A;  1HVV A;  1MFZ A;  5CCH D;  1A02 F;  3RK2 B;  1SQV K;  5AW1 B;  1JNM A;  1IK9 A;  3SWY A;  1GU4 A;  3KYQ A;  2J59 M;  2WSF H;  1GDT A;  1YTZ I;  3V4W A;  5AW9 B;  1DX7 A;  1GU5 A;  3UIA A;  1FZB A;  1RE3 C;  1J1D B;  1KZU B;  2HPC A;  3A3Y B;  4AQR D;  2WZ7 A;  5BU8 B;  2HLO A;  3M0D A;  2NPS C;  2HOD B;  2JJL A;  2WT7 A;  2N9B A;  2Q5U A;  3NFQ A;  5AVX B;  4EIJ A;  2KP8 A;  4ZKU A;  3HUS C;  3CI9 A;  1FZC C;  2O01 H;  1S9K E;  4JYC A;  1HH0 A;  1DH3 A;  1DEB A;  1JOC A;  4Y99 C;  2IPP A;  3KPE A;  2OYI C;  1LT9 A;  2R3C A;  2FYZ A;  3M91 A;  3M06 A;  1XTG B;  5AW6 B;  3L4F A;  2C0W A;  5APQ A;  1LWU B;  1L4A A;  3MTU E;  3VTP C;  1M1J B;  1H88 A;  1LTJ B;  4LGD E;  5CJ0 A;  1NTM K;  5CMZ A;  4W7Z A;  1KIL A;  2N1T C;  3B5N C;  3HD7 C;  3IR9 A;  1MZ9 A;  5AW4 B;  3MIW A;  1NWQ A;  2Q9I A;  1GW3 A;  2IFM A;  5APT A;  4DZO A;  2FYU K;  3A2A A;  3NXS A;  2VRS A;  5AW2 B;  1JCC A;  3M9H A;  4N78 D;  3RL0 D;  4IFF A;  2WSC H;  1GL2 A;  2ZXE B;  1KFN A;  2KSJ A;  4RES B;  1CSB A;  5AVS B;  3U1C A;  3VP9 A;  3CL3 D;  5CJ4 A;  1MUU A;  3M0D C;  1M7L A;  3N7N A;  1FZF A;  1LT9 B;  1IJD B;  4B86 A;  1FOS F;  1T3J A;  1LTA C;  2YMY A;  1L4A B;  3RK3 C;  2WPR A;  1WRG A;  2O1J A;  1IO4 A;  3LID A;  3TSI A;  1IC2 A;  2XZR A;  1URQ B;  3M9Q A;  3V2N A;  1SP4 A;  3V4Q A;  2HOD A;  1G1I A;  1FZG A;  2R5B A;  1J1E C;  1QL2 A;  1N73 C;  1FBM A;  1SFC A;  1N7S B;  3E1I A;  2HYN A;  2OYH B;  1FOS E;  1GW4 A;  1KIL C;  1Z56 A;  3RL0 B;  1JTH B;  1ZR4 A;  3TNU B;  3V5B A;  3KQG A;  2NPS D;  4XE5 B;  4O9B A;  1X9V A;  1NO4 A;  3H32 B;  5AW5 B;  1FZA A;  3GHG B;  4XA4 A;  1FZE A;  5CCH A;  5AW7 B;  1M1J A;  2Z4E A;  3VP8 A;  1LTJ A;  5AVT B;  3TYY A;  4WY4 D;  3A7O A;  2OAR A;  3P8C D;  1AFO A;  3T97 A;  1SQQ K;  2I1K A;  4AUW A;  2C9L Y;  1FAV A;  1GL2 C;  4N6J A;  1ZN5 A;  5AVR B;  4WB4 A;  3HE5 B;  1HGV A;  1T2K D;  2YO2 A;  2GUS A;  1IFD A;  3HD7 D;  3RK2 C;  1JY2 P;  1SFC B;  2R5D A;  3U59 A;  5APY A;  2FXM A;  3OJA B;  5AW8 B;  1NOH A;  2P1J A;  3BAT A;  1J1D C;  1FZC B;  1JO5 A;  4WY4 B;  1X8Y A;  4OH8 B;  2PAJ A;  2IX7 C;  1HGZ A;  1G1J A;  1SVF A;  2XU6 A;  2XDJ A;  4GT1 A;  2H8P D;  4AYC A;  1H8A A;  3A5T A;  3NTN A;  1IFM A;  4WBA A;  1URQ A;  1AQ5 A;  1RY3 A;  3R2P A;  4C7N B;  2A45 H;  3V2P A;  1T3U A;  1HWT C;  1LWU C;  1ZLL A;  2YO3 A;  3HD7 B;  5CCH C;  1M1J C;  3RK3 D;  1LTJ C;  1N7S A;  2OYH A;  3P32 A;  3P8M C;  1JTH A;  5KJ7 C;  5AVU B;  3TNU A;  2QM8 A;  1NHL A;  2P2U A;  1RF1 B;  4W80 A;  1YTZ T;  2HG5 D;  3H32 A;  5AW3 B;  3GHG A;  3M9B A;  3C9I A;  3HE4 A;  5APX A;  4N3Y B;  3II6 A;  2JEE A;  3N4X A;  3IFM A;  4ZKP A;  1KIL D;  1J2J B;  1CW5 A;  1N7L A;  1A02 J;  2KB7 P;  3VMZ A;  4N78 E;  2P67 A;  4C7R A;  1NU1 K;  3OAK A;  1LTT C;  5CCG D;  1GZL A;  2C0X A;  5AVY B;  2A45 G;  4I6M C;  3I5C A;  2YKO A;  1GK6 A;  2CPS A;  4HYT B;  3BVH A;  3HE5 A;  4M3L A;  3HTK B;  2E43 A;  1FJP A;  1LGH B;  2MJZ A;  3H6P A;  2WIT A;  2FFD B;  1QL1 A;  1LT9 C;  1N2D C;  5APW A;  3TK1 A;  5KLV K;  2W27 A;  1T8Z A;  1NAF A;  2XV5 A;  1L4A C;  1GD2 E;  4LC1 A;  2C9N Y;  1JY3 P;  1N73 B;  1URQ C;  4JYB A;  1FZC A;  4WY4 A;  1JY2 O;  1GTW A;  1N7S C;  3HE4 B;  4I2L C;  2OYH C;  2Z5H A;  5AVW B;  5AVZ B;  5CHX A;  3MGN A;  5APU A;  4C46 A;  2PP6 A;  4C7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...