1G2CB

Human respiratory syncytial virus fusion protein core
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
40
structure length
40
Chain Sequence
PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of the human respiratory syncytial virus fusion protein core.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
molecule keywords FUSION PROTEIN (F)
total genus 15
structure length 40
sequence length 40
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2000-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1g2cB00
5AVXB 3VMXA 1FOSF 1MUUA 2E42A 2Z5HA 5APXA 3MGNA 5AVSB 2XV5A 1CZQA 4JYCA 5AVQB 4C7NA 3LIEA 3TYYA 2QM7A 1T2KD 5APSA 2H7HA 4AQRD 1GU4A 4AUWA 3HE5A 3NTNA 1H88A 2WPQA 2XU6A 3M0DA 2Q3IA 4DZOA 1JUNA 1OWAA 4EOTA 3LIDA 1YYCA 1GD2E 3A7OA 1SP4A 5APQA 4C7NB 1X8YA 3SWFA 3M9BA 3VMYA 4I6MC 2YO3A 3O8ZA 3I5CA 1NAFA 1KQLA 3B8EB 3VN0A 1HUCA 2R32A 3P32A 5AVWB 2JJLA 4GT1A 4XE5B 1HWTC 4HYTB 1H89A 2ZFCA 5AW9B 5CMZA 2R3CA 5APUA 1GU5A 5AW4B 3V4WA 4JYBA 3HE4B 3M06A 4LC1A 5AW7B 5AW3B 5AW5B 4C46A 3M9HA 4KHXA 3IR9A 3NXSA 1OXZA 1NWQA 3VMZA 3M91A 1JNMA 1GTWA 1GZLA 2W27A 3VTPC 3TNUA 1IO4A 5APWA 2R5BA 3OAKA 5AVYB 1CI6B 2C9LY 3L35A 5AW2B 2WPSA 3HE5B 3L36A 5AVVB 1HJBA 2N9BA 1T2KC 3NFQA 2WWWA 5AVUB 2Q7CA 2YO2A 4B86A 2WT7A 2YNYA 1J2JB 2IPPA 1H8AA 3NMDA 2WTYA 1DH3A 1MFZA 2XZRA 2BASA 1G2CB 3KDPB 3VYIA 2C9NY 5AVRB 2P67A 5AW0B 2WPRA 3TK1A 2Z5IA 3P8MC 5APYA 1FOSE 2W6AA 2R5DA 5AW8B 5AW1B 1GK4A 1MV8A 3V4QA 3HTKA 4GKGA 4AYCA 1S9KE 1FAVA 2KP8A 2WT7B 4RESB 1A02F 2VRSA 2Q5UA 3L37A 3MD0A 1GK6A 3A5TA 3M0AA 2E43A 4M3LA 5AVTB 3HE4A 4I2LC 3UIAA 2ZXEB 5AW6B 2P2UA 1A02J 2P7JA 3A2AA 5APTA 3T97A 3KQGA 3P7KA 5AVZB 1CI6A 1S9KD 2QM8A 3V5BA 5APVA 1CSBA 1SLQA 3TNUB 1HBWA 3A3YB
chains in the Genus database with same CATH superfamily
2HFED 1SQXK 3MP7B 3GF7A 4ZMDA 3MHVA 2WSEJ 1ZW0A 3CXHD 1L0NE 4EIJA 1ZRTE 1OVRA 3MGNA 1PPJG 3ITKA 3RL0g 1URQD 2FYUG 2A06D 3CWBG 4JYCA 3U59A 4YPCA 4KT0J 1BE3D 3LIEA 3TYYA 4C7NA 5APSA 4OGQC 1K9MQ 3RL0B 3E7KA 3RL0C 4R4MA 4AQRD 3O6QA 3H1HJ 1IFJA 2WPQA 5B5EH 2ZYDA 1KORA 2KLUA 3M0DA 1S4XA 2Q3IA 5E79E 5CBNA 3I55P 4N78D 5CHXA 1QEXA 2XKMA 4HKZH 1SQVK 2BCCJ 3SSUA 1XTGB 2FFDC 4IL6X 1SP4A 4C7NB 4PJ0E 2QG4A 3SFEC 1LTAC 3TGUE 1N7LA 3RBXA 1IC2A 2YO3A 1NTZJ 4I6MC 3C8VA 4ASWA 1VQPP 4H13B 1EDKA 1N73A 1NAYA 3KHUA 3L73J 1N73B 1CW5A 5KAFH 3CCMP 1IJDB 2OTKE 1K04A 1SQPK 1USEA 3AE5C 3L70D 2BCCG 2WSCH 1HUCA 3L4FA 3P32A 1Q2NA 3N7NA 2KZJA 5KKZB 4NPDA 2GUVA 1VQ9P 1BDCA 3H1IE 3TDKA 2DW3A 1N2DC 2IFNA 1RF0C 2ZFCA 3RK2C 1VQ6P 3HRNA 4RKUJ 3LW5J 2R3CA 5APUA 2ZAEB 3AE6C 1M57D 4U3FJ 3AE3C 4PV1D 4EYYQ 1Q81Q 1L0LE 4JYBA 2FYNB 3HE4B 1PPJD 4I7ZB 2NPSC 3V6IA 4PD4H 2IFMA 4HB1A 5AW5B 1WT6A 4GIFA 1PFIA 4EDFA 1GDTA 1NO4A 2E75D 3IR9A 1SQVJ 3M9QA 3NXSA 2M5AA 2L91A 3VMZA 1LTJC 1FDMA 3RK3E 2FYZA 2KSJA 1GTWA 2KZIA 1U7JA 1L0NG 1SQQG 2XNDH 2YXRB 1UIXA 3VTPC 2KS1B 5APWA 2FYUE 3L71D 1EZVI 5CJ4A 1K73Q 1ZOYC 2IBZI 5AVYB 1QVGO 1KC8Q 2KXPB 5TJHA 2N1TD 2WPSA 3BASA 1JMMA 3HE5B 1LP1A 2N9BA 2RMZA 3KXDA 4K3AA 4A7PA 3KPEA 1J1DB 2KOGA 1QGKB 2WWWA 2KSEA 1T2KC 5KAIH 2P10A 3G9RA 2KIKA 1X22A 2YNYA 1J2JB 3CCSP 2KLVA 5KLVJ 3BRVB 2WTYA 1DH3A 1KILB 1WRGA 4N6JA 2OYHA 1NU1K 2AXTE 2MKVA 3H1JJ 1M1JA 1EDJA 4OVNF 1HGVA 3AEEC 1M56D 1BE3J 1IZNB 2OYOA 3A0HE 4N78E 1SQXJ 2O1JA 3KDPB 1KYOE 2UWJE 2WSFJ 3PHLA 3Q5RA 4JQ0D 3P8CE 1VQMP 1BGYJ 1PGJA 1SQBK 2Z5IA 1QL2A 5APYA 4DCKA 2Q6QA 2QRXA 5GTIH 3E1IA 1FOSE 1JY3P 4Y99C 3S1KA 2NPSA 2R5DA 3HD7C 2E74D 3CL3D 1LNQA 2JKVA 3CLQA 1GK4A 1URQB 1MV8A 5AW1B 1QX8A 3RK3C 3WUUA 4C7RA 1N7SA 2Q3EA 3L70E 4GOEA 1S72P 3QWOC 5B5EE 3L72J 1FAVA 2KP8A 3L75E 1A02F 4U7JA 4R4LA 1L0LG 3MD0A 4DT0A 3A5TA 3IF4A 3EQ2A 2E76D 3HD7A 4PJ0H 2AEFA 2E74C 3HD7D 3AECC 1SQXE 3V2QA 2FXMA 1PP9G 4DJGA 5APTA 3H6PA 2M0BA 4PD4I 1DD3A 1NTME 3R2PA 2IDBA 3H1KE 3MTUE 4WBAA 1K8AQ 1JY2O 1N8RQ 1RH5B 1SLQA 2HODA 3B4SA 1SQQE 3C1LA 2B87B 1GMJA 3MZWB 5GTHH 1RF1B 4I7ZC 2PAJA 5CCHC 5BU5A 3OA7A 2M8RA 5KTBA 3TGUJ 3AEBC 4UB8H 1W2BO 2Z5HA 3L75D 1LTSC 1KB9E 1E5WA 1ZRTD 2W6JH 1JTHB 1URQA 4IL6E 3B5NA 5CCGD 3H25A 1MKMA 1T3UA 2XV5A 1VL2A 2OYIA 3AE1C 1SFCB 5KJ7C 2H7HA 1T6AA 3II6A 1VQ7P 4TLFA 2J5UA 2N1TC 2K9YA 3BCCD 2ZT9B 2W83C 2KYVA 1AA0A 3HE5A 3L74D 3LW5H 1YITP 3CI9A 1H88A 2O1KA 1ZV8A 1JO5A 3H1IJ 2IYOA 3CX5E 1L4AD 3H1HG 3L71J 1SQQJ 1JCDA 1LGHB 3CC7P 2IBZG 2ZVOB 3A7OA 1BSHA 4WY4C 1HVVA 1YTZT 4YTPC 2OYIB 1L0LD 2M5AB 1FZFA 1KTMA 3CX5D 3FX0A 5L8RJ 2QA4P 1PV3A 1L0ND 2CPBA 2E75C 3H1LE 4H44B 3WUTA 2WQYC 4OH8B 5H2FE 1FDOA 4EI2A 1LWUA 1FS0E 1GL2A 1KQLA 2ITAA 4IOIH 5KLVD 1KYOD 2KNCB 2LKMA 4WVZA 1Q7YQ 5B66E 5GTHE 1YQ4C 2POHA 3L75G 4PV1C 1OX3A 5TISE 2O01H 2IX7C 2KS1A 2FYUJ 3CC4P 2R44A 1IFPA 1T3JA 1X9VA 3L72G 4H13D 3RK2D 5BU8B 2HR3A 1M90Q 3PH0A 1SQXG 3AEFC 1ZN5A 4ZKUA 3RK3B 1VQLP 1S3JA 4KJMA 1KB9I 5AW7B 2E5YA 3Q2YA 1T8ZA 4XFJA 5KLIC 3H1KG 3BVHA 3IN6A 4ZNCA 2FYUK 2Y0CA 4KHXA 1LT9B 4RJTA 1MFTA 3L72D 1OXZA 1WMKA 2IBZE 3VP9A 2QJYC 2N1TA 3R4YA 1LTJB 1NTZE 4JF7A 3EWKA 2D2CD 3H1HD 4L74A 4ZKPA 1JNMA 3F5HA 1IFNA 2KI7B 1NYHA 2W90A 1J1EC 3L73G 4IFFA 3TNUA 2WITA 1FU1A 3U1CA 3CD6P 1S5LH 2R5BA 5KLVG 1YJNP 1FZCA 2M3BA 2K3RA 3A0HH 3FXDA 1CI6B 2C9LY 5AW2B 1FZAA 1KILE 2JO1A 3RL0D 4OWFA 2OYHC 2OYHB 1SS1A 1FZBA 1KZUB 1LTJA 3CWBE 1JY3N 3CCJP 1AVOA 1VQOP 2YO2A 4B86A 3L73D 1X0TA 3SWKA 1KYOI 1SQPG 3AEDC 2LXCB 3L70J 1N86A 1IFMA 1RE3A 1H8AA 1FJPA 3B5ND 1JMBA 5CCGA 2WMMA 3VOPA 3ZDMA 1IFDA 4OGQB 2M3EA 1BCCD 5DJTB 2YMYA 4UB8E 3H1LG 3Q3DA 3ABVC 1OIPA 3H1JG 1AJYA 1LTBC 1SQPJ 2P67A 3BCCJ 3L74J 5AVRB 5AW0B 3TK1A 1DX7A 3H32B 1GW3A 2H43A 3D6ZA 2O3JA 3JCUE 2H88C 2KB7P 2OGUA 1VF5B 4RO0A 1JM0A 1AVYA 1NVOA 1J1EB 1KILA 2FXOA 2I8DA 1LTIC 2BCCE 4GDOA 3HTKA 1SFCD 5KLVE 4GKGA 4AYCA 1S9KE 2OTJP 3Q5SA 1JTHA 2ZT9D 1NTMK 4PD4E 2XDJA 4Z1MH 1GK6A 1QLED 2QJPC 1LP1B 1EDIA 1SQQK 4H0LD 3HE4A 5AVTB 2IBZD 3UIAA 1RF1A 5AW6B 1SQPE 3KQGA 3PJSK 1EDLA 3H1KJ 1ZR2A 1CI6A 1JOCA 4LGDE 3V5BA 2AXTH 3T97B 1OMIA 1BE3G 3H1LJ 4GOFA 4UB6E 3VMAA 1HBWA 1G2CA 3A3YB 1KYOH 1G1JA 1VF5C 4U3FE 3CCVP 3HD7B 5KAFE 3CCEP 1HF9A 3B5NC 2ZXXA 3B5NB 3V2PA 1FOSF 1MUUA 2HYNA 1U57A 3H1IG 4IL6H 2H89C 3E1RA 1L4AA 2WSEH 3BATA 3CXHE 1NKZB 5APXA 3G71P 3H1JD 1AFOA 5AVSB 5AVQB 2QM7A 4BRYB 2KK7A 1SQXD 3AE2C 3HUSB 1EZVG 3G4SP 2PRRA 1J1DC 3PLNA 1BGYD 1RE4C 1NTKD 1W2EA 3FWNA 1FZCB 1RE3C 2XU6A 2O01N 4WB4A 1L0NK 1JUNA 4EOTA 3WU2E 2V4HA 3LIDA 4JPZB 3CWBD 1RF1C 1OW8A 1GD2E 2D2CC 2XNXA 2GUSA 1R5SA 2YKQA 1YJWP 1X8YA 2OYIC 1Q86Q 1FBMA 2QVAA 4NPFX 1M1KQ 1ZP0C 2E76B 1MZ9A 3VMYA 3I56P 1TU3F 2GA1A 1XTCC 1RY3A 2KNCA 1JCCA 3GF3A 3O8ZA 2YIUC 1HTLC 3I5CA 1DIPA 2OARA 1KQFB 2YXQB 3PTZA 1FZGA 3JC22 1VQ8P 2SPZA 3VN0A 1DEBA 2R32A 1OVVA 4BRYA 1N7SD 2B9BA 1IK7A 2JJLA 1NU1G 2FY8A 1BCCJ 3HUSC 1NTMD 4GT1A 4XE5B 4Y28J 2AXCA 3QH9A 2I1KA 4H13C 1H89A 2OTLP 2CK3H 5GTIE 1VQNP 4ASVA 1LTGC 1SQPD 1EZVD 2NZ2A 4HJGH 1EC5A 1FDIA 1HJ0A 1U7MA 5AW4B 3V4WA 1YQ3C 1VQ5P 1IFIA 1SFCA 4PD4D 1H0TB 1DEEG 3L71G 4C46A 3M0DC 1PP9E 1ZXGA 2IZ1A 2JWDA 2QE7H 2D2CB 2QJKC 2ZVNB 2QJKB 2V7QH 4L73A 3BCCE 3L74E 3M91A 2ZYGA 1L0LK 4WY4D 5KAIE 3WU2H 4JBZA 2FFDA 4IFMA 2W27A 1YHQP 1DD4A 1YBKA 3IFMA 1IO4A 1L4AC 3H32A 3PRJA 3L70G 2WSFH 2HPCB 1JEKA 3L35A 3N4XA 5E79H 1FC2C 1NU1D 2O01J 2RKLA 3L36A 1HJBA 1LWUB 5KJ7D 2FFDB 5AVUB 2Q7CA 4H0LB 5CCGC 2OQQA 4W7YA 2P58A 2Z4EA 2FBWC 3TSIA 1PP9D 3F89A 4UB6H 1NTMG 2AEJA 3CXHH 4XA4A 1Y47A 3A0BE 5CCHD 1GW4A 3D71A 1MFZA 2ZYAA 2BASA 2PGDA 3CPWO 1OW7A 2Y0DA 1L2PA 2FKWB 3W68A 2C9NY 2E75B 3KYQA 4H44C 1ZLLA 4QMAA 3CMEP 3P8MC 1M7LA 3IAOA 3U1AA 3CC2P 3BCCG 3L74G 1NOHA 2MJZA 1P84D 2WPVB 3AE8C 2W6AA 3O6QB 2BEQD 1NU1E 5CBOA 3Q5PA 1M8OB 1PZQA 3CWBJ 2R3SA 2E76C 1SQVG 2J59M 3SWYA 3RK2B 1LT9A 3FGAD 1PIXA 1RF0A 4D6TJ 1Y9BA 2WT7B 2VRSA 3S9OA 2QEXP 3L37A 2E43A 3M0AA 1BDDA 2K9JB 3H1HE 2FXPA 3RK3D 3JCUH 3KZIH 3JSVC 1KQGB 4PV1B 4W7ZA 2NPSB 2ZXEB 4YXWH 1PL5A 1KQSO 1A02J 3T97A 3D70A 1W5CE 2WSSH 5AVZB 4WWIA 3GLMA 1HGZA 2QM8A 4H44D 3GHGC 5CJ0A 2PFXA 1CSBA 3FWLA 5B66H 2K9JA 2Q9IA 1Q90D 4U3FD 1YJ9P 2WSCJ 1LTTC 5AVXB 2L5GB 1GL2B 3MUDA 3VMXA 5KKZC 2E42A 1FJKA 1OW6A 1FZEA 1X79B 2Y9YA 1FZCC 3PP5A 1KB9D 2GM4A 2C0XA 4CPGA 1CZQA 1SQVD 3VP8A 1T2KD 1JY2P 4IFDK 1SQBE 1GU4A 1S5LE 4AUWA 2J58A 1PGQA 1LJ2A 1G1IA 2K1AA 1KFMA 2IZ0A 2WVRA 3NTNA 3P8CD 1NTZK 4MN4C 4BWNA 2BEZF 2RH0A 1RQUA 3G6EP 2JDIH 4NPEA 2QJPB 4DZOA 2RN0A 1OWAA 2YIUB 1KFNA 2I1JA 1YTZI 1YYCA 4DOJA 2CPSA 1R5LA 5KLVK 4Y99B 2QSIA 4I1LA 5APQA 3WMM0 2JWAA 3TF5A 2YKOA 3SWFA 3M9BA 1NTKK 1R8EA 2QIWA 3GHGA 1QVFO 2PP6A 5KLIB 3GHGB 2Q1KA 3CX5I 2G8YA 3L73E 4TT3H 5DJUB 1IK9A 1NAFA 1OZHA 3W67A 3RBZA 3B8EB 1SQBD 1PP9J 2NPSD 3USSA 1JY3O 1SQVE 4LLHA 2HPCA 5AVWB 1BCCE 1KMIZ 2E74B 2C0WA 2HODB 1FE6A 2HLOA 1P84E 1P84H 3H1KD 1HH0A 2YMKA 3C9IA 4HYTB 1JB0J 1HWTC 5TISH 1EXJA 3GG2A 5AW9B 3SFDC 1E79H 3EFFK 3H1LD 5CMZA 4D6TG 1EXIA 3Q1MA 1YIJP 1VQKP 1NKNA 1N7SC 1SQBG 1GU5A 1BGYE 5H2FH 3M06A 1ZMEC 4LC1A 1NTKG 1Z56A 5BVZA 5AW3B 1H0TA 2KUBA 3H1JE 3M9HA 3OJAB 3B71A 1PGOA 1RE4A 4D6TD 1NWQA 1SVFA 4L75A 2K37A 1KN7A 4WY4A 2A45H 3CX5H 2B89A 1NTKJ 2WZ7A 1BE3E 2B87A 3V2RA 1GZLA 2A06E 5C39A 2JEEA 1OFCX 1S1CX 3OAKA 2E5TA 2AEMA 3CMAP 2BCCD 2QJYB 1Y8AA 4O9BA 2W8ZA 5AVVB 1BCCG 3A0BH 1USDA 1PPJE 4OGQD 3S4RA 5KJ7A 4WY4B 1NHLA 1KB9H 2V7QJ 1NTZD 2N1TB 2Y0EA 3NFQA 1URQC 5EFWB 1KV4A 1AV1A 2WT7A 1EZVE 4D6TE 1BSNA 2G3AA 3G3ZA 2IPPA 3AEAC 3TGUD 2N9YB 1N7SB 4N3YB 3NMDA 3L75J 4W80A 5CCHA 3AE4C 5K5GB 3CCRP 4HH2A 1VF5D 1P84I 2H8PD 2XZRA 1KILD 1NTMJ 1G2CB 1LT1A 3AE9C 2JR8A 4U3FG 3VYIA 3CCLP 1AQTA 1QL1A 3BRTB 2Y9ZA 1OVUA 2WPRA 1VPCA 2A45I 1PGPA 4L76A 1GL2D 3TGUG 1VDFA 3MIWA 3HUSA 1YI2P 3D6YA 3MUDC 1RHZB 2B88A 3H1ID 5M1BA 1M1JB 1KD1Q 1AQ5A 1S5LX 1VQ4P 4K35A 1SQQD 4YXDC 3AE7C 4H0LC 3V4QA 2A06G 2FYNC 1L4AB 3OW2O 3EFGA 1EQ7A 1D7MA 2HG5D 1LWUC 3L72E 5AW8B 2JP3A 1L0LJ 2LR2A 2ZT9C 3V2NA 3KZIE 4RESB 1NJIQ 3RGUA 4BXLA 1BGYG 1Q82Q 2Q5UA 1L0NJ 3HTKB 3CCUP 3GW6A 1RQVA 1SFCC 4M3LA 3AEGC 2ZJSE 1NTKE 4GODA 2A45G 4I2LC 1K05A 1SQBJ 3CCQP 1NH4A 1JY2N 2P2UA 3WUVA 2P7JA 3A2AA 1GL2C 1ZR4A 2K88A 2NRGA 2P1JA 2IYPA 2W6BA 3P7KA 1UIIA 3GMAA 1S9KD 1LT9C 1NTZG 1NU1J 1S2EA 2FYUD 3CXHI 3L71E 1N73C 5APVA 2LXBA 2YKPA 1KILC 3K5BA 3TNUB 1NGMB 3FXEA 1M1JC
chains in the Genus database with same CATH topology
2HFED 1SQXK 4EIJA 3MGNA 1URQD 3U59A 4JYCA 4C7NA 3LIEA 3TYYA 2OYHA 5APSA 3RL0B 3RL0C 4AQRD 1IFJA 2WPQA 3M0DA 2Q3IA 4N78D 5CHXA 2XKMA 1SQVK 1XTGB 2FFDC 1SP4A 4C7NB 1LTAC 1N7LA 1IC2A 2YO3A 4I6MC 1N73A 1N73B 1CW5A 1IJDB 1SQPK 2WSCH 1HUCA 3L4FA 3P32A 3N7NA 2GUVA 1N2DC 2IFNA 1RF0C 2ZFCA 3RK2C 3HRNA 2R3CA 5APUA 4JYBA 3HE4B 2NPSC 2IFMA 5AW5B 1WT6A 4GIFA 1PFIA 1GDTA 1NO4A 3IR9A 3NXSA 3M9QA 3VMZA 1LTJC 1FDMA 2FYZA 2KSJA 1GTWA 3VTPC 5APWA 5CJ4A 5AVYB 2N1TD 2WPSA 3BASA 1JMMA 3HE5B 2N9BA 1T2KC 3KPEA 1J1DB 2KOGA 2WWWA 2YNYA 1J2JB 2KLVA 3BRVB 2WTYA 1DH3A 1KILB 1WRGA 4N6JA 1NU1K 1M1JA 1HGVA 4N78E 2O1JA 3KDPB 3P8CE 1SQBK 2Z5IA 1QL2A 5APYA 3E1IA 1FOSE 1JY3P 4Y99C 3V2PA 2NPSA 2R5DA 3HD7C 3CL3D 3CLQA 5AW8B 5AW1B 1GK4A 1MV8A 1URQB 3RK3C 4C7RA 1N7SA 1FAVA 2KP8A 1A02F 3MD0A 3A5TA 3EQ2A 3HD7A 3HD7D 3V2QA 2FXMA 5APTA 3H6PA 3R2PA 3MTUE 4WBAA 1JY2O 2HODA 1SLQA 1RF1B 2PAJA 5CCHC 5BU5A 3OA7A 2M8RA 5KTBA 2Z5HA 1LTSC 1E5WA 1JTHB 1URQA 3B5NA 5CCGD 1T3UA 2XV5A 2OYIA 5KJ7C 1SFCB 2H7HA 3II6A 2N1TC 3LW5H 2KYVA 3HE5A 1H88A 3CI9A 2O1KA 1ZV8A 1JO5A 1L4AD 1JCDA 1LGHB 3A7OA 4WY4C 1HVVA 1YTZT 2OYIB 1FZFA 2CPBA 4OH8B 1LWUA 1GL2A 1KQLA 2LKMA 2POHA 2O01H 2IX7C 3RK2D 1T3JA 1X9VA 5BU8B 1ZN5A 4ZKUA 3RK3B 5AW7B 1T8ZA 3BVHA 2FYUK 4KHXA 1LT9B 1OXZA 3VP9A 2N1TA 1LTJB 4JF7A 4ZKPA 1JNMA 1IFNA 1J1EC 3TNUA 4IFFA 3U1CA 2WITA 1FU1A 2R5BA 1FZCA 2M3BA 1CI6B 2C9LY 5AW2B 1FZAA 3RL0D 2OYHB 2OYHC 1FZBA 1KZUB 1LTJA 1JY3N 2YO2A 4B86A 1N86A 1IFMA 1RE3A 1H8AA 1FJPA 3B5ND 5CCGA 3VOPA 1IFDA 2YMYA 1LTBC 2P67A 5AVRB 5AW0B 1DX7A 3TK1A 3H32B 1GW3A 2H43A 2KB7P 1J1EB 1KILA 1LTIC 3HTKA 1SFCD 4GKGA 4AYCA 1S9KE 1JTHA 1NTMK 2XDJA 1GK6A 1SQQK 5AVTB 3HE4A 3UIAA 1RF1A 5AW6B 3KQGA 1ZR2A 1CI6A 1JOCA 4LGDE 3V5BA 1HBWA 1G2CA 3A3YB 1G1JA 3HD7B 3B5NC 3B5NB 1FOSF 1MUUA 2HYNA 5APXA 1L4AA 2WSEH 3BATA 1NKZB 1AFOA 5AVSB 5AVQB 2QM7A 3HUSB 1J1DC 1RE4C 1W2EA 1FZCB 1RE3C 2XU6A 4WB4A 1L0NK 1JUNA 4EOTA 3LIDA 1RF1C 1GD2E 2XNXA 2GUSA 2YKQA 1X8YA 2OYIC 1FBMA 1MZ9A 3VMYA 1XTCC 1RY3A 1JCCA 3O8ZA 1HTLC 3I5CA 2OARA 1FZGA 3VN0A 1DEBA 2R32A 1N7SD 2JJLA 4GT1A 3HUSC 4XE5B 1H89A 2I1KA 1LTGC 5AW4B 3V4WA 1IFIA 1SFCA 4C46A 3M0DC 2FFDA 3M91A 1L0LK 4WY4D 4IFMA 2W27A 3IFMA 1IO4A 1L4AC 3H32A 2WSFH 2HPCB 3L35A 3N4XA 3L36A 1HJBA 1LWUB 5KJ7D 2FFDB 5AVUB 2Q7CA 5CCGC 4W7YA 2Z4EA 3TSIA 4XA4A 5CCHD 1GW4A 1MFZA 2BASA 2FKWB 2C9NY 3KYQA 1ZLLA 3P8MC 1M7LA 3U1AA 1NOHA 2MJZA 2W6AA 2J59M 3SWYA 3RK2B 1LT9A 1RF0A 2WT7B 2VRSA 3L37A 2E43A 3M0AA 3RK3D 4W7ZA 2NPSB 2ZXEB 1A02J 3T97A 5AVZB 1HGZA 2QM8A 3GHGC 5CJ0A 1CSBA 2Q9IA 1LTTC 5AVXB 2L5GB 1GL2B 3MUDA 3VMXA 2E42A 1FJKA 1FZEA 1X79B 1FZCC 3PP5A 2GM4A 2C0XA 1CZQA 3VP8A 1T2KD 1JY2P 4IFDK 1GU4A 4AUWA 2J58A 1G1IA 1KFMA 3NTNA 3P8CD 1NTZK 4DZOA 1OWAA 1KFNA 2I1JA 1YTZI 1YYCA 4DOJA 2CPSA 5KLVK 4Y99B 4I1LA 5APQA 3WMM0 2YKOA 3SWFA 3M9BA 1NTKK 3GHGA 2PP6A 3GHGB 1IK9A 1NAFA 3B8EB 2NPSD 1JY3O 4LLHA 2HPCA 5AVWB 2HODB 2C0WA 2HLOA 1HH0A 3C9IA 4HYTB 1HWTC 5AW9B 5CMZA 1NKNA 1N7SC 1GU5A 3M06A 4LC1A 1Z56A 5BVZA 5AW3B 3M9HA 3OJAB 1RE4A 1NWQA 1SVFA 4WY4A 2A45H 2WZ7A 3V2RA 1GZLA 2JEEA 3OAKA 4O9BA 5AVVB 5KJ7A 4WY4B 3NFQA 1NHLA 2N1TB 1URQC 2WT7A 3G3ZA 2IPPA 1N7SB 4N3YB 3NMDA 4W80A 5CCHA 4HH2A 2H8PD 2XZRA 1KILD 1G2CB 3VYIA 1QL1A 3BRTB 2WPRA 1VPCA 2A45I 1GL2D 1VDFA 3MIWA 3HUSA 1M1JB 1AQ5A 3V4QA 1L4AB 3EFGA 1EQ7A 2HG5D 1LWUC 3V2NA 4RESB 2Q5UA 3HTKB 1SFCC 4M3LA 2A45G 4I2LC 1NH4A 1JY2N 2P2UA 2P7JA 3A2AA 1GL2C 1ZR4A 2P1JA 2W6BA 3P7KA 1S9KD 1LT9C 1N73C 5APVA 2YKPA 1KILC 3TNUB 1M1JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVX B;  3VMX A;  1FOS F;  1MUU A;  2E42 A;  2Z5H A;  5APX A;  3MGN A;  5AVS B;  2XV5 A;  1CZQ A;  4JYC A;  5AVQ B;  4C7N A;  3LIE A;  3TYY A;  2QM7 A;  1T2K D;  5APS A;  2H7H A;  4AQR D;  1GU4 A;  4AUW A;  3HE5 A;  3NTN A;  1H88 A;  2WPQ A;  2XU6 A;  3M0D A;  2Q3I A;  4DZO A;  1JUN A;  1OWA A;  4EOT A;  3LID A;  1YYC A;  1GD2 E;  3A7O A;  1SP4 A;  5APQ A;  4C7N B;  1X8Y A;  3SWF A;  3M9B A;  3VMY A;  4I6M C;  2YO3 A;  3O8Z A;  3I5C A;  1NAF A;  1KQL A;  3B8E B;  3VN0 A;  1HUC A;  2R32 A;  3P32 A;  5AVW B;  2JJL A;  4GT1 A;  4XE5 B;  1HWT C;  4HYT B;  1H89 A;  2ZFC A;  5AW9 B;  5CMZ A;  2R3C A;  5APU A;  1GU5 A;  5AW4 B;  3V4W A;  4JYB A;  3HE4 B;  3M06 A;  4LC1 A;  5AW7 B;  5AW3 B;  5AW5 B;  4C46 A;  3M9H A;  4KHX A;  3IR9 A;  3NXS A;  1OXZ A;  1NWQ A;  3VMZ A;  3M91 A;  1JNM A;  1GTW A;  1GZL A;  2W27 A;  3VTP C;  3TNU A;  1IO4 A;  5APW A;  2R5B A;  3OAK A;  5AVY B;  1CI6 B;  2C9L Y;  3L35 A;  5AW2 B;  2WPS A;  3HE5 B;  3L36 A;  5AVV B;  1HJB A;  2N9B A;  1T2K C;  3NFQ A;  2WWW A;  5AVU B;  2Q7C A;  2YO2 A;  4B86 A;  2WT7 A;  2YNY A;  1J2J B;  2IPP A;  1H8A A;  3NMD A;  2WTY A;  1DH3 A;  1MFZ A;  2XZR A;  2BAS A;  1G2C B;  3KDP B;  3VYI A;  2C9N Y;  5AVR B;  2P67 A;  5AW0 B;  2WPR A;  3TK1 A;  2Z5I A;  3P8M C;  5APY A;  1FOS E;  2W6A A;  2R5D A;  5AW8 B;  5AW1 B;  1GK4 A;  1MV8 A;  3V4Q A;  3HTK A;  4GKG A;  4AYC A;  1S9K E;  1FAV A;  2KP8 A;  2WT7 B;  4RES B;  1A02 F;  2VRS A;  2Q5U A;  3L37 A;  3MD0 A;  1GK6 A;  3A5T A;  3M0A A;  2E43 A;  4M3L A;  5AVT B;  3HE4 A;  4I2L C;  3UIA A;  2ZXE B;  5AW6 B;  2P2U A;  1A02 J;  2P7J A;  3A2A A;  5APT A;  3T97 A;  3KQG A;  3P7K A;  5AVZ B;  1CI6 A;  1S9K D;  2QM8 A;  3V5B A;  5APV A;  1CSB A;  1SLQ A;  3TNU B;  1HBW A;  3A3Y B; 
#chains in the Genus database with same CATH topology
 2HFE D;  1SQX K;  3MP7 B;  3GF7 A;  4ZMD A;  3MHV A;  2WSE J;  1ZW0 A;  3CXH D;  1L0N E;  4EIJ A;  1ZRT E;  1OVR A;  3MGN A;  1PPJ G;  3ITK A;  3RL0 g;  1URQ D;  2FYU G;  2A06 D;  3CWB G;  4JYC A;  3U59 A;  4YPC A;  4KT0 J;  1BE3 D;  3LIE A;  3TYY A;  4C7N A;  5APS A;  4OGQ C;  1K9M Q;  3RL0 B;  3E7K A;  3RL0 C;  4R4M A;  4AQR D;  3O6Q A;  3H1H J;  1IFJ A;  2WPQ A;  5B5E H;  2ZYD A;  1KOR A;  2KLU A;  3M0D A;  1S4X A;  2Q3I A;  5E79 E;  5CBN A;  3I55 P;  4N78 D;  5CHX A;  1QEX A;  2XKM A;  4HKZ H;  1SQV K;  2BCC J;  3SSU A;  1XTG B;  2FFD C;  4IL6 X;  1SP4 A;  4C7N B;  4PJ0 E;  2QG4 A;  3SFE C;  1LTA C;  3TGU E;  1N7L A;  3RBX A;  1IC2 A;  2YO3 A;  1NTZ J;  4I6M C;  3C8V A;  4ASW A;  1VQP P;  4H13 B;  1EDK A;  1N73 A;  1NAY A;  3KHU A;  3L73 J;  1N73 B;  1CW5 A;  5KAF H;  3CCM P;  1IJD B;  2OTK E;  1K04 A;  1SQP K;  1USE A;  3AE5 C;  3L70 D;  2BCC G;  2WSC H;  1HUC A;  3L4F A;  3P32 A;  1Q2N A;  3N7N A;  2KZJ A;  5KKZ B;  4NPD A;  2GUV A;  1VQ9 P;  1BDC A;  3H1I E;  3TDK A;  2DW3 A;  1N2D C;  2IFN A;  1RF0 C;  2ZFC A;  3RK2 C;  1VQ6 P;  3HRN A;  4RKU J;  3LW5 J;  2R3C A;  5APU A;  2ZAE B;  3AE6 C;  1M57 D;  4U3F J;  3AE3 C;  4PV1 D;  4EYY Q;  1Q81 Q;  1L0L E;  4JYB A;  2FYN B;  3HE4 B;  1PPJ D;  4I7Z B;  2NPS C;  3V6I A;  4PD4 H;  2IFM A;  4HB1 A;  5AW5 B;  1WT6 A;  4GIF A;  1PFI A;  4EDF A;  1GDT A;  1NO4 A;  2E75 D;  3IR9 A;  1SQV J;  3M9Q A;  3NXS A;  2M5A A;  2L91 A;  3VMZ A;  1LTJ C;  1FDM A;  3RK3 E;  2FYZ A;  2KSJ A;  1GTW A;  2KZI A;  1U7J A;  1L0N G;  1SQQ G;  2XND H;  2YXR B;  1UIX A;  3VTP C;  2KS1 B;  5APW A;  2FYU E;  3L71 D;  1EZV I;  5CJ4 A;  1K73 Q;  1ZOY C;  2IBZ I;  5AVY B;  1QVG O;  1KC8 Q;  2KXP B;  5TJH A;  2N1T D;  2WPS A;  3BAS A;  1JMM A;  3HE5 B;  1LP1 A;  2N9B A;  2RMZ A;  3KXD A;  4K3A A;  4A7P A;  3KPE A;  1J1D B;  2KOG A;  1QGK B;  2WWW A;  2KSE A;  1T2K C;  5KAI H;  2P10 A;  3G9R A;  2KIK A;  1X22 A;  2YNY A;  1J2J B;  3CCS P;  2KLV A;  5KLV J;  3BRV B;  2WTY A;  1DH3 A;  1KIL B;  1WRG A;  4N6J A;  2OYH A;  1NU1 K;  2AXT E;  2MKV A;  3H1J J;  1M1J A;  1EDJ A;  4OVN F;  1HGV A;  3AEE C;  1M56 D;  1BE3 J;  1IZN B;  2OYO A;  3A0H E;  4N78 E;  1SQX J;  2O1J A;  3KDP B;  1KYO E;  2UWJ E;  2WSF J;  3PHL A;  3Q5R A;  4JQ0 D;  3P8C E;  1VQM P;  1BGY J;  1PGJ A;  1SQB K;  2Z5I A;  1QL2 A;  5APY A;  4DCK A;  2Q6Q A;  2QRX A;  5GTI H;  3E1I A;  1FOS E;  1JY3 P;  4Y99 C;  3S1K A;  2NPS A;  2R5D A;  3HD7 C;  2E74 D;  3CL3 D;  1LNQ A;  2JKV A;  3CLQ A;  1GK4 A;  1URQ B;  1MV8 A;  5AW1 B;  1QX8 A;  3RK3 C;  3WUU A;  4C7R A;  1N7S A;  2Q3E A;  3L70 E;  4GOE A;  1S72 P;  3QWO C;  5B5E E;  3L72 J;  1FAV A;  2KP8 A;  3L75 E;  1A02 F;  4U7J A;  4R4L A;  1L0L G;  3MD0 A;  4DT0 A;  3A5T A;  3IF4 A;  3EQ2 A;  2E76 D;  3HD7 A;  4PJ0 H;  2AEF A;  2E74 C;  3HD7 D;  3AEC C;  1SQX E;  3V2Q A;  2FXM A;  1PP9 G;  4DJG A;  5APT A;  3H6P A;  2M0B A;  4PD4 I;  1DD3 A;  1NTM E;  3R2P A;  2IDB A;  3H1K E;  3MTU E;  4WBA A;  1K8A Q;  1JY2 O;  1N8R Q;  1RH5 B;  1SLQ A;  2HOD A;  3B4S A;  1SQQ E;  3C1L A;  2B87 B;  1GMJ A;  3MZW B;  5GTH H;  1RF1 B;  4I7Z C;  2PAJ A;  5CCH C;  5BU5 A;  3OA7 A;  2M8R A;  5KTB A;  3TGU J;  3AEB C;  4UB8 H;  1W2B O;  2Z5H A;  3L75 D;  1LTS C;  1KB9 E;  1E5W A;  1ZRT D;  2W6J H;  1JTH B;  1URQ A;  4IL6 E;  3B5N A;  5CCG D;  3H25 A;  1MKM A;  1T3U A;  2XV5 A;  1VL2 A;  2OYI A;  3AE1 C;  1SFC B;  5KJ7 C;  2H7H A;  1T6A A;  3II6 A;  1VQ7 P;  4TLF A;  2J5U A;  2N1T C;  2K9Y A;  3BCC D;  2ZT9 B;  2W83 C;  2KYV A;  1AA0 A;  3HE5 A;  3L74 D;  3LW5 H;  1YIT P;  3CI9 A;  1H88 A;  2O1K A;  1ZV8 A;  1JO5 A;  3H1I J;  2IYO A;  3CX5 E;  1L4A D;  3H1H G;  3L71 J;  1SQQ J;  1JCD A;  1LGH B;  3CC7 P;  2IBZ G;  2ZVO B;  3A7O A;  1BSH A;  4WY4 C;  1HVV A;  1YTZ T;  4YTP C;  2OYI B;  1L0L D;  2M5A B;  1FZF A;  1KTM A;  3CX5 D;  3FX0 A;  5L8R J;  2QA4 P;  1PV3 A;  1L0N D;  2CPB A;  2E75 C;  3H1L E;  4H44 B;  3WUT A;  2WQY C;  4OH8 B;  5H2F E;  1FDO A;  4EI2 A;  1LWU A;  1FS0 E;  1GL2 A;  1KQL A;  2ITA A;  4IOI H;  5KLV D;  1KYO D;  2KNC B;  2LKM A;  4WVZ A;  1Q7Y Q;  5B66 E;  5GTH E;  1YQ4 C;  2POH A;  3L75 G;  4PV1 C;  1OX3 A;  5TIS E;  2O01 H;  2IX7 C;  2KS1 A;  2FYU J;  3CC4 P;  2R44 A;  1IFP A;  1T3J A;  1X9V A;  3L72 G;  4H13 D;  3RK2 D;  5BU8 B;  2HR3 A;  1M90 Q;  3PH0 A;  1SQX G;  3AEF C;  1ZN5 A;  4ZKU A;  3RK3 B;  1VQL P;  1S3J A;  4KJM A;  1KB9 I;  5AW7 B;  2E5Y A;  3Q2Y A;  1T8Z A;  4XFJ A;  5KLI C;  3H1K G;  3BVH A;  3IN6 A;  4ZNC A;  2FYU K;  2Y0C A;  4KHX A;  1LT9 B;  4RJT A;  1MFT A;  3L72 D;  1OXZ A;  1WMK A;  2IBZ E;  3VP9 A;  2QJY C;  2N1T A;  3R4Y A;  1LTJ B;  1NTZ E;  4JF7 A;  3EWK A;  2D2C D;  3H1H D;  4L74 A;  4ZKP A;  1JNM A;  3F5H A;  1IFN A;  2KI7 B;  1NYH A;  2W90 A;  1J1E C;  3L73 G;  4IFF A;  3TNU A;  2WIT A;  1FU1 A;  3U1C A;  3CD6 P;  1S5L H;  2R5B A;  5KLV G;  1YJN P;  1FZC A;  2M3B A;  2K3R A;  3A0H H;  3FXD A;  1CI6 B;  2C9L Y;  5AW2 B;  1FZA A;  1KIL E;  2JO1 A;  3RL0 D;  4OWF A;  2OYH C;  2OYH B;  1SS1 A;  1FZB A;  1KZU B;  1LTJ A;  3CWB E;  1JY3 N;  3CCJ P;  1AVO A;  1VQO P;  2YO2 A;  4B86 A;  3L73 D;  1X0T A;  3SWK A;  1KYO I;  1SQP G;  3AED C;  2LXC B;  3L70 J;  1N86 A;  1IFM A;  1RE3 A;  1H8A A;  1FJP A;  3B5N D;  1JMB A;  5CCG A;  2WMM A;  3VOP A;  3ZDM A;  1IFD A;  4OGQ B;  2M3E A;  1BCC D;  5DJT B;  2YMY A;  4UB8 E;  3H1L G;  3Q3D A;  3ABV C;  1OIP A;  3H1J G;  1AJY A;  1LTB C;  1SQP J;  2P67 A;  3BCC J;  3L74 J;  5AVR B;  5AW0 B;  3TK1 A;  1DX7 A;  3H32 B;  1GW3 A;  2H43 A;  3D6Z A;  2O3J A;  3JCU E;  2H88 C;  2KB7 P;  2OGU A;  1VF5 B;  4RO0 A;  1JM0 A;  1AVY A;  1NVO A;  1J1E B;  1KIL A;  2FXO A;  2I8D A;  1LTI C;  2BCC E;  4GDO A;  3HTK A;  1SFC D;  5KLV E;  4GKG A;  4AYC A;  1S9K E;  2OTJ P;  3Q5S A;  1JTH A;  2ZT9 D;  1NTM K;  4PD4 E;  2XDJ A;  4Z1M H;  1GK6 A;  1QLE D;  2QJP C;  1LP1 B;  1EDI A;  1SQQ K;  4H0L D;  3HE4 A;  5AVT B;  2IBZ D;  3UIA A;  1RF1 A;  5AW6 B;  1SQP E;  3KQG A;  3PJS K;  1EDL A;  3H1K J;  1ZR2 A;  1CI6 A;  1JOC A;  4LGD E;  3V5B A;  2AXT H;  3T97 B;  1OMI A;  1BE3 G;  3H1L J;  4GOF A;  4UB6 E;  3VMA A;  1HBW A;  1G2C A;  3A3Y B;  1KYO H;  1G1J A;  1VF5 C;  4U3F E;  3CCV P;  3HD7 B;  5KAF E;  3CCE P;  1HF9 A;  3B5N C;  2ZXX A;  3B5N B;  3V2P A;  1FOS F;  1MUU A;  2HYN A;  1U57 A;  3H1I G;  4IL6 H;  2H89 C;  3E1R A;  1L4A A;  2WSE H;  3BAT A;  3CXH E;  1NKZ B;  5APX A;  3G71 P;  3H1J D;  1AFO A;  5AVS B;  5AVQ B;  2QM7 A;  4BRY B;  2KK7 A;  1SQX D;  3AE2 C;  3HUS B;  1EZV G;  3G4S P;  2PRR A;  1J1D C;  3PLN A;  1BGY D;  1RE4 C;  1NTK D;  1W2E A;  3FWN A;  1FZC B;  1RE3 C;  2XU6 A;  2O01 N;  4WB4 A;  1L0N K;  1JUN A;  4EOT A;  3WU2 E;  2V4H A;  3LID A;  4JPZ B;  3CWB D;  1RF1 C;  1OW8 A;  1GD2 E;  2D2C C;  2XNX A;  2GUS A;  1R5S A;  2YKQ A;  1YJW P;  1X8Y A;  2OYI C;  1Q86 Q;  1FBM A;  2QVA A;  4NPF X;  1M1K Q;  1ZP0 C;  2E76 B;  1MZ9 A;  3VMY A;  3I56 P;  1TU3 F;  2GA1 A;  1XTC C;  1RY3 A;  2KNC A;  1JCC A;  3GF3 A;  3O8Z A;  2YIU C;  1HTL C;  3I5C A;  1DIP A;  2OAR A;  1KQF B;  2YXQ B;  3PTZ A;  1FZG A;  3JC2 2;  1VQ8 P;  2SPZ A;  3VN0 A;  1DEB A;  2R32 A;  1OVV A;  4BRY A;  1N7S D;  2B9B A;  1IK7 A;  2JJL A;  1NU1 G;  2FY8 A;  1BCC J;  3HUS C;  1NTM D;  4GT1 A;  4XE5 B;  4Y28 J;  2AXC A;  3QH9 A;  2I1K A;  4H13 C;  1H89 A;  2OTL P;  2CK3 H;  5GTI E;  1VQN P;  4ASV A;  1LTG C;  1SQP D;  1EZV D;  2NZ2 A;  4HJG H;  1EC5 A;  1FDI A;  1HJ0 A;  1U7M A;  5AW4 B;  3V4W A;  1YQ3 C;  1VQ5 P;  1IFI A;  1SFC A;  4PD4 D;  1H0T B;  1DEE G;  3L71 G;  4C46 A;  3M0D C;  1PP9 E;  1ZXG A;  2IZ1 A;  2JWD A;  2QE7 H;  2D2C B;  2QJK C;  2ZVN B;  2QJK B;  2V7Q H;  4L73 A;  3BCC E;  3L74 E;  3M91 A;  2ZYG A;  1L0L K;  4WY4 D;  5KAI E;  3WU2 H;  4JBZ A;  2FFD A;  4IFM A;  2W27 A;  1YHQ P;  1DD4 A;  1YBK A;  3IFM A;  1IO4 A;  1L4A C;  3H32 A;  3PRJ A;  3L70 G;  2WSF H;  2HPC B;  1JEK A;  3L35 A;  3N4X A;  5E79 H;  1FC2 C;  1NU1 D;  2O01 J;  2RKL A;  3L36 A;  1HJB A;  1LWU B;  5KJ7 D;  2FFD B;  5AVU B;  2Q7C A;  4H0L B;  5CCG C;  2OQQ A;  4W7Y A;  2P58 A;  2Z4E A;  2FBW C;  3TSI A;  1PP9 D;  3F89 A;  4UB6 H;  1NTM G;  2AEJ A;  3CXH H;  4XA4 A;  1Y47 A;  3A0B E;  5CCH D;  1GW4 A;  3D71 A;  1MFZ A;  2ZYA A;  2BAS A;  2PGD A;  3CPW O;  1OW7 A;  2Y0D A;  1L2P A;  2FKW B;  3W68 A;  2C9N Y;  2E75 B;  3KYQ A;  4H44 C;  1ZLL A;  4QMA A;  3CME P;  3P8M C;  1M7L A;  3IAO A;  3U1A A;  3CC2 P;  3BCC G;  3L74 G;  1NOH A;  2MJZ A;  1P84 D;  2WPV B;  3AE8 C;  2W6A A;  3O6Q B;  2BEQ D;  1NU1 E;  5CBO A;  3Q5P A;  1M8O B;  1PZQ A;  3CWB J;  2R3S A;  2E76 C;  1SQV G;  2J59 M;  3SWY A;  3RK2 B;  1LT9 A;  3FGA D;  1PIX A;  1RF0 A;  4D6T J;  1Y9B A;  2WT7 B;  2VRS A;  3S9O A;  2QEX P;  3L37 A;  2E43 A;  3M0A A;  1BDD A;  2K9J B;  3H1H E;  2FXP A;  3RK3 D;  3JCU H;  3KZI H;  3JSV C;  1KQG B;  4PV1 B;  4W7Z A;  2NPS B;  2ZXE B;  4YXW H;  1PL5 A;  1KQS O;  1A02 J;  3T97 A;  3D70 A;  1W5C E;  2WSS H;  5AVZ B;  4WWI A;  3GLM A;  1HGZ A;  2QM8 A;  4H44 D;  3GHG C;  5CJ0 A;  2PFX A;  1CSB A;  3FWL A;  5B66 H;  2K9J A;  2Q9I A;  1Q90 D;  4U3F D;  1YJ9 P;  2WSC J;  1LTT C;  5AVX B;  2L5G B;  1GL2 B;  3MUD A;  3VMX A;  5KKZ C;  2E42 A;  1FJK A;  1OW6 A;  1FZE A;  1X79 B;  2Y9Y A;  1FZC C;  3PP5 A;  1KB9 D;  2GM4 A;  2C0X A;  4CPG A;  1CZQ A;  1SQV D;  3VP8 A;  1T2K D;  1JY2 P;  4IFD K;  1SQB E;  1GU4 A;  1S5L E;  4AUW A;  2J58 A;  1PGQ A;  1LJ2 A;  1G1I A;  2K1A A;  1KFM A;  2IZ0 A;  2WVR A;  3NTN A;  3P8C D;  1NTZ K;  4MN4 C;  4BWN A;  2BEZ F;  2RH0 A;  1RQU A;  3G6E P;  2JDI H;  4NPE A;  2QJP B;  4DZO A;  2RN0 A;  1OWA A;  2YIU B;  1KFN A;  2I1J A;  1YTZ I;  1YYC A;  4DOJ A;  2CPS A;  1R5L A;  5KLV K;  4Y99 B;  2QSI A;  4I1L A;  5APQ A;  3WMM 0;  2JWA A;  3TF5 A;  2YKO A;  3SWF A;  3M9B A;  1NTK K;  1R8E A;  2QIW A;  3GHG A;  1QVF O;  2PP6 A;  5KLI B;  3GHG B;  2Q1K A;  3CX5 I;  2G8Y A;  3L73 E;  4TT3 H;  5DJU B;  1IK9 A;  1NAF A;  1OZH A;  3W67 A;  3RBZ A;  3B8E B;  1SQB D;  1PP9 J;  2NPS D;  3USS A;  1JY3 O;  1SQV E;  4LLH A;  2HPC A;  5AVW B;  1BCC E;  1KMI Z;  2E74 B;  2C0W A;  2HOD B;  1FE6 A;  2HLO A;  1P84 E;  1P84 H;  3H1K D;  1HH0 A;  2YMK A;  3C9I A;  4HYT B;  1JB0 J;  1HWT C;  5TIS H;  1EXJ A;  3GG2 A;  5AW9 B;  3SFD C;  1E79 H;  3EFF K;  3H1L D;  5CMZ A;  4D6T G;  1EXI A;  3Q1M A;  1YIJ P;  1VQK P;  1NKN A;  1N7S C;  1SQB G;  1GU5 A;  1BGY E;  5H2F H;  3M06 A;  1ZME C;  4LC1 A;  1NTK G;  1Z56 A;  5BVZ A;  5AW3 B;  1H0T A;  2KUB A;  3H1J E;  3M9H A;  3OJA B;  3B71 A;  1PGO A;  1RE4 A;  4D6T D;  1NWQ A;  1SVF A;  4L75 A;  2K37 A;  1KN7 A;  4WY4 A;  2A45 H;  3CX5 H;  2B89 A;  1NTK J;  2WZ7 A;  1BE3 E;  2B87 A;  3V2R A;  1GZL A;  2A06 E;  5C39 A;  2JEE A;  1OFC X;  1S1C X;  3OAK A;  2E5T A;  2AEM A;  3CMA P;  2BCC D;  2QJY B;  1Y8A A;  4O9B A;  2W8Z A;  5AVV B;  1BCC G;  3A0B H;  1USD A;  1PPJ E;  4OGQ D;  3S4R A;  5KJ7 A;  4WY4 B;  1NHL A;  1KB9 H;  2V7Q J;  1NTZ D;  2N1T B;  2Y0E A;  3NFQ A;  1URQ C;  5EFW B;  1KV4 A;  1AV1 A;  2WT7 A;  1EZV E;  4D6T E;  1BSN A;  2G3A A;  3G3Z A;  2IPP A;  3AEA C;  3TGU D;  2N9Y B;  1N7S B;  4N3Y B;  3NMD A;  3L75 J;  4W80 A;  5CCH A;  3AE4 C;  5K5G B;  3CCR P;  4HH2 A;  1VF5 D;  1P84 I;  2H8P D;  2XZR A;  1KIL D;  1NTM J;  1G2C B;  1LT1 A;  3AE9 C;  2JR8 A;  4U3F G;  3VYI A;  3CCL P;  1AQT A;  1QL1 A;  3BRT B;  2Y9Z A;  1OVU A;  2WPR A;  1VPC A;  2A45 I;  1PGP A;  4L76 A;  1GL2 D;  3TGU G;  1VDF A;  3MIW A;  3HUS A;  1YI2 P;  3D6Y A;  3MUD C;  1RHZ B;  2B88 A;  3H1I D;  5M1B A;  1M1J B;  1KD1 Q;  1AQ5 A;  1S5L X;  1VQ4 P;  4K35 A;  1SQQ D;  4YXD C;  3AE7 C;  4H0L C;  3V4Q A;  2A06 G;  2FYN C;  1L4A B;  3OW2 O;  3EFG A;  1EQ7 A;  1D7M A;  2HG5 D;  1LWU C;  3L72 E;  5AW8 B;  2JP3 A;  1L0L J;  2LR2 A;  2ZT9 C;  3V2N A;  3KZI E;  4RES B;  1NJI Q;  3RGU A;  4BXL A;  1BGY G;  1Q82 Q;  2Q5U A;  1L0N J;  3HTK B;  3CCU P;  3GW6 A;  1RQV A;  1SFC C;  4M3L A;  3AEG C;  2ZJS E;  1NTK E;  4GOD A;  2A45 G;  4I2L C;  1K05 A;  1SQB J;  3CCQ P;  1NH4 A;  1JY2 N;  2P2U A;  3WUV A;  2P7J A;  3A2A A;  1GL2 C;  1ZR4 A;  2K88 A;  2NRG A;  2P1J A;  2IYP A;  2W6B A;  3P7K A;  1UII A;  3GMA A;  1S9K D;  1LT9 C;  1NTZ G;  1NU1 J;  1S2E A;  2FYU D;  3CXH I;  3L71 E;  1N73 C;  5APV A;  2LXB A;  2YKP A;  1KIL C;  3K5B A;  3TNU B;  1NGM B;  3FXE A;  1M1J C; 
#chains in the Genus database with same CATH homology
 2HFE D;  1SQX K;  4EIJ A;  3MGN A;  1URQ D;  3U59 A;  4JYC A;  4C7N A;  3LIE A;  3TYY A;  2OYH A;  5APS A;  3RL0 B;  3RL0 C;  4AQR D;  1IFJ A;  2WPQ A;  3M0D A;  2Q3I A;  4N78 D;  5CHX A;  2XKM A;  1SQV K;  1XTG B;  2FFD C;  1SP4 A;  4C7N B;  1LTA C;  1N7L A;  1IC2 A;  2YO3 A;  4I6M C;  1N73 A;  1N73 B;  1CW5 A;  1IJD B;  1SQP K;  2WSC H;  1HUC A;  3L4F A;  3P32 A;  3N7N A;  2GUV A;  1N2D C;  2IFN A;  1RF0 C;  2ZFC A;  3RK2 C;  3HRN A;  2R3C A;  5APU A;  4JYB A;  3HE4 B;  2NPS C;  2IFM A;  5AW5 B;  1WT6 A;  4GIF A;  1PFI A;  1GDT A;  1NO4 A;  3IR9 A;  3NXS A;  3M9Q A;  3VMZ A;  1LTJ C;  1FDM A;  2FYZ A;  2KSJ A;  1GTW A;  3VTP C;  5APW A;  5CJ4 A;  5AVY B;  2N1T D;  2WPS A;  3BAS A;  1JMM A;  3HE5 B;  2N9B A;  1T2K C;  3KPE A;  1J1D B;  2KOG A;  2WWW A;  2YNY A;  1J2J B;  2KLV A;  3BRV B;  2WTY A;  1DH3 A;  1KIL B;  1WRG A;  4N6J A;  1NU1 K;  1M1J A;  1HGV A;  4N78 E;  2O1J A;  3KDP B;  3P8C E;  1SQB K;  2Z5I A;  1QL2 A;  5APY A;  3E1I A;  1FOS E;  1JY3 P;  4Y99 C;  3V2P A;  2NPS A;  2R5D A;  3HD7 C;  3CL3 D;  3CLQ A;  5AW8 B;  5AW1 B;  1GK4 A;  1MV8 A;  1URQ B;  3RK3 C;  4C7R A;  1N7S A;  1FAV A;  2KP8 A;  1A02 F;  3MD0 A;  3A5T A;  3EQ2 A;  3HD7 A;  3HD7 D;  3V2Q A;  2FXM A;  5APT A;  3H6P A;  3R2P A;  3MTU E;  4WBA A;  1JY2 O;  2HOD A;  1SLQ A;  1RF1 B;  2PAJ A;  5CCH C;  5BU5 A;  3OA7 A;  2M8R A;  5KTB A;  2Z5H A;  1LTS C;  1E5W A;  1JTH B;  1URQ A;  3B5N A;  5CCG D;  1T3U A;  2XV5 A;  2OYI A;  5KJ7 C;  1SFC B;  2H7H A;  3II6 A;  2N1T C;  3LW5 H;  2KYV A;  3HE5 A;  1H88 A;  3CI9 A;  2O1K A;  1ZV8 A;  1JO5 A;  1L4A D;  1JCD A;  1LGH B;  3A7O A;  4WY4 C;  1HVV A;  1YTZ T;  2OYI B;  1FZF A;  2CPB A;  4OH8 B;  1LWU A;  1GL2 A;  1KQL A;  2LKM A;  2POH A;  2O01 H;  2IX7 C;  3RK2 D;  1T3J A;  1X9V A;  5BU8 B;  1ZN5 A;  4ZKU A;  3RK3 B;  5AW7 B;  1T8Z A;  3BVH A;  2FYU K;  4KHX A;  1LT9 B;  1OXZ A;  3VP9 A;  2N1T A;  1LTJ B;  4JF7 A;  4ZKP A;  1JNM A;  1IFN A;  1J1E C;  3TNU A;  4IFF A;  3U1C A;  2WIT A;  1FU1 A;  2R5B A;  1FZC A;  2M3B A;  1CI6 B;  2C9L Y;  5AW2 B;  1FZA A;  3RL0 D;  2OYH B;  2OYH C;  1FZB A;  1KZU B;  1LTJ A;  1JY3 N;  2YO2 A;  4B86 A;  1N86 A;  1IFM A;  1RE3 A;  1H8A A;  1FJP A;  3B5N D;  5CCG A;  3VOP A;  1IFD A;  2YMY A;  1LTB C;  2P67 A;  5AVR B;  5AW0 B;  1DX7 A;  3TK1 A;  3H32 B;  1GW3 A;  2H43 A;  2KB7 P;  1J1E B;  1KIL A;  1LTI C;  3HTK A;  1SFC D;  4GKG A;  4AYC A;  1S9K E;  1JTH A;  1NTM K;  2XDJ A;  1GK6 A;  1SQQ K;  5AVT B;  3HE4 A;  3UIA A;  1RF1 A;  5AW6 B;  3KQG A;  1ZR2 A;  1CI6 A;  1JOC A;  4LGD E;  3V5B A;  1HBW A;  1G2C A;  3A3Y B;  1G1J A;  3HD7 B;  3B5N C;  3B5N B;  1FOS F;  1MUU A;  2HYN A;  5APX A;  1L4A A;  2WSE H;  3BAT A;  1NKZ B;  1AFO A;  5AVS B;  5AVQ B;  2QM7 A;  3HUS B;  1J1D C;  1RE4 C;  1W2E A;  1FZC B;  1RE3 C;  2XU6 A;  4WB4 A;  1L0N K;  1JUN A;  4EOT A;  3LID A;  1RF1 C;  1GD2 E;  2XNX A;  2GUS A;  2YKQ A;  1X8Y A;  2OYI C;  1FBM A;  1MZ9 A;  3VMY A;  1XTC C;  1RY3 A;  1JCC A;  3O8Z A;  1HTL C;  3I5C A;  2OAR A;  1FZG A;  3VN0 A;  1DEB A;  2R32 A;  1N7S D;  2JJL A;  4GT1 A;  3HUS C;  4XE5 B;  1H89 A;  2I1K A;  1LTG C;  5AW4 B;  3V4W A;  1IFI A;  1SFC A;  4C46 A;  3M0D C;  2FFD A;  3M91 A;  1L0L K;  4WY4 D;  4IFM A;  2W27 A;  3IFM A;  1IO4 A;  1L4A C;  3H32 A;  2WSF H;  2HPC B;  3L35 A;  3N4X A;  3L36 A;  1HJB A;  1LWU B;  5KJ7 D;  2FFD B;  5AVU B;  2Q7C A;  5CCG C;  4W7Y A;  2Z4E A;  3TSI A;  4XA4 A;  5CCH D;  1GW4 A;  1MFZ A;  2BAS A;  2FKW B;  2C9N Y;  3KYQ A;  1ZLL A;  3P8M C;  1M7L A;  3U1A A;  1NOH A;  2MJZ A;  2W6A A;  2J59 M;  3SWY A;  3RK2 B;  1LT9 A;  1RF0 A;  2WT7 B;  2VRS A;  3L37 A;  2E43 A;  3M0A A;  3RK3 D;  4W7Z A;  2NPS B;  2ZXE B;  1A02 J;  3T97 A;  5AVZ B;  1HGZ A;  2QM8 A;  3GHG C;  5CJ0 A;  1CSB A;  2Q9I A;  1LTT C;  5AVX B;  2L5G B;  1GL2 B;  3MUD A;  3VMX A;  2E42 A;  1FJK A;  1FZE A;  1X79 B;  1FZC C;  3PP5 A;  2GM4 A;  2C0X A;  1CZQ A;  3VP8 A;  1T2K D;  1JY2 P;  4IFD K;  1GU4 A;  4AUW A;  2J58 A;  1G1I A;  1KFM A;  3NTN A;  3P8C D;  1NTZ K;  4DZO A;  1OWA A;  1KFN A;  2I1J A;  1YTZ I;  1YYC A;  4DOJ A;  2CPS A;  5KLV K;  4Y99 B;  4I1L A;  5APQ A;  3WMM 0;  2YKO A;  3SWF A;  3M9B A;  1NTK K;  3GHG A;  2PP6 A;  3GHG B;  1IK9 A;  1NAF A;  3B8E B;  2NPS D;  1JY3 O;  4LLH A;  2HPC A;  5AVW B;  2HOD B;  2C0W A;  2HLO A;  1HH0 A;  3C9I A;  4HYT B;  1HWT C;  5AW9 B;  5CMZ A;  1NKN A;  1N7S C;  1GU5 A;  3M06 A;  4LC1 A;  1Z56 A;  5BVZ A;  5AW3 B;  3M9H A;  3OJA B;  1RE4 A;  1NWQ A;  1SVF A;  4WY4 A;  2A45 H;  2WZ7 A;  3V2R A;  1GZL A;  2JEE A;  3OAK A;  4O9B A;  5AVV B;  5KJ7 A;  4WY4 B;  3NFQ A;  1NHL A;  2N1T B;  1URQ C;  2WT7 A;  3G3Z A;  2IPP A;  1N7S B;  4N3Y B;  3NMD A;  4W80 A;  5CCH A;  4HH2 A;  2H8P D;  2XZR A;  1KIL D;  1G2C B;  3VYI A;  1QL1 A;  3BRT B;  2WPR A;  1VPC A;  2A45 I;  1GL2 D;  1VDF A;  3MIW A;  3HUS A;  1M1J B;  1AQ5 A;  3V4Q A;  1L4A B;  3EFG A;  1EQ7 A;  2HG5 D;  1LWU C;  3V2N A;  4RES B;  2Q5U A;  3HTK B;  1SFC C;  4M3L A;  2A45 G;  4I2L C;  1NH4 A;  1JY2 N;  2P2U A;  2P7J A;  3A2A A;  1GL2 C;  1ZR4 A;  2P1J A;  2W6B A;  3P7K A;  1S9K D;  1LT9 C;  1N73 C;  5APV A;  2YKP A;  1KIL C;  3TNU B;  1M1J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...