1G2CB

Human respiratory syncytial virus fusion protein core
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
40
structure length
40
Chain Sequence
PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of the human respiratory syncytial virus fusion protein core.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
molecule keywords FUSION PROTEIN (F)
total genus 15
structure length 40
sequence length 40
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2000-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1g2cB00
2JJLA 3P32A 2P7JA 3VMZA 3A5TA 2W27A 5AW4B 2WT7B 2YO3A 4LC1A 1FOSF 3M0DA 2R3CA 2WPRA 5APSA 3TK1A 3SWFA 3TYYA 2IPPA 5APYA 1YYCA 1OXZA 2R5DA 2W6AA 2R32A 4XE5B 3VMYA 3HTKA 2E42A 1GK6A 1CI6B 2Q5UA 1S9KE 1OWAA 5AW6B 2WPQA 2C9NY 3IR9A 3M06A 4RESB 2ZFCA 1X8YA 5APTA 5APXA 1FAVA 3UIAA 1H89A 4EOTA 1GK4A 1CI6A 2N9BA 5APQA 5APUA 1HJBA 1KQLA 3HE4B 2WPSA 4AQRD 5AW2B 2E43A 3LIDA 4KHXA 3KQGA 3NTNA 3A3YB 1H8AA 1SLQA 3HE5B 1GU5A 3T97A 5APVA 2YO2A 1SP4A 5AVVB 5APWA 5AVZB 2Q7CA 1T2KD 2P2UA 1A02F 3P8MC 3A2AA 2C9LY 1GZLA 3M9BA 3A7OA 3NMDA 4C7NB 2XV5A 5AVUB 1G2CB 1FOSE 1JUNA 3V4WA 3P7KA 1NWQA 5AW0B 3B8EB 2ZXEB 3HE5A 3V5BA 4DZOA 4C46A 3KDPB 3M9HA 2Q3IA 2Z5IA 2H7HA 5AW5B 1MFZA 2Z5HA 5CMZA 3M91A 3HE4A 2BASA 3NFQA 3V4QA 4GKGA 4I6MC 1HBWA 1H88A 5AVSB 5AVRB 1GU4A 4M3LA 5AVYB 1IO4A 3VYIA 3TNUA 3L35A 3O8ZA 3OAKA 3LIEA 5AW3B 3NXSA 5AW9B 2WTYA 1J2JB 3L37A 4AYCA 1T2KC 3VN0A 5AVQB 5AVTB 2KP8A 5AW7B 3TNUB 3MD0A 2XZRA 1HUCA 2XU6A 4AUWA 2VRSA 2P67A 4JYCA 3VMXA 3M0AA 4JYBA 4I2LC 4B86A 2WWWA 1GD2E 1HWTC 1MUUA 5AVXB 2WT7A 2YNYA 5AVWB 2QM7A 1S9KD 3VTPC 2R5BA 5AW8B 1CSBA 3MGNA 1JNMA 2QM8A 1DH3A 1NAFA 3I5CA 1A02J 1MV8A 1GTWA 4HYTB 3L36A 4GT1A 4C7NA 5AW1B 1CZQA
chains in the Genus database with same CATH superfamily
2E76B 3P32A 4H44B 1SQPJ 2W27A 3VP9A 2OTJP 1X9VA 5KJ7A 1YI2P 2B89A 4D6TE 2C0WA 1FOSF 3SWYA 2M3EA 1EZVD 1RF1B 1SQVD 5DJTB 3RK2B 1X79B 3A0BH 1LT1A 3TK1A 1NAYA 1VPCA 3L70G 3L73D 2R3SA 3TYYA 4DCKA 2IPPA 3SWFA 3Q1MA 1TU3F 3D6YA 1X0TA 2E5TA 1M56D 1NTMJ 1JOCA 1YYCA 2OTKE 3H1KJ 1N7SC 3MUDA 4KT0J 4CPGA 1SFCD 1Y8AA 1JY2P 1M8OB 1ZN5A 1SQVE 2R32A 1JCCA 2HG5D 2POHA 3EWKA 4XE5B 5KKZB 2Y0EA 3PHLA 4OGQC 2H89C 4JPZB 2Q5UA 1OW6A 1VQ9P 1KQGB 2KSJA 2M5AB 3USSA 2QG4A 4ZNCA 1NTKJ 1X8YA 4PD4D 3H1LJ 2IX7C 2QJYB 2B87A 1IFIA 1BSNA 1CI6A 1NYHA 2V4HA 2JWDA 3L74E 5APUA 1W2EA 4YTPC 1N7SA 2RN0A 2XKMA 2QJYC 2RKLA 1SQBG 1HJBA 3RL0B 5BU8B 2WPSA 2N1TA 1YQ3C 3Q3DA 2ZYDA 3WU2H 2GUVA 1J1DB 4IL6X 2OYIB 3LIDA 1KB9I 3KQGA 4OGQB 2ZT9D 2BEQD 3PRJA 1GU5A 3AEEC 2N1TD 1KV4A 4N78E 5AVZB 1VQPP 2E75D 2P2UA 1LTJB 1LT9B 1HGZA 2QSIA 2YXQB 1T3JA 2D2CD 1PPJG 1SQPK 3BCCE 3A7OA 3CX5D 3NMDA 1W2BO 3H1ID 2K9JB 3CL3D 3L75D 1SQPE 2HPCB 1AJYA 1RF1C 3WUVA 2OYIC 2QIWA 3MP7B 2YKPA 4YXDC 3U1AA 1M1JA 3IAOA 3V4WA 1VQNP 3A0HH 3RL0C 1NWQA 4H44C 1FZGA 1AVOA 1FC2C 1HH0A 2ZXEB 3HE5A 4Z1MH 4BWNA 1SQBK 4ASWA 5GTHE 1T8ZA 2IZ0A 1S72P 1FE6A 1IK7A 1N73A 3H1KG 2KK7A 2MKVA 5CMZA 1JUNA 1LTBC 2V7QJ 2WSEH 4D6TJ 1NHLA 4XA4A 1JCDA 2NPSD 1M90Q 2ZXXA 1H88A 3L70E 3W67A 3RGUA 2AXTH 3A0HE 5AVYB 1IO4A 3VYIA 1M1KQ 1OIPA 2KLVA 3KHUA 1KQFB 1ZP0C 3L74J 3R2PA 2FXOA 4BXLA 1LWUA 2RMZA 5TISH 1SFCB 4L73A 1LTGC 2WVRA 2IFMA 1T2KC 1BGYE 2HODB 3GG2A 2IBZG 2AXCA 5EFWB 2KSEA 2KP8A 2O01J 3L71D 1PZQA 3HRNA 4WBAA 1GW3A 2KB7P 3H6PA 1S2EA 3L72D 3MD0A 1KYOH 1VQ6P 2P67A 4IL6H 4WY4A 4JYCA 3G3ZA 4EYYQ 3SWKA 1QGKB 3TGUG 2NPSB 2WQYC 2G3AA 3H1HG 3H1HD 1P84D 3JC22 1L0LJ 4I2LC 4B86A 4UB6E 1LNQA 3TGUD 5B5EH 1QL1A 1YTZI 1VF5B 1S5LX 2JWAA 1KMIZ 1FU1A 1R5SA 2YKQA 1YJNP 1L4AC 3GLMA 2OYHA 1YQ4C 2QM7A 4GDOA 3VTPC 4L75A 4K3AA 3CXHH 3L71G 1X22A 4PD4I 3A0BE 2PGDA 1SVFA 2Y9YA 3CMAP 3GMAA 1JNMA 1DH3A 1NAFA 3D71A 3CXHD 3RBZA 2ZJSE 4BRYA 3L36A 1PPJE 2BCCJ 3CCVP 3E1IA 1PP9J 4C7NA 1CZQA 2OYHB 1G1IA 3GW6A 1XTCC 1H0TB 3TSIA 2JJLA 2QVAA 1SQPG 2P7JA 5GTHH 2ZT9C 3GHGA 3C9IA 5AW4B 1EDIA 3CLQA 2CK3H 5KLVG 1HJ0A 3MZWB 1YHQP 2E74D 2OYHC 1EDKA 3JSVC 1Z56A 3CWBG 4LC1A 5CBOA 1MZ9A 2WSCJ 4H13D 3G71P 2YKOA 3CCJP 1AQTA 1BCCD 3IN6A 4I7ZB 3H1KE 1LTSC 1NTZD 1BCCE 2R5DA 2ZYGA 1SQXK 1SQPD 3HD7B 1S5LH 3VMYA 3HTKA 3RK3D 1DEBA 5CCGC 1LP1B 1D7MA 1ZXGA 1VDFA 1LWUB 1K9MQ 1UIXA 3C1LA 3AE4C 1T6AA 3L70J 4L76A 2K88A 4TT3H 1QL2A 2GA1A 2LXBA 4EIJA 3CCMP 3IR9A 2C9NY 3CC4P 5E79E 1KTMA 3HUSB 3UIAA 1RY3A 1URQB 5APXA 1Q81Q 1GK4A 2N9BA 3PLNA 1RF0A 1FZCC 5APQA 1SQQG 1K73Q 1BGYG 2FYUD 4JBZA 4EDFA 1KQLA 1SQXJ 1ZMEC 2FYUE 3L72E 2FY8A 2FXMA 4U3FE 3NTNA 3V2QA 2Z4EA 3EQ2A 3H25A 3A3YB 1BDCA 1H8AA 3B5NC 4WWIA 3HE5B 1LJ2A 2KYVA 1IFMA 5APVA 3T97A 2Y9ZA 2YO2A 2A06G 1VQ4P 1T2KD 3RK2D 1RF0C 1FZCA 1KB9D 4H13C 2WSSH 1NTMG 2LXCB 2JR8A 2C9LY 2KIKA 2QJKC 3BCCJ 1GZLA 5CCHD 5CHXA 3ABVC 1L0ND 3L71E 1KILE 3O6QB 4HH2A 4RJTA 4YXWH 1LTJA 1SQBD 1WMKA 2E5YA 3H1LE 3JCUE 3P7KA 3P8CD 4H0LD 4DZOA 4IFMA 4U3FJ 2QRXA 1EZVE 4C46A 3KDPB 2HFED 2Z5IA 1FZEA 1JY2O 1OFCX 5AW5B 1NTKD 1SS1A 2Q3EA 1L0NJ 2N1TB 3VMAA 1RE3A 1L0NG 3CWBE 1LTIC 1KYOI 3GF3A 1MFTA 1SQVG 1AQ5A 1LT9C 1LTJC 1NTZK 1PPJD 3AECC 3CWBD 1XTGB 5AVSB 5AVRB 1YIJP 2JDIH 3ITKA 1NTMK 2PAJA 3N4XA 2H8PD 2PRRA 3TNUA 3PP5A 3M0DC 1PGOA 2QJPC 4Y28J 1Y9BA 2E74C 1KILA 2JO1A 1JY3N 2M5AA 3H1IG 1AVYA 1JB0J 3LIEA 2N1TC 2W6JH 3NXSA 2KZIA 4UB6H 4AYCA 1GW4A 1URQD 1VQ5P 1NJIQ 3K5BA 1KILB 1SQBE 3VN0A 1DD4A 1W5CE 2M8RA 2AEJA 5B66H 2HR3A 5AW7B 1GDTA 4IL6E 1NU1E 4HJGH 3TNUB 3AEFC 2H43A 4IFFA 3C8VA 1P84I 1PGJA 2XU6A 1PL5A 5B66E 2V7QH 1L0NK 1QLED 3RK3B 1DIPA 2IDBA 2FYZA 3M0AA 3L75G 2CPSA 4WY4D 2H88C 3U1CA 2P10A 3OW2O 1RF1A 4PV1C 2WWWA 1HWTC 1ZW0A 1HVVA 1MUUA 1NTMD 4GODA 4OH8B 5AVXB 4HB1A 4YPCA 4U3FG 3CC7P 2KOGA 1PGPA 3QH9A 4H13B 1S9KD 4ZMDA 1FZAA 1QEXA 1DD3A 1NOHA 1JY3O 1N73C 3B5ND 1JEKA 1KYOE 2A06E 2L5GB 2QM8A 3B5NB 2YMYA 4H44D 2KI7B 3RK2C 3L73G 5KLIB 3O6QA 1NTZE 1JTHA 1PP9E 1KZUB 1BE3E 1L4AA 4RO0A 3H32B 1AA0A 1EZVI 3A5TA 2YIUC 1VQOP 1KN7A 1RQVA 3CXHI 4PD4H 1RE4A 3G9RA 2ZAEB 2E76C 1E79H 2D2CB 1FZCB 1HF9A 5H2FE 1EC5A 1NVOA 1R8EA 3T97B 1URQC 2R3CA 1K8AQ 2WPRA 1BDDA 1L0LK 3OA7A 3H1JJ 1EZVG 1VF5D 5BU5A 2QEXP 1L0LE 1NH4A 1NU1K 1SQXG 3SFEC 2AXTE 3V6IA 1LWUC 1KILD 1OVVA 4KJMA 1GMJA 3Q5RA 2CPBA 1L0NE 4I1LA 3AE8C 3HD7C 4PJ0E 1NTZJ 4WY4C 5L8RJ 2NZ2A 1Q86Q 1GL2D 5E79H 4PV1D 3U59A 3G6EP 2IBZE 2J59M 1URQA 1OWAA 3HUSA 1EDJA 3FGAD 3LW5J 5APTA 1H89A 3D70A 4N6JA 3BASA 4GIFA 2O3JA 4EOTA 1DX7A 1LP1A 2OARA 2WSCH 3IFMA 3HTKB 3W68A 2OYOA 1KFMA 4DJGA 1KYOD 3HD7A 2G8YA 2KS1A 2WPVB 4AQRD 1NU1J 5K5GB 2E43A 1DEEG 1FZBA 1U7MA 2FXPA 3JCUH 3L74D 3MHVA 4U7JA 4WB4A 4ZKPA 3AE9C 1SLQA 3GHGC 2Q7CA 1SP4A 1LTAC 5AVVB 1IFJA 1Y47A 3CCQP 2IFNA 2W8ZA 3A2AA 3P8MC 2A45G 1SQVJ 3GHGB 4IFDK 3AE1C 3RK3E 1PGQA 1QVGO 1S4XA 1WRGA 1H0TA 1VQMP 1L4AD 3E7KA 4C7NB 5KLVE 3AEBC 4BRYB 3FWNA 3V2NA 1PV3A 1G2CB 1BSHA 1VQLP 1L0LD 1R5LA 2KNCB 2Q1KA 4W80A 1PIXA 3L73E 1FS0E 4GOFA 1FOSE 3CCEP 1NTZG 3L72J 2FYUK 3M9QA 1SQQJ 1ZRTE 2FFDB 2IYPA 1YITP 3AE2C 4DOJA 3M9HA 3CD6P 1EQ7A 2Q3IA 4D6TD 1ZR4A 2H7HA 5KLIC 1EXJA 4UB8E 3II6A 1S1CX 1YJ9P 5CCGA 1SFCC 2UWJE 1VQ7P 5H2FH 3M91A 3VMZA 3ZDMA 3F5HA 3HE4A 4D6TG 4GKGA 1P84H 2NPSA 1KFNA 1MKMA 4I6MC 2O1JA 5GTIE 5KAFH 5KJ7C 2FYNB 3I56P 1PP9D 1N86A 3R4YA 2HLOA 4WY4B 2LR2A 1LTTC 3KPEA 3V2RA 2FBWC 4NPDA 1KB9H 1RQUA 1HGVA 1U57A 1NTKK 4PV1B 1S5LE 1ZV8A 2OQQA 3BATA 2K1AA 1FBMA 2HODA 3L35A 3OAKA 1GL2A 1NO4A 3H1IJ 5AW9B 1CW5A 1OVRA 1J2JB 1SFCA 1SQQE 3L37A 1EDLA 3RK3C 3FXEA 4W7ZA 3G4SP 3CPWO 4WVZA 2RH0A 1G1JA 5AVQB 2LKMA 3MUDC 1JMMA 1USEA 2Y0CA 3L72G 1HUCA 2KZJA 1YJWP 1IJDB 1KILC 1Q90D 2VRSA 2YIUB 2A06D 4AUWA 1JY3P 3FXDA 3VMXA 2WZ7A 5KLVK 2ITAA 3LW5H 4JYBA 3BRVB 2E74B 1KQSO 1GL2C 1VL2A 2BEZF 2IBZI 2J58A 1GD2E 3VOPA 3FX0A 1NKZB 1NTME 2YNYA 3PTZA 3IF4A 5CCHC 2WT7A 5TJHA 5AVWB 1NGMB 1N73B 1EXIA 1VQ8P 4LLHA 2O01N 1LGHB 3SFDC 1K04A 3CC2P 2IBZD 2KXPB 1YBKA 1JM0A 1IFNA 1AFOA 2GM4A 1M1JB 4A7PA 4W7YA 3H1LG 1NKNA 1A02J 1MV8A 1RE3C 2E75C 1SQVK 2XNXA 1N2DC 4HYTB 3Q2YA 1GTWA 4C7RA 1J1DC 3BCCG 2K9JA 4LGDE 2HPCA 1PFIA 3H1KD 5CBNA 1J1EC 3KXDA 5CCHA 4PJ0H 3TDKA 5KLVJ 2B88A 4O9BA 1NTKE 2PP6A 1J1EB 1LT9A 1UIIA 2WT7B 3CCUP 2YO3A 1KD1Q 3V2PA 1IFPA 2J5UA 3M0DA 5KJ7D 2W6BA 3L73J 3CMEP 4DT0A 3B4SA 2E75B 5C39A 5APSA 1OVUA 2SPZA 3CI9A 5TISE 3RL0D 3S1KA 2I1KA 1M1JC 2Q9IA 1Q2NA 2W83C 3MIWA 1E5WA 2QJPB 3H1LD 4EI2A 2OYIA 2KUBA 1BCCJ 1IFDA 5APYA 1OXZA 2NRGA 3S9OA 5KKZC 3D6ZA 2P58A 2W6AA 1JO5A 3H1IE 1KC8Q 2PFXA 2E42A 1N7SB 2AEFA 3BCCD 1FJPA 2FKWB 1YTZT 1GK6A 1CI6B 1GL2B 3OJAB 2B87B 1ZRTD 3H1HJ 1S9KE 1KB9E 5DJUB 2M3BA 2A45H 2XDJA 5AW6B 2WPQA 1NU1G 1RH5B 3M06A 4RESB 2ZFCA 1OW7A 2O1KA 1FAVA 2OTLP 2JEEA 3EFFK 1BE3D 3CX5H 4QMAA 4MN4C 1P84E 4RKUJ 3L75E 1Q7YQ 3PJSK 3H1JE 2L91A 2P1JA 1JY2N 1FZFA 3BRTB 4GOEA 3HE4B 5M1BA 5KAIH 3AEAC 4IOIH 2FYUJ 2K9YA 2QE7H 4OVNF 4ZKUA 2K3RA 3AE7C 5AW2B 1N8RQ 4JF7A 2M0BA 2Y0DA 4KHXA 4H0LB 2FFDA 1QX8A 1N7LA 2ZVNB 2E76D 4HKZH 1U7JA 4PD4E 1OZHA 2QJKB 3TGUE 3QWOC 3H1HE 5APWA 1A02F 1IZNB 1OW8A 2KNCA 3MTUE 1G2CA 2FYNC 2I1JA 4I7ZC 1PP9G 3PH0A 1BE3G 1RE4C 2BCCG 2WSFH 3M9BA 4L74A 4OWFA 1RHZB 4Y99B 3CCRP 3CCLP 3L70D 4K35A 1K05A 3WU2E 2XV5A 3AE3C 1FDOA 2WMMA 5AVUB 1FDMA 2FFDC 2JKVA 2JP3A 3EFGA 3FWLA 5CCGD 5AW0B 4TLFA 2OGUA 2ZT9B 1ZR2A 3B8EB 1FDIA 2Q6QA 1ZOYC 3V5BA 3F89A 3AEGC 3TF5A 1L0LG 2IYOA 4XFJA 1JMBA 1SQXE 4N3YB 3HUSC 1MFZA 1NTKG 2Z5HA 3L4FA 5KAFE 5GTIH 2KS1B 3E1RA 5BVZA 3NFQA 2BASA 3CWBJ 3V4QA 1IC2A 2HYNA 4OGQD 5CJ0A 2BCCD 2I8DA 1HBWA 3KZIE 1OMIA 3RL0g 2R44A 2WSEJ 1IK9A 2N9YB 3WUUA 1GU4A 1VF5C 4M3LA 1SQXD 2W90A 2YMKA 1USDA 2K37A 3SSUA 1BCCG 3Q5PA 5KTBA 1VQKP 2WTYA 3O8ZA 2WITA 5AW3B 4R4MA 3L74G 5CJ4A 3P8CE 3L75J 4UB8H 4N78D 3L71J 1ZLLA 1KORA 1BGYJ 2B9BA 3AE5C 1SQBJ 2MJZA 5AVTB 3CX5I 3RBXA 2IZ1A 5KLVD 4R4LA 2AEMA 3AEDC 1M7LA 3CXHE 3VP8A 3I55P 2XZRA 3KZIH 3GF7A 3CX5E 1M57D 3KYQA 1N7SD 1OX3A 1S3JA 3HD7D 2C0XA 1L2PA 2YXRB 1HTLC 2DW3A 3H1JD 3H1JG 5AW1B 3TGUJ 5B5EE 5KAIE 4NPEA 3CCSP 4Y99C 3N7NA 3WUTA 3S4RA 1BGYD 2FYUG 1WT6A 1SQQD 2XNDH 2QA4P 4JQ0D 2WSFJ 4U3FD 3H32A 2ZYAA 2KLUA 1L4AB 2R5BA 5AW8B 3WMM0 3B71A 1JTHB 1SQQK 1CSBA 2GUSA 3MGNA 2A45I 4NPFX 1QVFO 2ZVOB 3Q5SA 3B5NA 3I5CA 4H0LC 1AV1A 1T3UA 4ASVA 1NU1D 2O01H 2NPSC 4GT1A 3BVHA 3AE6C 2BCCE 1Q82Q 1FJKA 1BE3J 2D2CC
chains in the Genus database with same CATH topology
3P32A 2W27A 3VP9A 1X9VA 5KJ7A 2C0WA 1FOSF 3SWYA 1RF1B 3RK2B 1X79B 3TK1A 1VPCA 3SWFA 3TYYA 2IPPA 3MUDA 5CJ0A 1JOCA 1YYCA 1N7SC 1SFCD 2R32A 1JY2P 1ZN5A 4XE5B 1JCCA 2HG5D 2POHA 2Q5UA 2KSJA 1X8YA 2IX7C 1IFIA 1CI6A 5APUA 1W2EA 1N7SA 2XKMA 1HJBA 3RL0B 5BU8B 2WPSA 2N1TA 2GUVA 1J1DB 2OYIB 3LIDA 3KQGA 1GU5A 2N1TD 4N78E 5AVZB 2P2UA 1LTJB 1LT9B 1HGZA 1T3JA 1SQPK 3A7OA 3NMDA 3CL3D 2HPCB 1RF1C 2OYIC 2YKPA 3U1AA 1M1JA 3V4WA 1NWQA 3RL0C 1FZGA 2ZXEB 1HH0A 3HE5A 1SQBK 1T8ZA 1N73A 5CMZA 1LTBC 2WSEH 1NHLA 4XA4A 1JCDA 2NPSD 1H88A 5AVYB 1IO4A 3VYIA 2KLVA 3R2PA 1LWUA 1SFCB 1LTGC 1T2KC 2IFMA 2HODB 2KP8A 3HRNA 4WBAA 1GW3A 2KB7P 3H6PA 3MD0A 2P67A 4WY4A 4JYCA 3G3ZA 2NPSB 4I2LC 4B86A 1QL1A 1YTZI 1FU1A 2YKQA 1L4AC 2OYHA 2QM7A 3VTPC 1JNMA 1SVFA 1DH3A 1NAFA 3L36A 3E1IA 4C7NA 1CZQA 2OYHB 1G1IA 1XTCC 3TSIA 2JJLA 2P7JA 3VMZA 3GHGA 3C9IA 5AW4B 3CLQA 2OYHC 4LC1A 1Z56A 1MZ9A 2YKOA 1LTSC 2R5DA 1SQXK 3HD7B 3VMYA 3HTKA 3RK3D 1DEBA 5CCGC 1VDFA 1LWUB 1QL2A 4EIJA 2C9NY 3IR9A 3HUSB 3UIAA 1RY3A 1URQB 5APXA 1GK4A 2N9BA 1RF0A 1FZCC 5APQA 1KQLA 2FXMA 3NTNA 3V2QA 2Z4EA 3EQ2A 3A3YB 1H8AA 3B5NC 3HE5B 2KYVA 1IFMA 5APVA 3T97A 2YO2A 1T2KD 3RK2D 1RF0C 1FZCA 2C9LY 1GZLA 5CCHD 5CHXA 4HH2A 1LTJA 3P7KA 3P8CD 4DZOA 4IFMA 4C46A 3KDPB 2HFED 2Z5IA 1FZEA 1JY2O 5AW5B 2N1TB 1RE3A 1LTIC 1AQ5A 1LT9C 1LTJC 1NTZK 1XTGB 5AVSB 5AVRB 1NTMK 2PAJA 3N4XA 2H8PD 3TNUA 3PP5A 3M0DC 1KILA 3LIEA 1JY3N 3NXSA 2N1TC 4AYCA 1GW4A 1URQD 1KILB 3VN0A 1GDTA 2M8RA 5AW7B 3TNUB 2H43A 4IFFA 2XU6A 1L0NK 3RK3B 2FYZA 3M0AA 2CPSA 4WY4D 3U1CA 1RF1A 2WWWA 1HWTC 1HVVA 1MUUA 5AVXB 4OH8B 2KOGA 1S9KD 1FZAA 1NOHA 1JY3O 1N73C 3B5ND 2L5GB 2QM8A 3B5NB 2YMYA 3RK2C 1JTHA 1KZUB 1L4AA 3H32B 3A5TA 1RE4A 1FZCB 1URQC 2R3CA 2WPRA 1L0LK 3OA7A 5BU5A 1NH4A 1NU1K 1LWUC 1KILD 2CPBA 4I1LA 3HD7C 4WY4C 1GL2D 2J59M 1URQA 1OWAA 3HUSA 5APTA 1H89A 4N6JA 3BASA 4GIFA 4EOTA 1DX7A 2WSCH 2OARA 3IFMA 3HTKB 1KFMA 3HD7A 4AQRD 2E43A 1FZBA 4ZKPA 4WB4A 1SLQA 3GHGC 2Q7CA 1SP4A 1LTAC 5AVVB 1IFJA 2IFNA 3P8MC 3A2AA 2A45G 3GHGB 4IFDK 1WRGA 1L4AD 4C7NB 3V2NA 1G2CB 1FOSE 4W80A 1JUNA 3M9QA 2FYUK 2FFDB 4DOJA 3M9HA 1EQ7A 2Q3IA 1ZR4A 2H7HA 3II6A 5CCGA 1SFCC 3M91A 3HE4A 4GKGA 2NPSA 1KFNA 4I6MC 2O1JA 5KJ7C 1N86A 2HLOA 4WY4B 1LTTC 3KPEA 3V2RA 1HGVA 1NTKK 1ZV8A 3OAKA 3L35A 3BATA 1FBMA 2HODA 4W7YA 5AW9B 1GL2A 1NO4A 1CW5A 1SFCA 1J2JB 3L37A 3RK3C 4W7ZA 5AVQB 1G1JA 2LKMA 1JMMA 1HUCA 1IJDB 1KILC 2VRSA 4AUWA 1JY3P 3VMXA 2WZ7A 5KLVK 3LW5H 4JYBA 3BRVB 1GL2C 2J58A 1GD2E 3VOPA 1NKZB 2WT7A 2YNYA 5CCHC 1N73B 5AVWB 4LLHA 1LGHB 1IFNA 1AFOA 2GM4A 1M1JB 1NKNA 1A02J 1MV8A 1RE3C 1GTWA 1SQVK 2XNXA 1N2DC 4HYTB 4C7RA 1J1DC 4LGDE 2HPCA 1PFIA 1J1EC 5CCHA 4O9BA 2PP6A 2WT7B 1J1EB 1LT9A 2YO3A 3V2PA 3M0DA 5KJ7D 2W6BA 5APSA 3RL0D 3CI9A 2I1KA 1M1JC 2Q9IA 3MIWA 1E5WA 2OYIA 1IFDA 5APYA 1OXZA 1JO5A 2W6AA 2E42A 1N7SB 1FJPA 2FKWB 1YTZT 1GK6A 1CI6B 1GL2B 3OJAB 1S9KE 2M3BA 2A45H 2XDJA 5AW6B 2WPQA 3M06A 4RESB 2ZFCA 2O1KA 1FAVA 2JEEA 2P1JA 1JY2N 1FZFA 3BRTB 3HE4B 4ZKUA 5AW2B 4JF7A 4KHXA 2FFDA 1N7LA 5APWA 1A02F 3MTUE 1G2CA 2I1JA 1RE4C 2WSFH 3M9BA 4Y99B 2XV5A 5AVUB 1FDMA 2FFDC 3EFGA 5CCGD 5AW0B 1ZR2A 3B8EB 3V5BA 3U59A 4N3YB 3HUSC 1MFZA 2Z5HA 3L4FA 5BVZA 3NFQA 2BASA 3V4QA 1IC2A 2HYNA 1HBWA 1IK9A 1GU4A 4M3LA 5KTBA 2WTYA 3O8ZA 2WITA 5AW3B 5CJ4A 3P8CE 4N78D 1ZLLA 2MJZA 5AVTB 1M7LA 3VP8A 2XZRA 3KYQA 1N7SD 3HD7D 2C0XA 5AW1B 1HTLC 4Y99C 3N7NA 1WT6A 3H32A 1L4AB 2R5BA 5AW8B 3WMM0 1JTHB 1SQQK 1CSBA 3MGNA 2GUSA 2A45I 3I5CA 3B5NA 1T3UA 2O01H 2NPSC 4GT1A 3BVHA 1FJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJL A;  3P32 A;  2P7J A;  3VMZ A;  3A5T A;  2W27 A;  5AW4 B;  2WT7 B;  2YO3 A;  4LC1 A;  1FOS F;  3M0D A;  2R3C A;  2WPR A;  5APS A;  3TK1 A;  3SWF A;  3TYY A;  2IPP A;  5APY A;  1YYC A;  1OXZ A;  2R5D A;  2W6A A;  2R32 A;  4XE5 B;  3VMY A;  3HTK A;  2E42 A;  1GK6 A;  1CI6 B;  2Q5U A;  1S9K E;  1OWA A;  5AW6 B;  2WPQ A;  2C9N Y;  3IR9 A;  3M06 A;  4RES B;  2ZFC A;  1X8Y A;  5APT A;  5APX A;  1FAV A;  3UIA A;  1H89 A;  4EOT A;  1GK4 A;  1CI6 A;  2N9B A;  5APQ A;  5APU A;  1HJB A;  1KQL A;  3HE4 B;  2WPS A;  4AQR D;  5AW2 B;  2E43 A;  3LID A;  4KHX A;  3KQG A;  3NTN A;  3A3Y B;  1H8A A;  1SLQ A;  3HE5 B;  1GU5 A;  3T97 A;  5APV A;  2YO2 A;  1SP4 A;  5AVV B;  5APW A;  5AVZ B;  2Q7C A;  1T2K D;  2P2U A;  1A02 F;  3P8M C;  3A2A A;  2C9L Y;  1GZL A;  3M9B A;  3A7O A;  3NMD A;  4C7N B;  2XV5 A;  5AVU B;  1G2C B;  1FOS E;  1JUN A;  3V4W A;  3P7K A;  1NWQ A;  5AW0 B;  3B8E B;  2ZXE B;  3HE5 A;  3V5B A;  4DZO A;  4C46 A;  3KDP B;  3M9H A;  2Q3I A;  2Z5I A;  2H7H A;  5AW5 B;  1MFZ A;  2Z5H A;  5CMZ A;  3M91 A;  3HE4 A;  2BAS A;  3NFQ A;  3V4Q A;  4GKG A;  4I6M C;  1HBW A;  1H88 A;  5AVS B;  5AVR B;  1GU4 A;  4M3L A;  5AVY B;  1IO4 A;  3VYI A;  3TNU A;  3L35 A;  3O8Z A;  3OAK A;  3LIE A;  5AW3 B;  3NXS A;  5AW9 B;  2WTY A;  1J2J B;  3L37 A;  4AYC A;  1T2K C;  3VN0 A;  5AVQ B;  5AVT B;  2KP8 A;  5AW7 B;  3TNU B;  3MD0 A;  2XZR A;  1HUC A;  2XU6 A;  4AUW A;  2VRS A;  2P67 A;  4JYC A;  3VMX A;  3M0A A;  4JYB A;  4I2L C;  4B86 A;  2WWW A;  1GD2 E;  1HWT C;  1MUU A;  5AVX B;  2WT7 A;  2YNY A;  5AVW B;  2QM7 A;  1S9K D;  3VTP C;  2R5B A;  5AW8 B;  1CSB A;  3MGN A;  1JNM A;  2QM8 A;  1DH3 A;  1NAF A;  3I5C A;  1A02 J;  1MV8 A;  1GTW A;  4HYT B;  3L36 A;  4GT1 A;  4C7N A;  5AW1 B;  1CZQ A; 
#chains in the Genus database with same CATH topology
 2E76 B;  3P32 A;  4H44 B;  1SQP J;  2W27 A;  3VP9 A;  2OTJ P;  1X9V A;  5KJ7 A;  1YI2 P;  2B89 A;  4D6T E;  2C0W A;  1FOS F;  3SWY A;  2M3E A;  1EZV D;  1RF1 B;  1SQV D;  5DJT B;  3RK2 B;  1X79 B;  3A0B H;  1LT1 A;  3TK1 A;  1NAY A;  1VPC A;  3L70 G;  3L73 D;  2R3S A;  3TYY A;  4DCK A;  2IPP A;  3SWF A;  3Q1M A;  1TU3 F;  3D6Y A;  1X0T A;  2E5T A;  1M56 D;  1NTM J;  1JOC A;  1YYC A;  2OTK E;  3H1K J;  1N7S C;  3MUD A;  4KT0 J;  4CPG A;  1SFC D;  1Y8A A;  1JY2 P;  1M8O B;  1ZN5 A;  1SQV E;  2R32 A;  1JCC A;  2HG5 D;  2POH A;  3EWK A;  4XE5 B;  5KKZ B;  2Y0E A;  3PHL A;  4OGQ C;  2H89 C;  4JPZ B;  2Q5U A;  1OW6 A;  1VQ9 P;  1KQG B;  2KSJ A;  2M5A B;  3USS A;  2QG4 A;  4ZNC A;  1NTK J;  1X8Y A;  4PD4 D;  3H1L J;  2IX7 C;  2QJY B;  2B87 A;  1IFI A;  1BSN A;  1CI6 A;  1NYH A;  2V4H A;  2JWD A;  3L74 E;  5APU A;  1W2E A;  4YTP C;  1N7S A;  2RN0 A;  2XKM A;  2QJY C;  2RKL A;  1SQB G;  1HJB A;  3RL0 B;  5BU8 B;  2WPS A;  2N1T A;  1YQ3 C;  3Q3D A;  2ZYD A;  3WU2 H;  2GUV A;  1J1D B;  4IL6 X;  2OYI B;  3LID A;  1KB9 I;  3KQG A;  4OGQ B;  2ZT9 D;  2BEQ D;  3PRJ A;  1GU5 A;  3AEE C;  2N1T D;  1KV4 A;  4N78 E;  5AVZ B;  1VQP P;  2E75 D;  2P2U A;  1LTJ B;  1LT9 B;  1HGZ A;  2QSI A;  2YXQ B;  1T3J A;  2D2C D;  1PPJ G;  1SQP K;  3BCC E;  3A7O A;  3CX5 D;  3NMD A;  1W2B O;  3H1I D;  2K9J B;  3CL3 D;  3L75 D;  1SQP E;  2HPC B;  1AJY A;  1RF1 C;  3WUV A;  2OYI C;  2QIW A;  3MP7 B;  2YKP A;  4YXD C;  3U1A A;  1M1J A;  3IAO A;  3V4W A;  1VQN P;  3A0H H;  3RL0 C;  1NWQ A;  4H44 C;  1FZG A;  1AVO A;  1FC2 C;  1HH0 A;  2ZXE B;  3HE5 A;  4Z1M H;  4BWN A;  1SQB K;  4ASW A;  5GTH E;  1T8Z A;  2IZ0 A;  1S72 P;  1FE6 A;  1IK7 A;  1N73 A;  3H1K G;  2KK7 A;  2MKV A;  5CMZ A;  1JUN A;  1LTB C;  2V7Q J;  2WSE H;  4D6T J;  1NHL A;  4XA4 A;  1JCD A;  2NPS D;  1M90 Q;  2ZXX A;  1H88 A;  3L70 E;  3W67 A;  3RGU A;  2AXT H;  3A0H E;  5AVY B;  1IO4 A;  3VYI A;  1M1K Q;  1OIP A;  2KLV A;  3KHU A;  1KQF B;  1ZP0 C;  3L74 J;  3R2P A;  2FXO A;  4BXL A;  1LWU A;  2RMZ A;  5TIS H;  1SFC B;  4L73 A;  1LTG C;  2WVR A;  2IFM A;  1T2K C;  1BGY E;  2HOD B;  3GG2 A;  2IBZ G;  2AXC A;  5EFW B;  2KSE A;  2KP8 A;  2O01 J;  3L71 D;  1PZQ A;  3HRN A;  4WBA A;  1GW3 A;  2KB7 P;  3H6P A;  1S2E A;  3L72 D;  3MD0 A;  1KYO H;  1VQ6 P;  2P67 A;  4IL6 H;  4WY4 A;  4JYC A;  3G3Z A;  4EYY Q;  3SWK A;  1QGK B;  3TGU G;  2NPS B;  2WQY C;  2G3A A;  3H1H G;  3H1H D;  1P84 D;  3JC2 2;  1L0L J;  4I2L C;  4B86 A;  4UB6 E;  1LNQ A;  3TGU D;  5B5E H;  1QL1 A;  1YTZ I;  1VF5 B;  1S5L X;  2JWA A;  1KMI Z;  1FU1 A;  1R5S A;  2YKQ A;  1YJN P;  1L4A C;  3GLM A;  2OYH A;  1YQ4 C;  2QM7 A;  4GDO A;  3VTP C;  4L75 A;  4K3A A;  3CXH H;  3L71 G;  1X22 A;  4PD4 I;  3A0B E;  2PGD A;  1SVF A;  2Y9Y A;  3CMA P;  3GMA A;  1JNM A;  1DH3 A;  1NAF A;  3D71 A;  3CXH D;  3RBZ A;  2ZJS E;  4BRY A;  3L36 A;  1PPJ E;  2BCC J;  3CCV P;  3E1I A;  1PP9 J;  4C7N A;  1CZQ A;  2OYH B;  1G1I A;  3GW6 A;  1XTC C;  1H0T B;  3TSI A;  2JJL A;  2QVA A;  1SQP G;  2P7J A;  5GTH H;  2ZT9 C;  3GHG A;  3C9I A;  5AW4 B;  1EDI A;  3CLQ A;  2CK3 H;  5KLV G;  1HJ0 A;  3MZW B;  1YHQ P;  2E74 D;  2OYH C;  1EDK A;  3JSV C;  1Z56 A;  3CWB G;  4LC1 A;  5CBO A;  1MZ9 A;  2WSC J;  4H13 D;  3G71 P;  2YKO A;  3CCJ P;  1AQT A;  1BCC D;  3IN6 A;  4I7Z B;  3H1K E;  1LTS C;  1NTZ D;  1BCC E;  2R5D A;  2ZYG A;  1SQX K;  1SQP D;  3HD7 B;  1S5L H;  3VMY A;  3HTK A;  3RK3 D;  1DEB A;  5CCG C;  1LP1 B;  1D7M A;  1ZXG A;  1VDF A;  1LWU B;  1K9M Q;  1UIX A;  3C1L A;  3AE4 C;  1T6A A;  3L70 J;  4L76 A;  2K88 A;  4TT3 H;  1QL2 A;  2GA1 A;  2LXB A;  4EIJ A;  3CCM P;  3IR9 A;  2C9N Y;  3CC4 P;  5E79 E;  1KTM A;  3HUS B;  3UIA A;  1RY3 A;  1URQ B;  5APX A;  1Q81 Q;  1GK4 A;  2N9B A;  3PLN A;  1RF0 A;  1FZC C;  5APQ A;  1SQQ G;  1K73 Q;  1BGY G;  2FYU D;  4JBZ A;  4EDF A;  1KQL A;  1SQX J;  1ZME C;  2FYU E;  3L72 E;  2FY8 A;  2FXM A;  4U3F E;  3NTN A;  3V2Q A;  2Z4E A;  3EQ2 A;  3H25 A;  3A3Y B;  1BDC A;  1H8A A;  3B5N C;  4WWI A;  3HE5 B;  1LJ2 A;  2KYV A;  1IFM A;  5APV A;  3T97 A;  2Y9Z A;  2YO2 A;  2A06 G;  1VQ4 P;  1T2K D;  3RK2 D;  1RF0 C;  1FZC A;  1KB9 D;  4H13 C;  2WSS H;  1NTM G;  2LXC B;  2JR8 A;  2C9L Y;  2KIK A;  2QJK C;  3BCC J;  1GZL A;  5CCH D;  5CHX A;  3ABV C;  1L0N D;  3L71 E;  1KIL E;  3O6Q B;  4HH2 A;  4RJT A;  4YXW H;  1LTJ A;  1SQB D;  1WMK A;  2E5Y A;  3H1L E;  3JCU E;  3P7K A;  3P8C D;  4H0L D;  4DZO A;  4IFM A;  4U3F J;  2QRX A;  1EZV E;  4C46 A;  3KDP B;  2HFE D;  2Z5I A;  1FZE A;  1JY2 O;  1OFC X;  5AW5 B;  1NTK D;  1SS1 A;  2Q3E A;  1L0N J;  2N1T B;  3VMA A;  1RE3 A;  1L0N G;  3CWB E;  1LTI C;  1KYO I;  3GF3 A;  1MFT A;  1SQV G;  1AQ5 A;  1LT9 C;  1LTJ C;  1NTZ K;  1PPJ D;  3AEC C;  3CWB D;  1XTG B;  5AVS B;  5AVR B;  1YIJ P;  2JDI H;  3ITK A;  1NTM K;  2PAJ A;  3N4X A;  2H8P D;  2PRR A;  3TNU A;  3PP5 A;  3M0D C;  1PGO A;  2QJP C;  4Y28 J;  1Y9B A;  2E74 C;  1KIL A;  2JO1 A;  1JY3 N;  2M5A A;  3H1I G;  1AVY A;  1JB0 J;  3LIE A;  2N1T C;  2W6J H;  3NXS A;  2KZI A;  4UB6 H;  4AYC A;  1GW4 A;  1URQ D;  1VQ5 P;  1NJI Q;  3K5B A;  1KIL B;  1SQB E;  3VN0 A;  1DD4 A;  1W5C E;  2M8R A;  2AEJ A;  5B66 H;  2HR3 A;  5AW7 B;  1GDT A;  4IL6 E;  1NU1 E;  4HJG H;  3TNU B;  3AEF C;  2H43 A;  4IFF A;  3C8V A;  1P84 I;  1PGJ A;  2XU6 A;  1PL5 A;  5B66 E;  2V7Q H;  1L0N K;  1QLE D;  3RK3 B;  1DIP A;  2IDB A;  2FYZ A;  3M0A A;  3L75 G;  2CPS A;  4WY4 D;  2H88 C;  3U1C A;  2P10 A;  3OW2 O;  1RF1 A;  4PV1 C;  2WWW A;  1HWT C;  1ZW0 A;  1HVV A;  1MUU A;  1NTM D;  4GOD A;  4OH8 B;  5AVX B;  4HB1 A;  4YPC A;  4U3F G;  3CC7 P;  2KOG A;  1PGP A;  3QH9 A;  4H13 B;  1S9K D;  4ZMD A;  1FZA A;  1QEX A;  1DD3 A;  1NOH A;  1JY3 O;  1N73 C;  3B5N D;  1JEK A;  1KYO E;  2A06 E;  2L5G B;  2QM8 A;  3B5N B;  2YMY A;  4H44 D;  2KI7 B;  3RK2 C;  3L73 G;  5KLI B;  3O6Q A;  1NTZ E;  1JTH A;  1PP9 E;  1KZU B;  1BE3 E;  1L4A A;  4RO0 A;  3H32 B;  1AA0 A;  1EZV I;  3A5T A;  2YIU C;  1VQO P;  1KN7 A;  1RQV A;  3CXH I;  4PD4 H;  1RE4 A;  3G9R A;  2ZAE B;  2E76 C;  1E79 H;  2D2C B;  1FZC B;  1HF9 A;  5H2F E;  1EC5 A;  1NVO A;  1R8E A;  3T97 B;  1URQ C;  2R3C A;  1K8A Q;  2WPR A;  1BDD A;  1L0L K;  3OA7 A;  3H1J J;  1EZV G;  1VF5 D;  5BU5 A;  2QEX P;  1L0L E;  1NH4 A;  1NU1 K;  1SQX G;  3SFE C;  2AXT E;  3V6I A;  1LWU C;  1KIL D;  1OVV A;  4KJM A;  1GMJ A;  3Q5R A;  2CPB A;  1L0N E;  4I1L A;  3AE8 C;  3HD7 C;  4PJ0 E;  1NTZ J;  4WY4 C;  5L8R J;  2NZ2 A;  1Q86 Q;  1GL2 D;  5E79 H;  4PV1 D;  3U59 A;  3G6E P;  2IBZ E;  2J59 M;  1URQ A;  1OWA A;  3HUS A;  1EDJ A;  3FGA D;  3LW5 J;  5APT A;  1H89 A;  3D70 A;  4N6J A;  3BAS A;  4GIF A;  2O3J A;  4EOT A;  1DX7 A;  1LP1 A;  2OAR A;  2WSC H;  3IFM A;  3HTK B;  3W68 A;  2OYO A;  1KFM A;  4DJG A;  1KYO D;  3HD7 A;  2G8Y A;  2KS1 A;  2WPV B;  4AQR D;  1NU1 J;  5K5G B;  2E43 A;  1DEE G;  1FZB A;  1U7M A;  2FXP A;  3JCU H;  3L74 D;  3MHV A;  4U7J A;  4WB4 A;  4ZKP A;  3AE9 C;  1SLQ A;  3GHG C;  2Q7C A;  1SP4 A;  1LTA C;  5AVV B;  1IFJ A;  1Y47 A;  3CCQ P;  2IFN A;  2W8Z A;  3A2A A;  3P8M C;  2A45 G;  1SQV J;  3GHG B;  4IFD K;  3AE1 C;  3RK3 E;  1PGQ A;  1QVG O;  1S4X A;  1WRG A;  1H0T A;  1VQM P;  1L4A D;  3E7K A;  4C7N B;  5KLV E;  3AEB C;  4BRY B;  3FWN A;  3V2N A;  1PV3 A;  1G2C B;  1BSH A;  1VQL P;  1L0L D;  1R5L A;  2KNC B;  2Q1K A;  4W80 A;  1PIX A;  3L73 E;  1FS0 E;  4GOF A;  1FOS E;  3CCE P;  1NTZ G;  3L72 J;  2FYU K;  3M9Q A;  1SQQ J;  1ZRT E;  2FFD B;  2IYP A;  1YIT P;  3AE2 C;  4DOJ A;  3M9H A;  3CD6 P;  1EQ7 A;  2Q3I A;  4D6T D;  1ZR4 A;  2H7H A;  5KLI C;  1EXJ A;  4UB8 E;  3II6 A;  1S1C X;  1YJ9 P;  5CCG A;  1SFC C;  2UWJ E;  1VQ7 P;  5H2F H;  3M91 A;  3VMZ A;  3ZDM A;  3F5H A;  3HE4 A;  4D6T G;  4GKG A;  1P84 H;  2NPS A;  1KFN A;  1MKM A;  4I6M C;  2O1J A;  5GTI E;  5KAF H;  5KJ7 C;  2FYN B;  3I56 P;  1PP9 D;  1N86 A;  3R4Y A;  2HLO A;  4WY4 B;  2LR2 A;  1LTT C;  3KPE A;  3V2R A;  2FBW C;  4NPD A;  1KB9 H;  1RQU A;  1HGV A;  1U57 A;  1NTK K;  4PV1 B;  1S5L E;  1ZV8 A;  2OQQ A;  3BAT A;  2K1A A;  1FBM A;  2HOD A;  3L35 A;  3OAK A;  1GL2 A;  1NO4 A;  3H1I J;  5AW9 B;  1CW5 A;  1OVR A;  1J2J B;  1SFC A;  1SQQ E;  3L37 A;  1EDL A;  3RK3 C;  3FXE A;  4W7Z A;  3G4S P;  3CPW O;  4WVZ A;  2RH0 A;  1G1J A;  5AVQ B;  2LKM A;  3MUD C;  1JMM A;  1USE A;  2Y0C A;  3L72 G;  1HUC A;  2KZJ A;  1YJW P;  1IJD B;  1KIL C;  1Q90 D;  2VRS A;  2YIU B;  2A06 D;  4AUW A;  1JY3 P;  3FXD A;  3VMX A;  2WZ7 A;  5KLV K;  2ITA A;  3LW5 H;  4JYB A;  3BRV B;  2E74 B;  1KQS O;  1GL2 C;  1VL2 A;  2BEZ F;  2IBZ I;  2J58 A;  1GD2 E;  3VOP A;  3FX0 A;  1NKZ B;  1NTM E;  2YNY A;  3PTZ A;  3IF4 A;  5CCH C;  2WT7 A;  5TJH A;  5AVW B;  1NGM B;  1N73 B;  1EXI A;  1VQ8 P;  4LLH A;  2O01 N;  1LGH B;  3SFD C;  1K04 A;  3CC2 P;  2IBZ D;  2KXP B;  1YBK A;  1JM0 A;  1IFN A;  1AFO A;  2GM4 A;  1M1J B;  4A7P A;  4W7Y A;  3H1L G;  1NKN A;  1A02 J;  1MV8 A;  1RE3 C;  2E75 C;  1SQV K;  2XNX A;  1N2D C;  4HYT B;  3Q2Y A;  1GTW A;  4C7R A;  1J1D C;  3BCC G;  2K9J A;  4LGD E;  2HPC A;  1PFI A;  3H1K D;  5CBN A;  1J1E C;  3KXD A;  5CCH A;  4PJ0 H;  3TDK A;  5KLV J;  2B88 A;  4O9B A;  1NTK E;  2PP6 A;  1J1E B;  1LT9 A;  1UII A;  2WT7 B;  3CCU P;  2YO3 A;  1KD1 Q;  3V2P A;  1IFP A;  2J5U A;  3M0D A;  5KJ7 D;  2W6B A;  3L73 J;  3CME P;  4DT0 A;  3B4S A;  2E75 B;  5C39 A;  5APS A;  1OVU A;  2SPZ A;  3CI9 A;  5TIS E;  3RL0 D;  3S1K A;  2I1K A;  1M1J C;  2Q9I A;  1Q2N A;  2W83 C;  3MIW A;  1E5W A;  2QJP B;  3H1L D;  4EI2 A;  2OYI A;  2KUB A;  1BCC J;  1IFD A;  5APY A;  1OXZ A;  2NRG A;  3S9O A;  5KKZ C;  3D6Z A;  2P58 A;  2W6A A;  1JO5 A;  3H1I E;  1KC8 Q;  2PFX A;  2E42 A;  1N7S B;  2AEF A;  3BCC D;  1FJP A;  2FKW B;  1YTZ T;  1GK6 A;  1CI6 B;  1GL2 B;  3OJA B;  2B87 B;  1ZRT D;  3H1H J;  1S9K E;  1KB9 E;  5DJU B;  2M3B A;  2A45 H;  2XDJ A;  5AW6 B;  2WPQ A;  1NU1 G;  1RH5 B;  3M06 A;  4RES B;  2ZFC A;  1OW7 A;  2O1K A;  1FAV A;  2OTL P;  2JEE A;  3EFF K;  1BE3 D;  3CX5 H;  4QMA A;  4MN4 C;  1P84 E;  4RKU J;  3L75 E;  1Q7Y Q;  3PJS K;  3H1J E;  2L91 A;  2P1J A;  1JY2 N;  1FZF A;  3BRT B;  4GOE A;  3HE4 B;  5M1B A;  5KAI H;  3AEA C;  4IOI H;  2FYU J;  2K9Y A;  2QE7 H;  4OVN F;  4ZKU A;  2K3R A;  3AE7 C;  5AW2 B;  1N8R Q;  4JF7 A;  2M0B A;  2Y0D A;  4KHX A;  4H0L B;  2FFD A;  1QX8 A;  1N7L A;  2ZVN B;  2E76 D;  4HKZ H;  1U7J A;  4PD4 E;  1OZH A;  2QJK B;  3TGU E;  3QWO C;  3H1H E;  5APW A;  1A02 F;  1IZN B;  1OW8 A;  2KNC A;  3MTU E;  1G2C A;  2FYN C;  2I1J A;  4I7Z C;  1PP9 G;  3PH0 A;  1BE3 G;  1RE4 C;  2BCC G;  2WSF H;  3M9B A;  4L74 A;  4OWF A;  1RHZ B;  4Y99 B;  3CCR P;  3CCL P;  3L70 D;  4K35 A;  1K05 A;  3WU2 E;  2XV5 A;  3AE3 C;  1FDO A;  2WMM A;  5AVU B;  1FDM A;  2FFD C;  2JKV A;  2JP3 A;  3EFG A;  3FWL A;  5CCG D;  5AW0 B;  4TLF A;  2OGU A;  2ZT9 B;  1ZR2 A;  3B8E B;  1FDI A;  2Q6Q A;  1ZOY C;  3V5B A;  3F89 A;  3AEG C;  3TF5 A;  1L0L G;  2IYO A;  4XFJ A;  1JMB A;  1SQX E;  4N3Y B;  3HUS C;  1MFZ A;  1NTK G;  2Z5H A;  3L4F A;  5KAF E;  5GTI H;  2KS1 B;  3E1R A;  5BVZ A;  3NFQ A;  2BAS A;  3CWB J;  3V4Q A;  1IC2 A;  2HYN A;  4OGQ D;  5CJ0 A;  2BCC D;  2I8D A;  1HBW A;  3KZI E;  1OMI A;  3RL0 g;  2R44 A;  2WSE J;  1IK9 A;  2N9Y B;  3WUU A;  1GU4 A;  1VF5 C;  4M3L A;  1SQX D;  2W90 A;  2YMK A;  1USD A;  2K37 A;  3SSU A;  1BCC G;  3Q5P A;  5KTB A;  1VQK P;  2WTY A;  3O8Z A;  2WIT A;  5AW3 B;  4R4M A;  3L74 G;  5CJ4 A;  3P8C E;  3L75 J;  4UB8 H;  4N78 D;  3L71 J;  1ZLL A;  1KOR A;  1BGY J;  2B9B A;  3AE5 C;  1SQB J;  2MJZ A;  5AVT B;  3CX5 I;  3RBX A;  2IZ1 A;  5KLV D;  4R4L A;  2AEM A;  3AED C;  1M7L A;  3CXH E;  3VP8 A;  3I55 P;  2XZR A;  3KZI H;  3GF7 A;  3CX5 E;  1M57 D;  3KYQ A;  1N7S D;  1OX3 A;  1S3J A;  3HD7 D;  2C0X A;  1L2P A;  2YXR B;  1HTL C;  2DW3 A;  3H1J D;  3H1J G;  5AW1 B;  3TGU J;  5B5E E;  5KAI E;  4NPE A;  3CCS P;  4Y99 C;  3N7N A;  3WUT A;  3S4R A;  1BGY D;  2FYU G;  1WT6 A;  1SQQ D;  2XND H;  2QA4 P;  4JQ0 D;  2WSF J;  4U3F D;  3H32 A;  2ZYA A;  2KLU A;  1L4A B;  2R5B A;  5AW8 B;  3WMM 0;  3B71 A;  1JTH B;  1SQQ K;  1CSB A;  2GUS A;  3MGN A;  2A45 I;  4NPF X;  1QVF O;  2ZVO B;  3Q5S A;  3B5N A;  3I5C A;  4H0L C;  1AV1 A;  1T3U A;  4ASV A;  1NU1 D;  2O01 H;  2NPS C;  4GT1 A;  3BVH A;  3AE6 C;  2BCC E;  1Q82 Q;  1FJK A;  1BE3 J;  2D2C C; 
#chains in the Genus database with same CATH homology
 3P32 A;  2W27 A;  3VP9 A;  1X9V A;  5KJ7 A;  2C0W A;  1FOS F;  3SWY A;  1RF1 B;  3RK2 B;  1X79 B;  3TK1 A;  1VPC A;  3SWF A;  3TYY A;  2IPP A;  3MUD A;  5CJ0 A;  1JOC A;  1YYC A;  1N7S C;  1SFC D;  2R32 A;  1JY2 P;  1ZN5 A;  4XE5 B;  1JCC A;  2HG5 D;  2POH A;  2Q5U A;  2KSJ A;  1X8Y A;  2IX7 C;  1IFI A;  1CI6 A;  5APU A;  1W2E A;  1N7S A;  2XKM A;  1HJB A;  3RL0 B;  5BU8 B;  2WPS A;  2N1T A;  2GUV A;  1J1D B;  2OYI B;  3LID A;  3KQG A;  1GU5 A;  2N1T D;  4N78 E;  5AVZ B;  2P2U A;  1LTJ B;  1LT9 B;  1HGZ A;  1T3J A;  1SQP K;  3A7O A;  3NMD A;  3CL3 D;  2HPC B;  1RF1 C;  2OYI C;  2YKP A;  3U1A A;  1M1J A;  3V4W A;  1NWQ A;  3RL0 C;  1FZG A;  2ZXE B;  1HH0 A;  3HE5 A;  1SQB K;  1T8Z A;  1N73 A;  5CMZ A;  1LTB C;  2WSE H;  1NHL A;  4XA4 A;  1JCD A;  2NPS D;  1H88 A;  5AVY B;  1IO4 A;  3VYI A;  2KLV A;  3R2P A;  1LWU A;  1SFC B;  1LTG C;  1T2K C;  2IFM A;  2HOD B;  2KP8 A;  3HRN A;  4WBA A;  1GW3 A;  2KB7 P;  3H6P A;  3MD0 A;  2P67 A;  4WY4 A;  4JYC A;  3G3Z A;  2NPS B;  4I2L C;  4B86 A;  1QL1 A;  1YTZ I;  1FU1 A;  2YKQ A;  1L4A C;  2OYH A;  2QM7 A;  3VTP C;  1JNM A;  1SVF A;  1DH3 A;  1NAF A;  3L36 A;  3E1I A;  4C7N A;  1CZQ A;  2OYH B;  1G1I A;  1XTC C;  3TSI A;  2JJL A;  2P7J A;  3VMZ A;  3GHG A;  3C9I A;  5AW4 B;  3CLQ A;  2OYH C;  4LC1 A;  1Z56 A;  1MZ9 A;  2YKO A;  1LTS C;  2R5D A;  1SQX K;  3HD7 B;  3VMY A;  3HTK A;  3RK3 D;  1DEB A;  5CCG C;  1VDF A;  1LWU B;  1QL2 A;  4EIJ A;  2C9N Y;  3IR9 A;  3HUS B;  3UIA A;  1RY3 A;  1URQ B;  5APX A;  1GK4 A;  2N9B A;  1RF0 A;  1FZC C;  5APQ A;  1KQL A;  2FXM A;  3NTN A;  3V2Q A;  2Z4E A;  3EQ2 A;  3A3Y B;  1H8A A;  3B5N C;  3HE5 B;  2KYV A;  1IFM A;  5APV A;  3T97 A;  2YO2 A;  1T2K D;  3RK2 D;  1RF0 C;  1FZC A;  2C9L Y;  1GZL A;  5CCH D;  5CHX A;  4HH2 A;  1LTJ A;  3P7K A;  3P8C D;  4DZO A;  4IFM A;  4C46 A;  3KDP B;  2HFE D;  2Z5I A;  1FZE A;  1JY2 O;  5AW5 B;  2N1T B;  1RE3 A;  1LTI C;  1AQ5 A;  1LT9 C;  1LTJ C;  1NTZ K;  1XTG B;  5AVS B;  5AVR B;  1NTM K;  2PAJ A;  3N4X A;  2H8P D;  3TNU A;  3PP5 A;  3M0D C;  1KIL A;  3LIE A;  1JY3 N;  3NXS A;  2N1T C;  4AYC A;  1GW4 A;  1URQ D;  1KIL B;  3VN0 A;  1GDT A;  2M8R A;  5AW7 B;  3TNU B;  2H43 A;  4IFF A;  2XU6 A;  1L0N K;  3RK3 B;  2FYZ A;  3M0A A;  2CPS A;  4WY4 D;  3U1C A;  1RF1 A;  2WWW A;  1HWT C;  1HVV A;  1MUU A;  5AVX B;  4OH8 B;  2KOG A;  1S9K D;  1FZA A;  1NOH A;  1JY3 O;  1N73 C;  3B5N D;  2L5G B;  2QM8 A;  3B5N B;  2YMY A;  3RK2 C;  1JTH A;  1KZU B;  1L4A A;  3H32 B;  3A5T A;  1RE4 A;  1FZC B;  1URQ C;  2R3C A;  2WPR A;  1L0L K;  3OA7 A;  5BU5 A;  1NH4 A;  1NU1 K;  1LWU C;  1KIL D;  2CPB A;  4I1L A;  3HD7 C;  4WY4 C;  1GL2 D;  2J59 M;  1URQ A;  1OWA A;  3HUS A;  5APT A;  1H89 A;  4N6J A;  3BAS A;  4GIF A;  4EOT A;  1DX7 A;  2WSC H;  2OAR A;  3IFM A;  3HTK B;  1KFM A;  3HD7 A;  4AQR D;  2E43 A;  1FZB A;  4ZKP A;  4WB4 A;  1SLQ A;  3GHG C;  2Q7C A;  1SP4 A;  1LTA C;  5AVV B;  1IFJ A;  2IFN A;  3P8M C;  3A2A A;  2A45 G;  3GHG B;  4IFD K;  1WRG A;  1L4A D;  4C7N B;  3V2N A;  1G2C B;  1FOS E;  4W80 A;  1JUN A;  3M9Q A;  2FYU K;  2FFD B;  4DOJ A;  3M9H A;  1EQ7 A;  2Q3I A;  1ZR4 A;  2H7H A;  3II6 A;  5CCG A;  1SFC C;  3M91 A;  3HE4 A;  4GKG A;  2NPS A;  1KFN A;  4I6M C;  2O1J A;  5KJ7 C;  1N86 A;  2HLO A;  4WY4 B;  1LTT C;  3KPE A;  3V2R A;  1HGV A;  1NTK K;  1ZV8 A;  3OAK A;  3L35 A;  3BAT A;  1FBM A;  2HOD A;  4W7Y A;  5AW9 B;  1GL2 A;  1NO4 A;  1CW5 A;  1SFC A;  1J2J B;  3L37 A;  3RK3 C;  4W7Z A;  5AVQ B;  1G1J A;  2LKM A;  1JMM A;  1HUC A;  1IJD B;  1KIL C;  2VRS A;  4AUW A;  1JY3 P;  3VMX A;  2WZ7 A;  5KLV K;  3LW5 H;  4JYB A;  3BRV B;  1GL2 C;  2J58 A;  1GD2 E;  3VOP A;  1NKZ B;  2WT7 A;  2YNY A;  5CCH C;  1N73 B;  5AVW B;  4LLH A;  1LGH B;  1IFN A;  1AFO A;  2GM4 A;  1M1J B;  1NKN A;  1A02 J;  1MV8 A;  1RE3 C;  1GTW A;  1SQV K;  2XNX A;  1N2D C;  4HYT B;  4C7R A;  1J1D C;  4LGD E;  2HPC A;  1PFI A;  1J1E C;  5CCH A;  4O9B A;  2PP6 A;  2WT7 B;  1J1E B;  1LT9 A;  2YO3 A;  3V2P A;  3M0D A;  5KJ7 D;  2W6B A;  5APS A;  3RL0 D;  3CI9 A;  2I1K A;  1M1J C;  2Q9I A;  3MIW A;  1E5W A;  2OYI A;  1IFD A;  5APY A;  1OXZ A;  1JO5 A;  2W6A A;  2E42 A;  1N7S B;  1FJP A;  2FKW B;  1YTZ T;  1GK6 A;  1CI6 B;  1GL2 B;  3OJA B;  1S9K E;  2M3B A;  2A45 H;  2XDJ A;  5AW6 B;  2WPQ A;  3M06 A;  4RES B;  2ZFC A;  2O1K A;  1FAV A;  2JEE A;  2P1J A;  1JY2 N;  1FZF A;  3BRT B;  3HE4 B;  4ZKU A;  5AW2 B;  4JF7 A;  4KHX A;  2FFD A;  1N7L A;  5APW A;  1A02 F;  3MTU E;  1G2C A;  2I1J A;  1RE4 C;  2WSF H;  3M9B A;  4Y99 B;  2XV5 A;  5AVU B;  1FDM A;  2FFD C;  3EFG A;  5CCG D;  5AW0 B;  1ZR2 A;  3B8E B;  3V5B A;  3U59 A;  4N3Y B;  3HUS C;  1MFZ A;  2Z5H A;  3L4F A;  5BVZ A;  3NFQ A;  2BAS A;  3V4Q A;  1IC2 A;  2HYN A;  1HBW A;  1IK9 A;  1GU4 A;  4M3L A;  5KTB A;  2WTY A;  3O8Z A;  2WIT A;  5AW3 B;  5CJ4 A;  3P8C E;  4N78 D;  1ZLL A;  2MJZ A;  5AVT B;  1M7L A;  3VP8 A;  2XZR A;  3KYQ A;  1N7S D;  3HD7 D;  2C0X A;  5AW1 B;  1HTL C;  4Y99 C;  3N7N A;  1WT6 A;  3H32 A;  1L4A B;  2R5B A;  5AW8 B;  3WMM 0;  1JTH B;  1SQQ K;  1CSB A;  3MGN A;  2GUS A;  2A45 I;  3I5C A;  3B5N A;  1T3U A;  2O01 H;  2NPS C;  4GT1 A;  3BVH A;  1FJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...