1G2CB

Human respiratory syncytial virus fusion protein core
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
40
structure length
40
Chain Sequence
PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FUSION PROTEIN (F)
publication title Structural characterization of the human respiratory syncytial virus fusion protein core.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
total genus 15
structure length 40
sequence length 40
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2000-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1g2cB00
3L36A 3VMXA 1FOSE 1H89A 1MV8A 3VTPC 4GKGA 3VYIA 2QM8A 4I2LC 1MUUA 3I5CA 3HE5B 3M0AA 4RESB 5APVA 3P7KA 3VN0A 3IR9A 1HJBA 5AVWB 5AW5B 3P8MC 4DZOA 4JYCA 1YYCA 3M9BA 3V4QA 4LC1A 5APWA 5AVYB 1CI6B 2WPSA 3TYYA 1S9KD 5AW0B 3HE5A 5AW3B 1A02F 3TNUB 5AW8B 3M0DA 2JJLA 1X8YA 1IO4A 2R5DA 5AW6B 5AW2B 4KHXA 1H88A 2WTYA 3B8EB 2YO3A 1CI6A 1GU4A 3O8ZA 1CZQA 1NAFA 4B86A 2Q5UA 3TNUA 1KQLA 1A02J 5AW7B 3V4WA 4EOTA 2C9LY 2WWWA 3VMYA 2C9NY 5CMZA 3KQGA 2WPRA 3LIDA 3M06A 2Q3IA 1GZLA 4C46A 4C7NB 2P7JA 2W6AA 3A2AA 3A7OA 3LIEA 1HUCA 2IPPA 1JUNA 2N9BA 1NWQA 3OAKA 1FAVA 2KP8A 1DH3A 1GTWA 5AW9B 3HE4B 3MD0A 4C7NA 2P67A 4I6MC 1S9KE 3A3YB 4JYBA 1GK6A 1GU5A 1OWAA 1JNMA 3NMDA 5AVUB 3KDPB 3NTNA 2R5BA 2WT7B 5APUA 5APXA 3HTKA 4AQRD 1HBWA 3NXSA 5AVTB 3MGNA 1GD2E 2YNYA 3HE4A 3UIAA 2R3CA 3L37A 3M9HA 1MFZA 3NFQA 1GK4A 2W27A 4XE5B 1H8AA 2YO2A 2E42A 4M3LA 5APQA 1J2JB 2WT7A 5APSA 2E43A 2VRSA 1SP4A 4HYTB 5AVXB 4AYCA 2P2UA 3SWFA 3T97A 5AVSB 1FOSF 2H7HA 2XU6A 4GT1A 1SLQA 2BASA 1HWTC 5AVQB 2Z5IA 2ZXEB 2XZRA 3L35A 3M91A 2QM7A 5AVRB 3A5TA 5AVZB 2Q7CA 2R32A 1CSBA 5APTA 3VMZA 2ZFCA 4AUWA 2Z5HA 5APYA 3V5BA 2XV5A 3TK1A 5AW4B 3P32A 1G2CB 5AW1B 1T2KC 1T2KD 1OXZA 5AVVB 2WPQA
chains in the Genus database with same CATH superfamily
2WSSH 2LXBA 3M0AA 3CWBD 3HUSB 1OW7A 2QIWA 3CWBJ 3GHGC 1VQ9P 3MP7B 1L0NG 3H25A 3BCCD 4XFJA 3BCCJ 1BGYG 2B89A 3GHGB 2OYHB 1UIIA 3Q1MA 3VP8A 4ZKUA 1K9MQ 2ZYDA 1NTMD 1EZVD 2OYIC 1NAFA 1NTMJ 3CC7P 1EQ7A 4ASWA 2OTKE 4C7NB 1SQXD 3H1HE 1SQXJ 1JUNA 1VPCA 2OYIB 1PPJE 3HRNA 1KYOD 3CMEP 3CC4P 3Q5RA 4L73A 2BEZF 1RF1A 2FYUD 1KYOI 1LT9A 2FYUJ 3CWBG 4AQRD 1HBWA 2ITAA 1H8AA 1KILA 2B88A 3GF7A 5AVXB 4AYCA 2P2UA 1KB9E 3T97A 1SQPE 1YTZT 3HD7D 4WBAA 1SQQE 1EZVG 1OIPA 3OA7A 2PAJA 1Q81Q 1W5CE 5KLVD 1RF0C 1KQFB 5KLVJ 5M1BA 2GUVA 3H1JG 2M5AA 3R4YA 3W68A 3WUVA 2J5UA 1S4XA 2CK3H 4JYCA 3D71A 3TF5A 2IYPA 1SQBG 3CMAP 3M9BA 2FYUG 2NPSD 3AEEC 1AFOA 2JWDA 1SQBK 2AXTH 4OH8B 1HJ0A 4K3AA 1JY3O 3CX5D 1YITP 1CI6A 1OVUA 2Q5UA 5EFWB 3TNUA 3CX5I 1K05A 3MIWA 2QEXP 2KXPB 2Z4EA 3A0BE 4YXDC 1L4AC 5KLVG 3L73E 3A3YB 3V2RA 1RQUA 1TU3F 2O1KA 2GM4A 3HTKA 1IFNA 1L4AB 4NPEA 1JB0J 1NU1E 1LT1A 4W7YA 1J2JB 3CI9A 3IAOA 1LJ2A 1LNQA 5APSA 5CJ4A 4H44D 1Y9BA 5KAFE 1ZW0A 3BATA 3G71P 2WSCJ 2A06E 3R2PA 4C7RA 3JCUH 3Q5SA 2QM7A 2O01N 4PD4E 1LTBC 1KQGB 1Q2NA 1VQ8P 2ZFCA 2O1JA 2L91A 4GDOA 2QG4A 2LR2A 1JY2N 1AQTA 1LWUA 3P7KA 1QGKB 1M56D 3G6EP 3V4QA 4PJ0H 3MTUE 1FZBA 2KUBA 1ZRTD 2C0WA 5AW2B 1H88A 1ZR2A 4EDFA 1RF1C 1LT9C 5B66H 2KSEA 5CCGA 1HUCA 1PP9E 1RF1B 1KILC 1GDTA 1LT9B 1W2BO 1P84D 2ZT9D 3TSIA 2W6BA 3BCCE 1CW5A 4EI2A 3JSVC 4HB1A 1KILB 3KDPB 1MZ9A 1OW6A 1JEKA 3CLQA 2FXOA 5KJ7A 1NTME 3T97B 2KYVA 1Q90D 2WT7A 1YHQP 2B87A 1SQXE 4DCKA 2KOGA 2KS1B 3E1IA 2M5AB 2KI7B 1IFPA 3H32A 2NRGA 2R3SA 4GODA 2YIUC 1FE6A 1OVRA 2NZ2A 2Y0EA 1KZUB 1NKZB 1HJBA 2YIUB 2JDIH 1CI6B 4YTPC 3PRJA 3CL3D 4L76A 4NPFX 4U3FD 3TNUB 4U3FJ 4DOJA 1FZFA 1X8YA 1S5LX 3FX0A 3WUUA 3H1HD 4N78D 3AE2C 1N7LA 3H1HJ 1T6AA 1PPJD 3LIDA 3N4XA 3PH0A 1YJ9P 2A45I 3HTKB 4ASVA 2KK7A 1QVGO 3EFGA 1S3JA 2OQQA 3MGNA 3HE4A 2QA4P 1ZR4A 2N1TD 1KB9D 1URQA 1SQPD 4M3LA 5BVZA 2H89C 1SQPJ 1FU1A 1SP4A 1KB9I 3AE9C 1FOSF 1LWUC 2BASA 3U1AA 2JR8A 1YQ3C 3H1HG 4WY4A 5APTA 1PPJG 1LWUB 3EQ2A 1SQVK 2A45G 2XDJA 5AW4B 5AW1B 1WRGA 3VMXA 3VYIA 5H2FH 3IR9A 5CCGC 2K9JA 1KTMA 1YYCA 3H6PA 4DT0A 5AVYB 5KLIC 1VQLP 3HE5A 1N73A 4HH2A 2JJLA 4WVZA 1NTKK 1SQPG 5KLIB 2WQYC 1SQQG 3IN6A 1A02J 1QVFO 4EOTA 3AEBC 1VF5C 1EXIA 3M06A 5KJ7C 4PV1C 1OX3A 2D2CC 4JF7A 1NWQA 3OAKA 1VF5B 4N6JA 1JO5A 4PV1B 1VQNP 3E7KA 2D2CB 3L71D 2WT7B 3L71J 5K5GB 3RK3C 1NU1J 2B87B 1X79B 2YNYA 1AA0A 4LLHA 1JMMA 1GK4A 2YO2A 1VQ5P 3A0HH 3E1RA 3RK3B 2E43A 3AE8C 3TDKA 3H32B 1K73Q 1P84E 1KQSO 3CCJP 4PD4I 2Q7CA 3VMZA 1FC2C 1VDFA 1T2KC 2GUSA 3L73G 3WMM0 1VQ4P 3RBZA 1S5LH 1GMJA 4Y99C 1NU1G 3TYYA 1FDOA 2YKOA 2PFXA 1OW8A 1U7MA 1NO4A 1YQ4C 1S72P 4Y99B 2A06G 3LW5H 1M57D 2GA1A 1N7SD 4B86A 1PP9D 1ZN5A 3PP5A 2I1KA 3MUDC 2OYHC 1PP9J 4C46A 3PLNA 1URQC 1MFTA 2IPPA 2N9BA 1L0NK 2E75D 3HE4B 2E74D 4H13C 2P67A 1VQPP 4U3FE 1URQB 3M9QA 5B5EH 5TJHA 4WY4C 1EZVI 2R3CA 3L37A 4H13B 1QEXA 4N78E 2WSEJ 2Q6QA 4H0LD 1RY3A 4RO0A 4WY4B 4GOFA 5CBNA 3W67A 2W83C 1LGHB 1PP9G 1NVOA 1HGVA 1IFJA 2R32A 1N73C 2K9JB 3BCCG 1L0LE 3L36A 1RH5B 1FOSE 2QE7H 1BE3E 3HE5B 2OYOA 3VN0A 1N73B 5AW5B 2OTJP 1OFCX 3WU2H 1D7MA 1NTMG 3FWNA 3I56P 3VP9A 1S9KD 1KORA 2IBZD 1FDMA 4OGQC 1SQXG 3TGUD 3BVHA 1GL2D 2ZJSE 3TGUJ 2V7QH 5GTHH 5CCHD 4OGQB 4L74A 2KB7P 5KAIH 2W6AA 3USSA 2FYUK 3B5NC 5TISH 3KPEA 1DH3A 2M3EA 3L75D 2A45H 3FXDA 3G3ZA 4I6MC 2OARA 3L75J 3L72D 1YJNP 1JNMA 3JCUE 3GMAA 3L72J 2M8RA 2MJZA 3B5NB 1JY3N 3K5BA 5CJ0A 3CC2P 1ZMEC 4QMAA 1AVYA 5BU8B 2BEQD 2HFED 2XU6A 4GT1A 1SLQA 5CBOA 3D70A 3CXHH 5KLVK 2HYNA 1HF9A 3A5TA 1NTZD 3L71E 1NTZJ 2Z5HA 1H0TA 2WPQA 3KZIE 5B66E 1R8EA 2E76D 2YKQA 3HD7A 3RBXA 1FJKA 2YXRB 4ZNCA 2O01J 2MKVA 1ZOYC 3CCEP 3WUTA 3B8EB 2YO3A 1T8ZA 4IOIH 2W6JH 1Q86Q 2QJYC 2K9YA 4LGDE 2WSFH 3FWLA 2SPZA 2NPSA 4JBZA 2Q3EA 3RL0C 2QJYB 1PZQA 3PJSK 1KILE 2Q9IA 1YJWP 3P8CE 2AEJA 2ZVOB 5E79H 3N7NA 1AVOA 3RL0B 1FZGA 3UIAA 2AXCA 3MZWB 4XE5B 3B4SA 5APQA 1XTCC 1LTTC 5KAFH 1SFCD 1HTLC 1P84I 4IL6X 2Z5IA 1DX7A 1YBKA 1YI2P 1EDIA 3OJAB 4KJMA 1JMBA 3D6YA 3S9OA 1Q82Q 2CPBA 1N86A 1H89A 1MV8A 1KC8Q 4I2LC 3AEAC 3H1ID 5AVWB 3IFMA 3H1IJ 2K88A 3JC22 1M8OB 3CCSP 1DEEG 1FJPA 5AW0B 5AW3B 1EDLA 3CPWO 1IK9A 1BCCE 2W8ZA 2R5DA 2K3RA 4ZKPA 2WTYA 3G9RA 1DEBA 1USDA 2IFNA 5KKZC 3L4FA 3D6ZA 1IJDB 4XA4A 3A2AA 2W90A 1E79H 1QX8A 5KKZB 2KP8A 1NGMB 2O3JA 1S9KE 3EWKA 2I1JA 2IBZE 1NAYA 3CCQP 2QJKC 1SS1A 1QLED 3TGUE 2WMMA 4OVNF 2QJKB 5H2FE 3SWFA 2K1AA 4UB6E 3MHVA 1LP1A 1HWTC 3HD7C 1H0TB 3AE3C 3L75E 1U7JA 1KYOH 3M91A 3L72E 1L0LD 1BE3D 4D6TE 1IZNB 1L0LJ 1X0TA 1M7LA 3HD7B 1BE3J 2E5TA 4KHXA 1WMKA 2Y0CA 3SWYA 4U3FG 4N3YB 1T3UA 1KMIZ 2KSJA 2CPSA 3F5HA 4IFFA 2NPSC 3SFDC 3OW2O 3H1LE 3EFFK 3B5ND 1VQMP 1HVVA 4IFDK 1VL2A 3GG2A 1NTZE 2NPSB 3GLMA 2DW3A 1RE4A 1GU4A 1GW4A 5DJTB 3BRTB 3L70E 5AW7B 2QSIA 2WPRA 1R5SA 1GZLA 1LTJA 1RHZB 2QVAA 2P10A 2JO1A 2R44A 1L0LG 1L4AD 1BE3G 3C1LA 3BASA 2QRXA 2BCCD 1ZLLA 2BCCJ 2B9BA 1SQPK 2M0BA 5APXA 4IL6H 1SQQK 1GD2E 3CX5H 3RK2C 4TT3H 2IFMA 3Q5PA 4JPZB 1NH4A 3RK3E 2FFDA 2JEEA 3GW6A 3V2PA 4H44C 3RK2B 3BRVB 3PHLA 2ZYGA 1PGOA 4UB8E 1IK7A 3CCRP 4H44B 3SSUA 2N1TA 1OVVA 4AUWA 3I55P 4W80A 3TK1A 1RF0A 2G3AA 1LTAC 1M1KQ 2HG5D 2QM8A 4DJGA 4NPDA 4EYYQ 1Y8AA 1EDKA 4K35A 1IFIA 1DIPA 4LC1A 2WSCH 2C0XA 1U57A 1IC2A 2H88C 3M0DA 1FBMA 3II6A 4JQ0D 4GIFA 5GTIH 1CZQA 3O6QA 1BGYD 1BDCA 3KQGA 3L74E 1BGYJ 3A7OA 3L71G 3LIEA 4YPCA 1FS0E 1JY2P 1KILD 3H1IE 1K8AQ 3P8CD 1NU1K 2ZT9C 1Z56A 5AW9B 2G8YA 3MD0A 3IF4A 4WWIA 1OWAA 2PP6A 4R4LA 2YKPA 2Y9ZA 2ZT9B 2L5GB 2FYNC 2FXPA 2W27A 3KXDA 1LP1B 4KT0J 1KFMA 1EC5A 2FYNB 3WU2E 5AVQB 1T3JA 4Y28J 4BXLA 3AECC 1P84H 2ZXXA 5AVZB 3V2QA 3V5BA 2WPVB 1BSNA 2XNXA 2ZAEB 1RE4C 2HLOA 5GTHE 1VQKP 2Y0DA 5KAIE 1LTJC 1FZCA 1BCCD 3ZDMA 1BCCJ 1SQVE 2WPSA 3CCVP 5TISE 2AXTE 3H1JD 1JCDA 3H1JJ 1J1DC 2WVRA 3FXEA 1LTJB 3AE1C 1FZAA 1SQBD 2YMYA 2FBWC 1IFMA 1SQBJ 1KN7A 3V4WA 1J1DB 2C9LY 4BWNA 1NTMK 1NTKE 2FFDC 2PGDA 4L75A 1FAVA 3CXHE 2IBZI 2LKMA 1SQXK 1OZHA 1N7SA 2FFDB 3NTNA 3RL0g 3VOPA 2I8DA 1MKMA 3NFQA 2N1TC 2E42A 1PL5A 1BCCG 2KS1A 1NYHA 4OWFA 2KNCA 2N1TB 5BU5A 4D6TD 1R5LA 4D6TJ 2E5YA 2XZRA 2HPCA 2FXMA 2BCCE 3M0DC 4YXWH 4HKZH 2FYZA 1OXZA 2QJPC 2IBZG 3VTPC 1SVFA 3I5CA 1S2EA 3H1LD 1NOHA 1KB9H 5CCGD 3P8MC 3PTZA 1NJIQ 3H1KE 3TGUG 3H1LJ 1AQ5A 2RH0A 4PJ0E 2WZ7A 1JTHA 2QJPB 1HH0A 1KV4A 1PV3A 3C9IA 3O6QB 5AW8B 3CD6P 3V2NA 5C39A 1IO4A 3L70D 1LTIC 3L70J 5E79E 1DD4A 3L75G 1VF5D 2WWWA 3L72G 5CMZA 3AEGC 5KJ7D 2Q3IA 4PV1D 3RK2D 4D6TG 1S1CX 2D2CD 1DD3A 1J1EC 3C8VA 2PRRA 1AJYA 2J58A 4JYBA 1GK6A 1GL2A 5AVUB 4GOEA 1J1EB 3RK3D 5CCHA 1RE3A 3H1LG 2KIKA 4R4MA 1JM0A 1JY2O 1L0NE 1BGYE 1NTZG 3A0BH 3Q3DA 2YMKA 1FZEA 1NTZK 3L70G 1G1IA 2KLVA 2HODA 2ZXEB 1FZCC 2JWAA 1VQOP 3L35A 2JP3A 1CSBA 3LW5J 1WT6A 2YXQB 1ZV8A 1T2KD 3P32A 1BDDA 3FGAD 1FZCB 2C9NY 4EIJA 1YTZI 2J59M 3AE5C 4GKGA 3KZIH 3S4RA 2HR3A 5APVA 3RGUA 1OMIA 1ZXGA 3ITKA 3CWBE 2RMZA 4PD4H 3U59A 2OGUA 2K37A 2XNDH 3L74D 5CHXA 4MN4C 3L74J 2KZJA 1N7SC 1PGPA 1KQLA 1N8RQ 3VMYA 1EZVE 1PGQA 1URQD 1N7SB 3AEFC 1W2EA 2KZIA 2E75C 2P1JA 4A7PA 4H13D 2H8PD 2E74C 1Q7YQ 3H1JE 3NMDA 1KYOE 5DJUB 5APUA 2E75B 4WY4D 2E74B 2UWJE 1SQBE 3M9HA 2KNCB 3CCMP 2FYUE 1KD1Q 1AV1A 1M1JA 4H0LC 4W7ZA 2HPCB 3G4SP 4U7JA 2N9YB 3L74G 4BRYA 4H0LB 5AVRB 3H1IG 3AE6C 2V7QJ 1JTHB 4O9BA 2RKLA 2M3BA 2WSEH 1VQ6P 5KLVE 1SQVD 1SFCA 4DZOA 1PIXA 2ZYAA 1SQVJ 1G2CA 4CPGA 5L8RJ 4RKUJ 2Q1KA 2V4HA 3HUSA 1HGZA 3S1KA 4OGQD 3ABVC 2AEMA 1GL2C 2ZVNB 2KLUA 4IL6E 2IZ0A 5CCHC 3GHGA 1NTKD 3MUDA 1PGJA 3CX5E 2OYHA 1X9VA 2POHA 1RE3C 2P58A 1NTKJ 1GL2B 3AEDC 4WB4A 3CXHD 2Y9YA 3KYQA 1GW3A 1SQQD 1SQQJ 1JCCA 4IFMA 4C7NA 2FKWB 3CXHI 1GU5A 1N2DC 4TLFA 2OYIA 3GF3A 1Y47A 3NXSA 2AEFA 1EDJA 1SQVG 1RQVA 1MFZA 3A0HE 1E5WA 3B71A 2HODB 1LTGC 2VRSA 4HYTB 1L0LK 4I1LA 4UB6H 3VMAA 1NTKG 2IZ1A 1BSHA 1USEA 2XV5A 4HJGH 5AVVB 5KTBA 3H1KD 2H43A 1JY3P 1S5LE 3QWOC 5GTIE 3H1KJ 2WSFJ 1MUUA 3Q2YA 4RESB 1FDIA 2RN0A 2E76C 2IYOA 1L2PA 5APWA 2OTLP 3L73D 2IDBA 1A02F 3L73J 3SFEC 2E76B 1PFIA 1X22A 1NHLA 3QH9A 5AW6B 4RJTA 3O8ZA 1NU1D 1ZP0C 1ZRTE 2FY8A 2BCCG 1QL1A 2P7JA 1IFDA 3SWKA 3V6IA 2JKVA 2A06D 1M1JC 1XTGB 2XKMA 1EXJA 3RL0D 3CCLP 3B5NA 1GTWA 2WITA 1KFNA 2O01H 4PD4D 4ZMDA 3AE4C 3H1KG 5B5EE 1L0ND 3KHUA 1M1JB 2R5BA 1L0NJ 5AVTB 1NKNA 2IX7C 4BRYB 2LXCB 1L4AA 1VQ7P 4I7ZC 5AVSB 1YIJP 2H7HA 1JOCA 1SFCC 4UB8H 4I7ZB 3CCUP 1M90Q 1K04A 1LTSC 3F89A 3HUSC 1G1JA 1QL2A 1UIXA 4Z1MH 1SFCB 5APYA 3AE7C 1G2CB 3U1CA
chains in the Genus database with same CATH topology
1WRGA 2CPBA 3VMXA 1N86A 1H89A 1MV8A 3VTPC 3VYIA 4I2LC 1SVFA 3I5CA 3M0AA 3HUSB 3IR9A 1NOHA 5CCGC 5AVWB 5CCGD 3GHGC 3IFMA 3P8MC 1AQ5A 1YYCA 2WZ7A 1JTHA 3H6PA 5AVYB 1FJPA 1HH0A 5AW0B 3HE5A 5AW3B 3C9IA 1N73A 5AW8B 4HH2A 3GHGB 3V2NA 2OYHB 1IK9A 2JJLA 1NTKK 1IO4A 2R5DA 3VP8A 1LTIC 4ZKPA 4ZKUA 2WTYA 1OXZA 1DEBA 2OYIC 2IFNA 1NAFA 1EQ7A 1A02J 3L4FA 4EOTA 2WWWA 5CMZA 5KJ7D 3M06A 2Q3IA 5KJ7C 1IJDB 4C7NB 3RK2D 4XA4A 3A2AA 1JUNA 1VPCA 2OYIB 1J1EC 4JF7A 1NWQA 3OAKA 3HRNA 2KP8A 4N6JA 1JO5A 1S9KE 2J58A 4JYBA 1GK6A 1GL2A 2I1JA 1RF1A 5AVUB 1J1EB 1LT9A 2WT7B 3RK3D 3RK3C 5CCHA 4AQRD 1HBWA 1X79B 1RE3A 2YNYA 4LLHA 1JY2O 1JMMA 1GK4A 1H8AA 2YO2A 1KILA 3RK3B 2E43A 5AVXB 4AYCA 2P2UA 3SWFA 3T97A 1FZEA 1NTZK 3H32B 1G1IA 1YTZT 1HWTC 3HD7D 3HD7C 2KLVA 4WBAA 2HODA 2ZXEB 1FZCC 3L35A 3M91A 2Q7CA 3OA7A 1CSBA 2PAJA 1WT6A 3VMZA 1M7LA 1VDFA 1ZV8A 3HD7B 1RF0C 1T2KD 3P32A 1T2KC 2GUSA 1FZCB 2C9NY 4KHXA 4EIJA 3SWYA 1YTZI 2J59M 2GUVA 3WMM0 4GKGA 4N3YB 5APVA 1T3UA 2KSJA 4JYCA 4Y99C 2CPSA 3M9BA 2NPSD 2NPSC 4IFFA 1AFOA 3TYYA 1SQBK 2YKOA 3B5ND 3U59A 4OH8B 1NO4A 1HVVA 1JY3O 4Y99B 4IFDK 3LW5H 2NPSB 5CHXA 1CI6A 1RE4A 1GU4A 1N7SD 1N7SC 4B86A 2Q5UA 1GW4A 3TNUA 1KQLA 3BRTB 1ZN5A 3PP5A 2I1KA 5AW7B 2OYHC 3VMYA 2WPRA 1GZLA 1LTJA 3MIWA 4C46A 1URQD 1URQC 2IPPA 1N7SB 2N9BA 2Z4EA 1L0NK 1L4AD 1L4AC 1W2EA 2P1JA 3HE4B 2H8PD 2P67A 3BASA 3A3YB 1ZLLA 3V2RA 1URQB 3NMDA 3M9QA 1SQPK 2O1KA 2GM4A 5APUA 5APXA 3HTKA 1IFNA 1L4AB 1SQQK 1GD2E 4WY4D 4WY4C 2R3CA 3L37A 3M9HA 3RK2C 2IFMA 4N78E 1NH4A 4W7YA 2FFDA 1M1JA 1J2JB 3CI9A 2JEEA 5APSA 4W7ZA 2HPCB 5CJ4A 3V2PA 1RY3A 4WY4B 3RK2B 3BATA 3BRVB 3R2PA 4C7RA 1LGHB 5AVRB 2QM7A 1HGVA 1LTBC 1IFJA 2R32A 1N73C 2N1TA 2ZFCA 4AUWA 2O1JA 4W80A 3TK1A 1RF0A 1JTHB 1LTAC 3L36A 4O9BA 1FOSE 2HG5D 2QM8A 2M3BA 1JY2N 2WSEH 3HE5B 3P7KA 1LWUA 3VN0A 1N73B 5AW5B 1SFCA 4DZOA 1G2CA 1IFIA 3V4QA 4LC1A 3VP9A 2WSCH 3MTUE 1S9KD 2C0XA 3HUSA 1IC2A 1FZBA 3M0DA 1FBMA 1HGZA 3II6A 1FDMA 2C0WA 5AW2B 1H88A 1GL2D 1GL2C 1ZR2A 3BVHA 1RF1C 4GIFA 1CZQA 1LT9C 5CCHD 5CCHC 5CCGA 3GHGA 2OYHA 3MUDA 1X9VA 2POHA 1RE3C 2KB7P 3KQGA 2W6AA 3A7OA 3LIEA 1GL2B 1HUCA 1RF1B 1JY2P 1KILD 1KILC 4WB4A 1GDTA 1LT9B 3P8CD 3KYQA 2FYUK 1NU1K 3B5NC 1GW3A 3TSIA 3KPEA 1DH3A 1Z56A 5AW9B 2W6BA 2A45H 1JCCA 3MD0A 4IFMA 4C7NA 2FKWB 3G3ZA 4I6MC 2OARA 1CW5A 1GU5A 1OWAA 2PP6A 1JNMA 1KILB 1N2DC 3KDPB 2YKPA 2OYIA 2M8RA 2MJZA 3B5NB 1MZ9A 2L5GB 3NXSA 3CLQA 1JY3N 5KJ7A 2KYVA 1MFZA 2W27A 1E5WA 2HODB 1KFMA 2WT7A 5CJ0A 1LTGC 2VRSA 4HYTB 5BU8B 1L0LK 4I1LA 2HFED 2XU6A 2KOGA 1SLQA 4GT1A 5AVQB 1T3JA 5KLVK 2HYNA 3E1IA 3A5TA 5AVZB 3V2QA 3H32A 2Z5HA 3V5BA 2XV5A 2XNXA 5AVVB 5KTBA 2H43A 2WPQA 1KZUB 1JY3P 1RE4C 2HLOA 1MUUA 4RESB 1NKZB 1HJBA 2YKQA 3HD7A 1FJKA 1LTJC 1FZCA 5APWA 1CI6B 2WPSA 3CL3D 1A02F 3TNUB 1JCDA 4DOJA 1J1DC 1FZFA 1X8YA 1PFIA 1NHLA 5AW6B 1LTJB 3B8EB 1FZAA 2YO3A 2YMYA 1T8ZA 3O8ZA 1IFMA 4N78D 1N7LA 3V4WA 1J1DB 2C9LY 3LIDA 1QL1A 3N4XA 4LGDE 2P7JA 1IFDA 2WSFH 2NPSA 1NTMK 2FFDC 1M1JC 1XTGB 2XKMA 3RL0D 3RL0C 3B5NA 2A45I 1FAVA 3HTKB 1GTWA 2WITA 1KFNA 2O01H 2Q9IA 2LKMA 3P8CE 1SQXK 3EFGA 1N7SA 3N7NA 2FFDB 1M1JB 3NTNA 2R5BA 3RL0B 1FZGA 5AVTB 3MGNA 3VOPA 3HE4A 3UIAA 1NKNA 1ZR4A 2IX7C 3NFQA 2N1TD 2N1TC 1URQA 4XE5B 2E42A 4M3LA 5APQA 5BVZA 1XTCC 1LTTC 1FU1A 1L4AA 1SP4A 5AVSB 1FOSF 1LWUC 2N1TB 2H7HA 1JOCA 1SFCD 1SFCC 2BASA 3U1AA 5BU5A 1HTLC 2Z5IA 1DX7A 2XZRA 2HPCA 2FXMA 3OJAB 4WY4A 1LTSC 5APTA 3HUSC 1LWUB 3EQ2A 1G1JA 1QL2A 3M0DC 1SQVK 2A45G 1SFCB 2XDJA 5APYA 5AW4B 5AW1B 1G2CB 2FYZA 3U1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L36 A;  3VMX A;  1FOS E;  1H89 A;  1MV8 A;  3VTP C;  4GKG A;  3VYI A;  2QM8 A;  4I2L C;  1MUU A;  3I5C A;  3HE5 B;  3M0A A;  4RES B;  5APV A;  3P7K A;  3VN0 A;  3IR9 A;  1HJB A;  5AVW B;  5AW5 B;  3P8M C;  4DZO A;  4JYC A;  1YYC A;  3M9B A;  3V4Q A;  4LC1 A;  5APW A;  5AVY B;  1CI6 B;  2WPS A;  3TYY A;  1S9K D;  5AW0 B;  3HE5 A;  5AW3 B;  1A02 F;  3TNU B;  5AW8 B;  3M0D A;  2JJL A;  1X8Y A;  1IO4 A;  2R5D A;  5AW6 B;  5AW2 B;  4KHX A;  1H88 A;  2WTY A;  3B8E B;  2YO3 A;  1CI6 A;  1GU4 A;  3O8Z A;  1CZQ A;  1NAF A;  4B86 A;  2Q5U A;  3TNU A;  1KQL A;  1A02 J;  5AW7 B;  3V4W A;  4EOT A;  2C9L Y;  2WWW A;  3VMY A;  2C9N Y;  5CMZ A;  3KQG A;  2WPR A;  3LID A;  3M06 A;  2Q3I A;  1GZL A;  4C46 A;  4C7N B;  2P7J A;  2W6A A;  3A2A A;  3A7O A;  3LIE A;  1HUC A;  2IPP A;  1JUN A;  2N9B A;  1NWQ A;  3OAK A;  1FAV A;  2KP8 A;  1DH3 A;  1GTW A;  5AW9 B;  3HE4 B;  3MD0 A;  4C7N A;  2P67 A;  4I6M C;  1S9K E;  3A3Y B;  4JYB A;  1GK6 A;  1GU5 A;  1OWA A;  1JNM A;  3NMD A;  5AVU B;  3KDP B;  3NTN A;  2R5B A;  2WT7 B;  5APU A;  5APX A;  3HTK A;  4AQR D;  1HBW A;  3NXS A;  5AVT B;  3MGN A;  1GD2 E;  2YNY A;  3HE4 A;  3UIA A;  2R3C A;  3L37 A;  3M9H A;  1MFZ A;  3NFQ A;  1GK4 A;  2W27 A;  4XE5 B;  1H8A A;  2YO2 A;  2E42 A;  4M3L A;  5APQ A;  1J2J B;  2WT7 A;  5APS A;  2E43 A;  2VRS A;  1SP4 A;  4HYT B;  5AVX B;  4AYC A;  2P2U A;  3SWF A;  3T97 A;  5AVS B;  1FOS F;  2H7H A;  2XU6 A;  4GT1 A;  1SLQ A;  2BAS A;  1HWT C;  5AVQ B;  2Z5I A;  2ZXE B;  2XZR A;  3L35 A;  3M91 A;  2QM7 A;  5AVR B;  3A5T A;  5AVZ B;  2Q7C A;  2R32 A;  1CSB A;  5APT A;  3VMZ A;  2ZFC A;  4AUW A;  2Z5H A;  5APY A;  3V5B A;  2XV5 A;  3TK1 A;  5AW4 B;  3P32 A;  1G2C B;  5AW1 B;  1T2K C;  1T2K D;  1OXZ A;  5AVV B;  2WPQ A; 
#chains in the Genus database with same CATH topology
 2WSS H;  2LXB A;  3M0A A;  3CWB D;  3HUS B;  1OW7 A;  2QIW A;  3CWB J;  3GHG C;  1VQ9 P;  3MP7 B;  1L0N G;  3H25 A;  3BCC D;  4XFJ A;  3BCC J;  1BGY G;  2B89 A;  3GHG B;  2OYH B;  1UII A;  3Q1M A;  3VP8 A;  4ZKU A;  1K9M Q;  2ZYD A;  1NTM D;  1EZV D;  2OYI C;  1NAF A;  1NTM J;  3CC7 P;  1EQ7 A;  4ASW A;  2OTK E;  4C7N B;  1SQX D;  3H1H E;  1SQX J;  1JUN A;  1VPC A;  2OYI B;  1PPJ E;  3HRN A;  1KYO D;  3CME P;  3CC4 P;  3Q5R A;  4L73 A;  2BEZ F;  1RF1 A;  2FYU D;  1KYO I;  1LT9 A;  2FYU J;  3CWB G;  4AQR D;  1HBW A;  2ITA A;  1H8A A;  1KIL A;  2B88 A;  3GF7 A;  5AVX B;  4AYC A;  2P2U A;  1KB9 E;  3T97 A;  1SQP E;  1YTZ T;  3HD7 D;  4WBA A;  1SQQ E;  1EZV G;  1OIP A;  3OA7 A;  2PAJ A;  1Q81 Q;  1W5C E;  5KLV D;  1RF0 C;  1KQF B;  5KLV J;  5M1B A;  2GUV A;  3H1J G;  2M5A A;  3R4Y A;  3W68 A;  3WUV A;  2J5U A;  1S4X A;  2CK3 H;  4JYC A;  3D71 A;  3TF5 A;  2IYP A;  1SQB G;  3CMA P;  3M9B A;  2FYU G;  2NPS D;  3AEE C;  1AFO A;  2JWD A;  1SQB K;  2AXT H;  4OH8 B;  1HJ0 A;  4K3A A;  1JY3 O;  3CX5 D;  1YIT P;  1CI6 A;  1OVU A;  2Q5U A;  5EFW B;  3TNU A;  3CX5 I;  1K05 A;  3MIW A;  2QEX P;  2KXP B;  2Z4E A;  3A0B E;  4YXD C;  1L4A C;  5KLV G;  3L73 E;  3A3Y B;  3V2R A;  1RQU A;  1TU3 F;  2O1K A;  2GM4 A;  3HTK A;  1IFN A;  1L4A B;  4NPE A;  1JB0 J;  1NU1 E;  1LT1 A;  4W7Y A;  1J2J B;  3CI9 A;  3IAO A;  1LJ2 A;  1LNQ A;  5APS A;  5CJ4 A;  4H44 D;  1Y9B A;  5KAF E;  1ZW0 A;  3BAT A;  3G71 P;  2WSC J;  2A06 E;  3R2P A;  4C7R A;  3JCU H;  3Q5S A;  2QM7 A;  2O01 N;  4PD4 E;  1LTB C;  1KQG B;  1Q2N A;  1VQ8 P;  2ZFC A;  2O1J A;  2L91 A;  4GDO A;  2QG4 A;  2LR2 A;  1JY2 N;  1AQT A;  1LWU A;  3P7K A;  1QGK B;  1M56 D;  3G6E P;  3V4Q A;  4PJ0 H;  3MTU E;  1FZB A;  2KUB A;  1ZRT D;  2C0W A;  5AW2 B;  1H88 A;  1ZR2 A;  4EDF A;  1RF1 C;  1LT9 C;  5B66 H;  2KSE A;  5CCG A;  1HUC A;  1PP9 E;  1RF1 B;  1KIL C;  1GDT A;  1LT9 B;  1W2B O;  1P84 D;  2ZT9 D;  3TSI A;  2W6B A;  3BCC E;  1CW5 A;  4EI2 A;  3JSV C;  4HB1 A;  1KIL B;  3KDP B;  1MZ9 A;  1OW6 A;  1JEK A;  3CLQ A;  2FXO A;  5KJ7 A;  1NTM E;  3T97 B;  2KYV A;  1Q90 D;  2WT7 A;  1YHQ P;  2B87 A;  1SQX E;  4DCK A;  2KOG A;  2KS1 B;  3E1I A;  2M5A B;  2KI7 B;  1IFP A;  3H32 A;  2NRG A;  2R3S A;  4GOD A;  2YIU C;  1FE6 A;  1OVR A;  2NZ2 A;  2Y0E A;  1KZU B;  1NKZ B;  1HJB A;  2YIU B;  2JDI H;  1CI6 B;  4YTP C;  3PRJ A;  3CL3 D;  4L76 A;  4NPF X;  4U3F D;  3TNU B;  4U3F J;  4DOJ A;  1FZF A;  1X8Y A;  1S5L X;  3FX0 A;  3WUU A;  3H1H D;  4N78 D;  3AE2 C;  1N7L A;  3H1H J;  1T6A A;  1PPJ D;  3LID A;  3N4X A;  3PH0 A;  1YJ9 P;  2A45 I;  3HTK B;  4ASV A;  2KK7 A;  1QVG O;  3EFG A;  1S3J A;  2OQQ A;  3MGN A;  3HE4 A;  2QA4 P;  1ZR4 A;  2N1T D;  1KB9 D;  1URQ A;  1SQP D;  4M3L A;  5BVZ A;  2H89 C;  1SQP J;  1FU1 A;  1SP4 A;  1KB9 I;  3AE9 C;  1FOS F;  1LWU C;  2BAS A;  3U1A A;  2JR8 A;  1YQ3 C;  3H1H G;  4WY4 A;  5APT A;  1PPJ G;  1LWU B;  3EQ2 A;  1SQV K;  2A45 G;  2XDJ A;  5AW4 B;  5AW1 B;  1WRG A;  3VMX A;  3VYI A;  5H2F H;  3IR9 A;  5CCG C;  2K9J A;  1KTM A;  1YYC A;  3H6P A;  4DT0 A;  5AVY B;  5KLI C;  1VQL P;  3HE5 A;  1N73 A;  4HH2 A;  2JJL A;  4WVZ A;  1NTK K;  1SQP G;  5KLI B;  2WQY C;  1SQQ G;  3IN6 A;  1A02 J;  1QVF O;  4EOT A;  3AEB C;  1VF5 C;  1EXI A;  3M06 A;  5KJ7 C;  4PV1 C;  1OX3 A;  2D2C C;  4JF7 A;  1NWQ A;  3OAK A;  1VF5 B;  4N6J A;  1JO5 A;  4PV1 B;  1VQN P;  3E7K A;  2D2C B;  3L71 D;  2WT7 B;  3L71 J;  5K5G B;  3RK3 C;  1NU1 J;  2B87 B;  1X79 B;  2YNY A;  1AA0 A;  4LLH A;  1JMM A;  1GK4 A;  2YO2 A;  1VQ5 P;  3A0H H;  3E1R A;  3RK3 B;  2E43 A;  3AE8 C;  3TDK A;  3H32 B;  1K73 Q;  1P84 E;  1KQS O;  3CCJ P;  4PD4 I;  2Q7C A;  3VMZ A;  1FC2 C;  1VDF A;  1T2K C;  2GUS A;  3L73 G;  3WMM 0;  1VQ4 P;  3RBZ A;  1S5L H;  1GMJ A;  4Y99 C;  1NU1 G;  3TYY A;  1FDO A;  2YKO A;  2PFX A;  1OW8 A;  1U7M A;  1NO4 A;  1YQ4 C;  1S72 P;  4Y99 B;  2A06 G;  3LW5 H;  1M57 D;  2GA1 A;  1N7S D;  4B86 A;  1PP9 D;  1ZN5 A;  3PP5 A;  2I1K A;  3MUD C;  2OYH C;  1PP9 J;  4C46 A;  3PLN A;  1URQ C;  1MFT A;  2IPP A;  2N9B A;  1L0N K;  2E75 D;  3HE4 B;  2E74 D;  4H13 C;  2P67 A;  1VQP P;  4U3F E;  1URQ B;  3M9Q A;  5B5E H;  5TJH A;  4WY4 C;  1EZV I;  2R3C A;  3L37 A;  4H13 B;  1QEX A;  4N78 E;  2WSE J;  2Q6Q A;  4H0L D;  1RY3 A;  4RO0 A;  4WY4 B;  4GOF A;  5CBN A;  3W67 A;  2W83 C;  1LGH B;  1PP9 G;  1NVO A;  1HGV A;  1IFJ A;  2R32 A;  1N73 C;  2K9J B;  3BCC G;  1L0L E;  3L36 A;  1RH5 B;  1FOS E;  2QE7 H;  1BE3 E;  3HE5 B;  2OYO A;  3VN0 A;  1N73 B;  5AW5 B;  2OTJ P;  1OFC X;  3WU2 H;  1D7M A;  1NTM G;  3FWN A;  3I56 P;  3VP9 A;  1S9K D;  1KOR A;  2IBZ D;  1FDM A;  4OGQ C;  1SQX G;  3TGU D;  3BVH A;  1GL2 D;  2ZJS E;  3TGU J;  2V7Q H;  5GTH H;  5CCH D;  4OGQ B;  4L74 A;  2KB7 P;  5KAI H;  2W6A A;  3USS A;  2FYU K;  3B5N C;  5TIS H;  3KPE A;  1DH3 A;  2M3E A;  3L75 D;  2A45 H;  3FXD A;  3G3Z A;  4I6M C;  2OAR A;  3L75 J;  3L72 D;  1YJN P;  1JNM A;  3JCU E;  3GMA A;  3L72 J;  2M8R A;  2MJZ A;  3B5N B;  1JY3 N;  3K5B A;  5CJ0 A;  3CC2 P;  1ZME C;  4QMA A;  1AVY A;  5BU8 B;  2BEQ D;  2HFE D;  2XU6 A;  4GT1 A;  1SLQ A;  5CBO A;  3D70 A;  3CXH H;  5KLV K;  2HYN A;  1HF9 A;  3A5T A;  1NTZ D;  3L71 E;  1NTZ J;  2Z5H A;  1H0T A;  2WPQ A;  3KZI E;  5B66 E;  1R8E A;  2E76 D;  2YKQ A;  3HD7 A;  3RBX A;  1FJK A;  2YXR B;  4ZNC A;  2O01 J;  2MKV A;  1ZOY C;  3CCE P;  3WUT A;  3B8E B;  2YO3 A;  1T8Z A;  4IOI H;  2W6J H;  1Q86 Q;  2QJY C;  2K9Y A;  4LGD E;  2WSF H;  3FWL A;  2SPZ A;  2NPS A;  4JBZ A;  2Q3E A;  3RL0 C;  2QJY B;  1PZQ A;  3PJS K;  1KIL E;  2Q9I A;  1YJW P;  3P8C E;  2AEJ A;  2ZVO B;  5E79 H;  3N7N A;  1AVO A;  3RL0 B;  1FZG A;  3UIA A;  2AXC A;  3MZW B;  4XE5 B;  3B4S A;  5APQ A;  1XTC C;  1LTT C;  5KAF H;  1SFC D;  1HTL C;  1P84 I;  4IL6 X;  2Z5I A;  1DX7 A;  1YBK A;  1YI2 P;  1EDI A;  3OJA B;  4KJM A;  1JMB A;  3D6Y A;  3S9O A;  1Q82 Q;  2CPB A;  1N86 A;  1H89 A;  1MV8 A;  1KC8 Q;  4I2L C;  3AEA C;  3H1I D;  5AVW B;  3IFM A;  3H1I J;  2K88 A;  3JC2 2;  1M8O B;  3CCS P;  1DEE G;  1FJP A;  5AW0 B;  5AW3 B;  1EDL A;  3CPW O;  1IK9 A;  1BCC E;  2W8Z A;  2R5D A;  2K3R A;  4ZKP A;  2WTY A;  3G9R A;  1DEB A;  1USD A;  2IFN A;  5KKZ C;  3L4F A;  3D6Z A;  1IJD B;  4XA4 A;  3A2A A;  2W90 A;  1E79 H;  1QX8 A;  5KKZ B;  2KP8 A;  1NGM B;  2O3J A;  1S9K E;  3EWK A;  2I1J A;  2IBZ E;  1NAY A;  3CCQ P;  2QJK C;  1SS1 A;  1QLE D;  3TGU E;  2WMM A;  4OVN F;  2QJK B;  5H2F E;  3SWF A;  2K1A A;  4UB6 E;  3MHV A;  1LP1 A;  1HWT C;  3HD7 C;  1H0T B;  3AE3 C;  3L75 E;  1U7J A;  1KYO H;  3M91 A;  3L72 E;  1L0L D;  1BE3 D;  4D6T E;  1IZN B;  1L0L J;  1X0T A;  1M7L A;  3HD7 B;  1BE3 J;  2E5T A;  4KHX A;  1WMK A;  2Y0C A;  3SWY A;  4U3F G;  4N3Y B;  1T3U A;  1KMI Z;  2KSJ A;  2CPS A;  3F5H A;  4IFF A;  2NPS C;  3SFD C;  3OW2 O;  3H1L E;  3EFF K;  3B5N D;  1VQM P;  1HVV A;  4IFD K;  1VL2 A;  3GG2 A;  1NTZ E;  2NPS B;  3GLM A;  2DW3 A;  1RE4 A;  1GU4 A;  1GW4 A;  5DJT B;  3BRT B;  3L70 E;  5AW7 B;  2QSI A;  2WPR A;  1R5S A;  1GZL A;  1LTJ A;  1RHZ B;  2QVA A;  2P10 A;  2JO1 A;  2R44 A;  1L0L G;  1L4A D;  1BE3 G;  3C1L A;  3BAS A;  2QRX A;  2BCC D;  1ZLL A;  2BCC J;  2B9B A;  1SQP K;  2M0B A;  5APX A;  4IL6 H;  1SQQ K;  1GD2 E;  3CX5 H;  3RK2 C;  4TT3 H;  2IFM A;  3Q5P A;  4JPZ B;  1NH4 A;  3RK3 E;  2FFD A;  2JEE A;  3GW6 A;  3V2P A;  4H44 C;  3RK2 B;  3BRV B;  3PHL A;  2ZYG A;  1PGO A;  4UB8 E;  1IK7 A;  3CCR P;  4H44 B;  3SSU A;  2N1T A;  1OVV A;  4AUW A;  3I55 P;  4W80 A;  3TK1 A;  1RF0 A;  2G3A A;  1LTA C;  1M1K Q;  2HG5 D;  2QM8 A;  4DJG A;  4NPD A;  4EYY Q;  1Y8A A;  1EDK A;  4K35 A;  1IFI A;  1DIP A;  4LC1 A;  2WSC H;  2C0X A;  1U57 A;  1IC2 A;  2H88 C;  3M0D A;  1FBM A;  3II6 A;  4JQ0 D;  4GIF A;  5GTI H;  1CZQ A;  3O6Q A;  1BGY D;  1BDC A;  3KQG A;  3L74 E;  1BGY J;  3A7O A;  3L71 G;  3LIE A;  4YPC A;  1FS0 E;  1JY2 P;  1KIL D;  3H1I E;  1K8A Q;  3P8C D;  1NU1 K;  2ZT9 C;  1Z56 A;  5AW9 B;  2G8Y A;  3MD0 A;  3IF4 A;  4WWI A;  1OWA A;  2PP6 A;  4R4L A;  2YKP A;  2Y9Z A;  2ZT9 B;  2L5G B;  2FYN C;  2FXP A;  2W27 A;  3KXD A;  1LP1 B;  4KT0 J;  1KFM A;  1EC5 A;  2FYN B;  3WU2 E;  5AVQ B;  1T3J A;  4Y28 J;  4BXL A;  3AEC C;  1P84 H;  2ZXX A;  5AVZ B;  3V2Q A;  3V5B A;  2WPV B;  1BSN A;  2XNX A;  2ZAE B;  1RE4 C;  2HLO A;  5GTH E;  1VQK P;  2Y0D A;  5KAI E;  1LTJ C;  1FZC A;  1BCC D;  3ZDM A;  1BCC J;  1SQV E;  2WPS A;  3CCV P;  5TIS E;  2AXT E;  3H1J D;  1JCD A;  3H1J J;  1J1D C;  2WVR A;  3FXE A;  1LTJ B;  3AE1 C;  1FZA A;  1SQB D;  2YMY A;  2FBW C;  1IFM A;  1SQB J;  1KN7 A;  3V4W A;  1J1D B;  2C9L Y;  4BWN A;  1NTM K;  1NTK E;  2FFD C;  2PGD A;  4L75 A;  1FAV A;  3CXH E;  2IBZ I;  2LKM A;  1SQX K;  1OZH A;  1N7S A;  2FFD B;  3NTN A;  3RL0 g;  3VOP A;  2I8D A;  1MKM A;  3NFQ A;  2N1T C;  2E42 A;  1PL5 A;  1BCC G;  2KS1 A;  1NYH A;  4OWF A;  2KNC A;  2N1T B;  5BU5 A;  4D6T D;  1R5L A;  4D6T J;  2E5Y A;  2XZR A;  2HPC A;  2FXM A;  2BCC E;  3M0D C;  4YXW H;  4HKZ H;  2FYZ A;  1OXZ A;  2QJP C;  2IBZ G;  3VTP C;  1SVF A;  3I5C A;  1S2E A;  3H1L D;  1NOH A;  1KB9 H;  5CCG D;  3P8M C;  3PTZ A;  1NJI Q;  3H1K E;  3TGU G;  3H1L J;  1AQ5 A;  2RH0 A;  4PJ0 E;  2WZ7 A;  1JTH A;  2QJP B;  1HH0 A;  1KV4 A;  1PV3 A;  3C9I A;  3O6Q B;  5AW8 B;  3CD6 P;  3V2N A;  5C39 A;  1IO4 A;  3L70 D;  1LTI C;  3L70 J;  5E79 E;  1DD4 A;  3L75 G;  1VF5 D;  2WWW A;  3L72 G;  5CMZ A;  3AEG C;  5KJ7 D;  2Q3I A;  4PV1 D;  3RK2 D;  4D6T G;  1S1C X;  2D2C D;  1DD3 A;  1J1E C;  3C8V A;  2PRR A;  1AJY A;  2J58 A;  4JYB A;  1GK6 A;  1GL2 A;  5AVU B;  4GOE A;  1J1E B;  3RK3 D;  5CCH A;  1RE3 A;  3H1L G;  2KIK A;  4R4M A;  1JM0 A;  1JY2 O;  1L0N E;  1BGY E;  1NTZ G;  3A0B H;  3Q3D A;  2YMK A;  1FZE A;  1NTZ K;  3L70 G;  1G1I A;  2KLV A;  2HOD A;  2ZXE B;  1FZC C;  2JWA A;  1VQO P;  3L35 A;  2JP3 A;  1CSB A;  3LW5 J;  1WT6 A;  2YXQ B;  1ZV8 A;  1T2K D;  3P32 A;  1BDD A;  3FGA D;  1FZC B;  2C9N Y;  4EIJ A;  1YTZ I;  2J59 M;  3AE5 C;  4GKG A;  3KZI H;  3S4R A;  2HR3 A;  5APV A;  3RGU A;  1OMI A;  1ZXG A;  3ITK A;  3CWB E;  2RMZ A;  4PD4 H;  3U59 A;  2OGU A;  2K37 A;  2XND H;  3L74 D;  5CHX A;  4MN4 C;  3L74 J;  2KZJ A;  1N7S C;  1PGP A;  1KQL A;  1N8R Q;  3VMY A;  1EZV E;  1PGQ A;  1URQ D;  1N7S B;  3AEF C;  1W2E A;  2KZI A;  2E75 C;  2P1J A;  4A7P A;  4H13 D;  2H8P D;  2E74 C;  1Q7Y Q;  3H1J E;  3NMD A;  1KYO E;  5DJU B;  5APU A;  2E75 B;  4WY4 D;  2E74 B;  2UWJ E;  1SQB E;  3M9H A;  2KNC B;  3CCM P;  2FYU E;  1KD1 Q;  1AV1 A;  1M1J A;  4H0L C;  4W7Z A;  2HPC B;  3G4S P;  4U7J A;  2N9Y B;  3L74 G;  4BRY A;  4H0L B;  5AVR B;  3H1I G;  3AE6 C;  2V7Q J;  1JTH B;  4O9B A;  2RKL A;  2M3B A;  2WSE H;  1VQ6 P;  5KLV E;  1SQV D;  1SFC A;  4DZO A;  1PIX A;  2ZYA A;  1SQV J;  1G2C A;  4CPG A;  5L8R J;  4RKU J;  2Q1K A;  2V4H A;  3HUS A;  1HGZ A;  3S1K A;  4OGQ D;  3ABV C;  2AEM A;  1GL2 C;  2ZVN B;  2KLU A;  4IL6 E;  2IZ0 A;  5CCH C;  3GHG A;  1NTK D;  3MUD A;  1PGJ A;  3CX5 E;  2OYH A;  1X9V A;  2POH A;  1RE3 C;  2P58 A;  1NTK J;  1GL2 B;  3AED C;  4WB4 A;  3CXH D;  2Y9Y A;  3KYQ A;  1GW3 A;  1SQQ D;  1SQQ J;  1JCC A;  4IFM A;  4C7N A;  2FKW B;  3CXH I;  1GU5 A;  1N2D C;  4TLF A;  2OYI A;  3GF3 A;  1Y47 A;  3NXS A;  2AEF A;  1EDJ A;  1SQV G;  1RQV A;  1MFZ A;  3A0H E;  1E5W A;  3B71 A;  2HOD B;  1LTG C;  2VRS A;  4HYT B;  1L0L K;  4I1L A;  4UB6 H;  3VMA A;  1NTK G;  2IZ1 A;  1BSH A;  1USE A;  2XV5 A;  4HJG H;  5AVV B;  5KTB A;  3H1K D;  2H43 A;  1JY3 P;  1S5L E;  3QWO C;  5GTI E;  3H1K J;  2WSF J;  1MUU A;  3Q2Y A;  4RES B;  1FDI A;  2RN0 A;  2E76 C;  2IYO A;  1L2P A;  5APW A;  2OTL P;  3L73 D;  2IDB A;  1A02 F;  3L73 J;  3SFE C;  2E76 B;  1PFI A;  1X22 A;  1NHL A;  3QH9 A;  5AW6 B;  4RJT A;  3O8Z A;  1NU1 D;  1ZP0 C;  1ZRT E;  2FY8 A;  2BCC G;  1QL1 A;  2P7J A;  1IFD A;  3SWK A;  3V6I A;  2JKV A;  2A06 D;  1M1J C;  1XTG B;  2XKM A;  1EXJ A;  3RL0 D;  3CCL P;  3B5N A;  1GTW A;  2WIT A;  1KFN A;  2O01 H;  4PD4 D;  4ZMD A;  3AE4 C;  3H1K G;  5B5E E;  1L0N D;  3KHU A;  1M1J B;  2R5B A;  1L0N J;  5AVT B;  1NKN A;  2IX7 C;  4BRY B;  2LXC B;  1L4A A;  1VQ7 P;  4I7Z C;  5AVS B;  1YIJ P;  2H7H A;  1JOC A;  1SFC C;  4UB8 H;  4I7Z B;  3CCU P;  1M90 Q;  1K04 A;  1LTS C;  3F89 A;  3HUS C;  1G1J A;  1QL2 A;  1UIX A;  4Z1M H;  1SFC B;  5APY A;  3AE7 C;  1G2C B;  3U1C A; 
#chains in the Genus database with same CATH homology
 1WRG A;  2CPB A;  3VMX A;  1N86 A;  1H89 A;  1MV8 A;  3VTP C;  3VYI A;  4I2L C;  1SVF A;  3I5C A;  3M0A A;  3HUS B;  3IR9 A;  1NOH A;  5CCG C;  5AVW B;  5CCG D;  3GHG C;  3IFM A;  3P8M C;  1AQ5 A;  1YYC A;  2WZ7 A;  1JTH A;  3H6P A;  5AVY B;  1FJP A;  1HH0 A;  5AW0 B;  3HE5 A;  5AW3 B;  3C9I A;  1N73 A;  5AW8 B;  4HH2 A;  3GHG B;  3V2N A;  2OYH B;  1IK9 A;  2JJL A;  1NTK K;  1IO4 A;  2R5D A;  3VP8 A;  1LTI C;  4ZKP A;  4ZKU A;  2WTY A;  1OXZ A;  1DEB A;  2OYI C;  2IFN A;  1NAF A;  1EQ7 A;  1A02 J;  3L4F A;  4EOT A;  2WWW A;  5CMZ A;  5KJ7 D;  3M06 A;  2Q3I A;  5KJ7 C;  1IJD B;  4C7N B;  3RK2 D;  4XA4 A;  3A2A A;  1JUN A;  1VPC A;  2OYI B;  1J1E C;  4JF7 A;  1NWQ A;  3OAK A;  3HRN A;  2KP8 A;  4N6J A;  1JO5 A;  1S9K E;  2J58 A;  4JYB A;  1GK6 A;  1GL2 A;  2I1J A;  1RF1 A;  5AVU B;  1J1E B;  1LT9 A;  2WT7 B;  3RK3 D;  3RK3 C;  5CCH A;  4AQR D;  1HBW A;  1X79 B;  1RE3 A;  2YNY A;  4LLH A;  1JY2 O;  1JMM A;  1GK4 A;  1H8A A;  2YO2 A;  1KIL A;  3RK3 B;  2E43 A;  5AVX B;  4AYC A;  2P2U A;  3SWF A;  3T97 A;  1FZE A;  1NTZ K;  3H32 B;  1G1I A;  1YTZ T;  1HWT C;  3HD7 D;  3HD7 C;  2KLV A;  4WBA A;  2HOD A;  2ZXE B;  1FZC C;  3L35 A;  3M91 A;  2Q7C A;  3OA7 A;  1CSB A;  2PAJ A;  1WT6 A;  3VMZ A;  1M7L A;  1VDF A;  1ZV8 A;  3HD7 B;  1RF0 C;  1T2K D;  3P32 A;  1T2K C;  2GUS A;  1FZC B;  2C9N Y;  4KHX A;  4EIJ A;  3SWY A;  1YTZ I;  2J59 M;  2GUV A;  3WMM 0;  4GKG A;  4N3Y B;  5APV A;  1T3U A;  2KSJ A;  4JYC A;  4Y99 C;  2CPS A;  3M9B A;  2NPS D;  2NPS C;  4IFF A;  1AFO A;  3TYY A;  1SQB K;  2YKO A;  3B5N D;  3U59 A;  4OH8 B;  1NO4 A;  1HVV A;  1JY3 O;  4Y99 B;  4IFD K;  3LW5 H;  2NPS B;  5CHX A;  1CI6 A;  1RE4 A;  1GU4 A;  1N7S D;  1N7S C;  4B86 A;  2Q5U A;  1GW4 A;  3TNU A;  1KQL A;  3BRT B;  1ZN5 A;  3PP5 A;  2I1K A;  5AW7 B;  2OYH C;  3VMY A;  2WPR A;  1GZL A;  1LTJ A;  3MIW A;  4C46 A;  1URQ D;  1URQ C;  2IPP A;  1N7S B;  2N9B A;  2Z4E A;  1L0N K;  1L4A D;  1L4A C;  1W2E A;  2P1J A;  3HE4 B;  2H8P D;  2P67 A;  3BAS A;  3A3Y B;  1ZLL A;  3V2R A;  1URQ B;  3NMD A;  3M9Q A;  1SQP K;  2O1K A;  2GM4 A;  5APU A;  5APX A;  3HTK A;  1IFN A;  1L4A B;  1SQQ K;  1GD2 E;  4WY4 D;  4WY4 C;  2R3C A;  3L37 A;  3M9H A;  3RK2 C;  2IFM A;  4N78 E;  1NH4 A;  4W7Y A;  2FFD A;  1M1J A;  1J2J B;  3CI9 A;  2JEE A;  5APS A;  4W7Z A;  2HPC B;  5CJ4 A;  3V2P A;  1RY3 A;  4WY4 B;  3RK2 B;  3BAT A;  3BRV B;  3R2P A;  4C7R A;  1LGH B;  5AVR B;  2QM7 A;  1HGV A;  1LTB C;  1IFJ A;  2R32 A;  1N73 C;  2N1T A;  2ZFC A;  4AUW A;  2O1J A;  4W80 A;  3TK1 A;  1RF0 A;  1JTH B;  1LTA C;  3L36 A;  4O9B A;  1FOS E;  2HG5 D;  2QM8 A;  2M3B A;  1JY2 N;  2WSE H;  3HE5 B;  3P7K A;  1LWU A;  3VN0 A;  1N73 B;  5AW5 B;  1SFC A;  4DZO A;  1G2C A;  1IFI A;  3V4Q A;  4LC1 A;  3VP9 A;  2WSC H;  3MTU E;  1S9K D;  2C0X A;  3HUS A;  1IC2 A;  1FZB A;  3M0D A;  1FBM A;  1HGZ A;  3II6 A;  1FDM A;  2C0W A;  5AW2 B;  1H88 A;  1GL2 D;  1GL2 C;  1ZR2 A;  3BVH A;  1RF1 C;  4GIF A;  1CZQ A;  1LT9 C;  5CCH D;  5CCH C;  5CCG A;  3GHG A;  2OYH A;  3MUD A;  1X9V A;  2POH A;  1RE3 C;  2KB7 P;  3KQG A;  2W6A A;  3A7O A;  3LIE A;  1GL2 B;  1HUC A;  1RF1 B;  1JY2 P;  1KIL D;  1KIL C;  4WB4 A;  1GDT A;  1LT9 B;  3P8C D;  3KYQ A;  2FYU K;  1NU1 K;  3B5N C;  1GW3 A;  3TSI A;  3KPE A;  1DH3 A;  1Z56 A;  5AW9 B;  2W6B A;  2A45 H;  1JCC A;  3MD0 A;  4IFM A;  4C7N A;  2FKW B;  3G3Z A;  4I6M C;  2OAR A;  1CW5 A;  1GU5 A;  1OWA A;  2PP6 A;  1JNM A;  1KIL B;  1N2D C;  3KDP B;  2YKP A;  2OYI A;  2M8R A;  2MJZ A;  3B5N B;  1MZ9 A;  2L5G B;  3NXS A;  3CLQ A;  1JY3 N;  5KJ7 A;  2KYV A;  1MFZ A;  2W27 A;  1E5W A;  2HOD B;  1KFM A;  2WT7 A;  5CJ0 A;  1LTG C;  2VRS A;  4HYT B;  5BU8 B;  1L0L K;  4I1L A;  2HFE D;  2XU6 A;  2KOG A;  1SLQ A;  4GT1 A;  5AVQ B;  1T3J A;  5KLV K;  2HYN A;  3E1I A;  3A5T A;  5AVZ B;  3V2Q A;  3H32 A;  2Z5H A;  3V5B A;  2XV5 A;  2XNX A;  5AVV B;  5KTB A;  2H43 A;  2WPQ A;  1KZU B;  1JY3 P;  1RE4 C;  2HLO A;  1MUU A;  4RES B;  1NKZ B;  1HJB A;  2YKQ A;  3HD7 A;  1FJK A;  1LTJ C;  1FZC A;  5APW A;  1CI6 B;  2WPS A;  3CL3 D;  1A02 F;  3TNU B;  1JCD A;  4DOJ A;  1J1D C;  1FZF A;  1X8Y A;  1PFI A;  1NHL A;  5AW6 B;  1LTJ B;  3B8E B;  1FZA A;  2YO3 A;  2YMY A;  1T8Z A;  3O8Z A;  1IFM A;  4N78 D;  1N7L A;  3V4W A;  1J1D B;  2C9L Y;  3LID A;  1QL1 A;  3N4X A;  4LGD E;  2P7J A;  1IFD A;  2WSF H;  2NPS A;  1NTM K;  2FFD C;  1M1J C;  1XTG B;  2XKM A;  3RL0 D;  3RL0 C;  3B5N A;  2A45 I;  1FAV A;  3HTK B;  1GTW A;  2WIT A;  1KFN A;  2O01 H;  2Q9I A;  2LKM A;  3P8C E;  1SQX K;  3EFG A;  1N7S A;  3N7N A;  2FFD B;  1M1J B;  3NTN A;  2R5B A;  3RL0 B;  1FZG A;  5AVT B;  3MGN A;  3VOP A;  3HE4 A;  3UIA A;  1NKN A;  1ZR4 A;  2IX7 C;  3NFQ A;  2N1T D;  2N1T C;  1URQ A;  4XE5 B;  2E42 A;  4M3L A;  5APQ A;  5BVZ A;  1XTC C;  1LTT C;  1FU1 A;  1L4A A;  1SP4 A;  5AVS B;  1FOS F;  1LWU C;  2N1T B;  2H7H A;  1JOC A;  1SFC D;  1SFC C;  2BAS A;  3U1A A;  5BU5 A;  1HTL C;  2Z5I A;  1DX7 A;  2XZR A;  2HPC A;  2FXM A;  3OJA B;  4WY4 A;  1LTS C;  5APT A;  3HUS C;  1LWU B;  3EQ2 A;  1G1J A;  1QL2 A;  3M0D C;  1SQV K;  2A45 G;  1SFC B;  2XDJ A;  5APY A;  5AW4 B;  5AW1 B;  1G2C B;  2FYZ A;  3U1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...