1G2CB

Human respiratory syncytial virus fusion protein core
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
40
structure length
40
Chain Sequence
PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords FUSION PROTEIN (F)
publication title Structural characterization of the human respiratory syncytial virus fusion protein core.
pubmed doi rcsb
source organism Human respiratory syncytial virus
total genus 15
structure length 40
sequence length 40
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2000-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1g2cB00
1HJBA 5AVXB 2YO3A 1GK6A 5APXA 5APWA 3V5BA 3M0DA 2R5BA 4DZOA 5AVSB 3A5TA 1H89A 1S9KE 1A02J 5AW3B 3UIAA 1FAVA 3TK1A 4M3LA 3A7OA 1MV8A 2QM7A 1IO4A 3LIDA 3A2AA 3I5CA 2R5DA 1J2JB 3MGNA 4EOTA 3VMZA 3P7KA 5AVRB 4AUWA 3NTNA 1SP4A 4JYBA 5AW9B 3T97A 1NWQA 1OWAA 2P2UA 1HWTC 1T2KD 3NXSA 4B86A 3L37A 1T2KC 5AW7B 3M9HA 1X8YA 2IPPA 3L35A 2Z5IA 3V4QA 1GK4A 2Q7CA 5AVYB 2W6AA 2W27A 3O8ZA 2WPRA 1GU5A 4I2LC 2R3CA 2WPQA 1CI6A 1H88A 2Q3IA 2C9LY 2QM8A 2N9BA 5AW1B 1S9KD 2P67A 2ZFCA 3TYYA 4KHXA 3VMYA 1JUNA 2JJLA 3A3YB 3VTPC 5APVA 2E42A 4GKGA 2YNYA 4C7NA 4C7NB 2YO2A 2XZRA 3LIEA 5APUA 3SWFA 3M06A 1YYCA 2Q5UA 2WT7A 2BASA 5AVWB 2WT7B 2H7HA 3B8EB 2VRSA 5APQA 4I6MC 3HE5B 3HE5A 3V4WA 2WTYA 5AW6B 1SLQA 5APTA 5AVTB 5AVQB 3NMDA 5AVUB 3M9BA 1HBWA 2WPSA 4HYTB 5AW2B 1GU4A 1FOSF 1CI6B 1KQLA 1JNMA 1H8AA 5AVVB 1A02F 3TNUA 3OAKA 5AW4B 4JYCA 4AYCA 1OXZA 2XV5A 3IR9A 5APYA 3M91A 3VYIA 2P7JA 3KDPB 3VN0A 1GD2E 2R32A 2E43A 5AW0B 4GT1A 4C46A 2XU6A 4XE5B 1MUUA 2C9NY 1MFZA 3MD0A 4LC1A 1HUCA 5AW5B 3KQGA 1CZQA 5AVZB 3VMXA 4AQRD 1GTWA 3P8MC 3NFQA 1GZLA 2ZXEB 3M0AA 5AW8B 4RESB 5CMZA 3P32A 2KP8A 3HE4A 3HE4B 3TNUB 1DH3A 1G2CB 1FOSE 3HTKA 2Z5HA 5APSA 2WWWA 1CSBA 3L36A 1NAFA
chains in the Genus database with same CATH superfamily
3H1LD 3AE5C 2BCCG 2H43A 1EZVI 2NZ2A 1ZRTD 2UWJE 3H1KD 2KLVA 2WVRA 5CBNA 1L0NJ 1FJKA 1LNQA 1IFJA 1QEXA 1TU3F 3CX5H 3L35A 2PFXA 2W27A 1NTKJ 4N78D 2NRGA 2OYIB 2P58A 1CI6A 2P1JA 3K5BA 1DD4A 1JUNA 3B5ND 5APVA 1E79H 3FXDA 1OZHA 1SFCC 1SQVE 1P84E 2WT7A 2FY8A 2O1KA 3L4FA 1JCDA 5CCGC 4WY4C 3TF5A 1NTMJ 2I1JA 3L71G 1SQXJ 2M3EA 1HVVA 2DW3A 3L70G 3BCCE 2M0BA 3RK3C 1VQNP 1KYOD 2E43A 1GD2E 3B5NB 5M1BA 1URQC 2K37A 2Z4EA 1M1KQ 4IFMA 1HUCA 3CCQP 4WB4A 3L72J 2LR2A 2YKOA 4D6TG 3CCJP 1BCCE 4IL6E 2XKMA 3A0HH 4TLFA 1G2CB 2KYVA 1L4AD 3L73J 3S4RA 4U3FE 2YO3A 3MP7B 3L75E 2B87A 3A5TA 2O1JA 1NKZB 2QJYC 2E76D 3ZDMA 2YIUC 1PP9E 5B5EE 3VMAA 3MZWB 4MN4C 5KKZB 2M5AA 2AEJA 1XTGB 1HJ0A 2LXBA 3A0BH 1VF5C 4PD4H 5KLVD 2ZYGA 2E74C 1EXJA 3RL0C 5L8RJ 2FKWB 2Y0CA 4W7ZA 2WPQA 4GOEA 2E76B 1IFIA 1QVFO 1NYHA 2JJLA 1LJ2A 2A45H 4GDOA 2Y9ZA 1U57A 4PJ0E 1N7SA 4UB6E 5APTA 1NTKD 3L71J 3H1JG 1GW4A 3CXHI 4L75A 1KQSO 1QL1A 1FU1A 1VQOP 1IFPA 4I7ZC 2B9BA 1NTZG 1CZQA 1BE3J 1GTWA 1NTMD 2ZXEB 1H0TA 3M0AA 4D6TJ 3Q5PA 2MJZA 5E79E 2M3BA 1HH0A 4EYYQ 1H89A 1VDFA 4BXLA 1AVYA 2OARA 3LIDA 1JM0A 3VOPA 1FDOA 1KILA 2K9JA 5KJ7D 1J1EC 1ZR2A 1JY2P 3H32B 2B89A 1N2DC 3L74G 2OGUA 2W6BA 3H1ID 1BDCA 2A06D 3F89A 1FC2C 5H2FH 1SQBJ 2YO2A 2KLUA 5GTHH 5CCHC 2J5UA 3PTZA 3D70A 3CWBD 4ASVA 3NMDA 1PPJD 1T6AA 3H1JJ 4EIJA 3CMAP 2O01J 3H1LE 3CCUP 1YHQP 1JEKA 2XV5A 2ZYAA 1DX7A 2IZ1A 1L4AC 1SFCA 4C46A 3GHGB 1L2PA 3H1KE 2WMMA 3PRJA 1KTMA 2KXPB 2IDBA 5CCGA 1K9MQ 1AQ5A 1NTZJ 4WY4A 1FDIA 1L0LJ 2FYUG 1IC2A 1X79B 2I1KA 4A7PA 3CLQA 1URQA 1LTGC 1NOHA 1FAVA 3CCVP 3CCRP 1SQVD 1SQQG 1X9VA 2E5YA 1M1JC 3N4XA 1K73Q 1BE3D 2LXCB 2FBWC 2QVAA 2WZ7A 1RF0C 2HG5D 2FYZA 3WU2E 2W83C 3D6YA 3L37A 3W67A 2YXQB 3WUVA 2K9YA 1GK4A 1QVGO 2J58A 5BVZA 3HD7B 2K88A 1AJYA 1KYOE 2QJKC 2PP6A 1H88A 1S9KD 1LTJB 4Y99B 4RJTA 3TDKA 1WT6A 1NU1D 1R5LA 1S5LE 4DOJA 4EDFA 1SQPJ 1JO5A 1PIXA 1FJPA 2NPSD 3G71P 2G3AA 1SQBD 3CXHD 5DJUB 4GT1A 2C0XA 2C9NY 1HGZA 1LT9B 2W6JH 1Q2NA 3V2NA 3C1LA 4GIFA 2L5GB 4H0LB 5B66E 1YBKA 2V7QH 3H1JD 4W80A 4UB8H 2AXCA 3AE9C 2FYUJ 3AECC 2NPSB 2Z5HA 5KLVK 3RBZA 1FZCC 2IFNA 5TJHA 3IFMA 1GL2D 4M3LA 2OYIA 4IL6H 4U7JA 2D2CD 4JF7A 3O6QB 3I5CA 1UIIA 4EOTA 4C7RA 3BASA 1EDJA 1L0LD 1BGYG 4XFJA 2SPZA 1ZV8A 4XA4A 3MIWA 2Q9IA 1NTKE 1OW6A 3CI9A 1EDKA 3Q5SA 1RF1B 3S9OA 1ZXGA 1NTKK 2N1TB 1GL2B 2D2CB 2KNCA 1XTCC 3V2RA 4GKGA 1RE3A 1SVFA 2KSEA 3SFDC 2ZT9D 2KB7P 1NTME 4DT0A 1ZN5A 1M7LA 4OGQD 1NTMK 5GTIH 3PHLA 5CJ0A 1A02F 4BRYA 1G2CA 4AYCA 1G1JA 3OJAB 3VN0A 1EZVE 4IOIH 2WSCH 5CCHA 2ZT9B 3FWNA 2FXOA 1SQPD 4HB1A 4OGQB 3B4SA 3AEFC 1N7LA 3VP8A 1SLQA 3RK2C 3H1IE 1HJBA 1L4AA 2A06E 5AVSB 2R44A 1JMBA 3H1HJ 3ITKA 2QE7H 2I8DA 1RY3A 3T97A 3CX5D 1BGYJ 2ITAA 2P2UA 3G6EP 3NXSA 1K04A 1OW7A 3M9HA 3V4QA 1KB9I 2IBZD 1RQUA 1RE4C 1RQVA 3GF7A 4ZNCA 1T8ZA 3CCEP 2HLOA 1M1JA 3WUTA 4C7NA 1RF0A 2HODB 2BASA 3QWOC 4PV1C 2W90A 3HE5B 1N73B 1W5CE 1HBWA 2WPSA 1K8AQ 1FOSF 3M9QA 1KORA 3OAKA 3GLMA 5AW4B 3PLNA 4O9BA 3M91A 1LTIC 1BE3E 4WWIA 1LTSC 4H44D 1S1CX 1SQVK 4D6TE 2CK3H 4H13D 3NFQA 2E75C 2KS1B 5AW8B 2AEFA 2AXTH 5CMZA 3TGUJ 2KP8A 3W68A 4IFDK 1KMIZ 3HTKA 1MFTA 2OYHC 1IK9A 1S9KE 4OWFA 1KZUB 5KLIC 4H44B 3WUUA 3Q5RA 3JCUE 1NJIQ 4PD4D 4H13B 1YQ4C 4AUWA 5KJ7A 2OYOA 1NU1E 1J1DB 4B86A 2ZT9C 1VQ9P 1FZCA 1NU1K 2BCCJ 3C8VA 2Q7CA 2WPRA 2ZYDA 1SQBE 3CXHE 3H1HD 2QJPC 2N9BA 3TYYA 2E42A 1SQBK 1JTHB 3BCCG 5KAIE 1LWUB 3H1JE 5AW6B 2HFED 3AEDC 3JSVC 1JY3P 1LT1A 3RL0g 3Q3DA 1Q7YQ 1JNMA 2V4HA 2WSFJ 2WSEH 1YI2P 3VYIA 1X0TA 3KDPB 1BCCG 1L0ND 3RGUA 3SWYA 1NTZE 4L74A 4RKUJ 4U3FG 2WQYC 1L0LE 3L75G 2GUVA 2JP3A 1PP9G 1L0LK 3L70J 4OVNF 2QA4P 3R2PA 2R5BA 1QL2A 4DZOA 3U59A 2L91A 2OYIC 1K05A 1MV8A 1NGMB 3MGNA 3P7KA 1SQXD 3AE6C 1OVRA 4R4LA 1SP4A 3TGUD 1NWQA 1WRGA 1T2KD 3H6PA 1FZGA 1QLED 2OTKE 2W6AA 3CC4P 1DD3A 3O8ZA 1AVOA 1EXIA 1MZ9A 3GMAA 1EZVD 2R3CA 2J59M 2P67A 2KZJA 2Y0DA 3L72D 3JC22 1RE3C 3S1KA 2YNYA 3SFEC 3B5NC 4DJGA 1LP1B 2OTLP 2WT7B 3L73D 1SQPE 2V7QJ 1G1IA 2BCCD 1RE4A 3AE3C 1SQPK 1NHLA 1S72P 1KB9H 1OXZA 1PGJA 2NPSA 2R32A 5AW0B 2GM4A 3M0DC 2PRRA 1VQ7P 3KPEA 2O01N 5AW5B 3CX5E 3L75J 2RH0A 4AQRD 1KD1Q 5KKZC 1GZLA 1UIXA 5KAFH 3GF3A 1S5LX 1PP9J 3HE4A 3TNUB 3GG2A 4I1LA 2IBZE 5APSA 1CSBA 5APWA 1RF1A 2QG4A 2B87B 2RKLA 1PGPA 3G9RA 2JKVA 3A7OA 1GL2A 2E76C 2KZIA 4YXWH 1IO4A 2M5AB 3L71D 4KT0J 3VMZA 1PV3A 3CCMP 3L70D 1VQ5P 2WSFH 2OYHA 2FYNB 3HD7D 1YITP 1M90Q 4W7YA 2RMZA 5TISH 2WSCJ 2Q3IA 1N86A 4D6TD 3VP9A 2HR3A 1E5WA 1KQGB 3H1LG 3A0HE 1KC8Q 1YQ3C 1YYCA 1FZAA 5CBOA 5APQA 3L74J 4I6MC 3V4WA 3H1KG 1FZFA 5AVUB 2WITA 2C0WA 1BDDA 3HUSB 1CW5A 2B88A 3A0BE 4PD4E 1U7MA 3MD0A 3BVHA 3KZIE 4H0LD 1KILD 5AVZB 1BSHA 3P8MC 1KQFB 5DJTB 1P84H 1S4XA 1GDTA 3IR9A 3R4YA 5AVXB 1YJWP 1GW3A 3H1HE 1A02J 1VQKP 2QM7A 3I56P 3A2AA 1KILB 2KSJA 1SS1A 1OIPA 5KJ7C 3V2PA 1Q82Q 2AEMA 1NKNA 2QIWA 2ZVOB 4N6JA 2Z5IA 4ZMDA 3IN6A 2N1TD 4I2LC 3Q2YA 1SQQJ 3AE4C 1L0NE 1NTZD 4LLHA 2HYNA 1W2BO 1KYOI 4GOFA 1OX3A 1SFCD 1L0NK 1EQ7A 2XZRA 1ZW0A 3GHGC 3H1LJ 1HTLC 1KFNA 3V6IA 5CCGD 5B5EH 2QRXA 4WY4D 1U7JA 4L76A 2W8ZA 5AVQB 1GU4A 3AE2C 3EWKA 2ZAEB 1FE6A 5KLVG 1URQD 3B5NA 4JBZA 1SFCB 3E1IA 1LTAC 3L74D 1SQXE 3TGUE 3OA7A 1AQTA 4WY4B 1JY2N 1SQXK 4PJ0H 1NO4A 3RK3B 2WSSH 4UB6H 5H2FE 1GK6A 2QEXP 1URQB 3M0DA 3L72E 1NTKG 3HD7C 2YKPA 4WVZA 3HUSC 5CHXA 1DEEG 4Y28J 1AFOA 1LTJC 1OFCX 3L73E 2M8RA 1W2EA 4Y99C 1USDA 1VF5D 1EDIA 1OWAA 2BCCE 3E7KA 2Q1KA 2OQQA 3RL0D 1X8YA 1JOCA 2K3RA 2CPSA 2ZJSE 2WSEJ 1NTMG 2QJYB 4TT3H 1GU5A 2YIUB 5E79H 2JDIH 1NVOA 4KHXA 1M8OB 3A3YB 3N7NA 3Q1MA 4NPFX 3CC2P 1X22A 1VF5B 2FYUD 1LT9C 1IFMA 4IFFA 2IX7C 2E74B 3RL0B 4H0LC 2JEEA 2GA1A 5AW2B 1SQQD 3P8CD 1KQLA 3EQ2A 2NPSC 5KLVJ 3AEEC 1HF9A 3V2QA 3HRNA 4ASWA 3H1IG 3L71E 4LC1A 2XNDH 1Y8AA 2A06G 3KQGA 3L70E 4RESB 1IJDB 1PFIA 1RF1C 3CWBG 1PGOA 3G3ZA 3V5BA 3UIAA 4I7ZB 4RO0A 1PPJG 2N1TC 1GL2C 2R3SA 2D2CC 3E1RA 2R5DA 5KTBA 1J2JB 3SSUA 4JYBA 2JO1A 1LP1A 3H32A 1HWTC 2LKMA 4HKZH 1YIJP 2MKVA 2Y9YA 5AW7B 1OVUA 2K1AA 4BWNA 2IFMA 3CPWO 2G8YA 3U1AA 2KIKA 1KN7A 1OW8A 2KNCB 2ZFCA 2YMKA 3VMYA 1ZP0C 1J1EB 5CCHD 3M06A 1KILE 4UB8E 5AVWB 2H7HA 2WTYA 1SQVG 1NAYA 1BE3G 4QMAA 1FBMA 1MKMA 4OGQC 2P10A 1H8AA 3TNUA 4BRYB 1VQ6P 3WU2H 2KUBA 2H88C 1BGYD 2KOGA 3GHGA 1MUUA 1FZBA 3PH0A 1USEA 1ZR4A 3H1IJ 1KYOH 1P84I 4ZKUA 2WPVB 2FFDB 1YTZT 2PAJA 1D7MA 2Y0EA 1LTTC 4JQ0D 1DEBA 1IFNA 2PGDA 1NAFA 2OTJP 3KZIH 1L4AB 5APXA 1EDLA 1ZOYC 3CWBJ 1S5LH 1NU1G 4YXDC 3TK1A 1NTZK 2E5TA 2HPCB 5GTIE 1SQBG 3T97B 1VQPP 4GODA 2YMYA 1WMKA 1N73C 3AE8C 5B66H 3RK3E 3AEAC 1QX8A 3HD7A 3HUSA 4NPEA 1R8EA 4YPCA 1M1JB 1BSNA 3CMEP 1LTJA 4R4MA 4C7NB 4Z1MH 3L74E 4K35A 2N9YB 3II6A 1SQVJ 3GW6A 2JWDA 1KB9D 2CPBA 1N8RQ 4HYTB 1CI6B 2QJKB 3KHUA 4K3AA 1L0LG 4JYCA 1KV4A 3RBXA 1Q86Q 3LW5J 3QH9A 3BCCJ 3IF4A 1LT9A 4H44C 1DIPA 4H13C 3ABVC 1NH4A 3P32A 1J1DC 3MUDC 3HTKB 3C9IA 1M57D 1BCCJ 4N3YB 1NU1J 3USSA 5AW3B 1T3UA 4U3FJ 3FGAD 1Q81Q 5C39A 3FX0A 3O6QA 2FYUE 1QGKB 1S2EA 3KYQA 5AW9B 5BU5A 4EI2A 2FYUK 3IAOA 2O3JA 1LWUC 1SQQE 2IPPA 1FZCB 2FFDC 3P8CE 4HH2A 4L73A 1SQPG 2N1TA 2IYPA 1SQQK 2QM8A 1ZLLA 2H89C 3SWKA 1IFDA 2AXTE 1N7SD 3LIEA 3SWFA 1ZRTE 1OVVA 3BRVB 3B8EB 3H25A 1IK7A 1Q90D 5CJ4A 2JR8A 5K5GB 5APYA 4N78E 3AE1C 4YTPC 2IBZG 3U1CA 1N7SB 1VQLP 1RH5B 1MFZA 4DCKA 1P84D 2POHA 5EFWB 2ZXXA 3CX5I 1RHZB 2Q6QA 1FOSE 2JWAA 1Y47A 3RK2D 2GUSA 3L36A 2IBZI 3CC7P 1EC5A 1PGQA 2YXRB 3FWLA 3BCCD 2RN0A 1ZMEC 1OMIA 1PL5A 3AE7C 3CL3D 1M56D 3KXDA 1H0TB 1VQ4P 2ZVNB 3CCLP 3G4SP 3RK2B 1BCCD 1T2KC 2IZ0A 1JY3N 5AVYB 2H8PD 2FXMA 4U3FD 1JMMA 3LW5H 2C9LY 3L75D 1BGYE 2QSIA 2K9JB 4OH8B 1JB0J 3AEGC 1LTBC 4LGDE 5BU8B 3I55P 1PP9D 5APUA 2HODA 4PV1D 2Q5UA 4NPDA 2VRSA 3HE5A 3JCUH 1N73A 1JY3O 1S3JA 3WMM0 3M9BA 3CD6P 5KLVE 1JCCA 5AVVB 2XNXA 2P7JA 2XU6A 1AV1A 2Q3EA 3PJSK 4PV1B 3CXHH 4CPGA 2A45G 2BEZF 4WBAA 3FXEA 3H1HG 3H1KJ 4PD4I 1YJ9P 3D6ZA 2E75D 1HGVA 3VMXA 2KS1A 3TSIA 3BRTB 3HE4B 3RK3D 3EFGA 1DH3A 5KAIH 1YJNP 2WWWA 3MTUE 1VPCA 3VTPC 3D71A 1IZNB 1FZEA 2O01H 1PZQA 2FYNC 2A45I 3CCSP 2KK7A 1VQMP 4HJGH 2E75B 1GMJA 5AVRB 3NTNA 1L0NG 4ZKPA 2FXPA 1N7SC 3MUDA 1FDMA 1KB9E 1VL2A 5GTHE 2OYHB 1Y9BA 3OW2O 1T3JA 2KI7B 1LGHB 2YKQA 5KLIB 5AW1B 1JY2O 3BATA 5KAFE 1JTHA 2BEQD 2E74D 1R5SA 1LWUA 2FFDA 3B71A 5AVTB 3AEBC 1SQXG 3TGUG 2QJPB 1FS0E 3MHVA 2XDJA 3F5HA 2IYOA 4XE5B 1AA0A 1KFMA 1EZVG 1YTZI 1VQ8P 4JPZB 3PP5A 1KILC 3L72G 2HPCA 1Z56A 5TISE 3CWBE 3EFFK 4IL6X 3L73G 4KJMA 1PPJE
chains in the Genus database with same CATH topology
1L4AB 1FZCC 5APXA 5APWA 1RF1A 2H43A 2IFNA 3IFMA 3TK1A 1GL2D 4M3LA 3A7OA 2OYIA 1GL2A 2KLVA 1NTZK 1IO4A 4JF7A 3I5CA 2HPCB 4EOTA 4C7RA 3VMZA 3BASA 1FJKA 1ZV8A 4XA4A 3MIWA 2Q9IA 2YMYA 1IFJA 3CI9A 1RF1B 3L35A 1N73C 2WSFH 2OYHA 3HD7D 2W27A 1NTKK 4N78D 2N1TB 3HD7A 2OYIB 4W7YA 1GL2B 3HUSA 1CI6A 2Q3IA 2P1JA 1M1JB 1XTCC 1JUNA 1N86A 3B5ND 5APVA 1LTJA 3V2RA 4GKGA 3VP9A 1RE3A 1SVFA 4C7NB 1E5WA 1SFCC 1YYCA 2WT7A 2KB7P 1FZAA 5APQA 2O1KA 3II6A 3L4FA 1JCDA 4I6MC 3V4WA 5CCGC 1ZN5A 1M7LA 1FZFA 4WY4C 1NTMK 5AVUB 2CPBA 2WITA 2C0WA 2I1JA 5CJ0A 4HYTB 3HUSB 1HVVA 1CI6B 1CW5A 1A02F 4JYCA 1G2CA 4AYCA 3RK3C 1G1JA 3OJAB 2E43A 1GD2E 3VN0A 3B5NB 2WSCH 5CCHA 1URQC 2Z4EA 3MD0A 1LT9A 3BVHA 4IFMA 1HUCA 1KILD 5AVZB 4WB4A 3P8MC 2YKOA 1NH4A 3P32A 2XKMA 1G2CB 1GDTA 1J1DC 1N7LA 2KYVA 3HTKB 3VP8A 1L4AD 3C9IA 3IR9A 1SLQA 3RK2C 1HJBA 5AVXB 2YO3A 4N3YB 1GW3A 1L4AA 3A5TA 5AVSB 2O1JA 1NKZB 1A02J 5AW3B 1T3UA 2QM7A 3A2AA 1KILB 2KSJA 3KYQA 1XTGB 1RY3A 5KJ7C 3T97A 5AW9B 3V2PA 5BU5A 1NKNA 2P2UA 2FYUK 3NXSA 1LWUC 3M9HA 2IPPA 4N6JA 1FZCB 2Z5IA 3P8CE 4HH2A 3V4QA 2FFDC 3RL0C 1RE4C 2N1TD 2FKWB 1T8ZA 2N1TA 4I2LC 4W7ZA 1SQQK 2WPQA 2HLOA 1M1JA 2QM8A 1IFIA 4LLHA 2HYNA 1ZLLA 2JJLA 2A45H 1SFCD 4C7NA 1L0NK 1EQ7A 2XZRA 1IFDA 1RF0A 3GHGC 1N7SD 3LIEA 3SWFA 2HODB 3BRVB 2BASA 1N7SA 1HTLC 3B8EB 1KFNA 5CCGD 3HE5B 4WY4D 1N73B 5APTA 5AVQB 5CJ4A 1HBWA 2WPSA 1GU4A 1FOSF 1GW4A 3M9QA 3OAKA 5AW4B 5APYA 1QL1A 4O9BA 3M91A 1FU1A 1URQD 3B5NA 1LTIC 4N78E 1SFCB 3E1IA 3U1CA 1LTAC 1N7SB 1MFZA 1LTSC 1SQVK 3OA7A 1CZQA 2POHA 4WY4B 1GTWA 1JY2N 3NFQA 2ZXEB 1SQXK 3M0AA 5AW8B 5CMZA 2MJZA 2KP8A 2M3BA 1NO4A 1FOSE 1HH0A 4IFDK 3RK2D 2GUSA 3HTKA 3RK3B 3L36A 1GK6A 1URQB 2OYHC 1IK9A 3M0DA 1H89A 1VDFA 1S9KE 2OARA 1KZUB 3HD7C 2YKPA 3HUSC 5CHXA 3CL3D 1AFOA 3LIDA 3VOPA 1KILA 1LTJC 5KJ7D 1J1EC 2M8RA 1W2EA 4Y99C 4AUWA 1ZR2A 1JY2P 5KJ7A 1OWAA 1J1DB 3H32B 1N2DC 3RK2B 4B86A 1T2KC 3RL0D 1X8YA 1JOCA 1JY3N 1FZCA 1NU1K 2CPSA 2W6BA 2Q7CA 5AVYB 2WPRA 2H8PD 1GU5A 2FXMA 1JMMA 3LW5H 2C9LY 2N9BA 3TYYA 4KHXA 4OH8B 3A3YB 3N7NA 2E42A 1LTBC 4LGDE 1SQBK 5BU8B 2YO2A 1JTHB 5APUA 5CCHC 2HODA 2Q5UA 2VRSA 1LT9C 1IFMA 4IFFA 3HE5A 1LWUB 2IX7C 5AW6B 1N73A 2HFED 3RL0B 1JY3O 2JEEA 3WMM0 3NMDA 1JY3P 3M9BA 1JCCA 5AW2B 4EIJA 3P8CD 1KQLA 1JNMA 5AVVB 3EQ2A 2XNXA 2WSEH 2XV5A 2NPSC 3VYIA 1DX7A 2P7JA 3KDPB 1L4AC 1SFCA 4C46A 3GHGB 3V2QA 3HRNA 2XU6A 3SWYA 2A45G 4WBAA 4LC1A 5CCGA 1AQ5A 1HGVA 3KQGA 4WY4A 3VMXA 2GUVA 4RESB 3TSIA 3BRTB 1L0LK 3HE4B 3RK3D 3EFGA 1IJDB 1DH3A 1PFIA 1IC2A 1X79B 2I1KA 2WWWA 3MTUE 1VPCA 3VTPC 2O01H 1FZEA 1RF1C 3CLQA 1URQA 3G3ZA 3V5BA 1LTGC 3R2PA 2R5BA 1QL2A 4DZOA 2A45I 1NOHA 3UIAA 1FAVA 2N1TC 3U59A 2OYIC 1GL2C 1X9VA 1M1JC 1MV8A 3N4XA 2R5DA 5KTBA 1J2JB 3MGNA 3P7KA 5AVRB 3NTNA 1SP4A 4ZKPA 2WZ7A 1RF0C 4JYBA 1NWQA 2HG5D 1WRGA 2FYZA 1N7SC 3MUDA 3H32A 1FDMA 1HWTC 1T2KD 2LKMA 3L37A 5AW7B 3H6PA 1FZGA 2OYHB 1GK4A 2W6AA 1T3JA 2J58A 3O8ZA 2IFMA 5BVZA 1MZ9A 3HD7B 1LGHB 2R3CA 2YKQA 3U1AA 2PP6A 1H88A 5AW1B 1S9KD 2J59M 2P67A 2ZFCA 3VMYA 1JY2O 1LTJB 3BATA 1RE3C 1J1EB 2YNYA 4Y99B 5CCHD 3B5NC 1JTHA 3M06A 2WT7B 1WT6A 5AVWB 2H7HA 1G1IA 1LWUA 2WTYA 2FFDA 1RE4A 4DOJA 5AVTB 1JO5A 1SQPK 1FBMA 1NHLA 1FJPA 1H8AA 2NPSD 3TNUA 1OXZA 2NPSA 2R32A 5AW0B 2KOGA 2XDJA 3GHGA 4GT1A 2GM4A 2C0XA 3M0DC 4XE5B 1MUUA 2C9NY 1HGZA 1FZBA 3KPEA 1LT9B 1KFMA 1ZR4A 3V2NA 4ZKUA 2FFDB 5AW5B 1YTZT 1YTZI 4GIFA 2L5GB 2PAJA 4AQRD 3PP5A 1KILC 1GZLA 2HPCA 4W80A 1LTTC 1Z56A 3HE4A 3TNUB 4I1LA 1DEBA 2NPSB 2Z5HA 5APSA 5KLVK 1IFNA 1CSBA 1NAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJB A;  5AVX B;  2YO3 A;  1GK6 A;  5APX A;  5APW A;  3V5B A;  3M0D A;  2R5B A;  4DZO A;  5AVS B;  3A5T A;  1H89 A;  1S9K E;  1A02 J;  5AW3 B;  3UIA A;  1FAV A;  3TK1 A;  4M3L A;  3A7O A;  1MV8 A;  2QM7 A;  1IO4 A;  3LID A;  3A2A A;  3I5C A;  2R5D A;  1J2J B;  3MGN A;  4EOT A;  3VMZ A;  3P7K A;  5AVR B;  4AUW A;  3NTN A;  1SP4 A;  4JYB A;  5AW9 B;  3T97 A;  1NWQ A;  1OWA A;  2P2U A;  1HWT C;  1T2K D;  3NXS A;  4B86 A;  3L37 A;  1T2K C;  5AW7 B;  3M9H A;  1X8Y A;  2IPP A;  3L35 A;  2Z5I A;  3V4Q A;  1GK4 A;  2Q7C A;  5AVY B;  2W6A A;  2W27 A;  3O8Z A;  2WPR A;  1GU5 A;  4I2L C;  2R3C A;  2WPQ A;  1CI6 A;  1H88 A;  2Q3I A;  2C9L Y;  2QM8 A;  2N9B A;  5AW1 B;  1S9K D;  2P67 A;  2ZFC A;  3TYY A;  4KHX A;  3VMY A;  1JUN A;  2JJL A;  3A3Y B;  3VTP C;  5APV A;  2E42 A;  4GKG A;  2YNY A;  4C7N A;  4C7N B;  2YO2 A;  2XZR A;  3LIE A;  5APU A;  3SWF A;  3M06 A;  1YYC A;  2Q5U A;  2WT7 A;  2BAS A;  5AVW B;  2WT7 B;  2H7H A;  3B8E B;  2VRS A;  5APQ A;  4I6M C;  3HE5 B;  3HE5 A;  3V4W A;  2WTY A;  5AW6 B;  1SLQ A;  5APT A;  5AVT B;  5AVQ B;  3NMD A;  5AVU B;  3M9B A;  1HBW A;  2WPS A;  4HYT B;  5AW2 B;  1GU4 A;  1FOS F;  1CI6 B;  1KQL A;  1JNM A;  1H8A A;  5AVV B;  1A02 F;  3TNU A;  3OAK A;  5AW4 B;  4JYC A;  4AYC A;  1OXZ A;  2XV5 A;  3IR9 A;  5APY A;  3M91 A;  3VYI A;  2P7J A;  3KDP B;  3VN0 A;  1GD2 E;  2R32 A;  2E43 A;  5AW0 B;  4GT1 A;  4C46 A;  2XU6 A;  4XE5 B;  1MUU A;  2C9N Y;  1MFZ A;  3MD0 A;  4LC1 A;  1HUC A;  5AW5 B;  3KQG A;  1CZQ A;  5AVZ B;  3VMX A;  4AQR D;  1GTW A;  3P8M C;  3NFQ A;  1GZL A;  2ZXE B;  3M0A A;  5AW8 B;  4RES B;  5CMZ A;  3P32 A;  2KP8 A;  3HE4 A;  3HE4 B;  3TNU B;  1DH3 A;  1G2C B;  1FOS E;  3HTK A;  2Z5H A;  5APS A;  2WWW A;  1CSB A;  3L36 A;  1NAF A; 
#chains in the Genus database with same CATH topology
 3H1L D;  3AE5 C;  2BCC G;  2H43 A;  1EZV I;  2NZ2 A;  1ZRT D;  2UWJ E;  3H1K D;  2KLV A;  2WVR A;  5CBN A;  1L0N J;  1FJK A;  1LNQ A;  1IFJ A;  1QEX A;  1TU3 F;  3CX5 H;  3L35 A;  2PFX A;  2W27 A;  1NTK J;  4N78 D;  2NRG A;  2OYI B;  2P58 A;  1CI6 A;  2P1J A;  3K5B A;  1DD4 A;  1JUN A;  3B5N D;  5APV A;  1E79 H;  3FXD A;  1OZH A;  1SFC C;  1SQV E;  1P84 E;  2WT7 A;  2FY8 A;  2O1K A;  3L4F A;  1JCD A;  5CCG C;  4WY4 C;  3TF5 A;  1NTM J;  2I1J A;  3L71 G;  1SQX J;  2M3E A;  1HVV A;  2DW3 A;  3L70 G;  3BCC E;  2M0B A;  3RK3 C;  1VQN P;  1KYO D;  2E43 A;  1GD2 E;  3B5N B;  5M1B A;  1URQ C;  2K37 A;  2Z4E A;  1M1K Q;  4IFM A;  1HUC A;  3CCQ P;  4WB4 A;  3L72 J;  2LR2 A;  2YKO A;  4D6T G;  3CCJ P;  1BCC E;  4IL6 E;  2XKM A;  3A0H H;  4TLF A;  1G2C B;  2KYV A;  1L4A D;  3L73 J;  3S4R A;  4U3F E;  2YO3 A;  3MP7 B;  3L75 E;  2B87 A;  3A5T A;  2O1J A;  1NKZ B;  2QJY C;  2E76 D;  3ZDM A;  2YIU C;  1PP9 E;  5B5E E;  3VMA A;  3MZW B;  4MN4 C;  5KKZ B;  2M5A A;  2AEJ A;  1XTG B;  1HJ0 A;  2LXB A;  3A0B H;  1VF5 C;  4PD4 H;  5KLV D;  2ZYG A;  2E74 C;  1EXJ A;  3RL0 C;  5L8R J;  2FKW B;  2Y0C A;  4W7Z A;  2WPQ A;  4GOE A;  2E76 B;  1IFI A;  1QVF O;  1NYH A;  2JJL A;  1LJ2 A;  2A45 H;  4GDO A;  2Y9Z A;  1U57 A;  4PJ0 E;  1N7S A;  4UB6 E;  5APT A;  1NTK D;  3L71 J;  3H1J G;  1GW4 A;  3CXH I;  4L75 A;  1KQS O;  1QL1 A;  1FU1 A;  1VQO P;  1IFP A;  4I7Z C;  2B9B A;  1NTZ G;  1CZQ A;  1BE3 J;  1GTW A;  1NTM D;  2ZXE B;  1H0T A;  3M0A A;  4D6T J;  3Q5P A;  2MJZ A;  5E79 E;  2M3B A;  1HH0 A;  4EYY Q;  1H89 A;  1VDF A;  4BXL A;  1AVY A;  2OAR A;  3LID A;  1JM0 A;  3VOP A;  1FDO A;  1KIL A;  2K9J A;  5KJ7 D;  1J1E C;  1ZR2 A;  1JY2 P;  3H32 B;  2B89 A;  1N2D C;  3L74 G;  2OGU A;  2W6B A;  3H1I D;  1BDC A;  2A06 D;  3F89 A;  1FC2 C;  5H2F H;  1SQB J;  2YO2 A;  2KLU A;  5GTH H;  5CCH C;  2J5U A;  3PTZ A;  3D70 A;  3CWB D;  4ASV A;  3NMD A;  1PPJ D;  1T6A A;  3H1J J;  4EIJ A;  3CMA P;  2O01 J;  3H1L E;  3CCU P;  1YHQ P;  1JEK A;  2XV5 A;  2ZYA A;  1DX7 A;  2IZ1 A;  1L4A C;  1SFC A;  4C46 A;  3GHG B;  1L2P A;  3H1K E;  2WMM A;  3PRJ A;  1KTM A;  2KXP B;  2IDB A;  5CCG A;  1K9M Q;  1AQ5 A;  1NTZ J;  4WY4 A;  1FDI A;  1L0L J;  2FYU G;  1IC2 A;  1X79 B;  2I1K A;  4A7P A;  3CLQ A;  1URQ A;  1LTG C;  1NOH A;  1FAV A;  3CCV P;  3CCR P;  1SQV D;  1SQQ G;  1X9V A;  2E5Y A;  1M1J C;  3N4X A;  1K73 Q;  1BE3 D;  2LXC B;  2FBW C;  2QVA A;  2WZ7 A;  1RF0 C;  2HG5 D;  2FYZ A;  3WU2 E;  2W83 C;  3D6Y A;  3L37 A;  3W67 A;  2YXQ B;  3WUV A;  2K9Y A;  1GK4 A;  1QVG O;  2J58 A;  5BVZ A;  3HD7 B;  2K88 A;  1AJY A;  1KYO E;  2QJK C;  2PP6 A;  1H88 A;  1S9K D;  1LTJ B;  4Y99 B;  4RJT A;  3TDK A;  1WT6 A;  1NU1 D;  1R5L A;  1S5L E;  4DOJ A;  4EDF A;  1SQP J;  1JO5 A;  1PIX A;  1FJP A;  2NPS D;  3G71 P;  2G3A A;  1SQB D;  3CXH D;  5DJU B;  4GT1 A;  2C0X A;  2C9N Y;  1HGZ A;  1LT9 B;  2W6J H;  1Q2N A;  3V2N A;  3C1L A;  4GIF A;  2L5G B;  4H0L B;  5B66 E;  1YBK A;  2V7Q H;  3H1J D;  4W80 A;  4UB8 H;  2AXC A;  3AE9 C;  2FYU J;  3AEC C;  2NPS B;  2Z5H A;  5KLV K;  3RBZ A;  1FZC C;  2IFN A;  5TJH A;  3IFM A;  1GL2 D;  4M3L A;  2OYI A;  4IL6 H;  4U7J A;  2D2C D;  4JF7 A;  3O6Q B;  3I5C A;  1UII A;  4EOT A;  4C7R A;  3BAS A;  1EDJ A;  1L0L D;  1BGY G;  4XFJ A;  2SPZ A;  1ZV8 A;  4XA4 A;  3MIW A;  2Q9I A;  1NTK E;  1OW6 A;  3CI9 A;  1EDK A;  3Q5S A;  1RF1 B;  3S9O A;  1ZXG A;  1NTK K;  2N1T B;  1GL2 B;  2D2C B;  2KNC A;  1XTC C;  3V2R A;  4GKG A;  1RE3 A;  1SVF A;  2KSE A;  3SFD C;  2ZT9 D;  2KB7 P;  1NTM E;  4DT0 A;  1ZN5 A;  1M7L A;  4OGQ D;  1NTM K;  5GTI H;  3PHL A;  5CJ0 A;  1A02 F;  4BRY A;  1G2C A;  4AYC A;  1G1J A;  3OJA B;  3VN0 A;  1EZV E;  4IOI H;  2WSC H;  5CCH A;  2ZT9 B;  3FWN A;  2FXO A;  1SQP D;  4HB1 A;  4OGQ B;  3B4S A;  3AEF C;  1N7L A;  3VP8 A;  1SLQ A;  3RK2 C;  3H1I E;  1HJB A;  1L4A A;  2A06 E;  5AVS B;  2R44 A;  1JMB A;  3H1H J;  3ITK A;  2QE7 H;  2I8D A;  1RY3 A;  3T97 A;  3CX5 D;  1BGY J;  2ITA A;  2P2U A;  3G6E P;  3NXS A;  1K04 A;  1OW7 A;  3M9H A;  3V4Q A;  1KB9 I;  2IBZ D;  1RQU A;  1RE4 C;  1RQV A;  3GF7 A;  4ZNC A;  1T8Z A;  3CCE P;  2HLO A;  1M1J A;  3WUT A;  4C7N A;  1RF0 A;  2HOD B;  2BAS A;  3QWO C;  4PV1 C;  2W90 A;  3HE5 B;  1N73 B;  1W5C E;  1HBW A;  2WPS A;  1K8A Q;  1FOS F;  3M9Q A;  1KOR A;  3OAK A;  3GLM A;  5AW4 B;  3PLN A;  4O9B A;  3M91 A;  1LTI C;  1BE3 E;  4WWI A;  1LTS C;  4H44 D;  1S1C X;  1SQV K;  4D6T E;  2CK3 H;  4H13 D;  3NFQ A;  2E75 C;  2KS1 B;  5AW8 B;  2AEF A;  2AXT H;  5CMZ A;  3TGU J;  2KP8 A;  3W68 A;  4IFD K;  1KMI Z;  3HTK A;  1MFT A;  2OYH C;  1IK9 A;  1S9K E;  4OWF A;  1KZU B;  5KLI C;  4H44 B;  3WUU A;  3Q5R A;  3JCU E;  1NJI Q;  4PD4 D;  4H13 B;  1YQ4 C;  4AUW A;  5KJ7 A;  2OYO A;  1NU1 E;  1J1D B;  4B86 A;  2ZT9 C;  1VQ9 P;  1FZC A;  1NU1 K;  2BCC J;  3C8V A;  2Q7C A;  2WPR A;  2ZYD A;  1SQB E;  3CXH E;  3H1H D;  2QJP C;  2N9B A;  3TYY A;  2E42 A;  1SQB K;  1JTH B;  3BCC G;  5KAI E;  1LWU B;  3H1J E;  5AW6 B;  2HFE D;  3AED C;  3JSV C;  1JY3 P;  1LT1 A;  3RL0 g;  3Q3D A;  1Q7Y Q;  1JNM A;  2V4H A;  2WSF J;  2WSE H;  1YI2 P;  3VYI A;  1X0T A;  3KDP B;  1BCC G;  1L0N D;  3RGU A;  3SWY A;  1NTZ E;  4L74 A;  4RKU J;  4U3F G;  2WQY C;  1L0L E;  3L75 G;  2GUV A;  2JP3 A;  1PP9 G;  1L0L K;  3L70 J;  4OVN F;  2QA4 P;  3R2P A;  2R5B A;  1QL2 A;  4DZO A;  3U59 A;  2L91 A;  2OYI C;  1K05 A;  1MV8 A;  1NGM B;  3MGN A;  3P7K A;  1SQX D;  3AE6 C;  1OVR A;  4R4L A;  1SP4 A;  3TGU D;  1NWQ A;  1WRG A;  1T2K D;  3H6P A;  1FZG A;  1QLE D;  2OTK E;  2W6A A;  3CC4 P;  1DD3 A;  3O8Z A;  1AVO A;  1EXI A;  1MZ9 A;  3GMA A;  1EZV D;  2R3C A;  2J59 M;  2P67 A;  2KZJ A;  2Y0D A;  3L72 D;  3JC2 2;  1RE3 C;  3S1K A;  2YNY A;  3SFE C;  3B5N C;  4DJG A;  1LP1 B;  2OTL P;  2WT7 B;  3L73 D;  1SQP E;  2V7Q J;  1G1I A;  2BCC D;  1RE4 A;  3AE3 C;  1SQP K;  1NHL A;  1S72 P;  1KB9 H;  1OXZ A;  1PGJ A;  2NPS A;  2R32 A;  5AW0 B;  2GM4 A;  3M0D C;  2PRR A;  1VQ7 P;  3KPE A;  2O01 N;  5AW5 B;  3CX5 E;  3L75 J;  2RH0 A;  4AQR D;  1KD1 Q;  5KKZ C;  1GZL A;  1UIX A;  5KAF H;  3GF3 A;  1S5L X;  1PP9 J;  3HE4 A;  3TNU B;  3GG2 A;  4I1L A;  2IBZ E;  5APS A;  1CSB A;  5APW A;  1RF1 A;  2QG4 A;  2B87 B;  2RKL A;  1PGP A;  3G9R A;  2JKV A;  3A7O A;  1GL2 A;  2E76 C;  2KZI A;  4YXW H;  1IO4 A;  2M5A B;  3L71 D;  4KT0 J;  3VMZ A;  1PV3 A;  3CCM P;  3L70 D;  1VQ5 P;  2WSF H;  2OYH A;  2FYN B;  3HD7 D;  1YIT P;  1M90 Q;  4W7Y A;  2RMZ A;  5TIS H;  2WSC J;  2Q3I A;  1N86 A;  4D6T D;  3VP9 A;  2HR3 A;  1E5W A;  1KQG B;  3H1L G;  3A0H E;  1KC8 Q;  1YQ3 C;  1YYC A;  1FZA A;  5CBO A;  5APQ A;  3L74 J;  4I6M C;  3V4W A;  3H1K G;  1FZF A;  5AVU B;  2WIT A;  2C0W A;  1BDD A;  3HUS B;  1CW5 A;  2B88 A;  3A0B E;  4PD4 E;  1U7M A;  3MD0 A;  3BVH A;  3KZI E;  4H0L D;  1KIL D;  5AVZ B;  1BSH A;  3P8M C;  1KQF B;  5DJT B;  1P84 H;  1S4X A;  1GDT A;  3IR9 A;  3R4Y A;  5AVX B;  1YJW P;  1GW3 A;  3H1H E;  1A02 J;  1VQK P;  2QM7 A;  3I56 P;  3A2A A;  1KIL B;  2KSJ A;  1SS1 A;  1OIP A;  5KJ7 C;  3V2P A;  1Q82 Q;  2AEM A;  1NKN A;  2QIW A;  2ZVO B;  4N6J A;  2Z5I A;  4ZMD A;  3IN6 A;  2N1T D;  4I2L C;  3Q2Y A;  1SQQ J;  3AE4 C;  1L0N E;  1NTZ D;  4LLH A;  2HYN A;  1W2B O;  1KYO I;  4GOF A;  1OX3 A;  1SFC D;  1L0N K;  1EQ7 A;  2XZR A;  1ZW0 A;  3GHG C;  3H1L J;  1HTL C;  1KFN A;  3V6I A;  5CCG D;  5B5E H;  2QRX A;  4WY4 D;  1U7J A;  4L76 A;  2W8Z A;  5AVQ B;  1GU4 A;  3AE2 C;  3EWK A;  2ZAE B;  1FE6 A;  5KLV G;  1URQ D;  3B5N A;  4JBZ A;  1SFC B;  3E1I A;  1LTA C;  3L74 D;  1SQX E;  3TGU E;  3OA7 A;  1AQT A;  4WY4 B;  1JY2 N;  1SQX K;  4PJ0 H;  1NO4 A;  3RK3 B;  2WSS H;  4UB6 H;  5H2F E;  1GK6 A;  2QEX P;  1URQ B;  3M0D A;  3L72 E;  1NTK G;  3HD7 C;  2YKP A;  4WVZ A;  3HUS C;  5CHX A;  1DEE G;  4Y28 J;  1AFO A;  1LTJ C;  1OFC X;  3L73 E;  2M8R A;  1W2E A;  4Y99 C;  1USD A;  1VF5 D;  1EDI A;  1OWA A;  2BCC E;  3E7K A;  2Q1K A;  2OQQ A;  3RL0 D;  1X8Y A;  1JOC A;  2K3R A;  2CPS A;  2ZJS E;  2WSE J;  1NTM G;  2QJY B;  4TT3 H;  1GU5 A;  2YIU B;  5E79 H;  2JDI H;  1NVO A;  4KHX A;  1M8O B;  3A3Y B;  3N7N A;  3Q1M A;  4NPF X;  3CC2 P;  1X22 A;  1VF5 B;  2FYU D;  1LT9 C;  1IFM A;  4IFF A;  2IX7 C;  2E74 B;  3RL0 B;  4H0L C;  2JEE A;  2GA1 A;  5AW2 B;  1SQQ D;  3P8C D;  1KQL A;  3EQ2 A;  2NPS C;  5KLV J;  3AEE C;  1HF9 A;  3V2Q A;  3HRN A;  4ASW A;  3H1I G;  3L71 E;  4LC1 A;  2XND H;  1Y8A A;  2A06 G;  3KQG A;  3L70 E;  4RES B;  1IJD B;  1PFI A;  1RF1 C;  3CWB G;  1PGO A;  3G3Z A;  3V5B A;  3UIA A;  4I7Z B;  4RO0 A;  1PPJ G;  2N1T C;  1GL2 C;  2R3S A;  2D2C C;  3E1R A;  2R5D A;  5KTB A;  1J2J B;  3SSU A;  4JYB A;  2JO1 A;  1LP1 A;  3H32 A;  1HWT C;  2LKM A;  4HKZ H;  1YIJ P;  2MKV A;  2Y9Y A;  5AW7 B;  1OVU A;  2K1A A;  4BWN A;  2IFM A;  3CPW O;  2G8Y A;  3U1A A;  2KIK A;  1KN7 A;  1OW8 A;  2KNC B;  2ZFC A;  2YMK A;  3VMY A;  1ZP0 C;  1J1E B;  5CCH D;  3M06 A;  1KIL E;  4UB8 E;  5AVW B;  2H7H A;  2WTY A;  1SQV G;  1NAY A;  1BE3 G;  4QMA A;  1FBM A;  1MKM A;  4OGQ C;  2P10 A;  1H8A A;  3TNU A;  4BRY B;  1VQ6 P;  3WU2 H;  2KUB A;  2H88 C;  1BGY D;  2KOG A;  3GHG A;  1MUU A;  1FZB A;  3PH0 A;  1USE A;  1ZR4 A;  3H1I J;  1KYO H;  1P84 I;  4ZKU A;  2WPV B;  2FFD B;  1YTZ T;  2PAJ A;  1D7M A;  2Y0E A;  1LTT C;  4JQ0 D;  1DEB A;  1IFN A;  2PGD A;  1NAF A;  2OTJ P;  3KZI H;  1L4A B;  5APX A;  1EDL A;  1ZOY C;  3CWB J;  1S5L H;  1NU1 G;  4YXD C;  3TK1 A;  1NTZ K;  2E5T A;  2HPC B;  5GTI E;  1SQB G;  3T97 B;  1VQP P;  4GOD A;  2YMY A;  1WMK A;  1N73 C;  3AE8 C;  5B66 H;  3RK3 E;  3AEA C;  1QX8 A;  3HD7 A;  3HUS A;  4NPE A;  1R8E A;  4YPC A;  1M1J B;  1BSN A;  3CME P;  1LTJ A;  4R4M A;  4C7N B;  4Z1M H;  3L74 E;  4K35 A;  2N9Y B;  3II6 A;  1SQV J;  3GW6 A;  2JWD A;  1KB9 D;  2CPB A;  1N8R Q;  4HYT B;  1CI6 B;  2QJK B;  3KHU A;  4K3A A;  1L0L G;  4JYC A;  1KV4 A;  3RBX A;  1Q86 Q;  3LW5 J;  3QH9 A;  3BCC J;  3IF4 A;  1LT9 A;  4H44 C;  1DIP A;  4H13 C;  3ABV C;  1NH4 A;  3P32 A;  1J1D C;  3MUD C;  3HTK B;  3C9I A;  1M57 D;  1BCC J;  4N3Y B;  1NU1 J;  3USS A;  5AW3 B;  1T3U A;  4U3F J;  3FGA D;  1Q81 Q;  5C39 A;  3FX0 A;  3O6Q A;  2FYU E;  1QGK B;  1S2E A;  3KYQ A;  5AW9 B;  5BU5 A;  4EI2 A;  2FYU K;  3IAO A;  2O3J A;  1LWU C;  1SQQ E;  2IPP A;  1FZC B;  2FFD C;  3P8C E;  4HH2 A;  4L73 A;  1SQP G;  2N1T A;  2IYP A;  1SQQ K;  2QM8 A;  1ZLL A;  2H89 C;  3SWK A;  1IFD A;  2AXT E;  1N7S D;  3LIE A;  3SWF A;  1ZRT E;  1OVV A;  3BRV B;  3B8E B;  3H25 A;  1IK7 A;  1Q90 D;  5CJ4 A;  2JR8 A;  5K5G B;  5APY A;  4N78 E;  3AE1 C;  4YTP C;  2IBZ G;  3U1C A;  1N7S B;  1VQL P;  1RH5 B;  1MFZ A;  4DCK A;  1P84 D;  2POH A;  5EFW B;  2ZXX A;  3CX5 I;  1RHZ B;  2Q6Q A;  1FOS E;  2JWA A;  1Y47 A;  3RK2 D;  2GUS A;  3L36 A;  2IBZ I;  3CC7 P;  1EC5 A;  1PGQ A;  2YXR B;  3FWL A;  3BCC D;  2RN0 A;  1ZME C;  1OMI A;  1PL5 A;  3AE7 C;  3CL3 D;  1M56 D;  3KXD A;  1H0T B;  1VQ4 P;  2ZVN B;  3CCL P;  3G4S P;  3RK2 B;  1BCC D;  1T2K C;  2IZ0 A;  1JY3 N;  5AVY B;  2H8P D;  2FXM A;  4U3F D;  1JMM A;  3LW5 H;  2C9L Y;  3L75 D;  1BGY E;  2QSI A;  2K9J B;  4OH8 B;  1JB0 J;  3AEG C;  1LTB C;  4LGD E;  5BU8 B;  3I55 P;  1PP9 D;  5APU A;  2HOD A;  4PV1 D;  2Q5U A;  4NPD A;  2VRS A;  3HE5 A;  3JCU H;  1N73 A;  1JY3 O;  1S3J A;  3WMM 0;  3M9B A;  3CD6 P;  5KLV E;  1JCC A;  5AVV B;  2XNX A;  2P7J A;  2XU6 A;  1AV1 A;  2Q3E A;  3PJS K;  4PV1 B;  3CXH H;  4CPG A;  2A45 G;  2BEZ F;  4WBA A;  3FXE A;  3H1H G;  3H1K J;  4PD4 I;  1YJ9 P;  3D6Z A;  2E75 D;  1HGV A;  3VMX A;  2KS1 A;  3TSI A;  3BRT B;  3HE4 B;  3RK3 D;  3EFG A;  1DH3 A;  5KAI H;  1YJN P;  2WWW A;  3MTU E;  1VPC A;  3VTP C;  3D71 A;  1IZN B;  1FZE A;  2O01 H;  1PZQ A;  2FYN C;  2A45 I;  3CCS P;  2KK7 A;  1VQM P;  4HJG H;  2E75 B;  1GMJ A;  5AVR B;  3NTN A;  1L0N G;  4ZKP A;  2FXP A;  1N7S C;  3MUD A;  1FDM A;  1KB9 E;  1VL2 A;  5GTH E;  2OYH B;  1Y9B A;  3OW2 O;  1T3J A;  2KI7 B;  1LGH B;  2YKQ A;  5KLI B;  5AW1 B;  1JY2 O;  3BAT A;  5KAF E;  1JTH A;  2BEQ D;  2E74 D;  1R5S A;  1LWU A;  2FFD A;  3B71 A;  5AVT B;  3AEB C;  1SQX G;  3TGU G;  2QJP B;  1FS0 E;  3MHV A;  2XDJ A;  3F5H A;  2IYO A;  4XE5 B;  1AA0 A;  1KFM A;  1EZV G;  1YTZ I;  1VQ8 P;  4JPZ B;  3PP5 A;  1KIL C;  3L72 G;  2HPC A;  1Z56 A;  5TIS E;  3CWB E;  3EFF K;  4IL6 X;  3L73 G;  4KJM A;  1PPJ E; 
#chains in the Genus database with same CATH homology
 1L4A B;  1FZC C;  5APX A;  5APW A;  1RF1 A;  2H43 A;  2IFN A;  3IFM A;  3TK1 A;  1GL2 D;  4M3L A;  3A7O A;  2OYI A;  1GL2 A;  2KLV A;  1NTZ K;  1IO4 A;  4JF7 A;  3I5C A;  2HPC B;  4EOT A;  4C7R A;  3VMZ A;  3BAS A;  1FJK A;  1ZV8 A;  4XA4 A;  3MIW A;  2Q9I A;  2YMY A;  1IFJ A;  3CI9 A;  1RF1 B;  3L35 A;  1N73 C;  2WSF H;  2OYH A;  3HD7 D;  2W27 A;  1NTK K;  4N78 D;  2N1T B;  3HD7 A;  2OYI B;  4W7Y A;  1GL2 B;  3HUS A;  1CI6 A;  2Q3I A;  2P1J A;  1M1J B;  1XTC C;  1JUN A;  1N86 A;  3B5N D;  5APV A;  1LTJ A;  3V2R A;  4GKG A;  3VP9 A;  1RE3 A;  1SVF A;  4C7N B;  1E5W A;  1SFC C;  1YYC A;  2WT7 A;  2KB7 P;  1FZA A;  5APQ A;  2O1K A;  3II6 A;  3L4F A;  1JCD A;  4I6M C;  3V4W A;  5CCG C;  1ZN5 A;  1M7L A;  1FZF A;  4WY4 C;  1NTM K;  5AVU B;  2CPB A;  2WIT A;  2C0W A;  2I1J A;  5CJ0 A;  4HYT B;  3HUS B;  1HVV A;  1CI6 B;  1CW5 A;  1A02 F;  4JYC A;  1G2C A;  4AYC A;  3RK3 C;  1G1J A;  3OJA B;  2E43 A;  1GD2 E;  3VN0 A;  3B5N B;  2WSC H;  5CCH A;  1URQ C;  2Z4E A;  3MD0 A;  1LT9 A;  3BVH A;  4IFM A;  1HUC A;  1KIL D;  5AVZ B;  4WB4 A;  3P8M C;  2YKO A;  1NH4 A;  3P32 A;  2XKM A;  1G2C B;  1GDT A;  1J1D C;  1N7L A;  2KYV A;  3HTK B;  3VP8 A;  1L4A D;  3C9I A;  3IR9 A;  1SLQ A;  3RK2 C;  1HJB A;  5AVX B;  2YO3 A;  4N3Y B;  1GW3 A;  1L4A A;  3A5T A;  5AVS B;  2O1J A;  1NKZ B;  1A02 J;  5AW3 B;  1T3U A;  2QM7 A;  3A2A A;  1KIL B;  2KSJ A;  3KYQ A;  1XTG B;  1RY3 A;  5KJ7 C;  3T97 A;  5AW9 B;  3V2P A;  5BU5 A;  1NKN A;  2P2U A;  2FYU K;  3NXS A;  1LWU C;  3M9H A;  2IPP A;  4N6J A;  1FZC B;  2Z5I A;  3P8C E;  4HH2 A;  3V4Q A;  2FFD C;  3RL0 C;  1RE4 C;  2N1T D;  2FKW B;  1T8Z A;  2N1T A;  4I2L C;  4W7Z A;  1SQQ K;  2WPQ A;  2HLO A;  1M1J A;  2QM8 A;  1IFI A;  4LLH A;  2HYN A;  1ZLL A;  2JJL A;  2A45 H;  1SFC D;  4C7N A;  1L0N K;  1EQ7 A;  2XZR A;  1IFD A;  1RF0 A;  3GHG C;  1N7S D;  3LIE A;  3SWF A;  2HOD B;  3BRV B;  2BAS A;  1N7S A;  1HTL C;  3B8E B;  1KFN A;  5CCG D;  3HE5 B;  4WY4 D;  1N73 B;  5APT A;  5AVQ B;  5CJ4 A;  1HBW A;  2WPS A;  1GU4 A;  1FOS F;  1GW4 A;  3M9Q A;  3OAK A;  5AW4 B;  5APY A;  1QL1 A;  4O9B A;  3M91 A;  1FU1 A;  1URQ D;  3B5N A;  1LTI C;  4N78 E;  1SFC B;  3E1I A;  3U1C A;  1LTA C;  1N7S B;  1MFZ A;  1LTS C;  1SQV K;  3OA7 A;  1CZQ A;  2POH A;  4WY4 B;  1GTW A;  1JY2 N;  3NFQ A;  2ZXE B;  1SQX K;  3M0A A;  5AW8 B;  5CMZ A;  2MJZ A;  2KP8 A;  2M3B A;  1NO4 A;  1FOS E;  1HH0 A;  4IFD K;  3RK2 D;  2GUS A;  3HTK A;  3RK3 B;  3L36 A;  1GK6 A;  1URQ B;  2OYH C;  1IK9 A;  3M0D A;  1H89 A;  1VDF A;  1S9K E;  2OAR A;  1KZU B;  3HD7 C;  2YKP A;  3HUS C;  5CHX A;  3CL3 D;  1AFO A;  3LID A;  3VOP A;  1KIL A;  1LTJ C;  5KJ7 D;  1J1E C;  2M8R A;  1W2E A;  4Y99 C;  4AUW A;  1ZR2 A;  1JY2 P;  5KJ7 A;  1OWA A;  1J1D B;  3H32 B;  1N2D C;  3RK2 B;  4B86 A;  1T2K C;  3RL0 D;  1X8Y A;  1JOC A;  1JY3 N;  1FZC A;  1NU1 K;  2CPS A;  2W6B A;  2Q7C A;  5AVY B;  2WPR A;  2H8P D;  1GU5 A;  2FXM A;  1JMM A;  3LW5 H;  2C9L Y;  2N9B A;  3TYY A;  4KHX A;  4OH8 B;  3A3Y B;  3N7N A;  2E42 A;  1LTB C;  4LGD E;  1SQB K;  5BU8 B;  2YO2 A;  1JTH B;  5APU A;  5CCH C;  2HOD A;  2Q5U A;  2VRS A;  1LT9 C;  1IFM A;  4IFF A;  3HE5 A;  1LWU B;  2IX7 C;  5AW6 B;  1N73 A;  2HFE D;  3RL0 B;  1JY3 O;  2JEE A;  3WMM 0;  3NMD A;  1JY3 P;  3M9B A;  1JCC A;  5AW2 B;  4EIJ A;  3P8C D;  1KQL A;  1JNM A;  5AVV B;  3EQ2 A;  2XNX A;  2WSE H;  2XV5 A;  2NPS C;  3VYI A;  1DX7 A;  2P7J A;  3KDP B;  1L4A C;  1SFC A;  4C46 A;  3GHG B;  3V2Q A;  3HRN A;  2XU6 A;  3SWY A;  2A45 G;  4WBA A;  4LC1 A;  5CCG A;  1AQ5 A;  1HGV A;  3KQG A;  4WY4 A;  3VMX A;  2GUV A;  4RES B;  3TSI A;  3BRT B;  1L0L K;  3HE4 B;  3RK3 D;  3EFG A;  1IJD B;  1DH3 A;  1PFI A;  1IC2 A;  1X79 B;  2I1K A;  2WWW A;  3MTU E;  1VPC A;  3VTP C;  2O01 H;  1FZE A;  1RF1 C;  3CLQ A;  1URQ A;  3G3Z A;  3V5B A;  1LTG C;  3R2P A;  2R5B A;  1QL2 A;  4DZO A;  2A45 I;  1NOH A;  3UIA A;  1FAV A;  2N1T C;  3U59 A;  2OYI C;  1GL2 C;  1X9V A;  1M1J C;  1MV8 A;  3N4X A;  2R5D A;  5KTB A;  1J2J B;  3MGN A;  3P7K A;  5AVR B;  3NTN A;  1SP4 A;  4ZKP A;  2WZ7 A;  1RF0 C;  4JYB A;  1NWQ A;  2HG5 D;  1WRG A;  2FYZ A;  1N7S C;  3MUD A;  3H32 A;  1FDM A;  1HWT C;  1T2K D;  2LKM A;  3L37 A;  5AW7 B;  3H6P A;  1FZG A;  2OYH B;  1GK4 A;  2W6A A;  1T3J A;  2J58 A;  3O8Z A;  2IFM A;  5BVZ A;  1MZ9 A;  3HD7 B;  1LGH B;  2R3C A;  2YKQ A;  3U1A A;  2PP6 A;  1H88 A;  5AW1 B;  1S9K D;  2J59 M;  2P67 A;  2ZFC A;  3VMY A;  1JY2 O;  1LTJ B;  3BAT A;  1RE3 C;  1J1E B;  2YNY A;  4Y99 B;  5CCH D;  3B5N C;  1JTH A;  3M06 A;  2WT7 B;  1WT6 A;  5AVW B;  2H7H A;  1G1I A;  1LWU A;  2WTY A;  2FFD A;  1RE4 A;  4DOJ A;  5AVT B;  1JO5 A;  1SQP K;  1FBM A;  1NHL A;  1FJP A;  1H8A A;  2NPS D;  3TNU A;  1OXZ A;  2NPS A;  2R32 A;  5AW0 B;  2KOG A;  2XDJ A;  3GHG A;  4GT1 A;  2GM4 A;  2C0X A;  3M0D C;  4XE5 B;  1MUU A;  2C9N Y;  1HGZ A;  1FZB A;  3KPE A;  1LT9 B;  1KFM A;  1ZR4 A;  3V2N A;  4ZKU A;  2FFD B;  5AW5 B;  1YTZ T;  1YTZ I;  4GIF A;  2L5G B;  2PAJ A;  4AQR D;  3PP5 A;  1KIL C;  1GZL A;  2HPC A;  4W80 A;  1LTT C;  1Z56 A;  3HE4 A;  3TNU B;  4I1L A;  1DEB A;  2NPS B;  2Z5H A;  5APS A;  5KLV K;  1IFN A;  1CSB A;  1NAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...