2JWDA

Protein a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
DVDNKFNKEQQNAFWEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein A
publication title Polyglutamine length-dependent midfolding is confined to the Poly-Q region
rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2jwdA00
2LXBA 2B87A 2HR3A 5C39A 2M0BA 2B88A 4NPFX 2K3RA 4NPEA 2QVAA 1BDCA 4K35A 1LP1B 1LT1A 2B87B 5EFWB 1EC5A 4ZMDA 1JMBA 2KZJA 4NPDA 1FC2C 4K3AA 4BXLA 3MZWB 2KZIA 2I8DA 1H0TA 4HKZH 3ZDMA 2KI7B 3QWOC 5CBNA 2P58A 4JBZA 3RGUA 1OVRA 5DJUB 3FXEA 1Q2NA 2RKLA 2JWDA 4HB1A 2ZAEB 1OVVA 4WWIA 1SS1A 1EDIA 1NVOA 1H0TB 2WMMA 1MFTA 1OVUA 4GOEA 4IOIH 2Q1KA 2KUBA 4ZNCA 3FXDA 2LXCB 4KJMA 2R44A 4ASWA 1ZW0A 1U7MA 2M5AA 1DEEG 1LP1A 2KS1B 4EYYQ 2LR2A 1S3JA 1EDJA 5DJTB 4GODA 2OTKE 2UWJE 3MHVA 1ZXGA 4CPGA 2SPZA 1Y47A 1EDKA 1JM0A 1BDDA 4ASVA 2M5AB 5K5GB 3S1KA 2B89A 2QRXA 5CBOA 2KIKA 4MN4C 4GOFA 1EDLA 1X0TA 1U7JA 4HJGH 3PH0A
chains in the Genus database with same CATH superfamily
1YJNP 3PJSK 1H8AA 1RQUA 1HWTC 4U3FG 2K3RA 4I6MC 1BCCE 1L0LK 3GF7A 3A0BH 2QVAA 2QJYB 3L74J 4NPEA 1BCCG 3NXSA 3R2PA 1J1EC 3H1LE 4AYCA 2G3AA 3RK3D 1L0ND 3H1LG 4BXLA 2C0WA 4WBAA 1SQVD 2Z4EA 1N73B 1S2EA 1QEXA 3LW5J 3RGUA 2PP6A 3HD7A 2R32A 1P84E 2CPBA 1Q90D 4D6TE 3PRJA 4D6TG 3V2NA 2Y0CA 4RESB 4ZKPA 3G9RA 2E5TA 1G2CA 3GLMA 1WT6A 2E75C 2N1TD 1YHQP 3H1HD 5L8RJ 5AVSB 1GK4A 1QX8A 1GK6A 3RBXA 2A06D 1ZXGA 3CWBE 1N7SB 1HVVA 3CWBG 2Y9YA 1LNQA 3PH0A 5AW4B 1HH0A 2KNCA 2HR3A 1HF9A 2B88A 3L75J 2E75D 4U3FD 1FOSE 3IR9A 4LLHA 2AEFA 5APUA 2A45G 1PFIA 2JKVA 4JPZB 5AVUB 1GW3A 2IYPA 1VF5B 4IL6X 4N3YB 1RQVA 2KYVA 1IFDA 3SSUA 1AJYA 4OGQD 4PD4E 2GUVA 1JTHA 1SQVJ 3L4FA 3FXEA 4EDFA 4RJTA 4IOIH 1JEKA 4PD4H 3E1RA 2LXCB 2ITAA 2O1KA 4A7PA 3RL0C 3CCQP 3L73E 1AA0A 1DEEG 3L73G 2B9BA 4H13C 1LTJC 1MFZA 1PZQA 1EDJA 3EFFK 5TJHA 3D6YA 5DJTB 3CD6P 1RE3A 3MHVA 5CCHC 2IZ0A 2Q9IA 3EWKA 4ZKUA 1JM0A 1LWUC 3OAKA 1A02J 1NKZB 2KIKA 2E74B 1LJ2A 4W7YA 3VOPA 1IZNB 4YXDC 5KAFH 3H32B 1CW5A 3OA7A 2FYUD 3RL0D 3H1JG 3AE2C 4N6JA 1URQD 1HUCA 1VQ4P 1GW4A 1W2EA 1NO4A 1NU1E 5CCHD 3WMM0 4BWNA 2HYNA 3M91A 1NU1G 2WPRA 1YITP 3Q5PA 1J1DC 1JB0J 3CX5H 3VP9A 2E43A 4HKZH 2J59M 3PLNA 2W6BA 3RK2B 1NAFA 4GKGA 1Q2NA 2YXQB 2R5DA 1JY2P 1JUNA 3AE7C 4DZOA 5AVWB 2W8ZA 1Y9BA 4IFMA 1NU1K 1JTHB 2Q3IA 1PP9E 4DT0A 1EXJA 1PP9G 4DOJA 1OZHA 1ZW0A 1VQLP 2R5BA 3WUUA 3WUVA 3TNUB 5AW1B 4BRYB 5BU5A 1JY3N 1SQXE 3B71A 1FDMA 1NJIQ 2QJPC 1SQXG 5AW2B 3AECC 1VQNP 1FU1A 3VN0A 1QVGO 3GG2A 1ZRTD 1YQ4C 5CBOA 4GOFA 5B66E 1A02F 1JY3O 4HJGH 3UIAA 1N86A 3V2QA 2D2CD 2IBZE 2FXMA 3V6IA 5APSA 3H1JD 3BCCE 2IBZG 3HE4B 5KAIE 1IFIA 3BCCG 2M3BA 4PV1B 1S9KE 1LT9B 2FYUJ 3F5HA 3BATA 1NTME 1SQXK 1M1JC 1NTMG 2GM4A 1NU1D 2QJKC 1KD1Q 5KAIH 1VPCA 3MZWB 1D7MA 1BGYE 1PIXA 3EFGA 1BGYG 2QEXP 2FYNB 3B5NB 4H44C 5KTBA 5DJUB 4UB6E 2WT7A 3MTUE 4Y28J 4ZNCA 1NTMK 3TYYA 4UB6H 2FY8A 1AVOA 4M3LA 1ZN5A 3A7OA 1MUUA 1SFCC 3A3YB 3CC4P 1NTZE 2IDBA 1S72P 1NTZG 1KQFB 2ZT9D 4H44D 2NPSB 2XZRA 1S5LE 4TT3H 1GL2B 3L71E 4ASVA 3AE8C 5KLVE 2Z5IA 3Q5SA 3L71G 1SQBE 1SQPD 2OTLP 5KLVG 3RL0g 3MUDC 1X0TA 1SQBG 1VQKP 4WY4B 4WVZA 3M06A 3CCMP 1KFNA 3AE3C 1IFPA 4XFJA 1NTZK 2JP3A 1BDCA 1KN7A 2ZFCA 1FS0E 4YXWH 2P2UA 3N4XA 2WVRA 2BASA 3RBZA 5KLVK 5AVTB 1PL5A 1SQBK 1DIPA 2RMZA 4JBZA 2ZXXA 3A0HE 1FAVA 1R5LA 5TISE 5BU8B 2IZ1A 4Z1MH 3G3ZA 4IFFA 3VMXA 1L2PA 3A0HH 2XNDH 4QMAA 3H1KE 1DD4A 1T2KD 3H1KG 1NKNA 1HGZA 2WT7B 5E79E 4ASWA 2M5AA 2WSEJ 4H0LD 3C1LA 2MKVA 2W6JH 3M0AA 1HJBA 1G1JA 3T97A 1DEBA 3CCJP 1BE3E 5E79H 1KZUB 4TLFA 4IFDK 1BE3G 1RHZB 3HUSC 4GT1A 2HLOA 1SQQD 2IX7C 3KDPB 2FYZA 3U59A 2W83C 1Q7YQ 2Y0EA 1U7JA 1SQBD 5CMZA 1QGKB 4LC1A 4N78E 4OH8B 1SQPJ 2Q6QA 1MV8A 1FZCC 5AW6B 1RF1A 4WB4A 2HG5D 1ZR2A 1VDFA 3RK3C 1GDTA 4JQ0D 2HPCA 3A0BE 3KHUA 1LTJA 4B86A 1H0TA 5CBNA 2FFDC 3VTPC 1LWUA 2WSFJ 1L4AB 5M1BA 4RKUJ 4XE5B 2WSCH 2QIWA 1RE4A 3CPWO 3H1ID 1RH5B 1RY3A 1VQMP 2YO3A 3SWYA 1IFJA 2OYHC 1Q86Q 1EZVE 3CMEP 2BCCD 1NGMB 1M90Q 1EZVG 1YQ3C 2N1TC 3W67A 3ITKA 2BEQD 3V2RA 1NTKE 1KC8Q 1K8AQ 2YIUC 1NTKG 1NWQA 3F89A 3ABVC 3TDKA 1IJDB 1H89A 1FZGA 3P8CE 2O01J 1AV1A 1Q82Q 1EQ7A 2M5AB 2V4HA 1EXIA 3T97B 5AVYB 5KKZC 5KLIC 1SQQJ 1L0LD 1VQ7P 2M0BA 1FJPA 1JY3P 3M9QA 1IO4A 1NTKK 5AVQB 3TF5A 3II6A 3L72D 5KJ7D 3B8EB 3Q3DA 4C7NB 1RF1B 4C7RA 1S1CX 2YMYA 3E1IA 3HE5A 4OGQC 3K5BA 4HYTB 2Y0DA 1JMMA 3OW2O 1BCCD 4H13B 4AQRD 1OVRA 2PRRA 1LTJB 2KLUA 2POHA 2JWDA 2ZAEB 4HB1A 1OVVA 1USEA 1H0TB 1P84I 1LGHB 3H1LD 3KZIH 1L0NJ 2OYIC 1M1JA 1K73Q 2AEMA 2XKMA 3GW6A 2L5GB 2C9LY 3I56P 2BCCJ 4KT0J 1P84D 4D6TD 5GTHE 4GODA 2UWJE 1HTLC 3CCSP 3HD7B 1KYOE 4EI2A 1Z56A 1VQOP 5GTHH 1IC2A 1URQC 2LXBA 1IK9A 1KYOH 2WPVB 5CCGC 4W80A 1OIPA 5KAFE 3V2PA 1G2CB 3A2AA 1L0LJ 3H1HJ 1SFCA 2WWWA 3V4QA 1VQ5P 3C8VA 3CWBD 2KSJA 2A45I 5B5EH 3GF3A 1CI6A 1FDOA 1AFOA 1N7SD 3OJAB 3TGUE 1X9VA 5CCGD 3CX5E 3D71A 3TGUG 1KB9E 3MUDA 2KNCB 2I1JA 4U3FJ 2QJPB 4WWIA 4PD4I 3HE5B 2XV5A 2WMMA 1BCCJ 1CZQA 2XNXA 1HBWA 2W27A 2W90A 1QL1A 1KILA 1PPJE 1KB9H 5AVRB 1PPJG 1JO5A 1WMKA 1ZOYC 4Y99C 3H1LJ 1QLED 3G4SP 1VF5D 3CXHE 2GA1A 4PD4D 5CHXA 3WUTA 1Q81Q 2H7HA 3H6PA 4RO0A 2OTKE 3VMAA 3WU2E 2P10A 3CXHH 2K9JA 4D6TJ 3S1KA 3PTZA 2D2CC 1ZV8A 5H2FE 2K88A 3L73D 3WU2H 1YJ9P 1R5SA 1QVFO 3I5CA 5H2FH 3SFEC 4UB8E 1T8ZA 3FWLA 1VQ6P 1PGPA 3AE6C 2RH0A 2M3EA 3GHGC 3JSVC 1OWAA 1KV4A 4UB8H 2C9NY 1SFCB 3CWBJ 1YYCA 3QWOC 4LGDE 3HUSA 3MIWA 2E74D 5AW0B 4JYBA 3KXDA 2IYOA 2NZ2A 3M9HA 3RK2C 3L70E 2BEZF 1FZCA 3L70G 2KS1A 1AQTA 3MGNA 2P67A 4L74A 2ZYAA 3O8ZA 2KXPB 2ZT9C 4OWFA 3L74E 1N8RQ 1MZ9A 2J5UA 3FWNA 2XDJA 1LP1A 3L74G 2K9YA 3EQ2A 1KILB 3BASA 2KP8A 2E76B 5APYA 2FFDA 4CPGA 2O01N 1KILE 2SPZA 2WSFH 3RK2D 1GD2E 3TK1A 1PP9D 2OARA 4PJ0E 2V7QJ 1FBMA 5C39A 2OYHA 2Y9ZA 1SQXD 2J58A 2IBZI 3LW5H 4PJ0H 2N1TA 3L73J 1T3JA 1UIIA 3FGAD 4PV1C 1U57A 1M1KQ 1LT9C 1J2JB 3CC7P 1QL2A 2I8DA 3ZDMA 2KI7B 3SWKA 2DW3A 2IBZD 4O9BA 2P1JA 3BCCD 4C46A 3D70A 1S9KD 3H1JJ 1NTMD 3B5NC 3M0DC 1USDA 3GMAA 2YNYA 3Q2YA 3AEAC 1WRGA 4PV1D 1LTSC 1T2KC 4L75A 1FOSF 3R4YA 1VQPP 2N9BA 1NU1J 3L75E 1BGYD 2L91A 4H0LC 3L75G 2R44A 1XTCC 2H43A 3S9OA 1FZCB 2KS1B 1S5LX 3PP5A 3IAOA 3B5ND 2NPSC 3RK3B 5APQA 1GL2C 2ZVNB 1ZMEC 5K5GB 1ZLLA 3RK3E 1AQ5A 1KQSO 1NOHA 1SQVE 2FFDB 1FZFA 1NTZD 2B87A 1SQVG 1PP9J 4WY4C 2WPQA 3MP7B 5AW5B 1CSBA 1YTZT 2IPPA 2OYIA 1J1EB 3L36A 1TU3F 2VRSA 2NPSD 3BRTB 2QE7H 3L71D 2OYHB 1SQXJ 1GL2D 5KLVD 3BRVB 1LTBC 3AE4C 2KZJA 1FC2C 2HODA 1LTTC 2OGUA 1RF0C 2N1TB 1ZR4A 2JR8A 2OQQA 2YIUB 2PFXA 1SQVK 2QM8A 4WY4D 3H25A 1URQA 3B4SA 2A06E 1NVOA 3CI9A 3BCCJ 2IFMA 3KPEA 5CCGA 2JO1A 2G8YA 5CCHA 2YKPA 1NTMJ 1HGVA 2O3JA 2WITA 3N7NA 5KKZB 2E75B 1OFCX 3W68A 5GTIH 2FKWB 2PGDA 1SLQA 2FXPA 1BGYJ 2LR2A 4U3FE 5AW7B 2KK7A 3CCRP 3CLQA 4I7ZC 3BVHA 3NTNA 1BDDA 3H1KD 3CCUP 1K9MQ 4OGQB 3AE9C 3KYQA 1SP4A 3QH9A 1M8OB 1NTZJ 1BE3D 5KJ7C 2P7JA 2OTJP 2ZJSE 2B87B 3HTKA 1JMBA 3G6EP 4NPDA 3L71J 4EOTA 3VMZA 2OYIB 5KLVJ 1P84H 4IL6E 4N78D 2Q3EA 1SQBJ 1E5WA 3AE5C 2E5YA 2ZYGA 2HODB 2QJYC 1L4AC 2RN0A 4IL6H 4DJGA 4R4MA 4EIJA 5APVA 3H32A 1W2BO 3RL0B 1PGJA 3C9IA 2HPCB 2JWAA 1URQB 1DH3A 1EZVI 3KZIE 1YTZI 1N2DC 1VQ8P 1N73C 2FYUE 2M8RA 3GHGA 5AW3B 4EYYQ 2FYUG 2WTYA 1T6AA 2QG4A 3IN6A 3VYIA 1LWUB 2FXOA 4AUWA 1H88A 1L4AD 2H88C 1JOCA 3H1IJ 2NRGA 1PV3A 1HJ0A 3NFQA 1OW8A 2Q7CA 1EZVD 3L37A 4MN4C 3O6QA 2AXTE 1R8EA 2JEEA 2WZ7A 1NTKD 2ZYDA 3H1KJ 3HRNA 2A45H 1KFMA 3VP8A 4GIFA 2FYUK 4YTPC 2ZVOB 1LTAC 2AXTH 3FX0A 1J1DB 3P8CD 4DCKA 1OMIA 2O1JA 1GU5A 3AEFC 4GDOA 1VL2A 3IF4A 1KTMA 1N7SC 1BE3J 1BSNA 3JC22 1YJWP 3TNUA 1YBKA 4Y99B 4BRYA 5B5EE 1RF1C 2JJLA 4L73A 3HTKB 1OX3A 2V7QH 2C0XA 1BSHA 1AVYA 2I1KA 3USSA 2ZXEB 4HH2A 2W6AA 2CK3H 4U7JA 1IFNA 2WSSH 5CJ0A 1LTIC 3L72J 1ZRTE 2D2CB 1X22A 3G71P 5BVZA 1VF5C 3HE4A 1K04A 5APTA 1LT9A 5AW8B 1RE4C 2WSCJ 3H1JE 1SVFA 1GZLA 4H13D 1OW6A 3SFDC 3GHGB 3V4WA 1M56D 3AE1C 3CCVP 1KYOI 3HD7C 3AEEC 3B5NA 1EDLA 3M0DA 3AEGC 1NYHA 1LTGC 3LIEA 2AXCA 2H89C 4NPFX 1NAYA 1M1JB 1KORA 1GMJA 2MJZA 1NTKJ 2K37A 3O6QB 2QJKB 1DD3A 4KHXA 1KYOD 4ZMDA 3JCUE 4W7ZA 4JYCA 3U1CA 3HD7D 4K3AA 2E74C 3V5BA 2KZIA 2NPSA 2YKQA 2ZT9B 4H44B 4I2LC 2YO2A 1GL2A 3AEBC 1K05A 3JCUH 2GUSA 1FDIA 2WSEH 4OVNF 3CX5I 2CPSA 1UIXA 1SS1A 1KB9I 3VMYA 4GOEA 3CL3D 4WY4A 3CCEP 3LIDA 1N7LA 3AEDC 4R4LA 3NMDA 1SQPE 4JF7A 2WPSA 1SQPG 1X8YA 3E7KA 2WQYC 3TGUD 3CX5D 2YKOA 5APXA 1CI6B 1KB9D 3Q5RA 1KQGB 1RF0A 1FE6A 3CXHI 3CC2P 5B66H 1S4XA 1FZBA 1Y47A 1EDKA 1PPJD 2KB7P 2B89A 1FJKA 2QA4P 2OYOA 2QSIA 5CJ4A 2Z5HA 1SQPK 3P32A 3CXHD 1W5CE 2Q5UA 3CMAP 2YMKA 2KSEA 4K35A 1YIJP 1LT1A 2KLVA 3SWFA 3U1AA 5EFWB 1EC5A 3I55P 2HFED 4H0LB 1XTGB 2XU6A 2K9JB 1RE3C 2P58A 2R3SA 1KMIZ 2RKLA 3TSIA 1EDIA 1MFTA 1OVUA 2KUBA 2R3CA 1YI2P 1SQQE 2O01H 1SQQG 4KJMA 5KJ7A 2AEJA 1FZEA 1KQLA 3D6ZA 1S5LH 2FYNC 1SFCD 3L35A 1S3JA 1E79H 3HUSB 3TGUJ 2KOGA 4I1LA 1KILC 3L70D 1PGQA 1JCCA 1JNMA 2E76C 2E42A 2QRXA 2N9YB 4XA4A 2H8PD 1L4AA 1SQQK 3L74D 2IFNA 1IFMA 4L76A 1JCDA 1ZP0C 1DX7A 2JDIH 2QM7A 3H1IE 1KILD 1LP1B 1N73A 1JY2N 3H1IG 3S4RA 5AW9B 1L0NE 1OW7A 1Y8AA 2E76D 5AVZB 3IFMA 1L0NG 1VQ9P 1NHLA 3KQGA 3Q1MA 2BCCE 1GTWA 2BCCG 1JY2O 5TISH 5AVXB 1M7LA 1M57D 1OXZA 4I7ZB 2Q1KA 5APWA 1MKMA 3MD0A 1G1IA 1T3UA 3FXDA 2K1AA 1L0NK 1PGOA 1X79B 3A5TA 1L0LE 3H1HE 1U7MA 3CCLP 1N7SA 1L0LG 3H1HG 3PHLA 1IK7A 2FBWC 1GU4A 5AVVB 2A06G 2PAJA 4C7NA 5GTIE 3P7KA 4YPCA 1FZAA 3L72E 3M9BA 2LKMA 1NH4A 3P8MC 5KLIB 3L72G 3L75D 3L70J 2YXRB
chains in the Genus database with same CATH topology
2LXBA 2B87A 2HR3A 5C39A 2M0BA 2B88A 4NPFX 2K3RA 4NPEA 2QVAA 1BDCA 4K35A 1LP1B 1LT1A 2B87B 5EFWB 1EC5A 4ZMDA 1JMBA 2KZJA 4NPDA 1FC2C 4K3AA 4BXLA 3MZWB 2KZIA 2I8DA 1H0TA 4HKZH 3ZDMA 2KI7B 3QWOC 5CBNA 2P58A 4JBZA 3RGUA 1OVRA 5DJUB 3FXEA 1Q2NA 2RKLA 2JWDA 4HB1A 2ZAEB 1OVVA 4WWIA 1SS1A 1EDIA 1NVOA 1H0TB 2WMMA 1MFTA 1OVUA 4GOEA 4IOIH 2Q1KA 2KUBA 4ZNCA 3FXDA 2LXCB 4KJMA 2R44A 4ASWA 1ZW0A 1U7MA 2M5AA 1DEEG 1LP1A 2KS1B 4EYYQ 2LR2A 1S3JA 1EDJA 5DJTB 4GODA 2OTKE 2UWJE 3MHVA 1ZXGA 4CPGA 2SPZA 1Y47A 1EDKA 1JM0A 1BDDA 4ASVA 2M5AB 5K5GB 3S1KA 2B89A 2QRXA 5CBOA 2KIKA 4MN4C 4GOFA 1EDLA 1X0TA 1U7JA 4HJGH 3PH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXB A;  2B87 A;  2HR3 A;  5C39 A;  2M0B A;  2B88 A;  4NPF X;  2K3R A;  4NPE A;  2QVA A;  1BDC A;  4K35 A;  1LP1 B;  1LT1 A;  2B87 B;  5EFW B;  1EC5 A;  4ZMD A;  1JMB A;  2KZJ A;  4NPD A;  1FC2 C;  4K3A A;  4BXL A;  3MZW B;  2KZI A;  2I8D A;  1H0T A;  4HKZ H;  3ZDM A;  2KI7 B;  3QWO C;  5CBN A;  2P58 A;  4JBZ A;  3RGU A;  1OVR A;  5DJU B;  3FXE A;  1Q2N A;  2RKL A;  2JWD A;  4HB1 A;  2ZAE B;  1OVV A;  4WWI A;  1SS1 A;  1EDI A;  1NVO A;  1H0T B;  2WMM A;  1MFT A;  1OVU A;  4GOE A;  4IOI H;  2Q1K A;  2KUB A;  4ZNC A;  3FXD A;  2LXC B;  4KJM A;  2R44 A;  4ASW A;  1ZW0 A;  1U7M A;  2M5A A;  1DEE G;  1LP1 A;  2KS1 B;  4EYY Q;  2LR2 A;  1S3J A;  1EDJ A;  5DJT B;  4GOD A;  2OTK E;  2UWJ E;  3MHV A;  1ZXG A;  4CPG A;  2SPZ A;  1Y47 A;  1EDK A;  1JM0 A;  1BDD A;  4ASV A;  2M5A B;  5K5G B;  3S1K A;  2B89 A;  2QRX A;  5CBO A;  2KIK A;  4MN4 C;  4GOF A;  1EDL A;  1X0T A;  1U7J A;  4HJG H;  3PH0 A; 
#chains in the Genus database with same CATH topology
 1YJN P;  3PJS K;  1H8A A;  1RQU A;  1HWT C;  4U3F G;  2K3R A;  4I6M C;  1BCC E;  1L0L K;  3GF7 A;  3A0B H;  2QVA A;  2QJY B;  3L74 J;  4NPE A;  1BCC G;  3NXS A;  3R2P A;  1J1E C;  3H1L E;  4AYC A;  2G3A A;  3RK3 D;  1L0N D;  3H1L G;  4BXL A;  2C0W A;  4WBA A;  1SQV D;  2Z4E A;  1N73 B;  1S2E A;  1QEX A;  3LW5 J;  3RGU A;  2PP6 A;  3HD7 A;  2R32 A;  1P84 E;  2CPB A;  1Q90 D;  4D6T E;  3PRJ A;  4D6T G;  3V2N A;  2Y0C A;  4RES B;  4ZKP A;  3G9R A;  2E5T A;  1G2C A;  3GLM A;  1WT6 A;  2E75 C;  2N1T D;  1YHQ P;  3H1H D;  5L8R J;  5AVS B;  1GK4 A;  1QX8 A;  1GK6 A;  3RBX A;  2A06 D;  1ZXG A;  3CWB E;  1N7S B;  1HVV A;  3CWB G;  2Y9Y A;  1LNQ A;  3PH0 A;  5AW4 B;  1HH0 A;  2KNC A;  2HR3 A;  1HF9 A;  2B88 A;  3L75 J;  2E75 D;  4U3F D;  1FOS E;  3IR9 A;  4LLH A;  2AEF A;  5APU A;  2A45 G;  1PFI A;  2JKV A;  4JPZ B;  5AVU B;  1GW3 A;  2IYP A;  1VF5 B;  4IL6 X;  4N3Y B;  1RQV A;  2KYV A;  1IFD A;  3SSU A;  1AJY A;  4OGQ D;  4PD4 E;  2GUV A;  1JTH A;  1SQV J;  3L4F A;  3FXE A;  4EDF A;  4RJT A;  4IOI H;  1JEK A;  4PD4 H;  3E1R A;  2LXC B;  2ITA A;  2O1K A;  4A7P A;  3RL0 C;  3CCQ P;  3L73 E;  1AA0 A;  1DEE G;  3L73 G;  2B9B A;  4H13 C;  1LTJ C;  1MFZ A;  1PZQ A;  1EDJ A;  3EFF K;  5TJH A;  3D6Y A;  5DJT B;  3CD6 P;  1RE3 A;  3MHV A;  5CCH C;  2IZ0 A;  2Q9I A;  3EWK A;  4ZKU A;  1JM0 A;  1LWU C;  3OAK A;  1A02 J;  1NKZ B;  2KIK A;  2E74 B;  1LJ2 A;  4W7Y A;  3VOP A;  1IZN B;  4YXD C;  5KAF H;  3H32 B;  1CW5 A;  3OA7 A;  2FYU D;  3RL0 D;  3H1J G;  3AE2 C;  4N6J A;  1URQ D;  1HUC A;  1VQ4 P;  1GW4 A;  1W2E A;  1NO4 A;  1NU1 E;  5CCH D;  3WMM 0;  4BWN A;  2HYN A;  3M91 A;  1NU1 G;  2WPR A;  1YIT P;  3Q5P A;  1J1D C;  1JB0 J;  3CX5 H;  3VP9 A;  2E43 A;  4HKZ H;  2J59 M;  3PLN A;  2W6B A;  3RK2 B;  1NAF A;  4GKG A;  1Q2N A;  2YXQ B;  2R5D A;  1JY2 P;  1JUN A;  3AE7 C;  4DZO A;  5AVW B;  2W8Z A;  1Y9B A;  4IFM A;  1NU1 K;  1JTH B;  2Q3I A;  1PP9 E;  4DT0 A;  1EXJ A;  1PP9 G;  4DOJ A;  1OZH A;  1ZW0 A;  1VQL P;  2R5B A;  3WUU A;  3WUV A;  3TNU B;  5AW1 B;  4BRY B;  5BU5 A;  1JY3 N;  1SQX E;  3B71 A;  1FDM A;  1NJI Q;  2QJP C;  1SQX G;  5AW2 B;  3AEC C;  1VQN P;  1FU1 A;  3VN0 A;  1QVG O;  3GG2 A;  1ZRT D;  1YQ4 C;  5CBO A;  4GOF A;  5B66 E;  1A02 F;  1JY3 O;  4HJG H;  3UIA A;  1N86 A;  3V2Q A;  2D2C D;  2IBZ E;  2FXM A;  3V6I A;  5APS A;  3H1J D;  3BCC E;  2IBZ G;  3HE4 B;  5KAI E;  1IFI A;  3BCC G;  2M3B A;  4PV1 B;  1S9K E;  1LT9 B;  2FYU J;  3F5H A;  3BAT A;  1NTM E;  1SQX K;  1M1J C;  1NTM G;  2GM4 A;  1NU1 D;  2QJK C;  1KD1 Q;  5KAI H;  1VPC A;  3MZW B;  1D7M A;  1BGY E;  1PIX A;  3EFG A;  1BGY G;  2QEX P;  2FYN B;  3B5N B;  4H44 C;  5KTB A;  5DJU B;  4UB6 E;  2WT7 A;  3MTU E;  4Y28 J;  4ZNC A;  1NTM K;  3TYY A;  4UB6 H;  2FY8 A;  1AVO A;  4M3L A;  1ZN5 A;  3A7O A;  1MUU A;  1SFC C;  3A3Y B;  3CC4 P;  1NTZ E;  2IDB A;  1S72 P;  1NTZ G;  1KQF B;  2ZT9 D;  4H44 D;  2NPS B;  2XZR A;  1S5L E;  4TT3 H;  1GL2 B;  3L71 E;  4ASV A;  3AE8 C;  5KLV E;  2Z5I A;  3Q5S A;  3L71 G;  1SQB E;  1SQP D;  2OTL P;  5KLV G;  3RL0 g;  3MUD C;  1X0T A;  1SQB G;  1VQK P;  4WY4 B;  4WVZ A;  3M06 A;  3CCM P;  1KFN A;  3AE3 C;  1IFP A;  4XFJ A;  1NTZ K;  2JP3 A;  1BDC A;  1KN7 A;  2ZFC A;  1FS0 E;  4YXW H;  2P2U A;  3N4X A;  2WVR A;  2BAS A;  3RBZ A;  5KLV K;  5AVT B;  1PL5 A;  1SQB K;  1DIP A;  2RMZ A;  4JBZ A;  2ZXX A;  3A0H E;  1FAV A;  1R5L A;  5TIS E;  5BU8 B;  2IZ1 A;  4Z1M H;  3G3Z A;  4IFF A;  3VMX A;  1L2P A;  3A0H H;  2XND H;  4QMA A;  3H1K E;  1DD4 A;  1T2K D;  3H1K G;  1NKN A;  1HGZ A;  2WT7 B;  5E79 E;  4ASW A;  2M5A A;  2WSE J;  4H0L D;  3C1L A;  2MKV A;  2W6J H;  3M0A A;  1HJB A;  1G1J A;  3T97 A;  1DEB A;  3CCJ P;  1BE3 E;  5E79 H;  1KZU B;  4TLF A;  4IFD K;  1BE3 G;  1RHZ B;  3HUS C;  4GT1 A;  2HLO A;  1SQQ D;  2IX7 C;  3KDP B;  2FYZ A;  3U59 A;  2W83 C;  1Q7Y Q;  2Y0E A;  1U7J A;  1SQB D;  5CMZ A;  1QGK B;  4LC1 A;  4N78 E;  4OH8 B;  1SQP J;  2Q6Q A;  1MV8 A;  1FZC C;  5AW6 B;  1RF1 A;  4WB4 A;  2HG5 D;  1ZR2 A;  1VDF A;  3RK3 C;  1GDT A;  4JQ0 D;  2HPC A;  3A0B E;  3KHU A;  1LTJ A;  4B86 A;  1H0T A;  5CBN A;  2FFD C;  3VTP C;  1LWU A;  2WSF J;  1L4A B;  5M1B A;  4RKU J;  4XE5 B;  2WSC H;  2QIW A;  1RE4 A;  3CPW O;  3H1I D;  1RH5 B;  1RY3 A;  1VQM P;  2YO3 A;  3SWY A;  1IFJ A;  2OYH C;  1Q86 Q;  1EZV E;  3CME P;  2BCC D;  1NGM B;  1M90 Q;  1EZV G;  1YQ3 C;  2N1T C;  3W67 A;  3ITK A;  2BEQ D;  3V2R A;  1NTK E;  1KC8 Q;  1K8A Q;  2YIU C;  1NTK G;  1NWQ A;  3F89 A;  3ABV C;  3TDK A;  1IJD B;  1H89 A;  1FZG A;  3P8C E;  2O01 J;  1AV1 A;  1Q82 Q;  1EQ7 A;  2M5A B;  2V4H A;  1EXI A;  3T97 B;  5AVY B;  5KKZ C;  5KLI C;  1SQQ J;  1L0L D;  1VQ7 P;  2M0B A;  1FJP A;  1JY3 P;  3M9Q A;  1IO4 A;  1NTK K;  5AVQ B;  3TF5 A;  3II6 A;  3L72 D;  5KJ7 D;  3B8E B;  3Q3D A;  4C7N B;  1RF1 B;  4C7R A;  1S1C X;  2YMY A;  3E1I A;  3HE5 A;  4OGQ C;  3K5B A;  4HYT B;  2Y0D A;  1JMM A;  3OW2 O;  1BCC D;  4H13 B;  4AQR D;  1OVR A;  2PRR A;  1LTJ B;  2KLU A;  2POH A;  2JWD A;  2ZAE B;  4HB1 A;  1OVV A;  1USE A;  1H0T B;  1P84 I;  1LGH B;  3H1L D;  3KZI H;  1L0N J;  2OYI C;  1M1J A;  1K73 Q;  2AEM A;  2XKM A;  3GW6 A;  2L5G B;  2C9L Y;  3I56 P;  2BCC J;  4KT0 J;  1P84 D;  4D6T D;  5GTH E;  4GOD A;  2UWJ E;  1HTL C;  3CCS P;  3HD7 B;  1KYO E;  4EI2 A;  1Z56 A;  1VQO P;  5GTH H;  1IC2 A;  1URQ C;  2LXB A;  1IK9 A;  1KYO H;  2WPV B;  5CCG C;  4W80 A;  1OIP A;  5KAF E;  3V2P A;  1G2C B;  3A2A A;  1L0L J;  3H1H J;  1SFC A;  2WWW A;  3V4Q A;  1VQ5 P;  3C8V A;  3CWB D;  2KSJ A;  2A45 I;  5B5E H;  3GF3 A;  1CI6 A;  1FDO A;  1AFO A;  1N7S D;  3OJA B;  3TGU E;  1X9V A;  5CCG D;  3CX5 E;  3D71 A;  3TGU G;  1KB9 E;  3MUD A;  2KNC B;  2I1J A;  4U3F J;  2QJP B;  4WWI A;  4PD4 I;  3HE5 B;  2XV5 A;  2WMM A;  1BCC J;  1CZQ A;  2XNX A;  1HBW A;  2W27 A;  2W90 A;  1QL1 A;  1KIL A;  1PPJ E;  1KB9 H;  5AVR B;  1PPJ G;  1JO5 A;  1WMK A;  1ZOY C;  4Y99 C;  3H1L J;  1QLE D;  3G4S P;  1VF5 D;  3CXH E;  2GA1 A;  4PD4 D;  5CHX A;  3WUT A;  1Q81 Q;  2H7H A;  3H6P A;  4RO0 A;  2OTK E;  3VMA A;  3WU2 E;  2P10 A;  3CXH H;  2K9J A;  4D6T J;  3S1K A;  3PTZ A;  2D2C C;  1ZV8 A;  5H2F E;  2K88 A;  3L73 D;  3WU2 H;  1YJ9 P;  1R5S A;  1QVF O;  3I5C A;  5H2F H;  3SFE C;  4UB8 E;  1T8Z A;  3FWL A;  1VQ6 P;  1PGP A;  3AE6 C;  2RH0 A;  2M3E A;  3GHG C;  3JSV C;  1OWA A;  1KV4 A;  4UB8 H;  2C9N Y;  1SFC B;  3CWB J;  1YYC A;  3QWO C;  4LGD E;  3HUS A;  3MIW A;  2E74 D;  5AW0 B;  4JYB A;  3KXD A;  2IYO A;  2NZ2 A;  3M9H A;  3RK2 C;  3L70 E;  2BEZ F;  1FZC A;  3L70 G;  2KS1 A;  1AQT A;  3MGN A;  2P67 A;  4L74 A;  2ZYA A;  3O8Z A;  2KXP B;  2ZT9 C;  4OWF A;  3L74 E;  1N8R Q;  1MZ9 A;  2J5U A;  3FWN A;  2XDJ A;  1LP1 A;  3L74 G;  2K9Y A;  3EQ2 A;  1KIL B;  3BAS A;  2KP8 A;  2E76 B;  5APY A;  2FFD A;  4CPG A;  2O01 N;  1KIL E;  2SPZ A;  2WSF H;  3RK2 D;  1GD2 E;  3TK1 A;  1PP9 D;  2OAR A;  4PJ0 E;  2V7Q J;  1FBM A;  5C39 A;  2OYH A;  2Y9Z A;  1SQX D;  2J58 A;  2IBZ I;  3LW5 H;  4PJ0 H;  2N1T A;  3L73 J;  1T3J A;  1UII A;  3FGA D;  4PV1 C;  1U57 A;  1M1K Q;  1LT9 C;  1J2J B;  3CC7 P;  1QL2 A;  2I8D A;  3ZDM A;  2KI7 B;  3SWK A;  2DW3 A;  2IBZ D;  4O9B A;  2P1J A;  3BCC D;  4C46 A;  3D70 A;  1S9K D;  3H1J J;  1NTM D;  3B5N C;  3M0D C;  1USD A;  3GMA A;  2YNY A;  3Q2Y A;  3AEA C;  1WRG A;  4PV1 D;  1LTS C;  1T2K C;  4L75 A;  1FOS F;  3R4Y A;  1VQP P;  2N9B A;  1NU1 J;  3L75 E;  1BGY D;  2L91 A;  4H0L C;  3L75 G;  2R44 A;  1XTC C;  2H43 A;  3S9O A;  1FZC B;  2KS1 B;  1S5L X;  3PP5 A;  3IAO A;  3B5N D;  2NPS C;  3RK3 B;  5APQ A;  1GL2 C;  2ZVN B;  1ZME C;  5K5G B;  1ZLL A;  3RK3 E;  1AQ5 A;  1KQS O;  1NOH A;  1SQV E;  2FFD B;  1FZF A;  1NTZ D;  2B87 A;  1SQV G;  1PP9 J;  4WY4 C;  2WPQ A;  3MP7 B;  5AW5 B;  1CSB A;  1YTZ T;  2IPP A;  2OYI A;  1J1E B;  3L36 A;  1TU3 F;  2VRS A;  2NPS D;  3BRT B;  2QE7 H;  3L71 D;  2OYH B;  1SQX J;  1GL2 D;  5KLV D;  3BRV B;  1LTB C;  3AE4 C;  2KZJ A;  1FC2 C;  2HOD A;  1LTT C;  2OGU A;  1RF0 C;  2N1T B;  1ZR4 A;  2JR8 A;  2OQQ A;  2YIU B;  2PFX A;  1SQV K;  2QM8 A;  4WY4 D;  3H25 A;  1URQ A;  3B4S A;  2A06 E;  1NVO A;  3CI9 A;  3BCC J;  2IFM A;  3KPE A;  5CCG A;  2JO1 A;  2G8Y A;  5CCH A;  2YKP A;  1NTM J;  1HGV A;  2O3J A;  2WIT A;  3N7N A;  5KKZ B;  2E75 B;  1OFC X;  3W68 A;  5GTI H;  2FKW B;  2PGD A;  1SLQ A;  2FXP A;  1BGY J;  2LR2 A;  4U3F E;  5AW7 B;  2KK7 A;  3CCR P;  3CLQ A;  4I7Z C;  3BVH A;  3NTN A;  1BDD A;  3H1K D;  3CCU P;  1K9M Q;  4OGQ B;  3AE9 C;  3KYQ A;  1SP4 A;  3QH9 A;  1M8O B;  1NTZ J;  1BE3 D;  5KJ7 C;  2P7J A;  2OTJ P;  2ZJS E;  2B87 B;  3HTK A;  1JMB A;  3G6E P;  4NPD A;  3L71 J;  4EOT A;  3VMZ A;  2OYI B;  5KLV J;  1P84 H;  4IL6 E;  4N78 D;  2Q3E A;  1SQB J;  1E5W A;  3AE5 C;  2E5Y A;  2ZYG A;  2HOD B;  2QJY C;  1L4A C;  2RN0 A;  4IL6 H;  4DJG A;  4R4M A;  4EIJ A;  5APV A;  3H32 A;  1W2B O;  3RL0 B;  1PGJ A;  3C9I A;  2HPC B;  2JWA A;  1URQ B;  1DH3 A;  1EZV I;  3KZI E;  1YTZ I;  1N2D C;  1VQ8 P;  1N73 C;  2FYU E;  2M8R A;  3GHG A;  5AW3 B;  4EYY Q;  2FYU G;  2WTY A;  1T6A A;  2QG4 A;  3IN6 A;  3VYI A;  1LWU B;  2FXO A;  4AUW A;  1H88 A;  1L4A D;  2H88 C;  1JOC A;  3H1I J;  2NRG A;  1PV3 A;  1HJ0 A;  3NFQ A;  1OW8 A;  2Q7C A;  1EZV D;  3L37 A;  4MN4 C;  3O6Q A;  2AXT E;  1R8E A;  2JEE A;  2WZ7 A;  1NTK D;  2ZYD A;  3H1K J;  3HRN A;  2A45 H;  1KFM A;  3VP8 A;  4GIF A;  2FYU K;  4YTP C;  2ZVO B;  1LTA C;  2AXT H;  3FX0 A;  1J1D B;  3P8C D;  4DCK A;  1OMI A;  2O1J A;  1GU5 A;  3AEF C;  4GDO A;  1VL2 A;  3IF4 A;  1KTM A;  1N7S C;  1BE3 J;  1BSN A;  3JC2 2;  1YJW P;  3TNU A;  1YBK A;  4Y99 B;  4BRY A;  5B5E E;  1RF1 C;  2JJL A;  4L73 A;  3HTK B;  1OX3 A;  2V7Q H;  2C0X A;  1BSH A;  1AVY A;  2I1K A;  3USS A;  2ZXE B;  4HH2 A;  2W6A A;  2CK3 H;  4U7J A;  1IFN A;  2WSS H;  5CJ0 A;  1LTI C;  3L72 J;  1ZRT E;  2D2C B;  1X22 A;  3G71 P;  5BVZ A;  1VF5 C;  3HE4 A;  1K04 A;  5APT A;  1LT9 A;  5AW8 B;  1RE4 C;  2WSC J;  3H1J E;  1SVF A;  1GZL A;  4H13 D;  1OW6 A;  3SFD C;  3GHG B;  3V4W A;  1M56 D;  3AE1 C;  3CCV P;  1KYO I;  3HD7 C;  3AEE C;  3B5N A;  1EDL A;  3M0D A;  3AEG C;  1NYH A;  1LTG C;  3LIE A;  2AXC A;  2H89 C;  4NPF X;  1NAY A;  1M1J B;  1KOR A;  1GMJ A;  2MJZ A;  1NTK J;  2K37 A;  3O6Q B;  2QJK B;  1DD3 A;  4KHX A;  1KYO D;  4ZMD A;  3JCU E;  4W7Z A;  4JYC A;  3U1C A;  3HD7 D;  4K3A A;  2E74 C;  3V5B A;  2KZI A;  2NPS A;  2YKQ A;  2ZT9 B;  4H44 B;  4I2L C;  2YO2 A;  1GL2 A;  3AEB C;  1K05 A;  3JCU H;  2GUS A;  1FDI A;  2WSE H;  4OVN F;  3CX5 I;  2CPS A;  1UIX A;  1SS1 A;  1KB9 I;  3VMY A;  4GOE A;  3CL3 D;  4WY4 A;  3CCE P;  3LID A;  1N7L A;  3AED C;  4R4L A;  3NMD A;  1SQP E;  4JF7 A;  2WPS A;  1SQP G;  1X8Y A;  3E7K A;  2WQY C;  3TGU D;  3CX5 D;  2YKO A;  5APX A;  1CI6 B;  1KB9 D;  3Q5R A;  1KQG B;  1RF0 A;  1FE6 A;  3CXH I;  3CC2 P;  5B66 H;  1S4X A;  1FZB A;  1Y47 A;  1EDK A;  1PPJ D;  2KB7 P;  2B89 A;  1FJK A;  2QA4 P;  2OYO A;  2QSI A;  5CJ4 A;  2Z5H A;  1SQP K;  3P32 A;  3CXH D;  1W5C E;  2Q5U A;  3CMA P;  2YMK A;  2KSE A;  4K35 A;  1YIJ P;  1LT1 A;  2KLV A;  3SWF A;  3U1A A;  5EFW B;  1EC5 A;  3I55 P;  2HFE D;  4H0L B;  1XTG B;  2XU6 A;  2K9J B;  1RE3 C;  2P58 A;  2R3S A;  1KMI Z;  2RKL A;  3TSI A;  1EDI A;  1MFT A;  1OVU A;  2KUB A;  2R3C A;  1YI2 P;  1SQQ E;  2O01 H;  1SQQ G;  4KJM A;  5KJ7 A;  2AEJ A;  1FZE A;  1KQL A;  3D6Z A;  1S5L H;  2FYN C;  1SFC D;  3L35 A;  1S3J A;  1E79 H;  3HUS B;  3TGU J;  2KOG A;  4I1L A;  1KIL C;  3L70 D;  1PGQ A;  1JCC A;  1JNM A;  2E76 C;  2E42 A;  2QRX A;  2N9Y B;  4XA4 A;  2H8P D;  1L4A A;  1SQQ K;  3L74 D;  2IFN A;  1IFM A;  4L76 A;  1JCD A;  1ZP0 C;  1DX7 A;  2JDI H;  2QM7 A;  3H1I E;  1KIL D;  1LP1 B;  1N73 A;  1JY2 N;  3H1I G;  3S4R A;  5AW9 B;  1L0N E;  1OW7 A;  1Y8A A;  2E76 D;  5AVZ B;  3IFM A;  1L0N G;  1VQ9 P;  1NHL A;  3KQG A;  3Q1M A;  2BCC E;  1GTW A;  2BCC G;  1JY2 O;  5TIS H;  5AVX B;  1M7L A;  1M57 D;  1OXZ A;  4I7Z B;  2Q1K A;  5APW A;  1MKM A;  3MD0 A;  1G1I A;  1T3U A;  3FXD A;  2K1A A;  1L0N K;  1PGO A;  1X79 B;  3A5T A;  1L0L E;  3H1H E;  1U7M A;  3CCL P;  1N7S A;  1L0L G;  3H1H G;  3PHL A;  1IK7 A;  2FBW C;  1GU4 A;  5AVV B;  2A06 G;  2PAJ A;  4C7N A;  5GTI E;  3P7K A;  4YPC A;  1FZA A;  3L72 E;  3M9B A;  2LKM A;  1NH4 A;  3P8M C;  5KLI B;  3L72 G;  3L75 D;  3L70 J;  2YXR B; 
#chains in the Genus database with same CATH homology
 2LXB A;  2B87 A;  2HR3 A;  5C39 A;  2M0B A;  2B88 A;  4NPF X;  2K3R A;  4NPE A;  2QVA A;  1BDC A;  4K35 A;  1LP1 B;  1LT1 A;  2B87 B;  5EFW B;  1EC5 A;  4ZMD A;  1JMB A;  2KZJ A;  4NPD A;  1FC2 C;  4K3A A;  4BXL A;  3MZW B;  2KZI A;  2I8D A;  1H0T A;  4HKZ H;  3ZDM A;  2KI7 B;  3QWO C;  5CBN A;  2P58 A;  4JBZ A;  3RGU A;  1OVR A;  5DJU B;  3FXE A;  1Q2N A;  2RKL A;  2JWD A;  4HB1 A;  2ZAE B;  1OVV A;  4WWI A;  1SS1 A;  1EDI A;  1NVO A;  1H0T B;  2WMM A;  1MFT A;  1OVU A;  4GOE A;  4IOI H;  2Q1K A;  2KUB A;  4ZNC A;  3FXD A;  2LXC B;  4KJM A;  2R44 A;  4ASW A;  1ZW0 A;  1U7M A;  2M5A A;  1DEE G;  1LP1 A;  2KS1 B;  4EYY Q;  2LR2 A;  1S3J A;  1EDJ A;  5DJT B;  4GOD A;  2OTK E;  2UWJ E;  3MHV A;  1ZXG A;  4CPG A;  2SPZ A;  1Y47 A;  1EDK A;  1JM0 A;  1BDD A;  4ASV A;  2M5A B;  5K5G B;  3S1K A;  2B89 A;  2QRX A;  5CBO A;  2KIK A;  4MN4 C;  4GOF A;  1EDL A;  1X0T A;  1U7J A;  4HJG H;  3PH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...