2JWDA

Protein a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
DVDNKFNKEQQNAFWEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein A
publication title Polyglutamine length-dependent midfolding is confined to the Poly-Q region
rcsb
source organism Staphylococcus aureus
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2jwdA00
1BDCA 1H0TA 1DEEG 2SPZA 1LP1B 1FC2C 4GODA 5CBOA 2KIKA 4NPEA 5EFWB 2I8DA 4IOIH 1BDDA 4EYYQ 2B88A 2UWJE 2JWDA 3MHVA 3RGUA 1OVRA 2B87B 4NPFX 5DJTB 2M5AA 1OVVA 4BXLA 3S1KA 2ZAEB 2HR3A 2LXCB 4GOEA 1LT1A 1Q2NA 1SS1A 4CPGA 1EDIA 2R44A 1U7MA 3ZDMA 1LP1A 4HJGH 1U7JA 2KI7B 2LR2A 4MN4C 2LXBA 4K3AA 2QVAA 1EDKA 2M0BA 1EDJA 4HB1A 1JMBA 4K35A 2B89A 3PH0A 4KJMA 1H0TB 2KZJA 4NPDA 4ASVA 2Q1KA 4HKZH 2B87A 1EC5A 1MFTA 5K5GB 4ZMDA 1Y47A 5C39A 1JM0A 1S3JA 2KZIA 4WWIA 2KS1B 2KUBA 3FXDA 3FXEA 2QRXA 1ZW0A 1EDLA 1X0TA 4GOFA 4JBZA 4ASWA 1OVUA 2M5AB 1NVOA 1ZXGA 5DJUB 2P58A 3QWOC 2OTKE 2K3RA 3MZWB 5CBNA 4ZNCA 2RKLA 2WMMA
chains in the Genus database with same CATH superfamily
1HJBA 3T97A 3B5NA 3CC4P 1KN7A 1KQGB 1L0LD 3H1JD 3GHGC 1WMKA 3V4QA 3L72J 4EYYQ 2GUSA 1N73A 1KILD 2KXPB 2Q6QA 1RE3A 4XE5B 5DJTB 3CCRP 2Z5HA 3L73D 1G1IA 4Y99C 3L70D 2K88A 3G6EP 1EZVD 3HD7B 1LT1A 4M3LA 1SFCA 1NU1J 1AA0A 3EQ2A 1PP9E 1LT9C 2R5BA 1URQD 3MP7B 1T6AA 1FOSE 3IN6A 3FWNA 1QGKB 3AECC 4JQ0D 5AW8B 1H0TB 3C8VA 2YKQA 2YMKA 1MV8A 3CCSP 1VQ4P 1PPJG 1NU1K 3W68A 3Q1MA 1JY3P 1YI2P 1BCCD 2WSFH 1SQVG 1FJPA 5CJ0A 1USEA 2M5AB 1SQBE 3P8CE 3CD6P 3T97B 2OTLP 2FXOA 3B5NB 1FZAA 2OTKE 2FY8A 3L72D 1N73B 3I55P 1KV4A 2FFDC 3BCCD 1HTLC 1KILC 1AJYA 3ITKA 3Q5SA 3AE5C 4L73A 1IFNA 1ZP0C 1SFCB 2YO2A 1NU1D 1LWUC 1KFNA 3PP5A 1M56D 1Y9BA 1L2PA 1NKZB 2Y0DA 1NTMJ 2FYZA 1Q81Q 4R4MA 1VF5B 1J2JB 1PP9G 3OJAB 2KK7A 5B66E 1M1JA 1EDJA 1YBKA 4WY4D 2KZJA 1USDA 3VMZA 4ASVA 3OAKA 3SWFA 3EFGA 2I1KA 5AW6B 1JNMA 1KB9D 3N7NA 3NTNA 1N7SD 2H7HA 1X0TA 2XKMA 1FJKA 1L0NE 1SP4A 1CI6B 1RE4C 5BU8B 1SQPJ 2QIWA 1SQBG 4JYCA 2PFXA 3PHLA 4ZNCA 1EQ7A 3O6QA 2P67A 1BGYJ 2CPBA 1NTKJ 2R3SA 2WTYA 2WSCJ 1FZCC 3P32A 3MTUE 1OIPA 1GD2E 4BRYA 2A06E 4D6TJ 3M0DA 1ZR2A 1YYCA 1LTTC 1K04A 1OX3A 4NPFX 2D2CB 3KQGA 3V2PA 1FE6A 3B4SA 3S1KA 2K37A 1KB9H 1BGYE 1S4XA 1NTKK 3HE5A 1RF0A 2ZAEB 2LXCB 3KZIH 1M1JB 2O01H 1SS1A 1NTZE 3PLNA 2YMYA 1FDIA 2KI7B 4WY4C 4YPCA 2IBZE 2O1KA 1LTJA 2WZ7A 3AE3C 1P84I 4K35A 3PH0A 3CX5E 5B5EE 3GMAA 4NPDA 5AVUB 3D71A 1YIJP 4GKGA 1JOCA 1EXIA 2JO1A 3CCVP 2Y9YA 1N7SC 5H2FH 3AE6C 4UB8E 3CCMP 2QRXA 1NGMB 2FYUJ 3A0HH 1RF1A 2QJPC 1NJIQ 3QH9A 1NTKD 1QL2A 2Q3EA 3NFQA 3VP8A 3H1IJ 2P58A 3GF3A 3O8ZA 3L75D 2HYNA 5CJ4A 2RKLA 4H44D 4D6TD 1S9KD 2QSIA 4IL6E 5EFWB 2N1TB 3V2RA 4PJ0H 3HE4A 1JY2P 1PZQA 1N2DC 3SFDC 2OYIC 2G8YA 2A06G 1E5WA 3WU2H 2E76D 3A7OA 4OGQB 1SQXE 4BXLA 3CI9A 4C46A 1LTJB 2AEFA 3PRJA 3CC7P 4CPGA 3H1HJ 4PD4D 3RBXA 2WSCH 2H89C 4MN4C 1NTZG 1HGZA 1OW6A 2QA4P 3LW5J 1X22A 3CXHE 3H1KD 2NPSD 2JWAA 1UIXA 2ZYDA 1JY2O 2FXMA 1GK4A 1PFIA 2BEQD 5APQA 2NRGA 2WT7A 1ZRTE 5KLVE 1RF1B 3L71D 1T2KD 1K8AQ 3FXEA 3H1ID 4H13C 1LTGC 1IFMA 4C7NA 2QJKC 3G9RA 2WWWA 3S9OA 3BVHA 1CW5A 2KS1A 4H44C 3AEEC 2L91A 4PD4H 1BDCA 4U3FE 1LP1B 3RK2D 1DD3A 2Y0EA 1SVFA 5L8RJ 2I8DA 4N3YB 5KAIE 1KTMA 2E76C 2UWJE 3MHVA 3TK1A 2YIUC 2ZYAA 1JCDA 2IYPA 3I5CA 1VQKP 3H1HD 5AW0B 1H88A 3MUDC 3G3ZA 3H1LE 4I2LC 1JEKA 1SQXG 3WUUA 1HJ0A 1VPCA 4PV1B 2NPSC 1AQ5A 1GMJA 5KKZC 2YNYA 3KPEA 1JMBA 1KFMA 2XNDH 1T2KC 4I7ZC 1JY2N 1YTZT 1VQLP 4Y99B 2KS1B 3HD7A 4IL6X 1L0LE 3SWYA 2WSSH 3V4WA 1NKNA 3H1JE 2AXCA 4RO0A 5AW5B 1URQA 1X9VA 3RK2C 3UIAA 1X79B 3AEDC 4GDOA 3NMDA 3A2AA 3L73E 4JYBA 4U7JA 1H0TA 3L70E 1YQ3C 1SQQG 3TGUG 4N78D 1H89A 1N8RQ 3II6A 2GA1A 3AEGC 2KOGA 5CCGA 3VN0A 3AE4C 2XV5A 1KQLA 4WB4A 2WITA 1CSBA 5APVA 2M5AA 3B8EB 1K05A 2Q7CA 3BRTB 4OVNF 3JC22 4GOEA 4OWFA 3RL0C 1YJ9P 3A0BE 5APWA 3R4YA 1U7JA 5TISH 2J5UA 2XNXA 4QMAA 3BCCJ 3GLMA 1BCCE 4IFDK 2AXTH 2FFDB 1KILB 3JCUE 1KMIZ 3H25A 3CC2P 5AVTB 5AVWB 1IO4A 3EWKA 1M57D 1PPJD 3IR9A 4A7PA 2ZXEB 3P8MC 3L72E 1LTSC 1J1DC 1BE3G 2KZIA 2E42A 2JDIH 2K9JB 1URQB 2KYVA 3KXDA 5AVYB 3CWBG 3E1IA 3QWOC 3L74G 3CX5I 1PL5A 3V2QA 1NU1E 1JUNA 2OYHC 1GL2D 1W2BO 2P1JA 2W6AA 3L70G 4ZKUA 1L4AC 1BSNA 3C9IA 1FZEA 2RMZA 1PGJA 2P10A 3L36A 3B71A 1X8YA 2B87B 3IF4A 1SLQA 2HPCB 2O01J 4UB6H 1LGHB 2M8RA 1CI6A 2BASA 2YKPA 2HODB 3C1LA 1VQ9P 3U59A 3WUTA 2HLOA 3TSIA 1U7MA 1PP9D 1KYOI 1G2CA 3SFEC 2JEEA 1YTZI 3KZIE 4KJMA 2ZVOB 2BEZF 1SFCD 4DJGA 5KJ7D 5CCHA 2FYNC 1JM0A 4L74A 5APUA 3D70A 3BASA 2E74D 1JB0J 3P8CD 3CXHI 5CHXA 1FDOA 1HVVA 5H2FE 4WY4B 3TYYA 1GL2C 2E75D 3E1RA 1JTHA 3AE7C 1M8OB 1NTME 1VQPP 2IPPA 3MGNA 3Q5RA 4GODA 2Y9ZA 3CMEP 4BWNA 5BU5A 1N7SB 4RJTA 2B88A 4W7ZA 3WMM0 1NHLA 3I56P 1N73C 2Z4EA 2QJPB 1YITP 1G2CB 4C7RA 2A45I 3L75J 3G71P 4H0LD 2FBWC 1EDIA 3WU2E 4R4LA 2YXRB 1SQPE 2BCCJ 1CZQA 5KAFH 2N1TA 3VMAA 3VYIA 5GTHH 1SFCC 5KJ7C 1S5LE 2YO3A 1NTKE 2JP3A 2W6BA 1EC5A 2OYIB 2KLUA 1S3JA 2ZT9D 4D6TE 1S9KE 1EXJA 3FXDA 1PGPA 2E74C 1JTHB 1R8EA 3N4XA 1S72P 1U57A 4JBZA 2PRRA 2E75C 1R5SA 5DJUB 3H1KJ 3CCUP 3MZWB 2IFMA 1NTMG 1IC2A 1FZFA 1J1EC 2E5TA 3L71J 3F5HA 4EIJA 4H13D 4PD4E 1VQNP 3CLQA 2A06D 1L0NG 3H32B 1OVRA 1VDFA 1DIPA 3HUSC 4IFMA 1FBMA 2VRSA 1FDMA 4H0LC 2QJKB 1PIXA 3RK3D 5AVQB 2MJZA 2HR3A 2BCCD 2W27A 2C0WA 1IFJA 1Q2NA 4DCKA 5AVVB 2FYUE 2W8ZA 1LP1A 4YXWH 3MD0A 2ITAA 3H1IE 2JKVA 4W7YA 2D2CC 1SQPG 1AV1A 2B89A 2ZYGA 1OXZA 4Y28J 3D6YA 1E79H 1GTWA 1Q86Q 1BGYG 2JR8A 2YIUB 1MFTA 2OYOA 1NTKG 2ZT9C 1YJWP 1M1JC 1H8AA 2E5YA 4ZMDA 2GUVA 1ZR4A 1NYHA 1KORA 1SQXK 3BRVB 3VP9A 2IBZG 2NPSB 1M90Q 2PAJA 2QJYB 2C9NY 3GHGA 1YHQP 3H1HE 1XTCC 1K73Q 1D7MA 1FC2C 5CBOA 2C0XA 3BATA 2KIKA 1KYOD 2PP6A 3H6PA 2Z5IA 1SQQJ 3TGUJ 1NAFA 5AVXB 4I7ZB 2Q3IA 3RK3C 1HGVA 5GTIE 1S5LX 2YXQB 5AVSB 1SQXD 1LT9A 2OARA 4B86A 3M0DC 5BVZA 3RBZA 1VL2A 2W90A 3GW6A 3VMYA 5CMZA 1SQQK 3ZDMA 2FYUG 1YJNP 5KTBA 2XZRA 1LNQA 4K3AA 1PGQA 3F89A 4HB1A 3H1IG 4RESB 4EDFA 3HRNA 4I6MC 2OYHA 2HG5D 1QLED 3CCJP 1KYOH 3VMXA 1LTJC 5TISE 2AXTE 4W80A 3ABVC 4I1LA 5AW1B 3RL0D 1IK7A 4TLFA 3GHGB 1IJDB 1ZOYC 4ASWA 1OVUA 2O01N 2J58A 1NVOA 2POHA 3M9HA 3PTZA 2R3CA 1TU3F 2K3RA 2FFDA 1KILA 1RF1C 1VQ7P 1SQQD 3TGUD 3M9QA 5KLVG 2IDBA 3L74J 5E79H 4ZKPA 2R5DA 2KSJA 2MKVA 4IOIH 1DEBA 1NH4A 2AEMA 1LT9B 1SQVJ 1LWUA 1RQVA 1KILE 1J1DB 2K9JA 1OVVA 1ZLLA 2A45G 4JPZB 1EZVE 4WBAA 4U3FG 4LGDE 1PPJE 3L4FA 2R32A 4XA4A 1L4AD 1P84D 2OYHB 1SQVK 1QVFO 1Q7YQ 3Q3DA 1HUCA 5KLIC 2QVAA 2M0BA 1GL2A 2FKWB 1WT6A 1VQ5P 3VOPA 2ZXXA 3FX0A 1Y8AA 3KDPB 5TJHA 2B87A 3H1LG 1A02F 1OFCX 2HPCA 4HH2A 1BE3D 1MKMA 3M91A 4PV1C 2HODA 1FAVA 3SSUA 1RE4A 2KUBA 2V7QH 5AW2B 4KHXA 3AEFC 3CWBD 1PP9J 1OW8A 1LTBC 3SWKA 2W83C 3L74D 1FZCA 2GM4A 1A02J 2H43A 3AE9C 3HD7D 5AVZB 1P84H 1KQSO 3M06A 1RH5B 1LWUB 2QG4A 4HYTB 1SQVD 4L76A 1LJ2A 3BCCE 1JMMA 1IFPA 4DT0A 1L0LG 1MZ9A 3RL0g 3G4SP 2IBZI 2WPSA 3V5BA 3H1JG 2FYNB 5KJ7A 1FU1A 3M0AA 5APSA 1YQ4C 2H8PD 2RN0A 2QM7A 1SQBJ 3L37A 4AYCA 5CCGD 1T3JA 3L73G 4WY4A 1EZVG 1PGOA 2ZJSE 1GL2B 2R44A 2WQYC 2M3BA 4HJGH 3KHUA 4PD4I 2O1JA 2NZ2A 2CPSA 3B5ND 1N7SA 1SQBK 4OH8B 3OW2O 1GU4A 3OA7A 5KAFE 2WPVB 5GTHE 3AEBC 2V4HA 4WWIA 1FZCB 1KB9E 3CCQP 1EDLA 3HUSA 1BCCG 3HD7C 1JY3O 4LLHA 3D6ZA 2E43A 1HH0A 5AW4B 3V6IA 1N86A 3A0BH 1VQOP 2WMMA 1PV3A 3L72G 3Q5PA 3Q2YA 2OYIA 2IX7C 2IFNA 1URQC 1VF5D 1M7LA 4Z1MH 3JCUH 1SQBD 2AEJA 3BCCG 3FGAD 3RGUA 3W67A 2E74B 5CCGC 1L0NJ 1OW7A 2KB7P 3A0HE 2E75B 1HF9A 1DH3A 1NU1G 3IAOA 5AW3B 2CK3H 1ZMEC 1OWAA 1KQFB 2WVRA 1GZLA 1NTMK 1HBWA 3B5NC 3LIEA 2L5GB 2K9YA 2LXBA 1J1EB 3AE8C 1L0NK 4PJ0E 2I1JA 1VQ8P 3H32A 1RE3C 4HKZH 1GDTA 3HUSB 2KSEA 1GW3A 1IZNB 1Y47A 3NXSA 4H0LB 4KT0J 3A5TA 2IZ1A 2IZ0A 3U1CA 1ZW0A 4YXDC 2ZVNB 4GOFA 1NTZJ 1K9MQ 3WUVA 2XDJA 5CCHD 2D2CD 5M1BA 1QL1A 3PJSK 4DOJA 1SQPK 3L75E 1N7LA 2N9BA 1GK6A 1AQTA 1NTMD 1KC8Q 1GU5A 1VF5C 3RK3E 3TNUA 1JY3N 1VQMP 1KD1Q 2BCCE 2ZT9B 1VQ6P 1L0ND 3GG2A 1NTZK 2OGUA 3A3YB 3MUDA 4L75A 1GW4A 5AW7B 2FXPA 1NO4A 1UIIA 2NPSA 2C9LY 1ZN5A 4O9BA 3EFFK 5B66H 3CPWO 1FZBA 4JF7A 1R5LA 2WPQA 2KNCA 1M1KQ 3GF7A 2LR2A 1S1CX 1SQPD 4H13B 1AVOA 3H1KE 1IFDA 2G3AA 1IK9A 3O6QB 1BGYD 1ZV8A 2KLVA 4IFFA 2QE7H 4H44B 2RH0A 4TT3H 3RK3B 3R2PA 1EZVI 1NTZD 3L71E 2H88C 1SQXJ 2N9YB 3LIDA 4BRYB 2N1TD 2OTJP 3S4RA 2IBZD 5CCHC 1KYOE 3CX5D 1FZGA 1BSHA 3U1AA 2E76B 2FYUK 3FWLA 3TNUB 3HE5B 1QX8A 4OGQD 1DD4A 2HFED 5APXA 3L75G 2K1AA 3HTKA 2SPZA 1T3UA 1MFZA 1IFIA 2OQQA 1JO5A 4D6TG 1RQUA 3IFMA 4NPEA 5KLVJ 1S5LH 3M9BA 1KZUB 2BCCG 1LTAC 5KKZB 2WSEJ 5E79E 3TDKA 1NAYA 5AVRB 2Q9IA 5APTA 2PGDA 1LTIC 2KNCB 1AFOA 3CX5H 5KLVK 2ZFCA 5B5EH 2JJLA 1Z56A 2FYUD 4U3FJ 1HWTC 4AQRD 4UB8H 1EDKA 1OMIA 1FS0E 3H1KG 1W5CE 4GT1A 2Q1KA 3CCLP 2V7QJ 2N1TC 4YTPC 3USSA 3RK2B 1SQQE 3TGUE 5C39A 3HE4B 1RF0C 3H1LJ 3E7KA 2DW3A 3L71G 4EI2A 3CXHD 1JCCA 4OGQC 4WVZA 4AUWA 3HTKB 2O3JA 3AE2C 2M3EA 3CL3D 2P7JA 4IL6H 1G1JA 3TF5A 1ZRTD 1L4AA 5KLVD 5KLIB 2B9BA 4LC1A 4EOTA 2LKMA 2YKOA 1DEEG 4GIFA 4N78E 4PV1D 1BE3J 3CMAP 3RL0B 1KB9I 1BDDA 4XFJA 2J59M 1P84E 2JWDA 2XU6A 1L0LJ 2P2UA 2QJYC 3H1JJ 1QEXA 3CWBJ 2WT7B 2W6JH 4U3FD 1AVYA 3CXHH 1RHZB 3H1HG 2QEXP 1T8ZA 2QM8A 1MUUA 4RKUJ 1BE3E 2WSFJ 3L73J 4C7NB 3L70J 3JSVC 2Q5UA 4N6JA 1Q90D 1L0LK 2WPRA 1W2EA 3CWBE 1XTGB 3H1LD 3L35A 2WSEH 1RY3A 3L74E 3LW5H 5K5GB 2IYOA 3KYQA 1NOHA 1QVGO 5AW9B 4UB6E 1SQVE 3K5BA 2A45H 3P7KA 1Q82Q 5GTIH 1L4AB 1OZHA 3AEAC 2KP8A 3V2NA 3AE1C 1WRGA 3MIWA 1FOSF 1S2EA 1NWQA 1ZXGA 4DZOA 3VTPC 1BCCJ 2Y0CA 3CCEP 5KAIH 5APYA 5CBNA 1DX7A
chains in the Genus database with same CATH topology
1BDCA 1H0TA 1DEEG 2SPZA 1LP1B 1FC2C 4GODA 5CBOA 2KIKA 4NPEA 5EFWB 2I8DA 4IOIH 1BDDA 4EYYQ 2B88A 2UWJE 2JWDA 3MHVA 3RGUA 1OVRA 2B87B 4NPFX 5DJTB 2M5AA 1OVVA 4BXLA 3S1KA 2ZAEB 2HR3A 2LXCB 4GOEA 1LT1A 1Q2NA 1SS1A 4CPGA 1EDIA 2R44A 1U7MA 3ZDMA 1LP1A 4HJGH 1U7JA 2KI7B 2LR2A 4MN4C 2LXBA 4K3AA 2QVAA 1EDKA 2M0BA 1EDJA 4HB1A 1JMBA 4K35A 2B89A 3PH0A 4KJMA 1H0TB 2KZJA 4NPDA 4ASVA 2Q1KA 4HKZH 2B87A 1EC5A 1MFTA 5K5GB 4ZMDA 1Y47A 5C39A 1JM0A 1S3JA 2KZIA 4WWIA 2KS1B 2KUBA 3FXDA 3FXEA 2QRXA 1ZW0A 1EDLA 1X0TA 4GOFA 4JBZA 4ASWA 1OVUA 2M5AB 1NVOA 1ZXGA 5DJUB 2P58A 3QWOC 2OTKE 2K3RA 3MZWB 5CBNA 4ZNCA 2RKLA 2WMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDC A;  1H0T A;  1DEE G;  2SPZ A;  1LP1 B;  1FC2 C;  4GOD A;  5CBO A;  2KIK A;  4NPE A;  5EFW B;  2I8D A;  4IOI H;  1BDD A;  4EYY Q;  2B88 A;  2UWJ E;  2JWD A;  3MHV A;  3RGU A;  1OVR A;  2B87 B;  4NPF X;  5DJT B;  2M5A A;  1OVV A;  4BXL A;  3S1K A;  2ZAE B;  2HR3 A;  2LXC B;  4GOE A;  1LT1 A;  1Q2N A;  1SS1 A;  4CPG A;  1EDI A;  2R44 A;  1U7M A;  3ZDM A;  1LP1 A;  4HJG H;  1U7J A;  2KI7 B;  2LR2 A;  4MN4 C;  2LXB A;  4K3A A;  2QVA A;  1EDK A;  2M0B A;  1EDJ A;  4HB1 A;  1JMB A;  4K35 A;  2B89 A;  3PH0 A;  4KJM A;  1H0T B;  2KZJ A;  4NPD A;  4ASV A;  2Q1K A;  4HKZ H;  2B87 A;  1EC5 A;  1MFT A;  5K5G B;  4ZMD A;  1Y47 A;  5C39 A;  1JM0 A;  1S3J A;  2KZI A;  4WWI A;  2KS1 B;  2KUB A;  3FXD A;  3FXE A;  2QRX A;  1ZW0 A;  1EDL A;  1X0T A;  4GOF A;  4JBZ A;  4ASW A;  1OVU A;  2M5A B;  1NVO A;  1ZXG A;  5DJU B;  2P58 A;  3QWO C;  2OTK E;  2K3R A;  3MZW B;  5CBN A;  4ZNC A;  2RKL A;  2WMM A; 
#chains in the Genus database with same CATH topology
 1HJB A;  3T97 A;  3B5N A;  3CC4 P;  1KN7 A;  1KQG B;  1L0L D;  3H1J D;  3GHG C;  1WMK A;  3V4Q A;  3L72 J;  4EYY Q;  2GUS A;  1N73 A;  1KIL D;  2KXP B;  2Q6Q A;  1RE3 A;  4XE5 B;  5DJT B;  3CCR P;  2Z5H A;  3L73 D;  1G1I A;  4Y99 C;  3L70 D;  2K88 A;  3G6E P;  1EZV D;  3HD7 B;  1LT1 A;  4M3L A;  1SFC A;  1NU1 J;  1AA0 A;  3EQ2 A;  1PP9 E;  1LT9 C;  2R5B A;  1URQ D;  3MP7 B;  1T6A A;  1FOS E;  3IN6 A;  3FWN A;  1QGK B;  3AEC C;  4JQ0 D;  5AW8 B;  1H0T B;  3C8V A;  2YKQ A;  2YMK A;  1MV8 A;  3CCS P;  1VQ4 P;  1PPJ G;  1NU1 K;  3W68 A;  3Q1M A;  1JY3 P;  1YI2 P;  1BCC D;  2WSF H;  1SQV G;  1FJP A;  5CJ0 A;  1USE A;  2M5A B;  1SQB E;  3P8C E;  3CD6 P;  3T97 B;  2OTL P;  2FXO A;  3B5N B;  1FZA A;  2OTK E;  2FY8 A;  3L72 D;  1N73 B;  3I55 P;  1KV4 A;  2FFD C;  3BCC D;  1HTL C;  1KIL C;  1AJY A;  3ITK A;  3Q5S A;  3AE5 C;  4L73 A;  1IFN A;  1ZP0 C;  1SFC B;  2YO2 A;  1NU1 D;  1LWU C;  1KFN A;  3PP5 A;  1M56 D;  1Y9B A;  1L2P A;  1NKZ B;  2Y0D A;  1NTM J;  2FYZ A;  1Q81 Q;  4R4M A;  1VF5 B;  1J2J B;  1PP9 G;  3OJA B;  2KK7 A;  5B66 E;  1M1J A;  1EDJ A;  1YBK A;  4WY4 D;  2KZJ A;  1USD A;  3VMZ A;  4ASV A;  3OAK A;  3SWF A;  3EFG A;  2I1K A;  5AW6 B;  1JNM A;  1KB9 D;  3N7N A;  3NTN A;  1N7S D;  2H7H A;  1X0T A;  2XKM A;  1FJK A;  1L0N E;  1SP4 A;  1CI6 B;  1RE4 C;  5BU8 B;  1SQP J;  2QIW A;  1SQB G;  4JYC A;  2PFX A;  3PHL A;  4ZNC A;  1EQ7 A;  3O6Q A;  2P67 A;  1BGY J;  2CPB A;  1NTK J;  2R3S A;  2WTY A;  2WSC J;  1FZC C;  3P32 A;  3MTU E;  1OIP A;  1GD2 E;  4BRY A;  2A06 E;  4D6T J;  3M0D A;  1ZR2 A;  1YYC A;  1LTT C;  1K04 A;  1OX3 A;  4NPF X;  2D2C B;  3KQG A;  3V2P A;  1FE6 A;  3B4S A;  3S1K A;  2K37 A;  1KB9 H;  1BGY E;  1S4X A;  1NTK K;  3HE5 A;  1RF0 A;  2ZAE B;  2LXC B;  3KZI H;  1M1J B;  2O01 H;  1SS1 A;  1NTZ E;  3PLN A;  2YMY A;  1FDI A;  2KI7 B;  4WY4 C;  4YPC A;  2IBZ E;  2O1K A;  1LTJ A;  2WZ7 A;  3AE3 C;  1P84 I;  4K35 A;  3PH0 A;  3CX5 E;  5B5E E;  3GMA A;  4NPD A;  5AVU B;  3D71 A;  1YIJ P;  4GKG A;  1JOC A;  1EXI A;  2JO1 A;  3CCV P;  2Y9Y A;  1N7S C;  5H2F H;  3AE6 C;  4UB8 E;  3CCM P;  2QRX A;  1NGM B;  2FYU J;  3A0H H;  1RF1 A;  2QJP C;  1NJI Q;  3QH9 A;  1NTK D;  1QL2 A;  2Q3E A;  3NFQ A;  3VP8 A;  3H1I J;  2P58 A;  3GF3 A;  3O8Z A;  3L75 D;  2HYN A;  5CJ4 A;  2RKL A;  4H44 D;  4D6T D;  1S9K D;  2QSI A;  4IL6 E;  5EFW B;  2N1T B;  3V2R A;  4PJ0 H;  3HE4 A;  1JY2 P;  1PZQ A;  1N2D C;  3SFD C;  2OYI C;  2G8Y A;  2A06 G;  1E5W A;  3WU2 H;  2E76 D;  3A7O A;  4OGQ B;  1SQX E;  4BXL A;  3CI9 A;  4C46 A;  1LTJ B;  2AEF A;  3PRJ A;  3CC7 P;  4CPG A;  3H1H J;  4PD4 D;  3RBX A;  2WSC H;  2H89 C;  4MN4 C;  1NTZ G;  1HGZ A;  1OW6 A;  2QA4 P;  3LW5 J;  1X22 A;  3CXH E;  3H1K D;  2NPS D;  2JWA A;  1UIX A;  2ZYD A;  1JY2 O;  2FXM A;  1GK4 A;  1PFI A;  2BEQ D;  5APQ A;  2NRG A;  2WT7 A;  1ZRT E;  5KLV E;  1RF1 B;  3L71 D;  1T2K D;  1K8A Q;  3FXE A;  3H1I D;  4H13 C;  1LTG C;  1IFM A;  4C7N A;  2QJK C;  3G9R A;  2WWW A;  3S9O A;  3BVH A;  1CW5 A;  2KS1 A;  4H44 C;  3AEE C;  2L91 A;  4PD4 H;  1BDC A;  4U3F E;  1LP1 B;  3RK2 D;  1DD3 A;  2Y0E A;  1SVF A;  5L8R J;  2I8D A;  4N3Y B;  5KAI E;  1KTM A;  2E76 C;  2UWJ E;  3MHV A;  3TK1 A;  2YIU C;  2ZYA A;  1JCD A;  2IYP A;  3I5C A;  1VQK P;  3H1H D;  5AW0 B;  1H88 A;  3MUD C;  3G3Z A;  3H1L E;  4I2L C;  1JEK A;  1SQX G;  3WUU A;  1HJ0 A;  1VPC A;  4PV1 B;  2NPS C;  1AQ5 A;  1GMJ A;  5KKZ C;  2YNY A;  3KPE A;  1JMB A;  1KFM A;  2XND H;  1T2K C;  4I7Z C;  1JY2 N;  1YTZ T;  1VQL P;  4Y99 B;  2KS1 B;  3HD7 A;  4IL6 X;  1L0L E;  3SWY A;  2WSS H;  3V4W A;  1NKN A;  3H1J E;  2AXC A;  4RO0 A;  5AW5 B;  1URQ A;  1X9V A;  3RK2 C;  3UIA A;  1X79 B;  3AED C;  4GDO A;  3NMD A;  3A2A A;  3L73 E;  4JYB A;  4U7J A;  1H0T A;  3L70 E;  1YQ3 C;  1SQQ G;  3TGU G;  4N78 D;  1H89 A;  1N8R Q;  3II6 A;  2GA1 A;  3AEG C;  2KOG A;  5CCG A;  3VN0 A;  3AE4 C;  2XV5 A;  1KQL A;  4WB4 A;  2WIT A;  1CSB A;  5APV A;  2M5A A;  3B8E B;  1K05 A;  2Q7C A;  3BRT B;  4OVN F;  3JC2 2;  4GOE A;  4OWF A;  3RL0 C;  1YJ9 P;  3A0B E;  5APW A;  3R4Y A;  1U7J A;  5TIS H;  2J5U A;  2XNX A;  4QMA A;  3BCC J;  3GLM A;  1BCC E;  4IFD K;  2AXT H;  2FFD B;  1KIL B;  3JCU E;  1KMI Z;  3H25 A;  3CC2 P;  5AVT B;  5AVW B;  1IO4 A;  3EWK A;  1M57 D;  1PPJ D;  3IR9 A;  4A7P A;  2ZXE B;  3P8M C;  3L72 E;  1LTS C;  1J1D C;  1BE3 G;  2KZI A;  2E42 A;  2JDI H;  2K9J B;  1URQ B;  2KYV A;  3KXD A;  5AVY B;  3CWB G;  3E1I A;  3QWO C;  3L74 G;  3CX5 I;  1PL5 A;  3V2Q A;  1NU1 E;  1JUN A;  2OYH C;  1GL2 D;  1W2B O;  2P1J A;  2W6A A;  3L70 G;  4ZKU A;  1L4A C;  1BSN A;  3C9I A;  1FZE A;  2RMZ A;  1PGJ A;  2P10 A;  3L36 A;  3B71 A;  1X8Y A;  2B87 B;  3IF4 A;  1SLQ A;  2HPC B;  2O01 J;  4UB6 H;  1LGH B;  2M8R A;  1CI6 A;  2BAS A;  2YKP A;  2HOD B;  3C1L A;  1VQ9 P;  3U59 A;  3WUT A;  2HLO A;  3TSI A;  1U7M A;  1PP9 D;  1KYO I;  1G2C A;  3SFE C;  2JEE A;  1YTZ I;  3KZI E;  4KJM A;  2ZVO B;  2BEZ F;  1SFC D;  4DJG A;  5KJ7 D;  5CCH A;  2FYN C;  1JM0 A;  4L74 A;  5APU A;  3D70 A;  3BAS A;  2E74 D;  1JB0 J;  3P8C D;  3CXH I;  5CHX A;  1FDO A;  1HVV A;  5H2F E;  4WY4 B;  3TYY A;  1GL2 C;  2E75 D;  3E1R A;  1JTH A;  3AE7 C;  1M8O B;  1NTM E;  1VQP P;  2IPP A;  3MGN A;  3Q5R A;  4GOD A;  2Y9Z A;  3CME P;  4BWN A;  5BU5 A;  1N7S B;  4RJT A;  2B88 A;  4W7Z A;  3WMM 0;  1NHL A;  3I56 P;  1N73 C;  2Z4E A;  2QJP B;  1YIT P;  1G2C B;  4C7R A;  2A45 I;  3L75 J;  3G71 P;  4H0L D;  2FBW C;  1EDI A;  3WU2 E;  4R4L A;  2YXR B;  1SQP E;  2BCC J;  1CZQ A;  5KAF H;  2N1T A;  3VMA A;  3VYI A;  5GTH H;  1SFC C;  5KJ7 C;  1S5L E;  2YO3 A;  1NTK E;  2JP3 A;  2W6B A;  1EC5 A;  2OYI B;  2KLU A;  1S3J A;  2ZT9 D;  4D6T E;  1S9K E;  1EXJ A;  3FXD A;  1PGP A;  2E74 C;  1JTH B;  1R8E A;  3N4X A;  1S72 P;  1U57 A;  4JBZ A;  2PRR A;  2E75 C;  1R5S A;  5DJU B;  3H1K J;  3CCU P;  3MZW B;  2IFM A;  1NTM G;  1IC2 A;  1FZF A;  1J1E C;  2E5T A;  3L71 J;  3F5H A;  4EIJ A;  4H13 D;  4PD4 E;  1VQN P;  3CLQ A;  2A06 D;  1L0N G;  3H32 B;  1OVR A;  1VDF A;  1DIP A;  3HUS C;  4IFM A;  1FBM A;  2VRS A;  1FDM A;  4H0L C;  2QJK B;  1PIX A;  3RK3 D;  5AVQ B;  2MJZ A;  2HR3 A;  2BCC D;  2W27 A;  2C0W A;  1IFJ A;  1Q2N A;  4DCK A;  5AVV B;  2FYU E;  2W8Z A;  1LP1 A;  4YXW H;  3MD0 A;  2ITA A;  3H1I E;  2JKV A;  4W7Y A;  2D2C C;  1SQP G;  1AV1 A;  2B89 A;  2ZYG A;  1OXZ A;  4Y28 J;  3D6Y A;  1E79 H;  1GTW A;  1Q86 Q;  1BGY G;  2JR8 A;  2YIU B;  1MFT A;  2OYO A;  1NTK G;  2ZT9 C;  1YJW P;  1M1J C;  1H8A A;  2E5Y A;  4ZMD A;  2GUV A;  1ZR4 A;  1NYH A;  1KOR A;  1SQX K;  3BRV B;  3VP9 A;  2IBZ G;  2NPS B;  1M90 Q;  2PAJ A;  2QJY B;  2C9N Y;  3GHG A;  1YHQ P;  3H1H E;  1XTC C;  1K73 Q;  1D7M A;  1FC2 C;  5CBO A;  2C0X A;  3BAT A;  2KIK A;  1KYO D;  2PP6 A;  3H6P A;  2Z5I A;  1SQQ J;  3TGU J;  1NAF A;  5AVX B;  4I7Z B;  2Q3I A;  3RK3 C;  1HGV A;  5GTI E;  1S5L X;  2YXQ B;  5AVS B;  1SQX D;  1LT9 A;  2OAR A;  4B86 A;  3M0D C;  5BVZ A;  3RBZ A;  1VL2 A;  2W90 A;  3GW6 A;  3VMY A;  5CMZ A;  1SQQ K;  3ZDM A;  2FYU G;  1YJN P;  5KTB A;  2XZR A;  1LNQ A;  4K3A A;  1PGQ A;  3F89 A;  4HB1 A;  3H1I G;  4RES B;  4EDF A;  3HRN A;  4I6M C;  2OYH A;  2HG5 D;  1QLE D;  3CCJ P;  1KYO H;  3VMX A;  1LTJ C;  5TIS E;  2AXT E;  4W80 A;  3ABV C;  4I1L A;  5AW1 B;  3RL0 D;  1IK7 A;  4TLF A;  3GHG B;  1IJD B;  1ZOY C;  4ASW A;  1OVU A;  2O01 N;  2J58 A;  1NVO A;  2POH A;  3M9H A;  3PTZ A;  2R3C A;  1TU3 F;  2K3R A;  2FFD A;  1KIL A;  1RF1 C;  1VQ7 P;  1SQQ D;  3TGU D;  3M9Q A;  5KLV G;  2IDB A;  3L74 J;  5E79 H;  4ZKP A;  2R5D A;  2KSJ A;  2MKV A;  4IOI H;  1DEB A;  1NH4 A;  2AEM A;  1LT9 B;  1SQV J;  1LWU A;  1RQV A;  1KIL E;  1J1D B;  2K9J A;  1OVV A;  1ZLL A;  2A45 G;  4JPZ B;  1EZV E;  4WBA A;  4U3F G;  4LGD E;  1PPJ E;  3L4F A;  2R32 A;  4XA4 A;  1L4A D;  1P84 D;  2OYH B;  1SQV K;  1QVF O;  1Q7Y Q;  3Q3D A;  1HUC A;  5KLI C;  2QVA A;  2M0B A;  1GL2 A;  2FKW B;  1WT6 A;  1VQ5 P;  3VOP A;  2ZXX A;  3FX0 A;  1Y8A A;  3KDP B;  5TJH A;  2B87 A;  3H1L G;  1A02 F;  1OFC X;  2HPC A;  4HH2 A;  1BE3 D;  1MKM A;  3M91 A;  4PV1 C;  2HOD A;  1FAV A;  3SSU A;  1RE4 A;  2KUB A;  2V7Q H;  5AW2 B;  4KHX A;  3AEF C;  3CWB D;  1PP9 J;  1OW8 A;  1LTB C;  3SWK A;  2W83 C;  3L74 D;  1FZC A;  2GM4 A;  1A02 J;  2H43 A;  3AE9 C;  3HD7 D;  5AVZ B;  1P84 H;  1KQS O;  3M06 A;  1RH5 B;  1LWU B;  2QG4 A;  4HYT B;  1SQV D;  4L76 A;  1LJ2 A;  3BCC E;  1JMM A;  1IFP A;  4DT0 A;  1L0L G;  1MZ9 A;  3RL0 g;  3G4S P;  2IBZ I;  2WPS A;  3V5B A;  3H1J G;  2FYN B;  5KJ7 A;  1FU1 A;  3M0A A;  5APS A;  1YQ4 C;  2H8P D;  2RN0 A;  2QM7 A;  1SQB J;  3L37 A;  4AYC A;  5CCG D;  1T3J A;  3L73 G;  4WY4 A;  1EZV G;  1PGO A;  2ZJS E;  1GL2 B;  2R44 A;  2WQY C;  2M3B A;  4HJG H;  3KHU A;  4PD4 I;  2O1J A;  2NZ2 A;  2CPS A;  3B5N D;  1N7S A;  1SQB K;  4OH8 B;  3OW2 O;  1GU4 A;  3OA7 A;  5KAF E;  2WPV B;  5GTH E;  3AEB C;  2V4H A;  4WWI A;  1FZC B;  1KB9 E;  3CCQ P;  1EDL A;  3HUS A;  1BCC G;  3HD7 C;  1JY3 O;  4LLH A;  3D6Z A;  2E43 A;  1HH0 A;  5AW4 B;  3V6I A;  1N86 A;  3A0B H;  1VQO P;  2WMM A;  1PV3 A;  3L72 G;  3Q5P A;  3Q2Y A;  2OYI A;  2IX7 C;  2IFN A;  1URQ C;  1VF5 D;  1M7L A;  4Z1M H;  3JCU H;  1SQB D;  2AEJ A;  3BCC G;  3FGA D;  3RGU A;  3W67 A;  2E74 B;  5CCG C;  1L0N J;  1OW7 A;  2KB7 P;  3A0H E;  2E75 B;  1HF9 A;  1DH3 A;  1NU1 G;  3IAO A;  5AW3 B;  2CK3 H;  1ZME C;  1OWA A;  1KQF B;  2WVR A;  1GZL A;  1NTM K;  1HBW A;  3B5N C;  3LIE A;  2L5G B;  2K9Y A;  2LXB A;  1J1E B;  3AE8 C;  1L0N K;  4PJ0 E;  2I1J A;  1VQ8 P;  3H32 A;  1RE3 C;  4HKZ H;  1GDT A;  3HUS B;  2KSE A;  1GW3 A;  1IZN B;  1Y47 A;  3NXS A;  4H0L B;  4KT0 J;  3A5T A;  2IZ1 A;  2IZ0 A;  3U1C A;  1ZW0 A;  4YXD C;  2ZVN B;  4GOF A;  1NTZ J;  1K9M Q;  3WUV A;  2XDJ A;  5CCH D;  2D2C D;  5M1B A;  1QL1 A;  3PJS K;  4DOJ A;  1SQP K;  3L75 E;  1N7L A;  2N9B A;  1GK6 A;  1AQT A;  1NTM D;  1KC8 Q;  1GU5 A;  1VF5 C;  3RK3 E;  3TNU A;  1JY3 N;  1VQM P;  1KD1 Q;  2BCC E;  2ZT9 B;  1VQ6 P;  1L0N D;  3GG2 A;  1NTZ K;  2OGU A;  3A3Y B;  3MUD A;  4L75 A;  1GW4 A;  5AW7 B;  2FXP A;  1NO4 A;  1UII A;  2NPS A;  2C9L Y;  1ZN5 A;  4O9B A;  3EFF K;  5B66 H;  3CPW O;  1FZB A;  4JF7 A;  1R5L A;  2WPQ A;  2KNC A;  1M1K Q;  3GF7 A;  2LR2 A;  1S1C X;  1SQP D;  4H13 B;  1AVO A;  3H1K E;  1IFD A;  2G3A A;  1IK9 A;  3O6Q B;  1BGY D;  1ZV8 A;  2KLV A;  4IFF A;  2QE7 H;  4H44 B;  2RH0 A;  4TT3 H;  3RK3 B;  3R2P A;  1EZV I;  1NTZ D;  3L71 E;  2H88 C;  1SQX J;  2N9Y B;  3LID A;  4BRY B;  2N1T D;  2OTJ P;  3S4R A;  2IBZ D;  5CCH C;  1KYO E;  3CX5 D;  1FZG A;  1BSH A;  3U1A A;  2E76 B;  2FYU K;  3FWL A;  3TNU B;  3HE5 B;  1QX8 A;  4OGQ D;  1DD4 A;  2HFE D;  5APX A;  3L75 G;  2K1A A;  3HTK A;  2SPZ A;  1T3U A;  1MFZ A;  1IFI A;  2OQQ A;  1JO5 A;  4D6T G;  1RQU A;  3IFM A;  4NPE A;  5KLV J;  1S5L H;  3M9B A;  1KZU B;  2BCC G;  1LTA C;  5KKZ B;  2WSE J;  5E79 E;  3TDK A;  1NAY A;  5AVR B;  2Q9I A;  5APT A;  2PGD A;  1LTI C;  2KNC B;  1AFO A;  3CX5 H;  5KLV K;  2ZFC A;  5B5E H;  2JJL A;  1Z56 A;  2FYU D;  4U3F J;  1HWT C;  4AQR D;  4UB8 H;  1EDK A;  1OMI A;  1FS0 E;  3H1K G;  1W5C E;  4GT1 A;  2Q1K A;  3CCL P;  2V7Q J;  2N1T C;  4YTP C;  3USS A;  3RK2 B;  1SQQ E;  3TGU E;  5C39 A;  3HE4 B;  1RF0 C;  3H1L J;  3E7K A;  2DW3 A;  3L71 G;  4EI2 A;  3CXH D;  1JCC A;  4OGQ C;  4WVZ A;  4AUW A;  3HTK B;  2O3J A;  3AE2 C;  2M3E A;  3CL3 D;  2P7J A;  4IL6 H;  1G1J A;  3TF5 A;  1ZRT D;  1L4A A;  5KLV D;  5KLI B;  2B9B A;  4LC1 A;  4EOT A;  2LKM A;  2YKO A;  1DEE G;  4GIF A;  4N78 E;  4PV1 D;  1BE3 J;  3CMA P;  3RL0 B;  1KB9 I;  1BDD A;  4XFJ A;  2J59 M;  1P84 E;  2JWD A;  2XU6 A;  1L0L J;  2P2U A;  2QJY C;  3H1J J;  1QEX A;  3CWB J;  2WT7 B;  2W6J H;  4U3F D;  1AVY A;  3CXH H;  1RHZ B;  3H1H G;  2QEX P;  1T8Z A;  2QM8 A;  1MUU A;  4RKU J;  1BE3 E;  2WSF J;  3L73 J;  4C7N B;  3L70 J;  3JSV C;  2Q5U A;  4N6J A;  1Q90 D;  1L0L K;  2WPR A;  1W2E A;  3CWB E;  1XTG B;  3H1L D;  3L35 A;  2WSE H;  1RY3 A;  3L74 E;  3LW5 H;  5K5G B;  2IYO A;  3KYQ A;  1NOH A;  1QVG O;  5AW9 B;  4UB6 E;  1SQV E;  3K5B A;  2A45 H;  3P7K A;  1Q82 Q;  5GTI H;  1L4A B;  1OZH A;  3AEA C;  2KP8 A;  3V2N A;  3AE1 C;  1WRG A;  3MIW A;  1FOS F;  1S2E A;  1NWQ A;  1ZXG A;  4DZO A;  3VTP C;  1BCC J;  2Y0C A;  3CCE P;  5KAI H;  5APY A;  5CBN A;  1DX7 A; 
#chains in the Genus database with same CATH homology
 1BDC A;  1H0T A;  1DEE G;  2SPZ A;  1LP1 B;  1FC2 C;  4GOD A;  5CBO A;  2KIK A;  4NPE A;  5EFW B;  2I8D A;  4IOI H;  1BDD A;  4EYY Q;  2B88 A;  2UWJ E;  2JWD A;  3MHV A;  3RGU A;  1OVR A;  2B87 B;  4NPF X;  5DJT B;  2M5A A;  1OVV A;  4BXL A;  3S1K A;  2ZAE B;  2HR3 A;  2LXC B;  4GOE A;  1LT1 A;  1Q2N A;  1SS1 A;  4CPG A;  1EDI A;  2R44 A;  1U7M A;  3ZDM A;  1LP1 A;  4HJG H;  1U7J A;  2KI7 B;  2LR2 A;  4MN4 C;  2LXB A;  4K3A A;  2QVA A;  1EDK A;  2M0B A;  1EDJ A;  4HB1 A;  1JMB A;  4K35 A;  2B89 A;  3PH0 A;  4KJM A;  1H0T B;  2KZJ A;  4NPD A;  4ASV A;  2Q1K A;  4HKZ H;  2B87 A;  1EC5 A;  1MFT A;  5K5G B;  4ZMD A;  1Y47 A;  5C39 A;  1JM0 A;  1S3J A;  2KZI A;  4WWI A;  2KS1 B;  2KUB A;  3FXD A;  3FXE A;  2QRX A;  1ZW0 A;  1EDL A;  1X0T A;  4GOF A;  4JBZ A;  4ASW A;  1OVU A;  2M5A B;  1NVO A;  1ZXG A;  5DJU B;  2P58 A;  3QWO C;  2OTK E;  2K3R A;  3MZW B;  5CBN A;  4ZNC A;  2RKL A;  2WMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...