2JWDA

Protein a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
DVDNKFNKEQQNAFWEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polyglutamine length-dependent midfolding is confined to the Poly-Q region
rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords Immunoglobulin G-binding protein A
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2jwdA00
1Y47A 2KZIA 1ZW0A 2LXBA 1SS1A 1JM0A 2LXCB 1OVRA 2I8DA 4JBZA 5C39A 1EDLA 4HB1A 2KZJA 2M0BA 1H0TA 2ZAEB 5DJUB 2KUBA 1H0TB 1S3JA 3MHVA 1BDDA 4HJGH 2KIKA 2B89A 1EDJA 4EYYQ 2UWJE 1LP1B 3ZDMA 4ASVA 1EDIA 2SPZA 3FXEA 1DEEG 1BDCA 1OVUA 5K5GB 2B87B 4WWIA 1MFTA 2K3RA 1EDKA 4NPFX 1U7JA 2HR3A 2KI7B 1LP1A 4BXLA 1ZXGA 4K3AA 1OVVA 4IOIH 4HKZH 2B88A 4ZMDA 2P58A 3QWOC 2WMMA 2Q1KA 4K35A 4ZNCA 2M5AB 2QVAA 4GOEA 4GOFA 4ASWA 4CPGA 5DJTB 2B87A 1FC2C 2M5AA 4NPDA 1EC5A 3PH0A 2KS1B 3MZWB 2RKLA 4GODA 2R44A 1U7MA 1Q2NA 2OTKE 2QRXA 4MN4C 1NVOA 5CBNA 5CBOA 3FXDA 3S1KA 1X0TA 2LR2A 1LT1A 4KJMA 4NPEA 1JMBA 2JWDA 5EFWB 3RGUA
chains in the Genus database with same CATH superfamily
2P67A 1L0NG 3OA7A 2E75C 1OWAA 5APQA 1T3UA 3EFFK 1YJ9P 2WSEH 3BATA 1JCDA 4PJ0H 5KJ7C 2FFDA 2LXCB 1MZ9A 1PGPA 2QIWA 2IBZE 2KNCA 3VOPA 1YJNP 1DD4A 2OTLP 1KILC 1SQBE 2W6JH 2YXQB 5AW5B 1IFJA 2OYHB 5KAIH 3KPEA 3L75D 4LC1A 4HB1A 2WPQA 1URQB 5AVZB 2M8RA 2ZAEB 3IAOA 5KLVK 1NTMG 2KUBA 3C8VA 3AE5C 3L73E 3H25A 2WSCH 1LTGC 1FJKA 3H1LG 1KFMA 1GTWA 1JUNA 1JY2P 3AE6C 3RL0g 1KILD 1HUCA 4HJGH 2Z5IA 2ZYAA 2E74C 3MTUE 3HD7A 2VRSA 3A0BH 3H1KE 3A3YB 3CLQA 2HG5D 2RN0A 1DEBA 2HPCA 1SQBG 2CK3H 2O01H 1RE3A 3H1KJ 3KXDA 3RK3D 2ZVOB 5KKZC 1GDTA 1P84I 1J1DC 1M1JC 3AECC 4GKGA 4H13C 5AW7B 4IFDK 2BEQD 2WITA 1IC2A 2QJYC 3E1RA 3FXEA 1N7LA 4U3FJ 5CHXA 2BEZF 4H0LC 3G4SP 1LTAC 3Q1MA 1Q86Q 3P7KA 4WY4C 2KSJA 3WUUA 4L76A 1N8RQ 1VQ7P 3VMAA 3OAKA 3U1CA 1MFTA 3CMEP 2IBZD 3V2QA 3ITKA 2GA1A 3TGUD 4Y99B 5AVVB 4I1LA 3HTKB 5H2FE 4PV1D 2N1TB 2K9YA 3MIWA 4NPFX 1PIXA 2FYUJ 2HR3A 2PGDA 2QJKC 3A2AA 1M1JB 3F89A 3A0HE 4JPZB 1OW8A 1SQPK 1NTZD 1OVVA 2J58A 2Q6QA 1SQQD 4QMAA 1EZVI 4IOIH 5TISE 3RK2C 3VMZA 4DJGA 3D71A 4HKZH 1HVVA 1FDMA 3S9OA 3CCQP 4OWFA 1G2CA 1L4AD 2K9JB 1FOSF 3CCUP 5H2FH 3CWBJ 1JOCA 3QWOC 3AEAC 1M7LA 2L5GB 2FYUE 3M9QA 2K88A 1YIJP 2IPPA 3CCLP 3RK3B 1MKMA 3GF3A 3I56P 3IN6A 3Q5PA 3CCRP 1SQQG 1SQPD 1URQA 5APUA 4GOFA 3SFDC 4CPGA 1PGOA 3CXHH 2E76D 1QGKB 4HYTB 5CMZA 3RK2D 1Q90D 3E7KA 5KAFE 1AA0A 2NPSC 3R2PA 2R5DA 2HODB 5AW0B 4NPDA 1VQLP 2N1TA 3GHGB 1EC5A 4W7YA 4KT0J 1FZFA 1SQBD 3I55P 1W2BO 3IFMA 3H6PA 5M1BA 1J1DB 3GHGA 2QA4P 2E75D 3D70A 2YKPA 1GK4A 3H1HD 1S72P 3HD7D 2W27A 1K9MQ 1LTBC 3NTNA 4WBAA 2KYVA 1JY2N 4LLHA 1RE4C 1U7MA 1OW6A 3CCSP 1PFIA 1KYOD 1GZLA 3M0DC 3CWBD 4GIFA 3VTPC 5AW4B 3CCJP 4H0LD 1GK6A 3CCVP 1L0LE 3PP5A 1RF1C 1NU1E 3L71E 3GHGC 1CZQA 2P2UA 3L35A 1NTZE 3MD0A 4LGDE 1L4AB 1K73Q 3JCUH 5APTA 4DOJA 1A02F 3GG2A 1FS0E 2QM7A 2WSEJ 4DT0A 1NTZJ 1YBKA 1JCCA 1K05A 1H8AA 3M91A 2Z4EA 3U1AA 5L8RJ 1NYHA 1YQ3C 4KJMA 3H1LJ 2D2CC 3CC4P 1LWUC 1QL2A 1DIPA 2OARA 3KYQA 3BRVB 1R5SA 3RGUA 3BCCE 3H1JG 1ZRTE 1H88A 2Y0DA 5AVSB 2E74D 2A45I 1CI6B 1NTKD 1QL1A 1SQPJ 1XTCC 2B9BA 2KZIA 2NZ2A 3H1HJ 1SQVD 2JJLA 1JM0A 1LTIC 2ZVNB 4EOTA 2FFDB 4BRYA 4RKUJ 5BU8B 3Q5RA 2E75B 3HD7B 1A02J 3CWBG 4I7ZC 1LNQA 5AW2B 1ZOYC 3HUSC 1J2JB 1KMIZ 1EQ7A 1SQXE 4JBZA 3D6ZA 3H1KD 1HF9A 2YIUB 1PL5A 3P8CD 4OGQD 1MUUA 2P7JA 3WU2H 1BCCG 1FBMA 2H89C 2AEFA 2W6BA 2Y9YA 2M0BA 2PRRA 3L74E 4JQ0D 2Q9IA 4GDOA 1AQ5A 5CCHA 2JEEA 5DJUB 3V6IA 1N73B 3M9BA 4IFMA 4OGQB 1X79B 2O1KA 1HJBA 1TU3F 3RBZA 3H1ID 1S3JA 1SVFA 2AXCA 4I7ZB 1RF1A 1IFPA 3HD7C 1EXJA 3L37A 3L74G 1IJDB 4AUWA 3H1IJ 3M9HA 1L0LG 1DX7A 3AE3C 1N7SB 3LIEA 3L36A 1URQD 2KK7A 1LTJB 4DZOA 3NFQA 1ZR2A 1LP1B 2E74B 1FAVA 2A06E 2ZYGA 3U59A 2WT7A 2FYZA 3CX5D 4ASVA 1NGMB 1AJYA 2G3AA 1T2KC 1JY3O 1NH4A 1NAFA 2D2CB 2G8YA 2O1JA 1OVUA 1JB0J 3H1KG 1VQ6P 5APSA 2BCCG 1BCCE 1YTZT 2I1KA 5KJ7D 4XE5B 1LGHB 5E79H 1GL2C 1VF5B 2CPSA 4OH8B 1XTGB 5KJ7A 2OYIA 2NPSD 1FZAA 1RQVA 1KYOE 2OYHA 2WPRA 2R5BA 2XNXA 3CWBE 1KB9E 1JTHA 2BCCE 1Q82Q 1NOHA 1SQVG 1S1CX 1NU1D 3L71D 3SWFA 1FZCA 1K04A 1X9VA 3B5NC 3L4FA 1SQPE 3H1JD 3G71P 2IZ1A 3B5NA 2FYNC 1VQNP 1OW7A 3JCUE 4AQRD 3A0BE 2C0XA 2CPBA 2FXPA 4L74A 3BCCG 1WT6A 2YMKA 1YJWP 1EZVD 2JDIH 2KLVA 4RESB 4ZMDA 1GL2D 1DD3A 5BVZA 1DH3A 2E5YA 4ZKUA 2P58A 1S9KE 1FJPA 1CSBA 1LTSC 1N2DC 3G9RA 3HUSA 4OVNF 1L0NJ 1KZUB 2FYUK 3TNUA 1HH0A 1SQXJ 4L73A 1IFDA 1ZRTD 3V4QA 4ASWA 3CXHI 3KDPB 1PPJD 3G6EP 1SQVE 2K37A 1M90Q 2DW3A 1BSNA 2M5AA 5KLIC 4C7RA 4D6TD 2A06G 2D2CD 1GD2E 3SFEC 2N1TD 1KD1Q 2KS1B 1KQSO 1L0NK 2XV5A 2ZJSE 1IFIA 1JY3N 1SFCA 3FWNA 4L75A 4U7JA 3V2NA 3GF7A 3NXSA 4PJ0E 3JSVC 4U3FG 3P8CE 3VMYA 3LW5H 1VQOP 2R44A 2C9NY 4D6TJ 2HYNA 4C7NB 1HGZA 1OFCX 2OYOA 2NRGA 3D6YA 1KTMA 2YIUC 2WWWA 1OX3A 3RL0B 1NVOA 3E1IA 1L0LK 3H1IE 1NU1K 1USDA 3CL3D 3IR9A 3T97A 5CBOA 1L0ND 3H1JE 3W68A 3CX5I 1IK9A 3FXDA 1YI2P 4JYCA 1RE4A 3H1LE 4PD4E 2BASA 2YXRB 1LT1A 1PP9D 1JY2O 5AVUB 2HFED 1AVOA 1L4AC 1SP4A 5AVRB 1AQTA 2QJPC 5GTIH 2A06D 1SQQJ 2QJYB 3O6QA 3CX5E 2V7QJ 4EIJA 1SQXD 1NHLA 1H0TA 3Q2YA 2Q3EA 3CCEP 4H13B 1GMJA 1NTZG 1PPJG 1LT9C 1LWUB 2QSIA 4B86A 1UIXA 1UIIA 2KNCB 1Y47A 1QVFO 1LTTC 2LXBA 3LIDA 3CC7P 1SS1A 1SQXG 4W80A 2FYNB 1OVRA 2FXMA 1SQBJ 2O01N 2QE7H 3WUTA 4H0LB 2I8DA 3VMXA 1E5WA 1FE6A 1KB9D 1KILE 2BCCD 2ZT9D 1KILB 1OMIA 1SQXK 2WTYA 2JWAA 1VQMP 1T2KD 1SQPG 4A7PA 1EDLA 1KC8Q 3P8MC 1N86A 4DCKA 1J1EB 1KB9H 2IBZI 3II6A 2KZJA 4W7ZA 3Q5SA 1NTKK 1KQFB 3V2RA 1Q7YQ 1NTMJ 1MFZA 1VL2A 5KAFH 1AV1A 1VQ4P 5KTBA 1SQVJ 2YO2A 3B5NB 1H0TB 1GW4A 3V4WA 1S9KD 1FZCB 2A45G 3MHVA 2IDBA 2JP3A 2KP8A 1BDDA 3WMM0 4YXDC 2IYPA 4Y99C 2KIKA 1ZMEC 1E79H 3AE1C 1PZQA 3PRJA 4H44C 1M56D 2KLUA 4PD4D 1R8EA 1GL2B 3PHLA 5CCHC 1QVGO 1BGYJ 3KZIH 4EYYQ 2N9BA 1NTMK 2UWJE 3AE2C 2M3BA 1J1EC 2AXTE 3AEFC 3EWKA 3H32A 5B5EE 3ZDMA 2KSEA 1AVYA 2LKMA 2E5TA 1KN7A 1R5LA 1FOSE 1KQLA 2OYIC 3VYIA 1NU1J 3L71J 3AE9C 1BDCA 1SQQE 2NPSB 1QEXA 1LT9A 1SFCD 2Q5UA 1GW3A 1FZBA 2RH0A 3EQ2A 5K5GB 1P84E 1RE3C 2B87B 1LTJC 2K3RA 3LW5J 2E76B 2R32A 2XKMA 1GU5A 5CCHD 1EZVE 1G1IA 3FWLA 1NTMD 5AVXB 3CI9A 1FDOA 1IZNB 1EDKA 1M57D 2WPSA 3F5HA 3L75G 4EDFA 4Z1MH 4UB6H 1SLQA 2IBZG 4UB8H 3C1LA 1LP1A 1WMKA 2BCCJ 3R4YA 2YO3A 4K3AA 1HGVA 2QG4A 1ZP0C 2FFDC 2H7HA 1ZV8A 3H1LD 2YKQA 2GUVA 2B88A 5APXA 2Y0EA 2PFXA 1ZN5A 1KQGB 1X8YA 4D6TG 2FY8A 2OQQA 3HUSB 3GLMA 1KILA 1JY3P 2WQYC 3FX0A 3HE5A 4PV1B 1PV3A 1S4XA 1T3JA 4K35A 4N3YB 4IL6X 5AVWB 3TK1A 3H1HG 5BU5A 2QVAA 3L75J 3N4XA 4GOEA 3L74J 1YYCA 1EXIA 1URQC 1IO4A 4TT3H 1SQVK 5AVYB 1FC2C 5APVA 4H44B 1BE3D 1IFNA 3CXHD 1KV4A 1S5LX 2M3EA 1LJ2A 2H8PD 3RBXA 1NJIQ 3VP9A 1L0NE 1NKNA 1VPCA 2HODA 3OW2O 2FYUD 1PP9J 3MGNA 2XDJA 2RMZA 1P84D 2J59M 1VF5C 1KYOH 2GUSA 2RKLA 1HJ0A 1NU1G 3L72E 3L71G 3MZWB 3AEEC 1CI6A 2WPVB 3O8ZA 3MUDC 1LTJA 4O9BA 5E79E 2QEXP 2O01J 2WSSH 1RF0A 2YMYA 2Z5HA 3M0DA 1GL2A 3MUDA 3AE7C 5KLVD 1RF0C 2QRXA 5B66E 3L70D 5GTHH 4YXWH 5GTHE 2JKVA 3I5CA 4IL6H 1VQ8P 3M06A 3BCCD 2GM4A 5CBNA 2ZFCA 3T97B 1IFMA 2FYUG 1VQ9P 3B5ND 1YITP 3VP8A 3SSUA 4WB4A 1X0TA 2IFNA 2JR8A 1OIPA 1FZGA 2LR2A 1VF5D 2E43A 1L4AA 3TSIA 5KLVG 3BVHA 2I1JA 4NPEA 2OYHC 2O3JA 1Y9BA 3TGUG 5B66H 3QH9A 5EFWB 2ZYDA 2POHA 2KS1A 5CJ4A 3OJAB 2QJPB 3L74D 4I2LC 1OZHA 1W2EA 1ZW0A 3VN0A 3BRTB 1N7SC 3SWYA 2C0WA 4R4MA 1QLED 2AEJA 3C9IA 3EFGA 1N7SA 1M1KQ 3G3ZA 1SFCB 1BE3E 4M3LA 1T8ZA 3AE4C 1LT9B 1U57A 3AEDC 3HE5B 3NMDA 2YNYA 2QJKB 2W83C 1NTKG 2XNDH 1BE3J 1SQBK 2N1TC 3MP7B 2R3CA 2W90A 4HH2A 4PV1C 3TYYA 3WU2E 5CCGA 5CCGC 1FDIA 5C39A 2KOGA 3RL0C 5KLIB 1BGYD 1KORA 2L91A 1W5CE 3L72D 3H32B 2IFMA 4PD4H 2ZXEB 3S4RA 4XFJA 5AW9B 1KFNA 1NTKE 3TGUJ 1NWQA 1VQKP 5KLVE 3RK2B 1JMMA 2V4HA 4XA4A 2FBWC 1Y8AA 2WSFH 2Q7CA 2H88C 3HE4B 3L70J 3IF4A 4N6JA 5APWA 2V7QH 4ZKPA 1ZR4A 1FZCC 2OYIB 4BWNA 1JTHB 4U3FD 1G2CB 3BASA 3HE4A 4AYCA 2XU6A 2B89A 1P84H 3KHUA 4JF7A 1BCCD 5AW1B 1S5LE 4GT1A 1L2PA 1NO4A 3V2PA 4Y28J 4WVZA 1EDJA 1RHZB 2XZRA 4C46A 1NTME 2A45H 1Q81Q 1JO5A 1M1JA 4UB8E 1BSHA 1PGQA 1X22A 1T6AA 4N78E 4WY4B 5AVTB 2WSCJ 2H43A 2HLOA 2E42A 3B4SA 2PAJA 1EDIA 2SPZA 1K8AQ 3PTZA 2Q3IA 1GU4A 1MV8A 1DEEG 3B71A 2WT7B 3PJSK 1SQQK 1ZLLA 3TDKA 1BGYG 2PP6A 3Q3DA 3CMAP 2AEMA 2IZ0A 4WWIA 1HWTC 1NKZB 2P10A 2W6AA 3SWKA 3CD6P 1RY3A 2Y0CA 3RK3E 2R3SA 2K1AA 3A7OA 2WSFJ 2Y9ZA 1LWUA 4YTPC 3V5BA 5B5EH 2P1JA 3L72G 1RF1B 2ZT9C 1U7JA 1WRGA 3GW6A 2AXTH 2W8ZA 2KI7B 5KAIE 4BXLA 1ZXGA 3CPWO 3KZIE 1HTLC 3UIAA 3CC2P 1BCCJ 3N7NA 5APYA 4RO0A 1KYOI 3GMAA 2HPCB 1KB9I 3ABVC 1PGJA 3BCCJ 2KB7P 3CXHE 4IL6E 2JO1A 3L73G 3CCMP 1NTKJ 3TGUE 1CW5A 3RL0D 5CCGD 2ZT9B 5AVQB 2WMMA 4TLFA 1S5LH 4RJTA 4YPCA 2J5UA 2YKOA 2MJZA 2OTJP 4WY4D 2Q1KA 1YTZI 4H44D 5AW3B 3AEBC 4ZNCA 3JC22 2M5AB 4JYBA 3L72J 1QX8A 3H1IG 1YHQP 1D7MA 1G1JA 5DJTB 5KLVJ 1M8OB 2B87A 1IK7A 3HRNA 1EZVG 4N78D 3PLNA 1NAYA 5CJ0A 3L70E 2IX7C 2NPSA 5TISH 2OGUA 3PH0A 3A0HH 3M0AA 3HTKA 2FKWB 3O6QB 4BRYB 4EI2A 1YQ4C 2FXOA 5AW8B 1SFCC 2K9JA 1Z56A 4OGQC 4C7NA 3A5TA 1BGYE 1JNMA 3L73J 1VQPP 3L75E 1PP9E 4GODA 2WVRA 4IFFA 1N7SD 1USEA 1FU1A 1BE3G 1PPJE 1Q2NA 2WZ7A 2OTKE 2IYOA 2ITAA 4KHXA 3B8EB 4PD4I 1VQ5P 4D6TE 3CX5H 3L73D 3AE8C 4MN4C 3RK3C 1AFOA 2QM8A 4I6MC 3P32A 3TNUB 1FZEA 1PP9G 1OXZA 5AW6B 5GTIE 4H13D 4WY4A 1RH5B 1JEKA 1S2EA 1NTZK 1L0LJ 1VDFA 3FGAD 4U3FE 3K5BA 3WUVA 3S1KA 1N73C 3H1HE 2E76C 3H1JJ 1N73A 5KKZB 3TF5A 1H89A 1HBWA 2MKVA 2KXPB 4R4LA 4UB6E 3AEGC 3W67A 2ZXXA 3L70G 2N9YB 3KQGA 3USSA 1JMBA 2JWDA 1RQUA 2C9LY 5TJHA 1L0LD
chains in the Genus database with same CATH topology
1Y47A 2KZIA 1ZW0A 2LXBA 1SS1A 1JM0A 2LXCB 1OVRA 2I8DA 4JBZA 5C39A 1EDLA 4HB1A 2KZJA 2M0BA 1H0TA 2ZAEB 5DJUB 2KUBA 1H0TB 1S3JA 3MHVA 1BDDA 4HJGH 2KIKA 2B89A 1EDJA 4EYYQ 2UWJE 1LP1B 3ZDMA 4ASVA 1EDIA 2SPZA 3FXEA 1DEEG 1BDCA 1OVUA 5K5GB 2B87B 4WWIA 1MFTA 2K3RA 1EDKA 4NPFX 1U7JA 2HR3A 2KI7B 1LP1A 4BXLA 1ZXGA 4K3AA 1OVVA 4IOIH 4HKZH 2B88A 4ZMDA 2P58A 3QWOC 2WMMA 2Q1KA 4K35A 4ZNCA 2M5AB 2QVAA 4GOEA 4GOFA 4ASWA 4CPGA 5DJTB 2B87A 1FC2C 2M5AA 4NPDA 1EC5A 3PH0A 2KS1B 3MZWB 2RKLA 4GODA 2R44A 1U7MA 1Q2NA 2OTKE 2QRXA 4MN4C 1NVOA 5CBNA 5CBOA 3FXDA 3S1KA 1X0TA 2LR2A 1LT1A 4KJMA 4NPEA 1JMBA 2JWDA 5EFWB 3RGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y47 A;  2KZI A;  1ZW0 A;  2LXB A;  1SS1 A;  1JM0 A;  2LXC B;  1OVR A;  2I8D A;  4JBZ A;  5C39 A;  1EDL A;  4HB1 A;  2KZJ A;  2M0B A;  1H0T A;  2ZAE B;  5DJU B;  2KUB A;  1H0T B;  1S3J A;  3MHV A;  1BDD A;  4HJG H;  2KIK A;  2B89 A;  1EDJ A;  4EYY Q;  2UWJ E;  1LP1 B;  3ZDM A;  4ASV A;  1EDI A;  2SPZ A;  3FXE A;  1DEE G;  1BDC A;  1OVU A;  5K5G B;  2B87 B;  4WWI A;  1MFT A;  2K3R A;  1EDK A;  4NPF X;  1U7J A;  2HR3 A;  2KI7 B;  1LP1 A;  4BXL A;  1ZXG A;  4K3A A;  1OVV A;  4IOI H;  4HKZ H;  2B88 A;  4ZMD A;  2P58 A;  3QWO C;  2WMM A;  2Q1K A;  4K35 A;  4ZNC A;  2M5A B;  2QVA A;  4GOE A;  4GOF A;  4ASW A;  4CPG A;  5DJT B;  2B87 A;  1FC2 C;  2M5A A;  4NPD A;  1EC5 A;  3PH0 A;  2KS1 B;  3MZW B;  2RKL A;  4GOD A;  2R44 A;  1U7M A;  1Q2N A;  2OTK E;  2QRX A;  4MN4 C;  1NVO A;  5CBN A;  5CBO A;  3FXD A;  3S1K A;  1X0T A;  2LR2 A;  1LT1 A;  4KJM A;  4NPE A;  1JMB A;  2JWD A;  5EFW B;  3RGU A; 
#chains in the Genus database with same CATH topology
 2P67 A;  1L0N G;  3OA7 A;  2E75 C;  1OWA A;  5APQ A;  1T3U A;  3EFF K;  1YJ9 P;  2WSE H;  3BAT A;  1JCD A;  4PJ0 H;  5KJ7 C;  2FFD A;  2LXC B;  1MZ9 A;  1PGP A;  2QIW A;  2IBZ E;  2KNC A;  3VOP A;  1YJN P;  1DD4 A;  2OTL P;  1KIL C;  1SQB E;  2W6J H;  2YXQ B;  5AW5 B;  1IFJ A;  2OYH B;  5KAI H;  3KPE A;  3L75 D;  4LC1 A;  4HB1 A;  2WPQ A;  1URQ B;  5AVZ B;  2M8R A;  2ZAE B;  3IAO A;  5KLV K;  1NTM G;  2KUB A;  3C8V A;  3AE5 C;  3L73 E;  3H25 A;  2WSC H;  1LTG C;  1FJK A;  3H1L G;  1KFM A;  1GTW A;  1JUN A;  1JY2 P;  3AE6 C;  3RL0 g;  1KIL D;  1HUC A;  4HJG H;  2Z5I A;  2ZYA A;  2E74 C;  3MTU E;  3HD7 A;  2VRS A;  3A0B H;  3H1K E;  3A3Y B;  3CLQ A;  2HG5 D;  2RN0 A;  1DEB A;  2HPC A;  1SQB G;  2CK3 H;  2O01 H;  1RE3 A;  3H1K J;  3KXD A;  3RK3 D;  2ZVO B;  5KKZ C;  1GDT A;  1P84 I;  1J1D C;  1M1J C;  3AEC C;  4GKG A;  4H13 C;  5AW7 B;  4IFD K;  2BEQ D;  2WIT A;  1IC2 A;  2QJY C;  3E1R A;  3FXE A;  1N7L A;  4U3F J;  5CHX A;  2BEZ F;  4H0L C;  3G4S P;  1LTA C;  3Q1M A;  1Q86 Q;  3P7K A;  4WY4 C;  2KSJ A;  3WUU A;  4L76 A;  1N8R Q;  1VQ7 P;  3VMA A;  3OAK A;  3U1C A;  1MFT A;  3CME P;  2IBZ D;  3V2Q A;  3ITK A;  2GA1 A;  3TGU D;  4Y99 B;  5AVV B;  4I1L A;  3HTK B;  5H2F E;  4PV1 D;  2N1T B;  2K9Y A;  3MIW A;  4NPF X;  1PIX A;  2FYU J;  2HR3 A;  2PGD A;  2QJK C;  3A2A A;  1M1J B;  3F89 A;  3A0H E;  4JPZ B;  1OW8 A;  1SQP K;  1NTZ D;  1OVV A;  2J58 A;  2Q6Q A;  1SQQ D;  4QMA A;  1EZV I;  4IOI H;  5TIS E;  3RK2 C;  3VMZ A;  4DJG A;  3D71 A;  4HKZ H;  1HVV A;  1FDM A;  3S9O A;  3CCQ P;  4OWF A;  1G2C A;  1L4A D;  2K9J B;  1FOS F;  3CCU P;  5H2F H;  3CWB J;  1JOC A;  3QWO C;  3AEA C;  1M7L A;  2L5G B;  2FYU E;  3M9Q A;  2K88 A;  1YIJ P;  2IPP A;  3CCL P;  3RK3 B;  1MKM A;  3GF3 A;  3I56 P;  3IN6 A;  3Q5P A;  3CCR P;  1SQQ G;  1SQP D;  1URQ A;  5APU A;  4GOF A;  3SFD C;  4CPG A;  1PGO A;  3CXH H;  2E76 D;  1QGK B;  4HYT B;  5CMZ A;  3RK2 D;  1Q90 D;  3E7K A;  5KAF E;  1AA0 A;  2NPS C;  3R2P A;  2R5D A;  2HOD B;  5AW0 B;  4NPD A;  1VQL P;  2N1T A;  3GHG B;  1EC5 A;  4W7Y A;  4KT0 J;  1FZF A;  1SQB D;  3I55 P;  1W2B O;  3IFM A;  3H6P A;  5M1B A;  1J1D B;  3GHG A;  2QA4 P;  2E75 D;  3D70 A;  2YKP A;  1GK4 A;  3H1H D;  1S72 P;  3HD7 D;  2W27 A;  1K9M Q;  1LTB C;  3NTN A;  4WBA A;  2KYV A;  1JY2 N;  4LLH A;  1RE4 C;  1U7M A;  1OW6 A;  3CCS P;  1PFI A;  1KYO D;  1GZL A;  3M0D C;  3CWB D;  4GIF A;  3VTP C;  5AW4 B;  3CCJ P;  4H0L D;  1GK6 A;  3CCV P;  1L0L E;  3PP5 A;  1RF1 C;  1NU1 E;  3L71 E;  3GHG C;  1CZQ A;  2P2U A;  3L35 A;  1NTZ E;  3MD0 A;  4LGD E;  1L4A B;  1K73 Q;  3JCU H;  5APT A;  4DOJ A;  1A02 F;  3GG2 A;  1FS0 E;  2QM7 A;  2WSE J;  4DT0 A;  1NTZ J;  1YBK A;  1JCC A;  1K05 A;  1H8A A;  3M91 A;  2Z4E A;  3U1A A;  5L8R J;  1NYH A;  1YQ3 C;  4KJM A;  3H1L J;  2D2C C;  3CC4 P;  1LWU C;  1QL2 A;  1DIP A;  2OAR A;  3KYQ A;  3BRV B;  1R5S A;  3RGU A;  3BCC E;  3H1J G;  1ZRT E;  1H88 A;  2Y0D A;  5AVS B;  2E74 D;  2A45 I;  1CI6 B;  1NTK D;  1QL1 A;  1SQP J;  1XTC C;  2B9B A;  2KZI A;  2NZ2 A;  3H1H J;  1SQV D;  2JJL A;  1JM0 A;  1LTI C;  2ZVN B;  4EOT A;  2FFD B;  4BRY A;  4RKU J;  5BU8 B;  3Q5R A;  2E75 B;  3HD7 B;  1A02 J;  3CWB G;  4I7Z C;  1LNQ A;  5AW2 B;  1ZOY C;  3HUS C;  1J2J B;  1KMI Z;  1EQ7 A;  1SQX E;  4JBZ A;  3D6Z A;  3H1K D;  1HF9 A;  2YIU B;  1PL5 A;  3P8C D;  4OGQ D;  1MUU A;  2P7J A;  3WU2 H;  1BCC G;  1FBM A;  2H89 C;  2AEF A;  2W6B A;  2Y9Y A;  2M0B A;  2PRR A;  3L74 E;  4JQ0 D;  2Q9I A;  4GDO A;  1AQ5 A;  5CCH A;  2JEE A;  5DJU B;  3V6I A;  1N73 B;  3M9B A;  4IFM A;  4OGQ B;  1X79 B;  2O1K A;  1HJB A;  1TU3 F;  3RBZ A;  3H1I D;  1S3J A;  1SVF A;  2AXC A;  4I7Z B;  1RF1 A;  1IFP A;  3HD7 C;  1EXJ A;  3L37 A;  3L74 G;  1IJD B;  4AUW A;  3H1I J;  3M9H A;  1L0L G;  1DX7 A;  3AE3 C;  1N7S B;  3LIE A;  3L36 A;  1URQ D;  2KK7 A;  1LTJ B;  4DZO A;  3NFQ A;  1ZR2 A;  1LP1 B;  2E74 B;  1FAV A;  2A06 E;  2ZYG A;  3U59 A;  2WT7 A;  2FYZ A;  3CX5 D;  4ASV A;  1NGM B;  1AJY A;  2G3A A;  1T2K C;  1JY3 O;  1NH4 A;  1NAF A;  2D2C B;  2G8Y A;  2O1J A;  1OVU A;  1JB0 J;  3H1K G;  1VQ6 P;  5APS A;  2BCC G;  1BCC E;  1YTZ T;  2I1K A;  5KJ7 D;  4XE5 B;  1LGH B;  5E79 H;  1GL2 C;  1VF5 B;  2CPS A;  4OH8 B;  1XTG B;  5KJ7 A;  2OYI A;  2NPS D;  1FZA A;  1RQV A;  1KYO E;  2OYH A;  2WPR A;  2R5B A;  2XNX A;  3CWB E;  1KB9 E;  1JTH A;  2BCC E;  1Q82 Q;  1NOH A;  1SQV G;  1S1C X;  1NU1 D;  3L71 D;  3SWF A;  1FZC A;  1K04 A;  1X9V A;  3B5N C;  3L4F A;  1SQP E;  3H1J D;  3G71 P;  2IZ1 A;  3B5N A;  2FYN C;  1VQN P;  1OW7 A;  3JCU E;  4AQR D;  3A0B E;  2C0X A;  2CPB A;  2FXP A;  4L74 A;  3BCC G;  1WT6 A;  2YMK A;  1YJW P;  1EZV D;  2JDI H;  2KLV A;  4RES B;  4ZMD A;  1GL2 D;  1DD3 A;  5BVZ A;  1DH3 A;  2E5Y A;  4ZKU A;  2P58 A;  1S9K E;  1FJP A;  1CSB A;  1LTS C;  1N2D C;  3G9R A;  3HUS A;  4OVN F;  1L0N J;  1KZU B;  2FYU K;  3TNU A;  1HH0 A;  1SQX J;  4L73 A;  1IFD A;  1ZRT D;  3V4Q A;  4ASW A;  3CXH I;  3KDP B;  1PPJ D;  3G6E P;  1SQV E;  2K37 A;  1M90 Q;  2DW3 A;  1BSN A;  2M5A A;  5KLI C;  4C7R A;  4D6T D;  2A06 G;  2D2C D;  1GD2 E;  3SFE C;  2N1T D;  1KD1 Q;  2KS1 B;  1KQS O;  1L0N K;  2XV5 A;  2ZJS E;  1IFI A;  1JY3 N;  1SFC A;  3FWN A;  4L75 A;  4U7J A;  3V2N A;  3GF7 A;  3NXS A;  4PJ0 E;  3JSV C;  4U3F G;  3P8C E;  3VMY A;  3LW5 H;  1VQO P;  2R44 A;  2C9N Y;  4D6T J;  2HYN A;  4C7N B;  1HGZ A;  1OFC X;  2OYO A;  2NRG A;  3D6Y A;  1KTM A;  2YIU C;  2WWW A;  1OX3 A;  3RL0 B;  1NVO A;  3E1I A;  1L0L K;  3H1I E;  1NU1 K;  1USD A;  3CL3 D;  3IR9 A;  3T97 A;  5CBO A;  1L0N D;  3H1J E;  3W68 A;  3CX5 I;  1IK9 A;  3FXD A;  1YI2 P;  4JYC A;  1RE4 A;  3H1L E;  4PD4 E;  2BAS A;  2YXR B;  1LT1 A;  1PP9 D;  1JY2 O;  5AVU B;  2HFE D;  1AVO A;  1L4A C;  1SP4 A;  5AVR B;  1AQT A;  2QJP C;  5GTI H;  2A06 D;  1SQQ J;  2QJY B;  3O6Q A;  3CX5 E;  2V7Q J;  4EIJ A;  1SQX D;  1NHL A;  1H0T A;  3Q2Y A;  2Q3E A;  3CCE P;  4H13 B;  1GMJ A;  1NTZ G;  1PPJ G;  1LT9 C;  1LWU B;  2QSI A;  4B86 A;  1UIX A;  1UII A;  2KNC B;  1Y47 A;  1QVF O;  1LTT C;  2LXB A;  3LID A;  3CC7 P;  1SS1 A;  1SQX G;  4W80 A;  2FYN B;  1OVR A;  2FXM A;  1SQB J;  2O01 N;  2QE7 H;  3WUT A;  4H0L B;  2I8D A;  3VMX A;  1E5W A;  1FE6 A;  1KB9 D;  1KIL E;  2BCC D;  2ZT9 D;  1KIL B;  1OMI A;  1SQX K;  2WTY A;  2JWA A;  1VQM P;  1T2K D;  1SQP G;  4A7P A;  1EDL A;  1KC8 Q;  3P8M C;  1N86 A;  4DCK A;  1J1E B;  1KB9 H;  2IBZ I;  3II6 A;  2KZJ A;  4W7Z A;  3Q5S A;  1NTK K;  1KQF B;  3V2R A;  1Q7Y Q;  1NTM J;  1MFZ A;  1VL2 A;  5KAF H;  1AV1 A;  1VQ4 P;  5KTB A;  1SQV J;  2YO2 A;  3B5N B;  1H0T B;  1GW4 A;  3V4W A;  1S9K D;  1FZC B;  2A45 G;  3MHV A;  2IDB A;  2JP3 A;  2KP8 A;  1BDD A;  3WMM 0;  4YXD C;  2IYP A;  4Y99 C;  2KIK A;  1ZME C;  1E79 H;  3AE1 C;  1PZQ A;  3PRJ A;  4H44 C;  1M56 D;  2KLU A;  4PD4 D;  1R8E A;  1GL2 B;  3PHL A;  5CCH C;  1QVG O;  1BGY J;  3KZI H;  4EYY Q;  2N9B A;  1NTM K;  2UWJ E;  3AE2 C;  2M3B A;  1J1E C;  2AXT E;  3AEF C;  3EWK A;  3H32 A;  5B5E E;  3ZDM A;  2KSE A;  1AVY A;  2LKM A;  2E5T A;  1KN7 A;  1R5L A;  1FOS E;  1KQL A;  2OYI C;  3VYI A;  1NU1 J;  3L71 J;  3AE9 C;  1BDC A;  1SQQ E;  2NPS B;  1QEX A;  1LT9 A;  1SFC D;  2Q5U A;  1GW3 A;  1FZB A;  2RH0 A;  3EQ2 A;  5K5G B;  1P84 E;  1RE3 C;  2B87 B;  1LTJ C;  2K3R A;  3LW5 J;  2E76 B;  2R32 A;  2XKM A;  1GU5 A;  5CCH D;  1EZV E;  1G1I A;  3FWL A;  1NTM D;  5AVX B;  3CI9 A;  1FDO A;  1IZN B;  1EDK A;  1M57 D;  2WPS A;  3F5H A;  3L75 G;  4EDF A;  4Z1M H;  4UB6 H;  1SLQ A;  2IBZ G;  4UB8 H;  3C1L A;  1LP1 A;  1WMK A;  2BCC J;  3R4Y A;  2YO3 A;  4K3A A;  1HGV A;  2QG4 A;  1ZP0 C;  2FFD C;  2H7H A;  1ZV8 A;  3H1L D;  2YKQ A;  2GUV A;  2B88 A;  5APX A;  2Y0E A;  2PFX A;  1ZN5 A;  1KQG B;  1X8Y A;  4D6T G;  2FY8 A;  2OQQ A;  3HUS B;  3GLM A;  1KIL A;  1JY3 P;  2WQY C;  3FX0 A;  3HE5 A;  4PV1 B;  1PV3 A;  1S4X A;  1T3J A;  4K35 A;  4N3Y B;  4IL6 X;  5AVW B;  3TK1 A;  3H1H G;  5BU5 A;  2QVA A;  3L75 J;  3N4X A;  4GOE A;  3L74 J;  1YYC A;  1EXI A;  1URQ C;  1IO4 A;  4TT3 H;  1SQV K;  5AVY B;  1FC2 C;  5APV A;  4H44 B;  1BE3 D;  1IFN A;  3CXH D;  1KV4 A;  1S5L X;  2M3E A;  1LJ2 A;  2H8P D;  3RBX A;  1NJI Q;  3VP9 A;  1L0N E;  1NKN A;  1VPC A;  2HOD A;  3OW2 O;  2FYU D;  1PP9 J;  3MGN A;  2XDJ A;  2RMZ A;  1P84 D;  2J59 M;  1VF5 C;  1KYO H;  2GUS A;  2RKL A;  1HJ0 A;  1NU1 G;  3L72 E;  3L71 G;  3MZW B;  3AEE C;  1CI6 A;  2WPV B;  3O8Z A;  3MUD C;  1LTJ A;  4O9B A;  5E79 E;  2QEX P;  2O01 J;  2WSS H;  1RF0 A;  2YMY A;  2Z5H A;  3M0D A;  1GL2 A;  3MUD A;  3AE7 C;  5KLV D;  1RF0 C;  2QRX A;  5B66 E;  3L70 D;  5GTH H;  4YXW H;  5GTH E;  2JKV A;  3I5C A;  4IL6 H;  1VQ8 P;  3M06 A;  3BCC D;  2GM4 A;  5CBN A;  2ZFC A;  3T97 B;  1IFM A;  2FYU G;  1VQ9 P;  3B5N D;  1YIT P;  3VP8 A;  3SSU A;  4WB4 A;  1X0T A;  2IFN A;  2JR8 A;  1OIP A;  1FZG A;  2LR2 A;  1VF5 D;  2E43 A;  1L4A A;  3TSI A;  5KLV G;  3BVH A;  2I1J A;  4NPE A;  2OYH C;  2O3J A;  1Y9B A;  3TGU G;  5B66 H;  3QH9 A;  5EFW B;  2ZYD A;  2POH A;  2KS1 A;  5CJ4 A;  3OJA B;  2QJP B;  3L74 D;  4I2L C;  1OZH A;  1W2E A;  1ZW0 A;  3VN0 A;  3BRT B;  1N7S C;  3SWY A;  2C0W A;  4R4M A;  1QLE D;  2AEJ A;  3C9I A;  3EFG A;  1N7S A;  1M1K Q;  3G3Z A;  1SFC B;  1BE3 E;  4M3L A;  1T8Z A;  3AE4 C;  1LT9 B;  1U57 A;  3AED C;  3HE5 B;  3NMD A;  2YNY A;  2QJK B;  2W83 C;  1NTK G;  2XND H;  1BE3 J;  1SQB K;  2N1T C;  3MP7 B;  2R3C A;  2W90 A;  4HH2 A;  4PV1 C;  3TYY A;  3WU2 E;  5CCG A;  5CCG C;  1FDI A;  5C39 A;  2KOG A;  3RL0 C;  5KLI B;  1BGY D;  1KOR A;  2L91 A;  1W5C E;  3L72 D;  3H32 B;  2IFM A;  4PD4 H;  2ZXE B;  3S4R A;  4XFJ A;  5AW9 B;  1KFN A;  1NTK E;  3TGU J;  1NWQ A;  1VQK P;  5KLV E;  3RK2 B;  1JMM A;  2V4H A;  4XA4 A;  2FBW C;  1Y8A A;  2WSF H;  2Q7C A;  2H88 C;  3HE4 B;  3L70 J;  3IF4 A;  4N6J A;  5APW A;  2V7Q H;  4ZKP A;  1ZR4 A;  1FZC C;  2OYI B;  4BWN A;  1JTH B;  4U3F D;  1G2C B;  3BAS A;  3HE4 A;  4AYC A;  2XU6 A;  2B89 A;  1P84 H;  3KHU A;  4JF7 A;  1BCC D;  5AW1 B;  1S5L E;  4GT1 A;  1L2P A;  1NO4 A;  3V2P A;  4Y28 J;  4WVZ A;  1EDJ A;  1RHZ B;  2XZR A;  4C46 A;  1NTM E;  2A45 H;  1Q81 Q;  1JO5 A;  1M1J A;  4UB8 E;  1BSH A;  1PGQ A;  1X22 A;  1T6A A;  4N78 E;  4WY4 B;  5AVT B;  2WSC J;  2H43 A;  2HLO A;  2E42 A;  3B4S A;  2PAJ A;  1EDI A;  2SPZ A;  1K8A Q;  3PTZ A;  2Q3I A;  1GU4 A;  1MV8 A;  1DEE G;  3B71 A;  2WT7 B;  3PJS K;  1SQQ K;  1ZLL A;  3TDK A;  1BGY G;  2PP6 A;  3Q3D A;  3CMA P;  2AEM A;  2IZ0 A;  4WWI A;  1HWT C;  1NKZ B;  2P10 A;  2W6A A;  3SWK A;  3CD6 P;  1RY3 A;  2Y0C A;  3RK3 E;  2R3S A;  2K1A A;  3A7O A;  2WSF J;  2Y9Z A;  1LWU A;  4YTP C;  3V5B A;  5B5E H;  2P1J A;  3L72 G;  1RF1 B;  2ZT9 C;  1U7J A;  1WRG A;  3GW6 A;  2AXT H;  2W8Z A;  2KI7 B;  5KAI E;  4BXL A;  1ZXG A;  3CPW O;  3KZI E;  1HTL C;  3UIA A;  3CC2 P;  1BCC J;  3N7N A;  5APY A;  4RO0 A;  1KYO I;  3GMA A;  2HPC B;  1KB9 I;  3ABV C;  1PGJ A;  3BCC J;  2KB7 P;  3CXH E;  4IL6 E;  2JO1 A;  3L73 G;  3CCM P;  1NTK J;  3TGU E;  1CW5 A;  3RL0 D;  5CCG D;  2ZT9 B;  5AVQ B;  2WMM A;  4TLF A;  1S5L H;  4RJT A;  4YPC A;  2J5U A;  2YKO A;  2MJZ A;  2OTJ P;  4WY4 D;  2Q1K A;  1YTZ I;  4H44 D;  5AW3 B;  3AEB C;  4ZNC A;  3JC2 2;  2M5A B;  4JYB A;  3L72 J;  1QX8 A;  3H1I G;  1YHQ P;  1D7M A;  1G1J A;  5DJT B;  5KLV J;  1M8O B;  2B87 A;  1IK7 A;  3HRN A;  1EZV G;  4N78 D;  3PLN A;  1NAY A;  5CJ0 A;  3L70 E;  2IX7 C;  2NPS A;  5TIS H;  2OGU A;  3PH0 A;  3A0H H;  3M0A A;  3HTK A;  2FKW B;  3O6Q B;  4BRY B;  4EI2 A;  1YQ4 C;  2FXO A;  5AW8 B;  1SFC C;  2K9J A;  1Z56 A;  4OGQ C;  4C7N A;  3A5T A;  1BGY E;  1JNM A;  3L73 J;  1VQP P;  3L75 E;  1PP9 E;  4GOD A;  2WVR A;  4IFF A;  1N7S D;  1USE A;  1FU1 A;  1BE3 G;  1PPJ E;  1Q2N A;  2WZ7 A;  2OTK E;  2IYO A;  2ITA A;  4KHX A;  3B8E B;  4PD4 I;  1VQ5 P;  4D6T E;  3CX5 H;  3L73 D;  3AE8 C;  4MN4 C;  3RK3 C;  1AFO A;  2QM8 A;  4I6M C;  3P32 A;  3TNU B;  1FZE A;  1PP9 G;  1OXZ A;  5AW6 B;  5GTI E;  4H13 D;  4WY4 A;  1RH5 B;  1JEK A;  1S2E A;  1NTZ K;  1L0L J;  1VDF A;  3FGA D;  4U3F E;  3K5B A;  3WUV A;  3S1K A;  1N73 C;  3H1H E;  2E76 C;  3H1J J;  1N73 A;  5KKZ B;  3TF5 A;  1H89 A;  1HBW A;  2MKV A;  2KXP B;  4R4L A;  4UB6 E;  3AEG C;  3W67 A;  2ZXX A;  3L70 G;  2N9Y B;  3KQG A;  3USS A;  1JMB A;  2JWD A;  1RQU A;  2C9L Y;  5TJH A;  1L0L D; 
#chains in the Genus database with same CATH homology
 1Y47 A;  2KZI A;  1ZW0 A;  2LXB A;  1SS1 A;  1JM0 A;  2LXC B;  1OVR A;  2I8D A;  4JBZ A;  5C39 A;  1EDL A;  4HB1 A;  2KZJ A;  2M0B A;  1H0T A;  2ZAE B;  5DJU B;  2KUB A;  1H0T B;  1S3J A;  3MHV A;  1BDD A;  4HJG H;  2KIK A;  2B89 A;  1EDJ A;  4EYY Q;  2UWJ E;  1LP1 B;  3ZDM A;  4ASV A;  1EDI A;  2SPZ A;  3FXE A;  1DEE G;  1BDC A;  1OVU A;  5K5G B;  2B87 B;  4WWI A;  1MFT A;  2K3R A;  1EDK A;  4NPF X;  1U7J A;  2HR3 A;  2KI7 B;  1LP1 A;  4BXL A;  1ZXG A;  4K3A A;  1OVV A;  4IOI H;  4HKZ H;  2B88 A;  4ZMD A;  2P58 A;  3QWO C;  2WMM A;  2Q1K A;  4K35 A;  4ZNC A;  2M5A B;  2QVA A;  4GOE A;  4GOF A;  4ASW A;  4CPG A;  5DJT B;  2B87 A;  1FC2 C;  2M5A A;  4NPD A;  1EC5 A;  3PH0 A;  2KS1 B;  3MZW B;  2RKL A;  4GOD A;  2R44 A;  1U7M A;  1Q2N A;  2OTK E;  2QRX A;  4MN4 C;  1NVO A;  5CBN A;  5CBO A;  3FXD A;  3S1K A;  1X0T A;  2LR2 A;  1LT1 A;  4KJM A;  4NPE A;  1JMB A;  2JWD A;  5EFW B;  3RGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...