2KIKA

An artificial di-iron oxo-protein with phenol oxidase activity
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
48
structure length
48
Chain Sequence
DYLRELLKGELQGIKQYREALEYTHNPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Artificial diiron protein
publication title An artificial di-iron oxo-protein with phenol oxidase activity
rcsb
molecule tags De novo protein
total genus 14
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kikA00
2HR3A 1EDLA 2SPZA 1OVVA 2I8DA 1H0TB 2QRXA 3RGUA 4JBZA 1Q2NA 2M5AA 1OVUA 4MN4C 3ZDMA 2OTKE 2B87A 2RKLA 2LXCB 1BDDA 1Y47A 4ASWA 2LR2A 1JM0A 5EFWB 2R44A 3FXDA 1FC2C 1SS1A 4ZNCA 3S1KA 2P58A 2KZJA 2UWJE 2KS1B 4K35A 2LXBA 1LP1A 4NPDA 5CBOA 2M0BA 4CPGA 2KI7B 4EYYQ 2ZAEB 2KIKA 2B88A 4IOIH 3QWOC 4HKZH 4HJGH 5K5GB 4K3AA 4NPFX 4ZMDA 1EDKA 4ASVA 1OVRA 1H0TA 3MZWB 5C39A 4BXLA 2QVAA 2JWDA 4GOEA 2M5AB 5DJTB 3FXEA 1MFTA 2KUBA 1U7MA 1EDJA 1U7JA 2WMMA 1ZW0A 1LT1A 4KJMA 2B87B 4GOFA 1X0TA 3MHVA 1EDIA 2Q1KA 1BDCA 4NPEA 5CBNA 1EC5A 1DEEG 1LP1B 1JMBA 1NVOA 4HB1A 5DJUB 2K3RA 1ZXGA 4WWIA 3PH0A 4GODA 2B89A 1S3JA 2KZIA
chains in the Genus database with same CATH superfamily
3H1LD 2QEXP 1LTGC 2YKQA 3NTNA 1N7SA 3A5TA 3Q5PA 3RGUA 1Q2NA 2BCCG 1LT9C 1BCCD 2Y9YA 1PPJD 1GTWA 3BCCD 1SP4A 3L75D 1X22A 3LIEA 3AE1C 2OYHB 2P58A 1SQXG 2QJYB 2BEQD 3BATA 1LTJC 3CX5D 3L72J 3TNUA 5KJ7D 4N3YB 2HPCB 1LWUC 5KLVG 3AE4C 4HJGH 1USDA 1S72P 3CXHE 1S5LE 1EDKA 1Y9BA 3N7NA 3AEBC 4OGQD 1T8ZA 1J2JB 1N7SB 1X8YA 2OGUA 5BVZA 3B5NB 2XKMA 3MUDA 1IK9A 1M1KQ 3FX0A 3SFEC 2YXQB 3M0DA 4GKGA 2AXTH 5AW8B 1P84E 3MTUE 3HD7A 4GOFA 4YTPC 3L73E 5TISH 3LW5J 5APUA 1X0TA 2WQYC 3MD0A 1N73A 4RJTA 3R4YA 2WT7B 2O01J 1J1DB 1NKZB 3TNUB 2DW3A 1U57A 2E5TA 2JWAA 3PP5A 4RO0A 1W2BO 4DOJA 2IFNA 4Y99B 1W5CE 1FZGA 4Z1MH 1EZVD 2H8PD 1YJWP 1ZLLA 2P10A 1K8AQ 3LIDA 2OARA 3HD7B 1NO4A 1N73B 1NTZK 5AW1B 3L70J 3L72G 3KQGA 4YPCA 1NTZE 3P8CD 2K88A 4PV1B 1URQC 1NJIQ 1ZRTE 3H1LE 1GMJA 4H44C 1RH5B 1M1JA 2N9BA 1H0TA 1LJ2A 2YIUC 3KPEA 4H0LB 2Q9IA 3HTKB 4JYCA 3RBXA 2YMKA 1JCDA 1VQ8P 2C0XA 2J5UA 1N7SD 5GTIE 2PGDA 2ZJSE 5E79E 1WRGA 2W27A 3CX5H 2Q1KA 2RMZA 3WU2H 3H1JG 3AEEC 4A7PA 1LWUA 3RK2C 3H1ID 3A7OA 1IJDB 3BASA 3N4XA 1N8RQ 3KDPB 1OW7A 2SPZA 3CCRP 1KYOD 1M1JB 2MJZA 5BU5A 1H0TB 1GK6A 2K37A 4UB6E 5AVVB 1AQTA 3H1KJ 1DEBA 3F5HA 2JO1A 1NGMB 3WUVA 1PP9E 2IBZE 2KYVA 3C9IA 2KSJA 3ITKA 2XZRA 3CC2P 4D6TD 1M90Q 1FDMA 4U3FD 3HD7D 1OW6A 3V2RA 3RL0B 5GTHH 4GDOA 1KTMA 5KKZC 1BGYJ 1NTKJ 3VMZA 4YXWH 3P8MC 3GW6A 1VF5C 1WT6A 4PV1D 3CLQA 3Q5RA 3AE9C 1RY3A 3AE2C 3H1HJ 4I1LA 1KZUB 2WSFH 4H0LD 1JNMA 1WMKA 1SFCA 4C7RA 2H43A 2IZ0A 2NRGA 2ZVNB 3HUSC 3IF4A 3P8CE 1HGZA 5DJUB 3L36A 1BCCJ 2K3RA 1S3JA 3HE4A 5KLIB 3BCCJ 1RE3A 1H88A 3EWKA 3T97A 1T2KC 3NXSA 1YBKA 3L75J 4XFJA 2QM7A 2QIWA 2KB7P 1OXZA 3P32A 1VQOP 1VQNP 2AXCA 2BCCE 1KV4A 3AE8C 1CZQA 2QJPB 4N78E 3M9BA 3SWKA 1SLQA 4WY4A 2JP3A 1KORA 1T3UA 1SFCB 5AW4B 1SQXK 1K73Q 2ZYDA 1LP1A 3TF5A 1SQXE 2N1TC 5APSA 1G2CA 5KLVK 3Q1MA 1JY2O 1BGYG 1HH0A 3HE4B 1AJYA 4NPFX 5CCGA 1NTKG 2YMYA 2Y0CA 3T97B 1KYOE 2WPVB 2KS1A 3CCEP 3RL0D 1Q7YQ 4DJGA 5KAFH 2FYUD 4LC1A 3H1HG 3H1LG 1M56D 2OYIB 4EOTA 2KSEA 5H2FE 3AEGC 3F89A 2LKMA 1G1JA 1OMIA 4WY4B 5CBNA 5L8RJ 1EC5A 3L70D 2OQQA 3AE7C 1BCCG 4D6TE 1LP1B 1ZR4A 1IFMA 1X79B 1PPJG 2YKOA 3BCCG 1G2CB 3A0HH 3VMYA 1R5LA 3L75G 3AE6C 1SQPD 3B8EB 4JBZA 1L4AC 2E74C 2ZT9C 1FE6A 3B5NC 3MP7B 1BSHA 3ABVC 3RL0g 2FYNB 3CXHI 4HH2A 3RK3B 2A45H 1KFMA 1Q86Q 1FZCA 5AVRB 3TYYA 2QJKB 2E76D 2KZJA 4UB8E 2D2CC 2HODA 3L72E 2M0BA 4DZOA 1JY3O 1P84I 1L2PA 1NTMJ 1SFCD 3AEAC 1M7LA 3CMEP 4IL6H 2WPSA 3WUUA 1HF9A 4PD4D 3H1IJ 1CI6B 4OGQB 1RE4C 5B66E 3VTPC 2Y9ZA 2WSCH 3U59A 3MIWA 3CC4P 1M8OB 3LW5H 3I55P 1IZNB 1KQFB 1NU1D 2FY8A 3KZIH 1EZVG 1DEEG 2HODB 1NVOA 2FFDC 3VMAA 3IFMA 5B5EH 3JCUH 1DH3A 4WY4D 1L0ND 5B5EE 1K05A 1PV3A 1CW5A 3E1RA 1L0LJ 2FBWC 2B9BA 4LLHA 2I8DA 1LTBC 2G3AA 2E5YA 3V6IA 2M3EA 1QVGO 1SVFA 4U3FJ 4L73A 3QH9A 5CCGD 1HVVA 2RN0A 3Q3DA 2E75C 1RF0C 4I6MC 2LR2A 5EFWB 1XTGB 1FC2C 3L70E 2UWJE 2LXBA 3V2PA 5CBOA 3CWBD 3RK3D 1OW8A 1PGJA 1IFPA 5AVZB 1DX7A 1MV8A 2YXRB 3PRJA 3WMM0 3L35A 3L71J 1PZQA 4JF7A 1L4AA 4WBAA 3H1IG 2YO2A 2PAJA 2JWDA 5DJTB 1MFTA 3GHGA 1HWTC 3CCVP 1JY2P 3EFGA 1E79H 2O1KA 2Q5UA 2NPSA 1BDCA 3L4FA 4OH8B 4GODA 2AEFA 1ZMEC 1YJNP 2IBZI 1VQLP 2WSCJ 4I2LC 4PD4H 5AW3B 2AXTE 1KMIZ 1KILC 3OJAB 3H25A 1RE4A 5TISE 4LGDE 5CCHA 1KD1Q 1K04A 4D6TG 2J58A 3H1KE 2QA4P 4U3FG 1OVUA 2IPPA 1BE3J 1SQQJ 3GHGB 1SQBD 3M9HA 1IFDA 1LTIC 4ZKUA 3CMAP 1JOCA 5AW2B 4R4MA 4ZNCA 4IFDK 3OA7A 2FYUJ 1AVOA 1OWAA 4IOIH 3GMAA 1NTKK 1BGYE 2A45G 1NTKE 2JDIH 4RKUJ 2Z5HA 5BU8B 5APWA 3SSUA 3H1HE 2GUVA 1FBMA 1SQVD 1Q90D 1VQ5P 2Z4EA 4H13C 1SQPJ 1JY3P 1LT9A 4U7JA 1Q82Q 3BRVB 3GLMA 5AVTB 3D70A 1KB9I 4I7ZB 3TGUD 1AFOA 1BCCE 1AQ5A 2ZYGA 2XDJA 1PPJE 3BCCE 1NTMD 1LTJA 2ITAA 3L75E 1ZN5A 3CX5E 1NYHA 3WU2E 1NAFA 2WZ7A 1GL2C 5APQA 3VOPA 2LXCB 1VL2A 1L4AD 3AE5C 2QM8A 1FU1A 1Y47A 3WUTA 2P7JA 1LT9B 2FYUG 1XTCC 3A2AA 3FWNA 1A02J 1HBWA 2KIKA 2VRSA 1KILA 5AVSB 2R5DA 1FAVA 2NPSD 3VP8A 1NU1J 3I56P 1LTJB 2C0WA 2W90A 3L70G 1L0LD 1NWQA 3MZWB 3CCLP 1LWUB 3CL3D 3G3ZA 1L0NJ 4RESB 5GTHE 5CCHD 1OX3A 1YJ9P 1KC8Q 1VQMP 1DD3A 1EZVE 1MUUA 2IYPA 5AW9B 1USEA 4WWIA 4KHXA 2KLVA 1UIIA 3L71D 5KJ7C 1OVVA 1CSBA 3GF7A 2WSSH 1URQA 1RF1C 3CWBJ 1IFJA 3ZDMA 3B4SA 1W2EA 3NFQA 4R4LA 1FDOA 5APVA 1YITP 3C1LA 3M9QA 1IC2A 1J1EB 3H1KG 3CCSP 3CCUP 1LTAC 4TLFA 5TJHA 3R2PA 2E76B 3L74J 1YQ4C 1NTME 4K3AA 3KHUA 1NU1G 2WWWA 1QLED 5AW6B 1FS0E 1KB9H 3I5CA 4BXLA 3H1IE 2QVAA 3HE5A 1URQB 1L0NG 4H44B 2Z5IA 1BE3D 1SQQD 2YIUB 3CCQP 2HYNA 1ZOYC 4AQRD 1HJ0A 3EFFK 3D71A 1GU4A 2A06D 2HFED 1SQBJ 1HGVA 5KAFE 3A3YB 2HR3A 1RQUA 3AECC 3RK2B 1L0LE 2P2UA 3TK1A 2OYHC 1KILD 1T6AA 2QJYC 3HE5B 4U3FE 4KT0J 1S9KD 1FJPA 1HTLC 2WTYA 1TU3F 1QVFO 3VMXA 3A0HE 1Y8AA 1AV1A 2R3SA 3S1KA 1VDFA 1QX8A 2KS1B 5AVQB 3W67A 1N7SC 1H89A 2OTLP 3BVHA 1FOSF 3JC22 3HUSA 1SQVJ 3L71E 4L74A 2W6BA 2JJLA 1RF1A 1RHZB 2PP6A 3BRTB 1QL1A 1EXJA 3V2NA 3TGUJ 1PFIA 5KKZB 1J1DC 3CXHD 1N7LA 5APTA 1VF5B 4OWFA 1LNQA 3MHVA 2CPBA 1URQD 2KNCA 1OIPA 4IL6E 4PJ0H 1LTSC 4H44D 5AVXB 4GIFA 2YO3A 4HB1A 4Y99C 5KAIH 1VQ7P 1JY2N 3GF3A 1P84D 3MUDC 2HG5D 1PGPA 3L73D 2JR8A 3CPWO 3HUSB 2ZFCA 2N1TA 4TT3H 1FZCB 2IZ1A 3HD7C 3GG2A 1S4XA 1N73C 1HUCA 4JPZB 2R3CA 3KZIE 1LGHB 5CHXA 4MN4C 2QE7H 1KQGB 3KXDA 2W83C 2Y0EA 1BE3E 3RK2D 1SQQE 1AA0A 5KLVJ 2RKLA 4PV1C 3JCUE 1S1CX 1VQPP 2M8RA 4ASWA 3SFDC 4ZKPA 1N2DC 2JEEA 2AEMA 1Q81Q 2FYUK 1QL2A 4H0LC 2FYUE 1IO4A 2W6JH 3NMDA 2K9YA 1YHQP 2XV5A 1SQVG 3UIAA 2OYHA 3IN6A 2N1TB 2KOGA 2POHA 1NTZD 2YKPA 4GOEA 2HPCA 5APYA 1NTMG 1U7MA 1ZRTD 2PFXA 3M91A 3MGNA 1SQPK 5KTBA 1SQPE 4HYTB 3CX5I 3B5NA 1M1JC 1MZ9A 1JO5A 1YTZI 2G8YA 1N86A 3K5BA 2GUSA 1VF5D 4N6JA 1JY3N 3FGAD 1NHLA 3L74D 4C7NA 1YTZT 2FXMA 3H6PA 1K9MQ 2WT7A 2QRXA 1X9VA 2ZVOB 2BEZF 3CI9A 3O8ZA 3PJSK 3CXHH 1S5LH 2KLUA 3RL0C 5AVUB 5AVWB 3V4QA 1L0LG 2R44A 4PD4E 1L4AB 2E74B 2KK7A 2ZT9B 1T2KD 4K35A 1VQ6P 1JCCA 1P84H 5AW7B 3G4SP 4W7YA 2R32A 4JYBA 5M1BA 1NU1K 1PP9D 3W68A 2IBZD 4C7NB 4Y28J 2AEJA 1NU1E 2D2CB 2V4HA 2FFDA 4B86A 3H1JJ 2NPSB 1EZVI 2XU6A 3VP9A 3TSIA 1L0NK 3FXEA 2E43A 2ZYAA 1L0NE 2WMMA 2N1TD 2PRRA 3L71G 1ZV8A 5KLIC 2L91A 4WB4A 3TDKA 3HTKA 2V7QH 2KP8A 4OVNF 1J1EC 3E7KA 1RF0A 4W80A 1ZXGA 2H88C 2E76C 3OAKA 1PGQA 1S2EA 4DCKA 2QJPC 1BSNA 3EQ2A 3S4RA 2I1KA 1FJKA 2FFDB 2CK3H 1SFCC 3CWBE 3RK3E 1PGOA 3G9RA 1FOSE 1JM0A 2IDBA 1RE3C 4W7ZA 3AE3C 4L75A 2JKVA 4CPGA 1KB9D 2BCCD 1BE3G 2E75B 1SQQG 5GTIH 2B88A 5CJ0A 5E79H 3L74E 4HKZH 4DT0A 4N78D 2ZT9D 2E74D 4YXDC 1KYOI 3B5ND 2ZXEB 2OYIC 2Q6QA 2XNXA 1FZFA 3HRNA 2OTJP 2A06G 1HJBA 5C39A 4WY4C 1SQXD 1DIPA 1GW4A 2KUBA 1KQSO 3CD6P 1EDJA 2D2CD 1GK4A 1U7JA 3VYIA 5KLVD 3L73J 1M57D 1MKMA 4UB6H 4C46A 2I1JA 1VQ9P 2CPSA 2FXPA 5CCGC 1JMBA 1G1IA 1LTTC 1RQVA 1SQBK 3AEFC 3VN0A 2Q3IA 4EIJA 4IL6X 1SQBE 2KZIA 2W6AA 4QMAA 2Y0DA 3SWFA 3L37A 1SQPG 2FYNC 3CC7P 1EDLA 1ZR2A 1EXIA 3RK3C 2O1JA 2M5AA 2QJKC 4EI2A 1QGKB 2V7QJ 2OTKE 5AVYB 4L76A 2B87A 3M0AA 2M3BA 1KILB 3A0BH 3FWLA 1KFNA 3USSA 1GDTA 3U1AA 1OZHA 2A45I 4M3LA 3A0BE 2C9LY 2Q7CA 1NTZJ 2WVRA 2KI7B 2H89C 2P1JA 1IFNA 3OW2O 4OGQC 3H1LJ 1SQVK 3D6ZA 1R5SA 1PIXA 1ZP0C 1SQVE 2P67A 2HLOA 1OVRA 2E75D 1FZCC 4IFFA 3L72D 2M5AB 3PLNA 5AW0B 4EDFA 4XE5B 3TGUE 3CCMP 1NTMK 3PTZA 5CMZA 3L73G 1ZW0A 1VQKP 2B87B 3H32A 2RH0A 1GL2A 4IFMA 1EQ7A 1KB9E 1A02F 3PH0A 2B89A 2OYIA 4H13B 1GW3A 2QSIA 3Q5SA 2OYOA 1NH4A 1R8EA 1QEXA 1GU5A 5APXA 2MKVA 1DD4A 1E5WA 3H1JD 1JTHA 3JSVC 2IYOA 1PL5A 1KYOH 5KLVE 1PP9J 1JUNA 4BRYA 1L0LK 3IR9A 3H32B 3FXDA 3V2QA 1NAYA 1NTZG 1GL2B 1S5LX 3CWBG 1KQLA 2ZXXA 2ZAEB 5H2FH 1GD2E 1Z56A 2FYZA 1D7MA 1VQ4P 4WVZA 2O01N 4ZMDA 3PHLA 5AW5B 3P7KA 1NKNA 2WSEH 1OFCX 5CJ4A 1JTHB 3L74G 2J59M 5KJ7A 4GT1A 1YYCA 1T3JA 1GZLA 2L5GB 3U1CA 3O6QA 4BRYB 2WSFJ 1EDIA 2W8ZA 1CI6A 3IAOA 2FKWB 2IFMA 3KYQA 2K9JA 2XNDH 2E42A 3GHGC 1FZEA 4UB8H 3CCJP 4PD4I 2QG4A 1YQ3C 4H13D 2GM4A 4PJ0E 2NPSC 2BCCJ 1SQBG 3B71A 3D6YA 1JB0J 1PP9G 1NOHA 2IBZG 1BDDA 5KAIE 2BASA 4BWNA 1VPCA 3O6QB 4AUWA 2KXPB 3M0DC 1SS1A 3G71P 1RF1B 1MFZA 3M06A 2N9YB 1UIXA 2FXOA 1AVYA 3H1KD 4NPDA 1SQXJ 5B66H 3G6EP 5CCHC 1SQQK 4EYYQ 2GA1A 4AYCA 1FDIA 3QWOC 3SWYA 5K5GB 2K9JB 2WITA 1YI2P 2H7HA 1GL2D 4ASVA 1IK7A 1KN7A 2O01H 1JEKA 4O9BA 2K1AA 3E1IA 2WPRA 2KNCB 3H1JE 1JMMA 1IFIA 2A06E 1YIJP 2O3JA 2C9NY 1FZBA 2WPQA 4JQ0D 4I7ZC 2Q3EA 1LT1A 4KJMA 1FZAA 3C8VA 3V5BA 1BGYD 1H8AA 3II6A 1NTKD 4NPEA 3RBZA 2R5BA 4D6TJ 3AEDC 4XA4A 3TGUG 1KILE 3S9OA 2YNYA 1S9KE 2NZ2A 3V4WA 2IX7C 2WSEJ 3H1HD 3Q2YA
chains in the Genus database with same CATH topology
2HR3A 1EDLA 2SPZA 1OVVA 2I8DA 1H0TB 2QRXA 3RGUA 4JBZA 1Q2NA 2M5AA 1OVUA 4MN4C 3ZDMA 2OTKE 2B87A 2RKLA 2LXCB 1BDDA 1Y47A 4ASWA 2LR2A 1JM0A 5EFWB 2R44A 3FXDA 1FC2C 1SS1A 4ZNCA 3S1KA 2P58A 2KZJA 2UWJE 2KS1B 4K35A 2LXBA 1LP1A 4NPDA 5CBOA 2M0BA 4CPGA 2KI7B 4EYYQ 2ZAEB 2KIKA 2B88A 4IOIH 3QWOC 4HKZH 4HJGH 5K5GB 4K3AA 4NPFX 4ZMDA 1EDKA 4ASVA 1OVRA 1H0TA 3MZWB 5C39A 4BXLA 2QVAA 2JWDA 4GOEA 2M5AB 5DJTB 3FXEA 1MFTA 2KUBA 1U7MA 1EDJA 1U7JA 2WMMA 1ZW0A 1LT1A 4KJMA 2B87B 4GOFA 1X0TA 3MHVA 1EDIA 2Q1KA 1BDCA 4NPEA 5CBNA 1EC5A 1DEEG 1LP1B 1JMBA 1NVOA 4HB1A 5DJUB 2K3RA 1ZXGA 4WWIA 3PH0A 4GODA 2B89A 1S3JA 2KZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HR3 A;  1EDL A;  2SPZ A;  1OVV A;  2I8D A;  1H0T B;  2QRX A;  3RGU A;  4JBZ A;  1Q2N A;  2M5A A;  1OVU A;  4MN4 C;  3ZDM A;  2OTK E;  2B87 A;  2RKL A;  2LXC B;  1BDD A;  1Y47 A;  4ASW A;  2LR2 A;  1JM0 A;  5EFW B;  2R44 A;  3FXD A;  1FC2 C;  1SS1 A;  4ZNC A;  3S1K A;  2P58 A;  2KZJ A;  2UWJ E;  2KS1 B;  4K35 A;  2LXB A;  1LP1 A;  4NPD A;  5CBO A;  2M0B A;  4CPG A;  2KI7 B;  4EYY Q;  2ZAE B;  2KIK A;  2B88 A;  4IOI H;  3QWO C;  4HKZ H;  4HJG H;  5K5G B;  4K3A A;  4NPF X;  4ZMD A;  1EDK A;  4ASV A;  1OVR A;  1H0T A;  3MZW B;  5C39 A;  4BXL A;  2QVA A;  2JWD A;  4GOE A;  2M5A B;  5DJT B;  3FXE A;  1MFT A;  2KUB A;  1U7M A;  1EDJ A;  1U7J A;  2WMM A;  1ZW0 A;  1LT1 A;  4KJM A;  2B87 B;  4GOF A;  1X0T A;  3MHV A;  1EDI A;  2Q1K A;  1BDC A;  4NPE A;  5CBN A;  1EC5 A;  1DEE G;  1LP1 B;  1JMB A;  1NVO A;  4HB1 A;  5DJU B;  2K3R A;  1ZXG A;  4WWI A;  3PH0 A;  4GOD A;  2B89 A;  1S3J A;  2KZI A; 
#chains in the Genus database with same CATH topology
 3H1L D;  2QEX P;  1LTG C;  2YKQ A;  3NTN A;  1N7S A;  3A5T A;  3Q5P A;  3RGU A;  1Q2N A;  2BCC G;  1LT9 C;  1BCC D;  2Y9Y A;  1PPJ D;  1GTW A;  3BCC D;  1SP4 A;  3L75 D;  1X22 A;  3LIE A;  3AE1 C;  2OYH B;  2P58 A;  1SQX G;  2QJY B;  2BEQ D;  3BAT A;  1LTJ C;  3CX5 D;  3L72 J;  3TNU A;  5KJ7 D;  4N3Y B;  2HPC B;  1LWU C;  5KLV G;  3AE4 C;  4HJG H;  1USD A;  1S72 P;  3CXH E;  1S5L E;  1EDK A;  1Y9B A;  3N7N A;  3AEB C;  4OGQ D;  1T8Z A;  1J2J B;  1N7S B;  1X8Y A;  2OGU A;  5BVZ A;  3B5N B;  2XKM A;  3MUD A;  1IK9 A;  1M1K Q;  3FX0 A;  3SFE C;  2YXQ B;  3M0D A;  4GKG A;  2AXT H;  5AW8 B;  1P84 E;  3MTU E;  3HD7 A;  4GOF A;  4YTP C;  3L73 E;  5TIS H;  3LW5 J;  5APU A;  1X0T A;  2WQY C;  3MD0 A;  1N73 A;  4RJT A;  3R4Y A;  2WT7 B;  2O01 J;  1J1D B;  1NKZ B;  3TNU B;  2DW3 A;  1U57 A;  2E5T A;  2JWA A;  3PP5 A;  4RO0 A;  1W2B O;  4DOJ A;  2IFN A;  4Y99 B;  1W5C E;  1FZG A;  4Z1M H;  1EZV D;  2H8P D;  1YJW P;  1ZLL A;  2P10 A;  1K8A Q;  3LID A;  2OAR A;  3HD7 B;  1NO4 A;  1N73 B;  1NTZ K;  5AW1 B;  3L70 J;  3L72 G;  3KQG A;  4YPC A;  1NTZ E;  3P8C D;  2K88 A;  4PV1 B;  1URQ C;  1NJI Q;  1ZRT E;  3H1L E;  1GMJ A;  4H44 C;  1RH5 B;  1M1J A;  2N9B A;  1H0T A;  1LJ2 A;  2YIU C;  3KPE A;  4H0L B;  2Q9I A;  3HTK B;  4JYC A;  3RBX A;  2YMK A;  1JCD A;  1VQ8 P;  2C0X A;  2J5U A;  1N7S D;  5GTI E;  2PGD A;  2ZJS E;  5E79 E;  1WRG A;  2W27 A;  3CX5 H;  2Q1K A;  2RMZ A;  3WU2 H;  3H1J G;  3AEE C;  4A7P A;  1LWU A;  3RK2 C;  3H1I D;  3A7O A;  1IJD B;  3BAS A;  3N4X A;  1N8R Q;  3KDP B;  1OW7 A;  2SPZ A;  3CCR P;  1KYO D;  1M1J B;  2MJZ A;  5BU5 A;  1H0T B;  1GK6 A;  2K37 A;  4UB6 E;  5AVV B;  1AQT A;  3H1K J;  1DEB A;  3F5H A;  2JO1 A;  1NGM B;  3WUV A;  1PP9 E;  2IBZ E;  2KYV A;  3C9I A;  2KSJ A;  3ITK A;  2XZR A;  3CC2 P;  4D6T D;  1M90 Q;  1FDM A;  4U3F D;  3HD7 D;  1OW6 A;  3V2R A;  3RL0 B;  5GTH H;  4GDO A;  1KTM A;  5KKZ C;  1BGY J;  1NTK J;  3VMZ A;  4YXW H;  3P8M C;  3GW6 A;  1VF5 C;  1WT6 A;  4PV1 D;  3CLQ A;  3Q5R A;  3AE9 C;  1RY3 A;  3AE2 C;  3H1H J;  4I1L A;  1KZU B;  2WSF H;  4H0L D;  1JNM A;  1WMK A;  1SFC A;  4C7R A;  2H43 A;  2IZ0 A;  2NRG A;  2ZVN B;  3HUS C;  3IF4 A;  3P8C E;  1HGZ A;  5DJU B;  3L36 A;  1BCC J;  2K3R A;  1S3J A;  3HE4 A;  5KLI B;  3BCC J;  1RE3 A;  1H88 A;  3EWK A;  3T97 A;  1T2K C;  3NXS A;  1YBK A;  3L75 J;  4XFJ A;  2QM7 A;  2QIW A;  2KB7 P;  1OXZ A;  3P32 A;  1VQO P;  1VQN P;  2AXC A;  2BCC E;  1KV4 A;  3AE8 C;  1CZQ A;  2QJP B;  4N78 E;  3M9B A;  3SWK A;  1SLQ A;  4WY4 A;  2JP3 A;  1KOR A;  1T3U A;  1SFC B;  5AW4 B;  1SQX K;  1K73 Q;  2ZYD A;  1LP1 A;  3TF5 A;  1SQX E;  2N1T C;  5APS A;  1G2C A;  5KLV K;  3Q1M A;  1JY2 O;  1BGY G;  1HH0 A;  3HE4 B;  1AJY A;  4NPF X;  5CCG A;  1NTK G;  2YMY A;  2Y0C A;  3T97 B;  1KYO E;  2WPV B;  2KS1 A;  3CCE P;  3RL0 D;  1Q7Y Q;  4DJG A;  5KAF H;  2FYU D;  4LC1 A;  3H1H G;  3H1L G;  1M56 D;  2OYI B;  4EOT A;  2KSE A;  5H2F E;  3AEG C;  3F89 A;  2LKM A;  1G1J A;  1OMI A;  4WY4 B;  5CBN A;  5L8R J;  1EC5 A;  3L70 D;  2OQQ A;  3AE7 C;  1BCC G;  4D6T E;  1LP1 B;  1ZR4 A;  1IFM A;  1X79 B;  1PPJ G;  2YKO A;  3BCC G;  1G2C B;  3A0H H;  3VMY A;  1R5L A;  3L75 G;  3AE6 C;  1SQP D;  3B8E B;  4JBZ A;  1L4A C;  2E74 C;  2ZT9 C;  1FE6 A;  3B5N C;  3MP7 B;  1BSH A;  3ABV C;  3RL0 g;  2FYN B;  3CXH I;  4HH2 A;  3RK3 B;  2A45 H;  1KFM A;  1Q86 Q;  1FZC A;  5AVR B;  3TYY A;  2QJK B;  2E76 D;  2KZJ A;  4UB8 E;  2D2C C;  2HOD A;  3L72 E;  2M0B A;  4DZO A;  1JY3 O;  1P84 I;  1L2P A;  1NTM J;  1SFC D;  3AEA C;  1M7L A;  3CME P;  4IL6 H;  2WPS A;  3WUU A;  1HF9 A;  4PD4 D;  3H1I J;  1CI6 B;  4OGQ B;  1RE4 C;  5B66 E;  3VTP C;  2Y9Z A;  2WSC H;  3U59 A;  3MIW A;  3CC4 P;  1M8O B;  3LW5 H;  3I55 P;  1IZN B;  1KQF B;  1NU1 D;  2FY8 A;  3KZI H;  1EZV G;  1DEE G;  2HOD B;  1NVO A;  2FFD C;  3VMA A;  3IFM A;  5B5E H;  3JCU H;  1DH3 A;  4WY4 D;  1L0N D;  5B5E E;  1K05 A;  1PV3 A;  1CW5 A;  3E1R A;  1L0L J;  2FBW C;  2B9B A;  4LLH A;  2I8D A;  1LTB C;  2G3A A;  2E5Y A;  3V6I A;  2M3E A;  1QVG O;  1SVF A;  4U3F J;  4L73 A;  3QH9 A;  5CCG D;  1HVV A;  2RN0 A;  3Q3D A;  2E75 C;  1RF0 C;  4I6M C;  2LR2 A;  5EFW B;  1XTG B;  1FC2 C;  3L70 E;  2UWJ E;  2LXB A;  3V2P A;  5CBO A;  3CWB D;  3RK3 D;  1OW8 A;  1PGJ A;  1IFP A;  5AVZ B;  1DX7 A;  1MV8 A;  2YXR B;  3PRJ A;  3WMM 0;  3L35 A;  3L71 J;  1PZQ A;  4JF7 A;  1L4A A;  4WBA A;  3H1I G;  2YO2 A;  2PAJ A;  2JWD A;  5DJT B;  1MFT A;  3GHG A;  1HWT C;  3CCV P;  1JY2 P;  3EFG A;  1E79 H;  2O1K A;  2Q5U A;  2NPS A;  1BDC A;  3L4F A;  4OH8 B;  4GOD A;  2AEF A;  1ZME C;  1YJN P;  2IBZ I;  1VQL P;  2WSC J;  4I2L C;  4PD4 H;  5AW3 B;  2AXT E;  1KMI Z;  1KIL C;  3OJA B;  3H25 A;  1RE4 A;  5TIS E;  4LGD E;  5CCH A;  1KD1 Q;  1K04 A;  4D6T G;  2J58 A;  3H1K E;  2QA4 P;  4U3F G;  1OVU A;  2IPP A;  1BE3 J;  1SQQ J;  3GHG B;  1SQB D;  3M9H A;  1IFD A;  1LTI C;  4ZKU A;  3CMA P;  1JOC A;  5AW2 B;  4R4M A;  4ZNC A;  4IFD K;  3OA7 A;  2FYU J;  1AVO A;  1OWA A;  4IOI H;  3GMA A;  1NTK K;  1BGY E;  2A45 G;  1NTK E;  2JDI H;  4RKU J;  2Z5H A;  5BU8 B;  5APW A;  3SSU A;  3H1H E;  2GUV A;  1FBM A;  1SQV D;  1Q90 D;  1VQ5 P;  2Z4E A;  4H13 C;  1SQP J;  1JY3 P;  1LT9 A;  4U7J A;  1Q82 Q;  3BRV B;  3GLM A;  5AVT B;  3D70 A;  1KB9 I;  4I7Z B;  3TGU D;  1AFO A;  1BCC E;  1AQ5 A;  2ZYG A;  2XDJ A;  1PPJ E;  3BCC E;  1NTM D;  1LTJ A;  2ITA A;  3L75 E;  1ZN5 A;  3CX5 E;  1NYH A;  3WU2 E;  1NAF A;  2WZ7 A;  1GL2 C;  5APQ A;  3VOP A;  2LXC B;  1VL2 A;  1L4A D;  3AE5 C;  2QM8 A;  1FU1 A;  1Y47 A;  3WUT A;  2P7J A;  1LT9 B;  2FYU G;  1XTC C;  3A2A A;  3FWN A;  1A02 J;  1HBW A;  2KIK A;  2VRS A;  1KIL A;  5AVS B;  2R5D A;  1FAV A;  2NPS D;  3VP8 A;  1NU1 J;  3I56 P;  1LTJ B;  2C0W A;  2W90 A;  3L70 G;  1L0L D;  1NWQ A;  3MZW B;  3CCL P;  1LWU B;  3CL3 D;  3G3Z A;  1L0N J;  4RES B;  5GTH E;  5CCH D;  1OX3 A;  1YJ9 P;  1KC8 Q;  1VQM P;  1DD3 A;  1EZV E;  1MUU A;  2IYP A;  5AW9 B;  1USE A;  4WWI A;  4KHX A;  2KLV A;  1UII A;  3L71 D;  5KJ7 C;  1OVV A;  1CSB A;  3GF7 A;  2WSS H;  1URQ A;  1RF1 C;  3CWB J;  1IFJ A;  3ZDM A;  3B4S A;  1W2E A;  3NFQ A;  4R4L A;  1FDO A;  5APV A;  1YIT P;  3C1L A;  3M9Q A;  1IC2 A;  1J1E B;  3H1K G;  3CCS P;  3CCU P;  1LTA C;  4TLF A;  5TJH A;  3R2P A;  2E76 B;  3L74 J;  1YQ4 C;  1NTM E;  4K3A A;  3KHU A;  1NU1 G;  2WWW A;  1QLE D;  5AW6 B;  1FS0 E;  1KB9 H;  3I5C A;  4BXL A;  3H1I E;  2QVA A;  3HE5 A;  1URQ B;  1L0N G;  4H44 B;  2Z5I A;  1BE3 D;  1SQQ D;  2YIU B;  3CCQ P;  2HYN A;  1ZOY C;  4AQR D;  1HJ0 A;  3EFF K;  3D71 A;  1GU4 A;  2A06 D;  2HFE D;  1SQB J;  1HGV A;  5KAF E;  3A3Y B;  2HR3 A;  1RQU A;  3AEC C;  3RK2 B;  1L0L E;  2P2U A;  3TK1 A;  2OYH C;  1KIL D;  1T6A A;  2QJY C;  3HE5 B;  4U3F E;  4KT0 J;  1S9K D;  1FJP A;  1HTL C;  2WTY A;  1TU3 F;  1QVF O;  3VMX A;  3A0H E;  1Y8A A;  1AV1 A;  2R3S A;  3S1K A;  1VDF A;  1QX8 A;  2KS1 B;  5AVQ B;  3W67 A;  1N7S C;  1H89 A;  2OTL P;  3BVH A;  1FOS F;  3JC2 2;  3HUS A;  1SQV J;  3L71 E;  4L74 A;  2W6B A;  2JJL A;  1RF1 A;  1RHZ B;  2PP6 A;  3BRT B;  1QL1 A;  1EXJ A;  3V2N A;  3TGU J;  1PFI A;  5KKZ B;  1J1D C;  3CXH D;  1N7L A;  5APT A;  1VF5 B;  4OWF A;  1LNQ A;  3MHV A;  2CPB A;  1URQ D;  2KNC A;  1OIP A;  4IL6 E;  4PJ0 H;  1LTS C;  4H44 D;  5AVX B;  4GIF A;  2YO3 A;  4HB1 A;  4Y99 C;  5KAI H;  1VQ7 P;  1JY2 N;  3GF3 A;  1P84 D;  3MUD C;  2HG5 D;  1PGP A;  3L73 D;  2JR8 A;  3CPW O;  3HUS B;  2ZFC A;  2N1T A;  4TT3 H;  1FZC B;  2IZ1 A;  3HD7 C;  3GG2 A;  1S4X A;  1N73 C;  1HUC A;  4JPZ B;  2R3C A;  3KZI E;  1LGH B;  5CHX A;  4MN4 C;  2QE7 H;  1KQG B;  3KXD A;  2W83 C;  2Y0E A;  1BE3 E;  3RK2 D;  1SQQ E;  1AA0 A;  5KLV J;  2RKL A;  4PV1 C;  3JCU E;  1S1C X;  1VQP P;  2M8R A;  4ASW A;  3SFD C;  4ZKP A;  1N2D C;  2JEE A;  2AEM A;  1Q81 Q;  2FYU K;  1QL2 A;  4H0L C;  2FYU E;  1IO4 A;  2W6J H;  3NMD A;  2K9Y A;  1YHQ P;  2XV5 A;  1SQV G;  3UIA A;  2OYH A;  3IN6 A;  2N1T B;  2KOG A;  2POH A;  1NTZ D;  2YKP A;  4GOE A;  2HPC A;  5APY A;  1NTM G;  1U7M A;  1ZRT D;  2PFX A;  3M91 A;  3MGN A;  1SQP K;  5KTB A;  1SQP E;  4HYT B;  3CX5 I;  3B5N A;  1M1J C;  1MZ9 A;  1JO5 A;  1YTZ I;  2G8Y A;  1N86 A;  3K5B A;  2GUS A;  1VF5 D;  4N6J A;  1JY3 N;  3FGA D;  1NHL A;  3L74 D;  4C7N A;  1YTZ T;  2FXM A;  3H6P A;  1K9M Q;  2WT7 A;  2QRX A;  1X9V A;  2ZVO B;  2BEZ F;  3CI9 A;  3O8Z A;  3PJS K;  3CXH H;  1S5L H;  2KLU A;  3RL0 C;  5AVU B;  5AVW B;  3V4Q A;  1L0L G;  2R44 A;  4PD4 E;  1L4A B;  2E74 B;  2KK7 A;  2ZT9 B;  1T2K D;  4K35 A;  1VQ6 P;  1JCC A;  1P84 H;  5AW7 B;  3G4S P;  4W7Y A;  2R32 A;  4JYB A;  5M1B A;  1NU1 K;  1PP9 D;  3W68 A;  2IBZ D;  4C7N B;  4Y28 J;  2AEJ A;  1NU1 E;  2D2C B;  2V4H A;  2FFD A;  4B86 A;  3H1J J;  2NPS B;  1EZV I;  2XU6 A;  3VP9 A;  3TSI A;  1L0N K;  3FXE A;  2E43 A;  2ZYA A;  1L0N E;  2WMM A;  2N1T D;  2PRR A;  3L71 G;  1ZV8 A;  5KLI C;  2L91 A;  4WB4 A;  3TDK A;  3HTK A;  2V7Q H;  2KP8 A;  4OVN F;  1J1E C;  3E7K A;  1RF0 A;  4W80 A;  1ZXG A;  2H88 C;  2E76 C;  3OAK A;  1PGQ A;  1S2E A;  4DCK A;  2QJP C;  1BSN A;  3EQ2 A;  3S4R A;  2I1K A;  1FJK A;  2FFD B;  2CK3 H;  1SFC C;  3CWB E;  3RK3 E;  1PGO A;  3G9R A;  1FOS E;  1JM0 A;  2IDB A;  1RE3 C;  4W7Z A;  3AE3 C;  4L75 A;  2JKV A;  4CPG A;  1KB9 D;  2BCC D;  1BE3 G;  2E75 B;  1SQQ G;  5GTI H;  2B88 A;  5CJ0 A;  5E79 H;  3L74 E;  4HKZ H;  4DT0 A;  4N78 D;  2ZT9 D;  2E74 D;  4YXD C;  1KYO I;  3B5N D;  2ZXE B;  2OYI C;  2Q6Q A;  2XNX A;  1FZF A;  3HRN A;  2OTJ P;  2A06 G;  1HJB A;  5C39 A;  4WY4 C;  1SQX D;  1DIP A;  1GW4 A;  2KUB A;  1KQS O;  3CD6 P;  1EDJ A;  2D2C D;  1GK4 A;  1U7J A;  3VYI A;  5KLV D;  3L73 J;  1M57 D;  1MKM A;  4UB6 H;  4C46 A;  2I1J A;  1VQ9 P;  2CPS A;  2FXP A;  5CCG C;  1JMB A;  1G1I A;  1LTT C;  1RQV A;  1SQB K;  3AEF C;  3VN0 A;  2Q3I A;  4EIJ A;  4IL6 X;  1SQB E;  2KZI A;  2W6A A;  4QMA A;  2Y0D A;  3SWF A;  3L37 A;  1SQP G;  2FYN C;  3CC7 P;  1EDL A;  1ZR2 A;  1EXI A;  3RK3 C;  2O1J A;  2M5A A;  2QJK C;  4EI2 A;  1QGK B;  2V7Q J;  2OTK E;  5AVY B;  4L76 A;  2B87 A;  3M0A A;  2M3B A;  1KIL B;  3A0B H;  3FWL A;  1KFN A;  3USS A;  1GDT A;  3U1A A;  1OZH A;  2A45 I;  4M3L A;  3A0B E;  2C9L Y;  2Q7C A;  1NTZ J;  2WVR A;  2KI7 B;  2H89 C;  2P1J A;  1IFN A;  3OW2 O;  4OGQ C;  3H1L J;  1SQV K;  3D6Z A;  1R5S A;  1PIX A;  1ZP0 C;  1SQV E;  2P67 A;  2HLO A;  1OVR A;  2E75 D;  1FZC C;  4IFF A;  3L72 D;  2M5A B;  3PLN A;  5AW0 B;  4EDF A;  4XE5 B;  3TGU E;  3CCM P;  1NTM K;  3PTZ A;  5CMZ A;  3L73 G;  1ZW0 A;  1VQK P;  2B87 B;  3H32 A;  2RH0 A;  1GL2 A;  4IFM A;  1EQ7 A;  1KB9 E;  1A02 F;  3PH0 A;  2B89 A;  2OYI A;  4H13 B;  1GW3 A;  2QSI A;  3Q5S A;  2OYO A;  1NH4 A;  1R8E A;  1QEX A;  1GU5 A;  5APX A;  2MKV A;  1DD4 A;  1E5W A;  3H1J D;  1JTH A;  3JSV C;  2IYO A;  1PL5 A;  1KYO H;  5KLV E;  1PP9 J;  1JUN A;  4BRY A;  1L0L K;  3IR9 A;  3H32 B;  3FXD A;  3V2Q A;  1NAY A;  1NTZ G;  1GL2 B;  1S5L X;  3CWB G;  1KQL A;  2ZXX A;  2ZAE B;  5H2F H;  1GD2 E;  1Z56 A;  2FYZ A;  1D7M A;  1VQ4 P;  4WVZ A;  2O01 N;  4ZMD A;  3PHL A;  5AW5 B;  3P7K A;  1NKN A;  2WSE H;  1OFC X;  5CJ4 A;  1JTH B;  3L74 G;  2J59 M;  5KJ7 A;  4GT1 A;  1YYC A;  1T3J A;  1GZL A;  2L5G B;  3U1C A;  3O6Q A;  4BRY B;  2WSF J;  1EDI A;  2W8Z A;  1CI6 A;  3IAO A;  2FKW B;  2IFM A;  3KYQ A;  2K9J A;  2XND H;  2E42 A;  3GHG C;  1FZE A;  4UB8 H;  3CCJ P;  4PD4 I;  2QG4 A;  1YQ3 C;  4H13 D;  2GM4 A;  4PJ0 E;  2NPS C;  2BCC J;  1SQB G;  3B71 A;  3D6Y A;  1JB0 J;  1PP9 G;  1NOH A;  2IBZ G;  1BDD A;  5KAI E;  2BAS A;  4BWN A;  1VPC A;  3O6Q B;  4AUW A;  2KXP B;  3M0D C;  1SS1 A;  3G71 P;  1RF1 B;  1MFZ A;  3M06 A;  2N9Y B;  1UIX A;  2FXO A;  1AVY A;  3H1K D;  4NPD A;  1SQX J;  5B66 H;  3G6E P;  5CCH C;  1SQQ K;  4EYY Q;  2GA1 A;  4AYC A;  1FDI A;  3QWO C;  3SWY A;  5K5G B;  2K9J B;  2WIT A;  1YI2 P;  2H7H A;  1GL2 D;  4ASV A;  1IK7 A;  1KN7 A;  2O01 H;  1JEK A;  4O9B A;  2K1A A;  3E1I A;  2WPR A;  2KNC B;  3H1J E;  1JMM A;  1IFI A;  2A06 E;  1YIJ P;  2O3J A;  2C9N Y;  1FZB A;  2WPQ A;  4JQ0 D;  4I7Z C;  2Q3E A;  1LT1 A;  4KJM A;  1FZA A;  3C8V A;  3V5B A;  1BGY D;  1H8A A;  3II6 A;  1NTK D;  4NPE A;  3RBZ A;  2R5B A;  4D6T J;  3AED C;  4XA4 A;  3TGU G;  1KIL E;  3S9O A;  2YNY A;  1S9K E;  2NZ2 A;  3V4W A;  2IX7 C;  2WSE J;  3H1H D;  3Q2Y A; 
#chains in the Genus database with same CATH homology
 2HR3 A;  1EDL A;  2SPZ A;  1OVV A;  2I8D A;  1H0T B;  2QRX A;  3RGU A;  4JBZ A;  1Q2N A;  2M5A A;  1OVU A;  4MN4 C;  3ZDM A;  2OTK E;  2B87 A;  2RKL A;  2LXC B;  1BDD A;  1Y47 A;  4ASW A;  2LR2 A;  1JM0 A;  5EFW B;  2R44 A;  3FXD A;  1FC2 C;  1SS1 A;  4ZNC A;  3S1K A;  2P58 A;  2KZJ A;  2UWJ E;  2KS1 B;  4K35 A;  2LXB A;  1LP1 A;  4NPD A;  5CBO A;  2M0B A;  4CPG A;  2KI7 B;  4EYY Q;  2ZAE B;  2KIK A;  2B88 A;  4IOI H;  3QWO C;  4HKZ H;  4HJG H;  5K5G B;  4K3A A;  4NPF X;  4ZMD A;  1EDK A;  4ASV A;  1OVR A;  1H0T A;  3MZW B;  5C39 A;  4BXL A;  2QVA A;  2JWD A;  4GOE A;  2M5A B;  5DJT B;  3FXE A;  1MFT A;  2KUB A;  1U7M A;  1EDJ A;  1U7J A;  2WMM A;  1ZW0 A;  1LT1 A;  4KJM A;  2B87 B;  4GOF A;  1X0T A;  3MHV A;  1EDI A;  2Q1K A;  1BDC A;  4NPE A;  5CBN A;  1EC5 A;  1DEE G;  1LP1 B;  1JMB A;  1NVO A;  4HB1 A;  5DJU B;  2K3R A;  1ZXG A;  4WWI A;  3PH0 A;  4GOD A;  2B89 A;  1S3J A;  2KZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...