2KIKA

An artificial di-iron oxo-protein with phenol oxidase activity
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
48
structure length
48
Chain Sequence
b'DYLRELLKGELQGIKQYREALEYTHNPVLAKILEDEEKHIEWLETILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Artificial diiron protein
publication title An artificial di-iron oxo-protein with phenol oxidase activity
rcsb
molecule tags De novo protein
total genus 14
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kikA00
3QWOC 2KZJA 4MN4C 3MZWB 2JWDA 1ZW0A 1OVRA 2KZIA 1LT1A 5K5GB 1U7JA 2B87A 3PH0A 1EC5A 5DJUB 2I8DA 1S3JA 5CBOA 4EYYQ 2KUBA 1FC2C 3FXDA 1H0TA 4ZNCA 4HB1A 2B87B 4NPDA 5C39A 4K35A 2QVAA 2B88A 2LXCB 2Q1KA 1EDLA 4GODA 1DEEG 4NPEA 3RGUA 1H0TB 4K3AA 2M0BA 4ZMDA 2UWJE 3FXEA 2WMMA 1LP1A 4WWIA 3ZDMA 4KJMA 4JBZA 2LR2A 2LXBA 1ZXGA 3S1KA 1MFTA 2B89A 2RKLA 1LP1B 2KIKA 2HR3A 2M5AA 2K3RA 3MHVA 1U7MA 1OVVA 4HJGH 4CPGA 5DJTB 2ZAEB 1JM0A 1BDCA 1JMBA 2KS1B 1SS1A 2M5AB 2R44A 5CBNA 4HKZH 1EDKA 1NVOA 4NPFX 1X0TA 2P58A 1BDDA 1EDJA 1EDIA 4GOFA 4GOEA 1Y47A 2OTKE 4ASVA 4BXLA 4IOIH 1Q2NA 4ASWA 2SPZA 2KI7B 5EFWB 1OVUA 2QRXA
chains in the Genus database with same CATH superfamily
4RJTA 1NKNA 1SQXE 3N7NA 1GD2E 3CX5H 1L0NG 1SQQK 3CMAP 3IAOA 2IPPA 1GK4A 2FXPA 3HUSC 2BCCE 2FYUE 2GUSA 2HYNA 1FZBA 2IZ0A 1FBMA 3LW5H 4ZKUA 2V4HA 3L75E 1XTCC 1PGOA 2XNDH 3H1IJ 4C7NB 1LTJB 5C39A 1SQPD 1SQBD 4K35A 3H1IG 2KK7A 1HF9A 1GU5A 3A5TA 5AW9B 3H1KJ 1VF5C 5M1BA 1EQ7A 2IBZI 1WT6A 1KFMA 2OTLP 3CI9A 3HRNA 1E79H 5AW6B 1VQ5P 2KSEA 4XA4A 3V2RA 4EDFA 2ZT9D 1SQBK 2QJPB 3OA7A 1KD1Q 2B89A 1R8EA 2HR3A 1M1JB 4CPGA 2B9BA 5CJ4A 1X8YA 1PPJG 4U3FE 2ITAA 2QIWA 5B66E 1ZOYC 3H1KE 1GL2B 1BGYJ 2P67A 2YMYA 3AE3C 4B86A 1RF0C 1BGYG 4C7NA 2E74C 4GOFA 3S4RA 3PP5A 3KHUA 3L70J 4Y99B 3B4SA 2YKOA 3L70G 1KMIZ 3RL0g 1JTHB 3AEAC 4GDOA 3TDKA 1BSNA 3L73D 3B5ND 2KXPB 3V2QA 3M9BA 1M1JA 2OYHB 1BE3E 4UB6H 1PGJA 1SQVJ 3WMM0 1EDLA 3AE7C 1KB9D 1KILC 1KC8Q 2WPSA 4K3AA 1T6AA 2ZYGA 4ZMDA 1YTZI 2PAJA 4R4LA 2OTJP 1T3JA 1J1DB 2NPSD 2GUVA 1FZCC 3VN0A 3V4WA 2QE7H 2K9JB 1VL2A 1MUUA 1PP9E 2R44A 3CLQA 3H32A 2P58A 3AE9C 2ZJSE 1HGZA 2OYHA 1JCCA 2ZT9B 1PL5A 2XDJA 3AE1C 1YJ9P 1NTME 1PGPA 2M3EA 3Q2YA 1YBKA 3P8CE 4AUWA 1QVGO 1SQXD 1Q90D 5APQA 1ZR2A 3I56P 2KZIA 1K73Q 4I6MC 3PH0A 1NTZG 4UB8H 5CBOA 3M91A 3CCLP 1ZR4A 4L76A 3O8ZA 5KLIC 2WT7B 1SQXK 2K9JA 3A7OA 5AVRB 1G2CA 1LGHB 1Q86Q 1NU1J 1KILE 1S5LH 3B71A 1RF1B 3M9QA 1NU1G 2FYUK 4RKUJ 2P1JA 2YIUB 3FXEA 3GF7A 1N73A 3L71E 3TSIA 1NO4A 2ZXEB 4IFFA 2OYIC 1NKZB 4HH2A 1GW4A 1IFPA 3H1ID 1KQLA 1RE3C 2E75C 1QGKB 1SQQG 1VQMP 1N7SA 1M8OB 1PIXA 1ZN5A 3W67A 3H1KD 1PFIA 3VYIA 3M0AA 2R5BA 1DIPA 2KOGA 1FOSF 3RK3C 4L75A 3BVHA 3U1CA 2WSEJ 4O9BA 1K8AQ 3AE6C 4H0LC 2L91A 2HG5D 1RF1A 3M0DC 3TNUA 1N73C 1M56D 1HJBA 5B5EE 4D6TJ 2E5YA 2R3SA 1FZGA 3CWBE 3L35A 2AEFA 4D6TG 1LT1A 3B5NA 1XTGB 1SQBG 2I8DA 2FY8A 1Q7YQ 1BGYD 2R3CA 1N7SC 3O6QB 1ZRTE 2QVAA 2LXCB 4ZKPA 4OGQC 3RK2C 1VQ8P 2Z4EA 4XE5B 2JWAA 1LP1A 2NPSA 5L8RJ 1ZXGA 2WSFJ 3SWFA 5AVXB 3E1RA 2QJKB 1FZEA 1N8RQ 3KQGA 5DJTB 4H13C 3H1HJ 1RY3A 1SQVD 1MZ9A 2FYNB 4PD4D 3RBZA 1EDKA 2FFDA 1WMKA 1N86A 3CCJP 3VP8A 1ZMEC 1Z56A 1FJKA 1NJIQ 3G9RA 3H1JJ 2IBZG 2P2UA 5AVQB 1H8AA 3L73J 1AJYA 1S72P 3A0HE 3II6A 3L73G 1NTKE 5B66H 3L36A 3VMYA 3WUUA 3EFFK 3G3ZA 2ZVOB 4N78E 3GHGC 2KUBA 1DX7A 3FWNA 5KAIE 4ZNCA 2B87B 3CC2P 4DJGA 1VQ6P 2FFDC 1L4AC 2KP8A 1NWQA 1SP4A 1K04A 2WMMA 4DZOA 4HYTB 3I55P 1P84E 4DCKA 2LKMA 2WSCJ 5APWA 3GMAA 1GK6A 1U57A 1URQA 1HH0A 2K9YA 1OVVA 2KYVA 3V2PA 1NU1D 5APTA 1OMIA 4OVNF 3BCCE 1BDDA 1M7LA 2BEQD 1SQXG 2PFXA 3MUDA 2HLOA 2QM8A 1ZLLA 3CCSP 4ASWA 2BCCJ 2FYUJ 2N1TD 2E76D 2FYUG 2Q7CA 3L75J 3MZWB 1IFIA 1ZW0A 3MTUE 1URQC 1A02F 4RO0A 3C9IA 1EZVE 3CXHD 1LTTC 2DW3A 5APYA 3VP9A 2FXOA 2I1JA 2Q3EA 3MIWA 2IYPA 2WSSH 2IFMA 3GW6A 1JEKA 3MUDC 2OARA 1FOSE 2JDIH 3NTNA 1HGVA 4WWIA 4D6TD 1SFCD 2WWWA 1LWUA 2YKQA 2WITA 1FDOA 2LR2A 1L0LE 4U3FJ 2Y9YA 1USDA 1MFTA 3F89A 2HFED 1ZV8A 4U3FG 3AEGC 1U7MA 2WVRA 2Z5IA 5AVSB 3RBXA 3H1KG 4WY4D 2OGUA 1AVYA 5KTBA 1S9KD 1NAYA 2KS1B 1CI6A 1MKMA 4XFJA 2D2CD 3AE8C 5AW0B 5KKZB 1P84I 1DH3A 4W7ZA 2O1KA 3K5BA 1FZCB 3KYQA 1L0NE 4C46A 1W2BO 1CZQA 2WPVB 1LWUC 4I7ZB 2C9NY 3Q1MA 1QVFO 5CCGA 1JY3O 1BE3J 3H1HD 1LJ2A 1LTJA 1ZP0C 1FE6A 3H25A 1DD3A 3F5HA 3R4YA 4HB1A 1IFNA 1JNMA 2N1TB 2IBZD 5B5EH 2E76B 4Y28J 3H1JD 1AQTA 2KB7P 5CCHD 2OQQA 1YHQP 1YQ4C 1T8ZA 1LT9B 1LTSC 3M06A 2O01H 5KLVJ 1EZVI 3CXHH 1X79B 3ABVC 1P84D 1NH4A 2P10A 1PP9J 1PPJE 3FGAD 3HD7D 4IL6X 1IFDA 5CCGC 1SQVG 2WQYC 3T97B 2WSEH 1T2KC 1Q82Q 1LTJC 1GL2A 1CW5A 2K1AA 2QJYB 1SS1A 1NTMJ 3M9HA 3W68A 1HWTC 5AVVB 4NPFX 1X0TA 2ZXXA 3BCCD 3SSUA 1SFCB 1WRGA 5KJ7A 5BVZA 2Z5HA 2OYIB 2MJZA 2OTKE 3SWKA 2ZFCA 2N1TA 2XNXA 4H44D 5KLVE 3SFDC 1JTHA 1QL2A 2QRXA 2QJPC 4LLHA 3P32A 2E75B 4WY4B 2M8RA 4EOTA 3PHLA 1M1JC 2JWDA 1YJWP 1OZHA 3TYYA 5K5GB 2D2CB 1VQLP 5GTHE 4WVZA 4N6JA 3P7KA 4EYYQ 1GL2C 3TGUE 5AW3B 1FZAA 4WBAA 2I1KA 2WSFH 1KFNA 3L71J 3A0HH 2AXTE 5KJ7C 2WPQA 2BCCD 2FYUD 1KTMA 1SFCA 1GU4A 1J1EB 1GZLA 3L75D 2JJLA 2KSJA 1NHLA 3ZDMA 5AVWB 1QLED 2ZYDA 5KAIH 1KQGB 1OIPA 3AEBC 1IZNB 3KDPB 5TISE 1GW3A 2OYHC 3AECC 1BDCA 1JMBA 1JUNA 4N3YB 2M5AB 1KORA 3CCMP 1YQ3C 3U1AA 1P84H 3L4FA 3H1LE 5BU8B 3L74E 3CWBJ 1Y47A 3B8EB 2JEEA 3HD7B 1OWAA 2KI7B 1J1DC 1FAVA 1HTLC 4U3FD 5CHXA 2C0WA 2O01J 2Y0DA 4L74A 1NTZE 4PV1D 3D6ZA 3RL0D 3WU2E 1AA0A 2WTYA 2WT7A 5AVZB 1EC5A 4EI2A 1KQSO 1G1IA 3JC22 4H44B 5TJHA 3VMXA 2ZT9C 2WSCH 3HE4B 2ZVNB 3EQ2A 2QA4P 4JF7A 4NPEA 4I1LA 3HE5B 2FXMA 2YKPA 2HPCB 3BRVB 2Y9ZA 4DOJA 1GDTA 1BE3D 2HODB 4KJMA 3U59A 3GLMA 3GHGB 3HD7A 3S1KA 2RKLA 2KIKA 5AW8B 2K3RA 1VF5D 4HJGH 3CCEP 3JCUE 1NGMB 2KLVA 4W7YA 1VQ7P 1RF1C 1LTGC 5KAFE 2R32A 2YIUC 1NTKJ 1KN7A 5GTIE 5KLVD 3B5NC 2YNYA 4IOIH 2W6AA 1YJNP 4BRYB 1JB0J 1PP9D 3QWOC 1FJPA 3H1HG 3E7KA 1SQPE 2WPRA 1SQBE 4KT0J 1JY3N 3L37A 2W6JH 3CPWO 3KZIE 3RK3E 2E74D 3VMAA 3O6QA 1LTIC 1NTMD 4YPCA 1J2JB 5KLVK 1HBWA 3P8CD 2W6BA 1NYHA 3H1JG 3CL3D 3AE5C 1JY2O 2YXQB 2NPSC 2V7QH 3AEEC 3L72J 1H0TB 3R2PA 4PV1B 2A45I 3RL0B 2RN0A 2NZ2A 1H88A 2P7JA 1NTMK 2POHA 3IR9A 4GIFA 4IL6E 1FZFA 2IYOA 1OFCX 3CMEP 3S9OA 1VQ9P 1RH5B 3VOPA 4BRYA 1RE4A 1KILD 3AE4C 1VQ4P 3IF4A 1EXIA 3BCCJ 1W5CE 3BCCG 3HUSB 3L71D 1UIIA 1NAFA 3L72E 3N4XA 2YMKA 1EDJA 2Q3IA 3CC4P 3L74D 5APVA 1QX8A 4BXLA 1VF5B 3CCRP 1VQPP 1S2EA 2W83C 2QJKC 3GG2A 1KB9E 3TK1A 1IJDB 2O3JA 2AEJA 1RE4C 2B87A 2FYNC 3Q3DA 3AEDC 1OX3A 3FXDA 2BCCG 2O1JA 3IFMA 1DD4A 2AXCA 1IFMA 3CWBD 5AVYB 2E43A 3HUSA 1VDFA 3L75G 1L2PA 3RGUA 1L0LJ 2YO2A 1M1KQ 1UIXA 5APSA 5GTHH 1OW7A 2E74B 3LIEA 4W80A 3NFQA 2A06E 1ZRTD 1FDIA 1IK9A 1NOHA 5BU5A 3G6EP 2CPSA 1FS0E 2AXTH 1N7LA 1M57D 1K05A 4PJ0E 1RHZB 1X22A 1L0NJ 4R4MA 3Q5SA 2PP6A 1KYOE 1JY2P 1Y8AA 2V7QJ 4YTPC 4ASVA 4C7RA 1KILB 2E75D 2E42A 5TISH 3UIAA 3E1IA 2QM7A 1JOCA 1BCCE 4LGDE 4MN4C 2J59M 4U7JA 1RF0A 5AW2B 2R5DA 3RK3D 3H6PA 2JP3A 5DJUB 3FX0A 4H0LD 1LNQA 1YTZT 2YXRB 1SQPK 1NTKD 2W27A 5AW7B 3Q5PA 1JMMA 4GODA 3Q5RA 5H2FE 3WU2H 2A45H 2Q6QA 1BE3G 3H1IE 1KB9I 2M0BA 4N78D 1JCDA 1N7SD 2OYOA 1IO4A 3CCQP 1VQNP 1M90Q 3LIDA 2G3AA 3KXDA 1KILA 1S4XA 2LXBA 1NTKK 2KS1A 3ITKA 4OGQD 3RK2D 2CK3H 2M3BA 1USEA 2JKVA 3L72D 2H89C 1FZCA 2IDBA 5KLVG 2H43A 1CSBA 5KLIB 1PP9G 3D6YA 4GOEA 3NXSA 2QEXP 1N2DC 2K88A 3H32B 4H13D 3VTPC 3JCUH 2Q5UA 3OJAB 4KHXA 1BGYE 2N9YB 2KZJA 2FKWB 1NTMG 3TGUJ 3D70A 3TGUG 3CD6P 3SFEC 5KAFH 1KYOI 3PRJA 3L70E 2GM4A 5GTIH 1S5LX 1FC2C 2C9LY 5KKZC 1HUCA 2W90A 1JY2N 1RQUA 3PTZA 5AW5B 1PZQA 1YITP 2B88A 1K9MQ 3CC7P 3A2AA 2Q1KA 1LT9A 3BASA 1GMJA 4M3LA 1DEEG 2IX7C 5E79E 3CCVP 3HTKB 2JO1A 3KZIH 1EZVD 1G2CB 3RK3B 3LW5J 4I7ZC 1SQVE 4PD4E 2A06D 2FYZA 3T97A 3PLNA 2CPBA 4H0LB 4YXWH 1A02J 1L4AD 1N73B 2QSIA 4DT0A 3L71G 1W2EA 3H1LJ 3TF5A 1LTBC 1R5SA 3V4QA 4QMAA 1JM0A 3A0BE 4JYCA 4Y99C 3SWYA 3H1LG 4BWNA 3L74J 2KLUA 2N1TC 2BEZF 2W8ZA 4IL6H 1D7MA 5CMZA 2E76C 2OYIA 3L74G 1NVOA 3CX5E 1YIJP 1KYOD 1L0LD 1N7SB 3MD0A 1NTZJ 3EFGA 3G4SP 1LT9C 1RE3A 4WY4A 1FDMA 3MP7B 1JY3P 1VQOP 3V5BA 1Q2NA 4JPZB 2A45G 1HJ0A 1BCCD 1AQ5A 3EWKA 4OGQB 1AVOA 3V2NA 3RK2B 3HTKA 3WUVA 2JR8A 1LTAC 1L0LK 1OVRA 3BRTB 3TNUB 2QJYC 3I5CA 1L0ND 4EIJA 3CWBG 2WZ7A 3M0DA 2RH0A 1SFCC 3B5NB 4H13B 4NPDA 3NMDA 3JSVC 1KB9H 1URQD 1SQQJ 4WY4C 1TU3F 1L0NK 2Q9IA 1IK7A 1AV1A 2H88C 4JYBA 1NU1E 2D2CC 5CJ0A 3BATA 1LP1B 4RESB 1RQVA 2M5AA 3QH9A 5CCHA 2NPSB 3PJSK 2Y0EA 2ZAEB 1DEBA 2C0XA 3AEFC 4HKZH 3WUTA 3A3YB 4PD4I 1PV3A 1SQQE 1PPJD 1SQPJ 1SQBJ 4IFDK 5AVUB 1EDIA 1J1EC 1SQPG 4L73A 1HVVA 1AFOA 2FFDB 1L4AB 4I2LC 4PJ0H 3CXHE 1OW8A 2XU6A 4UB6E 2IZ1A 2H8PD 1SLQA 3V6IA 2N9BA 3CX5I 3KPEA 1KYOH 3IN6A 4AYCA 1U7JA 2QG4A 3L70D 5APXA 5CCHC 3HE4A 1YYCA 1S3JA 1NTKG 1H89A 1SVFA 4JQ0D 4D6TE 1KZUB 3HE5A 4YXDC 2HPCA 5AW1B 3CCUP 2O01N 3HD7C 3G71P 1QEXA 4TLFA 2HODA 4AQRD 1QL1A 1Q81Q 3GHGA 2IFNA 5AVTB 2PRRA 1MV8A 1S9KE 2AEMA 3TGUD 5AW4B 1YI2P 4A7PA 1L4AA 3OW2O 3VMZA 2E5TA 2XKMA 1IFJA 2FBWC 1Y9BA 5H2FH 2RMZA 1EXJA 3OAKA 2KNCB 3L72G 1PGQA 4H44C 1KV4A 3GF3A 1URQB 2XV5A 1SQVK 5CBNA 3CX5D 1T3UA 2K37A 1VPCA 3H1HE 1OXZA 3P8MC 1KQFB 2NRGA 5CCGD 2H7HA 4UB8E 1T2KD 1JO5A 1G1JA 3D71A 4LC1A 1MFZA 4IFMA 3FWLA 2IBZE 3H1LD 1S5LE 2XZRA 1IC2A 3H1JE 1X9VA 4OH8B 1BSHA 3MGNA 2J58A 3L73E 1H0TA 5APUA 1R5LA 3CXHI 1NTZD 2J5UA 2KNCA 1GTWA 2Y0CA 1EZVG 3AE2C 2A06G 2YO3A 2UWJE 3C8VA 1GL2D 4TT3H 4WB4A 1E5WA 2PGDA 4JBZA 1NTZK 4GKGA 1SQXJ 2GA1A 2ZYAA 4Z1MH 5KJ7D 1LWUB 3MHVA 3C1LA 5E79H 4OWFA 1L0LG 2MKVA 2L5GB 1S1CX 4PD4H 1NU1K 1OW6A 4PV1C 1BCCJ 1SQQD 3RL0C 1FU1A 1CI6B 1BCCG 4GT1A 1VQKP 3USSA 2BASA 2VRSA 2G8YA 2SPZA 5EFWB 1OVUA 3A0BH
chains in the Genus database with same CATH topology
3QWOC 2KZJA 4MN4C 3MZWB 2JWDA 1ZW0A 1OVRA 2KZIA 1LT1A 5K5GB 1U7JA 2B87A 3PH0A 1EC5A 5DJUB 2I8DA 1S3JA 5CBOA 4EYYQ 2KUBA 1FC2C 3FXDA 1H0TA 4ZNCA 4HB1A 2B87B 4NPDA 5C39A 4K35A 2QVAA 2B88A 2LXCB 2Q1KA 1EDLA 4GODA 1DEEG 4NPEA 3RGUA 1H0TB 4K3AA 2M0BA 4ZMDA 2UWJE 3FXEA 2WMMA 1LP1A 4WWIA 3ZDMA 4KJMA 4JBZA 2LR2A 2LXBA 1ZXGA 3S1KA 1MFTA 2B89A 2RKLA 1LP1B 2KIKA 2HR3A 2M5AA 2K3RA 3MHVA 1U7MA 1OVVA 4HJGH 4CPGA 5DJTB 2ZAEB 1JM0A 1BDCA 1JMBA 2KS1B 1SS1A 2M5AB 2R44A 5CBNA 4HKZH 1EDKA 1NVOA 4NPFX 1X0TA 2P58A 1BDDA 1EDJA 1EDIA 4GOFA 4GOEA 1Y47A 2OTKE 4ASVA 4BXLA 4IOIH 1Q2NA 4ASWA 2SPZA 2KI7B 5EFWB 1OVUA 2QRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWO C;  2KZJ A;  4MN4 C;  3MZW B;  2JWD A;  1ZW0 A;  1OVR A;  2KZI A;  1LT1 A;  5K5G B;  1U7J A;  2B87 A;  3PH0 A;  1EC5 A;  5DJU B;  2I8D A;  1S3J A;  5CBO A;  4EYY Q;  2KUB A;  1FC2 C;  3FXD A;  1H0T A;  4ZNC A;  4HB1 A;  2B87 B;  4NPD A;  5C39 A;  4K35 A;  2QVA A;  2B88 A;  2LXC B;  2Q1K A;  1EDL A;  4GOD A;  1DEE G;  4NPE A;  3RGU A;  1H0T B;  4K3A A;  2M0B A;  4ZMD A;  2UWJ E;  3FXE A;  2WMM A;  1LP1 A;  4WWI A;  3ZDM A;  4KJM A;  4JBZ A;  2LR2 A;  2LXB A;  1ZXG A;  3S1K A;  1MFT A;  2B89 A;  2RKL A;  1LP1 B;  2KIK A;  2HR3 A;  2M5A A;  2K3R A;  3MHV A;  1U7M A;  1OVV A;  4HJG H;  4CPG A;  5DJT B;  2ZAE B;  1JM0 A;  1BDC A;  1JMB A;  2KS1 B;  1SS1 A;  2M5A B;  2R44 A;  5CBN A;  4HKZ H;  1EDK A;  1NVO A;  4NPF X;  1X0T A;  2P58 A;  1BDD A;  1EDJ A;  1EDI A;  4GOF A;  4GOE A;  1Y47 A;  2OTK E;  4ASV A;  4BXL A;  4IOI H;  1Q2N A;  4ASW A;  2SPZ A;  2KI7 B;  5EFW B;  1OVU A;  2QRX A; 
#chains in the Genus database with same CATH topology
 4RJT A;  1NKN A;  1SQX E;  3N7N A;  1GD2 E;  3CX5 H;  1L0N G;  1SQQ K;  3CMA P;  3IAO A;  2IPP A;  1GK4 A;  2FXP A;  3HUS C;  2BCC E;  2FYU E;  2GUS A;  2HYN A;  1FZB A;  2IZ0 A;  1FBM A;  3LW5 H;  4ZKU A;  2V4H A;  3L75 E;  1XTC C;  1PGO A;  2XND H;  3H1I J;  4C7N B;  1LTJ B;  5C39 A;  1SQP D;  1SQB D;  4K35 A;  3H1I G;  2KK7 A;  1HF9 A;  1GU5 A;  3A5T A;  5AW9 B;  3H1K J;  1VF5 C;  5M1B A;  1EQ7 A;  2IBZ I;  1WT6 A;  1KFM A;  2OTL P;  3CI9 A;  3HRN A;  1E79 H;  5AW6 B;  1VQ5 P;  2KSE A;  4XA4 A;  3V2R A;  4EDF A;  2ZT9 D;  1SQB K;  2QJP B;  3OA7 A;  1KD1 Q;  2B89 A;  1R8E A;  2HR3 A;  1M1J B;  4CPG A;  2B9B A;  5CJ4 A;  1X8Y A;  1PPJ G;  4U3F E;  2ITA A;  2QIW A;  5B66 E;  1ZOY C;  3H1K E;  1GL2 B;  1BGY J;  2P67 A;  2YMY A;  3AE3 C;  4B86 A;  1RF0 C;  1BGY G;  4C7N A;  2E74 C;  4GOF A;  3S4R A;  3PP5 A;  3KHU A;  3L70 J;  4Y99 B;  3B4S A;  2YKO A;  3L70 G;  1KMI Z;  3RL0 g;  1JTH B;  3AEA C;  4GDO A;  3TDK A;  1BSN A;  3L73 D;  3B5N D;  2KXP B;  3V2Q A;  3M9B A;  1M1J A;  2OYH B;  1BE3 E;  4UB6 H;  1PGJ A;  1SQV J;  3WMM 0;  1EDL A;  3AE7 C;  1KB9 D;  1KIL C;  1KC8 Q;  2WPS A;  4K3A A;  1T6A A;  2ZYG A;  4ZMD A;  1YTZ I;  2PAJ A;  4R4L A;  2OTJ P;  1T3J A;  1J1D B;  2NPS D;  2GUV A;  1FZC C;  3VN0 A;  3V4W A;  2QE7 H;  2K9J B;  1VL2 A;  1MUU A;  1PP9 E;  2R44 A;  3CLQ A;  3H32 A;  2P58 A;  3AE9 C;  2ZJS E;  1HGZ A;  2OYH A;  1JCC A;  2ZT9 B;  1PL5 A;  2XDJ A;  3AE1 C;  1YJ9 P;  1NTM E;  1PGP A;  2M3E A;  3Q2Y A;  1YBK A;  3P8C E;  4AUW A;  1QVG O;  1SQX D;  1Q90 D;  5APQ A;  1ZR2 A;  3I56 P;  2KZI A;  1K73 Q;  4I6M C;  3PH0 A;  1NTZ G;  4UB8 H;  5CBO A;  3M91 A;  3CCL P;  1ZR4 A;  4L76 A;  3O8Z A;  5KLI C;  2WT7 B;  1SQX K;  2K9J A;  3A7O A;  5AVR B;  1G2C A;  1LGH B;  1Q86 Q;  1NU1 J;  1KIL E;  1S5L H;  3B71 A;  1RF1 B;  3M9Q A;  1NU1 G;  2FYU K;  4RKU J;  2P1J A;  2YIU B;  3FXE A;  3GF7 A;  1N73 A;  3L71 E;  3TSI A;  1NO4 A;  2ZXE B;  4IFF A;  2OYI C;  1NKZ B;  4HH2 A;  1GW4 A;  1IFP A;  3H1I D;  1KQL A;  1RE3 C;  2E75 C;  1QGK B;  1SQQ G;  1VQM P;  1N7S A;  1M8O B;  1PIX A;  1ZN5 A;  3W67 A;  3H1K D;  1PFI A;  3VYI A;  3M0A A;  2R5B A;  1DIP A;  2KOG A;  1FOS F;  3RK3 C;  4L75 A;  3BVH A;  3U1C A;  2WSE J;  4O9B A;  1K8A Q;  3AE6 C;  4H0L C;  2L91 A;  2HG5 D;  1RF1 A;  3M0D C;  3TNU A;  1N73 C;  1M56 D;  1HJB A;  5B5E E;  4D6T J;  2E5Y A;  2R3S A;  1FZG A;  3CWB E;  3L35 A;  2AEF A;  4D6T G;  1LT1 A;  3B5N A;  1XTG B;  1SQB G;  2I8D A;  2FY8 A;  1Q7Y Q;  1BGY D;  2R3C A;  1N7S C;  3O6Q B;  1ZRT E;  2QVA A;  2LXC B;  4ZKP A;  4OGQ C;  3RK2 C;  1VQ8 P;  2Z4E A;  4XE5 B;  2JWA A;  1LP1 A;  2NPS A;  5L8R J;  1ZXG A;  2WSF J;  3SWF A;  5AVX B;  3E1R A;  2QJK B;  1FZE A;  1N8R Q;  3KQG A;  5DJT B;  4H13 C;  3H1H J;  1RY3 A;  1SQV D;  1MZ9 A;  2FYN B;  4PD4 D;  3RBZ A;  1EDK A;  2FFD A;  1WMK A;  1N86 A;  3CCJ P;  3VP8 A;  1ZME C;  1Z56 A;  1FJK A;  1NJI Q;  3G9R A;  3H1J J;  2IBZ G;  2P2U A;  5AVQ B;  1H8A A;  3L73 J;  1AJY A;  1S72 P;  3A0H E;  3II6 A;  3L73 G;  1NTK E;  5B66 H;  3L36 A;  3VMY A;  3WUU A;  3EFF K;  3G3Z A;  2ZVO B;  4N78 E;  3GHG C;  2KUB A;  1DX7 A;  3FWN A;  5KAI E;  4ZNC A;  2B87 B;  3CC2 P;  4DJG A;  1VQ6 P;  2FFD C;  1L4A C;  2KP8 A;  1NWQ A;  1SP4 A;  1K04 A;  2WMM A;  4DZO A;  4HYT B;  3I55 P;  1P84 E;  4DCK A;  2LKM A;  2WSC J;  5APW A;  3GMA A;  1GK6 A;  1U57 A;  1URQ A;  1HH0 A;  2K9Y A;  1OVV A;  2KYV A;  3V2P A;  1NU1 D;  5APT A;  1OMI A;  4OVN F;  3BCC E;  1BDD A;  1M7L A;  2BEQ D;  1SQX G;  2PFX A;  3MUD A;  2HLO A;  2QM8 A;  1ZLL A;  3CCS P;  4ASW A;  2BCC J;  2FYU J;  2N1T D;  2E76 D;  2FYU G;  2Q7C A;  3L75 J;  3MZW B;  1IFI A;  1ZW0 A;  3MTU E;  1URQ C;  1A02 F;  4RO0 A;  3C9I A;  1EZV E;  3CXH D;  1LTT C;  2DW3 A;  5APY A;  3VP9 A;  2FXO A;  2I1J A;  2Q3E A;  3MIW A;  2IYP A;  2WSS H;  2IFM A;  3GW6 A;  1JEK A;  3MUD C;  2OAR A;  1FOS E;  2JDI H;  3NTN A;  1HGV A;  4WWI A;  4D6T D;  1SFC D;  2WWW A;  1LWU A;  2YKQ A;  2WIT A;  1FDO A;  2LR2 A;  1L0L E;  4U3F J;  2Y9Y A;  1USD A;  1MFT A;  3F89 A;  2HFE D;  1ZV8 A;  4U3F G;  3AEG C;  1U7M A;  2WVR A;  2Z5I A;  5AVS B;  3RBX A;  3H1K G;  4WY4 D;  2OGU A;  1AVY A;  5KTB A;  1S9K D;  1NAY A;  2KS1 B;  1CI6 A;  1MKM A;  4XFJ A;  2D2C D;  3AE8 C;  5AW0 B;  5KKZ B;  1P84 I;  1DH3 A;  4W7Z A;  2O1K A;  3K5B A;  1FZC B;  3KYQ A;  1L0N E;  4C46 A;  1W2B O;  1CZQ A;  2WPV B;  1LWU C;  4I7Z B;  2C9N Y;  3Q1M A;  1QVF O;  5CCG A;  1JY3 O;  1BE3 J;  3H1H D;  1LJ2 A;  1LTJ A;  1ZP0 C;  1FE6 A;  3H25 A;  1DD3 A;  3F5H A;  3R4Y A;  4HB1 A;  1IFN A;  1JNM A;  2N1T B;  2IBZ D;  5B5E H;  2E76 B;  4Y28 J;  3H1J D;  1AQT A;  2KB7 P;  5CCH D;  2OQQ A;  1YHQ P;  1YQ4 C;  1T8Z A;  1LT9 B;  1LTS C;  3M06 A;  2O01 H;  5KLV J;  1EZV I;  3CXH H;  1X79 B;  3ABV C;  1P84 D;  1NH4 A;  2P10 A;  1PP9 J;  1PPJ E;  3FGA D;  3HD7 D;  4IL6 X;  1IFD A;  5CCG C;  1SQV G;  2WQY C;  3T97 B;  2WSE H;  1T2K C;  1Q82 Q;  1LTJ C;  1GL2 A;  1CW5 A;  2K1A A;  2QJY B;  1SS1 A;  1NTM J;  3M9H A;  3W68 A;  1HWT C;  5AVV B;  4NPF X;  1X0T A;  2ZXX A;  3BCC D;  3SSU A;  1SFC B;  1WRG A;  5KJ7 A;  5BVZ A;  2Z5H A;  2OYI B;  2MJZ A;  2OTK E;  3SWK A;  2ZFC A;  2N1T A;  2XNX A;  4H44 D;  5KLV E;  3SFD C;  1JTH A;  1QL2 A;  2QRX A;  2QJP C;  4LLH A;  3P32 A;  2E75 B;  4WY4 B;  2M8R A;  4EOT A;  3PHL A;  1M1J C;  2JWD A;  1YJW P;  1OZH A;  3TYY A;  5K5G B;  2D2C B;  1VQL P;  5GTH E;  4WVZ A;  4N6J A;  3P7K A;  4EYY Q;  1GL2 C;  3TGU E;  5AW3 B;  1FZA A;  4WBA A;  2I1K A;  2WSF H;  1KFN A;  3L71 J;  3A0H H;  2AXT E;  5KJ7 C;  2WPQ A;  2BCC D;  2FYU D;  1KTM A;  1SFC A;  1GU4 A;  1J1E B;  1GZL A;  3L75 D;  2JJL A;  2KSJ A;  1NHL A;  3ZDM A;  5AVW B;  1QLE D;  2ZYD A;  5KAI H;  1KQG B;  1OIP A;  3AEB C;  1IZN B;  3KDP B;  5TIS E;  1GW3 A;  2OYH C;  3AEC C;  1BDC A;  1JMB A;  1JUN A;  4N3Y B;  2M5A B;  1KOR A;  3CCM P;  1YQ3 C;  3U1A A;  1P84 H;  3L4F A;  3H1L E;  5BU8 B;  3L74 E;  3CWB J;  1Y47 A;  3B8E B;  2JEE A;  3HD7 B;  1OWA A;  2KI7 B;  1J1D C;  1FAV A;  1HTL C;  4U3F D;  5CHX A;  2C0W A;  2O01 J;  2Y0D A;  4L74 A;  1NTZ E;  4PV1 D;  3D6Z A;  3RL0 D;  3WU2 E;  1AA0 A;  2WTY A;  2WT7 A;  5AVZ B;  1EC5 A;  4EI2 A;  1KQS O;  1G1I A;  3JC2 2;  4H44 B;  5TJH A;  3VMX A;  2ZT9 C;  2WSC H;  3HE4 B;  2ZVN B;  3EQ2 A;  2QA4 P;  4JF7 A;  4NPE A;  4I1L A;  3HE5 B;  2FXM A;  2YKP A;  2HPC B;  3BRV B;  2Y9Z A;  4DOJ A;  1GDT A;  1BE3 D;  2HOD B;  4KJM A;  3U59 A;  3GLM A;  3GHG B;  3HD7 A;  3S1K A;  2RKL A;  2KIK A;  5AW8 B;  2K3R A;  1VF5 D;  4HJG H;  3CCE P;  3JCU E;  1NGM B;  2KLV A;  4W7Y A;  1VQ7 P;  1RF1 C;  1LTG C;  5KAF E;  2R32 A;  2YIU C;  1NTK J;  1KN7 A;  5GTI E;  5KLV D;  3B5N C;  2YNY A;  4IOI H;  2W6A A;  1YJN P;  4BRY B;  1JB0 J;  1PP9 D;  3QWO C;  1FJP A;  3H1H G;  3E7K A;  1SQP E;  2WPR A;  1SQB E;  4KT0 J;  1JY3 N;  3L37 A;  2W6J H;  3CPW O;  3KZI E;  3RK3 E;  2E74 D;  3VMA A;  3O6Q A;  1LTI C;  1NTM D;  4YPC A;  1J2J B;  5KLV K;  1HBW A;  3P8C D;  2W6B A;  1NYH A;  3H1J G;  3CL3 D;  3AE5 C;  1JY2 O;  2YXQ B;  2NPS C;  2V7Q H;  3AEE C;  3L72 J;  1H0T B;  3R2P A;  4PV1 B;  2A45 I;  3RL0 B;  2RN0 A;  2NZ2 A;  1H88 A;  2P7J A;  1NTM K;  2POH A;  3IR9 A;  4GIF A;  4IL6 E;  1FZF A;  2IYO A;  1OFC X;  3CME P;  3S9O A;  1VQ9 P;  1RH5 B;  3VOP A;  4BRY A;  1RE4 A;  1KIL D;  3AE4 C;  1VQ4 P;  3IF4 A;  1EXI A;  3BCC J;  1W5C E;  3BCC G;  3HUS B;  3L71 D;  1UII A;  1NAF A;  3L72 E;  3N4X A;  2YMK A;  1EDJ A;  2Q3I A;  3CC4 P;  3L74 D;  5APV A;  1QX8 A;  4BXL A;  1VF5 B;  3CCR P;  1VQP P;  1S2E A;  2W83 C;  2QJK C;  3GG2 A;  1KB9 E;  3TK1 A;  1IJD B;  2O3J A;  2AEJ A;  1RE4 C;  2B87 A;  2FYN C;  3Q3D A;  3AED C;  1OX3 A;  3FXD A;  2BCC G;  2O1J A;  3IFM A;  1DD4 A;  2AXC A;  1IFM A;  3CWB D;  5AVY B;  2E43 A;  3HUS A;  1VDF A;  3L75 G;  1L2P A;  3RGU A;  1L0L J;  2YO2 A;  1M1K Q;  1UIX A;  5APS A;  5GTH H;  1OW7 A;  2E74 B;  3LIE A;  4W80 A;  3NFQ A;  2A06 E;  1ZRT D;  1FDI A;  1IK9 A;  1NOH A;  5BU5 A;  3G6E P;  2CPS A;  1FS0 E;  2AXT H;  1N7L A;  1M57 D;  1K05 A;  4PJ0 E;  1RHZ B;  1X22 A;  1L0N J;  4R4M A;  3Q5S A;  2PP6 A;  1KYO E;  1JY2 P;  1Y8A A;  2V7Q J;  4YTP C;  4ASV A;  4C7R A;  1KIL B;  2E75 D;  2E42 A;  5TIS H;  3UIA A;  3E1I A;  2QM7 A;  1JOC A;  1BCC E;  4LGD E;  4MN4 C;  2J59 M;  4U7J A;  1RF0 A;  5AW2 B;  2R5D A;  3RK3 D;  3H6P A;  2JP3 A;  5DJU B;  3FX0 A;  4H0L D;  1LNQ A;  1YTZ T;  2YXR B;  1SQP K;  1NTK D;  2W27 A;  5AW7 B;  3Q5P A;  1JMM A;  4GOD A;  3Q5R A;  5H2F E;  3WU2 H;  2A45 H;  2Q6Q A;  1BE3 G;  3H1I E;  1KB9 I;  2M0B A;  4N78 D;  1JCD A;  1N7S D;  2OYO A;  1IO4 A;  3CCQ P;  1VQN P;  1M90 Q;  3LID A;  2G3A A;  3KXD A;  1KIL A;  1S4X A;  2LXB A;  1NTK K;  2KS1 A;  3ITK A;  4OGQ D;  3RK2 D;  2CK3 H;  2M3B A;  1USE A;  2JKV A;  3L72 D;  2H89 C;  1FZC A;  2IDB A;  5KLV G;  2H43 A;  1CSB A;  5KLI B;  1PP9 G;  3D6Y A;  4GOE A;  3NXS A;  2QEX P;  1N2D C;  2K88 A;  3H32 B;  4H13 D;  3VTP C;  3JCU H;  2Q5U A;  3OJA B;  4KHX A;  1BGY E;  2N9Y B;  2KZJ A;  2FKW B;  1NTM G;  3TGU J;  3D70 A;  3TGU G;  3CD6 P;  3SFE C;  5KAF H;  1KYO I;  3PRJ A;  3L70 E;  2GM4 A;  5GTI H;  1S5L X;  1FC2 C;  2C9L Y;  5KKZ C;  1HUC A;  2W90 A;  1JY2 N;  1RQU A;  3PTZ A;  5AW5 B;  1PZQ A;  1YIT P;  2B88 A;  1K9M Q;  3CC7 P;  3A2A A;  2Q1K A;  1LT9 A;  3BAS A;  1GMJ A;  4M3L A;  1DEE G;  2IX7 C;  5E79 E;  3CCV P;  3HTK B;  2JO1 A;  3KZI H;  1EZV D;  1G2C B;  3RK3 B;  3LW5 J;  4I7Z C;  1SQV E;  4PD4 E;  2A06 D;  2FYZ A;  3T97 A;  3PLN A;  2CPB A;  4H0L B;  4YXW H;  1A02 J;  1L4A D;  1N73 B;  2QSI A;  4DT0 A;  3L71 G;  1W2E A;  3H1L J;  3TF5 A;  1LTB C;  1R5S A;  3V4Q A;  4QMA A;  1JM0 A;  3A0B E;  4JYC A;  4Y99 C;  3SWY A;  3H1L G;  4BWN A;  3L74 J;  2KLU A;  2N1T C;  2BEZ F;  2W8Z A;  4IL6 H;  1D7M A;  5CMZ A;  2E76 C;  2OYI A;  3L74 G;  1NVO A;  3CX5 E;  1YIJ P;  1KYO D;  1L0L D;  1N7S B;  3MD0 A;  1NTZ J;  3EFG A;  3G4S P;  1LT9 C;  1RE3 A;  4WY4 A;  1FDM A;  3MP7 B;  1JY3 P;  1VQO P;  3V5B A;  1Q2N A;  4JPZ B;  2A45 G;  1HJ0 A;  1BCC D;  1AQ5 A;  3EWK A;  4OGQ B;  1AVO A;  3V2N A;  3RK2 B;  3HTK A;  3WUV A;  2JR8 A;  1LTA C;  1L0L K;  1OVR A;  3BRT B;  3TNU B;  2QJY C;  3I5C A;  1L0N D;  4EIJ A;  3CWB G;  2WZ7 A;  3M0D A;  2RH0 A;  1SFC C;  3B5N B;  4H13 B;  4NPD A;  3NMD A;  3JSV C;  1KB9 H;  1URQ D;  1SQQ J;  4WY4 C;  1TU3 F;  1L0N K;  2Q9I A;  1IK7 A;  1AV1 A;  2H88 C;  4JYB A;  1NU1 E;  2D2C C;  5CJ0 A;  3BAT A;  1LP1 B;  4RES B;  1RQV A;  2M5A A;  3QH9 A;  5CCH A;  2NPS B;  3PJS K;  2Y0E A;  2ZAE B;  1DEB A;  2C0X A;  3AEF C;  4HKZ H;  3WUT A;  3A3Y B;  4PD4 I;  1PV3 A;  1SQQ E;  1PPJ D;  1SQP J;  1SQB J;  4IFD K;  5AVU B;  1EDI A;  1J1E C;  1SQP G;  4L73 A;  1HVV A;  1AFO A;  2FFD B;  1L4A B;  4I2L C;  4PJ0 H;  3CXH E;  1OW8 A;  2XU6 A;  4UB6 E;  2IZ1 A;  2H8P D;  1SLQ A;  3V6I A;  2N9B A;  3CX5 I;  3KPE A;  1KYO H;  3IN6 A;  4AYC A;  1U7J A;  2QG4 A;  3L70 D;  5APX A;  5CCH C;  3HE4 A;  1YYC A;  1S3J A;  1NTK G;  1H89 A;  1SVF A;  4JQ0 D;  4D6T E;  1KZU B;  3HE5 A;  4YXD C;  2HPC A;  5AW1 B;  3CCU P;  2O01 N;  3HD7 C;  3G71 P;  1QEX A;  4TLF A;  2HOD A;  4AQR D;  1QL1 A;  1Q81 Q;  3GHG A;  2IFN A;  5AVT B;  2PRR A;  1MV8 A;  1S9K E;  2AEM A;  3TGU D;  5AW4 B;  1YI2 P;  4A7P A;  1L4A A;  3OW2 O;  3VMZ A;  2E5T A;  2XKM A;  1IFJ A;  2FBW C;  1Y9B A;  5H2F H;  2RMZ A;  1EXJ A;  3OAK A;  2KNC B;  3L72 G;  1PGQ A;  4H44 C;  1KV4 A;  3GF3 A;  1URQ B;  2XV5 A;  1SQV K;  5CBN A;  3CX5 D;  1T3U A;  2K37 A;  1VPC A;  3H1H E;  1OXZ A;  3P8M C;  1KQF B;  2NRG A;  5CCG D;  2H7H A;  4UB8 E;  1T2K D;  1JO5 A;  1G1J A;  3D71 A;  4LC1 A;  1MFZ A;  4IFM A;  3FWL A;  2IBZ E;  3H1L D;  1S5L E;  2XZR A;  1IC2 A;  3H1J E;  1X9V A;  4OH8 B;  1BSH A;  3MGN A;  2J58 A;  3L73 E;  1H0T A;  5APU A;  1R5L A;  3CXH I;  1NTZ D;  2J5U A;  2KNC A;  1GTW A;  2Y0C A;  1EZV G;  3AE2 C;  2A06 G;  2YO3 A;  2UWJ E;  3C8V A;  1GL2 D;  4TT3 H;  4WB4 A;  1E5W A;  2PGD A;  4JBZ A;  1NTZ K;  4GKG A;  1SQX J;  2GA1 A;  2ZYA A;  4Z1M H;  5KJ7 D;  1LWU B;  3MHV A;  3C1L A;  5E79 H;  4OWF A;  1L0L G;  2MKV A;  2L5G B;  1S1C X;  4PD4 H;  1NU1 K;  1OW6 A;  4PV1 C;  1BCC J;  1SQQ D;  3RL0 C;  1FU1 A;  1CI6 B;  1BCC G;  4GT1 A;  1VQK P;  3USS A;  2BAS A;  2VRS A;  2G8Y A;  2SPZ A;  5EFW B;  1OVU A;  3A0B H; 
#chains in the Genus database with same CATH homology
 3QWO C;  2KZJ A;  4MN4 C;  3MZW B;  2JWD A;  1ZW0 A;  1OVR A;  2KZI A;  1LT1 A;  5K5G B;  1U7J A;  2B87 A;  3PH0 A;  1EC5 A;  5DJU B;  2I8D A;  1S3J A;  5CBO A;  4EYY Q;  2KUB A;  1FC2 C;  3FXD A;  1H0T A;  4ZNC A;  4HB1 A;  2B87 B;  4NPD A;  5C39 A;  4K35 A;  2QVA A;  2B88 A;  2LXC B;  2Q1K A;  1EDL A;  4GOD A;  1DEE G;  4NPE A;  3RGU A;  1H0T B;  4K3A A;  2M0B A;  4ZMD A;  2UWJ E;  3FXE A;  2WMM A;  1LP1 A;  4WWI A;  3ZDM A;  4KJM A;  4JBZ A;  2LR2 A;  2LXB A;  1ZXG A;  3S1K A;  1MFT A;  2B89 A;  2RKL A;  1LP1 B;  2KIK A;  2HR3 A;  2M5A A;  2K3R A;  3MHV A;  1U7M A;  1OVV A;  4HJG H;  4CPG A;  5DJT B;  2ZAE B;  1JM0 A;  1BDC A;  1JMB A;  2KS1 B;  1SS1 A;  2M5A B;  2R44 A;  5CBN A;  4HKZ H;  1EDK A;  1NVO A;  4NPF X;  1X0T A;  2P58 A;  1BDD A;  1EDJ A;  1EDI A;  4GOF A;  4GOE A;  1Y47 A;  2OTK E;  4ASV A;  4BXL A;  4IOI H;  1Q2N A;  4ASW A;  2SPZ A;  2KI7 B;  5EFW B;  1OVU A;  2QRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...