2KIKA

An artificial di-iron oxo-protein with phenol oxidase activity
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
48
structure length
48
Chain Sequence
DYLRELLKGELQGIKQYREALEYTHNPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Artificial diiron protein
publication title An artificial di-iron oxo-protein with phenol oxidase activity
rcsb
total genus 14
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kikA00
4K35A 3PH0A 2I8DA 5C39A 1X0TA 1ZW0A 1BDCA 2R44A 2KS1B 5DJUB 2HR3A 4NPEA 1U7JA 4K3AA 2M5AB 4ASWA 1OVRA 1NVOA 2KUBA 1LT1A 1JMBA 2LXCB 4GOFA 1EDIA 4KJMA 4EYYQ 2LXBA 5CBNA 2KIKA 2Q1KA 3FXEA 2OTKE 2B88A 1H0TB 4CPGA 2B87A 5DJTB 4JBZA 1OVUA 2M0BA 3S1KA 4HB1A 2KZJA 4MN4C 4GODA 2JWDA 3MZWB 4GOEA 1ZXGA 2B87B 1U7MA 4HJGH 5EFWB 1OVVA 1EDLA 1JM0A 5K5GB 1Y47A 1BDDA 1LP1A 1EDJA 2QVAA 1Q2NA 1SS1A 2K3RA 2KZIA 4ZMDA 2B89A 3RGUA 1DEEG 4WWIA 1MFTA 1LP1B 3MHVA 2RKLA 2P58A 1FC2C 4ZNCA 4BXLA 4NPDA 4HKZH 1H0TA 4IOIH 2WMMA 3QWOC 2UWJE 1S3JA 2LR2A 5CBOA 1EDKA 3ZDMA 3FXDA 2ZAEB 4NPFX 2QRXA 2SPZA 2M5AA 4ASVA 2KI7B 1EC5A
chains in the Genus database with same CATH superfamily
3JCUH 1BDCA 1HGVA 4DCKA 4H13D 1ZLLA 3AE7C 2FYUD 1SQXG 4L73A 1N73C 1BSHA 2Z5IA 2M3BA 2R32A 2H89C 5APWA 2MKVA 2ZT9B 3U59A 1KILB 3AE1C 1MV8A 2QJYC 3UIAA 2AXTH 2W6JH 2FXOA 4MN4C 1AQ5A 2IZ1A 5KJ7A 3H1LG 1IC2A 4C7NB 2OTJP 4KHXA 4AYCA 2YNYA 3RK2D 2WSCH 2FYUK 2O3JA 2W8ZA 1N7SC 1JY3P 3H1HJ 1EDLA 1MUUA 3A5TA 5APYA 1SLQA 1X79B 3EQ2A 3AECC 1USEA 1QEXA 3BATA 1P84H 1RY3A 3VN0A 2Y0EA 3IAOA 3H25A 4HYTB 1BGYG 4ZMDA 1J1DB 2B89A 3USSA 3D71A 4N3YB 5E79H 4D6TG 2ZFCA 5GTHE 4HKZH 4EIJA 2PAJA 5B66H 2XKMA 2E75B 2HFED 2PRRA 2WMMA 3H1HD 3BVHA 3CWBJ 2FXPA 3AE6C 4ASVA 4BRYB 2ZYGA 3JSVC 1BCCG 1URQB 1KILA 2CPSA 2Z4EA 1N73B 2KS1B 1K8AQ 2WZ7A 3L72G 3IFMA 3Q3DA 1IZNB 1EDIA 2QJYB 2R5DA 5CCHC 3P8CE 4C7NA 3OAKA 1DD3A 1OIPA 5KLVJ 1L0NE 2W27A 3MUDC 3PHLA 3GF3A 1N7SB 3BRVB 3LIEA 1MKMA 1AVOA 3VOPA 2QEXP 4PD4I 1NJIQ 5GTHH 4YXWH 2CK3H 3PTZA 4Y99B 3PP5A 3RGUA 3H1JD 1D7MA 3CCQP 5KLVD 4BRYA 4LGDE 3PLNA 4H13C 2IBZI 3CX5H 1GL2A 1URQA 1N73A 2KS1A 3ITKA 1SQPE 1T3JA 3S9OA 1TU3F 1H8AA 1DH3A 4EOTA 1H89A 2OYOA 1OXZA 2HR3A 1LTTC 4PD4D 5KJ7D 2WITA 4LC1A 5KLVK 1JCCA 1U57A 1JY3N 2N9YB 3RL0g 3HTKB 3HUSB 1S5LX 4GIFA 5AW2B 5KAFE 5AW5B 1N7SA 5AW8B 1FJKA 2M3EA 1WT6A 1RF1C 2BCCJ 1SQBJ 5AVXB 1IJDB 3B4SA 2IBZD 1GK6A 4N78D 1MFZA 1OVVA 2I1JA 5KLIB 1KYOI 1FZFA 1EXJA 1SQXJ 3VP8A 1AQTA 3R2PA 1W5CE 2JKVA 4H13B 1LJ2A 2BCCD 1SQBD 3L73E 3L70J 4H44D 1HWTC 5CCGA 2P7JA 5AW9B 5KAFH 3HTKA 1GMJA 3HUSA 3G6EP 1KYOD 1NAYA 1BGYJ 3WUTA 2V4HA 2RN0A 4L76A 1OZHA 3H1JE 1OFCX 3RK2B 1SQBK 4HH2A 1H0TB 3L70D 1HJBA 2A06G 2IDBA 1RF1B 3F89A 2HYNA 2XZRA 2FYZA 3CXHI 1FBMA 4PV1D 1SQVE 2IYPA 2FFDB 4M3LA 1N2DC 1BCCJ 1NWQA 1ZR2A 5K5GB 1BGYD 4PD4E 3L72J 2XV5A 1FDOA 3V2QA 2P67A 1KQFB 1GL2D 1M1JC 1A02J 1QGKB 4C46A 5CMZA 4DJGA 1VPCA 3OJAB 5BU5A 1L4AD 4BWNA 1NTMG 2AXCA 4JF7A 1LWUC 2RKLA 4R4LA 3GW6A 3CC4P 1K04A 1KQSO 1YQ4C 1NHLA 2L91A 3FWNA 1VQ7P 3BCCJ 3GHGB 5KJ7C 1HTLC 4ZKPA 4N78E 1BCCD 3L73G 3CXHD 2KI7B 2WQYC 1X0TA 1JY3O 2ZXXA 4A7PA 3M0AA 1R5SA 1ZMEC 5GTIE 1NO4A 1SQQE 1KMIZ 2J58A 2KUBA 2IZ0A 1CI6B 1GU5A 1KFMA 2G8YA 3MD0A 1M1KQ 4QMAA 1QVFO 2B88A 3EFGA 1FU1A 1VL2A 3IN6A 2CPBA 3BCCD 1KILE 1PPJE 4OVNF 1EZVG 2FFDA 1FAVA 1JUNA 3VYIA 4PD4H 2O01N 2K37A 1GW4A 2N1TD 4WVZA 1NAFA 1BSNA 5CJ0A 1KB9I 1JM0A 2KB7P 1Y8AA 1PZQA 1SVFA 2ZT9C 1KILC 1R8EA 1FOSF 1M1JB 4B86A 2Q6QA 4H44C 2OTLP 4LLHA 3IF4A 1LWUB 2L5GB 3GF7A 1GTWA 3GHGA 3AE8C 4PJ0E 3L70E 3E1IA 3H1IJ 1LT9B 1NU1E 4KT0J 3A3YB 4OH8B 3M0DC 3TGUG 4IL6E 3Q5SA 4NPDA 2JWAA 2A45G 3FX0A 5APUA 2KSEA 3QWOC 3KYQA 5GTIH 1G1IA 1VF5D 3O8ZA 2YKQA 1RE4C 1AV1A 1CI6A 1S2EA 1J1DC 3L4FA 1XTGB 3T97B 1KB9D 5AVRB 3AE2C 3IR9A 1NGMB 1NTKG 3H1ID 2HLOA 4PV1C 2WPSA 1YITP 2Q3IA 2ZYAA 2KIKA 2GUSA 3E1RA 3CD6P 1SQQG 3AE5C 1JOCA 1KYOH 5B66E 5AVYB 1FOSE 2FY8A 4GODA 4W80A 2JWDA 1GL2C 3KZIH 2OYHC 2NPSD 2XNXA 4I2LC 1URQC 2WPVB 1M1JA 1ZXGA 3BRTB 1PPJG 2QJPC 1XTCC 1FDMA 5EFWB 1LTBC 2KLVA 4PJ0H 1S72P 1LWUA 4JYCA 3VMAA 4H44B 1LT9A 4IL6H 2E76D 1IK9A 3CL3D 2FBWC 2JDIH 1ZP0C 4IFDK 2YMYA 5TISH 3M91A 4BXLA 1YJNP 4L75A 3H1KJ 2Y9YA 3NTNA 1NU1G 3T97A 3CCLP 2NZ2A 3AEGC 3ZDMA 2WSFJ 2JR8A 2YIUB 1PGJA 2W90A 1Q90D 1G2CB 5C39A 4Y99C 1X22A 1ZV8A 2KOGA 1NTZG 3L37A 4I1LA 1M57D 1NKZB 3L75E 1EXIA 1VQLP 4NPEA 4PV1B 1L0LJ 1OW6A 2N1TC 4C7RA 1PP9E 3AE4C 2QSIA 1GU4A 1NTMJ 4GKGA 4GOFA 2A06D 3CXHH 2LXBA 3H6PA 1YI2P 5APSA 1IFMA 3FXEA 1YTZT 3L74E 2YKOA 5AVWB 3H1KD 3CCMP 1QVGO 3V2RA 1GL2B 2OYHB 3L71G 3CX5E 4OWFA 1L4AB 2QJPB 1FZBA 4GOEA 5CCGC 4U7JA 2C0WA 1BE3E 3VP9A 2QM7A 3HUSC 3M0DA 1L0LD 1ZOYC 5H2FH 3TDKA 3H1IE 3I55P 2QJKC 3M9BA 3CWBD 1IO4A 1VQMP 3MP7B 3SFDC 1HBWA 1RE4A 1GK4A 1HH0A 1HF9A 3V2PA 1M7LA 2FYUE 1G2CA 3AEAC 3HD7B 5KLIC 3MIWA 1QL1A 3M9HA 2QRXA 4EDFA 1L0LK 1SFCA 2OYIB 4YTPC 3R4YA 4U3FJ 2N1TB 2H7HA 1E5WA 4WBAA 2NPSC 4K3AA 4DT0A 2OYHA 3U1CA 2A45I 2YXQB 5CBNA 2NRGA 4H0LD 1L4AA 1LGHB 1T6AA 3TGUJ 2OTKE 2WVRA 1RQUA 3G3ZA 3CCJP 2VRSA 4XFJA 1KB9H 2M0BA 2E76C 5AVTB 3AE3C 3L74G 1W2EA 4RKUJ 3WUVA 5AW3B 4HJGH 4U3FD 3RK2C 5KKZC 3W67A 4AQRD 3C1LA 4TT3H 3H32B 1VF5B 2QJKB 4JPZB 3KQGA 1NTKJ 1DX7A 1KV4A 3CCVP 3H1HE 2IFNA 3TGUD 3HD7A 3OW2O 1BE3G 1K73Q 4YPCA 1L0NG 2FFDC 3EFFK 2OYIA 1Q81Q 2N9BA 2N1TA 3CCSP 3FXDA 1OWAA 2FYUG 3A2AA 3PH0A 1L0LE 2I8DA 2YXRB 3GMAA 1KTMA 1NTKD 4R4MA 4JYBA 3D6ZA 1Z56A 2NPSB 3CWBE 2C9LY 1YHQP 3JC22 3H1LJ 3GHGC 1MZ9A 1KQLA 2OQQA 1YIJP 2Q1KA 1SQXD 2RMZA 2E42A 2E76B 1GD2E 4DZOA 2I1KA 1SQPG 1GZLA 3G4SP 3H32A 1Y9BA 4I6MC 3KXDA 1LTJA 1NTKK 3C8VA 5KKZB 1S9KD 1JY2P 5KLVE 3CLQA 4UB8E 1NTZJ 4D6TJ 4IFFA 1FDIA 5KAIE 1S5LH 2O01J 1YJ9P 2WTYA 4EI2A 2QA4P 2K9JB 3H1LD 1OX3A 2OGUA 3I5CA 1SQXK 4N6JA 1Q2NA 1GW3A 1NYHA 1SFCD 2BEZF 2P1JA 3S4RA 3L71J 5B5EE 1FC2C 1LTGC 3QH9A 3B5ND 3U1AA 1OW7A 2NPSA 5AVQB 1PFIA 1EDKA 1NTZD 4U3FE 4D6TD 4H0LC 2WPQA 4UB6H 4K35A 4IFMA 3GLMA 3CMAP 1VQ9P 1LT9C 1Q86Q 1AVYA 3B71A 1U7JA 3A0BH 1FZCA 2IBZE 1LT1A 1IFJA 1ZR4A 4OGQD 1T8ZA 3L72D 1CW5A 5AW6B 4UB8H 1X8YA 3O6QB 3TNUB 3M9QA 1K05A 5KAIH 3L35A 3S1KA 2KZJA 2HODB 1NTZK 3V4WA 3HD7D 2K9JA 3AEEC 3A7OA 1SP4A 2KLUA 2Q7CA 1DEBA 1Q7YQ 2BCCE 3WUUA 1SQBE 2KSJA 1W2BO 1JEKA 5B5EH 3H1JG 3FGAD 2JO1A 1EDJA 2JJLA 2YO3A 3V5BA 3RBXA 1SQXE 2R3CA 2RH0A 1FZEA 5AW7B 1N7LA 1KYOE 2P10A 1QX8A 3HE4A 3OA7A 3KZIE 1SQVG 2H88C 4H0LB 2GUVA 1WRGA 1S9KE 1WMKA 1M90Q 2WT7B 4IL6X 5APQA 1CZQA 1FJPA 3P8MC 2R44A 5AW0B 3AEDC 2E5YA 5AVVB 3O6QA 3TNUA 4XE5B 1N8RQ 1JY2N 1RE3C 2HODA 5TISE 2JP3A 1L0NJ 3RBZA 1JTHA 2E5TA 3TSIA 2Y0DA 3AEFC 3NXSA 1BGYE 1JMMA 2YIUC 1H88A 3N4XA 3CCEP 3MZWB 1IK7A 2QIWA 2Q5UA 3VMXA 2BEQD 1SFCC 3CCUP 2KXPB 2GA1A 1YBKA 3V2NA 1VDFA 1S1CX 1J1EB 1BDDA 2Z5HA 2Q9IA 1GDTA 2J5UA 2QVAA 1L0ND 4I7ZB 2D2CD 1BCCE 2K3RA 3CXHE 1AFOA 3Q5PA 2YO2A 1L4AC 5KTBA 3L72E 2HPCA 2KP8A 1SQPJ 2WT7A 3L36A 1VQ6P 3RK3D 2QM8A 1VQPP 1VQNP 3HE5B 4OGQC 1ZN5A 2SPZA 1JO5A 2E74D 1N86A 3BCCE 3B8EB 4AUWA 4TLFA 1ZW0A 5H2FE 1L0NK 2Y9ZA 3TYYA 3L70G 3M06A 2J59M 2O1KA 1NH4A 3HD7C 1JMBA 3P7KA 2LXCB 1RF0A 2FXMA 3Q1MA 2O01H 2WPRA 1SQPD 1E79H 3F5HA 2IPPA 1KQGB 3BASA 2OYIC 2XNDH 1PGPA 1SFCB 5AVSB 1VQ8P 2IFMA 1X9VA 1VQ4P 3B5NB 1AA0A 5CHXA 1S4XA 1USDA 2B9BA 2R3SA 1SQPK 3L73J 5BU8B 2KZIA 3PRJA 1LNQA 1MFTA 2R5BA 1LP1B 3MHVA 3HE5A 2P58A 1PGOA 1KB9E 4ZNCA 2PGDA 2XU6A 3Q5RA 2V7QJ 2XDJA 1NTMD 2P2UA 4OGQB 1VF5C 1M56D 1EZVI 1LTJC 5CBOA 2E43A 3NMDA 4W7YA 1VQ5P 1RE3A 3II6A 1FS0E 2FYNC 1JY2O 3H1JJ 4WY4D 3WU2E 3D6YA 1EQ7A 3L73D 5DJUB 3E7KA 1OVRA 3BCCG 2GM4A 2HG5D 3HRNA 1NTMK 1IFIA 5AVZB 3MGNA 1SQVJ 1T2KD 1IFNA 3B5NA 3RK3E 2K88A 3SSUA 2D2CC 2AEFA 2ITAA 2ZYDA 1EZVD 5APTA 2PP6A 3KHUA 1RH5B 3L75G 1Q82Q 3CPWO 1PP9G 3FWLA 1LP1A 1L2PA 3CC7P 1FZCC 3RK3C 1SS1A 1FE6A 2ZXEB 1G1JA 2E74C 1DEEG 1VQOP 1SQVD 1ZRTD 3CC2P 3LW5J 5TJHA 1HGZA 1KFNA 4Y28J 4DOJA 2QE7H 3WU2H 3AEBC 1LTJB 1JB0J 2H8PD 1S3JA 2A06E 1HJ0A 2OARA 2FYNB 3CI9A 5AW4B 4NPFX 2Q3EA 4RJTA 1SQQJ 2FKWB 2KNCB 3AE9C 3H1KE 3H1IG 3MTUE 1S5LE 1KN7A 1LTIC 2WSEJ 4GT1A 3RL0D 2IYOA 1NVOA 1SQVK 2BASA 3G9RA 4EYYQ 1OW8A 1FZGA 3GG2A 5DJTB 3CCRP 1NTME 2ZJSE 4GDOA 1OVUA 2D2CB 4HB1A 2W83C 4RO0A 5AVUB 1FZAA 1SQQD 4WB4A 2B87B 1JNMA 3NFQA 1QL2A 4UB6E 5CJ4A 1R5LA 2ZT9D 4RESB 1FZCB 1KILD 3RK3B 1PPJD 1NU1J 3A0BE 2PFXA 2E74B 1JCDA 5APXA 1IFPA 3WMM0 5CCHA 4WY4C 1UIXA 2DW3A 1P84I 1SQQK 2KNCA 2WSCJ 3V6IA 3P32A 2WSFH 1YTZI 2ZVNB 1EZVE 3LIDA 3MUDA 2ZAEB 3TK1A 3SWKA 2G3AA 1PGQA 1QLED 1NU1D 4XA4A 4L74A 4YXDC 3H1HG 1T2KC 4Z1MH 3VTPC 2C9NY 3A0HE 1KC8Q 2KYVA 1YJWP 3H1KG 1DD4A 3W68A 2E75D 4KJMA 1ZRTE 2JEEA 3D70A 1J2JB 3HE4B 1KORA 4CPGA 2B87A 3KDPB 3V4QA 1YQ3C 1NOHA 1HUCA 1P84D 5BVZA 3TGUE 1M8OB 1URQD 1L0LG 1RHZB 1NU1K 3L71D 1PL5A 4ZKUA 3CWBG 2V7QH 1CSBA 1KD1Q 5AW1B 1Y47A 4W7ZA 3SWFA 2POHA 1JTHB 1RF0C 1LTAC 1OMIA 4WY4B 1NTKE 3TF5A 2AEJA 1N7SD 1NKNA 2C0XA 1H0TA 4IOIH 3RL0C 3VMZA 1RF1A 1J1EC 2LKMA 5KLVG 3A0HH 3SWYA 3ABVC 1RQVA 2M8RA 3C9IA 3L75J 1VQKP 4I7ZC 1IFDA 1PP9J 2QG4A 3KPEA 3CX5I 2H43A 3L74J 4ASWA 2M5AB 1LTSC 1K9MQ 2HPCB 3SFEC 2W6BA 3JCUE 2MJZA 2KK7A 2A45H 2IX7C 1HVVA 2YKPA 2YMKA 1A02F 3K5BA 3H1LE 2O1JA 4JBZA 3EWKA 4U3FG 3L75D 1BE3J 1PP9D 5M1BA 2ZVOB 3LW5H 5L8RJ 5CCGD 1U7MA 2AEMA 2AXTE 1T3UA 5CCHD 3Q2YA 3G71P 3L74D 2IBZG 3N7NA 4WY4A 2K1AA 2WWWA 1AJYA 3CX5D 1NTZE 4D6TE 2FYUJ 5APVA 4O9BA 4WWIA 3CMEP 1UIIA 1YYCA 1DIPA 2WSEH 3RL0B 3P8CD 2Y0CA 1BE3D 1P84E 3B5NC 3PJSK 2K9YA 2UWJE 2W6AA 1PIXA 2LR2A 2BCCG 2WSSH 1SQBG 3L71E 2E75C 1PV3A 4JQ0D 3I56P 1KZUB 2M5AA 5E79E 3VMYA 1EC5A
chains in the Genus database with same CATH topology
4K35A 3PH0A 2I8DA 5C39A 1X0TA 1ZW0A 1BDCA 2R44A 2KS1B 5DJUB 2HR3A 4NPEA 1U7JA 4K3AA 2M5AB 4ASWA 1OVRA 1NVOA 2KUBA 1LT1A 1JMBA 2LXCB 4GOFA 1EDIA 4KJMA 4EYYQ 2LXBA 5CBNA 2KIKA 2Q1KA 3FXEA 2OTKE 2B88A 1H0TB 4CPGA 2B87A 5DJTB 4JBZA 1OVUA 2M0BA 3S1KA 4HB1A 2KZJA 4MN4C 4GODA 2JWDA 3MZWB 4GOEA 1ZXGA 2B87B 1U7MA 4HJGH 5EFWB 1OVVA 1EDLA 1JM0A 5K5GB 1Y47A 1BDDA 1LP1A 1EDJA 2QVAA 1Q2NA 1SS1A 2K3RA 2KZIA 4ZMDA 2B89A 3RGUA 1DEEG 4WWIA 1MFTA 1LP1B 3MHVA 2RKLA 2P58A 1FC2C 4ZNCA 4BXLA 4NPDA 4HKZH 1H0TA 4IOIH 2WMMA 3QWOC 2UWJE 1S3JA 2LR2A 5CBOA 1EDKA 3ZDMA 3FXDA 2ZAEB 4NPFX 2QRXA 2SPZA 2M5AA 4ASVA 2KI7B 1EC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K35 A;  3PH0 A;  2I8D A;  5C39 A;  1X0T A;  1ZW0 A;  1BDC A;  2R44 A;  2KS1 B;  5DJU B;  2HR3 A;  4NPE A;  1U7J A;  4K3A A;  2M5A B;  4ASW A;  1OVR A;  1NVO A;  2KUB A;  1LT1 A;  1JMB A;  2LXC B;  4GOF A;  1EDI A;  4KJM A;  4EYY Q;  2LXB A;  5CBN A;  2KIK A;  2Q1K A;  3FXE A;  2OTK E;  2B88 A;  1H0T B;  4CPG A;  2B87 A;  5DJT B;  4JBZ A;  1OVU A;  2M0B A;  3S1K A;  4HB1 A;  2KZJ A;  4MN4 C;  4GOD A;  2JWD A;  3MZW B;  4GOE A;  1ZXG A;  2B87 B;  1U7M A;  4HJG H;  5EFW B;  1OVV A;  1EDL A;  1JM0 A;  5K5G B;  1Y47 A;  1BDD A;  1LP1 A;  1EDJ A;  2QVA A;  1Q2N A;  1SS1 A;  2K3R A;  2KZI A;  4ZMD A;  2B89 A;  3RGU A;  1DEE G;  4WWI A;  1MFT A;  1LP1 B;  3MHV A;  2RKL A;  2P58 A;  1FC2 C;  4ZNC A;  4BXL A;  4NPD A;  4HKZ H;  1H0T A;  4IOI H;  2WMM A;  3QWO C;  2UWJ E;  1S3J A;  2LR2 A;  5CBO A;  1EDK A;  3ZDM A;  3FXD A;  2ZAE B;  4NPF X;  2QRX A;  2SPZ A;  2M5A A;  4ASV A;  2KI7 B;  1EC5 A; 
#chains in the Genus database with same CATH topology
 3JCU H;  1BDC A;  1HGV A;  4DCK A;  4H13 D;  1ZLL A;  3AE7 C;  2FYU D;  1SQX G;  4L73 A;  1N73 C;  1BSH A;  2Z5I A;  2M3B A;  2R32 A;  2H89 C;  5APW A;  2MKV A;  2ZT9 B;  3U59 A;  1KIL B;  3AE1 C;  1MV8 A;  2QJY C;  3UIA A;  2AXT H;  2W6J H;  2FXO A;  4MN4 C;  1AQ5 A;  2IZ1 A;  5KJ7 A;  3H1L G;  1IC2 A;  4C7N B;  2OTJ P;  4KHX A;  4AYC A;  2YNY A;  3RK2 D;  2WSC H;  2FYU K;  2O3J A;  2W8Z A;  1N7S C;  1JY3 P;  3H1H J;  1EDL A;  1MUU A;  3A5T A;  5APY A;  1SLQ A;  1X79 B;  3EQ2 A;  3AEC C;  1USE A;  1QEX A;  3BAT A;  1P84 H;  1RY3 A;  3VN0 A;  2Y0E A;  3IAO A;  3H25 A;  4HYT B;  1BGY G;  4ZMD A;  1J1D B;  2B89 A;  3USS A;  3D71 A;  4N3Y B;  5E79 H;  4D6T G;  2ZFC A;  5GTH E;  4HKZ H;  4EIJ A;  2PAJ A;  5B66 H;  2XKM A;  2E75 B;  2HFE D;  2PRR A;  2WMM A;  3H1H D;  3BVH A;  3CWB J;  2FXP A;  3AE6 C;  4ASV A;  4BRY B;  2ZYG A;  3JSV C;  1BCC G;  1URQ B;  1KIL A;  2CPS A;  2Z4E A;  1N73 B;  2KS1 B;  1K8A Q;  2WZ7 A;  3L72 G;  3IFM A;  3Q3D A;  1IZN B;  1EDI A;  2QJY B;  2R5D A;  5CCH C;  3P8C E;  4C7N A;  3OAK A;  1DD3 A;  1OIP A;  5KLV J;  1L0N E;  2W27 A;  3MUD C;  3PHL A;  3GF3 A;  1N7S B;  3BRV B;  3LIE A;  1MKM A;  1AVO A;  3VOP A;  2QEX P;  4PD4 I;  1NJI Q;  5GTH H;  4YXW H;  2CK3 H;  3PTZ A;  4Y99 B;  3PP5 A;  3RGU A;  3H1J D;  1D7M A;  3CCQ P;  5KLV D;  4BRY A;  4LGD E;  3PLN A;  4H13 C;  2IBZ I;  3CX5 H;  1GL2 A;  1URQ A;  1N73 A;  2KS1 A;  3ITK A;  1SQP E;  1T3J A;  3S9O A;  1TU3 F;  1H8A A;  1DH3 A;  4EOT A;  1H89 A;  2OYO A;  1OXZ A;  2HR3 A;  1LTT C;  4PD4 D;  5KJ7 D;  2WIT A;  4LC1 A;  5KLV K;  1JCC A;  1U57 A;  1JY3 N;  2N9Y B;  3RL0 g;  3HTK B;  3HUS B;  1S5L X;  4GIF A;  5AW2 B;  5KAF E;  5AW5 B;  1N7S A;  5AW8 B;  1FJK A;  2M3E A;  1WT6 A;  1RF1 C;  2BCC J;  1SQB J;  5AVX B;  1IJD B;  3B4S A;  2IBZ D;  1GK6 A;  4N78 D;  1MFZ A;  1OVV A;  2I1J A;  5KLI B;  1KYO I;  1FZF A;  1EXJ A;  1SQX J;  3VP8 A;  1AQT A;  3R2P A;  1W5C E;  2JKV A;  4H13 B;  1LJ2 A;  2BCC D;  1SQB D;  3L73 E;  3L70 J;  4H44 D;  1HWT C;  5CCG A;  2P7J A;  5AW9 B;  5KAF H;  3HTK A;  1GMJ A;  3HUS A;  3G6E P;  1KYO D;  1NAY A;  1BGY J;  3WUT A;  2V4H A;  2RN0 A;  4L76 A;  1OZH A;  3H1J E;  1OFC X;  3RK2 B;  1SQB K;  4HH2 A;  1H0T B;  3L70 D;  1HJB A;  2A06 G;  2IDB A;  1RF1 B;  3F89 A;  2HYN A;  2XZR A;  2FYZ A;  3CXH I;  1FBM A;  4PV1 D;  1SQV E;  2IYP A;  2FFD B;  4M3L A;  1N2D C;  1BCC J;  1NWQ A;  1ZR2 A;  5K5G B;  1BGY D;  4PD4 E;  3L72 J;  2XV5 A;  1FDO A;  3V2Q A;  2P67 A;  1KQF B;  1GL2 D;  1M1J C;  1A02 J;  1QGK B;  4C46 A;  5CMZ A;  4DJG A;  1VPC A;  3OJA B;  5BU5 A;  1L4A D;  4BWN A;  1NTM G;  2AXC A;  4JF7 A;  1LWU C;  2RKL A;  4R4L A;  3GW6 A;  3CC4 P;  1K04 A;  1KQS O;  1YQ4 C;  1NHL A;  2L91 A;  3FWN A;  1VQ7 P;  3BCC J;  3GHG B;  5KJ7 C;  1HTL C;  4ZKP A;  4N78 E;  1BCC D;  3L73 G;  3CXH D;  2KI7 B;  2WQY C;  1X0T A;  1JY3 O;  2ZXX A;  4A7P A;  3M0A A;  1R5S A;  1ZME C;  5GTI E;  1NO4 A;  1SQQ E;  1KMI Z;  2J58 A;  2KUB A;  2IZ0 A;  1CI6 B;  1GU5 A;  1KFM A;  2G8Y A;  3MD0 A;  1M1K Q;  4QMA A;  1QVF O;  2B88 A;  3EFG A;  1FU1 A;  1VL2 A;  3IN6 A;  2CPB A;  3BCC D;  1KIL E;  1PPJ E;  4OVN F;  1EZV G;  2FFD A;  1FAV A;  1JUN A;  3VYI A;  4PD4 H;  2O01 N;  2K37 A;  1GW4 A;  2N1T D;  4WVZ A;  1NAF A;  1BSN A;  5CJ0 A;  1KB9 I;  1JM0 A;  2KB7 P;  1Y8A A;  1PZQ A;  1SVF A;  2ZT9 C;  1KIL C;  1R8E A;  1FOS F;  1M1J B;  4B86 A;  2Q6Q A;  4H44 C;  2OTL P;  4LLH A;  3IF4 A;  1LWU B;  2L5G B;  3GF7 A;  1GTW A;  3GHG A;  3AE8 C;  4PJ0 E;  3L70 E;  3E1I A;  3H1I J;  1LT9 B;  1NU1 E;  4KT0 J;  3A3Y B;  4OH8 B;  3M0D C;  3TGU G;  4IL6 E;  3Q5S A;  4NPD A;  2JWA A;  2A45 G;  3FX0 A;  5APU A;  2KSE A;  3QWO C;  3KYQ A;  5GTI H;  1G1I A;  1VF5 D;  3O8Z A;  2YKQ A;  1RE4 C;  1AV1 A;  1CI6 A;  1S2E A;  1J1D C;  3L4F A;  1XTG B;  3T97 B;  1KB9 D;  5AVR B;  3AE2 C;  3IR9 A;  1NGM B;  1NTK G;  3H1I D;  2HLO A;  4PV1 C;  2WPS A;  1YIT P;  2Q3I A;  2ZYA A;  2KIK A;  2GUS A;  3E1R A;  3CD6 P;  1SQQ G;  3AE5 C;  1JOC A;  1KYO H;  5B66 E;  5AVY B;  1FOS E;  2FY8 A;  4GOD A;  4W80 A;  2JWD A;  1GL2 C;  3KZI H;  2OYH C;  2NPS D;  2XNX A;  4I2L C;  1URQ C;  2WPV B;  1M1J A;  1ZXG A;  3BRT B;  1PPJ G;  2QJP C;  1XTC C;  1FDM A;  5EFW B;  1LTB C;  2KLV A;  4PJ0 H;  1S72 P;  1LWU A;  4JYC A;  3VMA A;  4H44 B;  1LT9 A;  4IL6 H;  2E76 D;  1IK9 A;  3CL3 D;  2FBW C;  2JDI H;  1ZP0 C;  4IFD K;  2YMY A;  5TIS H;  3M91 A;  4BXL A;  1YJN P;  4L75 A;  3H1K J;  2Y9Y A;  3NTN A;  1NU1 G;  3T97 A;  3CCL P;  2NZ2 A;  3AEG C;  3ZDM A;  2WSF J;  2JR8 A;  2YIU B;  1PGJ A;  2W90 A;  1Q90 D;  1G2C B;  5C39 A;  4Y99 C;  1X22 A;  1ZV8 A;  2KOG A;  1NTZ G;  3L37 A;  4I1L A;  1M57 D;  1NKZ B;  3L75 E;  1EXI A;  1VQL P;  4NPE A;  4PV1 B;  1L0L J;  1OW6 A;  2N1T C;  4C7R A;  1PP9 E;  3AE4 C;  2QSI A;  1GU4 A;  1NTM J;  4GKG A;  4GOF A;  2A06 D;  3CXH H;  2LXB A;  3H6P A;  1YI2 P;  5APS A;  1IFM A;  3FXE A;  1YTZ T;  3L74 E;  2YKO A;  5AVW B;  3H1K D;  3CCM P;  1QVG O;  3V2R A;  1GL2 B;  2OYH B;  3L71 G;  3CX5 E;  4OWF A;  1L4A B;  2QJP B;  1FZB A;  4GOE A;  5CCG C;  4U7J A;  2C0W A;  1BE3 E;  3VP9 A;  2QM7 A;  3HUS C;  3M0D A;  1L0L D;  1ZOY C;  5H2F H;  3TDK A;  3H1I E;  3I55 P;  2QJK C;  3M9B A;  3CWB D;  1IO4 A;  1VQM P;  3MP7 B;  3SFD C;  1HBW A;  1RE4 A;  1GK4 A;  1HH0 A;  1HF9 A;  3V2P A;  1M7L A;  2FYU E;  1G2C A;  3AEA C;  3HD7 B;  5KLI C;  3MIW A;  1QL1 A;  3M9H A;  2QRX A;  4EDF A;  1L0L K;  1SFC A;  2OYI B;  4YTP C;  3R4Y A;  4U3F J;  2N1T B;  2H7H A;  1E5W A;  4WBA A;  2NPS C;  4K3A A;  4DT0 A;  2OYH A;  3U1C A;  2A45 I;  2YXQ B;  5CBN A;  2NRG A;  4H0L D;  1L4A A;  1LGH B;  1T6A A;  3TGU J;  2OTK E;  2WVR A;  1RQU A;  3G3Z A;  3CCJ P;  2VRS A;  4XFJ A;  1KB9 H;  2M0B A;  2E76 C;  5AVT B;  3AE3 C;  3L74 G;  1W2E A;  4RKU J;  3WUV A;  5AW3 B;  4HJG H;  4U3F D;  3RK2 C;  5KKZ C;  3W67 A;  4AQR D;  3C1L A;  4TT3 H;  3H32 B;  1VF5 B;  2QJK B;  4JPZ B;  3KQG A;  1NTK J;  1DX7 A;  1KV4 A;  3CCV P;  3H1H E;  2IFN A;  3TGU D;  3HD7 A;  3OW2 O;  1BE3 G;  1K73 Q;  4YPC A;  1L0N G;  2FFD C;  3EFF K;  2OYI A;  1Q81 Q;  2N9B A;  2N1T A;  3CCS P;  3FXD A;  1OWA A;  2FYU G;  3A2A A;  3PH0 A;  1L0L E;  2I8D A;  2YXR B;  3GMA A;  1KTM A;  1NTK D;  4R4M A;  4JYB A;  3D6Z A;  1Z56 A;  2NPS B;  3CWB E;  2C9L Y;  1YHQ P;  3JC2 2;  3H1L J;  3GHG C;  1MZ9 A;  1KQL A;  2OQQ A;  1YIJ P;  2Q1K A;  1SQX D;  2RMZ A;  2E42 A;  2E76 B;  1GD2 E;  4DZO A;  2I1K A;  1SQP G;  1GZL A;  3G4S P;  3H32 A;  1Y9B A;  4I6M C;  3KXD A;  1LTJ A;  1NTK K;  3C8V A;  5KKZ B;  1S9K D;  1JY2 P;  5KLV E;  3CLQ A;  4UB8 E;  1NTZ J;  4D6T J;  4IFF A;  1FDI A;  5KAI E;  1S5L H;  2O01 J;  1YJ9 P;  2WTY A;  4EI2 A;  2QA4 P;  2K9J B;  3H1L D;  1OX3 A;  2OGU A;  3I5C A;  1SQX K;  4N6J A;  1Q2N A;  1GW3 A;  1NYH A;  1SFC D;  2BEZ F;  2P1J A;  3S4R A;  3L71 J;  5B5E E;  1FC2 C;  1LTG C;  3QH9 A;  3B5N D;  3U1A A;  1OW7 A;  2NPS A;  5AVQ B;  1PFI A;  1EDK A;  1NTZ D;  4U3F E;  4D6T D;  4H0L C;  2WPQ A;  4UB6 H;  4K35 A;  4IFM A;  3GLM A;  3CMA P;  1VQ9 P;  1LT9 C;  1Q86 Q;  1AVY A;  3B71 A;  1U7J A;  3A0B H;  1FZC A;  2IBZ E;  1LT1 A;  1IFJ A;  1ZR4 A;  4OGQ D;  1T8Z A;  3L72 D;  1CW5 A;  5AW6 B;  4UB8 H;  1X8Y A;  3O6Q B;  3TNU B;  3M9Q A;  1K05 A;  5KAI H;  3L35 A;  3S1K A;  2KZJ A;  2HOD B;  1NTZ K;  3V4W A;  3HD7 D;  2K9J A;  3AEE C;  3A7O A;  1SP4 A;  2KLU A;  2Q7C A;  1DEB A;  1Q7Y Q;  2BCC E;  3WUU A;  1SQB E;  2KSJ A;  1W2B O;  1JEK A;  5B5E H;  3H1J G;  3FGA D;  2JO1 A;  1EDJ A;  2JJL A;  2YO3 A;  3V5B A;  3RBX A;  1SQX E;  2R3C A;  2RH0 A;  1FZE A;  5AW7 B;  1N7L A;  1KYO E;  2P10 A;  1QX8 A;  3HE4 A;  3OA7 A;  3KZI E;  1SQV G;  2H88 C;  4H0L B;  2GUV A;  1WRG A;  1S9K E;  1WMK A;  1M90 Q;  2WT7 B;  4IL6 X;  5APQ A;  1CZQ A;  1FJP A;  3P8M C;  2R44 A;  5AW0 B;  3AED C;  2E5Y A;  5AVV B;  3O6Q A;  3TNU A;  4XE5 B;  1N8R Q;  1JY2 N;  1RE3 C;  2HOD A;  5TIS E;  2JP3 A;  1L0N J;  3RBZ A;  1JTH A;  2E5T A;  3TSI A;  2Y0D A;  3AEF C;  3NXS A;  1BGY E;  1JMM A;  2YIU C;  1H88 A;  3N4X A;  3CCE P;  3MZW B;  1IK7 A;  2QIW A;  2Q5U A;  3VMX A;  2BEQ D;  1SFC C;  3CCU P;  2KXP B;  2GA1 A;  1YBK A;  3V2N A;  1VDF A;  1S1C X;  1J1E B;  1BDD A;  2Z5H A;  2Q9I A;  1GDT A;  2J5U A;  2QVA A;  1L0N D;  4I7Z B;  2D2C D;  1BCC E;  2K3R A;  3CXH E;  1AFO A;  3Q5P A;  2YO2 A;  1L4A C;  5KTB A;  3L72 E;  2HPC A;  2KP8 A;  1SQP J;  2WT7 A;  3L36 A;  1VQ6 P;  3RK3 D;  2QM8 A;  1VQP P;  1VQN P;  3HE5 B;  4OGQ C;  1ZN5 A;  2SPZ A;  1JO5 A;  2E74 D;  1N86 A;  3BCC E;  3B8E B;  4AUW A;  4TLF A;  1ZW0 A;  5H2F E;  1L0N K;  2Y9Z A;  3TYY A;  3L70 G;  3M06 A;  2J59 M;  2O1K A;  1NH4 A;  3HD7 C;  1JMB A;  3P7K A;  2LXC B;  1RF0 A;  2FXM A;  3Q1M A;  2O01 H;  2WPR A;  1SQP D;  1E79 H;  3F5H A;  2IPP A;  1KQG B;  3BAS A;  2OYI C;  2XND H;  1PGP A;  1SFC B;  5AVS B;  1VQ8 P;  2IFM A;  1X9V A;  1VQ4 P;  3B5N B;  1AA0 A;  5CHX A;  1S4X A;  1USD A;  2B9B A;  2R3S A;  1SQP K;  3L73 J;  5BU8 B;  2KZI A;  3PRJ A;  1LNQ A;  1MFT A;  2R5B A;  1LP1 B;  3MHV A;  3HE5 A;  2P58 A;  1PGO A;  1KB9 E;  4ZNC A;  2PGD A;  2XU6 A;  3Q5R A;  2V7Q J;  2XDJ A;  1NTM D;  2P2U A;  4OGQ B;  1VF5 C;  1M56 D;  1EZV I;  1LTJ C;  5CBO A;  2E43 A;  3NMD A;  4W7Y A;  1VQ5 P;  1RE3 A;  3II6 A;  1FS0 E;  2FYN C;  1JY2 O;  3H1J J;  4WY4 D;  3WU2 E;  3D6Y A;  1EQ7 A;  3L73 D;  5DJU B;  3E7K A;  1OVR A;  3BCC G;  2GM4 A;  2HG5 D;  3HRN A;  1NTM K;  1IFI A;  5AVZ B;  3MGN A;  1SQV J;  1T2K D;  1IFN A;  3B5N A;  3RK3 E;  2K88 A;  3SSU A;  2D2C C;  2AEF A;  2ITA A;  2ZYD A;  1EZV D;  5APT A;  2PP6 A;  3KHU A;  1RH5 B;  3L75 G;  1Q82 Q;  3CPW O;  1PP9 G;  3FWL A;  1LP1 A;  1L2P A;  3CC7 P;  1FZC C;  3RK3 C;  1SS1 A;  1FE6 A;  2ZXE B;  1G1J A;  2E74 C;  1DEE G;  1VQO P;  1SQV D;  1ZRT D;  3CC2 P;  3LW5 J;  5TJH A;  1HGZ A;  1KFN A;  4Y28 J;  4DOJ A;  2QE7 H;  3WU2 H;  3AEB C;  1LTJ B;  1JB0 J;  2H8P D;  1S3J A;  2A06 E;  1HJ0 A;  2OAR A;  2FYN B;  3CI9 A;  5AW4 B;  4NPF X;  2Q3E A;  4RJT A;  1SQQ J;  2FKW B;  2KNC B;  3AE9 C;  3H1K E;  3H1I G;  3MTU E;  1S5L E;  1KN7 A;  1LTI C;  2WSE J;  4GT1 A;  3RL0 D;  2IYO A;  1NVO A;  1SQV K;  2BAS A;  3G9R A;  4EYY Q;  1OW8 A;  1FZG A;  3GG2 A;  5DJT B;  3CCR P;  1NTM E;  2ZJS E;  4GDO A;  1OVU A;  2D2C B;  4HB1 A;  2W83 C;  4RO0 A;  5AVU B;  1FZA A;  1SQQ D;  4WB4 A;  2B87 B;  1JNM A;  3NFQ A;  1QL2 A;  4UB6 E;  5CJ4 A;  1R5L A;  2ZT9 D;  4RES B;  1FZC B;  1KIL D;  3RK3 B;  1PPJ D;  1NU1 J;  3A0B E;  2PFX A;  2E74 B;  1JCD A;  5APX A;  1IFP A;  3WMM 0;  5CCH A;  4WY4 C;  1UIX A;  2DW3 A;  1P84 I;  1SQQ K;  2KNC A;  2WSC J;  3V6I A;  3P32 A;  2WSF H;  1YTZ I;  2ZVN B;  1EZV E;  3LID A;  3MUD A;  2ZAE B;  3TK1 A;  3SWK A;  2G3A A;  1PGQ A;  1QLE D;  1NU1 D;  4XA4 A;  4L74 A;  4YXD C;  3H1H G;  1T2K C;  4Z1M H;  3VTP C;  2C9N Y;  3A0H E;  1KC8 Q;  2KYV A;  1YJW P;  3H1K G;  1DD4 A;  3W68 A;  2E75 D;  4KJM A;  1ZRT E;  2JEE A;  3D70 A;  1J2J B;  3HE4 B;  1KOR A;  4CPG A;  2B87 A;  3KDP B;  3V4Q A;  1YQ3 C;  1NOH A;  1HUC A;  1P84 D;  5BVZ A;  3TGU E;  1M8O B;  1URQ D;  1L0L G;  1RHZ B;  1NU1 K;  3L71 D;  1PL5 A;  4ZKU A;  3CWB G;  2V7Q H;  1CSB A;  1KD1 Q;  5AW1 B;  1Y47 A;  4W7Z A;  3SWF A;  2POH A;  1JTH B;  1RF0 C;  1LTA C;  1OMI A;  4WY4 B;  1NTK E;  3TF5 A;  2AEJ A;  1N7S D;  1NKN A;  2C0X A;  1H0T A;  4IOI H;  3RL0 C;  3VMZ A;  1RF1 A;  1J1E C;  2LKM A;  5KLV G;  3A0H H;  3SWY A;  3ABV C;  1RQV A;  2M8R A;  3C9I A;  3L75 J;  1VQK P;  4I7Z C;  1IFD A;  1PP9 J;  2QG4 A;  3KPE A;  3CX5 I;  2H43 A;  3L74 J;  4ASW A;  2M5A B;  1LTS C;  1K9M Q;  2HPC B;  3SFE C;  2W6B A;  3JCU E;  2MJZ A;  2KK7 A;  2A45 H;  2IX7 C;  1HVV A;  2YKP A;  2YMK A;  1A02 F;  3K5B A;  3H1L E;  2O1J A;  4JBZ A;  3EWK A;  4U3F G;  3L75 D;  1BE3 J;  1PP9 D;  5M1B A;  2ZVO B;  3LW5 H;  5L8R J;  5CCG D;  1U7M A;  2AEM A;  2AXT E;  1T3U A;  5CCH D;  3Q2Y A;  3G71 P;  3L74 D;  2IBZ G;  3N7N A;  4WY4 A;  2K1A A;  2WWW A;  1AJY A;  3CX5 D;  1NTZ E;  4D6T E;  2FYU J;  5APV A;  4O9B A;  4WWI A;  3CME P;  1UII A;  1YYC A;  1DIP A;  2WSE H;  3RL0 B;  3P8C D;  2Y0C A;  1BE3 D;  1P84 E;  3B5N C;  3PJS K;  2K9Y A;  2UWJ E;  2W6A A;  1PIX A;  2LR2 A;  2BCC G;  2WSS H;  1SQB G;  3L71 E;  2E75 C;  1PV3 A;  4JQ0 D;  3I56 P;  1KZU B;  2M5A A;  5E79 E;  3VMY A;  1EC5 A; 
#chains in the Genus database with same CATH homology
 4K35 A;  3PH0 A;  2I8D A;  5C39 A;  1X0T A;  1ZW0 A;  1BDC A;  2R44 A;  2KS1 B;  5DJU B;  2HR3 A;  4NPE A;  1U7J A;  4K3A A;  2M5A B;  4ASW A;  1OVR A;  1NVO A;  2KUB A;  1LT1 A;  1JMB A;  2LXC B;  4GOF A;  1EDI A;  4KJM A;  4EYY Q;  2LXB A;  5CBN A;  2KIK A;  2Q1K A;  3FXE A;  2OTK E;  2B88 A;  1H0T B;  4CPG A;  2B87 A;  5DJT B;  4JBZ A;  1OVU A;  2M0B A;  3S1K A;  4HB1 A;  2KZJ A;  4MN4 C;  4GOD A;  2JWD A;  3MZW B;  4GOE A;  1ZXG A;  2B87 B;  1U7M A;  4HJG H;  5EFW B;  1OVV A;  1EDL A;  1JM0 A;  5K5G B;  1Y47 A;  1BDD A;  1LP1 A;  1EDJ A;  2QVA A;  1Q2N A;  1SS1 A;  2K3R A;  2KZI A;  4ZMD A;  2B89 A;  3RGU A;  1DEE G;  4WWI A;  1MFT A;  1LP1 B;  3MHV A;  2RKL A;  2P58 A;  1FC2 C;  4ZNC A;  4BXL A;  4NPD A;  4HKZ H;  1H0T A;  4IOI H;  2WMM A;  3QWO C;  2UWJ E;  1S3J A;  2LR2 A;  5CBO A;  1EDK A;  3ZDM A;  3FXD A;  2ZAE B;  4NPF X;  2QRX A;  2SPZ A;  2M5A A;  4ASV A;  2KI7 B;  1EC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...