2KIKA

An artificial di-iron oxo-protein with phenol oxidase activity
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
48
structure length
48
Chain Sequence
DYLRELLKGELQGIKQYREALEYTHNPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An artificial di-iron oxo-protein with phenol oxidase activity
rcsb
molecule tags De novo protein
molecule keywords Artificial diiron protein
total genus 14
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kikA00
2OTKE 2KI7B 1EDKA 1LP1B 1DEEG 4ZNCA 4BXLA 3MZWB 1JM0A 1EDLA 5CBNA 2ZAEB 4GOFA 2K3RA 4HKZH 3PH0A 4IOIH 1U7JA 2I8DA 4MN4C 1LP1A 5DJTB 1EDIA 4ASVA 2UWJE 2B87B 2M0BA 1FC2C 1SS1A 1H0TA 4ASWA 1BDCA 2KS1B 1OVVA 2JWDA 4JBZA 2M5AA 4K3AA 3RGUA 4HB1A 1Q2NA 2KZIA 4NPEA 2B89A 4WWIA 1X0TA 3ZDMA 4CPGA 1JMBA 1LT1A 1MFTA 1U7MA 2R44A 4K35A 4NPFX 5EFWB 5C39A 4KJMA 3FXEA 2LXCB 2LXBA 2M5AB 2QVAA 4GODA 4EYYQ 3S1KA 2Q1KA 4ZMDA 1H0TB 2B87A 1ZXGA 1OVRA 4NPDA 2KZJA 2P58A 2RKLA 4GOEA 1OVUA 3QWOC 1Y47A 3FXDA 1BDDA 2KIKA 1ZW0A 1EDJA 2B88A 5CBOA 2SPZA 5DJUB 5K5GB 4HJGH 2LR2A 2KUBA 2HR3A 1EC5A 1S3JA 3MHVA 2QRXA 1NVOA 2WMMA
chains in the Genus database with same CATH superfamily
2OTKE 1PFIA 3H6PA 2KSEA 1GZLA 2HPCB 3HD7A 2KI7B 1JOCA 1EDKA 3LW5H 4PD4I 2FYZA 1DEEG 4PV1D 1PGJA 3D70A 2G8YA 3P7KA 4EI2A 2HPCA 1UIXA 3FWLA 3MZWB 1D7MA 3CX5H 2OQQA 3BRVB 3RK2D 2E5YA 3H1KG 2OYIC 1KB9H 2WSSH 2R5DA 2J5UA 1NTME 4IOIH 1FZCA 3CCRP 3BATA 4Z1MH 1SQPE 5AVXB 3RL0g 3A0HE 5GTHE 1URQD 5KLVK 2J59M 1VF5C 4TT3H 1RQVA 1SFCB 2FYNB 2R3CA 2OYHC 3B8EB 1VQNP 1LP1A 1J1DB 1JY2N 1BCCD 4HYTB 1Q81Q 1BSHA 3R4YA 3RK2B 2FFDB 2M0BA 3CC4P 1NU1D 4GDOA 1H0TA 1PPJD 3IN6A 1MKMA 1DEBA 1RHZB 1M1JA 2B9BA 3H32B 3AE4C 4XFJA 1GL2B 5E79H 3MTUE 1NU1K 1URQC 3RK3D 2HG5D 3V5BA 2M5AA 1KYOE 4ZKUA 1NJIQ 2KYVA 1FZFA 1IK9A 1NTMG 4RESB 2WZ7A 3PJSK 4XA4A 3GF3A 1JNMA 2Q6QA 4UB6E 2GUVA 3A7OA 3AE3C 3H1KE 1Q2NA 2KZIA 2HLOA 1VQMP 1KB9I 1N86A 1IFIA 3NFQA 4JYCA 4C7RA 3L72J 3L35A 4WWIA 4CPGA 4PV1B 5GTIE 1JMBA 2Z5HA 4N78E 3TGUD 2QJYB 3I56P 1QVGO 2H89C 1GL2D 3CXHI 1LT1A 1MFTA 2WSFH 2R44A 1RF0C 1YYCA 2YXQB 5KAFE 1W2BO 4K35A 4W7YA 1QX8A 3CD6P 2C0XA 1SQXJ 3A0BH 2PAJA 3LIDA 1ZN5A 5EFWB 3AE2C 1Q82Q 4Y99C 3L4FA 2WTYA 2IFMA 1AQTA 3AE6C 3OAKA 1T3JA 1IC2A 1SP4A 4KJMA 1DIPA 5APQA 1M90Q 4D6TJ 1E5WA 4W80A 5CCGD 1JY2P 4L73A 5KAIH 4L75A 1PP9J 1WT6A 5APTA 2LXBA 1JO5A 2M5AB 2QJYC 3W67A 2AEJA 3UIAA 1VQPP 1NWQA 1RE4A 1S5LE 3HE5B 1BE3J 1PGPA 2XU6A 1BSNA 4U3FD 2H43A 3JCUE 3H32A 2WPVB 4LGDE 3I55P 2BEZF 3O8ZA 2XKMA 3L71E 4L74A 1H8AA 3S1KA 3CCMP 3PTZA 4KHXA 4WY4B 4Y99B 1BCCG 1S4XA 1SQQE 4O9BA 2MKVA 3KXDA 3MUDA 3VMXA 5AVYB 3CCSP 3Q5RA 2AXCA 1NO4A 3CI9A 5KJ7A 1TU3F 1S9KD 3H1HD 1T2KD 1L4AB 2IFNA 3FX0A 5AW9B 3F5HA 5AW2B 1KMIZ 1NU1G 1SFCA 4OH8B 1KV4A 1SQPG 1NAFA 2A06G 1PP9G 2BCCE 3BCCG 1N7SC 3CXHD 5CCGA 1N8RQ 1VQLP 5B5EE 5KJ7C 3M0DC 3CCVP 1ZR4A 1FZCB 3Q5PA 1YQ3C 2G3AA 1H0TB 3NXSA 4WY4C 3OA7A 2YIUC 1M1KQ 1OVUA 2KSJA 3CCJP 2WPQA 2YO2A 2L5GB 2KIKA 1SQXE 1ZW0A 1VPCA 2B88A 2N1TC 3TSIA 5B5EH 1JUNA 3CCQP 4H13D 4PV1C 3CCUP 1N7SB 1S2EA 1OWAA 2ZXEB 1HF9A 2IDBA 2A45G 1NTKD 2YMKA 2BCCD 3CXHE 4N6JA 4C46A 2FY8A 3L72E 1T6AA 2NPSA 3B4SA 3M9BA 1FZGA 5AVZB 2KUBA 2PFXA 1S9KE 2IZ0A 1PGQA 1OFCX 3L71J 5AVVB 2QRXA 1FZAA 2R32A 2WPSA 2WSFJ 1XTCC 1SQVJ 1SQQJ 5H2FE 1LGHB 1MZ9A 1NHLA 3WUTA 1IFDA 3TYYA 1GDTA 3H1JJ 4LC1A 2WMMA 5AW5B 1LTGC 3L75J 1NKZB 3CX5E 5KLVD 3V4QA 1BGYD 2WPRA 1CZQA 2QEXP 1L0LG 3G9RA 3VMYA 3EQ2A 2WT7A 1PPJE 4DOJA 4ZNCA 2AEMA 1URQA 1KFNA 3V4WA 2P7JA 2KLUA 3C8VA 5APXA 3MIWA 4OGQB 2JKVA 4PJ0H 1FZEA 4GOFA 3H1HG 1KB9D 2RMZA 3PH0A 1LTJA 4GT1A 3ABVC 1JTHA 3TGUG 2IZ1A 1U7JA 3L75G 4KT0J 2Y0DA 4N78D 5CCHA 1AVOA 3P32A 2Y9ZA 3TNUA 1T8ZA 3CWBD 2XDJA 3H1KD 1EDIA 2V7QJ 3FWNA 1P84E 4I6MC 5TISH 4JQ0D 2WSEJ 1JCCA 3B5NB 1HGZA 5B66H 1N7SA 2Z5IA 1RF1B 2QM8A 2OYIA 3TK1A 2KLVA 3V2NA 2JO1A 2KS1B 1OVVA 2OGUA 3TNUB 4A7PA 1AJYA 4TLFA 5APUA 3IR9A 2QG4A 2BASA 2VRSA 3BCCD 3SWFA 3U1CA 1NTZJ 5CJ0A 4PD4H 1K8AQ 1N73B 1QLED 1JTHB 2BEQD 3EWKA 3HUSA 1YI2P 5L8RJ 1BE3E 2POHA 3SFEC 2JP3A 5AVSB 1GTWA 2C9NY 2E43A 1NTZK 3RGUA 3JSVC 3OJAB 4DJGA 1WRGA 2KOGA 3C9IA 3L36A 4ZKPA 3TF5A 2ITAA 3H1IE 1N7LA 2FYUG 5AVRB 3SWKA 1YJ9P 4EIJA 4RO0A 5GTIH 5KLVG 1IZNB 2ZYAA 1SQPD 2IYPA 2WVRA 1L0LD 2HODB 5BU8B 1EXJA 1NTMD 1U7MA 3F89A 3WUVA 1KQLA 3E1IA 3M9HA 5APVA 1LWUA 5AW6B 4IFFA 1FZBA 2IBZG 3L73J 2OTJP 2YIUB 1PZQA 4BRYB 1JEKA 1OW8A 2XNDH 2KXPB 2YKPA 3I5CA 3PRJA 3G3ZA 1M57D 5E79E 1J2JB 1W2EA 2LXCB 3KZIH 1FOSE 3HUSB 1YJNP 3MP7B 1M8OB 2E75B 4WY4D 2CPBA 2QVAA 2GM4A 2N1TB 4I1LA 5AW7B 2E5TA 2QJPB 5KJ7D 3H25A 1AQ5A 1ZRTE 2KS1A 3CWBG 1Z56A 3E7KA 3IF4A 3KDPB 3VTPC 4YXWH 1K9MQ 2O01N 2RH0A 2I1JA 1DD4A 3B5NA 1FOSF 1PV3A 1USEA 2Y0CA 1EXIA 3CC2P 1ZXGA 3L70J 5APWA 3RL0C 2FXOA 3NMDA 2N1TA 3S9OA 4NPDA 2W83C 5BVZA 1KQSO 4R4LA 1GK4A 2O01J 3L74J 1KQFB 4H0LB 2P58A 1L0ND 3VMZA 3CXHH 3SFDC 1NKNA 1SQQK 5CCHC 1SQVK 1VQ9P 1J1EB 1EZVG 1ZOYC 5KAIE 3CL3D 3M0DA 1X8YA 1SQBD 2H8PD 3Q3DA 1K04A 1PIXA 4LLHA 5CCGC 4I7ZB 4PD4E 2CK3H 1KILC 1PL5A 2OARA 1YITP 1DH3A 1BDDA 1Y8AA 2JR8A 3H1LD 1GL2A 1VF5B 1G2CB 3HE4A 3H1IJ 1EQ7A 3G71P 1LT9C 3RBZA 1P84H 4OGQC 1NTZE 1FZCC 1IFPA 1JY2O 1BGYG 2NPSD 3AEBC 3A3YB 1X79B 3IFMA 2H88C 3RK2C 2FFDC 2V4HA 1NYHA 2HYNA 3EFFK 3PLNA 1LTBC 3L73G 2HR3A 2IBZI 2QM7A 1G1JA 3L72D 2KNCA 2W6BA 3MHVA 1K05A 1KFMA 3TGUJ 4D6TG 1NTKE 3B71A 2WWWA 2DW3A 2K37A 1S5LX 4H13B 3CCLP 4OGQD 1CI6B 4OWFA 1R5LA 1FDIA 3M91A 3AECC 1RF1C 3OW2O 1AVYA 2KK7A 4H44B 3C1LA 3P8CD 3P8CE 3ITKA 1KD1Q 2MJZA 3WU2H 1W5CE 2W90A 2FXPA 2IYOA 3CC7P 1DD3A 3RL0B 4GKGA 3VMAA 3HD7B 2FYUJ 2E74C 2WQYC 5TJHA 1WMKA 1JM0A 2V7QH 1FS0E 3AEEC 3B5ND 3HTKB 5CBNA 3AE7C 3BCCJ 2ZAEB 2FYUD 2AXTE 1LTJB 2R5BA 3A0BE 3L74E 3II6A 1AFOA 2ZYGA 3BRTB 1VDFA 3L70E 1LTIC 1L0NG 2KNCB 1RE3C 2I8DA 1SFCC 1T3UA 2FYNC 2IBZD 1SQVE 5APSA 3GMAA 1OW6A 1SQBG 2AXTH 1FJKA 1SQXK 2K1AA 5DJTB 3VOPA 3H1JE 1LTTC 3U59A 1ZLLA 2UWJE 3RK3E 4U3FE 3EFGA 2B87B 1FC2C 1LTJC 1SS1A 2KB7P 2XZRA 3H1LG 2PGDA 3H1LE 2E76B 4JF7A 5AW1B 2A45H 1Q7YQ 1YQ4C 3BVHA 1VQOP 2OTLP 2JWDA 1KC8Q 4XE5B 1SQBE 3QH9A 1RE3A 4D6TE 3HE4B 3MGNA 4GIFA 2OYHA 5AVQB 2N9YB 1GW4A 4JBZA 4PD4D 4WBAA 1CSBA 1IFMA 3B5NC 1YTZI 1L0NE 1BCCJ 2WSEH 1OMIA 1A02J 5AVWB 2Q7CA 1KN7A 4HB1A 1HUCA 1NU1J 1KTMA 1VQKP 2BCCJ 3NTNA 3V2QA 3O6QA 4YXDC 4NPEA 3CPWO 3SWYA 1N2DC 1E79H 2M3BA 1NGMB 1N73C 1X0TA 4WVZA 3ZDMA 3A0HH 4U7JA 1HTLC 2Q5UA 2YO3A 3AE5C 1HJ0A 5M1BA 4OVNF 1KYOH 1GW3A 1Q90D 5AW4B 1T2KC 1J1EC 3RK3C 2H7HA 2K9JA 2D2CB 4U3FJ 2P67A 4H0LC 4DCKA 1N7SD 3O6QB 1KORA 5KLVJ 4I2LC 3V6IA 2Q9IA 5CHXA 2ZFCA 2ZVNB 3USSA 2A45I 1MV8A 1G1IA 3CMEP 1EZVI 5APYA 3HRNA 1ZR2A 1YBKA 2C9LY 5CCHD 1J1DC 3SSUA 1SVFA 5TISE 1ZP0C 1RY3A 3M9QA 2M8RA 2P2UA 1HJBA 2NRGA 1KILE 2N9BA 4BRYA 4RJTA 3M06A 1ZV8A 4WY4A 1IK7A 2B87A 4U3FG 3HUSC 2P1JA 3VN0A 4B86A 5KAFH 1YIJP 3H1JG 2ZYDA 1LTSC 2E76C 3P8MC 1GL2C 1SQVG 4M3LA 2FYUK 3JC22 1KILA 1BE3D 4PJ0E 3H1KJ 1FBMA 1KYOI 2GUSA 2RKLA 3L70G 4GOEA 4IFMA 2O1JA 2WSCJ 3KZIE 3L74G 4QMAA 1SQPK 5AW3B 1EZVE 2A06D 4UB8H 4EOTA 1Y47A 2JEEA 3FXDA 3GHGC 3V2RA 3H1HJ 1VL2A 1OX3A 2AEFA 2CPSA 5KTBA 1RE4C 1SQBK 1L4AD 1JMMA 2JJLA 2O01H 1QL1A 1P84D 2WITA 3AEFC 5CBOA 1EZVD 3VP8A 3Q2YA 1IO4A 2SPZA 1KZUB 2E74D 2QJKB 3HD7C 2R3SA 1L0NK 5DJUB 1USDA 4HJGH 1VQ6P 3A5TA 4H44D 1JB0J 3AEDC 5AVUB 2LR2A 2QE7H 3CWBE 5GTHH 3WMM0 4DZOA 1VQ8P 2W27A 1IFNA 4RKUJ 2P10A 1QEXA 1KB9E 1EC5A 1FDOA 1NTKG 3V2PA 1HVVA 1VF5D 3IAOA 3JCUH 1MUUA 3L73E 2PP6A 2OYOA 1SQXD 2D2CC 1LJ2A 2QJKC 3E1RA 1YTZT 2RN0A 4BWNA 1S1CX 1LTAC 1U57A 1M7LA 1LWUC 3KPEA 4WB4A 3G4SP 3AE9C 4D6TD 1BGYE 2FFDA 1GU4A 4DT0A 1NH4A 1NTZG 1AA0A 1PP9D 1GK6A 1SFCD 3KHUA 1LP1B 3T97A 3U1AA 3D6YA 1OW7A 2Q3IA 2QSIA 2WT7B 1LT9A 4YPCA 1G2CA 3N4XA 1SQVD 4IL6E 4BXLA 2XV5A 3CX5D 2Y9YA 5KLVE 3MD0A 1P84I 3H1JD 1M1JC 1YHQP 4H44C 3AEAC 2YXRB 1EDLA 1NTMK 2K3RA 2FBWC 4HKZH 2OYHB 4AQRD 1HWTC 1X9VA 1X22A 3HTKA 3W68A 1YJWP 5KLIC 2M3EA 3L70D 1L2PA 4ZMDA 2QA4P 2ZJSE 3BASA 2ZXXA 3RK3B 3VYIA 1H88A 3GHGB 4Y28J 4MN4C 5AW0B 1FU1A 2NPSB 3L74D 2ZT9C 1RF1A 1FDMA 3GG2A 4ASVA 4C7NA 2Z4EA 2L91A 5CMZA 3CLQA 2IX7C 4IL6H 3TDKA 1Y9BA 1OIPA 4L76A 3AE8C 4ASWA 3A2AA 1BDCA 1CI6A 1CW5A 1NAYA 1NTKK 3CWBJ 1L0LJ 5H2FH 3L75E 2ZT9B 3MUDC 2K88A 4H0LD 3KYQA 4K3AA 1RH5B 3PHLA 3K5BA 4HH2A 4R4MA 5AVTB 3TGUE 1DX7A 1L0LK 1OXZA 1NTKJ 3H1HE 3Q1MA 4AYCA 1M56D 1LNQA 3FGAD 3WUUA 2IBZE 1VQ7P 2B89A 2GA1A 3L37A 1JY3O 1LWUB 2ZVOB 2YKQA 1L4AA 3N7NA 3L71D 3RL0D 1NTZD 1PPJG 2HODA 1KYOD 2Q3EA 3GW6A 3T97B 2E42A 1PGOA 1HH0A 1SQQD 2JDIH 4IL6X 3G6EP 2HFED 4W7ZA 1VQ4P 5CJ4A 2W6JH 2FYUE 3H1IG 4NPFX 1JCDA 3L75D 2J58A 5C39A 1BGYJ 1NOHA 1S72P 1XTGB 3FXEA 1BE3G 1RF0A 5B66E 2LKMA 3HE5A 5KKZB 2YMYA 3LW5J 1Q86Q 4JYBA 3PP5A 2QIWA 5BU5A 2E75C 1HBWA 1IFJA 1N73A 1NTMJ 5KLIB 1JY3P 2XNXA 4GODA 3CMAP 4H13C 2YKOA 3L73D 3AEGC 2QJPC 1FAVA 4JPZB 1QL2A 3R2PA 4EYYQ 1RQUA 1K73Q 2OYIB 2Q1KA 3KQGA 1QVFO 2JWAA 3D71A 2K9JB 1FE6A 4C7NB 5KKZC 1OVRA 3D6ZA 3GHGA 1SQXG 2IPPA 2KZJA 2E75D 1A02F 3CCEP 1OZHA 2E74B 3HD7D 3M0AA 2NZ2A 4EDFA 2YNYA 1S5LH 2O3JA 4YTPC 1MFZA 1R8EA 4I7ZC 3QWOC 1FJPA 1PP9E 2BCCG 2A06E 1SLQA 1KILB 3BCCE 3WU2E 1NU1E 2W8ZA 5AW8B 1HGVA 2KP8A 1URQB 1EDJA 1LT9B 3CX5I 2W6AA 4AUWA 1L0NJ 1M1JB 2D2CD 4UB8E 1L0LE 2I1KA 3GF7A 3RBXA 4IFDK 3AE1C 2WSCH 5K5GB 1SQQG 1BCCE 1QGKB 2C0WA 4N3YB 1SQBJ 1VQ5P 3L71G 1ZMEC 3S4RA 1JY3N 1R5SA 3Q5SA 1GU5A 2E76D 2K9YA 2O1KA 1KQGB 3H1LJ 1GMJA 1KILD 1SQPJ 1S3JA 2Y0EA 1UIIA 3H1ID 3GLMA 4UB6H 3VP9A 2N1TD 1GD2E 3LIEA 1L4AC 1H89A 1NVOA 1AV1A 2PRRA 2FKWB 2ZT9D 3L72G 2NPSC 2FXMA 1ZRTD 1IJDB
chains in the Genus database with same CATH topology
2OTKE 2KI7B 1EDKA 1LP1B 1DEEG 4ZNCA 4BXLA 3MZWB 1JM0A 1EDLA 5CBNA 2ZAEB 4GOFA 2K3RA 4HKZH 3PH0A 4IOIH 1U7JA 2I8DA 4MN4C 1LP1A 5DJTB 1EDIA 4ASVA 2UWJE 2B87B 2M0BA 1FC2C 1SS1A 1H0TA 4ASWA 1BDCA 2KS1B 1OVVA 2JWDA 4JBZA 2M5AA 4K3AA 3RGUA 4HB1A 1Q2NA 2KZIA 4NPEA 2B89A 4WWIA 1X0TA 3ZDMA 4CPGA 1JMBA 1LT1A 1MFTA 1U7MA 2R44A 4K35A 4NPFX 5EFWB 5C39A 4KJMA 3FXEA 2LXCB 2LXBA 2M5AB 2QVAA 4GODA 4EYYQ 3S1KA 2Q1KA 4ZMDA 1H0TB 2B87A 1ZXGA 1OVRA 4NPDA 2KZJA 2P58A 2RKLA 4GOEA 1OVUA 3QWOC 1Y47A 3FXDA 1BDDA 2KIKA 1ZW0A 1EDJA 2B88A 5CBOA 2SPZA 5DJUB 5K5GB 4HJGH 2LR2A 2KUBA 2HR3A 1EC5A 1S3JA 3MHVA 2QRXA 1NVOA 2WMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTK E;  2KI7 B;  1EDK A;  1LP1 B;  1DEE G;  4ZNC A;  4BXL A;  3MZW B;  1JM0 A;  1EDL A;  5CBN A;  2ZAE B;  4GOF A;  2K3R A;  4HKZ H;  3PH0 A;  4IOI H;  1U7J A;  2I8D A;  4MN4 C;  1LP1 A;  5DJT B;  1EDI A;  4ASV A;  2UWJ E;  2B87 B;  2M0B A;  1FC2 C;  1SS1 A;  1H0T A;  4ASW A;  1BDC A;  2KS1 B;  1OVV A;  2JWD A;  4JBZ A;  2M5A A;  4K3A A;  3RGU A;  4HB1 A;  1Q2N A;  2KZI A;  4NPE A;  2B89 A;  4WWI A;  1X0T A;  3ZDM A;  4CPG A;  1JMB A;  1LT1 A;  1MFT A;  1U7M A;  2R44 A;  4K35 A;  4NPF X;  5EFW B;  5C39 A;  4KJM A;  3FXE A;  2LXC B;  2LXB A;  2M5A B;  2QVA A;  4GOD A;  4EYY Q;  3S1K A;  2Q1K A;  4ZMD A;  1H0T B;  2B87 A;  1ZXG A;  1OVR A;  4NPD A;  2KZJ A;  2P58 A;  2RKL A;  4GOE A;  1OVU A;  3QWO C;  1Y47 A;  3FXD A;  1BDD A;  2KIK A;  1ZW0 A;  1EDJ A;  2B88 A;  5CBO A;  2SPZ A;  5DJU B;  5K5G B;  4HJG H;  2LR2 A;  2KUB A;  2HR3 A;  1EC5 A;  1S3J A;  3MHV A;  2QRX A;  1NVO A;  2WMM A; 
#chains in the Genus database with same CATH topology
 2OTK E;  1PFI A;  3H6P A;  2KSE A;  1GZL A;  2HPC B;  3HD7 A;  2KI7 B;  1JOC A;  1EDK A;  3LW5 H;  4PD4 I;  2FYZ A;  1DEE G;  4PV1 D;  1PGJ A;  3D70 A;  2G8Y A;  3P7K A;  4EI2 A;  2HPC A;  1UIX A;  3FWL A;  3MZW B;  1D7M A;  3CX5 H;  2OQQ A;  3BRV B;  3RK2 D;  2E5Y A;  3H1K G;  2OYI C;  1KB9 H;  2WSS H;  2R5D A;  2J5U A;  1NTM E;  4IOI H;  1FZC A;  3CCR P;  3BAT A;  4Z1M H;  1SQP E;  5AVX B;  3RL0 g;  3A0H E;  5GTH E;  1URQ D;  5KLV K;  2J59 M;  1VF5 C;  4TT3 H;  1RQV A;  1SFC B;  2FYN B;  2R3C A;  2OYH C;  3B8E B;  1VQN P;  1LP1 A;  1J1D B;  1JY2 N;  1BCC D;  4HYT B;  1Q81 Q;  1BSH A;  3R4Y A;  3RK2 B;  2FFD B;  2M0B A;  3CC4 P;  1NU1 D;  4GDO A;  1H0T A;  1PPJ D;  3IN6 A;  1MKM A;  1DEB A;  1RHZ B;  1M1J A;  2B9B A;  3H32 B;  3AE4 C;  4XFJ A;  1GL2 B;  5E79 H;  3MTU E;  1NU1 K;  1URQ C;  3RK3 D;  2HG5 D;  3V5B A;  2M5A A;  1KYO E;  4ZKU A;  1NJI Q;  2KYV A;  1FZF A;  1IK9 A;  1NTM G;  4RES B;  2WZ7 A;  3PJS K;  4XA4 A;  3GF3 A;  1JNM A;  2Q6Q A;  4UB6 E;  2GUV A;  3A7O A;  3AE3 C;  3H1K E;  1Q2N A;  2KZI A;  2HLO A;  1VQM P;  1KB9 I;  1N86 A;  1IFI A;  3NFQ A;  4JYC A;  4C7R A;  3L72 J;  3L35 A;  4WWI A;  4CPG A;  4PV1 B;  5GTI E;  1JMB A;  2Z5H A;  4N78 E;  3TGU D;  2QJY B;  3I56 P;  1QVG O;  2H89 C;  1GL2 D;  3CXH I;  1LT1 A;  1MFT A;  2WSF H;  2R44 A;  1RF0 C;  1YYC A;  2YXQ B;  5KAF E;  1W2B O;  4K35 A;  4W7Y A;  1QX8 A;  3CD6 P;  2C0X A;  1SQX J;  3A0B H;  2PAJ A;  3LID A;  1ZN5 A;  5EFW B;  3AE2 C;  1Q82 Q;  4Y99 C;  3L4F A;  2WTY A;  2IFM A;  1AQT A;  3AE6 C;  3OAK A;  1T3J A;  1IC2 A;  1SP4 A;  4KJM A;  1DIP A;  5APQ A;  1M90 Q;  4D6T J;  1E5W A;  4W80 A;  5CCG D;  1JY2 P;  4L73 A;  5KAI H;  4L75 A;  1PP9 J;  1WT6 A;  5APT A;  2LXB A;  1JO5 A;  2M5A B;  2QJY C;  3W67 A;  2AEJ A;  3UIA A;  1VQP P;  1NWQ A;  1RE4 A;  1S5L E;  3HE5 B;  1BE3 J;  1PGP A;  2XU6 A;  1BSN A;  4U3F D;  2H43 A;  3JCU E;  3H32 A;  2WPV B;  4LGD E;  3I55 P;  2BEZ F;  3O8Z A;  2XKM A;  3L71 E;  4L74 A;  1H8A A;  3S1K A;  3CCM P;  3PTZ A;  4KHX A;  4WY4 B;  4Y99 B;  1BCC G;  1S4X A;  1SQQ E;  4O9B A;  2MKV A;  3KXD A;  3MUD A;  3VMX A;  5AVY B;  3CCS P;  3Q5R A;  2AXC A;  1NO4 A;  3CI9 A;  5KJ7 A;  1TU3 F;  1S9K D;  3H1H D;  1T2K D;  1L4A B;  2IFN A;  3FX0 A;  5AW9 B;  3F5H A;  5AW2 B;  1KMI Z;  1NU1 G;  1SFC A;  4OH8 B;  1KV4 A;  1SQP G;  1NAF A;  2A06 G;  1PP9 G;  2BCC E;  3BCC G;  1N7S C;  3CXH D;  5CCG A;  1N8R Q;  1VQL P;  5B5E E;  5KJ7 C;  3M0D C;  3CCV P;  1ZR4 A;  1FZC B;  3Q5P A;  1YQ3 C;  2G3A A;  1H0T B;  3NXS A;  4WY4 C;  3OA7 A;  2YIU C;  1M1K Q;  1OVU A;  2KSJ A;  3CCJ P;  2WPQ A;  2YO2 A;  2L5G B;  2KIK A;  1SQX E;  1ZW0 A;  1VPC A;  2B88 A;  2N1T C;  3TSI A;  5B5E H;  1JUN A;  3CCQ P;  4H13 D;  4PV1 C;  3CCU P;  1N7S B;  1S2E A;  1OWA A;  2ZXE B;  1HF9 A;  2IDB A;  2A45 G;  1NTK D;  2YMK A;  2BCC D;  3CXH E;  4N6J A;  4C46 A;  2FY8 A;  3L72 E;  1T6A A;  2NPS A;  3B4S A;  3M9B A;  1FZG A;  5AVZ B;  2KUB A;  2PFX A;  1S9K E;  2IZ0 A;  1PGQ A;  1OFC X;  3L71 J;  5AVV B;  2QRX A;  1FZA A;  2R32 A;  2WPS A;  2WSF J;  1XTC C;  1SQV J;  1SQQ J;  5H2F E;  1LGH B;  1MZ9 A;  1NHL A;  3WUT A;  1IFD A;  3TYY A;  1GDT A;  3H1J J;  4LC1 A;  2WMM A;  5AW5 B;  1LTG C;  3L75 J;  1NKZ B;  3CX5 E;  5KLV D;  3V4Q A;  1BGY D;  2WPR A;  1CZQ A;  2QEX P;  1L0L G;  3G9R A;  3VMY A;  3EQ2 A;  2WT7 A;  1PPJ E;  4DOJ A;  4ZNC A;  2AEM A;  1URQ A;  1KFN A;  3V4W A;  2P7J A;  2KLU A;  3C8V A;  5APX A;  3MIW A;  4OGQ B;  2JKV A;  4PJ0 H;  1FZE A;  4GOF A;  3H1H G;  1KB9 D;  2RMZ A;  3PH0 A;  1LTJ A;  4GT1 A;  3ABV C;  1JTH A;  3TGU G;  2IZ1 A;  1U7J A;  3L75 G;  4KT0 J;  2Y0D A;  4N78 D;  5CCH A;  1AVO A;  3P32 A;  2Y9Z A;  3TNU A;  1T8Z A;  3CWB D;  2XDJ A;  3H1K D;  1EDI A;  2V7Q J;  3FWN A;  1P84 E;  4I6M C;  5TIS H;  4JQ0 D;  2WSE J;  1JCC A;  3B5N B;  1HGZ A;  5B66 H;  1N7S A;  2Z5I A;  1RF1 B;  2QM8 A;  2OYI A;  3TK1 A;  2KLV A;  3V2N A;  2JO1 A;  2KS1 B;  1OVV A;  2OGU A;  3TNU B;  4A7P A;  1AJY A;  4TLF A;  5APU A;  3IR9 A;  2QG4 A;  2BAS A;  2VRS A;  3BCC D;  3SWF A;  3U1C A;  1NTZ J;  5CJ0 A;  4PD4 H;  1K8A Q;  1N73 B;  1QLE D;  1JTH B;  2BEQ D;  3EWK A;  3HUS A;  1YI2 P;  5L8R J;  1BE3 E;  2POH A;  3SFE C;  2JP3 A;  5AVS B;  1GTW A;  2C9N Y;  2E43 A;  1NTZ K;  3RGU A;  3JSV C;  3OJA B;  4DJG A;  1WRG A;  2KOG A;  3C9I A;  3L36 A;  4ZKP A;  3TF5 A;  2ITA A;  3H1I E;  1N7L A;  2FYU G;  5AVR B;  3SWK A;  1YJ9 P;  4EIJ A;  4RO0 A;  5GTI H;  5KLV G;  1IZN B;  2ZYA A;  1SQP D;  2IYP A;  2WVR A;  1L0L D;  2HOD B;  5BU8 B;  1EXJ A;  1NTM D;  1U7M A;  3F89 A;  3WUV A;  1KQL A;  3E1I A;  3M9H A;  5APV A;  1LWU A;  5AW6 B;  4IFF A;  1FZB A;  2IBZ G;  3L73 J;  2OTJ P;  2YIU B;  1PZQ A;  4BRY B;  1JEK A;  1OW8 A;  2XND H;  2KXP B;  2YKP A;  3I5C A;  3PRJ A;  3G3Z A;  1M57 D;  5E79 E;  1J2J B;  1W2E A;  2LXC B;  3KZI H;  1FOS E;  3HUS B;  1YJN P;  3MP7 B;  1M8O B;  2E75 B;  4WY4 D;  2CPB A;  2QVA A;  2GM4 A;  2N1T B;  4I1L A;  5AW7 B;  2E5T A;  2QJP B;  5KJ7 D;  3H25 A;  1AQ5 A;  1ZRT E;  2KS1 A;  3CWB G;  1Z56 A;  3E7K A;  3IF4 A;  3KDP B;  3VTP C;  4YXW H;  1K9M Q;  2O01 N;  2RH0 A;  2I1J A;  1DD4 A;  3B5N A;  1FOS F;  1PV3 A;  1USE A;  2Y0C A;  1EXI A;  3CC2 P;  1ZXG A;  3L70 J;  5APW A;  3RL0 C;  2FXO A;  3NMD A;  2N1T A;  3S9O A;  4NPD A;  2W83 C;  5BVZ A;  1KQS O;  4R4L A;  1GK4 A;  2O01 J;  3L74 J;  1KQF B;  4H0L B;  2P58 A;  1L0N D;  3VMZ A;  3CXH H;  3SFD C;  1NKN A;  1SQQ K;  5CCH C;  1SQV K;  1VQ9 P;  1J1E B;  1EZV G;  1ZOY C;  5KAI E;  3CL3 D;  3M0D A;  1X8Y A;  1SQB D;  2H8P D;  3Q3D A;  1K04 A;  1PIX A;  4LLH A;  5CCG C;  4I7Z B;  4PD4 E;  2CK3 H;  1KIL C;  1PL5 A;  2OAR A;  1YIT P;  1DH3 A;  1BDD A;  1Y8A A;  2JR8 A;  3H1L D;  1GL2 A;  1VF5 B;  1G2C B;  3HE4 A;  3H1I J;  1EQ7 A;  3G71 P;  1LT9 C;  3RBZ A;  1P84 H;  4OGQ C;  1NTZ E;  1FZC C;  1IFP A;  1JY2 O;  1BGY G;  2NPS D;  3AEB C;  3A3Y B;  1X79 B;  3IFM A;  2H88 C;  3RK2 C;  2FFD C;  2V4H A;  1NYH A;  2HYN A;  3EFF K;  3PLN A;  1LTB C;  3L73 G;  2HR3 A;  2IBZ I;  2QM7 A;  1G1J A;  3L72 D;  2KNC A;  2W6B A;  3MHV A;  1K05 A;  1KFM A;  3TGU J;  4D6T G;  1NTK E;  3B71 A;  2WWW A;  2DW3 A;  2K37 A;  1S5L X;  4H13 B;  3CCL P;  4OGQ D;  1CI6 B;  4OWF A;  1R5L A;  1FDI A;  3M91 A;  3AEC C;  1RF1 C;  3OW2 O;  1AVY A;  2KK7 A;  4H44 B;  3C1L A;  3P8C D;  3P8C E;  3ITK A;  1KD1 Q;  2MJZ A;  3WU2 H;  1W5C E;  2W90 A;  2FXP A;  2IYO A;  3CC7 P;  1DD3 A;  3RL0 B;  4GKG A;  3VMA A;  3HD7 B;  2FYU J;  2E74 C;  2WQY C;  5TJH A;  1WMK A;  1JM0 A;  2V7Q H;  1FS0 E;  3AEE C;  3B5N D;  3HTK B;  5CBN A;  3AE7 C;  3BCC J;  2ZAE B;  2FYU D;  2AXT E;  1LTJ B;  2R5B A;  3A0B E;  3L74 E;  3II6 A;  1AFO A;  2ZYG A;  3BRT B;  1VDF A;  3L70 E;  1LTI C;  1L0N G;  2KNC B;  1RE3 C;  2I8D A;  1SFC C;  1T3U A;  2FYN C;  2IBZ D;  1SQV E;  5APS A;  3GMA A;  1OW6 A;  1SQB G;  2AXT H;  1FJK A;  1SQX K;  2K1A A;  5DJT B;  3VOP A;  3H1J E;  1LTT C;  3U59 A;  1ZLL A;  2UWJ E;  3RK3 E;  4U3F E;  3EFG A;  2B87 B;  1FC2 C;  1LTJ C;  1SS1 A;  2KB7 P;  2XZR A;  3H1L G;  2PGD A;  3H1L E;  2E76 B;  4JF7 A;  5AW1 B;  2A45 H;  1Q7Y Q;  1YQ4 C;  3BVH A;  1VQO P;  2OTL P;  2JWD A;  1KC8 Q;  4XE5 B;  1SQB E;  3QH9 A;  1RE3 A;  4D6T E;  3HE4 B;  3MGN A;  4GIF A;  2OYH A;  5AVQ B;  2N9Y B;  1GW4 A;  4JBZ A;  4PD4 D;  4WBA A;  1CSB A;  1IFM A;  3B5N C;  1YTZ I;  1L0N E;  1BCC J;  2WSE H;  1OMI A;  1A02 J;  5AVW B;  2Q7C A;  1KN7 A;  4HB1 A;  1HUC A;  1NU1 J;  1KTM A;  1VQK P;  2BCC J;  3NTN A;  3V2Q A;  3O6Q A;  4YXD C;  4NPE A;  3CPW O;  3SWY A;  1N2D C;  1E79 H;  2M3B A;  1NGM B;  1N73 C;  1X0T A;  4WVZ A;  3ZDM A;  3A0H H;  4U7J A;  1HTL C;  2Q5U A;  2YO3 A;  3AE5 C;  1HJ0 A;  5M1B A;  4OVN F;  1KYO H;  1GW3 A;  1Q90 D;  5AW4 B;  1T2K C;  1J1E C;  3RK3 C;  2H7H A;  2K9J A;  2D2C B;  4U3F J;  2P67 A;  4H0L C;  4DCK A;  1N7S D;  3O6Q B;  1KOR A;  5KLV J;  4I2L C;  3V6I A;  2Q9I A;  5CHX A;  2ZFC A;  2ZVN B;  3USS A;  2A45 I;  1MV8 A;  1G1I A;  3CME P;  1EZV I;  5APY A;  3HRN A;  1ZR2 A;  1YBK A;  2C9L Y;  5CCH D;  1J1D C;  3SSU A;  1SVF A;  5TIS E;  1ZP0 C;  1RY3 A;  3M9Q A;  2M8R A;  2P2U A;  1HJB A;  2NRG A;  1KIL E;  2N9B A;  4BRY A;  4RJT A;  3M06 A;  1ZV8 A;  4WY4 A;  1IK7 A;  2B87 A;  4U3F G;  3HUS C;  2P1J A;  3VN0 A;  4B86 A;  5KAF H;  1YIJ P;  3H1J G;  2ZYD A;  1LTS C;  2E76 C;  3P8M C;  1GL2 C;  1SQV G;  4M3L A;  2FYU K;  3JC2 2;  1KIL A;  1BE3 D;  4PJ0 E;  3H1K J;  1FBM A;  1KYO I;  2GUS A;  2RKL A;  3L70 G;  4GOE A;  4IFM A;  2O1J A;  2WSC J;  3KZI E;  3L74 G;  4QMA A;  1SQP K;  5AW3 B;  1EZV E;  2A06 D;  4UB8 H;  4EOT A;  1Y47 A;  2JEE A;  3FXD A;  3GHG C;  3V2R A;  3H1H J;  1VL2 A;  1OX3 A;  2AEF A;  2CPS A;  5KTB A;  1RE4 C;  1SQB K;  1L4A D;  1JMM A;  2JJL A;  2O01 H;  1QL1 A;  1P84 D;  2WIT A;  3AEF C;  5CBO A;  1EZV D;  3VP8 A;  3Q2Y A;  1IO4 A;  2SPZ A;  1KZU B;  2E74 D;  2QJK B;  3HD7 C;  2R3S A;  1L0N K;  5DJU B;  1USD A;  4HJG H;  1VQ6 P;  3A5T A;  4H44 D;  1JB0 J;  3AED C;  5AVU B;  2LR2 A;  2QE7 H;  3CWB E;  5GTH H;  3WMM 0;  4DZO A;  1VQ8 P;  2W27 A;  1IFN A;  4RKU J;  2P10 A;  1QEX A;  1KB9 E;  1EC5 A;  1FDO A;  1NTK G;  3V2P A;  1HVV A;  1VF5 D;  3IAO A;  3JCU H;  1MUU A;  3L73 E;  2PP6 A;  2OYO A;  1SQX D;  2D2C C;  1LJ2 A;  2QJK C;  3E1R A;  1YTZ T;  2RN0 A;  4BWN A;  1S1C X;  1LTA C;  1U57 A;  1M7L A;  1LWU C;  3KPE A;  4WB4 A;  3G4S P;  3AE9 C;  4D6T D;  1BGY E;  2FFD A;  1GU4 A;  4DT0 A;  1NH4 A;  1NTZ G;  1AA0 A;  1PP9 D;  1GK6 A;  1SFC D;  3KHU A;  1LP1 B;  3T97 A;  3U1A A;  3D6Y A;  1OW7 A;  2Q3I A;  2QSI A;  2WT7 B;  1LT9 A;  4YPC A;  1G2C A;  3N4X A;  1SQV D;  4IL6 E;  4BXL A;  2XV5 A;  3CX5 D;  2Y9Y A;  5KLV E;  3MD0 A;  1P84 I;  3H1J D;  1M1J C;  1YHQ P;  4H44 C;  3AEA C;  2YXR B;  1EDL A;  1NTM K;  2K3R A;  2FBW C;  4HKZ H;  2OYH B;  4AQR D;  1HWT C;  1X9V A;  1X22 A;  3HTK A;  3W68 A;  1YJW P;  5KLI C;  2M3E A;  3L70 D;  1L2P A;  4ZMD A;  2QA4 P;  2ZJS E;  3BAS A;  2ZXX A;  3RK3 B;  3VYI A;  1H88 A;  3GHG B;  4Y28 J;  4MN4 C;  5AW0 B;  1FU1 A;  2NPS B;  3L74 D;  2ZT9 C;  1RF1 A;  1FDM A;  3GG2 A;  4ASV A;  4C7N A;  2Z4E A;  2L91 A;  5CMZ A;  3CLQ A;  2IX7 C;  4IL6 H;  3TDK A;  1Y9B A;  1OIP A;  4L76 A;  3AE8 C;  4ASW A;  3A2A A;  1BDC A;  1CI6 A;  1CW5 A;  1NAY A;  1NTK K;  3CWB J;  1L0L J;  5H2F H;  3L75 E;  2ZT9 B;  3MUD C;  2K88 A;  4H0L D;  3KYQ A;  4K3A A;  1RH5 B;  3PHL A;  3K5B A;  4HH2 A;  4R4M A;  5AVT B;  3TGU E;  1DX7 A;  1L0L K;  1OXZ A;  1NTK J;  3H1H E;  3Q1M A;  4AYC A;  1M56 D;  1LNQ A;  3FGA D;  3WUU A;  2IBZ E;  1VQ7 P;  2B89 A;  2GA1 A;  3L37 A;  1JY3 O;  1LWU B;  2ZVO B;  2YKQ A;  1L4A A;  3N7N A;  3L71 D;  3RL0 D;  1NTZ D;  1PPJ G;  2HOD A;  1KYO D;  2Q3E A;  3GW6 A;  3T97 B;  2E42 A;  1PGO A;  1HH0 A;  1SQQ D;  2JDI H;  4IL6 X;  3G6E P;  2HFE D;  4W7Z A;  1VQ4 P;  5CJ4 A;  2W6J H;  2FYU E;  3H1I G;  4NPF X;  1JCD A;  3L75 D;  2J58 A;  5C39 A;  1BGY J;  1NOH A;  1S72 P;  1XTG B;  3FXE A;  1BE3 G;  1RF0 A;  5B66 E;  2LKM A;  3HE5 A;  5KKZ B;  2YMY A;  3LW5 J;  1Q86 Q;  4JYB A;  3PP5 A;  2QIW A;  5BU5 A;  2E75 C;  1HBW A;  1IFJ A;  1N73 A;  1NTM J;  5KLI B;  1JY3 P;  2XNX A;  4GOD A;  3CMA P;  4H13 C;  2YKO A;  3L73 D;  3AEG C;  2QJP C;  1FAV A;  4JPZ B;  1QL2 A;  3R2P A;  4EYY Q;  1RQU A;  1K73 Q;  2OYI B;  2Q1K A;  3KQG A;  1QVF O;  2JWA A;  3D71 A;  2K9J B;  1FE6 A;  4C7N B;  5KKZ C;  1OVR A;  3D6Z A;  3GHG A;  1SQX G;  2IPP A;  2KZJ A;  2E75 D;  1A02 F;  3CCE P;  1OZH A;  2E74 B;  3HD7 D;  3M0A A;  2NZ2 A;  4EDF A;  2YNY A;  1S5L H;  2O3J A;  4YTP C;  1MFZ A;  1R8E A;  4I7Z C;  3QWO C;  1FJP A;  1PP9 E;  2BCC G;  2A06 E;  1SLQ A;  1KIL B;  3BCC E;  3WU2 E;  1NU1 E;  2W8Z A;  5AW8 B;  1HGV A;  2KP8 A;  1URQ B;  1EDJ A;  1LT9 B;  3CX5 I;  2W6A A;  4AUW A;  1L0N J;  1M1J B;  2D2C D;  4UB8 E;  1L0L E;  2I1K A;  3GF7 A;  3RBX A;  4IFD K;  3AE1 C;  2WSC H;  5K5G B;  1SQQ G;  1BCC E;  1QGK B;  2C0W A;  4N3Y B;  1SQB J;  1VQ5 P;  3L71 G;  1ZME C;  3S4R A;  1JY3 N;  1R5S A;  3Q5S A;  1GU5 A;  2E76 D;  2K9Y A;  2O1K A;  1KQG B;  3H1L J;  1GMJ A;  1KIL D;  1SQP J;  1S3J A;  2Y0E A;  1UII A;  3H1I D;  3GLM A;  4UB6 H;  3VP9 A;  2N1T D;  1GD2 E;  3LIE A;  1L4A C;  1H89 A;  1NVO A;  1AV1 A;  2PRR A;  2FKW B;  2ZT9 D;  3L72 G;  2NPS C;  2FXM A;  1ZRT D;  1IJD B; 
#chains in the Genus database with same CATH homology
 2OTK E;  2KI7 B;  1EDK A;  1LP1 B;  1DEE G;  4ZNC A;  4BXL A;  3MZW B;  1JM0 A;  1EDL A;  5CBN A;  2ZAE B;  4GOF A;  2K3R A;  4HKZ H;  3PH0 A;  4IOI H;  1U7J A;  2I8D A;  4MN4 C;  1LP1 A;  5DJT B;  1EDI A;  4ASV A;  2UWJ E;  2B87 B;  2M0B A;  1FC2 C;  1SS1 A;  1H0T A;  4ASW A;  1BDC A;  2KS1 B;  1OVV A;  2JWD A;  4JBZ A;  2M5A A;  4K3A A;  3RGU A;  4HB1 A;  1Q2N A;  2KZI A;  4NPE A;  2B89 A;  4WWI A;  1X0T A;  3ZDM A;  4CPG A;  1JMB A;  1LT1 A;  1MFT A;  1U7M A;  2R44 A;  4K35 A;  4NPF X;  5EFW B;  5C39 A;  4KJM A;  3FXE A;  2LXC B;  2LXB A;  2M5A B;  2QVA A;  4GOD A;  4EYY Q;  3S1K A;  2Q1K A;  4ZMD A;  1H0T B;  2B87 A;  1ZXG A;  1OVR A;  4NPD A;  2KZJ A;  2P58 A;  2RKL A;  4GOE A;  1OVU A;  3QWO C;  1Y47 A;  3FXD A;  1BDD A;  2KIK A;  1ZW0 A;  1EDJ A;  2B88 A;  5CBO A;  2SPZ A;  5DJU B;  5K5G B;  4HJG H;  2LR2 A;  2KUB A;  2HR3 A;  1EC5 A;  1S3J A;  3MHV A;  2QRX A;  1NVO A;  2WMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...