2KIKA

An artificial di-iron oxo-protein with phenol oxidase activity
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
48
structure length
48
Chain Sequence
DYLRELLKGELQGIKQYREALEYTHNPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An artificial di-iron oxo-protein with phenol oxidase activity
rcsb
molecule tags De novo protein
molecule keywords Artificial diiron protein
total genus 14
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kikA00
1EC5A 4ASWA 5C39A 1LT1A 4NPDA 1SS1A 2LXCB 5DJTB 2LXBA 3RGUA 5CBNA 4ZNCA 4GOFA 2Q1KA 4NPFX 2KZIA 2KZJA 2B87B 4NPEA 3MZWB 1U7JA 1ZW0A 1NVOA 4K3AA 2JWDA 1U7MA 4IOIH 3FXEA 1EDJA 2M5AA 2LR2A 4HJGH 4CPGA 2UWJE 4HB1A 5EFWB 1H0TA 2KIKA 1FC2C 1BDDA 1S3JA 2RKLA 4KJMA 1LP1B 1OVRA 4K35A 1X0TA 4JBZA 4GODA 4EYYQ 2I8DA 4MN4C 2M5AB 1BDCA 1DEEG 3PH0A 5CBOA 2QVAA 4ZMDA 1LP1A 2KS1B 2WMMA 2QRXA 1Y47A 4ASVA 2M0BA 3MHVA 5K5GB 2OTKE 5DJUB 1EDKA 1OVUA 2HR3A 3QWOC 1JMBA 1JM0A 1MFTA 2P58A 2SPZA 1H0TB 1Q2NA 1OVVA 2KI7B 4GOEA 1EDLA 3S1KA 2B88A 2R44A 3FXDA 4HKZH 2K3RA 4BXLA 3ZDMA 2B89A 1EDIA 2B87A 2KUBA 1ZXGA 4WWIA 2ZAEB
chains in the Genus database with same CATH superfamily
4RO0A 1NTKE 5CCHA 1JUNA 2WPQA 4H0LC 2QJYC 3RK3C 1CW5A 2XNDH 3L74D 1M90Q 1BCCJ 2A06E 2W27A 3PRJA 4NPDA 2IX7C 3B5NC 2E74C 3Q2YA 1YJ9P 1PPJE 3L75G 4L73A 4TLFA 1MUUA 1L0LK 2E5YA 4D6TD 2IYPA 5DJTB 1P84I 3S9OA 3TGUJ 2D2CC 1FJPA 1NTKK 1N7SC 2XV5A 2H7HA 2Y0CA 3L75J 4N78E 2YKQA 4BRYB 1KB9E 2QE7H 1HWTC 1NTZG 3JCUE 1N7SA 2WQYC 1LTTC 3NTNA 3PTZA 2QIWA 1LTIC 2WSEH 4R4LA 5CJ4A 4NPEA 3RL0g 1LTJA 1K04A 1OIPA 1Q90D 1U7JA 1N2DC 2K9YA 2WPSA 4PD4H 3HTKA 3B5NA 4A7PA 4K3AA 5APXA 2BCCG 1BE3G 2Z5IA 2FXMA 5APVA 1JY3P 1WMKA 4I2LC 4RESB 3HD7B 3D6YA 3A5TA 2WPRA 2J58A 1KYOI 1RF1B 1HGVA 3G3ZA 3MP7B 2M5AA 4EOTA 1PPJD 3PHLA 4HJGH 4PD4E 2PFXA 3SWYA 4CPGA 3Q5SA 1Q7YQ 4HB1A 1NKNA 3ABVC 2K88A 4I7ZB 1QX8A 1KB9I 1SQQK 1VDFA 1BGYJ 2P10A 2MKVA 3HE4B 3Q5RA 1KQGB 1L2PA 2QJYB 1S3JA 2KNCA 2GUVA 2P1JA 4GT1A 3L72G 3CCVP 1DIPA 2RKLA 2NPSD 3V2PA 3P8CE 3GW6A 2HLOA 2KSEA 4BRYA 1PGOA 2IPPA 1LTBC 2M3EA 2BCCD 1SQBD 1N7SB 5CHXA 5APYA 1FU1A 1OMIA 1USDA 4H13B 1NGMB 3BCCD 3CCLP 2ZYAA 3R2PA 1SQQE 2XKMA 4H44C 2JWAA 3RK3D 2W8ZA 3Q5PA 2O1KA 2OGUA 3HTKB 3L74G 4EYYQ 3TK1A 3E1IA 1NWQA 2I8DA 5AW4B 1FOSF 2I1KA 5CMZA 1HJ0A 3M0AA 1CSBA 1JOCA 3PH0A 3VMYA 3RK2C 3CCJP 1N73A 1KILC 3BATA 3LIDA 4UB6H 4DJGA 4DT0A 1SQBJ 3T97B 3L73G 3BCCG 1SQVD 1NOHA 4Y99C 3USSA 2IDBA 3H32A 1NYHA 3JC22 4IL6E 3U59A 2LKMA 5AVSB 1YYCA 1EXJA 1LNQA 4L74A 2NPSB 4IFMA 3WUVA 1BSNA 3CX5D 3H1LD 2XU6A 1J1EB 1R5SA 1ZV8A 3P32A 4RKUJ 5E79H 5H2FH 1T2KD 3CD6P 1Y8AA 1OW6A 2WSFH 3HRNA 2KOGA 4HYTB 1H89A 1QL2A 3NFQA 2Q3EA 1IFIA 3L73D 4YXDC 4AYCA 1KN7A 1IFPA 1N7SD 1GK6A 1MV8A 2Q5UA 1VF5C 1FS0E 1H8AA 4GIFA 1GU4A 5AW2B 2V7QJ 1L4AA 1FDOA 1AVYA 1NU1D 1VF5B 2K37A 2ZFCA 3CL3D 3L72D 3AE9C 3RBXA 5KLVK 2O3JA 4PJ0E 1YITP 2HPCA 1M57D 1OW7A 1K05A 1SQQD 4L76A 2SPZA 1KILD 1M1JA 5AVXB 2FFDB 2ZJSE 2OYHA 5APQA 3AE3C 3SWFA 2WT7A 3VMAA 3I55P 1IFJA 3AE6C 3IR9A 3AECC 3S1KA 5KKZC 1AJYA 1PFIA 1URQB 4HKZH 5CCGA 1NTMG 1KYOE 1IJDB 3WUTA 4H0LB 1FZGA 1X22A 1AFOA 1E5WA 5GTHE 1GK4A 3H1HE 3H32B 3L75D 4UB8E 3II6A 4M3LA 2HODB 3WMM0 2KUBA 2POHA 2R32A 2BEZF 3SFDC 1PGPA 2DW3A 3AE4C 2FYUG 1VPCA 1FZCB 4OVNF 1FAVA 1XTCC 1RE3A 4WY4A 1YJNP 1J1EC 1NU1G 3F89A 3H1LG 3GHGB 5AVVB 2RN0A 3L37A 2NZ2A 5C39A 1LJ2A 4DOJA 4W80A 3L74J 3MGNA 4PV1C 5KLVJ 3OW2O 2YIUC 3C1LA 1J1DB 1GZLA 1OX3A 1SQXJ 3L71G 3I56P 3D71A 2QA4P 2ZT9C 3L36A 1KFNA 3NXSA 1USEA 3L70E 1FBMA 1LTSC 4UB6E 5CCGD 1VQ5P 1GL2B 2J5UA 3H1JE 3TDKA 2HPCB 3V2RA 3A7OA 1G1JA 1L0LE 2JJLA 2QSIA 3F5HA 5AW1B 3D6ZA 1U57A 1ZN5A 2G8YA 4ZKUA 3N4XA 4H44B 1GTWA 2IBZE 2FFDA 4H0LD 1JTHB 2P7JA 1KB9D 2Q1KA 1L0LG 3H1KD 3IFMA 4WY4B 3V5BA 1VQOP 2KNCB 3GLMA 5AVWB 2YMKA 2B87B 3L70G 1L0NE 4H13D 3G6EP 3H25A 1ZR2A 1JEKA 1LT9A 1L0LJ 2JWDA 1U7MA 3H1JJ 1FDMA 3C9IA 2HYNA 3M0DA 2E42A 1BE3E 1P84H 1SQQJ 3A3YB 1YQ4C 3C8VA 1FE6A 3EFFK 4OGQC 3P7KA 3FXEA 4TT3H 2FYUK 4RJTA 1RH5B 2WSSH 2E76B 2H43A 3A0HE 5AVRB 3CLQA 2AEFA 1ZR4A 3K5BA 1EXIA 2WSFJ 3BRTB 3L70D 3RBZA 2FXOA 1FOSE 2V7QH 1HH0A 3IF4A 3S4RA 3MD0A 1T8ZA 5BU8B 1NTZE 2FYUD 4XE5B 2M8RA 5TISE 1QVGO 1M1KQ 1URQA 4JQ0D 2Q6QA 3I5CA 1SLQA 5EFWB 3AEEC 1NTME 2AXCA 3GHGC 1S9KE 1S9KD 3KDPB 2YO2A 3G71P 3LW5J 3R4YA 4OGQD 3D70A 3E7KA 4DZOA 5B66H 5AW7B 1UIIA 3HE5B 2QJPC 1GU5A 1SFCA 2IZ1A 3H6PA 4KJMA 1X79B 3RK2D 2E76C 1PPJG 3W68A 1LP1B 5KAFH 1IO4A 2M3BA 1KV4A 3CC4P 3GF3A 1SQBE 3ITKA 1IC2A 1X0TA 4K35A 1AVOA 1KYOD 1JY2O 2P67A 4GODA 1KILE 4JBZA 3VTPC 1EZVE 2PAJA 2ZYDA 3O8ZA 3M91A 3SWKA 3H1KG 2IZ0A 3TF5A 2KS1A 1VQ8P 1KB9H 1KILA 1G2CB 1UIXA 1S4XA 1JY3O 2A06D 3CCEP 2M5AB 1URQD 3NMDA 4WY4C 2K9JB 5CCGC 3QH9A 1D7MA 1SQBG 1ZOYC 2BCCE 1CZQA 2E74B 2JDIH 2KB7P 3B71A 3BCCJ 4U3FD 4XFJA 2FFDC 3PP5A 3FWNA 3Q1MA 3IAOA 1GL2C 1M7LA 1YQ3C 4W7YA 1NTZJ 2WMMA 1M1JC 1SQPK 2KLUA 4OGQB 1IK7A 1YI2P 2YXQB 3RK3E 3VYIA 2YMYA 2AEMA 1BGYD 4PV1B 1BGYE 3V6IA 3VMZA 4U3FG 1L4AC 2XZRA 3BASA 5M1BA 2W83C 2OYOA 3WU2E 2W6JH 4IL6H 3U1AA 1KD1Q 2WSEJ 1FZEA 1S5LH 1G1IA 2YO3A 2Y9ZA 1W2BO 4D6TE 2ITAA 4WB4A 2A06G 3TYYA 4U3FE 5AW6B 1BGYG 1QEXA 4C46A 5CCHC 3B4SA 1G2CA 1L0NG 2ZT9B 1BSHA 2HG5D 3BRVB 1PV3A 3SFEC 3VP9A 1PP9E 4YXWH 3V2QA 1GMJA 1S1CX 2CPSA 1NTMJ 3VOPA 4ZKPA 5GTIH 1VF5D 2R44A 2GUSA 3CWBG 5KLIC 3WUUA 3U1CA 2VRSA 3KQGA 1N73C 3A2AA 1RQUA 3KZIE 2C9NY 2WITA 3TNUA 1IFDA 2E75B 3JSVC 5KJ7A 1DEBA 5KLVE 1S72P 2NPSC 2Q7CA 1H88A 1Q81Q 2WPVB 3M06A 2C0WA 2B87A 1IK9A 1Q82Q 1R5LA 5TISH 3TGUE 3CX5H 3TGUD 4WWIA 1QL1A 3W67A 3AEFC 3L71E 4Y28J 1FZBA 5KAIE 5AVZB 1LTAC 2CPBA 1L0LD 2A45G 3AEDC 1URQC 1DH3A 3L4FA 1QLED 1OWAA 1M1JB 1YBKA 1SQPJ 3H1HJ 3PJSK 4N78D 1JNMA 1KQSO 2WT7B 1FJKA 3MIWA 1NTKJ 1GW4A 5APUA 1SQXG 2HFED 1MKMA 2Y0DA 3H1KJ 2YKOA 1AQTA 1EZVI 2IFMA 4LLHA 1J2JB 5AW0B 3FGAD 3RGUA 5CBNA 1WRGA 3HD7C 5KAIH 1ZLLA 2C0XA 3O6QB 3GF7A 5KJ7C 1VQKP 4C7NA 4NPFX 2KZIA 1HF9A 1NTKD 2QJKC 5KAFE 1SQXE 1E79H 1SQXD 1SQPD 2G3AA 3MZWB 3H1HD 3L75E 2OTLP 1JTHA 1ZW0A 1L4AD 3OAKA 1GW3A 4I7ZC 1NJIQ 2FY8A 4IOIH 1LTJC 1SQXK 1OZHA 4HH2A 3L35A 1IZNB 2KSJA 1LWUC 2R3SA 1AV1A 1S5LX 5GTHH 1EZVG 1YIJP 1BE3J 1FZAA 1HJBA 4EIJA 2LR2A 1NAFA 1JY3N 3IN6A 2OARA 3HE5A 2UWJE 1VQNP 1K8AQ 1L0NJ 2WTYA 1H0TA 1NTZK 1PZQA 1RF0C 1S5LE 1NTMD 2JEEA 1FC2C 5KJ7D 2OYHC 3CXHI 2Y9YA 3MUDC 1BDDA 1JY2P 2QJPB 2W90A 2RH0A 3OA7A 4GKGA 2IYOA 3LIEA 2Z4EA 3M9HA 2KP8A 2N9YB 1SQPE 3A0BE 4PD4D 2N1TC 2B9BA 4U7JA 3O6QA 1RE4A 1KQLA 1ZRTD 1PP9D 3KPEA 1YHQP 3FX0A 1LWUA 1JO5A 5AW9B 1VQ9P 1ZMEC 3CX5E 3H1LE 3L72J 3L71J 2JR8A 1NU1J 2XNXA 2OYIC 2CK3H 2HODA 2JKVA 2PGDA 2JO1A 2FYNB 1W2EA 2FXPA 3L74E 3L73J 2OYHB 2QJKB 4PJ0H 3G4SP 2ZXEB 5APSA 1BDCA 3H1HG 1DEEG 3AE8C 3CI9A 1Q86Q 2YIUB 2H8PD 5CBOA 1LGHB 2D2CD 2KLVA 1KQFB 1PP9J 1CI6B 2KS1B 1EQ7A 3H1IG 5CJ0A 5KTBA 2AXTE 4LGDE 2QEXP 1JCCA 3CCMP 1IFNA 3KZIH 1Y47A 3CC7P 2GA1A 5E79E 1LTJB 1N8RQ 4JF7A 3A0HH 4U3FJ 2OTKE 2R5DA 4IFFA 4OWFA 1EDKA 1SQVE 4IL6X 3HE4A 3HUSA 2IFNA 1L0ND 4PD4I 2QM7A 4WVZA 3VN0A 4D6TJ 1T3JA 2HR3A 3H1JG 2WVRA 3QWOC 3AEGC 1ZP0C 2W6BA 4YTPC 1S2EA 2ZVNB 3PLNA 3CWBD 2J59M 1TU3F 3GMAA 1KFMA 1RE4C 4YPCA 1L0NK 5KKZB 1VQPP 1HBWA 2KXPB 2WWWA 1VQ6P 1MFTA 2NRGA 1W5CE 3RL0D 4PV1D 1H0TB 4QMAA 1Q2NA 2A45I 2OYIA 1DD4A 3CCRP 1OVVA 2KI7B 2FYUE 3EFGA 2Z5HA 1NKZB 5BU5A 2RMZA 1EDLA 2FKWB 3EWKA 2B88A 1HUCA 3H1ID 3H1IE 2N1TA 4N6JA 1RF1A 3FXDA 4I6MC 4R4MA 3CMEP 1LT9C 3BCCE 2K3RA 2BASA 2E74D 2FYUJ 4BXLA 1KORA 1LT9B 1Y9BA 2H88C 3A0BH 1CI6A 1JY2N 1M56D 3MTUE 4UB8H 5L8RJ 1HVVA 2YNYA 3CXHD 4WY4D 4EI2A 1EDIA 4B86A 5CCHD 2ZXXA 1ZXGA 4AQRD 1SFCC 2ZAEB 1R8EA 1VQ7P 2R5BA 2H89C 3HD7D 1EC5A 2KK7A 3TSIA 2O01J 2O01N 5AVQB 3UIAA 1LT1A 4ASWA 1SQBK 3RL0B 2I1JA 2K1AA 2WZ7A 5APWA 5B5EH 1SP4A 1NTKG 1KILB 3JCUH 1SS1A 2LXCB 4L75A 2WSCJ 3RK2B 1M8OB 4AUWA 1DX7A 1SQPG 2O01H 3TGUG 4Y99B 3V4QA 3FWLA 3CPWO 1KC8Q 1VQ4P 2K9JA 2NPSA 2L91A 2LXBA 2QM8A 2W6AA 3SSUA 1SQVG 4ZNCA 2IBZG 2OYIB 3TNUB 3B8EB 4GOFA 1FZCA 2ZYGA 2FYNC 1VL2A 5GTIE 2KZJA 1PP9G 3HD7A 1WT6A 3B5ND 3H1IJ 5H2FE 3AEAC 1T2KC 2N1TB 1RF1C 3CC2P 1KTMA 3G9RA 4W7ZA 5AVYB 5KLVD 3L73E 4XA4A 1BCCD 1NVOA 3CXHE 1X8YA 2YKPA 3VMXA 1FZFA 3HUSC 1A02J 1NU1E 1JMMA 4GDOA 1KMIZ 2BCCJ 3V4WA 1KZUB 2XDJA 3H1KE 4IFDK 3CWBJ 3CX5I 3WU2H 1SQQG 3P8MC 4OH8B 4H13C 2C9LY 2GM4A 2AEJA 4H44D 3AE1C 3M9BA 2QG4A 4JYCA 1SFCD 2AXTH 1N86A 2KIKA 2BEQD 1HGZA 2O1JA 3N7NA 1QGKB 4O9BA 1K73Q 1JCDA 1LWUB 3M9QA 3CCSP 1AA0A 1EZVD 3OJAB 1NTZD 1GD2E 1RHZB 3CCQP 1NTMK 2FBWC 3B5NB 4Z1MH 1OVRA 2OTJP 1EDJA 2ZT9D 3HUSB 1A02F 1PIXA 2R3CA 1PGQA 4N3YB 3P8CD 3GG2A 3AE2C 1J1DC 2E75D 1BCCE 4MN4C 5TJHA 1T3UA 1RF0A 4EDFA 1HTLC 1RE3C 3RL0C 5KLVG 1VQMP 1GL2A 2KYVA 3L71D 1T6AA 2QVAA 1FDIA 3H1LJ 2P2UA 4ZMDA 1NHLA 4I1LA 1LP1A 1PGJA 2PP6A 3EQ2A 4C7RA 1FZCC 1QVFO 2N9BA 3RK3B 2Y0EA 5AVTB 1DD3A 5BVZA 5AVUB 1KYOH 1SQVJ 2QRXA 3AEBC 3KYQA 3AE5C 4ASVA 2M0BA 1YTZI 4WBAA 5AW8B 5B5EE 1SQVK 3MHVA 3T97A 1LTGC 5K5GB 1MZ9A 3CCUP 2Q9IA 1XTGB 5DJUB 3BVHA 1NU1K 1NAYA 3VP8A 4C7NB 4KHXA 1YJWP 1OVUA 2D2CB 1OW8A 3MUDA 1RY3A 4D6TG 2Q3IA 3CXHH 5AW3B 1JMBA 5KLIB 1SFCB 1BE3D 1OFCX 3L70J 1JM0A 1GL2D 2E75C 1MFZA 2MJZA 5B66E 5AW5B 4JPZB 1N73B 4BWNA 3CMAP 2P58A 4KT0J 3H1JD 3LW5H 1IFMA 3Q3DA 1N7LA 1NH4A 1NO4A 2JP3A 4GOEA 1GDTA 1PL5A 3L72E 2E43A 2IBZD 1P84E 1Z56A 1P84D 5APTA 1AQ5A 1YTZT 4LC1A 1VQLP 3KHUA 2V4HA 1X9VA 2N1TD 3E1RA 3V2NA 2FYZA 2L5GB 2IBZI 2PRRA 3GHGA 3M0DC 3CWBE 3ZDMA 1JB0J 1ZRTE 2WSCH 2YXRB 2B89A 2ZVOB 3AE7C 2E76D 1BCCG 1RQVA 1K9MQ 2OQQA 2E5TA 4DCKA 4JYBA 3KXDA 2A45H 1L4AB 1SVFA 1OXZA
chains in the Genus database with same CATH topology
1EC5A 4ASWA 5C39A 1LT1A 4NPDA 1SS1A 2LXCB 5DJTB 2LXBA 3RGUA 5CBNA 4ZNCA 4GOFA 2Q1KA 4NPFX 2KZIA 2KZJA 2B87B 4NPEA 3MZWB 1U7JA 1ZW0A 1NVOA 4K3AA 2JWDA 1U7MA 4IOIH 3FXEA 1EDJA 2M5AA 2LR2A 4HJGH 4CPGA 2UWJE 4HB1A 5EFWB 1H0TA 2KIKA 1FC2C 1BDDA 1S3JA 2RKLA 4KJMA 1LP1B 1OVRA 4K35A 1X0TA 4JBZA 4GODA 4EYYQ 2I8DA 4MN4C 2M5AB 1BDCA 1DEEG 3PH0A 5CBOA 2QVAA 4ZMDA 1LP1A 2KS1B 2WMMA 2QRXA 1Y47A 4ASVA 2M0BA 3MHVA 5K5GB 2OTKE 5DJUB 1EDKA 1OVUA 2HR3A 3QWOC 1JMBA 1JM0A 1MFTA 2P58A 2SPZA 1H0TB 1Q2NA 1OVVA 2KI7B 4GOEA 1EDLA 3S1KA 2B88A 2R44A 3FXDA 4HKZH 2K3RA 4BXLA 3ZDMA 2B89A 1EDIA 2B87A 2KUBA 1ZXGA 4WWIA 2ZAEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EC5 A;  4ASW A;  5C39 A;  1LT1 A;  4NPD A;  1SS1 A;  2LXC B;  5DJT B;  2LXB A;  3RGU A;  5CBN A;  4ZNC A;  4GOF A;  2Q1K A;  4NPF X;  2KZI A;  2KZJ A;  2B87 B;  4NPE A;  3MZW B;  1U7J A;  1ZW0 A;  1NVO A;  4K3A A;  2JWD A;  1U7M A;  4IOI H;  3FXE A;  1EDJ A;  2M5A A;  2LR2 A;  4HJG H;  4CPG A;  2UWJ E;  4HB1 A;  5EFW B;  1H0T A;  2KIK A;  1FC2 C;  1BDD A;  1S3J A;  2RKL A;  4KJM A;  1LP1 B;  1OVR A;  4K35 A;  1X0T A;  4JBZ A;  4GOD A;  4EYY Q;  2I8D A;  4MN4 C;  2M5A B;  1BDC A;  1DEE G;  3PH0 A;  5CBO A;  2QVA A;  4ZMD A;  1LP1 A;  2KS1 B;  2WMM A;  2QRX A;  1Y47 A;  4ASV A;  2M0B A;  3MHV A;  5K5G B;  2OTK E;  5DJU B;  1EDK A;  1OVU A;  2HR3 A;  3QWO C;  1JMB A;  1JM0 A;  1MFT A;  2P58 A;  2SPZ A;  1H0T B;  1Q2N A;  1OVV A;  2KI7 B;  4GOE A;  1EDL A;  3S1K A;  2B88 A;  2R44 A;  3FXD A;  4HKZ H;  2K3R A;  4BXL A;  3ZDM A;  2B89 A;  1EDI A;  2B87 A;  2KUB A;  1ZXG A;  4WWI A;  2ZAE B; 
#chains in the Genus database with same CATH topology
 4RO0 A;  1NTK E;  5CCH A;  1JUN A;  2WPQ A;  4H0L C;  2QJY C;  3RK3 C;  1CW5 A;  2XND H;  3L74 D;  1M90 Q;  1BCC J;  2A06 E;  2W27 A;  3PRJ A;  4NPD A;  2IX7 C;  3B5N C;  2E74 C;  3Q2Y A;  1YJ9 P;  1PPJ E;  3L75 G;  4L73 A;  4TLF A;  1MUU A;  1L0L K;  2E5Y A;  4D6T D;  2IYP A;  5DJT B;  1P84 I;  3S9O A;  3TGU J;  2D2C C;  1FJP A;  1NTK K;  1N7S C;  2XV5 A;  2H7H A;  2Y0C A;  3L75 J;  4N78 E;  2YKQ A;  4BRY B;  1KB9 E;  2QE7 H;  1HWT C;  1NTZ G;  3JCU E;  1N7S A;  2WQY C;  1LTT C;  3NTN A;  3PTZ A;  2QIW A;  1LTI C;  2WSE H;  4R4L A;  5CJ4 A;  4NPE A;  3RL0 g;  1LTJ A;  1K04 A;  1OIP A;  1Q90 D;  1U7J A;  1N2D C;  2K9Y A;  2WPS A;  4PD4 H;  3HTK A;  3B5N A;  4A7P A;  4K3A A;  5APX A;  2BCC G;  1BE3 G;  2Z5I A;  2FXM A;  5APV A;  1JY3 P;  1WMK A;  4I2L C;  4RES B;  3HD7 B;  3D6Y A;  3A5T A;  2WPR A;  2J58 A;  1KYO I;  1RF1 B;  1HGV A;  3G3Z A;  3MP7 B;  2M5A A;  4EOT A;  1PPJ D;  3PHL A;  4HJG H;  4PD4 E;  2PFX A;  3SWY A;  4CPG A;  3Q5S A;  1Q7Y Q;  4HB1 A;  1NKN A;  3ABV C;  2K88 A;  4I7Z B;  1QX8 A;  1KB9 I;  1SQQ K;  1VDF A;  1BGY J;  2P10 A;  2MKV A;  3HE4 B;  3Q5R A;  1KQG B;  1L2P A;  2QJY B;  1S3J A;  2KNC A;  2GUV A;  2P1J A;  4GT1 A;  3L72 G;  3CCV P;  1DIP A;  2RKL A;  2NPS D;  3V2P A;  3P8C E;  3GW6 A;  2HLO A;  2KSE A;  4BRY A;  1PGO A;  2IPP A;  1LTB C;  2M3E A;  2BCC D;  1SQB D;  1N7S B;  5CHX A;  5APY A;  1FU1 A;  1OMI A;  1USD A;  4H13 B;  1NGM B;  3BCC D;  3CCL P;  2ZYA A;  3R2P A;  1SQQ E;  2XKM A;  4H44 C;  2JWA A;  3RK3 D;  2W8Z A;  3Q5P A;  2O1K A;  2OGU A;  3HTK B;  3L74 G;  4EYY Q;  3TK1 A;  3E1I A;  1NWQ A;  2I8D A;  5AW4 B;  1FOS F;  2I1K A;  5CMZ A;  1HJ0 A;  3M0A A;  1CSB A;  1JOC A;  3PH0 A;  3VMY A;  3RK2 C;  3CCJ P;  1N73 A;  1KIL C;  3BAT A;  3LID A;  4UB6 H;  4DJG A;  4DT0 A;  1SQB J;  3T97 B;  3L73 G;  3BCC G;  1SQV D;  1NOH A;  4Y99 C;  3USS A;  2IDB A;  3H32 A;  1NYH A;  3JC2 2;  4IL6 E;  3U59 A;  2LKM A;  5AVS B;  1YYC A;  1EXJ A;  1LNQ A;  4L74 A;  2NPS B;  4IFM A;  3WUV A;  1BSN A;  3CX5 D;  3H1L D;  2XU6 A;  1J1E B;  1R5S A;  1ZV8 A;  3P32 A;  4RKU J;  5E79 H;  5H2F H;  1T2K D;  3CD6 P;  1Y8A A;  1OW6 A;  2WSF H;  3HRN A;  2KOG A;  4HYT B;  1H89 A;  1QL2 A;  3NFQ A;  2Q3E A;  1IFI A;  3L73 D;  4YXD C;  4AYC A;  1KN7 A;  1IFP A;  1N7S D;  1GK6 A;  1MV8 A;  2Q5U A;  1VF5 C;  1FS0 E;  1H8A A;  4GIF A;  1GU4 A;  5AW2 B;  2V7Q J;  1L4A A;  1FDO A;  1AVY A;  1NU1 D;  1VF5 B;  2K37 A;  2ZFC A;  3CL3 D;  3L72 D;  3AE9 C;  3RBX A;  5KLV K;  2O3J A;  4PJ0 E;  1YIT P;  2HPC A;  1M57 D;  1OW7 A;  1K05 A;  1SQQ D;  4L76 A;  2SPZ A;  1KIL D;  1M1J A;  5AVX B;  2FFD B;  2ZJS E;  2OYH A;  5APQ A;  3AE3 C;  3SWF A;  2WT7 A;  3VMA A;  3I55 P;  1IFJ A;  3AE6 C;  3IR9 A;  3AEC C;  3S1K A;  5KKZ C;  1AJY A;  1PFI A;  1URQ B;  4HKZ H;  5CCG A;  1NTM G;  1KYO E;  1IJD B;  3WUT A;  4H0L B;  1FZG A;  1X22 A;  1AFO A;  1E5W A;  5GTH E;  1GK4 A;  3H1H E;  3H32 B;  3L75 D;  4UB8 E;  3II6 A;  4M3L A;  2HOD B;  3WMM 0;  2KUB A;  2POH A;  2R32 A;  2BEZ F;  3SFD C;  1PGP A;  2DW3 A;  3AE4 C;  2FYU G;  1VPC A;  1FZC B;  4OVN F;  1FAV A;  1XTC C;  1RE3 A;  4WY4 A;  1YJN P;  1J1E C;  1NU1 G;  3F89 A;  3H1L G;  3GHG B;  5AVV B;  2RN0 A;  3L37 A;  2NZ2 A;  5C39 A;  1LJ2 A;  4DOJ A;  4W80 A;  3L74 J;  3MGN A;  4PV1 C;  5KLV J;  3OW2 O;  2YIU C;  3C1L A;  1J1D B;  1GZL A;  1OX3 A;  1SQX J;  3L71 G;  3I56 P;  3D71 A;  2QA4 P;  2ZT9 C;  3L36 A;  1KFN A;  3NXS A;  1USE A;  3L70 E;  1FBM A;  1LTS C;  4UB6 E;  5CCG D;  1VQ5 P;  1GL2 B;  2J5U A;  3H1J E;  3TDK A;  2HPC B;  3V2R A;  3A7O A;  1G1J A;  1L0L E;  2JJL A;  2QSI A;  3F5H A;  5AW1 B;  3D6Z A;  1U57 A;  1ZN5 A;  2G8Y A;  4ZKU A;  3N4X A;  4H44 B;  1GTW A;  2IBZ E;  2FFD A;  4H0L D;  1JTH B;  2P7J A;  1KB9 D;  2Q1K A;  1L0L G;  3H1K D;  3IFM A;  4WY4 B;  3V5B A;  1VQO P;  2KNC B;  3GLM A;  5AVW B;  2YMK A;  2B87 B;  3L70 G;  1L0N E;  4H13 D;  3G6E P;  3H25 A;  1ZR2 A;  1JEK A;  1LT9 A;  1L0L J;  2JWD A;  1U7M A;  3H1J J;  1FDM A;  3C9I A;  2HYN A;  3M0D A;  2E42 A;  1BE3 E;  1P84 H;  1SQQ J;  3A3Y B;  1YQ4 C;  3C8V A;  1FE6 A;  3EFF K;  4OGQ C;  3P7K A;  3FXE A;  4TT3 H;  2FYU K;  4RJT A;  1RH5 B;  2WSS H;  2E76 B;  2H43 A;  3A0H E;  5AVR B;  3CLQ A;  2AEF A;  1ZR4 A;  3K5B A;  1EXI A;  2WSF J;  3BRT B;  3L70 D;  3RBZ A;  2FXO A;  1FOS E;  2V7Q H;  1HH0 A;  3IF4 A;  3S4R A;  3MD0 A;  1T8Z A;  5BU8 B;  1NTZ E;  2FYU D;  4XE5 B;  2M8R A;  5TIS E;  1QVG O;  1M1K Q;  1URQ A;  4JQ0 D;  2Q6Q A;  3I5C A;  1SLQ A;  5EFW B;  3AEE C;  1NTM E;  2AXC A;  3GHG C;  1S9K E;  1S9K D;  3KDP B;  2YO2 A;  3G71 P;  3LW5 J;  3R4Y A;  4OGQ D;  3D70 A;  3E7K A;  4DZO A;  5B66 H;  5AW7 B;  1UII A;  3HE5 B;  2QJP C;  1GU5 A;  1SFC A;  2IZ1 A;  3H6P A;  4KJM A;  1X79 B;  3RK2 D;  2E76 C;  1PPJ G;  3W68 A;  1LP1 B;  5KAF H;  1IO4 A;  2M3B A;  1KV4 A;  3CC4 P;  3GF3 A;  1SQB E;  3ITK A;  1IC2 A;  1X0T A;  4K35 A;  1AVO A;  1KYO D;  1JY2 O;  2P67 A;  4GOD A;  1KIL E;  4JBZ A;  3VTP C;  1EZV E;  2PAJ A;  2ZYD A;  3O8Z A;  3M91 A;  3SWK A;  3H1K G;  2IZ0 A;  3TF5 A;  2KS1 A;  1VQ8 P;  1KB9 H;  1KIL A;  1G2C B;  1UIX A;  1S4X A;  1JY3 O;  2A06 D;  3CCE P;  2M5A B;  1URQ D;  3NMD A;  4WY4 C;  2K9J B;  5CCG C;  3QH9 A;  1D7M A;  1SQB G;  1ZOY C;  2BCC E;  1CZQ A;  2E74 B;  2JDI H;  2KB7 P;  3B71 A;  3BCC J;  4U3F D;  4XFJ A;  2FFD C;  3PP5 A;  3FWN A;  3Q1M A;  3IAO A;  1GL2 C;  1M7L A;  1YQ3 C;  4W7Y A;  1NTZ J;  2WMM A;  1M1J C;  1SQP K;  2KLU A;  4OGQ B;  1IK7 A;  1YI2 P;  2YXQ B;  3RK3 E;  3VYI A;  2YMY A;  2AEM A;  1BGY D;  4PV1 B;  1BGY E;  3V6I A;  3VMZ A;  4U3F G;  1L4A C;  2XZR A;  3BAS A;  5M1B A;  2W83 C;  2OYO A;  3WU2 E;  2W6J H;  4IL6 H;  3U1A A;  1KD1 Q;  2WSE J;  1FZE A;  1S5L H;  1G1I A;  2YO3 A;  2Y9Z A;  1W2B O;  4D6T E;  2ITA A;  4WB4 A;  2A06 G;  3TYY A;  4U3F E;  5AW6 B;  1BGY G;  1QEX A;  4C46 A;  5CCH C;  3B4S A;  1G2C A;  1L0N G;  2ZT9 B;  1BSH A;  2HG5 D;  3BRV B;  1PV3 A;  3SFE C;  3VP9 A;  1PP9 E;  4YXW H;  3V2Q A;  1GMJ A;  1S1C X;  2CPS A;  1NTM J;  3VOP A;  4ZKP A;  5GTI H;  1VF5 D;  2R44 A;  2GUS A;  3CWB G;  5KLI C;  3WUU A;  3U1C A;  2VRS A;  3KQG A;  1N73 C;  3A2A A;  1RQU A;  3KZI E;  2C9N Y;  2WIT A;  3TNU A;  1IFD A;  2E75 B;  3JSV C;  5KJ7 A;  1DEB A;  5KLV E;  1S72 P;  2NPS C;  2Q7C A;  1H88 A;  1Q81 Q;  2WPV B;  3M06 A;  2C0W A;  2B87 A;  1IK9 A;  1Q82 Q;  1R5L A;  5TIS H;  3TGU E;  3CX5 H;  3TGU D;  4WWI A;  1QL1 A;  3W67 A;  3AEF C;  3L71 E;  4Y28 J;  1FZB A;  5KAI E;  5AVZ B;  1LTA C;  2CPB A;  1L0L D;  2A45 G;  3AED C;  1URQ C;  1DH3 A;  3L4F A;  1QLE D;  1OWA A;  1M1J B;  1YBK A;  1SQP J;  3H1H J;  3PJS K;  4N78 D;  1JNM A;  1KQS O;  2WT7 B;  1FJK A;  3MIW A;  1NTK J;  1GW4 A;  5APU A;  1SQX G;  2HFE D;  1MKM A;  2Y0D A;  3H1K J;  2YKO A;  1AQT A;  1EZV I;  2IFM A;  4LLH A;  1J2J B;  5AW0 B;  3FGA D;  3RGU A;  5CBN A;  1WRG A;  3HD7 C;  5KAI H;  1ZLL A;  2C0X A;  3O6Q B;  3GF7 A;  5KJ7 C;  1VQK P;  4C7N A;  4NPF X;  2KZI A;  1HF9 A;  1NTK D;  2QJK C;  5KAF E;  1SQX E;  1E79 H;  1SQX D;  1SQP D;  2G3A A;  3MZW B;  3H1H D;  3L75 E;  2OTL P;  1JTH A;  1ZW0 A;  1L4A D;  3OAK A;  1GW3 A;  4I7Z C;  1NJI Q;  2FY8 A;  4IOI H;  1LTJ C;  1SQX K;  1OZH A;  4HH2 A;  3L35 A;  1IZN B;  2KSJ A;  1LWU C;  2R3S A;  1AV1 A;  1S5L X;  5GTH H;  1EZV G;  1YIJ P;  1BE3 J;  1FZA A;  1HJB A;  4EIJ A;  2LR2 A;  1NAF A;  1JY3 N;  3IN6 A;  2OAR A;  3HE5 A;  2UWJ E;  1VQN P;  1K8A Q;  1L0N J;  2WTY A;  1H0T A;  1NTZ K;  1PZQ A;  1RF0 C;  1S5L E;  1NTM D;  2JEE A;  1FC2 C;  5KJ7 D;  2OYH C;  3CXH I;  2Y9Y A;  3MUD C;  1BDD A;  1JY2 P;  2QJP B;  2W90 A;  2RH0 A;  3OA7 A;  4GKG A;  2IYO A;  3LIE A;  2Z4E A;  3M9H A;  2KP8 A;  2N9Y B;  1SQP E;  3A0B E;  4PD4 D;  2N1T C;  2B9B A;  4U7J A;  3O6Q A;  1RE4 A;  1KQL A;  1ZRT D;  1PP9 D;  3KPE A;  1YHQ P;  3FX0 A;  1LWU A;  1JO5 A;  5AW9 B;  1VQ9 P;  1ZME C;  3CX5 E;  3H1L E;  3L72 J;  3L71 J;  2JR8 A;  1NU1 J;  2XNX A;  2OYI C;  2CK3 H;  2HOD A;  2JKV A;  2PGD A;  2JO1 A;  2FYN B;  1W2E A;  2FXP A;  3L74 E;  3L73 J;  2OYH B;  2QJK B;  4PJ0 H;  3G4S P;  2ZXE B;  5APS A;  1BDC A;  3H1H G;  1DEE G;  3AE8 C;  3CI9 A;  1Q86 Q;  2YIU B;  2H8P D;  5CBO A;  1LGH B;  2D2C D;  2KLV A;  1KQF B;  1PP9 J;  1CI6 B;  2KS1 B;  1EQ7 A;  3H1I G;  5CJ0 A;  5KTB A;  2AXT E;  4LGD E;  2QEX P;  1JCC A;  3CCM P;  1IFN A;  3KZI H;  1Y47 A;  3CC7 P;  2GA1 A;  5E79 E;  1LTJ B;  1N8R Q;  4JF7 A;  3A0H H;  4U3F J;  2OTK E;  2R5D A;  4IFF A;  4OWF A;  1EDK A;  1SQV E;  4IL6 X;  3HE4 A;  3HUS A;  2IFN A;  1L0N D;  4PD4 I;  2QM7 A;  4WVZ A;  3VN0 A;  4D6T J;  1T3J A;  2HR3 A;  3H1J G;  2WVR A;  3QWO C;  3AEG C;  1ZP0 C;  2W6B A;  4YTP C;  1S2E A;  2ZVN B;  3PLN A;  3CWB D;  2J59 M;  1TU3 F;  3GMA A;  1KFM A;  1RE4 C;  4YPC A;  1L0N K;  5KKZ B;  1VQP P;  1HBW A;  2KXP B;  2WWW A;  1VQ6 P;  1MFT A;  2NRG A;  1W5C E;  3RL0 D;  4PV1 D;  1H0T B;  4QMA A;  1Q2N A;  2A45 I;  2OYI A;  1DD4 A;  3CCR P;  1OVV A;  2KI7 B;  2FYU E;  3EFG A;  2Z5H A;  1NKZ B;  5BU5 A;  2RMZ A;  1EDL A;  2FKW B;  3EWK A;  2B88 A;  1HUC A;  3H1I D;  3H1I E;  2N1T A;  4N6J A;  1RF1 A;  3FXD A;  4I6M C;  4R4M A;  3CME P;  1LT9 C;  3BCC E;  2K3R A;  2BAS A;  2E74 D;  2FYU J;  4BXL A;  1KOR A;  1LT9 B;  1Y9B A;  2H88 C;  3A0B H;  1CI6 A;  1JY2 N;  1M56 D;  3MTU E;  4UB8 H;  5L8R J;  1HVV A;  2YNY A;  3CXH D;  4WY4 D;  4EI2 A;  1EDI A;  4B86 A;  5CCH D;  2ZXX A;  1ZXG A;  4AQR D;  1SFC C;  2ZAE B;  1R8E A;  1VQ7 P;  2R5B A;  2H89 C;  3HD7 D;  1EC5 A;  2KK7 A;  3TSI A;  2O01 J;  2O01 N;  5AVQ B;  3UIA A;  1LT1 A;  4ASW A;  1SQB K;  3RL0 B;  2I1J A;  2K1A A;  2WZ7 A;  5APW A;  5B5E H;  1SP4 A;  1NTK G;  1KIL B;  3JCU H;  1SS1 A;  2LXC B;  4L75 A;  2WSC J;  3RK2 B;  1M8O B;  4AUW A;  1DX7 A;  1SQP G;  2O01 H;  3TGU G;  4Y99 B;  3V4Q A;  3FWL A;  3CPW O;  1KC8 Q;  1VQ4 P;  2K9J A;  2NPS A;  2L91 A;  2LXB A;  2QM8 A;  2W6A A;  3SSU A;  1SQV G;  4ZNC A;  2IBZ G;  2OYI B;  3TNU B;  3B8E B;  4GOF A;  1FZC A;  2ZYG A;  2FYN C;  1VL2 A;  5GTI E;  2KZJ A;  1PP9 G;  3HD7 A;  1WT6 A;  3B5N D;  3H1I J;  5H2F E;  3AEA C;  1T2K C;  2N1T B;  1RF1 C;  3CC2 P;  1KTM A;  3G9R A;  4W7Z A;  5AVY B;  5KLV D;  3L73 E;  4XA4 A;  1BCC D;  1NVO A;  3CXH E;  1X8Y A;  2YKP A;  3VMX A;  1FZF A;  3HUS C;  1A02 J;  1NU1 E;  1JMM A;  4GDO A;  1KMI Z;  2BCC J;  3V4W A;  1KZU B;  2XDJ A;  3H1K E;  4IFD K;  3CWB J;  3CX5 I;  3WU2 H;  1SQQ G;  3P8M C;  4OH8 B;  4H13 C;  2C9L Y;  2GM4 A;  2AEJ A;  4H44 D;  3AE1 C;  3M9B A;  2QG4 A;  4JYC A;  1SFC D;  2AXT H;  1N86 A;  2KIK A;  2BEQ D;  1HGZ A;  2O1J A;  3N7N A;  1QGK B;  4O9B A;  1K73 Q;  1JCD A;  1LWU B;  3M9Q A;  3CCS P;  1AA0 A;  1EZV D;  3OJA B;  1NTZ D;  1GD2 E;  1RHZ B;  3CCQ P;  1NTM K;  2FBW C;  3B5N B;  4Z1M H;  1OVR A;  2OTJ P;  1EDJ A;  2ZT9 D;  3HUS B;  1A02 F;  1PIX A;  2R3C A;  1PGQ A;  4N3Y B;  3P8C D;  3GG2 A;  3AE2 C;  1J1D C;  2E75 D;  1BCC E;  4MN4 C;  5TJH A;  1T3U A;  1RF0 A;  4EDF A;  1HTL C;  1RE3 C;  3RL0 C;  5KLV G;  1VQM P;  1GL2 A;  2KYV A;  3L71 D;  1T6A A;  2QVA A;  1FDI A;  3H1L J;  2P2U A;  4ZMD A;  1NHL A;  4I1L A;  1LP1 A;  1PGJ A;  2PP6 A;  3EQ2 A;  4C7R A;  1FZC C;  1QVF O;  2N9B A;  3RK3 B;  2Y0E A;  5AVT B;  1DD3 A;  5BVZ A;  5AVU B;  1KYO H;  1SQV J;  2QRX A;  3AEB C;  3KYQ A;  3AE5 C;  4ASV A;  2M0B A;  1YTZ I;  4WBA A;  5AW8 B;  5B5E E;  1SQV K;  3MHV A;  3T97 A;  1LTG C;  5K5G B;  1MZ9 A;  3CCU P;  2Q9I A;  1XTG B;  5DJU B;  3BVH A;  1NU1 K;  1NAY A;  3VP8 A;  4C7N B;  4KHX A;  1YJW P;  1OVU A;  2D2C B;  1OW8 A;  3MUD A;  1RY3 A;  4D6T G;  2Q3I A;  3CXH H;  5AW3 B;  1JMB A;  5KLI B;  1SFC B;  1BE3 D;  1OFC X;  3L70 J;  1JM0 A;  1GL2 D;  2E75 C;  1MFZ A;  2MJZ A;  5B66 E;  5AW5 B;  4JPZ B;  1N73 B;  4BWN A;  3CMA P;  2P58 A;  4KT0 J;  3H1J D;  3LW5 H;  1IFM A;  3Q3D A;  1N7L A;  1NH4 A;  1NO4 A;  2JP3 A;  4GOE A;  1GDT A;  1PL5 A;  3L72 E;  2E43 A;  2IBZ D;  1P84 E;  1Z56 A;  1P84 D;  5APT A;  1AQ5 A;  1YTZ T;  4LC1 A;  1VQL P;  3KHU A;  2V4H A;  1X9V A;  2N1T D;  3E1R A;  3V2N A;  2FYZ A;  2L5G B;  2IBZ I;  2PRR A;  3GHG A;  3M0D C;  3CWB E;  3ZDM A;  1JB0 J;  1ZRT E;  2WSC H;  2YXR B;  2B89 A;  2ZVO B;  3AE7 C;  2E76 D;  1BCC G;  1RQV A;  1K9M Q;  2OQQ A;  2E5T A;  4DCK A;  4JYB A;  3KXD A;  2A45 H;  1L4A B;  1SVF A;  1OXZ A; 
#chains in the Genus database with same CATH homology
 1EC5 A;  4ASW A;  5C39 A;  1LT1 A;  4NPD A;  1SS1 A;  2LXC B;  5DJT B;  2LXB A;  3RGU A;  5CBN A;  4ZNC A;  4GOF A;  2Q1K A;  4NPF X;  2KZI A;  2KZJ A;  2B87 B;  4NPE A;  3MZW B;  1U7J A;  1ZW0 A;  1NVO A;  4K3A A;  2JWD A;  1U7M A;  4IOI H;  3FXE A;  1EDJ A;  2M5A A;  2LR2 A;  4HJG H;  4CPG A;  2UWJ E;  4HB1 A;  5EFW B;  1H0T A;  2KIK A;  1FC2 C;  1BDD A;  1S3J A;  2RKL A;  4KJM A;  1LP1 B;  1OVR A;  4K35 A;  1X0T A;  4JBZ A;  4GOD A;  4EYY Q;  2I8D A;  4MN4 C;  2M5A B;  1BDC A;  1DEE G;  3PH0 A;  5CBO A;  2QVA A;  4ZMD A;  1LP1 A;  2KS1 B;  2WMM A;  2QRX A;  1Y47 A;  4ASV A;  2M0B A;  3MHV A;  5K5G B;  2OTK E;  5DJU B;  1EDK A;  1OVU A;  2HR3 A;  3QWO C;  1JMB A;  1JM0 A;  1MFT A;  2P58 A;  2SPZ A;  1H0T B;  1Q2N A;  1OVV A;  2KI7 B;  4GOE A;  1EDL A;  3S1K A;  2B88 A;  2R44 A;  3FXD A;  4HKZ H;  2K3R A;  4BXL A;  3ZDM A;  2B89 A;  1EDI A;  2B87 A;  2KUB A;  1ZXG A;  4WWI A;  2ZAE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...