2KIKA

An artificial di-iron oxo-protein with phenol oxidase activity
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
48
structure length
48
Chain Sequence
DYLRELLKGELQGIKQYREALEYTHNPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An artificial di-iron oxo-protein with phenol oxidase activity
rcsb
molecule tags De novo protein
molecule keywords Artificial diiron protein
total genus 14
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kikA00
2LR2A 1SS1A 5DJTB 4MN4C 1S3JA 2QVAA 4KJMA 1ZW0A 1Q2NA 3QWOC 4EYYQ 1JM0A 4GODA 4HB1A 2WMMA 3RGUA 1OVUA 2M5AB 1EC5A 1Y47A 1EDJA 4ASWA 4GOFA 3ZDMA 5K5GB 5CBOA 1BDCA 2ZAEB 2LXCB 2P58A 2SPZA 4K3AA 4BXLA 1EDKA 1LT1A 1BDDA 1U7MA 4NPEA 4JBZA 2B87B 5CBNA 2HR3A 2M0BA 4WWIA 3PH0A 4NPFX 5EFWB 1JMBA 1U7JA 2LXBA 5DJUB 1EDIA 4ZMDA 1X0TA 2JWDA 2KIKA 1H0TB 2B88A 2QRXA 4CPGA 4HKZH 4ZNCA 2B89A 1H0TA 5C39A 2KI7B 1ZXGA 3S1KA 2UWJE 2OTKE 2R44A 3MZWB 1EDLA 1LP1A 2KUBA 2B87A 4IOIH 2KZIA 4HJGH 3MHVA 3FXEA 4K35A 1MFTA 2RKLA 4GOEA 1NVOA 2KS1B 2Q1KA 4ASVA 1OVVA 1OVRA 2I8DA 4NPDA 1FC2C 3FXDA 1LP1B 2K3RA 2KZJA 1DEEG 2M5AA
chains in the Genus database with same CATH superfamily
3BVHA 4R4MA 5DJTB 2E75B 3GMAA 1BCCD 2WWWA 3HTKA 5GTIE 1SP4A 2QVAA 3L73D 1LNQA 1M7LA 4H44C 3B71A 3PP5A 2YXRB 1FZAA 1IFMA 2B9BA 3V4QA 2O3JA 5AW2B 4AUWA 3M9QA 4H13B 5CCGA 2QIWA 3JCUH 1USDA 1VQ5P 3ITKA 1VQMP 2YKOA 1TU3F 3BRTB 1JM0A 1RE4A 5CCHA 2GM4A 5APYA 3CC2P 1FZGA 2KNCA 4OH8B 5GTHH 3RK3C 3VTPC 3RGUA 3I56P 1SQVK 4DOJA 1W2BO 3L72G 1FDIA 3IR9A 4JF7A 4N6JA 1D7MA 3VMAA 2QJKC 1BCCJ 3C8VA 2A45G 2AEFA 2W6JH 5AW0B 4L73A 1K04A 2QSIA 5AW6B 3A3YB 5AVVB 1GW4A 2J59M 1HVVA 2N1TB 5KKZC 1JY2N 2OQQA 5CBOA 3H6PA 1RF1A 2RN0A 2XNXA 5TISE 2Z4EA 2QJPC 1NTKG 3KHUA 1HGVA 3LW5H 1BGYJ 1IJDB 2P1JA 1SQVJ 3LW5J 1NJIQ 3CWBJ 3CD6P 1ZP0C 4PV1B 2OYIC 3S9OA 1NAFA 2ZXXA 3EQ2A 2R3CA 1GK6A 2PGDA 2ZYGA 1BCCE 4I1LA 2Q5UA 4PV1C 3RK2D 5B66E 3PJSK 3A0HE 3AEFC 1NGMB 2G8YA 3K5BA 1FZEA 4GDOA 1LTJA 1QVGO 1U7MA 1LTTC 5APTA 2QE7H 2QJPB 1Q81Q 5AVRB 2B87B 4YTPC 2MKVA 3T97A 1UIIA 4PD4D 2FYUK 2M0BA 5KKZB 2N1TC 2QM8A 2POHA 5KAIH 4XE5B 3Q1MA 1JY2O 4NPFX 1FOSF 3L70J 1P84D 2Q3IA 1JY3O 1YBKA 1IFIA 2QJKB 1T8ZA 2W83C 3H1KD 1SQVE 5CJ0A 3CX5H 3CCUP 1BGYE 1BGYD 1NKNA 1EDIA 3OJAB 1S1CX 1SQVG 2FKWB 2ZVNB 5CHXA 5DJUB 2HODA 2WSCH 3CWBD 3RK3B 1H88A 4C7NB 2NPSD 1OWAA 1T6AA 3BATA 3H1IE 1JTHB 3D70A 2IZ1A 4W80A 2XDJA 3NTNA 2JEEA 3A0HH 1JY3N 2I1KA 3AE8C 2O01N 4H13C 4HKZH 2B89A 4W7YA 4CPGA 5B5EH 2G3AA 3HTKB 3AEBC 4H44B 1ZXGA 3MGNA 4U7JA 3L70G 4L74A 3VMZA 3D6ZA 1NTZD 2E75C 3S1KA 1PFIA 1LWUA 2UWJE 3AEEC 2OTKE 4WVZA 1PGQA 2JWAA 4RJTA 1KYOH 1SFCC 3HE4A 3W67A 2IFMA 2N9YB 3JC22 2IZ0A 3H32A 1PPJG 3IN6A 1NTKD 1GTWA 4I7ZB 3H1JD 4K35A 1L2PA 2K88A 1MFTA 1KILC 2IYPA 4LGDE 2NPSB 3AEDC 3WMM0 5KLVK 1J1EB 2WT7A 1DH3A 1KILA 1N7SB 1P84H 2QEXP 2OTLP 2BEZF 3L71G 4GOEA 1HJBA 2D2CC 1NVOA 2WTYA 1L4AB 2NPSA 5AW1B 2OYIB 1NTZJ 3TNUA 1JO5A 2QM7A 1L0LK 4XA4A 4EIJA 3G71P 1GL2B 1LTAC 1OVRA 2I8DA 4RO0A 1YTZT 1HWTC 3AE9C 3E1RA 4C46A 1W5CE 3FXDA 3H1LD 4UB6H 3U1CA 1YI2P 2JR8A 3CC7P 1JUNA 5B66H 1IFDA 1M56D 2FBWC 4OGQB 2K9YA 2KZJA 3H1IG 2FFDB 1VQ9P 1FDMA 2Q7CA 2QJYB 1IC2A 3U59A 1YJ9P 1AJYA 2FYUE 1DD4A 1AA0A 4GKGA 5KTBA 3USSA 5KJ7D 3A5TA 1VF5B 1U57A 2DW3A 4Y28J 5M1BA 5KLVJ 4DCKA 1KC8Q 1VQ7P 1N73B 2C9NY 3CMEP 3D71A 3HUSC 3L75D 2HYNA 1ZW0A 3JCUE 1L0LD 1Q2NA 3P7KA 1JTHA 5AVWB 2A45H 2V7QH 1RE3A 1Y9BA 2ITAA 2YO3A 3SFEC 3HD7C 1NTKE 1LJ2A 5KJ7C 1HGZA 2HLOA 3UIAA 2OYHB 2M8RA 1EZVG 1ZR4A 4JPZB 2W6BA 1URQC 1LT9A 4Y99C 3G6EP 1JB0J 1OVUA 2IBZG 4I6MC 2E5YA 1S5LX 1WT6A 4PJ0H 1SQPG 3BASA 5CCHD 2Q3EA 3N7NA 4GOFA 2K37A 1NU1J 3ZDMA 5TISH 3CCMP 1T3UA 1CI6A 2FY8A 2YIUB 1CZQA 3GG2A 3GLMA 2P67A 4PD4H 3SWKA 1PPJD 2ZFCA 2AXCA 1DX7A 3AE1C 1NTMJ 1MUUA 1R5LA 1FE6A 3P8CE 3SSUA 3AE4C 3M06A 4AQRD 1PP9G 2WQYC 3RL0B 2Y9ZA 1RF1C 1ZMEC 1PGJA 1EXJA 3GHGA 1M1JB 3TGUE 1IFPA 4L76A 3KZIH 3LIEA 1Q90D 3S4RA 2Y0DA 3AE3C 2WPRA 3GHGC 3TNUB 3L74G 1LTJC 3AE7C 3L73J 1IK9A 3MTUE 1KB9H 2AXTE 3H1KE 5CCGD 2P10A 3MUDC 2C0XA 4L75A 2WT7B 1YIJP 1L0NE 1PIXA 2HR3A 1GMJA 3M9HA 4WWIA 1G1JA 1R5SA 2WITA 3PH0A 1KTMA 3VP8A 2CK3H 2JP3A 3CX5E 3H32B 1JMBA 1LWUB 4U3FE 1SQBK 1GW3A 1BSNA 4D6TJ 1VQLP 3MP7B 1IZNB 2LKMA 2MJZA 3KDPB 5GTHE 3PLNA 3O8ZA 3M0DA 1RY3A 2ZT9B 4H0LB 2Y0EA 4UB8H 1BCCG 1S9KE 3H1LE 4RKUJ 2JJLA 1H0TB 1LTSC 1PL5A 2B88A 1DD3A 2QRXA 1DEBA 2XU6A 4LC1A 5APSA 5AW3B 3U1AA 4JQ0D 3VYIA 4ZKUA 1HTLC 2KOGA 3L74J 1S2EA 3FX0A 1VQ4P 1PPJE 2E74B 1KB9E 1H0TA 3P8CD 1G2CA 4ZNCA 3G9RA 2KI7B 5CCGC 1M8OB 2BCCD 1EZVD 1QL2A 1HF9A 1QEXA 4D6TD 2WSFH 1RE4C 3L75J 3RK3E 3TYYA 1FOSE 4DZOA 1GD2E 4C7NA 2IBZD 1NO4A 1BE3E 2HODB 2YNYA 1KYOE 3L72E 3SWYA 3Q5SA 3Q5PA 3B5NB 3H1JE 4WY4B 3BCCE 2R44A 3EFGA 1AVOA 5AW4B 4RESB 1EDLA 1KFMA 2KUBA 2YO2A 1SQBJ 3NMDA 1ZRTD 1FS0E 1XTCC 2PFXA 3L37A 4UB8E 2ZT9D 2Z5IA 4N3YB 3CXHI 1KILE 4HJGH 2M3BA 1RF0A 1SQQJ 1A02F 1YTZI 4PJ0E 3CC4P 1J1DC 1RF0C 2BCCJ 3RK2B 3V5BA 1PP9D 1FJPA 3P8MC 3GW6A 1R8EA 4IFFA 2RKLA 1W2EA 1L0LE 5H2FH 1EQ7A 1SQPE 2W8ZA 1FZCA 2R5DA 3LIDA 1KORA 4YXDC 1M90Q 4ASVA 1VF5D 1FZCB 1OVVA 3P32A 1FDOA 3NXSA 4BWNA 4DT0A 1KMIZ 3V2RA 2L91A 5KLIB 1N73C 3WUUA 2E42A 1NTZK 2N9BA 1AVYA 4N78D 2E76B 3KZIE 2WPSA 1SQBD 3IFMA 1T3JA 3H1HG 3L35A 3V6IA 1GU5A 2WPVB 5APUA 1KQLA 1NH4A 2XZRA 3H1HE 1N2DC 1MFZA 2IX7C 4WY4D 1E5WA 1YJWP 1Q7YQ 1DEEG 2AXTH 4BRYA 3CCJP 4JYBA 2O1JA 2WZ7A 3MIWA 3VOPA 1A02J 2J5UA 3E7KA 5KAFE 5KLVD 1LT9B 2OGUA 1PP9J 4KHXA 4WY4A 1NKZB 1KYOI 1SQVD 3B4SA 3II6A 1VPCA 3CXHD 3CWBG 4OWFA 3TDKA 3WUTA 1AV1A 1SQQE 1EXIA 2E74D 4IL6E 1X9VA 1L0NG 2KNCB 3RL0g 2VRSA 1IFNA 2WPQA 2OYHA 1RE3C 5KJ7A 1SQBE 2Q9IA 1SQQK 1PGOA 2FYNB 3QWOC 4N78E 2A06G 1N73A 2ZVOB 1SQXE 3L71J 1JY3P 2BCCG 3BRVB 4HB1A 1HH0A 2YKQA 4D6TG 1NTZG 3FWLA 1FZFA 1BE3G 3OA7A 1EC5A 1VQ6P 1EDJA 2RH0A 3BCCG 1SFCA 3N4XA 2H7HA 3F89A 3D6YA 2QG4A 1KFNA 5K5GB 1X79B 2FFDA 1BDCA 2ZAEB 4UB6E 3H25A 1GL2A 2XV5A 2N1TD 2YMYA 4W7ZA 3H1JG 5TJHA 1VQNP 1BSHA 1MV8A 2P58A 3Q5RA 1S9KD 1DIPA 1KN7A 3JSVC 3CXHE 1JCDA 1MZ9A 3A0BE 1GL2D 2XKMA 3CL3D 3L71D 3RBZA 3CCVP 2CPSA 1QLED 4BXLA 1EDKA 3VMYA 1OW6A 2PAJA 1EZVE 2NZ2A 2K9JB 1BDDA 1QX8A 4EOTA 2BEQD 3H1KJ 4U3FG 1OX3A 4O9BA 2O01J 1NU1G 5CBNA 2W90A 2PRRA 1ZV8A 2A45I 3H1LG 4QMAA 1OW8A 3H1HD 4H13D 3TSIA 1QVFO 3AE5C 5AW5B 4TLFA 1WMKA 1OFCX 2JDIH 2OYOA 2NRGA 3C1LA 2E76D 3EFFK 3KYQA 1PZQA 1HUCA 1J2JB 2FYUG 2LXBA 3HE4B 2V7QJ 4H0LD 5AVYB 1SQPK 1USEA 3M0DC 4XFJA 5AW8B 2KB7P 2C9LY 1SFCD 2ZJSE 3TGUG 3O6QA 2BASA 2GUVA 3G3ZA 4ZMDA 1AFOA 1YYCA 3HD7D 2JWDA 3TK1A 3A0BH 3L73G 4JYCA 1PP9E 5AVTB 2FYZA 3R2PA 3CX5D 1K73Q 1ZOYC 1URQD 1ZLLA 3L75G 5AW7B 4EDFA 1X22A 3CMAP 3OAKA 2FYNC 3HUSA 4AYCA 2E5TA 4H44D 1NTMK 1NU1E 3H1HJ 3VN0A 2A06D 4YPCA 3CI9A 5C39A 1URQA 4I2LC 1VQKP 3ABVC 3TGUD 1FZBA 4IFMA 2V4HA 1N7LA 5CCHC 2FXMA 3OW2O 3AEGC 1LT9C 1SQXJ 3L71E 1NTKJ 2WSCJ 4OGQD 1S5LH 3I55P 1LP1A 3V2QA 2CPBA 4BRYB 1SQXK 1SQPJ 1YHQP 2H8PD 2B87A 3T97B 3RK3D 3VP9A 1KQSO 4DJGA 2E76C 3FXEA 1VQ8P 1OXZA 3GF7A 5KLIC 2HPCB 3CCEP 1M1KQ 3M0AA 1JEKA 1FZCC 2W27A 2Z5HA 3HE5B 3HE5A 1KQFB 3I5CA 2FXOA 3KQGA 2KS1B 5E79E 1L4AA 5AVQB 1JMMA 2OYIA 3H1JJ 3CCRP 1N7SA 5AVXB 4TT3H 4PV1D 3RK2C 4IFDK 1J1DB 1HBWA 1VQPP 1JY2P 1EZVI 3L75E 2KLUA 3PHLA 4KT0J 4A7PA 1NU1D 1K05A 2KSJA 3MUDA 1NHLA 1N8RQ 3SFDC 2IBZI 1VQOP 1LP1B 2K3RA 3CPWO 2N1TA 3AE6C 4HH2A 2RMZA 3B5NA 3L74E 3V4WA 4B86A 5AVUB 5KAFH 1NWQA 2FYUD 1LTIC 2M5AA 4WY4C 3B5NC 3CLQA 2D2CD 1Q86Q 1BGYG 2K1AA 2ZXEB 1NTKK 2LR2A 1SS1A 3H1LJ 4IL6H 4MN4C 2KXPB 1S3JA 2XNDH 1NAYA 3V2NA 3TF5A 3PRJA 4PD4E 5AVSB 2Y9YA 1G2CB 1N86A 2J58A 4KJMA 1OZHA 2JO1A 4GIFA 2QA4P 1VDFA 1KQGB 2E74C 2R32A 3IF4A 2PP6A 4WB4A 4EYYQ 3IAOA 1M57D 1YITP 5KAIE 3QH9A 1X8YA 2GA1A 5APXA 5AW9B 1S72P 4GODA 3L72J 3L70D 2WMMA 1Y8AA 1RHZB 4OVNF 4H0LC 2ZT9C 4PD4I 5H2FE 5BVZA 2M5AB 1K8AQ 1Y47A 4ASWA 1IO4A 1LWUC 3SWFA 4M3LA 1K9MQ 2KLVA 1SQXD 2WVRA 3TGUJ 2KSEA 1IK7A 3VMXA 3A7OA 3FWNA 2E75D 1ZRTE 1L0NK 2YKPA 3A2AA 3C9IA 3H1IJ 4IL6X 3CCQP 5B5EE 3CXHH 1S5LE 2LXCB 1LTGC 2M3EA 4WBAA 1SVFA 2KYVA 1P84I 1LTJB 2SPZA 3E1IA 1YQ4C 2IYOA 2GUSA 4HYTB 3AEAC 1M1JA 3GHGB 3GF3A 3L4FA 3AE2C 3L70E 4K3AA 4U3FJ 4ZKPA 4GT1A 1M1JC 1NTMD 1SQQG 2KS1A 2O01H 3KXDA 2OARA 1NOHA 2HPCA 1CW5A 1E79H 3HRNA 3RL0C 1L0NJ 1LT1A 1HJ0A 3L36A 5CMZA 4NPEA 2OTJP 1G1IA 1FAVA 1Z56A 2O1KA 1KB9D 2Y0CA 2YXQB 2YMKA 1FBMA 4JBZA 1LGHB 1SQBG 3KPEA 3L73E 3V2PA 2AEMA 2YIUC 2KK7A 3R4YA 5GTIH 2KP8A 1RF1B 3H1ID 5EFWB 5APQA 3RL0D 1CI6B 1QL1A 1U7JA 2P2UA 2P7JA 3CWBE 2WSFJ 5KLVG 1PV3A 1YQ3C 1JCCA 1FJKA 1JOCA 5BU8B 5KLVE 1T2KC 1X0TA 1URQB 4Y99B 1NTME 2KIKA 1L0ND 4LLHA 2OYHC 3HD7B 1N7SD 1KD1Q 2FYUJ 1L0LG 2HFED 2H43A 1GDTA 3WU2H 4D6TE 5BU5A 2ZYAA 3HD7A 4C7RA 1IFJA 2JKVA 3M9BA 2W6AA 3FGAD 1ZR2A 1T2KD 1GZLA 1OIPA 3HUSB 1CSBA 1KZUB 1ZN5A 1RQVA 1RQUA 2ZYDA 2I1JA 3B8EB 1UIXA 1OMIA 3O6QB 5APVA 1VF5C 1MKMA 1XTGB 3B5ND 1RH5B 1S4XA 3MD0A 1BE3D 3L72D 2FXPA 1KB9I 1SQPD 1NTZE 1OW7A 2Q6QA 3BCCD 4Z1MH 3MZWB 2QJYC 3Q2YA 3W68A 1SQXG 3WUVA 2FFDC 2HG5D 4OGQC 1L0LJ 2IDBA 5AVZB 1H8AA 4IOIH 2KZIA 5L8RJ 3G4SP 1WRGA 1KILD 1LTBC 2BCCE 3MHVA 1H89A 1FU1A 1GU4A 3EWKA 3F5HA 2WSEJ 1JNMA 1GL2C 3WU2E 5E79H 2WSEH 2K9JA 2IFNA 1AQTA 2IPPA 3AECC 3NFQA 4EI2A 1Q82Q 1L4AC 3CX5I 2R3SA 1KYOD 2D2CB 2Q1KA 2IBZE 1VL2A 1N7SC 1NTMG 1SQQD 2A06E 2WSSH 1P84E 3BCCJ 1NYHA 1J1EC 4R4LA 3L74D 2E43A 2H88C 1NU1K 1BE3J 1KILB 2NPSC 5CJ4A 3CCLP 1AQ5A 2L5GB 4I7ZC 1FC2C 4NPDA 3M91A 4U3FD 5APWA 1L4AD 1PGPA 2AEJA 3RBXA 3Q3DA 1GK4A 1SLQA 3H1KG 1SFCB 3CCSP 1KV4A 3PTZA 1YJNP 2C0WA 4YXWH 2R5BA 1QGKB 2H89C
chains in the Genus database with same CATH topology
2LR2A 1SS1A 5DJTB 4MN4C 1S3JA 2QVAA 4KJMA 1ZW0A 1Q2NA 3QWOC 4EYYQ 1JM0A 4GODA 4HB1A 2WMMA 3RGUA 1OVUA 2M5AB 1EC5A 1Y47A 1EDJA 4ASWA 4GOFA 3ZDMA 5K5GB 5CBOA 1BDCA 2ZAEB 2LXCB 2P58A 2SPZA 4K3AA 4BXLA 1EDKA 1LT1A 1BDDA 1U7MA 4NPEA 4JBZA 2B87B 5CBNA 2HR3A 2M0BA 4WWIA 3PH0A 4NPFX 5EFWB 1JMBA 1U7JA 2LXBA 5DJUB 1EDIA 4ZMDA 1X0TA 2JWDA 2KIKA 1H0TB 2B88A 2QRXA 4CPGA 4HKZH 4ZNCA 2B89A 1H0TA 5C39A 2KI7B 1ZXGA 3S1KA 2UWJE 2OTKE 2R44A 3MZWB 1EDLA 1LP1A 2KUBA 2B87A 4IOIH 2KZIA 4HJGH 3MHVA 3FXEA 4K35A 1MFTA 2RKLA 4GOEA 1NVOA 2KS1B 2Q1KA 4ASVA 1OVVA 1OVRA 2I8DA 4NPDA 1FC2C 3FXDA 1LP1B 2K3RA 2KZJA 1DEEG 2M5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LR2 A;  1SS1 A;  5DJT B;  4MN4 C;  1S3J A;  2QVA A;  4KJM A;  1ZW0 A;  1Q2N A;  3QWO C;  4EYY Q;  1JM0 A;  4GOD A;  4HB1 A;  2WMM A;  3RGU A;  1OVU A;  2M5A B;  1EC5 A;  1Y47 A;  1EDJ A;  4ASW A;  4GOF A;  3ZDM A;  5K5G B;  5CBO A;  1BDC A;  2ZAE B;  2LXC B;  2P58 A;  2SPZ A;  4K3A A;  4BXL A;  1EDK A;  1LT1 A;  1BDD A;  1U7M A;  4NPE A;  4JBZ A;  2B87 B;  5CBN A;  2HR3 A;  2M0B A;  4WWI A;  3PH0 A;  4NPF X;  5EFW B;  1JMB A;  1U7J A;  2LXB A;  5DJU B;  1EDI A;  4ZMD A;  1X0T A;  2JWD A;  2KIK A;  1H0T B;  2B88 A;  2QRX A;  4CPG A;  4HKZ H;  4ZNC A;  2B89 A;  1H0T A;  5C39 A;  2KI7 B;  1ZXG A;  3S1K A;  2UWJ E;  2OTK E;  2R44 A;  3MZW B;  1EDL A;  1LP1 A;  2KUB A;  2B87 A;  4IOI H;  2KZI A;  4HJG H;  3MHV A;  3FXE A;  4K35 A;  1MFT A;  2RKL A;  4GOE A;  1NVO A;  2KS1 B;  2Q1K A;  4ASV A;  1OVV A;  1OVR A;  2I8D A;  4NPD A;  1FC2 C;  3FXD A;  1LP1 B;  2K3R A;  2KZJ A;  1DEE G;  2M5A A; 
#chains in the Genus database with same CATH topology
 3BVH A;  4R4M A;  5DJT B;  2E75 B;  3GMA A;  1BCC D;  2WWW A;  3HTK A;  5GTI E;  1SP4 A;  2QVA A;  3L73 D;  1LNQ A;  1M7L A;  4H44 C;  3B71 A;  3PP5 A;  2YXR B;  1FZA A;  1IFM A;  2B9B A;  3V4Q A;  2O3J A;  5AW2 B;  4AUW A;  3M9Q A;  4H13 B;  5CCG A;  2QIW A;  3JCU H;  1USD A;  1VQ5 P;  3ITK A;  1VQM P;  2YKO A;  1TU3 F;  3BRT B;  1JM0 A;  1RE4 A;  5CCH A;  2GM4 A;  5APY A;  3CC2 P;  1FZG A;  2KNC A;  4OH8 B;  5GTH H;  3RK3 C;  3VTP C;  3RGU A;  3I56 P;  1SQV K;  4DOJ A;  1W2B O;  3L72 G;  1FDI A;  3IR9 A;  4JF7 A;  4N6J A;  1D7M A;  3VMA A;  2QJK C;  1BCC J;  3C8V A;  2A45 G;  2AEF A;  2W6J H;  5AW0 B;  4L73 A;  1K04 A;  2QSI A;  5AW6 B;  3A3Y B;  5AVV B;  1GW4 A;  2J59 M;  1HVV A;  2N1T B;  5KKZ C;  1JY2 N;  2OQQ A;  5CBO A;  3H6P A;  1RF1 A;  2RN0 A;  2XNX A;  5TIS E;  2Z4E A;  2QJP C;  1NTK G;  3KHU A;  1HGV A;  3LW5 H;  1BGY J;  1IJD B;  2P1J A;  1SQV J;  3LW5 J;  1NJI Q;  3CWB J;  3CD6 P;  1ZP0 C;  4PV1 B;  2OYI C;  3S9O A;  1NAF A;  2ZXX A;  3EQ2 A;  2R3C A;  1GK6 A;  2PGD A;  2ZYG A;  1BCC E;  4I1L A;  2Q5U A;  4PV1 C;  3RK2 D;  5B66 E;  3PJS K;  3A0H E;  3AEF C;  1NGM B;  2G8Y A;  3K5B A;  1FZE A;  4GDO A;  1LTJ A;  1QVG O;  1U7M A;  1LTT C;  5APT A;  2QE7 H;  2QJP B;  1Q81 Q;  5AVR B;  2B87 B;  4YTP C;  2MKV A;  3T97 A;  1UII A;  4PD4 D;  2FYU K;  2M0B A;  5KKZ B;  2N1T C;  2QM8 A;  2POH A;  5KAI H;  4XE5 B;  3Q1M A;  1JY2 O;  4NPF X;  1FOS F;  3L70 J;  1P84 D;  2Q3I A;  1JY3 O;  1YBK A;  1IFI A;  2QJK B;  1T8Z A;  2W83 C;  3H1K D;  1SQV E;  5CJ0 A;  3CX5 H;  3CCU P;  1BGY E;  1BGY D;  1NKN A;  1EDI A;  3OJA B;  1S1C X;  1SQV G;  2FKW B;  2ZVN B;  5CHX A;  5DJU B;  2HOD A;  2WSC H;  3CWB D;  3RK3 B;  1H88 A;  4C7N B;  2NPS D;  1OWA A;  1T6A A;  3BAT A;  3H1I E;  1JTH B;  3D70 A;  2IZ1 A;  4W80 A;  2XDJ A;  3NTN A;  2JEE A;  3A0H H;  1JY3 N;  2I1K A;  3AE8 C;  2O01 N;  4H13 C;  4HKZ H;  2B89 A;  4W7Y A;  4CPG A;  5B5E H;  2G3A A;  3HTK B;  3AEB C;  4H44 B;  1ZXG A;  3MGN A;  4U7J A;  3L70 G;  4L74 A;  3VMZ A;  3D6Z A;  1NTZ D;  2E75 C;  3S1K A;  1PFI A;  1LWU A;  2UWJ E;  3AEE C;  2OTK E;  4WVZ A;  1PGQ A;  2JWA A;  4RJT A;  1KYO H;  1SFC C;  3HE4 A;  3W67 A;  2IFM A;  2N9Y B;  3JC2 2;  2IZ0 A;  3H32 A;  1PPJ G;  3IN6 A;  1NTK D;  1GTW A;  4I7Z B;  3H1J D;  4K35 A;  1L2P A;  2K88 A;  1MFT A;  1KIL C;  2IYP A;  4LGD E;  2NPS B;  3AED C;  3WMM 0;  5KLV K;  1J1E B;  2WT7 A;  1DH3 A;  1KIL A;  1N7S B;  1P84 H;  2QEX P;  2OTL P;  2BEZ F;  3L71 G;  4GOE A;  1HJB A;  2D2C C;  1NVO A;  2WTY A;  1L4A B;  2NPS A;  5AW1 B;  2OYI B;  1NTZ J;  3TNU A;  1JO5 A;  2QM7 A;  1L0L K;  4XA4 A;  4EIJ A;  3G71 P;  1GL2 B;  1LTA C;  1OVR A;  2I8D A;  4RO0 A;  1YTZ T;  1HWT C;  3AE9 C;  3E1R A;  4C46 A;  1W5C E;  3FXD A;  3H1L D;  4UB6 H;  3U1C A;  1YI2 P;  2JR8 A;  3CC7 P;  1JUN A;  5B66 H;  1IFD A;  1M56 D;  2FBW C;  4OGQ B;  2K9Y A;  2KZJ A;  3H1I G;  2FFD B;  1VQ9 P;  1FDM A;  2Q7C A;  2QJY B;  1IC2 A;  3U59 A;  1YJ9 P;  1AJY A;  2FYU E;  1DD4 A;  1AA0 A;  4GKG A;  5KTB A;  3USS A;  5KJ7 D;  3A5T A;  1VF5 B;  1U57 A;  2DW3 A;  4Y28 J;  5M1B A;  5KLV J;  4DCK A;  1KC8 Q;  1VQ7 P;  1N73 B;  2C9N Y;  3CME P;  3D71 A;  3HUS C;  3L75 D;  2HYN A;  1ZW0 A;  3JCU E;  1L0L D;  1Q2N A;  3P7K A;  1JTH A;  5AVW B;  2A45 H;  2V7Q H;  1RE3 A;  1Y9B A;  2ITA A;  2YO3 A;  3SFE C;  3HD7 C;  1NTK E;  1LJ2 A;  5KJ7 C;  1HGZ A;  2HLO A;  3UIA A;  2OYH B;  2M8R A;  1EZV G;  1ZR4 A;  4JPZ B;  2W6B A;  1URQ C;  1LT9 A;  4Y99 C;  3G6E P;  1JB0 J;  1OVU A;  2IBZ G;  4I6M C;  2E5Y A;  1S5L X;  1WT6 A;  4PJ0 H;  1SQP G;  3BAS A;  5CCH D;  2Q3E A;  3N7N A;  4GOF A;  2K37 A;  1NU1 J;  3ZDM A;  5TIS H;  3CCM P;  1T3U A;  1CI6 A;  2FY8 A;  2YIU B;  1CZQ A;  3GG2 A;  3GLM A;  2P67 A;  4PD4 H;  3SWK A;  1PPJ D;  2ZFC A;  2AXC A;  1DX7 A;  3AE1 C;  1NTM J;  1MUU A;  1R5L A;  1FE6 A;  3P8C E;  3SSU A;  3AE4 C;  3M06 A;  4AQR D;  1PP9 G;  2WQY C;  3RL0 B;  2Y9Z A;  1RF1 C;  1ZME C;  1PGJ A;  1EXJ A;  3GHG A;  1M1J B;  3TGU E;  1IFP A;  4L76 A;  3KZI H;  3LIE A;  1Q90 D;  3S4R A;  2Y0D A;  3AE3 C;  2WPR A;  3GHG C;  3TNU B;  3L74 G;  1LTJ C;  3AE7 C;  3L73 J;  1IK9 A;  3MTU E;  1KB9 H;  2AXT E;  3H1K E;  5CCG D;  2P10 A;  3MUD C;  2C0X A;  4L75 A;  2WT7 B;  1YIJ P;  1L0N E;  1PIX A;  2HR3 A;  1GMJ A;  3M9H A;  4WWI A;  1G1J A;  1R5S A;  2WIT A;  3PH0 A;  1KTM A;  3VP8 A;  2CK3 H;  2JP3 A;  3CX5 E;  3H32 B;  1JMB A;  1LWU B;  4U3F E;  1SQB K;  1GW3 A;  1BSN A;  4D6T J;  1VQL P;  3MP7 B;  1IZN B;  2LKM A;  2MJZ A;  3KDP B;  5GTH E;  3PLN A;  3O8Z A;  3M0D A;  1RY3 A;  2ZT9 B;  4H0L B;  2Y0E A;  4UB8 H;  1BCC G;  1S9K E;  3H1L E;  4RKU J;  2JJL A;  1H0T B;  1LTS C;  1PL5 A;  2B88 A;  1DD3 A;  2QRX A;  1DEB A;  2XU6 A;  4LC1 A;  5APS A;  5AW3 B;  3U1A A;  4JQ0 D;  3VYI A;  4ZKU A;  1HTL C;  2KOG A;  3L74 J;  1S2E A;  3FX0 A;  1VQ4 P;  1PPJ E;  2E74 B;  1KB9 E;  1H0T A;  3P8C D;  1G2C A;  4ZNC A;  3G9R A;  2KI7 B;  5CCG C;  1M8O B;  2BCC D;  1EZV D;  1QL2 A;  1HF9 A;  1QEX A;  4D6T D;  2WSF H;  1RE4 C;  3L75 J;  3RK3 E;  3TYY A;  1FOS E;  4DZO A;  1GD2 E;  4C7N A;  2IBZ D;  1NO4 A;  1BE3 E;  2HOD B;  2YNY A;  1KYO E;  3L72 E;  3SWY A;  3Q5S A;  3Q5P A;  3B5N B;  3H1J E;  4WY4 B;  3BCC E;  2R44 A;  3EFG A;  1AVO A;  5AW4 B;  4RES B;  1EDL A;  1KFM A;  2KUB A;  2YO2 A;  1SQB J;  3NMD A;  1ZRT D;  1FS0 E;  1XTC C;  2PFX A;  3L37 A;  4UB8 E;  2ZT9 D;  2Z5I A;  4N3Y B;  3CXH I;  1KIL E;  4HJG H;  2M3B A;  1RF0 A;  1SQQ J;  1A02 F;  1YTZ I;  4PJ0 E;  3CC4 P;  1J1D C;  1RF0 C;  2BCC J;  3RK2 B;  3V5B A;  1PP9 D;  1FJP A;  3P8M C;  3GW6 A;  1R8E A;  4IFF A;  2RKL A;  1W2E A;  1L0L E;  5H2F H;  1EQ7 A;  1SQP E;  2W8Z A;  1FZC A;  2R5D A;  3LID A;  1KOR A;  4YXD C;  1M90 Q;  4ASV A;  1VF5 D;  1FZC B;  1OVV A;  3P32 A;  1FDO A;  3NXS A;  4BWN A;  4DT0 A;  1KMI Z;  3V2R A;  2L91 A;  5KLI B;  1N73 C;  3WUU A;  2E42 A;  1NTZ K;  2N9B A;  1AVY A;  4N78 D;  2E76 B;  3KZI E;  2WPS A;  1SQB D;  3IFM A;  1T3J A;  3H1H G;  3L35 A;  3V6I A;  1GU5 A;  2WPV B;  5APU A;  1KQL A;  1NH4 A;  2XZR A;  3H1H E;  1N2D C;  1MFZ A;  2IX7 C;  4WY4 D;  1E5W A;  1YJW P;  1Q7Y Q;  1DEE G;  2AXT H;  4BRY A;  3CCJ P;  4JYB A;  2O1J A;  2WZ7 A;  3MIW A;  3VOP A;  1A02 J;  2J5U A;  3E7K A;  5KAF E;  5KLV D;  1LT9 B;  2OGU A;  1PP9 J;  4KHX A;  4WY4 A;  1NKZ B;  1KYO I;  1SQV D;  3B4S A;  3II6 A;  1VPC A;  3CXH D;  3CWB G;  4OWF A;  3TDK A;  3WUT A;  1AV1 A;  1SQQ E;  1EXI A;  2E74 D;  4IL6 E;  1X9V A;  1L0N G;  2KNC B;  3RL0 g;  2VRS A;  1IFN A;  2WPQ A;  2OYH A;  1RE3 C;  5KJ7 A;  1SQB E;  2Q9I A;  1SQQ K;  1PGO A;  2FYN B;  3QWO C;  4N78 E;  2A06 G;  1N73 A;  2ZVO B;  1SQX E;  3L71 J;  1JY3 P;  2BCC G;  3BRV B;  4HB1 A;  1HH0 A;  2YKQ A;  4D6T G;  1NTZ G;  3FWL A;  1FZF A;  1BE3 G;  3OA7 A;  1EC5 A;  1VQ6 P;  1EDJ A;  2RH0 A;  3BCC G;  1SFC A;  3N4X A;  2H7H A;  3F89 A;  3D6Y A;  2QG4 A;  1KFN A;  5K5G B;  1X79 B;  2FFD A;  1BDC A;  2ZAE B;  4UB6 E;  3H25 A;  1GL2 A;  2XV5 A;  2N1T D;  2YMY A;  4W7Z A;  3H1J G;  5TJH A;  1VQN P;  1BSH A;  1MV8 A;  2P58 A;  3Q5R A;  1S9K D;  1DIP A;  1KN7 A;  3JSV C;  3CXH E;  1JCD A;  1MZ9 A;  3A0B E;  1GL2 D;  2XKM A;  3CL3 D;  3L71 D;  3RBZ A;  3CCV P;  2CPS A;  1QLE D;  4BXL A;  1EDK A;  3VMY A;  1OW6 A;  2PAJ A;  1EZV E;  2NZ2 A;  2K9J B;  1BDD A;  1QX8 A;  4EOT A;  2BEQ D;  3H1K J;  4U3F G;  1OX3 A;  4O9B A;  2O01 J;  1NU1 G;  5CBN A;  2W90 A;  2PRR A;  1ZV8 A;  2A45 I;  3H1L G;  4QMA A;  1OW8 A;  3H1H D;  4H13 D;  3TSI A;  1QVF O;  3AE5 C;  5AW5 B;  4TLF A;  1WMK A;  1OFC X;  2JDI H;  2OYO A;  2NRG A;  3C1L A;  2E76 D;  3EFF K;  3KYQ A;  1PZQ A;  1HUC A;  1J2J B;  2FYU G;  2LXB A;  3HE4 B;  2V7Q J;  4H0L D;  5AVY B;  1SQP K;  1USE A;  3M0D C;  4XFJ A;  5AW8 B;  2KB7 P;  2C9L Y;  1SFC D;  2ZJS E;  3TGU G;  3O6Q A;  2BAS A;  2GUV A;  3G3Z A;  4ZMD A;  1AFO A;  1YYC A;  3HD7 D;  2JWD A;  3TK1 A;  3A0B H;  3L73 G;  4JYC A;  1PP9 E;  5AVT B;  2FYZ A;  3R2P A;  3CX5 D;  1K73 Q;  1ZOY C;  1URQ D;  1ZLL A;  3L75 G;  5AW7 B;  4EDF A;  1X22 A;  3CMA P;  3OAK A;  2FYN C;  3HUS A;  4AYC A;  2E5T A;  4H44 D;  1NTM K;  1NU1 E;  3H1H J;  3VN0 A;  2A06 D;  4YPC A;  3CI9 A;  5C39 A;  1URQ A;  4I2L C;  1VQK P;  3ABV C;  3TGU D;  1FZB A;  4IFM A;  2V4H A;  1N7L A;  5CCH C;  2FXM A;  3OW2 O;  3AEG C;  1LT9 C;  1SQX J;  3L71 E;  1NTK J;  2WSC J;  4OGQ D;  1S5L H;  3I55 P;  1LP1 A;  3V2Q A;  2CPB A;  4BRY B;  1SQX K;  1SQP J;  1YHQ P;  2H8P D;  2B87 A;  3T97 B;  3RK3 D;  3VP9 A;  1KQS O;  4DJG A;  2E76 C;  3FXE A;  1VQ8 P;  1OXZ A;  3GF7 A;  5KLI C;  2HPC B;  3CCE P;  1M1K Q;  3M0A A;  1JEK A;  1FZC C;  2W27 A;  2Z5H A;  3HE5 B;  3HE5 A;  1KQF B;  3I5C A;  2FXO A;  3KQG A;  2KS1 B;  5E79 E;  1L4A A;  5AVQ B;  1JMM A;  2OYI A;  3H1J J;  3CCR P;  1N7S A;  5AVX B;  4TT3 H;  4PV1 D;  3RK2 C;  4IFD K;  1J1D B;  1HBW A;  1VQP P;  1JY2 P;  1EZV I;  3L75 E;  2KLU A;  3PHL A;  4KT0 J;  4A7P A;  1NU1 D;  1K05 A;  2KSJ A;  3MUD A;  1NHL A;  1N8R Q;  3SFD C;  2IBZ I;  1VQO P;  1LP1 B;  2K3R A;  3CPW O;  2N1T A;  3AE6 C;  4HH2 A;  2RMZ A;  3B5N A;  3L74 E;  3V4W A;  4B86 A;  5AVU B;  5KAF H;  1NWQ A;  2FYU D;  1LTI C;  2M5A A;  4WY4 C;  3B5N C;  3CLQ A;  2D2C D;  1Q86 Q;  1BGY G;  2K1A A;  2ZXE B;  1NTK K;  2LR2 A;  1SS1 A;  3H1L J;  4IL6 H;  4MN4 C;  2KXP B;  1S3J A;  2XND H;  1NAY A;  3V2N A;  3TF5 A;  3PRJ A;  4PD4 E;  5AVS B;  2Y9Y A;  1G2C B;  1N86 A;  2J58 A;  4KJM A;  1OZH A;  2JO1 A;  4GIF A;  2QA4 P;  1VDF A;  1KQG B;  2E74 C;  2R32 A;  3IF4 A;  2PP6 A;  4WB4 A;  4EYY Q;  3IAO A;  1M57 D;  1YIT P;  5KAI E;  3QH9 A;  1X8Y A;  2GA1 A;  5APX A;  5AW9 B;  1S72 P;  4GOD A;  3L72 J;  3L70 D;  2WMM A;  1Y8A A;  1RHZ B;  4OVN F;  4H0L C;  2ZT9 C;  4PD4 I;  5H2F E;  5BVZ A;  2M5A B;  1K8A Q;  1Y47 A;  4ASW A;  1IO4 A;  1LWU C;  3SWF A;  4M3L A;  1K9M Q;  2KLV A;  1SQX D;  2WVR A;  3TGU J;  2KSE A;  1IK7 A;  3VMX A;  3A7O A;  3FWN A;  2E75 D;  1ZRT E;  1L0N K;  2YKP A;  3A2A A;  3C9I A;  3H1I J;  4IL6 X;  3CCQ P;  5B5E E;  3CXH H;  1S5L E;  2LXC B;  1LTG C;  2M3E A;  4WBA A;  1SVF A;  2KYV A;  1P84 I;  1LTJ B;  2SPZ A;  3E1I A;  1YQ4 C;  2IYO A;  2GUS A;  4HYT B;  3AEA C;  1M1J A;  3GHG B;  3GF3 A;  3L4F A;  3AE2 C;  3L70 E;  4K3A A;  4U3F J;  4ZKP A;  4GT1 A;  1M1J C;  1NTM D;  1SQQ G;  2KS1 A;  2O01 H;  3KXD A;  2OAR A;  1NOH A;  2HPC A;  1CW5 A;  1E79 H;  3HRN A;  3RL0 C;  1L0N J;  1LT1 A;  1HJ0 A;  3L36 A;  5CMZ A;  4NPE A;  2OTJ P;  1G1I A;  1FAV A;  1Z56 A;  2O1K A;  1KB9 D;  2Y0C A;  2YXQ B;  2YMK A;  1FBM A;  4JBZ A;  1LGH B;  1SQB G;  3KPE A;  3L73 E;  3V2P A;  2AEM A;  2YIU C;  2KK7 A;  3R4Y A;  5GTI H;  2KP8 A;  1RF1 B;  3H1I D;  5EFW B;  5APQ A;  3RL0 D;  1CI6 B;  1QL1 A;  1U7J A;  2P2U A;  2P7J A;  3CWB E;  2WSF J;  5KLV G;  1PV3 A;  1YQ3 C;  1JCC A;  1FJK A;  1JOC A;  5BU8 B;  5KLV E;  1T2K C;  1X0T A;  1URQ B;  4Y99 B;  1NTM E;  2KIK A;  1L0N D;  4LLH A;  2OYH C;  3HD7 B;  1N7S D;  1KD1 Q;  2FYU J;  1L0L G;  2HFE D;  2H43 A;  1GDT A;  3WU2 H;  4D6T E;  5BU5 A;  2ZYA A;  3HD7 A;  4C7R A;  1IFJ A;  2JKV A;  3M9B A;  2W6A A;  3FGA D;  1ZR2 A;  1T2K D;  1GZL A;  1OIP A;  3HUS B;  1CSB A;  1KZU B;  1ZN5 A;  1RQV A;  1RQU A;  2ZYD A;  2I1J A;  3B8E B;  1UIX A;  1OMI A;  3O6Q B;  5APV A;  1VF5 C;  1MKM A;  1XTG B;  3B5N D;  1RH5 B;  1S4X A;  3MD0 A;  1BE3 D;  3L72 D;  2FXP A;  1KB9 I;  1SQP D;  1NTZ E;  1OW7 A;  2Q6Q A;  3BCC D;  4Z1M H;  3MZW B;  2QJY C;  3Q2Y A;  3W68 A;  1SQX G;  3WUV A;  2FFD C;  2HG5 D;  4OGQ C;  1L0L J;  2IDB A;  5AVZ B;  1H8A A;  4IOI H;  2KZI A;  5L8R J;  3G4S P;  1WRG A;  1KIL D;  1LTB C;  2BCC E;  3MHV A;  1H89 A;  1FU1 A;  1GU4 A;  3EWK A;  3F5H A;  2WSE J;  1JNM A;  1GL2 C;  3WU2 E;  5E79 H;  2WSE H;  2K9J A;  2IFN A;  1AQT A;  2IPP A;  3AEC C;  3NFQ A;  4EI2 A;  1Q82 Q;  1L4A C;  3CX5 I;  2R3S A;  1KYO D;  2D2C B;  2Q1K A;  2IBZ E;  1VL2 A;  1N7S C;  1NTM G;  1SQQ D;  2A06 E;  2WSS H;  1P84 E;  3BCC J;  1NYH A;  1J1E C;  4R4L A;  3L74 D;  2E43 A;  2H88 C;  1NU1 K;  1BE3 J;  1KIL B;  2NPS C;  5CJ4 A;  3CCL P;  1AQ5 A;  2L5G B;  4I7Z C;  1FC2 C;  4NPD A;  3M91 A;  4U3F D;  5APW A;  1L4A D;  1PGP A;  2AEJ A;  3RBX A;  3Q3D A;  1GK4 A;  1SLQ A;  3H1K G;  1SFC B;  3CCS P;  1KV4 A;  3PTZ A;  1YJN P;  2C0W A;  4YXW H;  2R5B A;  1QGK B;  2H89 C; 
#chains in the Genus database with same CATH homology
 2LR2 A;  1SS1 A;  5DJT B;  4MN4 C;  1S3J A;  2QVA A;  4KJM A;  1ZW0 A;  1Q2N A;  3QWO C;  4EYY Q;  1JM0 A;  4GOD A;  4HB1 A;  2WMM A;  3RGU A;  1OVU A;  2M5A B;  1EC5 A;  1Y47 A;  1EDJ A;  4ASW A;  4GOF A;  3ZDM A;  5K5G B;  5CBO A;  1BDC A;  2ZAE B;  2LXC B;  2P58 A;  2SPZ A;  4K3A A;  4BXL A;  1EDK A;  1LT1 A;  1BDD A;  1U7M A;  4NPE A;  4JBZ A;  2B87 B;  5CBN A;  2HR3 A;  2M0B A;  4WWI A;  3PH0 A;  4NPF X;  5EFW B;  1JMB A;  1U7J A;  2LXB A;  5DJU B;  1EDI A;  4ZMD A;  1X0T A;  2JWD A;  2KIK A;  1H0T B;  2B88 A;  2QRX A;  4CPG A;  4HKZ H;  4ZNC A;  2B89 A;  1H0T A;  5C39 A;  2KI7 B;  1ZXG A;  3S1K A;  2UWJ E;  2OTK E;  2R44 A;  3MZW B;  1EDL A;  1LP1 A;  2KUB A;  2B87 A;  4IOI H;  2KZI A;  4HJG H;  3MHV A;  3FXE A;  4K35 A;  1MFT A;  2RKL A;  4GOE A;  1NVO A;  2KS1 B;  2Q1K A;  4ASV A;  1OVV A;  1OVR A;  2I8D A;  4NPD A;  1FC2 C;  3FXD A;  1LP1 B;  2K3R A;  2KZJ A;  1DEE G;  2M5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...