1FJPA

Nmr solution structure of phospholamban (c41f)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
52
structure length
52
Chain Sequence
MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILIFLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords CARDIAC PHOSPHOLAMBAN
publication title NMR Solution Structure of Phospholamban
pubmed rcsb
total genus 14
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fjpA00
2HYNA 1ZLLA 2KYVA 1FJKA 2KB7P 2M3BA 1FJPA 1N7LA
chains in the Genus database with same CATH superfamily
3L71E 1PGQA 5AVZB 3L70D 4H0LD 4C46A 3IFMA 3MUDC 2FXPA 1PPJD 3L36A 5BU8B 2B87B 1QL2A 3M91A 3H1JJ 1YTZT 4ZKPA 1VPCA 4TLFA 3L72J 5CCGD 3CXHD 3G6EP 2Q5UA 4GKGA 3U59A 4QMAA 1G2CB 2FYZA 5AVUB 2A06D 1NU1D 3I56P 4H0LC 4PV1D 1J1DC 1Q2NA 3EFFK 5AW6B 3L35A 2Y9YA 2FYUJ 1YYCA 3VMAA 4YXDC 2WQYC 3H25A 1BE3E 5CCGC 3RK3B 2J59M 1NTZJ 4IOIH 1M7LA 2P67A 1URQA 4IL6H 4HB1A 3L70E 3MIWA 3EQ2A 3WUTA 5APYA 1PPJE 2MKVA 1S3JA 3E7KA 3WU2H 4H13B 1NTKJ 4PV1C 3MHVA 3B5NA 5BU5A 3CCEP 3P7KA 3FGAD 2KSJA 3VOPA 3CXHE 2KOGA 4N78D 2QJPC 4UB8E 2FBWC 4EOTA 1E5WA 2A06E 1NU1E 1JY3N 5CBNA 3CPWO 1GW3A 2N1TA 2WPSA 3T97A 1L0LJ 1SQQJ 1KB9H 2W90A 3V2RA 2QJYB 1IC2A 3H32A 3MUDA 1HGVA 1VQNP 2ZYGA 4OGQD 4W7ZA 2A45G 1HVVA 4H44B 1CI6B 5H2FE 1FAVA 3L73J 3L75J 4KJMA 1S5LE 3PLNA 3AEDC 3NMDA 2P10A 4D6TJ 3L71G 1VQ7P 2E5TA 3CWBD 4GDOA 3CX5I 4OGQC 1PV3A 2G3AA 5AVXB 4RJTA 1ZW0A 3LW5J 5CCGA 1JNMA 1JMMA 1LTGC 2HODB 2XDJA 1M1JB 3MTUE 5M1BA 2Y0DA 2QJKB 3EFGA 2PRRA 1R5SA 4A7PA 2LKMA 1AVYA 3R2PA 1GDTA 1A02F 4IFMA 5KLVJ 4L73A 4K3AA 4XE5B 1GU4A 3G3ZA 3A7OA 1VL2A 2RMZA 4Y99B 3CWBE 1FBMA 3CCRP 3L70G 1PPJG 1SQPK 5L8RJ 1WRGA 5APXA 3L71J 1OVRA 5B5EH 3RK3D 2O01J 4TT3H 1AFOA 2QG4A 1OFCX 3M0DA 1FZFA 4H13D 3R4YA 3QH9A 2WSFJ 1NU1G 4NPEA 2QM8A 1SS1A 5EFWB 3BATA 1SQBK 3RK3C 1S1CX 1L0NK 5GTHH 1S9KD 5DJTB 2XZRA 1AQ5A 4EIJA 1SLQA 4H13C 3V2PA 2W6BA 2J58A 1BCCD 1RH5B 1BE3J 2KK7A 3KYQA 2OGUA 3L70J 2V4HA 1ZP0C 2E42A 2V7QJ 3CX5D 2IYPA 2K9YA 1OW7A 2XU6A 2CPBA 1URQB 4H44D 2PP6A 2H89C 1J2JB 1FDOA 3BCCD 2NRGA 4JYCA 1LWUB 1EC5A 4JYBA 2GM4A 5CCHA 3TDKA 3RL0B 3B5NB 5CJ0A 1ZOYC 1NU1J 5AVSB 2QJYC 3KPEA 1S9KE 3H1HD 2K37A 4R4MA 4Z1MH 2B87A 1KYOH 1YTZI 3AE5C 1DD4A 2WPRA 1LP1B 4JF7A 4H44C 4W80A 2A45I 3GG2A 2ZAEB 3CCUP 1LNQA 3G9RA 2H7HA 2I1JA 2C9LY 2FKWB 1RE4A 1G2CA 1QX8A 1CSBA 3H32B 2KP8A 3FWNA 3AE4C 3A0HE 3CWBG 3H1IJ 5APUA 3BCCE 1MFTA 1RE3A 3CC7P 2R3CA 2P2UA 2KB7P 3KDPB 3V4QA 3ZDMA 3F5HA 3NFQA 1M1JC 1YBKA 3OJAB 2QJKC 2IDBA 1FJKA 2FY8A 1AV1A 3SFDC 2W8ZA 4HYTB 3HTKB 1IO4A 1SQPD 4EDFA 1EDLA 3N4XA 3VP9A 2WSCH 1MFZA 1YQ4C 1AJYA 5AW5B 1M57D 2K3RA 3AE7C 2YMYA 4PD4H 3VP8A 3JC22 2SPZA 2IBZI 1ZRTE 2KZJA 3A2AA 4Y99C 2YKPA 3CCQP 1R5LA 2NPSB 1Q7YQ 1G1JA 3USSA 3CI9A 5AVTB 3G4SP 1SQBD 4NPFX 1QGKB 1L0ND 2Q6QA 5GTIE 1CI6A 2R5BA 1SQPE 2E74B 3FXEA 1HTLC 3RK2B 2KZIA 3NTNA 3E1RA 1URQD 2Y0CA 4PJ0H 5KAIE 1PP9J 1CZQA 1HJ0A 1HGZA 4I6MC 4ASVA 3RL0D 3B5ND 2WITA 1BCCG 2HODA 1M1JA 4ZKUA 2O1JA 1SQVD 2KLVA 4I1LA 1URQC 1EZVI 2N1TD 2YNYA 3SWFA 1LWUC 3CD6P 1IFJA 3Q5PA 3RL0C 2ZJSE 3B5NC 2O01H 2YIUB 3M9QA 4N6JA 1FC2C 3AE8C 1LTSC 1MUUA 1JO5A 3B8EB 1LTJA 1NAYA 1P84H 3H1HG 1KB9I 1LJ2A 4YPCA 3IR9A 3AEFC 5CJ4A 2IBZD 1W2BO 4KHXA 1XTGB 1T8ZA 2CK3H 1HUCA 3SFEC 3E1IA 3V5BA 1SQVE 3VMYA 5E79H 4DOJA 1JTHA 2AEMA 2D2CB 1Q81Q 2QIWA 1IFIA 2YXRB 3F89A 4WWIA 3CCMP 1M8OB 1VQ5P 1RF0C 2IX7C 3I5CA 1VQMP 4RESB 4RO0A 2V7QH 2KYVA 1K04A 3A0BE 3BCCJ 2ZT9B 2NPSD 1JY2N 3H1LD 2Q7CA 1SQPG 1MV8A 2IBZE 3O8ZA 2AEFA 3JCUE 2JEEA 1HH0A 2JWAA 3L4FA 1KQLA 3KQGA 1RHZB 2ZVNB 1BGYD 2E74D 2O1KA 2WSSH 3CLQA 2KSEA 3RK2D 1SQXK 2NPSC 1LWUA 3D71A 2L91A 5K5GB 1TU3F 5KLIB 1SQBG 2M0BA 2IFMA 1RQUA 2ITAA 2J5UA 3BASA 3H6PA 1X79B 4ASWA 2FFDB 1L0NG 1EZVD 1NWQA 2M3EA 2O3JA 1LP1A 3S4RA 2IZ0A 1QEXA 2E74C 3RK2C 3KZIH 4UB6H 3CCSP 2LXCB 1X0TA 1PIXA 4O9BA 3HD7B 1KB9D 3PHLA 3HUSA 3BRTB 1DD3A 1VF5B 1EXJA 2ZXXA 1NTMK 2WVRA 4WVZA 2POHA 1BGYE 5APVA 3M0DC 4IL6E 1Z56A 1G1IA 1RF0A 1YIJP 3WU2E 3S9OA 3A3YB 2R5DA 1WMKA 4N78E 4NPDA 4WB4A 3HTKA 1YJNP 5KTBA 1SQVG 3AEAC 3SWYA 2HR3A 1OXZA 5AW0B 3Q5SA 3AECC 5CCHD 1W2EA 3FWLA 2P7JA 2YIUC 1KB9E 4HJGH 2FYUK 1NOHA 1FU1A 2D2CD 5AW8B 2E76B 2Z5IA 2W27A 1YQ3C 1NTZK 1KN7A 2NPSA 1X22A 1DIPA 2IYOA 2QRXA 3OAKA 1KQGB 1NTKK 1KILB 2IBZG 1SFCA 4L74A 5CCHC 1KYOI 2JR8A 1N86A 1S5LX 2M3BA 2ZT9D 1LTIC 4L76A 2ZXEB 1MZ9A 2FYNB 4AYCA 3I55P 2D2CC 1LTJB 4KT0J 3GW6A 1BDDA 3UIAA 2YKOA 3CCLP 2ZVOB 3W67A 1SQVJ 1YI2P 1L0LK 1SQQK 1KQFB 2R44A 1RE4C 2XV5A 3HE5B 3O6QB 2ZT9C 1DH3A 2W6JH 3MD0A 3GLMA 1JTHB 3H1LG 3HE4B 1S4XA 3CC2P 1RE3C 1GD2E 3V2QA 1VQLP 3SSUA 1K9MQ 3VN0A 1RF1A 2WMMA 1BGYG 3CMAP 3C1LA 3Q5RA 4WY4A 1SP4A 3AE6C 4PD4I 5AW7B 1GW4A 2HFED 3HD7D 5KLIC 1RQVA 1GK4A 1JM0A 1OZHA 2GUSA 3RK3E 5AW1B 5AW9B 1VF5D 5B5EE 3C8VA 1YHQP 3RBZA 2FFDC 3D6ZA 3RL0g 1EZVG 1Y9BA 4WBAA 1FOSE 3M0AA 4I7ZB 2BEZF 2RH0A 3B4SA 1PGOA 3PP5A 5AVQB 3TNUA 3H1JD 3HD7C 1JCCA 1Q86Q 1QVGO 3CCVP 2ZFCA 2W6AA 2ZYAA 3L72D 5KLVK 1HJBA 2YO2A 1VF5C 2Y0EA 3BRVB 2AXTH 5BVZA 3AE2C 1BSNA 3OW2O 5GTHE 5KJ7D 3AEGC 1FDMA 2L5GB 1AA0A 1BCCE 1A02J 1KYOD 2VRSA 1USEA 2N9YB 1N8RQ 1BGYJ 2C9NY 4ZMDA 2FYUD 2BCCG 3CX5E 2E76D 3HUSB 2R3SA 2K88A 1H8AA 1U57A 4CPGA 1NTZD 2XNDH 2KS1B 5KJ7C 4JBZA 1KILD 2OYHB 1NTKD 3H1JE 3WUVA 1JOCA 3VYIA 3AE1C 3FX0A 3PRJA 1FOSF 3H1KG 2JJLA 2WSEJ 2Z5HA 3H1HE 1GL2A 2RN0A 1OX3A 3MP7B 2LR2A 2E76C 5DJUB 3W68A 1VQ6P 1RY3A 1X8YA 2E43A 1OWAA 2Z4EA 1KYOE 1NH4A 2WZ7A 3VMZA 4OH8B 2E75B 1P84I 3M9BA 1KILC 1JUNA 1SQQD 2FYUE 2FFDA 5KAFH 4PD4D 1NTZE 2FYNC 1LTJC 2IZ1A 2QE7H 2OARA 1JY2O 3P8MC 3B71A 2JWDA 4JQ0D 5APSA 1KILE 3HD7A 1NTKE 5TISE 2Q3EA 2WPVB 3L73D 3CWBJ 3L75D 1SFCB 1QLED 1U7MA 1NU1K 4K35A 5B66H 3PTZA 3U1AA 4D6TD 5AVWB 1NO4A 4XFJA 1VQ9P 3N7NA 2BEQD 1E79H 1T6AA 3LW5H 1SQQE 2I8DA 3ITKA 1KZUB 4PD4E 1GZLA 1H89A 2WT7A 1K73Q 1JY3O 4IFDK 5KJ7A 2YMKA 4OWFA 1T3JA 3IAOA 5AVRB 1FZCA 1SQBE 2P58A 4N3YB 1N7SA 1FZBA 2FXMA 5KLVD 3L75E 1L0NE 3IF4A 4D6TE 4I7ZC 1KD1Q 1RF1B 1EDJA 4GT1A 1KILA 1PFIA 4WY4B 3GF7A 2KXPB 3G71P 4GODA 2QA4P 3H1JG 1J1EB 1ZV8A 3L72G 2DW3A 2Q1KA 1YITP 1UIIA 1P84D 2WSFH 3P32A 1OVUA 4PJ0E 1VQOP 2JP3A 3A0BH 4W7YA 2JO1A 3TNUB 1KORA 5KLVE 1LTTC 1HF9A 1IJDB 3HE5A 2FYUG 2K9JB 3O6QA 1OMIA 3HUSC 3TGUD 5AVVB 1BCCJ 1NTZG 4BRYA 1LT9B 1NKZB 1Q90D 3II6A 1X9VA 3HE4A 1VDFA 2E75D 2KI7B 2OYHC 2QEXP 1NTKG 1FJPA 1Q82Q 2JKVA 3Q2YA 2HYNA 4IFFA 5APTA 2H43A 3D70A 4U3FD 1AVOA 1FZEA 1P84E 3CXHH 1KFNA 4C7NB 1NVOA 1U7JA 1N2DC 3LIEA 3Q3DA 2K1AA 4UB8H 2E75C 3H1HJ 3MZWB 1K05A 1XTCC 1SFCD 1L0LG 2OYIA 1T2KD 1SQQG 1M56D 2HPCA 1NYHA 3TGUE 4B86A 1GL2B 2YXQB 5E79E 2CPSA 2KLUA 3RBXA 3S1KA 1DEBA 1HWTC 2P1JA 1VQPP 4YXWH 2UWJE 3L73G 5CBOA 2PFXA 1SFCC 3L75G 2ZYDA 1UIXA 1T2KC 5KKZB 2B9BA 4U3FE 5H2FH 5AW2B 4D6TG 3H1LE 4YTPC 3VMXA 1H88A 1L4AB 1N73A 1S5LH 3H1ID 3V2NA 2WWWA 1JMBA 1BSHA 3FXDA 2WSEH 1IFPA 1SQPJ 1ZN5A 5C39A 4DZOA 2G8YA 1M1KQ 3BVHA 2XNXA 1R8EA 2KS1A 2FXOA 2WTYA 1KFMA 2WSCJ 2QSIA 4WY4D 2OYHA 3GF3A 3L74D 1JCDA 2H8PD 2C0WA 4GOEA 3IN6A 2BCCD 5KLVG 3AEEC 3WMM0 1EZVE 1QL1A 1T3UA 1SQBJ 1BDCA 1RF1C 3ABVC 2WT7B 3H1IE 2IFNA 2M5AA 4WY4C 1L0NJ 4I2LC 3KZIE 1FZCB 1OW6A 3AE9C 4UB6E 3H1KD 1J1EC 4AUWA 1N7SB 2JDIH 2OTJP 2WPQA 4IL6X 2R32A 3L74E 3P8CD 3CL3D 4L75A 2Q3IA 4HKZH 4OVNF 1GMJA 2BCCE 3AE3C 2KNCA 1YJWP 1SVFA 1DX7A 3V6IA 5AW3B 4GOFA 2KIKA 3TGUG 2QM7A 1OVVA 1KTMA 3NXSA 1KQSO 1LT9C 4EI2A 4RKUJ 1PP9D 3D6YA 3C9IA 1BE3G 3H1KE 1H0TA 4LC1A 5CMZA 1K8AQ 1JY2P 1GL2D 3TSIA 1FE6A 3U1CA 1GK6A 4U3FG 3V4WA 1SQXD 4BRYB 3P8CE 3M06A 4MN4C 2M8RA 2B89A 3GHGB 3TYYA 3KXDA 1FZAA 1D7MA 2A06G 2W83C 1GL2C 1L4AD 2PGDA 1PP9E 2KUBA 1ZR4A 4LLHA 3TGUJ 2XKMA 4EYYQ 1JY3P 2YO3A 1IFNA 3L37A 2OYIB 5KKZC 1NTMD 1NAFA 2HPCB 3K5BA 4DT0A 1IK9A 2OTKE 1IFMA 4XA4A 1SQXE 4ZNCA 1LTBC 1L4AC 3CX5H 1FDIA 3H1IG 4U3FJ 2K9JA 4JPZB 1LTAC 2QVAA 3A0HH 1KV4A 3EWKA 3H1LJ 1GU5A 1LT9A 4AQRD 2NZ2A 2AEJA 3L74G 1N73B 1N7SD 1JEKA 1SQVK 1VQKP 1NTME 1JB0J 4C7NA 2PAJA 2Y9ZA 2N1TB 3HRNA 3T97B 3Q1MA 1OW8A 3CMEP 1Y8AA 1FZCC 2BASA 3VTPC 1ZRTD 3L72E 1N7SC 2GA1A 1FS0E 5TISH 2AXTE 1USDA 1VQ4P 1PGJA 2AXCA 5AVYB 1LGHB 3JSVC 2M5AB 3LIDA 1L0LD 2H88C 5GTIH 1NKNA 4C7RA 1YJ9P 3OA7A 3L74J 3TF5A 1W5CE 4H0LB 1J1DB 5APWA 1L4AA 3M9HA 1WT6A 2BCCJ 1AQTA 1PP9G 1S2EA 2MJZA 1Y47A 1IFDA 5TJHA 4DJGA 1MKMA 3PJSK 5KAIH 1PZQA 1N7LA 2KNCB 3MGNA 3QWOC 2OTLP 2IPPA 3CC4P 1KC8Q 1PGPA 4PV1B 4BXLA 3H1KJ 2I1KA 5AW4B 1SQXG 1S72P 4Y28J 2Q9IA 2GUVA 2QJPB 3GHGC 1L0LE 2N9BA 3SWKA 3CXHI 2C0XA 1NGMB 5APQA 1H0TB 4M3LA 3WUUA 2B88A 1VQ8P 4LGDE 1NHLA 3CCJP 1EQ7A 5KAFE 4BWNA 2A45H 3L73E 2RKLA 1EXIA 2OYIC 3PH0A 2O01N 5CHXA 1NTMG 1HBWA 5B66E 1FZGA 2OYOA 4DCKA 1GTWA 2HG5D 1IZNB 1OIPA 1EDKA 3L71D 1QVFO 2OQQA 1SQXJ 4OGQB 1LT1A 1CW5A 3BCCG 2HLOA 3GMAA 2E5YA 1DEEG 3AEBC 4R4LA 1EDIA 1IK7A 1N73C 3A5TA 3RGUA 1M90Q 4U7JA 1ZXGA 2LXBA 1PL5A 1ZR2A 1KMIZ 3JCUH 4GIFA 3KHUA 2N1TC 2YKQA 1NJIQ 1L2PA 3TK1A 3GHGA 1ZLLA 1ZMEC 1NTMJ 1BE3D 4HH2A
chains in the Genus database with same CATH topology
1RF1C 2NPSB 1G1JA 2WT7B 3CI9A 5AVTB 2FFDC 5AVZB 2IFNA 4C46A 3IFMA 4WY4C 4I2LC 4WBAA 1FOSE 3M0AA 3L36A 1FZCB 5BU8B 3M91A 1QL2A 1YTZT 1J1EC 4AUWA 1N7SB 4ZKPA 3PP5A 1VPCA 5AVQB 3TNUA 5CCGD 3HD7C 1JCCA 1CI6A 2Q5UA 2R5BA 2WPQA 4GKGA 2ZFCA 2W6AA 3U59A 5KLVK 2R32A 1HJBA 2YO2A 1HTLC 3RK2B 3P8CD 1G2CB 2FYZA 3BRVB 3CL3D 5BVZA 5AVUB 2Q3IA 3NTNA 5KJ7D 1J1DC 1FDMA 2L5GB 1SVFA 5AW6B 3L35A 1A02J 1DX7A 1URQD 2VRSA 5AW3B 1YYCA 2QM7A 1CZQA 5CCGC 3NXSA 3RK3B 2C9NY 1HGZA 2J59M 1LT9C 1M7LA 2P67A 4I6MC 1URQA 3RL0D 3B5ND 2WITA 3HUSB 3MIWA 3C9IA 3EQ2A 5APYA 2HODA 1H8AA 1M1JA 5AW9B 4LC1A 5CMZA 1JY2P 3B5NA 5BU5A 3P7KA 4ZKUA 5KJ7C 2O1JA 1KILD 2OYHB 2KLVA 1GL2D 2KSJA 3VOPA 1JOCA 3TSIA 2KOGA 4I1LA 1URQC 3VYIA 3U1CA 1GK6A 4N78D 1FOSF 3V4WA 2N1TD 2JJLA 2Z5HA 3P8CE 2YNYA 1GL2A 3SWFA 1LWUC 1IFJA 3M06A 4EOTA 3RL0C 1E5WA 3B5NC 2M8RA 1JY3N 2O01H 3GHGB 1RY3A 3M9QA 1X8YA 4N6JA 2E43A 1OWAA 3TYYA 1GW3A 2N1TA 2WPSA 3T97A 2Z4EA 1LTSC 1NH4A 2WZ7A 1MUUA 1JO5A 3B8EB 1FZAA 1LTJA 3VMZA 4OH8B 3M9BA 1KILC 1JUNA 1GL2C 1L4AD 3V2RA 2FFDA 1IC2A 3H32A 3MUDA 3IR9A 1HGVA 5CJ4A 1ZR4A 4W7ZA 4LLHA 2A45G 1HVVA 4KHXA 1XTGB 1T8ZA 2XKMA 1LTJC 1CI6B 1HUCA 2OARA 1JY2O 3P8MC 1JY3P 1FAVA 1IFNA 2YO3A 3L37A 5APSA 3E1IA 3V5BA 4DOJA 3VMYA 3HD7A 2OYIB 1JTHA 1NAFA 2HPCB 1IFIA 1IK9A 1IFMA 4XA4A 3NMDA 1SFCB 1LTBC 1L4AC 1RF0C 2IX7C 3I5CA 4RESB 1NU1K 3U1AA 5AVWB 2KYVA 1LTAC 5AVXB 1NO4A 3N7NA 1GU5A 5CCGA 3LW5H 1JNMA 1JMMA 1LT9A 1LTGC 2HODB 2NPSD 2XDJA 1JY2N 4AQRD 1M1JB 2Q7CA 3MTUE 3EFGA 1MV8A 1KZUB 2LKMA 3O8ZA 1GZLA 3R2PA 1N73B 1H89A 2WT7A 2JEEA 1JY3O 1N7SD 4IFDK 1HH0A 5KJ7A 1GDTA 1A02F 3L4FA 4IFMA 1SQVK 1T3JA 1KQLA 5AVRB 3KQGA 1FZCA 2O1KA 3CLQA 4N3YB 1N7SA 1FZBA 3RK2D 4C7NA 2FXMA 2PAJA 4XE5B 1SQXK 1GU4A 2NPSC 1LWUA 3G3ZA 3A7OA 2N1TB 3HRNA 4Y99B 1FBMA 2IFMA 1FZCC 1RF1B 2BASA 1SQPK 3VTPC 3BASA 3H6PA 1X79B 1WRGA 1N7SC 5APXA 2FFDB 4GT1A 1KILA 1PFIA 4WY4B 1NWQA 3RK3D 1J1EB 1AFOA 1ZV8A 3M0DA 3RK2C 5AVYB 1FZFA 4O9BA 3HD7B 1LGHB 3LIDA 3HUSA 2QM8A 2WSFH 3P32A 3BRTB 1NKNA 3BATA 1SQBK 1NTMK 4C7RA 3OA7A 2POHA 5APVA 4W7YA 3M0DC 3TNUB 1J1DB 1Z56A 1LTTC 1G1IA 3RK3C 5APWA 1L4AA 1RF0A 1IJDB 1L0NK 3HE5A 3M9HA 1S9KD 1WT6A 3HUSC 5AVVB 3A3YB 2R5DA 2XZRA 2MJZA 1AQ5A 1IFDA 4EIJA 1SLQA 1LT9B 1NKZB 3V2PA 2W6BA 4N78E 2J58A 3II6A 1X9VA 3HE4A 1VDFA 1N7LA 4WB4A 3HTKA 3MGNA 2OYHC 3KYQA 5KTBA 2IPPA 1FJPA 2E42A 3SWYA 2HYNA 2I1KA 1OXZA 4IFFA 5APTA 5AW0B 2XU6A 5AW4B 2H43A 2CPBA 5CCHD 1W2EA 2Q9IA 1URQB 2GUVA 2P7JA 2PP6A 1FZEA 1J2JB 3GHGC 2N9BA 1KFNA 2FYUK 4C7NB 1NOHA 4JYCA 2C0XA 5APQA 1LWUB 1FU1A 4JYBA 1N2DC 3LIEA 4M3LA 5CCHA 2GM4A 3RL0B 3B5NB 5AW8B 2Z5IA 2W27A 1NHLA 1NTZK 4LGDE 5CJ0A 1EQ7A 2NPSA 1XTCC 1SFCD 5AVSB 2OYIA 1T2KD 3KPEA 1S9KE 3OAKA 2HPCA 1NTKK 1KILB 4B86A 1GL2B 1YTZI 1SFCA 2WPRA 4JF7A 5CCHC 2A45H 4W80A 2CPSA 1N86A 2A45I 2M3BA 1LTIC 2ZXEB 1DEBA 1MZ9A 1HWTC 2OYIC 4AYCA 2H7HA 2P1JA 5CHXA 1LTJB 2I1JA 2C9LY 2FKWB 1RE4A 1HBWA 3UIAA 1G2CA 2YKOA 1FZGA 1SFCC 1GTWA 1CSBA 2HG5D 1T2KC 3H32B 2KP8A 1L0LK 5APUA 5AW2B 1SQQK 1RE3A 3VMXA 1H88A 1L4AB 1N73A 1RE4C 2XV5A 2R3CA 3HE5B 2P2UA 2KB7P 3KDPB 3V4QA 1DH3A 3V2NA 3MD0A 2WWWA 1CW5A 3NFQA 1JTHB 1M1JC 2HLOA 3OJAB 2WSEH 1ZN5A 3HE4B 4DZOA 1FJKA 1RE3C 3BVHA 4HYTB 3HTKB 1IO4A 1GD2E 3V2QA 1N73C 2XNXA 3A5TA 2WTYA 1KFMA 4WY4D 3N4XA 2OYHA 3VP9A 2WSCH 1MFZA 1JCDA 3VN0A 1RF1A 2H8PD 2C0WA 5AW5B 2YMYA 3VP8A 4WY4A 1SP4A 1ZR2A 5AW7B 4GIFA 1GW4A 2HFED 3HD7D 2N1TC 2YKQA 3WMM0 3A2AA 3TK1A 3GHGA 4Y99C 1ZLLA 1QL1A 2YKPA 1T3UA 1GK4A 2GUSA 5AW1B 4HH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYN A;  1ZLL A;  2KYV A;  1FJK A;  2KB7 P;  2M3B A;  1FJP A;  1N7L A; 
#chains in the Genus database with same CATH topology
 3L71 E;  1PGQ A;  5AVZ B;  3L70 D;  4H0L D;  4C46 A;  3IFM A;  3MUD C;  2FXP A;  1PPJ D;  3L36 A;  5BU8 B;  2B87 B;  1QL2 A;  3M91 A;  3H1J J;  1YTZ T;  4ZKP A;  1VPC A;  4TLF A;  3L72 J;  5CCG D;  3CXH D;  3G6E P;  2Q5U A;  4GKG A;  3U59 A;  4QMA A;  1G2C B;  2FYZ A;  5AVU B;  2A06 D;  1NU1 D;  3I56 P;  4H0L C;  4PV1 D;  1J1D C;  1Q2N A;  3EFF K;  5AW6 B;  3L35 A;  2Y9Y A;  2FYU J;  1YYC A;  3VMA A;  4YXD C;  2WQY C;  3H25 A;  1BE3 E;  5CCG C;  3RK3 B;  2J59 M;  1NTZ J;  4IOI H;  1M7L A;  2P67 A;  1URQ A;  4IL6 H;  4HB1 A;  3L70 E;  3MIW A;  3EQ2 A;  3WUT A;  5APY A;  1PPJ E;  2MKV A;  1S3J A;  3E7K A;  3WU2 H;  4H13 B;  1NTK J;  4PV1 C;  3MHV A;  3B5N A;  5BU5 A;  3CCE P;  3P7K A;  3FGA D;  2KSJ A;  3VOP A;  3CXH E;  2KOG A;  4N78 D;  2QJP C;  4UB8 E;  2FBW C;  4EOT A;  1E5W A;  2A06 E;  1NU1 E;  1JY3 N;  5CBN A;  3CPW O;  1GW3 A;  2N1T A;  2WPS A;  3T97 A;  1L0L J;  1SQQ J;  1KB9 H;  2W90 A;  3V2R A;  2QJY B;  1IC2 A;  3H32 A;  3MUD A;  1HGV A;  1VQN P;  2ZYG A;  4OGQ D;  4W7Z A;  2A45 G;  1HVV A;  4H44 B;  1CI6 B;  5H2F E;  1FAV A;  3L73 J;  3L75 J;  4KJM A;  1S5L E;  3PLN A;  3AED C;  3NMD A;  2P10 A;  4D6T J;  3L71 G;  1VQ7 P;  2E5T A;  3CWB D;  4GDO A;  3CX5 I;  4OGQ C;  1PV3 A;  2G3A A;  5AVX B;  4RJT A;  1ZW0 A;  3LW5 J;  5CCG A;  1JNM A;  1JMM A;  1LTG C;  2HOD B;  2XDJ A;  1M1J B;  3MTU E;  5M1B A;  2Y0D A;  2QJK B;  3EFG A;  2PRR A;  1R5S A;  4A7P A;  2LKM A;  1AVY A;  3R2P A;  1GDT A;  1A02 F;  4IFM A;  5KLV J;  4L73 A;  4K3A A;  4XE5 B;  1GU4 A;  3G3Z A;  3A7O A;  1VL2 A;  2RMZ A;  4Y99 B;  3CWB E;  1FBM A;  3CCR P;  3L70 G;  1PPJ G;  1SQP K;  5L8R J;  1WRG A;  5APX A;  3L71 J;  1OVR A;  5B5E H;  3RK3 D;  2O01 J;  4TT3 H;  1AFO A;  2QG4 A;  1OFC X;  3M0D A;  1FZF A;  4H13 D;  3R4Y A;  3QH9 A;  2WSF J;  1NU1 G;  4NPE A;  2QM8 A;  1SS1 A;  5EFW B;  3BAT A;  1SQB K;  3RK3 C;  1S1C X;  1L0N K;  5GTH H;  1S9K D;  5DJT B;  2XZR A;  1AQ5 A;  4EIJ A;  1SLQ A;  4H13 C;  3V2P A;  2W6B A;  2J58 A;  1BCC D;  1RH5 B;  1BE3 J;  2KK7 A;  3KYQ A;  2OGU A;  3L70 J;  2V4H A;  1ZP0 C;  2E42 A;  2V7Q J;  3CX5 D;  2IYP A;  2K9Y A;  1OW7 A;  2XU6 A;  2CPB A;  1URQ B;  4H44 D;  2PP6 A;  2H89 C;  1J2J B;  1FDO A;  3BCC D;  2NRG A;  4JYC A;  1LWU B;  1EC5 A;  4JYB A;  2GM4 A;  5CCH A;  3TDK A;  3RL0 B;  3B5N B;  5CJ0 A;  1ZOY C;  1NU1 J;  5AVS B;  2QJY C;  3KPE A;  1S9K E;  3H1H D;  2K37 A;  4R4M A;  4Z1M H;  2B87 A;  1KYO H;  1YTZ I;  3AE5 C;  1DD4 A;  2WPR A;  1LP1 B;  4JF7 A;  4H44 C;  4W80 A;  2A45 I;  3GG2 A;  2ZAE B;  3CCU P;  1LNQ A;  3G9R A;  2H7H A;  2I1J A;  2C9L Y;  2FKW B;  1RE4 A;  1G2C A;  1QX8 A;  1CSB A;  3H32 B;  2KP8 A;  3FWN A;  3AE4 C;  3A0H E;  3CWB G;  3H1I J;  5APU A;  3BCC E;  1MFT A;  1RE3 A;  3CC7 P;  2R3C A;  2P2U A;  2KB7 P;  3KDP B;  3V4Q A;  3ZDM A;  3F5H A;  3NFQ A;  1M1J C;  1YBK A;  3OJA B;  2QJK C;  2IDB A;  1FJK A;  2FY8 A;  1AV1 A;  3SFD C;  2W8Z A;  4HYT B;  3HTK B;  1IO4 A;  1SQP D;  4EDF A;  1EDL A;  3N4X A;  3VP9 A;  2WSC H;  1MFZ A;  1YQ4 C;  1AJY A;  5AW5 B;  1M57 D;  2K3R A;  3AE7 C;  2YMY A;  4PD4 H;  3VP8 A;  3JC2 2;  2SPZ A;  2IBZ I;  1ZRT E;  2KZJ A;  3A2A A;  4Y99 C;  2YKP A;  3CCQ P;  1R5L A;  2NPS B;  1Q7Y Q;  1G1J A;  3USS A;  3CI9 A;  5AVT B;  3G4S P;  1SQB D;  4NPF X;  1QGK B;  1L0N D;  2Q6Q A;  5GTI E;  1CI6 A;  2R5B A;  1SQP E;  2E74 B;  3FXE A;  1HTL C;  3RK2 B;  2KZI A;  3NTN A;  3E1R A;  1URQ D;  2Y0C A;  4PJ0 H;  5KAI E;  1PP9 J;  1CZQ A;  1HJ0 A;  1HGZ A;  4I6M C;  4ASV A;  3RL0 D;  3B5N D;  2WIT A;  1BCC G;  2HOD A;  1M1J A;  4ZKU A;  2O1J A;  1SQV D;  2KLV A;  4I1L A;  1URQ C;  1EZV I;  2N1T D;  2YNY A;  3SWF A;  1LWU C;  3CD6 P;  1IFJ A;  3Q5P A;  3RL0 C;  2ZJS E;  3B5N C;  2O01 H;  2YIU B;  3M9Q A;  4N6J A;  1FC2 C;  3AE8 C;  1LTS C;  1MUU A;  1JO5 A;  3B8E B;  1LTJ A;  1NAY A;  1P84 H;  3H1H G;  1KB9 I;  1LJ2 A;  4YPC A;  3IR9 A;  3AEF C;  5CJ4 A;  2IBZ D;  1W2B O;  4KHX A;  1XTG B;  1T8Z A;  2CK3 H;  1HUC A;  3SFE C;  3E1I A;  3V5B A;  1SQV E;  3VMY A;  5E79 H;  4DOJ A;  1JTH A;  2AEM A;  2D2C B;  1Q81 Q;  2QIW A;  1IFI A;  2YXR B;  3F89 A;  4WWI A;  3CCM P;  1M8O B;  1VQ5 P;  1RF0 C;  2IX7 C;  3I5C A;  1VQM P;  4RES B;  4RO0 A;  2V7Q H;  2KYV A;  1K04 A;  3A0B E;  3BCC J;  2ZT9 B;  2NPS D;  1JY2 N;  3H1L D;  2Q7C A;  1SQP G;  1MV8 A;  2IBZ E;  3O8Z A;  2AEF A;  3JCU E;  2JEE A;  1HH0 A;  2JWA A;  3L4F A;  1KQL A;  3KQG A;  1RHZ B;  2ZVN B;  1BGY D;  2E74 D;  2O1K A;  2WSS H;  3CLQ A;  2KSE A;  3RK2 D;  1SQX K;  2NPS C;  1LWU A;  3D71 A;  2L91 A;  5K5G B;  1TU3 F;  5KLI B;  1SQB G;  2M0B A;  2IFM A;  1RQU A;  2ITA A;  2J5U A;  3BAS A;  3H6P A;  1X79 B;  4ASW A;  2FFD B;  1L0N G;  1EZV D;  1NWQ A;  2M3E A;  2O3J A;  1LP1 A;  3S4R A;  2IZ0 A;  1QEX A;  2E74 C;  3RK2 C;  3KZI H;  4UB6 H;  3CCS P;  2LXC B;  1X0T A;  1PIX A;  4O9B A;  3HD7 B;  1KB9 D;  3PHL A;  3HUS A;  3BRT B;  1DD3 A;  1VF5 B;  1EXJ A;  2ZXX A;  1NTM K;  2WVR A;  4WVZ A;  2POH A;  1BGY E;  5APV A;  3M0D C;  4IL6 E;  1Z56 A;  1G1I A;  1RF0 A;  1YIJ P;  3WU2 E;  3S9O A;  3A3Y B;  2R5D A;  1WMK A;  4N78 E;  4NPD A;  4WB4 A;  3HTK A;  1YJN P;  5KTB A;  1SQV G;  3AEA C;  3SWY A;  2HR3 A;  1OXZ A;  5AW0 B;  3Q5S A;  3AEC C;  5CCH D;  1W2E A;  3FWL A;  2P7J A;  2YIU C;  1KB9 E;  4HJG H;  2FYU K;  1NOH A;  1FU1 A;  2D2C D;  5AW8 B;  2E76 B;  2Z5I A;  2W27 A;  1YQ3 C;  1NTZ K;  1KN7 A;  2NPS A;  1X22 A;  1DIP A;  2IYO A;  2QRX A;  3OAK A;  1KQG B;  1NTK K;  1KIL B;  2IBZ G;  1SFC A;  4L74 A;  5CCH C;  1KYO I;  2JR8 A;  1N86 A;  1S5L X;  2M3B A;  2ZT9 D;  1LTI C;  4L76 A;  2ZXE B;  1MZ9 A;  2FYN B;  4AYC A;  3I55 P;  2D2C C;  1LTJ B;  4KT0 J;  3GW6 A;  1BDD A;  3UIA A;  2YKO A;  3CCL P;  2ZVO B;  3W67 A;  1SQV J;  1YI2 P;  1L0L K;  1SQQ K;  1KQF B;  2R44 A;  1RE4 C;  2XV5 A;  3HE5 B;  3O6Q B;  2ZT9 C;  1DH3 A;  2W6J H;  3MD0 A;  3GLM A;  1JTH B;  3H1L G;  3HE4 B;  1S4X A;  3CC2 P;  1RE3 C;  1GD2 E;  3V2Q A;  1VQL P;  3SSU A;  1K9M Q;  3VN0 A;  1RF1 A;  2WMM A;  1BGY G;  3CMA P;  3C1L A;  3Q5R A;  4WY4 A;  1SP4 A;  3AE6 C;  4PD4 I;  5AW7 B;  1GW4 A;  2HFE D;  3HD7 D;  5KLI C;  1RQV A;  1GK4 A;  1JM0 A;  1OZH A;  2GUS A;  3RK3 E;  5AW1 B;  5AW9 B;  1VF5 D;  5B5E E;  3C8V A;  1YHQ P;  3RBZ A;  2FFD C;  3D6Z A;  3RL0 g;  1EZV G;  1Y9B A;  4WBA A;  1FOS E;  3M0A A;  4I7Z B;  2BEZ F;  2RH0 A;  3B4S A;  1PGO A;  3PP5 A;  5AVQ B;  3TNU A;  3H1J D;  3HD7 C;  1JCC A;  1Q86 Q;  1QVG O;  3CCV P;  2ZFC A;  2W6A A;  2ZYA A;  3L72 D;  5KLV K;  1HJB A;  2YO2 A;  1VF5 C;  2Y0E A;  3BRV B;  2AXT H;  5BVZ A;  3AE2 C;  1BSN A;  3OW2 O;  5GTH E;  5KJ7 D;  3AEG C;  1FDM A;  2L5G B;  1AA0 A;  1BCC E;  1A02 J;  1KYO D;  2VRS A;  1USE A;  2N9Y B;  1N8R Q;  1BGY J;  2C9N Y;  4ZMD A;  2FYU D;  2BCC G;  3CX5 E;  2E76 D;  3HUS B;  2R3S A;  2K88 A;  1H8A A;  1U57 A;  4CPG A;  1NTZ D;  2XND H;  2KS1 B;  5KJ7 C;  4JBZ A;  1KIL D;  2OYH B;  1NTK D;  3H1J E;  3WUV A;  1JOC A;  3VYI A;  3AE1 C;  3FX0 A;  3PRJ A;  1FOS F;  3H1K G;  2JJL A;  2WSE J;  2Z5H A;  3H1H E;  1GL2 A;  2RN0 A;  1OX3 A;  3MP7 B;  2LR2 A;  2E76 C;  5DJU B;  3W68 A;  1VQ6 P;  1RY3 A;  1X8Y A;  2E43 A;  1OWA A;  2Z4E A;  1KYO E;  1NH4 A;  2WZ7 A;  3VMZ A;  4OH8 B;  2E75 B;  1P84 I;  3M9B A;  1KIL C;  1JUN A;  1SQQ D;  2FYU E;  2FFD A;  5KAF H;  4PD4 D;  1NTZ E;  2FYN C;  1LTJ C;  2IZ1 A;  2QE7 H;  2OAR A;  1JY2 O;  3P8M C;  3B71 A;  2JWD A;  4JQ0 D;  5APS A;  1KIL E;  3HD7 A;  1NTK E;  5TIS E;  2Q3E A;  2WPV B;  3L73 D;  3CWB J;  3L75 D;  1SFC B;  1QLE D;  1U7M A;  1NU1 K;  4K35 A;  5B66 H;  3PTZ A;  3U1A A;  4D6T D;  5AVW B;  1NO4 A;  4XFJ A;  1VQ9 P;  3N7N A;  2BEQ D;  1E79 H;  1T6A A;  3LW5 H;  1SQQ E;  2I8D A;  3ITK A;  1KZU B;  4PD4 E;  1GZL A;  1H89 A;  2WT7 A;  1K73 Q;  1JY3 O;  4IFD K;  5KJ7 A;  2YMK A;  4OWF A;  1T3J A;  3IAO A;  5AVR B;  1FZC A;  1SQB E;  2P58 A;  4N3Y B;  1N7S A;  1FZB A;  2FXM A;  5KLV D;  3L75 E;  1L0N E;  3IF4 A;  4D6T E;  4I7Z C;  1KD1 Q;  1RF1 B;  1EDJ A;  4GT1 A;  1KIL A;  1PFI A;  4WY4 B;  3GF7 A;  2KXP B;  3G71 P;  4GOD A;  2QA4 P;  3H1J G;  1J1E B;  1ZV8 A;  3L72 G;  2DW3 A;  2Q1K A;  1YIT P;  1UII A;  1P84 D;  2WSF H;  3P32 A;  1OVU A;  4PJ0 E;  1VQO P;  2JP3 A;  3A0B H;  4W7Y A;  2JO1 A;  3TNU B;  1KOR A;  5KLV E;  1LTT C;  1HF9 A;  1IJD B;  3HE5 A;  2FYU G;  2K9J B;  3O6Q A;  1OMI A;  3HUS C;  3TGU D;  5AVV B;  1BCC J;  1NTZ G;  4BRY A;  1LT9 B;  1NKZ B;  1Q90 D;  3II6 A;  1X9V A;  3HE4 A;  1VDF A;  2E75 D;  2KI7 B;  2OYH C;  2QEX P;  1NTK G;  1FJP A;  1Q82 Q;  2JKV A;  3Q2Y A;  2HYN A;  4IFF A;  5APT A;  2H43 A;  3D70 A;  4U3F D;  1AVO A;  1FZE A;  1P84 E;  3CXH H;  1KFN A;  4C7N B;  1NVO A;  1U7J A;  1N2D C;  3LIE A;  3Q3D A;  2K1A A;  4UB8 H;  2E75 C;  3H1H J;  3MZW B;  1K05 A;  1XTC C;  1SFC D;  1L0L G;  2OYI A;  1T2K D;  1SQQ G;  1M56 D;  2HPC A;  1NYH A;  3TGU E;  4B86 A;  1GL2 B;  2YXQ B;  5E79 E;  2CPS A;  2KLU A;  3RBX A;  3S1K A;  1DEB A;  1HWT C;  2P1J A;  1VQP P;  4YXW H;  2UWJ E;  3L73 G;  5CBO A;  2PFX A;  1SFC C;  3L75 G;  2ZYD A;  1UIX A;  1T2K C;  5KKZ B;  2B9B A;  4U3F E;  5H2F H;  5AW2 B;  4D6T G;  3H1L E;  4YTP C;  3VMX A;  1H88 A;  1L4A B;  1N73 A;  1S5L H;  3H1I D;  3V2N A;  2WWW A;  1JMB A;  1BSH A;  3FXD A;  2WSE H;  1IFP A;  1SQP J;  1ZN5 A;  5C39 A;  4DZO A;  2G8Y A;  1M1K Q;  3BVH A;  2XNX A;  1R8E A;  2KS1 A;  2FXO A;  2WTY A;  1KFM A;  2WSC J;  2QSI A;  4WY4 D;  2OYH A;  3GF3 A;  3L74 D;  1JCD A;  2H8P D;  2C0W A;  4GOE A;  3IN6 A;  2BCC D;  5KLV G;  3AEE C;  3WMM 0;  1EZV E;  1QL1 A;  1T3U A;  1SQB J;  1BDC A;  1RF1 C;  3ABV C;  2WT7 B;  3H1I E;  2IFN A;  2M5A A;  4WY4 C;  1L0N J;  4I2L C;  3KZI E;  1FZC B;  1OW6 A;  3AE9 C;  4UB6 E;  3H1K D;  1J1E C;  4AUW A;  1N7S B;  2JDI H;  2OTJ P;  2WPQ A;  4IL6 X;  2R32 A;  3L74 E;  3P8C D;  3CL3 D;  4L75 A;  2Q3I A;  4HKZ H;  4OVN F;  1GMJ A;  2BCC E;  3AE3 C;  2KNC A;  1YJW P;  1SVF A;  1DX7 A;  3V6I A;  5AW3 B;  4GOF A;  2KIK A;  3TGU G;  2QM7 A;  1OVV A;  1KTM A;  3NXS A;  1KQS O;  1LT9 C;  4EI2 A;  4RKU J;  1PP9 D;  3D6Y A;  3C9I A;  1BE3 G;  3H1K E;  1H0T A;  4LC1 A;  5CMZ A;  1K8A Q;  1JY2 P;  1GL2 D;  3TSI A;  1FE6 A;  3U1C A;  1GK6 A;  4U3F G;  3V4W A;  1SQX D;  4BRY B;  3P8C E;  3M06 A;  4MN4 C;  2M8R A;  2B89 A;  3GHG B;  3TYY A;  3KXD A;  1FZA A;  1D7M A;  2A06 G;  2W83 C;  1GL2 C;  1L4A D;  2PGD A;  1PP9 E;  2KUB A;  1ZR4 A;  4LLH A;  3TGU J;  2XKM A;  4EYY Q;  1JY3 P;  2YO3 A;  1IFN A;  3L37 A;  2OYI B;  5KKZ C;  1NTM D;  1NAF A;  2HPC B;  3K5B A;  4DT0 A;  1IK9 A;  2OTK E;  1IFM A;  4XA4 A;  1SQX E;  4ZNC A;  1LTB C;  1L4A C;  3CX5 H;  1FDI A;  3H1I G;  4U3F J;  2K9J A;  4JPZ B;  1LTA C;  2QVA A;  3A0H H;  1KV4 A;  3EWK A;  3H1L J;  1GU5 A;  1LT9 A;  4AQR D;  2NZ2 A;  2AEJ A;  3L74 G;  1N73 B;  1N7S D;  1JEK A;  1SQV K;  1VQK P;  1NTM E;  1JB0 J;  4C7N A;  2PAJ A;  2Y9Z A;  2N1T B;  3HRN A;  3T97 B;  3Q1M A;  1OW8 A;  3CME P;  1Y8A A;  1FZC C;  2BAS A;  3VTP C;  1ZRT D;  3L72 E;  1N7S C;  2GA1 A;  1FS0 E;  5TIS H;  2AXT E;  1USD A;  1VQ4 P;  1PGJ A;  2AXC A;  5AVY B;  1LGH B;  3JSV C;  2M5A B;  3LID A;  1L0L D;  2H88 C;  5GTI H;  1NKN A;  4C7R A;  1YJ9 P;  3OA7 A;  3L74 J;  3TF5 A;  1W5C E;  4H0L B;  1J1D B;  5APW A;  1L4A A;  3M9H A;  1WT6 A;  2BCC J;  1AQT A;  1PP9 G;  1S2E A;  2MJZ A;  1Y47 A;  1IFD A;  5TJH A;  4DJG A;  1MKM A;  3PJS K;  5KAI H;  1PZQ A;  1N7L A;  2KNC B;  3MGN A;  3QWO C;  2OTL P;  2IPP A;  3CC4 P;  1KC8 Q;  1PGP A;  4PV1 B;  4BXL A;  3H1K J;  2I1K A;  5AW4 B;  1SQX G;  1S72 P;  4Y28 J;  2Q9I A;  2GUV A;  2QJP B;  3GHG C;  1L0L E;  2N9B A;  3SWK A;  3CXH I;  2C0X A;  1NGM B;  5APQ A;  1H0T B;  4M3L A;  3WUU A;  2B88 A;  1VQ8 P;  4LGD E;  1NHL A;  3CCJ P;  1EQ7 A;  5KAF E;  4BWN A;  2A45 H;  3L73 E;  2RKL A;  1EXI A;  2OYI C;  3PH0 A;  2O01 N;  5CHX A;  1NTM G;  1HBW A;  5B66 E;  1FZG A;  2OYO A;  4DCK A;  1GTW A;  2HG5 D;  1IZN B;  1OIP A;  1EDK A;  3L71 D;  1QVF O;  2OQQ A;  1SQX J;  4OGQ B;  1LT1 A;  1CW5 A;  3BCC G;  2HLO A;  3GMA A;  2E5Y A;  1DEE G;  3AEB C;  4R4L A;  1EDI A;  1IK7 A;  1N73 C;  3A5T A;  3RGU A;  1M90 Q;  4U7J A;  1ZXG A;  2LXB A;  1PL5 A;  1ZR2 A;  1KMI Z;  3JCU H;  4GIF A;  3KHU A;  2N1T C;  2YKQ A;  1NJI Q;  1L2P A;  3TK1 A;  3GHG A;  1ZLL A;  1ZME C;  1NTM J;  1BE3 D;  4HH2 A; 
#chains in the Genus database with same CATH homology
 1RF1 C;  2NPS B;  1G1J A;  2WT7 B;  3CI9 A;  5AVT B;  2FFD C;  5AVZ B;  2IFN A;  4C46 A;  3IFM A;  4WY4 C;  4I2L C;  4WBA A;  1FOS E;  3M0A A;  3L36 A;  1FZC B;  5BU8 B;  3M91 A;  1QL2 A;  1YTZ T;  1J1E C;  4AUW A;  1N7S B;  4ZKP A;  3PP5 A;  1VPC A;  5AVQ B;  3TNU A;  5CCG D;  3HD7 C;  1JCC A;  1CI6 A;  2Q5U A;  2R5B A;  2WPQ A;  4GKG A;  2ZFC A;  2W6A A;  3U59 A;  5KLV K;  2R32 A;  1HJB A;  2YO2 A;  1HTL C;  3RK2 B;  3P8C D;  1G2C B;  2FYZ A;  3BRV B;  3CL3 D;  5BVZ A;  5AVU B;  2Q3I A;  3NTN A;  5KJ7 D;  1J1D C;  1FDM A;  2L5G B;  1SVF A;  5AW6 B;  3L35 A;  1A02 J;  1DX7 A;  1URQ D;  2VRS A;  5AW3 B;  1YYC A;  2QM7 A;  1CZQ A;  5CCG C;  3NXS A;  3RK3 B;  2C9N Y;  1HGZ A;  2J59 M;  1LT9 C;  1M7L A;  2P67 A;  4I6M C;  1URQ A;  3RL0 D;  3B5N D;  2WIT A;  3HUS B;  3MIW A;  3C9I A;  3EQ2 A;  5APY A;  2HOD A;  1H8A A;  1M1J A;  5AW9 B;  4LC1 A;  5CMZ A;  1JY2 P;  3B5N A;  5BU5 A;  3P7K A;  4ZKU A;  5KJ7 C;  2O1J A;  1KIL D;  2OYH B;  2KLV A;  1GL2 D;  2KSJ A;  3VOP A;  1JOC A;  3TSI A;  2KOG A;  4I1L A;  1URQ C;  3VYI A;  3U1C A;  1GK6 A;  4N78 D;  1FOS F;  3V4W A;  2N1T D;  2JJL A;  2Z5H A;  3P8C E;  2YNY A;  1GL2 A;  3SWF A;  1LWU C;  1IFJ A;  3M06 A;  4EOT A;  3RL0 C;  1E5W A;  3B5N C;  2M8R A;  1JY3 N;  2O01 H;  3GHG B;  1RY3 A;  3M9Q A;  1X8Y A;  4N6J A;  2E43 A;  1OWA A;  3TYY A;  1GW3 A;  2N1T A;  2WPS A;  3T97 A;  2Z4E A;  1LTS C;  1NH4 A;  2WZ7 A;  1MUU A;  1JO5 A;  3B8E B;  1FZA A;  1LTJ A;  3VMZ A;  4OH8 B;  3M9B A;  1KIL C;  1JUN A;  1GL2 C;  1L4A D;  3V2R A;  2FFD A;  1IC2 A;  3H32 A;  3MUD A;  3IR9 A;  1HGV A;  5CJ4 A;  1ZR4 A;  4W7Z A;  4LLH A;  2A45 G;  1HVV A;  4KHX A;  1XTG B;  1T8Z A;  2XKM A;  1LTJ C;  1CI6 B;  1HUC A;  2OAR A;  1JY2 O;  3P8M C;  1JY3 P;  1FAV A;  1IFN A;  2YO3 A;  3L37 A;  5APS A;  3E1I A;  3V5B A;  4DOJ A;  3VMY A;  3HD7 A;  2OYI B;  1JTH A;  1NAF A;  2HPC B;  1IFI A;  1IK9 A;  1IFM A;  4XA4 A;  3NMD A;  1SFC B;  1LTB C;  1L4A C;  1RF0 C;  2IX7 C;  3I5C A;  4RES B;  1NU1 K;  3U1A A;  5AVW B;  2KYV A;  1LTA C;  5AVX B;  1NO4 A;  3N7N A;  1GU5 A;  5CCG A;  3LW5 H;  1JNM A;  1JMM A;  1LT9 A;  1LTG C;  2HOD B;  2NPS D;  2XDJ A;  1JY2 N;  4AQR D;  1M1J B;  2Q7C A;  3MTU E;  3EFG A;  1MV8 A;  1KZU B;  2LKM A;  3O8Z A;  1GZL A;  3R2P A;  1N73 B;  1H89 A;  2WT7 A;  2JEE A;  1JY3 O;  1N7S D;  4IFD K;  1HH0 A;  5KJ7 A;  1GDT A;  1A02 F;  3L4F A;  4IFM A;  1SQV K;  1T3J A;  1KQL A;  5AVR B;  3KQG A;  1FZC A;  2O1K A;  3CLQ A;  4N3Y B;  1N7S A;  1FZB A;  3RK2 D;  4C7N A;  2FXM A;  2PAJ A;  4XE5 B;  1SQX K;  1GU4 A;  2NPS C;  1LWU A;  3G3Z A;  3A7O A;  2N1T B;  3HRN A;  4Y99 B;  1FBM A;  2IFM A;  1FZC C;  1RF1 B;  2BAS A;  1SQP K;  3VTP C;  3BAS A;  3H6P A;  1X79 B;  1WRG A;  1N7S C;  5APX A;  2FFD B;  4GT1 A;  1KIL A;  1PFI A;  4WY4 B;  1NWQ A;  3RK3 D;  1J1E B;  1AFO A;  1ZV8 A;  3M0D A;  3RK2 C;  5AVY B;  1FZF A;  4O9B A;  3HD7 B;  1LGH B;  3LID A;  3HUS A;  2QM8 A;  2WSF H;  3P32 A;  3BRT B;  1NKN A;  3BAT A;  1SQB K;  1NTM K;  4C7R A;  3OA7 A;  2POH A;  5APV A;  4W7Y A;  3M0D C;  3TNU B;  1J1D B;  1Z56 A;  1LTT C;  1G1I A;  3RK3 C;  5APW A;  1L4A A;  1RF0 A;  1IJD B;  1L0N K;  3HE5 A;  3M9H A;  1S9K D;  1WT6 A;  3HUS C;  5AVV B;  3A3Y B;  2R5D A;  2XZR A;  2MJZ A;  1AQ5 A;  1IFD A;  4EIJ A;  1SLQ A;  1LT9 B;  1NKZ B;  3V2P A;  2W6B A;  4N78 E;  2J58 A;  3II6 A;  1X9V A;  3HE4 A;  1VDF A;  1N7L A;  4WB4 A;  3HTK A;  3MGN A;  2OYH C;  3KYQ A;  5KTB A;  2IPP A;  1FJP A;  2E42 A;  3SWY A;  2HYN A;  2I1K A;  1OXZ A;  4IFF A;  5APT A;  5AW0 B;  2XU6 A;  5AW4 B;  2H43 A;  2CPB A;  5CCH D;  1W2E A;  2Q9I A;  1URQ B;  2GUV A;  2P7J A;  2PP6 A;  1FZE A;  1J2J B;  3GHG C;  2N9B A;  1KFN A;  2FYU K;  4C7N B;  1NOH A;  4JYC A;  2C0X A;  5APQ A;  1LWU B;  1FU1 A;  4JYB A;  1N2D C;  3LIE A;  4M3L A;  5CCH A;  2GM4 A;  3RL0 B;  3B5N B;  5AW8 B;  2Z5I A;  2W27 A;  1NHL A;  1NTZ K;  4LGD E;  5CJ0 A;  1EQ7 A;  2NPS A;  1XTC C;  1SFC D;  5AVS B;  2OYI A;  1T2K D;  3KPE A;  1S9K E;  3OAK A;  2HPC A;  1NTK K;  1KIL B;  4B86 A;  1GL2 B;  1YTZ I;  1SFC A;  2WPR A;  4JF7 A;  5CCH C;  2A45 H;  4W80 A;  2CPS A;  1N86 A;  2A45 I;  2M3B A;  1LTI C;  2ZXE B;  1DEB A;  1MZ9 A;  1HWT C;  2OYI C;  4AYC A;  2H7H A;  2P1J A;  5CHX A;  1LTJ B;  2I1J A;  2C9L Y;  2FKW B;  1RE4 A;  1HBW A;  3UIA A;  1G2C A;  2YKO A;  1FZG A;  1SFC C;  1GTW A;  1CSB A;  2HG5 D;  1T2K C;  3H32 B;  2KP8 A;  1L0L K;  5APU A;  5AW2 B;  1SQQ K;  1RE3 A;  3VMX A;  1H88 A;  1L4A B;  1N73 A;  1RE4 C;  2XV5 A;  2R3C A;  3HE5 B;  2P2U A;  2KB7 P;  3KDP B;  3V4Q A;  1DH3 A;  3V2N A;  3MD0 A;  2WWW A;  1CW5 A;  3NFQ A;  1JTH B;  1M1J C;  2HLO A;  3OJA B;  2WSE H;  1ZN5 A;  3HE4 B;  4DZO A;  1FJK A;  1RE3 C;  3BVH A;  4HYT B;  3HTK B;  1IO4 A;  1GD2 E;  3V2Q A;  1N73 C;  2XNX A;  3A5T A;  2WTY A;  1KFM A;  4WY4 D;  3N4X A;  2OYH A;  3VP9 A;  2WSC H;  1MFZ A;  1JCD A;  3VN0 A;  1RF1 A;  2H8P D;  2C0W A;  5AW5 B;  2YMY A;  3VP8 A;  4WY4 A;  1SP4 A;  1ZR2 A;  5AW7 B;  4GIF A;  1GW4 A;  2HFE D;  3HD7 D;  2N1T C;  2YKQ A;  3WMM 0;  3A2A A;  3TK1 A;  3GHG A;  4Y99 C;  1ZLL A;  1QL1 A;  2YKP A;  1T3U A;  1GK4 A;  2GUS A;  5AW1 B;  4HH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...