1FJPA

Nmr solution structure of phospholamban (c41f)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
52
structure length
52
Chain Sequence
MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILIFLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIAC PHOSPHOLAMBAN
publication title NMR Solution Structure of Phospholamban
pubmed rcsb
molecule tags Membrane protein
total genus 14
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fjpA00
1N7LA 1FJKA 2M3BA 2KB7P 2KYVA 1ZLLA 2HYNA 1FJPA
chains in the Genus database with same CATH superfamily
4WWIA 5M1BA 2KNCA 2JJLA 5C39A 1WT6A 5E79E 5AW6B 1T6AA 2I1KA 3P8CE 4D6TD 2K9JA 3H6PA 4K35A 5TISH 3U59A 2Z4EA 1DD4A 3PLNA 3KZIH 1L0LG 1ZR2A 3MTUE 1DD3A 2YO2A 2JP3A 2P67A 1XTCC 1EZVE 4NPDA 2W6AA 1Q82Q 1N7SA 5APQA 2R3CA 1KC8Q 3GW6A 1K9MQ 1X79B 2D2CD 1R8EA 4XA4A 2A06D 1KTMA 1M1JC 2QM8A 1GK4A 1K04A 3KYQA 2C9LY 2RH0A 1L0NE 1W2EA 3B5ND 1OW6A 3V2NA 1NYHA 4Y99B 2O3JA 2PFXA 3GMAA 1PL5A 3AE2C 2K3RA 2YNYA 4EI2A 1KB9E 1NVOA 4C46A 3ZDMA 1NAFA 3H32B 3VN0A 1FZCC 1AV1A 1SS1A 1KILA 1LTAC 1YHQP 3L74E 1LWUB 4H13D 1FC2C 1ZR4A 3D6YA 5TJHA 1NAYA 2WSCJ 2FYUE 2IBZG 2YKPA 3D71A 3RL0g 3CX5D 5CCHC 2V7QH 3L70J 5TISE 2M8RA 2ZYGA 3RGUA 2QJPC 5AW3B 3KZIE 3W67A 3KXDA 1URQD 2FFDC 1JY2N 2N9BA 2RN0A 3K5BA 1VF5B 1LTJC 1VQNP 1N86A 4GOFA 5KLIB 2E74C 1KFNA 3ABVC 1L4AD 4TLFA 3RK3D 1CI6A 1RF1C 1VPCA 1SVFA 2GM4A 3HUSB 1SQBE 2FXOA 3TGUE 2AEFA 3AE5C 1MZ9A 1PGQA 2OARA 2O01H 1BGYG 4GIFA 4C7RA 1LNQA 2ZAEB 1ZRTE 3L35A 1HF9A 3FX0A 1PP9J 1GW4A 4AYCA 3MIWA 2IBZD 5AW4B 3AE6C 3H1JJ 1X22A 1N73A 1T2KC 3G71P 1SQQK 1GL2B 1NTKE 1NTMK 2Q3IA 2E75B 2H43A 4L76A 2R44A 2ZT9D 3USSA 4HH2A 4BXLA 5AVYB 3V2QA 2BCCE 1JCCA 2JWAA 3B71A 4H0LB 1IC2A 3CWBG 1N2DC 3GF7A 3U1AA 4I6MC 2Y9ZA 1R5LA 3TSIA 2FFDA 2N1TD 1SQQG 2R5BA 1LTIC 3AEFC 4C7NB 5KJ7A 3M0DC 1KV4A 3CI9A 1NTMG 1RE3A 1JY2P 3NMDA 3CCEP 3V2PA 1AQTA 2Q7CA 3AEBC 2FBWC 2A45I 1FJKA 3JCUH 2HYNA 1FDMA 4Y99C 2WT7A 4PD4H 4DZOA 1LGHB 1IK7A 2AXTE 2WSSH 4Z1MH 1W2BO 2W27A 3CLQA 4WY4D 2W83C 3HE4A 4XFJA 2I1JA 4YXWH 4JPZB 2NPSB 1HBWA 4HKZH 2N9YB 1H8AA 1LWUC 1KYOI 1JB0J 3EWKA 1GMJA 2Q6QA 2W6BA 1FOSE 3CWBD 3CX5I 1QGKB 1UIXA 2CPBA 4R4LA 3L73E 2Y0DA 3I56P 4LGDE 3Q5PA 1T3UA 1RF0A 3TDKA 2XNXA 1L0LE 5DJTB 2J59M 3JC22 1SQQD 3SFEC 1DX7A 4W7ZA 1SQVK 5AVSB 3NXSA 5KLVK 4H44D 5KAFH 1OX3A 2DW3A 1VQLP 1JNMA 3H1LJ 2WSFJ 2WSEJ 3S1KA 4EOTA 1RQUA 2E76C 3C8VA 1N7SD 5CCGC 5KLIC 2NRGA 2IYOA 5CBOA 3BCCG 1IFIA 5AVRB 4WBAA 1FU1A 3RK3E 4OWFA 1FZCB 2XKMA 3JCUE 3HUSC 1WMKA 2IYPA 2BEZF 1P84H 2ZXXA 4HYTB 2ZVNB 1RE4A 2LXCB 1SQVG 3PHLA 4PD4E 2E5TA 5KLVG 4RJTA 3WUVA 3CC2P 1AVYA 3BCCJ 5CMZA 4PJ0H 3S4RA 5AW9B 4U3FJ 3RBZA 3OW2O 2HODB 1MFTA 1IJDB 4IL6H 1W5CE 1OMIA 2OYHB 3H32A 1USEA 3CCJP 1SQVJ 1YTZI 1KILD 5KLVJ 1LWUA 1HUCA 3B4SA 3H1LD 1BE3J 1RH5B 2IBZE 1M1KQ 1GD2E 2E75C 2D2CB 5APXA 2L91A 1MUUA 1YQ4C 3Q5SA 3N7NA 1EC5A 4H0LC 1YJNP 3B5NB 3CC4P 4EYYQ 3FXEA 3GF3A 3SFDC 3LW5H 3R4YA 3BCCD 4AQRD 1DEEG 1YTZT 1SQPK 3HRNA 4PV1D 2A06G 4U3FD 2KXPB 1GW3A 1DEBA 2P2UA 1KFMA 2P58A 4H13B 1IFDA 1R5SA 1SQVD 1FBMA 2A45G 5KLVD 4CPGA 1EXJA 3SWFA 4JQ0D 1Z56A 2IDBA 2R3SA 1BE3D 1P84E 3AECC 3RK2D 3V5BA 5H2FE 1Q81Q 1JY3P 1LTTC 4RKUJ 2B87A 2O1KA 1BGYE 3ITKA 2KZJA 4PJ0E 3WUUA 1SQPG 5AW8B 1T3JA 3TYYA 1JUNA 1URQB 3O6QB 4IL6E 2NPSC 3VMAA 1VQOP 3KDPB 4JF7A 3HD7A 1OVRA 2BEQD 4EDFA 3H1HJ 4N3YB 3VYIA 2OYIA 4I2LC 1L4AB 3CL3D 1GL2A 1OVUA 3RK3B 1SQPJ 4RO0A 4M3LA 1JMBA 1OW7A 3CWBE 3G6EP 3IN6A 3EFGA 2PAJA 3MUDC 5AVWB 2AEJA 2WWWA 1K05A 1NKNA 1SQQE 5APTA 2WPRA 1NTME 1SFCA 1VQ7P 1SQXJ 1ZV8A 3GHGB 1KQLA 3M91A 4W7YA 2YMYA 3TNUB 5KJ7D 5AW7B 4C7NA 1GZLA 2KOGA 5APVA 4Y28J 2YIUC 2HPCA 5AVVB 4UB8E 3OA7A 2Q3EA 2ZT9B 1E5WA 1JTHB 1X0TA 1SQPD 3A0BH 3L70G 1LTGC 4YXDC 3QWOC 2QSIA 3HTKB 1S9KE 2FYNB 2KB7P 3WMM0 3Q3DA 1KYOD 2ZFCA 4HJGH 1OFCX 3L75G 5AVZB 1ZN5A 3A7OA 2OYHC 1PGJA 1Q90D 2KP8A 5AVUB 1NTZJ 2OQQA 5AW2B 2Z5IA 1VQ6P 5GTHH 3L75J 2D2CC 1BCCJ 1AVOA 1YQ3C 3P7KA 4ZMDA 2Y9YA 2E76B 1TU3F 5GTIE 3CCUP 1HVVA 5AVXB 3P8MC 4ZKPA 3B5NC 1FZAA 3MUDA 5AVQB 4BRYB 1MFZA 1M1JA 2YMKA 2QJYB 1KD1Q 2YXQB 4U7JA 1S5LH 1PP9G 4JYCA 3NFQA 2JKVA 3H1JG 3BCCE 4B86A 1U57A 1FDOA 2AXTH 3L70D 2A45H 3L72G 2YKQA 1NU1J 1CSBA 4H13C 1H0TB 1IFPA 1VQMP 1SQVE 4AUWA 3A0BE 1FZCA 3IAOA 2KNCB 5KLVE 2R32A 2RMZA 3L75D 1EXIA 1AJYA 1YBKA 3VMXA 2XV5A 3CXHD 4GT1A 3L72J 1RHZB 2E5YA 1FJPA 1NWQA 1YYCA 3L36A 3QH9A 4O9BA 1URQC 1Q7YQ 4H44B 1KYOH 5CCHA 3VOPA 3M9HA 3H1IJ 1QVGO 3W68A 2YO3A 3CX5H 4D6TE 4RESB 1N7SB 3Q1MA 1L4AC 3RK3C 2K88A 5APUA 3AE9C 5GTHE 1IZNB 2W6JH 1AFOA 1LTJA 2B9BA 1WRGA 1PP9D 2JDIH 4GODA 5KAIH 1PFIA 3H1JD 1RF1A 2JR8A 3L37A 2IZ0A 1ZMEC 1JM0A 2GUSA 3CCVP 1S5LE 1NJIQ 3T97A 3L72D 2A06E 1HWTC 4WB4A 3GHGC 4I1LA 1VQ4P 4GDOA 1VF5D 2QRXA 2WSCH 3C1LA 3OJAB 3H1ID 3RBXA 1BSNA 1KILB 2K37A 2QJKB 3LW5J 1L0NJ 2ZT9C 2OYOA 2C9NY 2WVRA 4N6JA 2H89C 3P8CD 1OIPA 1Y9BA 2V4HA 2IZ1A 1SQPE 2FYNC 1S72P 5KKZB 3OAKA 4OGQD 1G1JA 3CD6P 1YIJP 2KZIA 2NZ2A 2W90A 1AA0A 1HGVA 1ZP0C 1KYOE 2QG4A 3H1LG 1URQA 3L74J 3V4WA 2N1TC 1EZVD 3IR9A 3CX5E 4PV1B 1G1IA 4A7PA 3BRTB 4NPFX 3HD7D 2AXCA 4IFFA 1FZEA 1HJBA 2FYUJ 2LXBA 2KLVA 2QM7A 1FAVA 4HB1A 1JOCA 3M0DA 1L0ND 4I7ZC 4IL6X 3RK2B 1VQ9P 1KN7A 3E1IA 3AE4C 2YIUB 5KAIE 1NGMB 1NOHA 3C9IA 4ASVA 2I8DA 1JY3N 4U3FG 2L5GB 2PGDA 2QJYC 1KB9D 4MN4C 5H2FH 1SFCD 4WY4C 3A0HH 4PD4I 4IOIH 5APSA 3RL0D 2JWDA 1BE3G 2G8YA 1GTWA 3SSUA 1NHLA 1J1DB 3Q2YA 4L73A 1N73B 5B66H 1MV8A 1JY2O 1SQBJ 3L70E 1EDLA 1EDIA 3TGUJ 3VMYA 1SLQA 3V2RA 3CXHI 1YI2P 1HH0A 1NTKG 3PJSK 4OH8B 2WPQA 1EDKA 3HTKA 3PTZA 4W80A 4N78D 1LP1B 3G9RA 2C0XA 2KS1B 4DOJA 4LLHA 1HGZA 4H44C 2POHA 1X9VA 3AEGC 2C0WA 4QMAA 1NTKJ 3SWYA 2LKMA 3KPEA 1FE6A 1J1EB 3EQ2A 1ZLLA 1QEXA 1N7SC 1EDJA 3HE5B 2BCCJ 3KQGA 2YKOA 2V7QJ 2KI7B 1PV3A 4YTPC 3TGUD 3O8ZA 5CCGA 3LIEA 1GDTA 1L2PA 1PP9E 2Z5HA 4UB8H 3H1JE 1JMMA 3HUSA 1P84I 1ZRTD 3A0HE 2QIWA 3H1HG 2W8ZA 1SQXK 2KSJA 3HE4B 2H88C 2KSEA 2Q9IA 3B8EB 2JEEA 3MP7B 3GLMA 1KILC 1NTKD 5B66E 3JSVC 2QJKC 1ZOYC 5APYA 2OTKE 2K9YA 1OWAA 2AEMA 3BRVB 5KTBA 2H8PD 2BCCD 3AE8C 2P7JA 2O01J 5CJ4A 1GU4A 2G3AA 2RKLA 1S1CX 3L73G 5KKZC 3KHUA 1LTBC 5BU5A 2QA4P 3AE7C 1SQXG 2WSFH 1EZVI 2BASA 2WSEH 3A3YB 1Q86Q 5GTIH 1VQPP 1K8AQ 1G2CB 5CCHD 3MHVA 2OTJP 1FZGA 1DIPA 3VMZA 4PV1C 1FS0E 2M3BA 4KHXA 1NTZK 1XTGB 3L73J 3VP8A 1PIXA 3CC7P 1PPJG 1NO4A 3H1KG 2IFMA 1L0LJ 3I55P 3RK2C 2WPVB 1KB9I 2E74D 3H1HD 2XDJA 1M90Q 3L71G 1M8OB 3CCMP 3P32A 1RQVA 4DT0A 3R2PA 3H1KJ 2WQYC 2ZXEB 2P1JA 3CMAP 2FYZA 1NTZG 1FDIA 4L75A 3VTPC 1Q2NA 1OXZA 1EQ7A 4LC1A 1J1DC 2HR3A 5B5EH 4XE5B 3L71J 1IFMA 1BCCG 3WU2H 1N73C 1NU1K 1A02J 2NPSA 3L73D 1S5LX 2N1TB 2ZYAA 2FXMA 1LTSC 2KIKA 2OTLP 1YJ9P 1SQXD 1DH3A 2Y0CA 3A2AA 3PRJA 1T2KD 2QVAA 1L0LD 3FWLA 2GUVA 1KILE 5AW5B 1PZQA 2E42A 2M0BA 3D6ZA 3H1LE 1JY3O 1NKZB 1QX8A 1VDFA 4N78E 1LT9B 4I7ZB 1IFNA 1CZQA 4DCKA 1JEKA 1IK9A 2ZJSE 1PPJD 3N4XA 1KQGB 3H1KD 4YPCA 2UWJE 3CCSP 2YXRB 3V4QA 1NU1G 5KJ7C 5APWA 2J58A 4IFDK 1J1EC 3E1RA 1VQ5P 2M5AB 3PH0A 1RE3C 1PGPA 1FZFA 5CHXA 4WY4B 2WPSA 2XU6A 5EFWB 1RY3A 1K73Q 3L71D 3FGAD 2QEXP 3F89A 4PD4D 2PRRA 2ZYDA 4U3FE 1GU5A 1NTZD 5BU8B 1JO5A 2B87B 1S3JA 4OGQB 3H1IG 2KUBA 2VRSA 3CCQP 1BE3E 1BCCD 4WVZA 1GK6A 2R5DA 2JO1A 1Y8AA 4NPEA 1QL2A 3AE3C 2K9JB 3CMEP 3HD7B 1BDCA 1N8RQ 5B5EE 1KQFB 3AEAC 1HTLC 3WU2E 1E79H 2OYIB 3V6IA 2Y0EA 3M06A 2HODA 1L0NK 2P10A 1SP4A 1VQ8P 1N7LA 1BGYJ 2OYHA 1OZHA 3AE1C 4GOEA 1USDA 1AQ5A 1FOSF 2ZVOB 1QVFO 1RF0C 4GKGA 1Y47A 1EZVG 3EFFK 1NU1D 1OVVA 2XNDH 3FXDA 3M9QA 1M7LA 1LP1A 2KS1A 2LR2A 1SFCB 2IFNA 3B5NA 3RL0B 3I5CA 1L0NG 2KK7A 5AW1B 2FYUK 3HE5A 3CWBJ 4JBZA 2HPCB 3Q5RA 4TT3H 3SWKA 1NH4A 3UIAA 1P84D 5L8RJ 3IF4A 2KYVA 3E7KA 2FY8A 1YITP 2E43A 2E76D 2HLOA 1UIIA 1BGYD 5CCGD 2WMMA 1VL2A 1RE4C 1SQQJ 2MKVA 3AEDC 1NTMJ 3H1HE 3L74G 2O01N 1A02F 2CPSA 4DJGA 3BVHA 2FKWB 4IFMA 1H88A 3CCRP 1D7MA 1X8YA 4R4MA 2CK3H 2FYUG 2Q1KA 1T8ZA 2B89A 1U7MA 3CXHH 1S2EA 4UB6H 3LIDA 4K3AA 1FZBA 3O6QA 1SQBK 3FWNA 2B88A 1LT1A 4ASWA 2IPPA 1SQXE 5BVZA 1L4AA 1GL2D 5K5GB 1ZW0A 2GA1A 1CI6B 3TF5A 1LJ2A 2E75D 2SPZA 2FXPA 1M1JB 1NTMD 1LT9C 1MKMA 1YJWP 1U7JA 2WITA 1JCDA 5AW0B 4BWNA 1KMIZ 3IFMA 1G2CA 5AVTB 4H0LD 3BASA 1NTKK 1PPJE 1M56D 1VF5C 3PP5A 1IO4A 1SQBG 2ITAA 3H1KE 3TGUG 3MD0A 5CBNA 3GHGA 3AEEC 2M3EA 3TNUA 1HJ0A 1PGOA 3L74D 3U1CA 3L71E 3NTNA 2WTYA 1S4XA 1S9KD 3H25A 3GG2A 5DJUB 2K1AA 3VP9A 2FYUD 3M0AA 2H7HA 1NTZE 4OGQC 1JTHA 3BATA 3L4FA 2PP6A 2HG5D 2IBZI 3II6A 5E79H 2WZ7A 3F5HA 3L75E 4JYBA 1BCCE 2HFED 2XZRA 3HD7C 3CXHE 2BCCG 2QJPB 4UB6E 2OYIC 1BSHA 5CJ0A 1GL2C 2FFDB 4D6TG 2O1JA 2NPSD 2N1TA 3G4SP 1OW8A 1LTJB 3TK1A 3G3ZA 3MGNA 3CPWO 3S9OA 3D70A 2E74B 1QLED 1RF1B 4OVNF 1M57D 2MJZA 2OGUA 1SQBD 4ZKUA 2QE7H 4D6TJ 1NU1E 1LT9A 1IFJA 3T97B 1QL1A 1BDDA 1SFCC 1KZUB 5KAFE 3MZWB 2WT7B 3RL0C 1ZXGA 4BRYA 2M5AA 3A5TA 1VQKP 1H89A 4KT0J 2KLUA 4WY4A 4EIJA 3L72E 1KB9H 3M9BA 4L74A 2J5UA 1J2JB 3CCLP 1KORA 2IX7C 1L0LK 4KJMA 4ZNCA 2Q5UA 3H1IE 1H0TA 1CW5A 1KQSO 3WUTA
chains in the Genus database with same CATH topology
1WRGA 2GUVA 3HUSC 5AW5B 2E42A 1JY3O 1NKZB 4HYTB 2JJLA 1PFIA 1RF1A 1RE4A 1WT6A 1VDFA 3L37A 4N78E 1LT9B 1IFNA 5AW6B 1CZQA 2GUSA 2I1KA 3P8CE 1IK9A 3T97A 1HWTC 5CMZA 3N4XA 3H6PA 4WB4A 5AW9B 3GHGC 3V4QA 5KJ7C 5APWA 2J58A 3U59A 2Z4EA 4IFDK 1J1EC 4I1LA 1RE3C 2HODB 1IJDB 1ZR2A 2WSCH 3MTUE 3OJAB 2OYHB 3H32A 5CHXA 1FZFA 4WY4B 2YO2A 2WPSA 2XU6A 1KILB 1YTZI 1RY3A 1KILD 2P67A 1XTCC 1LWUA 1HUCA 2W6AA 1N7SA 1GD2E 5APQA 2R3CA 1GU5A 2C9NY 5APXA 4N6JA 3P8CD 5BU8B 1X79B 1JO5A 4XA4A 1MUUA 1M1JC 3N7NA 2QM8A 1GK4A 3KYQA 3B5NB 3OAKA 2C9LY 2VRSA 1G1JA 1W2EA 3B5ND 3V2NA 4Y99B 1HGVA 1GK6A 2R5DA 1URQA 1QL2A 3V4WA 2N1TC 3HD7B 3LW5H 2YNYA 3IR9A 1HTLC 4AQRD 1G1IA 1YTZT 3BRTB 1SQPK 3HD7D 3HRNA 4IFFA 2OYIB 4C46A 1FZEA 1GW3A 1HJBA 1DEBA 3M06A 1NAFA 2HODA 2P2UA 3H32B 1L0NK 3VN0A 1FZCC 1SP4A 2KLVA 2QM7A 1N7LA 2OYHA 1FAVA 1JOCA 1KFMA 1KILA 1LTAC 1IFDA 1FBMA 1AQ5A 1LWUB 2A45G 1FOSF 3M0DA 1RF0C 1ZR4A 3SWFA 1Z56A 4GKGA 3RK2B 3E1IA 3RK2D 3V5BA 1NOHA 3C9IA 3M9QA 1JY3P 2YKPA 1M7LA 1JY3N 1LTTC 2O1KA 2L5GB 5CCHC 1SFCB 2IFNA 3B5NA 2M8RA 5AW8B 1T3JA 1SFCD 4WY4C 3TYYA 3RL0B 3I5CA 1JUNA 5AW3B 1URQB 5APSA 3RL0D 1URQD 2NPSC 5AW1B 1GTWA 2FFDC 1JY2N 1NHLA 3KDPB 2FYUK 3HE5A 1J1DB 4JF7A 3HD7A 2N9BA 2HPCB 4N3YB 1N73B 1LTJC 3VYIA 1MV8A 2OYIA 4I2LC 1JY2O 1NH4A 3UIAA 1N86A 3VMYA 2KYVA 1L4AB 3CL3D 1GL2A 1SLQA 3RK3B 3V2RA 2E43A 1KFNA 4M3LA 1L4AD 2HLOA 3RK3D 1CI6A 5CCGD 1HH0A 1RF1C 1RE4C 1VPCA 4OH8B 1SVFA 2GM4A 2WPQA 3EFGA 3HUSB 2PAJA 3HTKA 1A02F 4W80A 2CPSA 4N78D 3BVHA 2FKWB 4IFMA 5AVWB 1H88A 2C0XA 2WWWA 4DOJA 1X8YA 1NKNA 4LLHA 1HGZA 1MZ9A 2POHA 5APTA 1T8ZA 1X9VA 2WPRA 2OARA 1SFCA 2O01H 2C0WA 3SWYA 3GHGB 2LKMA 3KPEA 1ZV8A 1KQLA 4GIFA 3M91A 4C7RA 4W7YA 1J1EB 2YMYA 3LIDA 1FZBA 3EQ2A 1ZLLA 3TNUB 5KJ7D 3L35A 5AW7B 4C7NA 1GZLA 1N7SC 1SQBK 3HE5B 1GW4A 2KOGA 5APVA 4AYCA 3MIWA 5AW4B 3KQGA 2YKOA 2HPCA 5AVVB 1N73A 1T2KC 2IPPA 1SQQK 1GL2B 3OA7A 1NTMK 2Q3IA 5BVZA 1E5WA 1JTHB 1L4AA 3O8ZA 1GL2D 2H43A 1CI6B 5CCGA 3LIEA 1GDTA 4HH2A 1LTGC 5AVYB 3V2QA 1M1JB 2Z5HA 1LT9C 3HTKB 2WITA 1JCDA 2KB7P 1JCCA 5AW0B 1S9KE 1JMMA 3HUSA 3WMM0 3IFMA 1IC2A 1G2CA 5AVTB 2ZFCA 3BASA 1N2DC 1NTKK 3U1AA 1SQXK 2KSJA 3HE4B 3PP5A 1IO4A 5AVZB 1ZN5A 4I6MC 3TSIA 3A7OA 2Q9IA 3B8EB 2JEEA 2OYHC 2FFDA 3MD0A 1KILC 2N1TD 2KP8A 5AVUB 3GHGA 2R5BA 5KJ7A 1LTIC 4C7NB 3M0DC 5APYA 3CI9A 3TNUA 1RE3A 1OWAA 5AW2B 1JY2P 2Z5IA 3NMDA 3BRVB 3U1CA 5KTBA 3NTNA 2H8PD 2WTYA 3V2PA 2Q7CA 2P7JA 1S9KD 5CJ4A 3P7KA 3VP9A 3M0AA 1HVVA 5AVXB 1GU4A 2A45I 2H7HA 1FJKA 3P8MC 1JTHA 4ZKPA 3BATA 3B5NC 3L4FA 1FZAA 2HYNA 1LTBC 3MUDA 5BU5A 1FDMA 2PP6A 5AVQB 2WSFH 2BASA 2WSEH 4Y99C 2WT7A 1MFZA 3A3YB 4DZOA 2HG5D 3II6A 1LGHB 1M1JA 2WZ7A 4JYBA 2HFED 1G2CB 2XZRA 5CCHD 1FZGA 3HD7C 3VMZA 4JYCA 2W27A 3NFQA 3CLQA 2OYIC 4WY4D 2M3BA 4KHXA 3HE4A 1NTZK 1XTGB 2I1JA 2NPSB 5CJ0A 1GL2C 3VP8A 4B86A 1HBWA 2FFDB 2O1JA 2NPSD 2N1TA 2A45H 1NO4A 2YKQA 1H8AA 1CSBA 1LTJB 2IFMA 1LWUC 3TK1A 3G3ZA 3MGNA 2W6BA 3RK2C 4AUWA 1FOSE 1FZCA 2CPBA 1RF1B 2R32A 2XDJA 2MJZA 4LGDE 3VMXA 2XV5A 1T3UA 4ZKUA 1RF0A 3P32A 1LT9A 1IFJA 4GT1A 2XNXA 1QL1A 1SFCC 1FJPA 1KZUB 3R2PA 1NWQA 2ZXEB 1YYCA 3L36A 2P1JA 2WT7B 2J59M 2FYZA 3RL0C 1DX7A 4O9BA 3VTPC 4W7ZA 1URQC 1SQVK 3A5TA 5CCHA 5AVSB 3VOPA 1OXZA 3NXSA 1EQ7A 3M9HA 5KLVK 4LC1A 1J1DC 1H89A 2YO3A 4WY4A 4EIJA 4XE5B 1IFMA 1N73C 4RESB 1NU1K 1JNMA 3M9BA 1N7SB 4EOTA 1J2JB 1L4AC 1A02J 2NPSA 2N1TB 2IX7C 1L0LK 3RK3C 1N7SD 5APUA 2FXMA 1LTSC 5CCGC 1DH3A 1AFOA 1IFIA 1LTJA 2Q5UA 5AVRB 4WBAA 3A2AA 1FU1A 1CW5A 1T2KD 1FZCB 2XKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7L A;  1FJK A;  2M3B A;  2KB7 P;  2KYV A;  1ZLL A;  2HYN A;  1FJP A; 
#chains in the Genus database with same CATH topology
 4WWI A;  5M1B A;  2KNC A;  2JJL A;  5C39 A;  1WT6 A;  5E79 E;  5AW6 B;  1T6A A;  2I1K A;  3P8C E;  4D6T D;  2K9J A;  3H6P A;  4K35 A;  5TIS H;  3U59 A;  2Z4E A;  1DD4 A;  3PLN A;  3KZI H;  1L0L G;  1ZR2 A;  3MTU E;  1DD3 A;  2YO2 A;  2JP3 A;  2P67 A;  1XTC C;  1EZV E;  4NPD A;  2W6A A;  1Q82 Q;  1N7S A;  5APQ A;  2R3C A;  1KC8 Q;  3GW6 A;  1K9M Q;  1X79 B;  2D2C D;  1R8E A;  4XA4 A;  2A06 D;  1KTM A;  1M1J C;  2QM8 A;  1GK4 A;  1K04 A;  3KYQ A;  2C9L Y;  2RH0 A;  1L0N E;  1W2E A;  3B5N D;  1OW6 A;  3V2N A;  1NYH A;  4Y99 B;  2O3J A;  2PFX A;  3GMA A;  1PL5 A;  3AE2 C;  2K3R A;  2YNY A;  4EI2 A;  1KB9 E;  1NVO A;  4C46 A;  3ZDM A;  1NAF A;  3H32 B;  3VN0 A;  1FZC C;  1AV1 A;  1SS1 A;  1KIL A;  1LTA C;  1YHQ P;  3L74 E;  1LWU B;  4H13 D;  1FC2 C;  1ZR4 A;  3D6Y A;  5TJH A;  1NAY A;  2WSC J;  2FYU E;  2IBZ G;  2YKP A;  3D71 A;  3RL0 g;  3CX5 D;  5CCH C;  2V7Q H;  3L70 J;  5TIS E;  2M8R A;  2ZYG A;  3RGU A;  2QJP C;  5AW3 B;  3KZI E;  3W67 A;  3KXD A;  1URQ D;  2FFD C;  1JY2 N;  2N9B A;  2RN0 A;  3K5B A;  1VF5 B;  1LTJ C;  1VQN P;  1N86 A;  4GOF A;  5KLI B;  2E74 C;  1KFN A;  3ABV C;  1L4A D;  4TLF A;  3RK3 D;  1CI6 A;  1RF1 C;  1VPC A;  1SVF A;  2GM4 A;  3HUS B;  1SQB E;  2FXO A;  3TGU E;  2AEF A;  3AE5 C;  1MZ9 A;  1PGQ A;  2OAR A;  2O01 H;  1BGY G;  4GIF A;  4C7R A;  1LNQ A;  2ZAE B;  1ZRT E;  3L35 A;  1HF9 A;  3FX0 A;  1PP9 J;  1GW4 A;  4AYC A;  3MIW A;  2IBZ D;  5AW4 B;  3AE6 C;  3H1J J;  1X22 A;  1N73 A;  1T2K C;  3G71 P;  1SQQ K;  1GL2 B;  1NTK E;  1NTM K;  2Q3I A;  2E75 B;  2H43 A;  4L76 A;  2R44 A;  2ZT9 D;  3USS A;  4HH2 A;  4BXL A;  5AVY B;  3V2Q A;  2BCC E;  1JCC A;  2JWA A;  3B71 A;  4H0L B;  1IC2 A;  3CWB G;  1N2D C;  3GF7 A;  3U1A A;  4I6M C;  2Y9Z A;  1R5L A;  3TSI A;  2FFD A;  2N1T D;  1SQQ G;  2R5B A;  1LTI C;  3AEF C;  4C7N B;  5KJ7 A;  3M0D C;  1KV4 A;  3CI9 A;  1NTM G;  1RE3 A;  1JY2 P;  3NMD A;  3CCE P;  3V2P A;  1AQT A;  2Q7C A;  3AEB C;  2FBW C;  2A45 I;  1FJK A;  3JCU H;  2HYN A;  1FDM A;  4Y99 C;  2WT7 A;  4PD4 H;  4DZO A;  1LGH B;  1IK7 A;  2AXT E;  2WSS H;  4Z1M H;  1W2B O;  2W27 A;  3CLQ A;  4WY4 D;  2W83 C;  3HE4 A;  4XFJ A;  2I1J A;  4YXW H;  4JPZ B;  2NPS B;  1HBW A;  4HKZ H;  2N9Y B;  1H8A A;  1LWU C;  1KYO I;  1JB0 J;  3EWK A;  1GMJ A;  2Q6Q A;  2W6B A;  1FOS E;  3CWB D;  3CX5 I;  1QGK B;  1UIX A;  2CPB A;  4R4L A;  3L73 E;  2Y0D A;  3I56 P;  4LGD E;  3Q5P A;  1T3U A;  1RF0 A;  3TDK A;  2XNX A;  1L0L E;  5DJT B;  2J59 M;  3JC2 2;  1SQQ D;  3SFE C;  1DX7 A;  4W7Z A;  1SQV K;  5AVS B;  3NXS A;  5KLV K;  4H44 D;  5KAF H;  1OX3 A;  2DW3 A;  1VQL P;  1JNM A;  3H1L J;  2WSF J;  2WSE J;  3S1K A;  4EOT A;  1RQU A;  2E76 C;  3C8V A;  1N7S D;  5CCG C;  5KLI C;  2NRG A;  2IYO A;  5CBO A;  3BCC G;  1IFI A;  5AVR B;  4WBA A;  1FU1 A;  3RK3 E;  4OWF A;  1FZC B;  2XKM A;  3JCU E;  3HUS C;  1WMK A;  2IYP A;  2BEZ F;  1P84 H;  2ZXX A;  4HYT B;  2ZVN B;  1RE4 A;  2LXC B;  1SQV G;  3PHL A;  4PD4 E;  2E5T A;  5KLV G;  4RJT A;  3WUV A;  3CC2 P;  1AVY A;  3BCC J;  5CMZ A;  4PJ0 H;  3S4R A;  5AW9 B;  4U3F J;  3RBZ A;  3OW2 O;  2HOD B;  1MFT A;  1IJD B;  4IL6 H;  1W5C E;  1OMI A;  2OYH B;  3H32 A;  1USE A;  3CCJ P;  1SQV J;  1YTZ I;  1KIL D;  5KLV J;  1LWU A;  1HUC A;  3B4S A;  3H1L D;  1BE3 J;  1RH5 B;  2IBZ E;  1M1K Q;  1GD2 E;  2E75 C;  2D2C B;  5APX A;  2L91 A;  1MUU A;  1YQ4 C;  3Q5S A;  3N7N A;  1EC5 A;  4H0L C;  1YJN P;  3B5N B;  3CC4 P;  4EYY Q;  3FXE A;  3GF3 A;  3SFD C;  3LW5 H;  3R4Y A;  3BCC D;  4AQR D;  1DEE G;  1YTZ T;  1SQP K;  3HRN A;  4PV1 D;  2A06 G;  4U3F D;  2KXP B;  1GW3 A;  1DEB A;  2P2U A;  1KFM A;  2P58 A;  4H13 B;  1IFD A;  1R5S A;  1SQV D;  1FBM A;  2A45 G;  5KLV D;  4CPG A;  1EXJ A;  3SWF A;  4JQ0 D;  1Z56 A;  2IDB A;  2R3S A;  1BE3 D;  1P84 E;  3AEC C;  3RK2 D;  3V5B A;  5H2F E;  1Q81 Q;  1JY3 P;  1LTT C;  4RKU J;  2B87 A;  2O1K A;  1BGY E;  3ITK A;  2KZJ A;  4PJ0 E;  3WUU A;  1SQP G;  5AW8 B;  1T3J A;  3TYY A;  1JUN A;  1URQ B;  3O6Q B;  4IL6 E;  2NPS C;  3VMA A;  1VQO P;  3KDP B;  4JF7 A;  3HD7 A;  1OVR A;  2BEQ D;  4EDF A;  3H1H J;  4N3Y B;  3VYI A;  2OYI A;  4I2L C;  1L4A B;  3CL3 D;  1GL2 A;  1OVU A;  3RK3 B;  1SQP J;  4RO0 A;  4M3L A;  1JMB A;  1OW7 A;  3CWB E;  3G6E P;  3IN6 A;  3EFG A;  2PAJ A;  3MUD C;  5AVW B;  2AEJ A;  2WWW A;  1K05 A;  1NKN A;  1SQQ E;  5APT A;  2WPR A;  1NTM E;  1SFC A;  1VQ7 P;  1SQX J;  1ZV8 A;  3GHG B;  1KQL A;  3M91 A;  4W7Y A;  2YMY A;  3TNU B;  5KJ7 D;  5AW7 B;  4C7N A;  1GZL A;  2KOG A;  5APV A;  4Y28 J;  2YIU C;  2HPC A;  5AVV B;  4UB8 E;  3OA7 A;  2Q3E A;  2ZT9 B;  1E5W A;  1JTH B;  1X0T A;  1SQP D;  3A0B H;  3L70 G;  1LTG C;  4YXD C;  3QWO C;  2QSI A;  3HTK B;  1S9K E;  2FYN B;  2KB7 P;  3WMM 0;  3Q3D A;  1KYO D;  2ZFC A;  4HJG H;  1OFC X;  3L75 G;  5AVZ B;  1ZN5 A;  3A7O A;  2OYH C;  1PGJ A;  1Q90 D;  2KP8 A;  5AVU B;  1NTZ J;  2OQQ A;  5AW2 B;  2Z5I A;  1VQ6 P;  5GTH H;  3L75 J;  2D2C C;  1BCC J;  1AVO A;  1YQ3 C;  3P7K A;  4ZMD A;  2Y9Y A;  2E76 B;  1TU3 F;  5GTI E;  3CCU P;  1HVV A;  5AVX B;  3P8M C;  4ZKP A;  3B5N C;  1FZA A;  3MUD A;  5AVQ B;  4BRY B;  1MFZ A;  1M1J A;  2YMK A;  2QJY B;  1KD1 Q;  2YXQ B;  4U7J A;  1S5L H;  1PP9 G;  4JYC A;  3NFQ A;  2JKV A;  3H1J G;  3BCC E;  4B86 A;  1U57 A;  1FDO A;  2AXT H;  3L70 D;  2A45 H;  3L72 G;  2YKQ A;  1NU1 J;  1CSB A;  4H13 C;  1H0T B;  1IFP A;  1VQM P;  1SQV E;  4AUW A;  3A0B E;  1FZC A;  3IAO A;  2KNC B;  5KLV E;  2R32 A;  2RMZ A;  3L75 D;  1EXI A;  1AJY A;  1YBK A;  3VMX A;  2XV5 A;  3CXH D;  4GT1 A;  3L72 J;  1RHZ B;  2E5Y A;  1FJP A;  1NWQ A;  1YYC A;  3L36 A;  3QH9 A;  4O9B A;  1URQ C;  1Q7Y Q;  4H44 B;  1KYO H;  5CCH A;  3VOP A;  3M9H A;  3H1I J;  1QVG O;  3W68 A;  2YO3 A;  3CX5 H;  4D6T E;  4RES B;  1N7S B;  3Q1M A;  1L4A C;  3RK3 C;  2K88 A;  5APU A;  3AE9 C;  5GTH E;  1IZN B;  2W6J H;  1AFO A;  1LTJ A;  2B9B A;  1WRG A;  1PP9 D;  2JDI H;  4GOD A;  5KAI H;  1PFI A;  3H1J D;  1RF1 A;  2JR8 A;  3L37 A;  2IZ0 A;  1ZME C;  1JM0 A;  2GUS A;  3CCV P;  1S5L E;  1NJI Q;  3T97 A;  3L72 D;  2A06 E;  1HWT C;  4WB4 A;  3GHG C;  4I1L A;  1VQ4 P;  4GDO A;  1VF5 D;  2QRX A;  2WSC H;  3C1L A;  3OJA B;  3H1I D;  3RBX A;  1BSN A;  1KIL B;  2K37 A;  2QJK B;  3LW5 J;  1L0N J;  2ZT9 C;  2OYO A;  2C9N Y;  2WVR A;  4N6J A;  2H89 C;  3P8C D;  1OIP A;  1Y9B A;  2V4H A;  2IZ1 A;  1SQP E;  2FYN C;  1S72 P;  5KKZ B;  3OAK A;  4OGQ D;  1G1J A;  3CD6 P;  1YIJ P;  2KZI A;  2NZ2 A;  2W90 A;  1AA0 A;  1HGV A;  1ZP0 C;  1KYO E;  2QG4 A;  3H1L G;  1URQ A;  3L74 J;  3V4W A;  2N1T C;  1EZV D;  3IR9 A;  3CX5 E;  4PV1 B;  1G1I A;  4A7P A;  3BRT B;  4NPF X;  3HD7 D;  2AXC A;  4IFF A;  1FZE A;  1HJB A;  2FYU J;  2LXB A;  2KLV A;  2QM7 A;  1FAV A;  4HB1 A;  1JOC A;  3M0D A;  1L0N D;  4I7Z C;  4IL6 X;  3RK2 B;  1VQ9 P;  1KN7 A;  3E1I A;  3AE4 C;  2YIU B;  5KAI E;  1NGM B;  1NOH A;  3C9I A;  4ASV A;  2I8D A;  1JY3 N;  4U3F G;  2L5G B;  2PGD A;  2QJY C;  1KB9 D;  4MN4 C;  5H2F H;  1SFC D;  4WY4 C;  3A0H H;  4PD4 I;  4IOI H;  5APS A;  3RL0 D;  2JWD A;  1BE3 G;  2G8Y A;  1GTW A;  3SSU A;  1NHL A;  1J1D B;  3Q2Y A;  4L73 A;  1N73 B;  5B66 H;  1MV8 A;  1JY2 O;  1SQB J;  3L70 E;  1EDL A;  1EDI A;  3TGU J;  3VMY A;  1SLQ A;  3V2R A;  3CXH I;  1YI2 P;  1HH0 A;  1NTK G;  3PJS K;  4OH8 B;  2WPQ A;  1EDK A;  3HTK A;  3PTZ A;  4W80 A;  4N78 D;  1LP1 B;  3G9R A;  2C0X A;  2KS1 B;  4DOJ A;  4LLH A;  1HGZ A;  4H44 C;  2POH A;  1X9V A;  3AEG C;  2C0W A;  4QMA A;  1NTK J;  3SWY A;  2LKM A;  3KPE A;  1FE6 A;  1J1E B;  3EQ2 A;  1ZLL A;  1QEX A;  1N7S C;  1EDJ A;  3HE5 B;  2BCC J;  3KQG A;  2YKO A;  2V7Q J;  2KI7 B;  1PV3 A;  4YTP C;  3TGU D;  3O8Z A;  5CCG A;  3LIE A;  1GDT A;  1L2P A;  1PP9 E;  2Z5H A;  4UB8 H;  3H1J E;  1JMM A;  3HUS A;  1P84 I;  1ZRT D;  3A0H E;  2QIW A;  3H1H G;  2W8Z A;  1SQX K;  2KSJ A;  3HE4 B;  2H88 C;  2KSE A;  2Q9I A;  3B8E B;  2JEE A;  3MP7 B;  3GLM A;  1KIL C;  1NTK D;  5B66 E;  3JSV C;  2QJK C;  1ZOY C;  5APY A;  2OTK E;  2K9Y A;  1OWA A;  2AEM A;  3BRV B;  5KTB A;  2H8P D;  2BCC D;  3AE8 C;  2P7J A;  2O01 J;  5CJ4 A;  1GU4 A;  2G3A A;  2RKL A;  1S1C X;  3L73 G;  5KKZ C;  3KHU A;  1LTB C;  5BU5 A;  2QA4 P;  3AE7 C;  1SQX G;  2WSF H;  1EZV I;  2BAS A;  2WSE H;  3A3Y B;  1Q86 Q;  5GTI H;  1VQP P;  1K8A Q;  1G2C B;  5CCH D;  3MHV A;  2OTJ P;  1FZG A;  1DIP A;  3VMZ A;  4PV1 C;  1FS0 E;  2M3B A;  4KHX A;  1NTZ K;  1XTG B;  3L73 J;  3VP8 A;  1PIX A;  3CC7 P;  1PPJ G;  1NO4 A;  3H1K G;  2IFM A;  1L0L J;  3I55 P;  3RK2 C;  2WPV B;  1KB9 I;  2E74 D;  3H1H D;  2XDJ A;  1M90 Q;  3L71 G;  1M8O B;  3CCM P;  3P32 A;  1RQV A;  4DT0 A;  3R2P A;  3H1K J;  2WQY C;  2ZXE B;  2P1J A;  3CMA P;  2FYZ A;  1NTZ G;  1FDI A;  4L75 A;  3VTP C;  1Q2N A;  1OXZ A;  1EQ7 A;  4LC1 A;  1J1D C;  2HR3 A;  5B5E H;  4XE5 B;  3L71 J;  1IFM A;  1BCC G;  3WU2 H;  1N73 C;  1NU1 K;  1A02 J;  2NPS A;  3L73 D;  1S5L X;  2N1T B;  2ZYA A;  2FXM A;  1LTS C;  2KIK A;  2OTL P;  1YJ9 P;  1SQX D;  1DH3 A;  2Y0C A;  3A2A A;  3PRJ A;  1T2K D;  2QVA A;  1L0L D;  3FWL A;  2GUV A;  1KIL E;  5AW5 B;  1PZQ A;  2E42 A;  2M0B A;  3D6Z A;  3H1L E;  1JY3 O;  1NKZ B;  1QX8 A;  1VDF A;  4N78 E;  1LT9 B;  4I7Z B;  1IFN A;  1CZQ A;  4DCK A;  1JEK A;  1IK9 A;  2ZJS E;  1PPJ D;  3N4X A;  1KQG B;  3H1K D;  4YPC A;  2UWJ E;  3CCS P;  2YXR B;  3V4Q A;  1NU1 G;  5KJ7 C;  5APW A;  2J58 A;  4IFD K;  1J1E C;  3E1R A;  1VQ5 P;  2M5A B;  3PH0 A;  1RE3 C;  1PGP A;  1FZF A;  5CHX A;  4WY4 B;  2WPS A;  2XU6 A;  5EFW B;  1RY3 A;  1K73 Q;  3L71 D;  3FGA D;  2QEX P;  3F89 A;  4PD4 D;  2PRR A;  2ZYD A;  4U3F E;  1GU5 A;  1NTZ D;  5BU8 B;  1JO5 A;  2B87 B;  1S3J A;  4OGQ B;  3H1I G;  2KUB A;  2VRS A;  3CCQ P;  1BE3 E;  1BCC D;  4WVZ A;  1GK6 A;  2R5D A;  2JO1 A;  1Y8A A;  4NPE A;  1QL2 A;  3AE3 C;  2K9J B;  3CME P;  3HD7 B;  1BDC A;  1N8R Q;  5B5E E;  1KQF B;  3AEA C;  1HTL C;  3WU2 E;  1E79 H;  2OYI B;  3V6I A;  2Y0E A;  3M06 A;  2HOD A;  1L0N K;  2P10 A;  1SP4 A;  1VQ8 P;  1N7L A;  1BGY J;  2OYH A;  1OZH A;  3AE1 C;  4GOE A;  1USD A;  1AQ5 A;  1FOS F;  2ZVO B;  1QVF O;  1RF0 C;  4GKG A;  1Y47 A;  1EZV G;  3EFF K;  1NU1 D;  1OVV A;  2XND H;  3FXD A;  3M9Q A;  1M7L A;  1LP1 A;  2KS1 A;  2LR2 A;  1SFC B;  2IFN A;  3B5N A;  3RL0 B;  3I5C A;  1L0N G;  2KK7 A;  5AW1 B;  2FYU K;  3HE5 A;  3CWB J;  4JBZ A;  2HPC B;  3Q5R A;  4TT3 H;  3SWK A;  1NH4 A;  3UIA A;  1P84 D;  5L8R J;  3IF4 A;  2KYV A;  3E7K A;  2FY8 A;  1YIT P;  2E43 A;  2E76 D;  2HLO A;  1UII A;  1BGY D;  5CCG D;  2WMM A;  1VL2 A;  1RE4 C;  1SQQ J;  2MKV A;  3AED C;  1NTM J;  3H1H E;  3L74 G;  2O01 N;  1A02 F;  2CPS A;  4DJG A;  3BVH A;  2FKW B;  4IFM A;  1H88 A;  3CCR P;  1D7M A;  1X8Y A;  4R4M A;  2CK3 H;  2FYU G;  2Q1K A;  1T8Z A;  2B89 A;  1U7M A;  3CXH H;  1S2E A;  4UB6 H;  3LID A;  4K3A A;  1FZB A;  3O6Q A;  1SQB K;  3FWN A;  2B88 A;  1LT1 A;  4ASW A;  2IPP A;  1SQX E;  5BVZ A;  1L4A A;  1GL2 D;  5K5G B;  1ZW0 A;  2GA1 A;  1CI6 B;  3TF5 A;  1LJ2 A;  2E75 D;  2SPZ A;  2FXP A;  1M1J B;  1NTM D;  1LT9 C;  1MKM A;  1YJW P;  1U7J A;  2WIT A;  1JCD A;  5AW0 B;  4BWN A;  1KMI Z;  3IFM A;  1G2C A;  5AVT B;  4H0L D;  3BAS A;  1NTK K;  1PPJ E;  1M56 D;  1VF5 C;  3PP5 A;  1IO4 A;  1SQB G;  2ITA A;  3H1K E;  3TGU G;  3MD0 A;  5CBN A;  3GHG A;  3AEE C;  2M3E A;  3TNU A;  1HJ0 A;  1PGO A;  3L74 D;  3U1C A;  3L71 E;  3NTN A;  2WTY A;  1S4X A;  1S9K D;  3H25 A;  3GG2 A;  5DJU B;  2K1A A;  3VP9 A;  2FYU D;  3M0A A;  2H7H A;  1NTZ E;  4OGQ C;  1JTH A;  3BAT A;  3L4F A;  2PP6 A;  2HG5 D;  2IBZ I;  3II6 A;  5E79 H;  2WZ7 A;  3F5H A;  3L75 E;  4JYB A;  1BCC E;  2HFE D;  2XZR A;  3HD7 C;  3CXH E;  2BCC G;  2QJP B;  4UB6 E;  2OYI C;  1BSH A;  5CJ0 A;  1GL2 C;  2FFD B;  4D6T G;  2O1J A;  2NPS D;  2N1T A;  3G4S P;  1OW8 A;  1LTJ B;  3TK1 A;  3G3Z A;  3MGN A;  3CPW O;  3S9O A;  3D70 A;  2E74 B;  1QLE D;  1RF1 B;  4OVN F;  1M57 D;  2MJZ A;  2OGU A;  1SQB D;  4ZKU A;  2QE7 H;  4D6T J;  1NU1 E;  1LT9 A;  1IFJ A;  3T97 B;  1QL1 A;  1BDD A;  1SFC C;  1KZU B;  5KAF E;  3MZW B;  2WT7 B;  3RL0 C;  1ZXG A;  4BRY A;  2M5A A;  3A5T A;  1VQK P;  1H89 A;  4KT0 J;  2KLU A;  4WY4 A;  4EIJ A;  3L72 E;  1KB9 H;  3M9B A;  4L74 A;  2J5U A;  1J2J B;  3CCL P;  1KOR A;  2IX7 C;  1L0L K;  4KJM A;  4ZNC A;  2Q5U A;  3H1I E;  1H0T A;  1CW5 A;  1KQS O;  3WUT A; 
#chains in the Genus database with same CATH homology
 1WRG A;  2GUV A;  3HUS C;  5AW5 B;  2E42 A;  1JY3 O;  1NKZ B;  4HYT B;  2JJL A;  1PFI A;  1RF1 A;  1RE4 A;  1WT6 A;  1VDF A;  3L37 A;  4N78 E;  1LT9 B;  1IFN A;  5AW6 B;  1CZQ A;  2GUS A;  2I1K A;  3P8C E;  1IK9 A;  3T97 A;  1HWT C;  5CMZ A;  3N4X A;  3H6P A;  4WB4 A;  5AW9 B;  3GHG C;  3V4Q A;  5KJ7 C;  5APW A;  2J58 A;  3U59 A;  2Z4E A;  4IFD K;  1J1E C;  4I1L A;  1RE3 C;  2HOD B;  1IJD B;  1ZR2 A;  2WSC H;  3MTU E;  3OJA B;  2OYH B;  3H32 A;  5CHX A;  1FZF A;  4WY4 B;  2YO2 A;  2WPS A;  2XU6 A;  1KIL B;  1YTZ I;  1RY3 A;  1KIL D;  2P67 A;  1XTC C;  1LWU A;  1HUC A;  2W6A A;  1N7S A;  1GD2 E;  5APQ A;  2R3C A;  1GU5 A;  2C9N Y;  5APX A;  4N6J A;  3P8C D;  5BU8 B;  1X79 B;  1JO5 A;  4XA4 A;  1MUU A;  1M1J C;  3N7N A;  2QM8 A;  1GK4 A;  3KYQ A;  3B5N B;  3OAK A;  2C9L Y;  2VRS A;  1G1J A;  1W2E A;  3B5N D;  3V2N A;  4Y99 B;  1HGV A;  1GK6 A;  2R5D A;  1URQ A;  1QL2 A;  3V4W A;  2N1T C;  3HD7 B;  3LW5 H;  2YNY A;  3IR9 A;  1HTL C;  4AQR D;  1G1I A;  1YTZ T;  3BRT B;  1SQP K;  3HD7 D;  3HRN A;  4IFF A;  2OYI B;  4C46 A;  1FZE A;  1GW3 A;  1HJB A;  1DEB A;  3M06 A;  1NAF A;  2HOD A;  2P2U A;  3H32 B;  1L0N K;  3VN0 A;  1FZC C;  1SP4 A;  2KLV A;  2QM7 A;  1N7L A;  2OYH A;  1FAV A;  1JOC A;  1KFM A;  1KIL A;  1LTA C;  1IFD A;  1FBM A;  1AQ5 A;  1LWU B;  2A45 G;  1FOS F;  3M0D A;  1RF0 C;  1ZR4 A;  3SWF A;  1Z56 A;  4GKG A;  3RK2 B;  3E1I A;  3RK2 D;  3V5B A;  1NOH A;  3C9I A;  3M9Q A;  1JY3 P;  2YKP A;  1M7L A;  1JY3 N;  1LTT C;  2O1K A;  2L5G B;  5CCH C;  1SFC B;  2IFN A;  3B5N A;  2M8R A;  5AW8 B;  1T3J A;  1SFC D;  4WY4 C;  3TYY A;  3RL0 B;  3I5C A;  1JUN A;  5AW3 B;  1URQ B;  5APS A;  3RL0 D;  1URQ D;  2NPS C;  5AW1 B;  1GTW A;  2FFD C;  1JY2 N;  1NHL A;  3KDP B;  2FYU K;  3HE5 A;  1J1D B;  4JF7 A;  3HD7 A;  2N9B A;  2HPC B;  4N3Y B;  1N73 B;  1LTJ C;  3VYI A;  1MV8 A;  2OYI A;  4I2L C;  1JY2 O;  1NH4 A;  3UIA A;  1N86 A;  3VMY A;  2KYV A;  1L4A B;  3CL3 D;  1GL2 A;  1SLQ A;  3RK3 B;  3V2R A;  2E43 A;  1KFN A;  4M3L A;  1L4A D;  2HLO A;  3RK3 D;  1CI6 A;  5CCG D;  1HH0 A;  1RF1 C;  1RE4 C;  1VPC A;  4OH8 B;  1SVF A;  2GM4 A;  2WPQ A;  3EFG A;  3HUS B;  2PAJ A;  3HTK A;  1A02 F;  4W80 A;  2CPS A;  4N78 D;  3BVH A;  2FKW B;  4IFM A;  5AVW B;  1H88 A;  2C0X A;  2WWW A;  4DOJ A;  1X8Y A;  1NKN A;  4LLH A;  1HGZ A;  1MZ9 A;  2POH A;  5APT A;  1T8Z A;  1X9V A;  2WPR A;  2OAR A;  1SFC A;  2O01 H;  2C0W A;  3SWY A;  3GHG B;  2LKM A;  3KPE A;  1ZV8 A;  1KQL A;  4GIF A;  3M91 A;  4C7R A;  4W7Y A;  1J1E B;  2YMY A;  3LID A;  1FZB A;  3EQ2 A;  1ZLL A;  3TNU B;  5KJ7 D;  3L35 A;  5AW7 B;  4C7N A;  1GZL A;  1N7S C;  1SQB K;  3HE5 B;  1GW4 A;  2KOG A;  5APV A;  4AYC A;  3MIW A;  5AW4 B;  3KQG A;  2YKO A;  2HPC A;  5AVV B;  1N73 A;  1T2K C;  2IPP A;  1SQQ K;  1GL2 B;  3OA7 A;  1NTM K;  2Q3I A;  5BVZ A;  1E5W A;  1JTH B;  1L4A A;  3O8Z A;  1GL2 D;  2H43 A;  1CI6 B;  5CCG A;  3LIE A;  1GDT A;  4HH2 A;  1LTG C;  5AVY B;  3V2Q A;  1M1J B;  2Z5H A;  1LT9 C;  3HTK B;  2WIT A;  1JCD A;  2KB7 P;  1JCC A;  5AW0 B;  1S9K E;  1JMM A;  3HUS A;  3WMM 0;  3IFM A;  1IC2 A;  1G2C A;  5AVT B;  2ZFC A;  3BAS A;  1N2D C;  1NTK K;  3U1A A;  1SQX K;  2KSJ A;  3HE4 B;  3PP5 A;  1IO4 A;  5AVZ B;  1ZN5 A;  4I6M C;  3TSI A;  3A7O A;  2Q9I A;  3B8E B;  2JEE A;  2OYH C;  2FFD A;  3MD0 A;  1KIL C;  2N1T D;  2KP8 A;  5AVU B;  3GHG A;  2R5B A;  5KJ7 A;  1LTI C;  4C7N B;  3M0D C;  5APY A;  3CI9 A;  3TNU A;  1RE3 A;  1OWA A;  5AW2 B;  1JY2 P;  2Z5I A;  3NMD A;  3BRV B;  3U1C A;  5KTB A;  3NTN A;  2H8P D;  2WTY A;  3V2P A;  2Q7C A;  2P7J A;  1S9K D;  5CJ4 A;  3P7K A;  3VP9 A;  3M0A A;  1HVV A;  5AVX B;  1GU4 A;  2A45 I;  2H7H A;  1FJK A;  3P8M C;  1JTH A;  4ZKP A;  3BAT A;  3B5N C;  3L4F A;  1FZA A;  2HYN A;  1LTB C;  3MUD A;  5BU5 A;  1FDM A;  2PP6 A;  5AVQ B;  2WSF H;  2BAS A;  2WSE H;  4Y99 C;  2WT7 A;  1MFZ A;  3A3Y B;  4DZO A;  2HG5 D;  3II6 A;  1LGH B;  1M1J A;  2WZ7 A;  4JYB A;  2HFE D;  1G2C B;  2XZR A;  5CCH D;  1FZG A;  3HD7 C;  3VMZ A;  4JYC A;  2W27 A;  3NFQ A;  3CLQ A;  2OYI C;  4WY4 D;  2M3B A;  4KHX A;  3HE4 A;  1NTZ K;  1XTG B;  2I1J A;  2NPS B;  5CJ0 A;  1GL2 C;  3VP8 A;  4B86 A;  1HBW A;  2FFD B;  2O1J A;  2NPS D;  2N1T A;  2A45 H;  1NO4 A;  2YKQ A;  1H8A A;  1CSB A;  1LTJ B;  2IFM A;  1LWU C;  3TK1 A;  3G3Z A;  3MGN A;  2W6B A;  3RK2 C;  4AUW A;  1FOS E;  1FZC A;  2CPB A;  1RF1 B;  2R32 A;  2XDJ A;  2MJZ A;  4LGD E;  3VMX A;  2XV5 A;  1T3U A;  4ZKU A;  1RF0 A;  3P32 A;  1LT9 A;  1IFJ A;  4GT1 A;  2XNX A;  1QL1 A;  1SFC C;  1FJP A;  1KZU B;  3R2P A;  1NWQ A;  2ZXE B;  1YYC A;  3L36 A;  2P1J A;  2WT7 B;  2J59 M;  2FYZ A;  3RL0 C;  1DX7 A;  4O9B A;  3VTP C;  4W7Z A;  1URQ C;  1SQV K;  3A5T A;  5CCH A;  5AVS B;  3VOP A;  1OXZ A;  3NXS A;  1EQ7 A;  3M9H A;  5KLV K;  4LC1 A;  1J1D C;  1H89 A;  2YO3 A;  4WY4 A;  4EIJ A;  4XE5 B;  1IFM A;  1N73 C;  4RES B;  1NU1 K;  1JNM A;  3M9B A;  1N7S B;  4EOT A;  1J2J B;  1L4A C;  1A02 J;  2NPS A;  2N1T B;  2IX7 C;  1L0L K;  3RK3 C;  1N7S D;  5APU A;  2FXM A;  1LTS C;  5CCG C;  1DH3 A;  1AFO A;  1IFI A;  1LTJ A;  2Q5U A;  5AVR B;  4WBA A;  3A2A A;  1FU1 A;  1CW5 A;  1T2K D;  1FZC B;  2XKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...