1FJPA

Nmr solution structure of phospholamban (c41f)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
52
structure length
52
Chain Sequence
MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILIFLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIAC PHOSPHOLAMBAN
publication title NMR Solution Structure of Phospholamban
pubmed rcsb
molecule tags Membrane protein
total genus 14
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fjpA00
2KYVA 2HYNA 1FJKA 1FJPA 2KB7P 1ZLLA 2M3BA 1N7LA
chains in the Genus database with same CATH superfamily
5TISH 3NXSA 4OGQD 1BCCE 2YMKA 1LTTC 3TDKA 1AQTA 3H1IG 1PP9G 2OTKE 2N1TA 1ZR2A 1EXIA 3PP5A 4L74A 1EDLA 2E5TA 3H6PA 1Y47A 4PV1B 3SFEC 1VDFA 1KB9D 1YYCA 5CBNA 1OW8A 1P84D 2ZT9B 1EDKA 1FZCA 1MKMA 2E76D 1H8AA 1SFCA 3L73G 1AVOA 1ZOYC 1NHLA 4NPDA 1NTKJ 3D70A 4GDOA 1KILC 3GHGA 2Q7CA 1MV8A 3A7OA 1GL2D 1NTMG 2FXMA 1SQPD 5BVZA 1S1CX 2H88C 1LP1B 4H44B 1J1EC 3KXDA 3NTNA 2PFXA 1S2EA 1NTMK 5APVA 1HUCA 1R5SA 4ASVA 1WRGA 1MZ9A 4C7NA 1KMIZ 3L70G 1VQLP 1X22A 2E75B 5GTHE 5CMZA 4WWIA 1KB9H 2YXRB 1N7SC 1KORA 3S4RA 3HD7A 3CMAP 1JTHB 2OYIA 1TU3F 4PD4E 2R44A 1NU1E 1A02F 2WSCJ 4ZNCA 3R4YA 2ITAA 2AXCA 4H13D 3MUDC 5AVXB 2YXQB 4NPFX 3G9RA 1SQBG 1NVOA 4EDFA 4U7JA 3M9BA 3CWBE 2KNCB 2XKMA 1S9KE 3GW6A 1EQ7A 3HE4B 5CCGD 5M1BA 1G1IA 2N1TC 2Z4EA 1D7MA 2Y0EA 3AEBC 3CC7P 2WSSH 3RBXA 1FZCC 5KKZB 2BEZF 2LR2A 1SFCC 1KD1Q 2KSJA 1GTWA 4Y99C 1CZQA 3GHGC 1L0NE 3L71G 1L0LJ 4N3YB 3UIAA 2J5UA 3H1LD 3BRTB 3CX5E 2W6AA 1NTZG 2M5AB 4YXDC 3H25A 1YQ4C 2E74D 1FZGA 5AW8B 2B89A 1L2PA 1JY3N 2NPSD 3M9QA 3H1ID 1PP9D 4R4MA 3RK3C 1NTZK 4GIFA 1JB0J 1NTKG 1KFNA 2HODB 1JY2P 3AEEC 1KILB 1SQXJ 3Q2YA 1G2CB 5DJTB 3L73D 1SP4A 4PJ0E 1H0TB 2I8DA 4UB6E 3HD7C 1UIIA 2CPBA 2OYIC 4AYCA 1VQMP 1NTMD 1J1EB 3ABVC 3G6EP 3A2AA 3L36A 3SSUA 1EZVI 5TISE 3WUTA 1GDTA 1BE3E 1KILE 4WY4D 2I1JA 1RH5B 2IBZE 5KJ7A 4K35A 1KTMA 2Z5HA 4KJMA 2H7HA 3IR9A 2FXPA 3TNUA 2ZVNB 1E79H 5APXA 2FYUJ 2FKWB 3L70D 1KYOI 1RHZB 2WPRA 4PV1D 1N7SB 1X0TA 2WITA 4PD4I 3CCJP 3AEDC 2W83C 3CLQA 5KLIC 3KYQA 1T2KC 1YQ3C 3IN6A 3CD6P 1GZLA 1OIPA 1LJ2A 4BRYB 1U7MA 1FOSF 1VF5C 1HH0A 3A0BH 2Z5IA 2ZFCA 3W68A 4YXWH 5CCHD 1JEKA 2Y9ZA 1SQBD 3H32B 2RH0A 3O8ZA 3K5BA 2K88A 2H43A 2N1TB 2JEEA 2C0XA 3SWYA 1M8OB 1YIJP 1JY3O 5CJ4A 2YMYA 2K9JA 2E75D 3OA7A 1L4AA 1KB9E 2AXTE 3H1JJ 5AVUB 1NWQA 1AQ5A 1FZCB 1SFCB 1L0LG 4Y99B 3GHGB 3CC2P 2D2CD 1ZW0A 1YBKA 5GTHH 5AVRB 3AEAC 1SQPE 3L71D 3U59A 2E42A 4Y28J 3LIEA 4U3FJ 1EXJA 1L0LK 3M0AA 4IFDK 3H1KJ 1RE4C 1CW5A 3MIWA 4JQ0D 5KJ7C 1KQLA 2CPSA 2POHA 2GUVA 2JWAA 1VQKP 2HG5D 2HYNA 4C7NB 2RKLA 2E43A 3RK3B 2QJPC 4YTPC 2KSEA 3GLMA 2E5YA 1DX7A 1SQXG 3L74E 2ZAEB 2GA1A 3CXHI 1NTKD 1ZRTD 1XTCC 1NAYA 3O6QA 2K37A 3HD7B 1OVUA 4DZOA 2AEMA 2ZXXA 1VQ5P 1LTAC 1PPJE 2OYHA 3R2PA 1SQVK 3GF3A 5EFWB 1ZR4A 1IFJA 3CCRP 2FYUG 1SLQA 4DCKA 1FDOA 4JPZB 2PRRA 1FS0E 2FBWC 3EFFK 3AE3C 3GG2A 5APWA 2A06G 1EDIA 2QJKC 3CX5H 5CHXA 4N6JA 2FYUK 1RY3A 3SWFA 2A45H 1L4AC 2O1JA 5AW6B 1BGYJ 5AW3B 2QEXP 1HF9A 2JDIH 3RL0D 3HUSA 2QIWA 1K9MQ 4LGDE 3KQGA 1VF5B 4NPEA 3TYYA 2UWJE 1FDMA 1LTIC 5APUA 2KUBA 3H1LE 1OWAA 3V2PA 1FOSE 2G3AA 3VP8A 3FX0A 4H0LC 1VQ9P 2QG4A 4UB6H 3MHVA 1FDIA 2WSEJ 1FZFA 3V4QA 3H1IE 1CI6B 3H1JG 3SWKA 1R5LA 5KLVE 1T6AA 2NRGA 1N7SD 1K05A 4EOTA 1NTZJ 1AFOA 1RQUA 2IFNA 3AE8C 1L0LD 2V7QJ 1L0NJ 4U3FG 2O01H 2PP6A 1DEEG 1PGPA 1ZMEC 3H1KG 1Q81Q 3A0BE 4EI2A 1RF1A 3BATA 1CSBA 1LTJB 2CK3H 2G8YA 3KZIE 1QVFO 1SQQJ 3C8VA 4D6TJ 2O1KA 2FY8A 1HVVA 1BSHA 2W6BA 2QJPB 3TGUJ 3TNUB 2LKMA 3WU2H 3AE7C 3U1CA 2FFDA 4YPCA 3L70E 4OH8B 1PFIA 4W7ZA 4W80A 3AE5C 1PZQA 1RE3A 5AVSB 1SQXD 4C7RA 4OVNF 3VOPA 1FZEA 2JO1A 2KLUA 1FZAA 5CJ0A 2AEFA 4ZKPA 2O3JA 3HUSC 2AXTH 3I55P 1P84H 1YJ9P 3II6A 2QE7H 3V4WA 3E7KA 5AW2B 4OGQC 1QGKB 1BE3J 1AV1A 3OW2O 4OWFA 4WBAA 2BEQD 1EZVG 5APSA 5AW0B 1SQBE 5CCGA 2IYOA 1FJPA 1S5LH 2FYUD 1DH3A 1HBWA 2QJKB 3C1LA 3HTKA 2K9JB 1HTLC 1M56D 2A06D 2P7JA 1L4AB 1BGYG 1MFZA 2QRXA 2I1KA 1LNQA 2YO2A 1YJNP 2N9BA 2QVAA 1IZNB 1YHQP 1G1JA 1HJBA 3VMAA 1RF0A 5AW9B 3CC4P 2LXCB 2JR8A 2MJZA 4GOFA 5DJUB 3JCUE 2KS1A 3CWBG 4BXLA 4H0LB 2W8ZA 2IZ0A 4CPGA 1RF1C 2NPSA 1IO4A 3EFGA 1URQD 1LTSC 5KTBA 2OTLP 2GM4A 3Q5SA 1M90Q 2WQYC 4L76A 2XZRA 2ZJSE 1OFCX 5KAFH 3MD0A 2FFDC 3H1JD 2P58A 3H1HE 2XDJA 1ZP0C 1NKNA 2QM8A 1RE3C 1NTKE 1L0NG 1ZRTE 2L5GB 1Q7YQ 4TLFA 2WSFH 3O6QB 1JO5A 1YITP 5B5EE 1KQGB 2RN0A 3M06A 2FXOA 1AVYA 2KB7P 2WZ7A 4A7PA 4U3FD 1L0NK 3MGNA 4WY4A 1SQQG 3L72E 3H1KD 4D6TG 2B88A 4H13C 1JOCA 3JC22 2OTJP 1N86A 3TGUG 3CCQP 3P32A 3F5HA 1SQQK 1SQVJ 3LW5H 1IFMA 5CCGC 2FYNC 1KQSO 3IF4A 1DEBA 3Q1MA 1HJ0A 4LC1A 3U1AA 3A0HE 1XTGB 1BDDA 3L74J 5AW4B 1IFIA 1X79B 2KOGA 3CCMP 3WMM0 2BCCJ 4RJTA 3MP7B 1ZN5A 2HPCA 4WB4A 3HUSB 2OQQA 1BE3G 1JM0A 1RF0C 1ZLLA 4GT1A 2ZT9D 1PL5A 4OGQB 4EIJA 3JSVC 4L75A 5CCHA 1QVGO 1SVFA 1QEXA 3L75J 4IFFA 4BWNA 5AVWB 5AVVB 2Q3EA 1LWUA 1IFDA 2NPSC 1EZVD 3BCCJ 3WU2E 4H44D 3PLNA 4RKUJ 1YTZT 2KP8A 1GU4A 4GOEA 1USDA 3KZIH 2KZJA 5AVQB 3GF7A 1UIXA 1BGYD 1KYOD 1JTHA 3SFDC 1L0LE 2YKOA 3VYIA 4PD4D 1EC5A 2JP3A 1KC8Q 1T3UA 4MN4C 1P84E 3A5TA 2K1AA 3M9HA 2QA4P 3AE4C 5L8RJ 4AQRD 1RF1B 1X8YA 3CX5I 3AE9C 3CWBD 2WT7A 2KNCA 2A45I 2J59M 1Q2NA 1S5LE 3OAKA 1QLED 2FFDB 1BCCJ 1GK6A 2YO3A 5KLVJ 2ZYDA 3CCSP 1NTZD 3CI9A 1FE6A 1LTGC 1SQXE 4IL6E 1VQ7P 4DJGA 2M0BA 1L0ND 1NAFA 3FGAD 3P8MC 1H89A 1Q82Q 3P8CD 1IC2A 2L91A 4C46A 2WPVB 2WTYA 1ZV8A 3Q5PA 1QL1A 2KXPB 3G4SP 3MZWB 1JY2O 1SQQD 5CCHC 4D6TD 1SQVG 2OYIB 2IBZI 1J1DC 4R4LA 3HE5A 2ZYGA 3TGUD 3HRNA 3V5BA 2FYNB 3RK2C 3D6YA 1LWUC 3CCUP 2FYUE 3JCUH 2KYVA 3L74G 5AVZB 2Q5UA 5KAFE 1VPCA 3HTKB 2A06E 2HODA 4WVZA 4XFJA 5APYA 2M3EA 2BCCG 3B5NA 5K5GB 4IOIH 1NH4A 2D2CC 1FC2C 5H2FH 1NKZB 2H89C 1DIPA 1YJWP 1N2DC 2W27A 3CXHD 3FXEA 2Q3IA 5AW1B 3VMYA 1PPJG 1K04A 2R3CA 3CPWO 5KLIB 3L75G 1IFNA 1BE3D 1YTZI 1KILD 3A3YB 3AE1C 3KPEA 5B5EH 3ZDMA 3BCCG 1VQNP 2NPSB 5BU5A 1NU1J 3PJSK 1SS1A 5AW7B 1N7SA 3H1JE 1KB9I 3CWBJ 2QM7A 1QX8A 1P84I 2Q1KA 2M8RA 2QSIA 3PH0A 1RQVA 3CCEP 1PP9E 3A0HH 1JNMA 3B71A 5APTA 1GU5A 4U3FE 3WUUA 5KAIH 3PRJA 3WUVA 4O9BA 1GL2A 3H1KE 1KFMA 4GODA 3L73E 4AUWA 1U57A 3H32A 2C9NY 2XV5A 4IFMA 1W2BO 1NTME 2WSCH 1BCCG 2YNYA 1K8AQ 1OVVA 3EWKA 5KLVG 2HR3A 1OXZA 3VTPC 1Y8AA 2JKVA 2OYHC 2WWWA 3CL3D 3KDPB 4L73A 1N73A 3H1HJ 1H88A 3MTUE 3AE2C 5KLVK 3B5NC 2B87A 2N1TD 3M91A 3EQ2A 1NYHA 3IFMA 1VQ4P 3RL0C 2HPCB 1M7LA 2WPQA 2P67A 3RGUA 2YIUC 1KN7A 3NMDA 3E1IA 2YKPA 1HWTC 4ASWA 3TK1A 1GD2E 1SFCD 3F89A 3L72J 3N7NA 3P7KA 2KI7B 2H8PD 5APQA 1J1DB 3PTZA 4M3LA 4N78D 2JWDA 1M1KQ 1LT1A 3RK2B 2PAJA 1SQVD 1LWUB 3VMXA 1EZVE 1MUUA 4HYTB 3CMEP 4I7ZC 2K3RA 1WT6A 3L74D 3OJAB 3M0DA 2IDBA 5B66E 2W6JH 1LT9A 4I1LA 1IFPA 4HKZH 2BCCD 2D2CB 1W2EA 1BGYE 1W5CE 1KQFB 1KYOE 3RK3D 2RMZA 1HGVA 1VQPP 2O01J 2BASA 2FYZA 1X9VA 2E76C 2K9YA 1GW4A 4IL6H 1PPJD 2KZIA 4DT0A 3L75D 1M57D 1GL2C 3KHUA 1OX3A 1NU1G 1LGHB 3HD7D 2WT7B 3PHLA 3VN0A 1URQA 3V2QA 1JY3P 3BCCD 1S4XA 3L71E 2OGUA 1N7LA 2PGDA 5E79E 2ZVOB 2O01N 1SQBK 4XA4A 1NU1K 1A02J 2XNDH 1K73Q 1BSNA 1NTZE 3Q5RA 1N73C 2VRSA 2N9YB 3AEGC 1NO4A 3D71A 5H2FE 1M1JA 3CCVP 3FWNA 3G3ZA 3V2NA 4DOJA 3P8CE 2P1JA 2P10A 2GUSA 3ITKA 1PIXA 3VP9A 1T2KD 1Y9BA 2NZ2A 1DD3A 3LIDA 4I2LC 1SQQE 1MFTA 1IK9A 4D6TE 2IZ1A 1PGJA 5AW5B 3HE5B 3C9IA 4W7YA 4I6MC 1SQPJ 3T97A 3RL0g 3TGUE 1NJIQ 1VF5D 5BU8B 3N4XA 4EYYQ 1CI6A 5GTIH 1BCCD 1IJDB 2OYHB 2A45G 4UB8E 4JYCA 1T8ZA 3H1HG 4ZMDA 5KLVD 1YI2P 1QL2A 1Z56A 2R5BA 2OARA 1GK4A 3B5NB 3M0DC 1DD4A 1PGOA 1GMJA 1LT9C 4QMAA 3RL0B 2P2UA 3B8EB 1IK7A 3E1RA 2HFED 4XE5B 1NTKK 4Z1MH 1VQ8P 2YIUB 1OVRA 3IAOA 3CXHE 1OMIA 2J58A 3L72G 4RESB 5KAIE 2Y0DA 2R32A 1HGZA 1Q90D 1RE4A 2WPSA 1LTJA 3VMZA 1EDJA 4LLHA 3BASA 1R8EA 1N8RQ 1LP1A 1U7JA 1OZHA 1JY2N 4I7ZB 1URQC 2JJLA 2IBZG 4HJGH 3QH9A 2HLOA 4TT3H 1VL2A 2E74C 5KJ7D 1AA0A 2QJYC 3GMAA 2IPPA 2WSFJ 5CBOA 2Q9IA 2E76B 1M1JC 4KHXA 3V2RA 2R3SA 3G71P 4JF7A 2IFMA 1E5WA 2R5DA 1GL2B 3AEFC 1GW3A 3FXDA 2DW3A 2ZXEB 4RO0A 2YKQA 1NU1D 1VQOP 2KLVA 3RK2D 3D6ZA 3LW5J 3I5CA 1JCCA 3H1LJ 4WY4C 1FBMA 2V4HA 4GKGA 2WVRA 1N73B 1S9KD 3HE4A 4JBZA 2WMMA 1VQ6P 2B87B 1AJYA 3H1IJ 1PP9J 2B9BA 1NOHA 2IYPA 2OYOA 4PV1C 3CCLP 1L4AD 1FJKA 1PV3A 1PGQA 5AVTB 5B66H 2ZT9C 2LXBA 1KYOH 1SQPG 4HB1A 3L73J 4N78E 4KT0J 1LTJC 1OW6A 2XNXA 4PD4H 2Q6QA 1SQVE 1NTMJ 3S1KA 1OW7A 4B86A 3L4FA 4H13B 2IX7C 4H44C 1SQPK 4ZKUA 3AE6C 3CX5D 2M5AA 3TSIA 1J2JB 4H0LD 2Y0CA 3H1HD 2WSEH 1WMKA 3Q3DA 3RBZA 2C9LY 2AEJA 1LT9B 2ZYAA 2BCCE 1JCDA 5E79H 2MKVA 3I56P 3QWOC 3B4SA 3RK3E 3W67A 1SQXK 1JMMA 2E75C 3L70J 2W90A 1KILA 3L72D 1G2CA 5AVYB 3TF5A 2KK7A 2KIKA 4JYBA 3BVHA 3L75E 1H0TA 2XU6A 2V7QH 1FZBA 3BRVB 1FAVA 1JMBA 3NFQA 4HH2A 1URQB 2SPZA 3BCCE 5GTIE 3V6IA 2KS1B 1FU1A 3USSA 2IBZD 2Y9YA 2E74B 3S9OA 1KV4A 5TJHA 1Q86Q 1LTBC 1ZXGA 1SQBJ 2QJYB 1KZUB 1BDCA 3B5ND 1S3JA 3L37A 1S72P 1NGMB 3FWLA 4UB8H 3L35A 1M1JB 1JUNA 2C0WA 2M3BA 1S5LX 1T3JA 5KKZC 4K3AA 4PJ0H 4BRYA 3CXHH 3H1LG 3AECC 3T97B 5C39A 3L71J 4IL6X 1USEA 4WY4B 3MUDA
chains in the Genus database with same CATH topology
3WMM0 3NXSA 1ZN5A 2HPCA 4WB4A 1GL2C 1LTTC 3HUSB 1DX7A 1LGHB 3HD7D 2WT7B 3VN0A 1URQA 3V2QA 1JY3P 1RF0C 1ZLLA 2N1TA 4GT1A 1ZR2A 1N7LA 4EIJA 3PP5A 1XTCC 5CCHA 1SQBK 4XA4A 1NU1K 3H6PA 3HD7B 1SVFA 4DZOA 1VDFA 1A02J 4IFFA 1YYCA 5AVWB 5AVVB 1FZCA 1LWUA 1IFDA 2NPSC 1H8AA 1N73C 1SFCA 2VRSA 1NHLA 1LTAC 1KILC 1NO4A 3GHGA 2Q7CA 2OYHA 1MV8A 3A7OA 3R2PA 1SQVK 1YTZT 2KP8A 1GU4A 1M1JA 1GL2D 2FXMA 5AVQB 3G3ZA 1ZR4A 5BVZA 1IFJA 3V2NA 4DOJA 3P8CE 1SLQA 2P1JA 1J1EC 2GUSA 3NTNA 5APWA 3VP9A 1T2KD 1JTHA 1NTMK 5APVA 4I2LC 3LIDA 5CHXA 1HUCA 1IK9A 2YKOA 3VYIA 4N6JA 2FYUK 5AW5B 1RY3A 3HE5B 2A45H 1WRGA 3SWFA 1MZ9A 3C9IA 1T3UA 4W7YA 1L4AC 4I6MC 2O1JA 3T97A 5AW6B 3A5TA 3M9HA 4C7NA 5BU8B 3N4XA 1CI6A 1IJDB 2OYHB 2A45G 5AW3B 4JYCA 1T8ZA 4AQRD 1RF1B 1X8YA 3RL0D 3HUSA 5CMZA 2WT7A 1QL2A 4LGDE 1Z56A 2R5BA 2OARA 2A45I 3KQGA 1GK4A 2J59M 1N7SC 3B5NB 3M0DC 3TYYA 1FDMA 1LTIC 3OAKA 5APUA 1LT9C 1OWAA 3RL0B 2P2UA 3B8EB 2HFED 3V2PA 3HD7A 4XE5B 2FFDB 1FOSE 1JTHB 3VP8A 1NTKK 2OYIA 1GK6A 2YO3A 2J58A 1FZFA 3CI9A 1LTGC 1A02F 4RESB 3V4QA 2R32A 1HGZA 1CI6B 1RE4A 2WPSA 5AVXB 1LTJA 1NAFA 3P8MC 3M9BA 3VMZA 1H89A 4LLHA 3BASA 2XKMA 3P8CD 1IC2A 4C46A 1N7SD 1S9KE 1JY2N 1EQ7A 4EOTA 1URQC 3HE4B 2WTYA 1ZV8A 1AFOA 5CCGD 2IFNA 2JJLA 1QL1A 1G1IA 2N1TC 2HLOA 1JY2O 2Z4EA 5CCHC 2OYIB 2O01H 1J1DC 3HE5A 2PP6A 5KJ7D 3HRNA 3V5BA 3RK2C 1FZCC 1LWUC 2KYVA 1SFCC 5AVZB 2IPPA 2KSJA 1RF1A 2Q9IA 1GTWA 3BATA 1CZQA 1CSBA 2Q5UA 4Y99C 3GHGC 1LTJB 1VPCA 3HTKB 1M1JC 2HODA 2O1KA 4KHXA 1HVVA 4N3YB 5APYA 3V2RA 3B5NA 4JF7A 2W6BA 3UIAA 2IFMA 1E5WA 1NH4A 3TNUB 2LKMA 2R5DA 3U1CA 1GL2B 3BRTB 2FFDA 1GW3A 1NKZB 2W6AA 4OH8B 1PFIA 4W7ZA 4W80A 1N2DC 2ZXEB 2W27A 1RE3A 5AW1B 2Q3IA 2YKQA 1FZGA 3VMYA 5AW8B 5AVSB 2R3CA 1JY3N 2KLVA 4C7RA 2NPSD 3RK2D 3VOPA 3M9QA 1FZEA 3I5CA 1IFNA 1YTZI 1JCCA 1KILD 4WY4C 1FZAA 3RK3C 5CJ0A 3A3YB 1NTZK 3KPEA 4GIFA 1FBMA 4ZKPA 4GKGA 1KFNA 3HUSC 2HODB 2NPSB 1N73B 5BU5A 1S9KD 1JY2P 3HE4A 1KILB 3II6A 3V4WA 1G2CB 5AW2B 1NOHA 1SP4A 3HD7C 4WBAA 5AW7B 1N7SA 5APSA 2CPBA 2OYIC 5AW0B 4AYCA 2QM7A 5CCGA 1L4AD 1FJKA 1J1EB 5AVTB 2M8RA 1FJPA 3A2AA 3L36A 1DH3A 1HBWA 1GDTA 4WY4D 2I1JA 3HTKA 5KJ7A 1JNMA 1HTLC 4N78E 1LTJC 2P7JA 1L4AB 2Z5HA 2XNXA 5APTA 1GU5A 2H7HA 1MFZA 3IR9A 2I1KA 2YO2A 4B86A 3TNUA 3L4FA 2IX7C 5APXA 4O9BA 1SQPK 1GL2A 4ZKUA 1KFMA 2FKWB 2N9BA 4AUWA 3TSIA 1J2JB 2WPRA 1G1JA 3H32A 1HJBA 1N7SB 2WSEH 2C9NY 1RF0A 5AW9B 2XV5A 2WITA 4IFMA 2C9LY 2MJZA 2WSCH 1LT9B 2YNYA 3CLQA 1JCDA 3KYQA 1T2KC 1OXZA 3VTPC 1SQXK 2OYHC 2WWWA 1JMMA 3CL3D 1GZLA 3KDPB 1RF1C 2NPSA 1N73A 1IO4A 1FOSF 3EFGA 1KILA 1HH0A 1H88A 3MTUE 1URQD 1LTSC 5KLVK 3B5NC 1G2CA 2Z5IA 5KTBA 5AVYB 2N1TD 2ZFCA 3M91A 2GM4A 4JYBA 3EQ2A 3IFMA 3RL0C 3BVHA 2XZRA 2HPCB 5CCHD 1M7LA 2XU6A 3BRVB 1FZBA 3MD0A 2FFDC 1FAVA 2WPQA 2P67A 3H32B 2XDJA 3O8ZA 3NFQA 4HH2A 1URQB 3NMDA 1NKNA 3E1IA 2YKPA 2QM8A 1RE3C 2H43A 2N1TB 2JEEA 2C0XA 3SWYA 1HWTC 3TK1A 1GD2E 2L5GB 2WSFH 1SFCD 3N7NA 1JY3O 3P7KA 5CJ4A 1JO5A 1FU1A 2YMYA 2H8PD 5APQA 1J1DB 4M3LA 4N78D 3M06A 3OA7A 1L4AA 2KB7P 1LTBC 2WZ7A 2PAJA 3RK2B 5AVUB 1NWQA 1AQ5A 1FZCB 1L0NK 1KZUB 1LWUB 3MGNA 3VMXA 4WY4A 1MUUA 1SFCB 3B5ND 4HYTB 4Y99B 3GHGB 3L37A 1JOCA 1WT6A 3L35A 1M1JB 1N86A 1JUNA 3OJAB 5AVRB 3M0DA 2C0WA 3P32A 3U59A 2E42A 2M3BA 1LT9A 4I1LA 3LIEA 1SQQK 5CCGC 3LW5H 1L0LK 1IFMA 1W2EA 1T3JA 3M0AA 4IFDK 1DEBA 4LC1A 3RK3D 3U1AA 1RE4C 1CW5A 1HGVA 3MIWA 1XTGB 2BASA 2FYZA 1X9VA 5KJ7C 1KQLA 2CPSA 5AW4B 2POHA 2GUVA 1IFIA 1X79B 2KOGA 2HG5D 2HYNA 4C7NB 1GW4A 2E43A 4WY4B 3MUDA 3RK3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KYV A;  2HYN A;  1FJK A;  1FJP A;  2KB7 P;  1ZLL A;  2M3B A;  1N7L A; 
#chains in the Genus database with same CATH topology
 5TIS H;  3NXS A;  4OGQ D;  1BCC E;  2YMK A;  1LTT C;  3TDK A;  1AQT A;  3H1I G;  1PP9 G;  2OTK E;  2N1T A;  1ZR2 A;  1EXI A;  3PP5 A;  4L74 A;  1EDL A;  2E5T A;  3H6P A;  1Y47 A;  4PV1 B;  3SFE C;  1VDF A;  1KB9 D;  1YYC A;  5CBN A;  1OW8 A;  1P84 D;  2ZT9 B;  1EDK A;  1FZC A;  1MKM A;  2E76 D;  1H8A A;  1SFC A;  3L73 G;  1AVO A;  1ZOY C;  1NHL A;  4NPD A;  1NTK J;  3D70 A;  4GDO A;  1KIL C;  3GHG A;  2Q7C A;  1MV8 A;  3A7O A;  1GL2 D;  1NTM G;  2FXM A;  1SQP D;  5BVZ A;  1S1C X;  2H88 C;  1LP1 B;  4H44 B;  1J1E C;  3KXD A;  3NTN A;  2PFX A;  1S2E A;  1NTM K;  5APV A;  1HUC A;  1R5S A;  4ASV A;  1WRG A;  1MZ9 A;  4C7N A;  1KMI Z;  3L70 G;  1VQL P;  1X22 A;  2E75 B;  5GTH E;  5CMZ A;  4WWI A;  1KB9 H;  2YXR B;  1N7S C;  1KOR A;  3S4R A;  3HD7 A;  3CMA P;  1JTH B;  2OYI A;  1TU3 F;  4PD4 E;  2R44 A;  1NU1 E;  1A02 F;  2WSC J;  4ZNC A;  3R4Y A;  2ITA A;  2AXC A;  4H13 D;  3MUD C;  5AVX B;  2YXQ B;  4NPF X;  3G9R A;  1SQB G;  1NVO A;  4EDF A;  4U7J A;  3M9B A;  3CWB E;  2KNC B;  2XKM A;  1S9K E;  3GW6 A;  1EQ7 A;  3HE4 B;  5CCG D;  5M1B A;  1G1I A;  2N1T C;  2Z4E A;  1D7M A;  2Y0E A;  3AEB C;  3CC7 P;  2WSS H;  3RBX A;  1FZC C;  5KKZ B;  2BEZ F;  2LR2 A;  1SFC C;  1KD1 Q;  2KSJ A;  1GTW A;  4Y99 C;  1CZQ A;  3GHG C;  1L0N E;  3L71 G;  1L0L J;  4N3Y B;  3UIA A;  2J5U A;  3H1L D;  3BRT B;  3CX5 E;  2W6A A;  1NTZ G;  2M5A B;  4YXD C;  3H25 A;  1YQ4 C;  2E74 D;  1FZG A;  5AW8 B;  2B89 A;  1L2P A;  1JY3 N;  2NPS D;  3M9Q A;  3H1I D;  1PP9 D;  4R4M A;  3RK3 C;  1NTZ K;  4GIF A;  1JB0 J;  1NTK G;  1KFN A;  2HOD B;  1JY2 P;  3AEE C;  1KIL B;  1SQX J;  3Q2Y A;  1G2C B;  5DJT B;  3L73 D;  1SP4 A;  4PJ0 E;  1H0T B;  2I8D A;  4UB6 E;  3HD7 C;  1UII A;  2CPB A;  2OYI C;  4AYC A;  1VQM P;  1NTM D;  1J1E B;  3ABV C;  3G6E P;  3A2A A;  3L36 A;  3SSU A;  1EZV I;  5TIS E;  3WUT A;  1GDT A;  1BE3 E;  1KIL E;  4WY4 D;  2I1J A;  1RH5 B;  2IBZ E;  5KJ7 A;  4K35 A;  1KTM A;  2Z5H A;  4KJM A;  2H7H A;  3IR9 A;  2FXP A;  3TNU A;  2ZVN B;  1E79 H;  5APX A;  2FYU J;  2FKW B;  3L70 D;  1KYO I;  1RHZ B;  2WPR A;  4PV1 D;  1N7S B;  1X0T A;  2WIT A;  4PD4 I;  3CCJ P;  3AED C;  2W83 C;  3CLQ A;  5KLI C;  3KYQ A;  1T2K C;  1YQ3 C;  3IN6 A;  3CD6 P;  1GZL A;  1OIP A;  1LJ2 A;  4BRY B;  1U7M A;  1FOS F;  1VF5 C;  1HH0 A;  3A0B H;  2Z5I A;  2ZFC A;  3W68 A;  4YXW H;  5CCH D;  1JEK A;  2Y9Z A;  1SQB D;  3H32 B;  2RH0 A;  3O8Z A;  3K5B A;  2K88 A;  2H43 A;  2N1T B;  2JEE A;  2C0X A;  3SWY A;  1M8O B;  1YIJ P;  1JY3 O;  5CJ4 A;  2YMY A;  2K9J A;  2E75 D;  3OA7 A;  1L4A A;  1KB9 E;  2AXT E;  3H1J J;  5AVU B;  1NWQ A;  1AQ5 A;  1FZC B;  1SFC B;  1L0L G;  4Y99 B;  3GHG B;  3CC2 P;  2D2C D;  1ZW0 A;  1YBK A;  5GTH H;  5AVR B;  3AEA C;  1SQP E;  3L71 D;  3U59 A;  2E42 A;  4Y28 J;  3LIE A;  4U3F J;  1EXJ A;  1L0L K;  3M0A A;  4IFD K;  3H1K J;  1RE4 C;  1CW5 A;  3MIW A;  4JQ0 D;  5KJ7 C;  1KQL A;  2CPS A;  2POH A;  2GUV A;  2JWA A;  1VQK P;  2HG5 D;  2HYN A;  4C7N B;  2RKL A;  2E43 A;  3RK3 B;  2QJP C;  4YTP C;  2KSE A;  3GLM A;  2E5Y A;  1DX7 A;  1SQX G;  3L74 E;  2ZAE B;  2GA1 A;  3CXH I;  1NTK D;  1ZRT D;  1XTC C;  1NAY A;  3O6Q A;  2K37 A;  3HD7 B;  1OVU A;  4DZO A;  2AEM A;  2ZXX A;  1VQ5 P;  1LTA C;  1PPJ E;  2OYH A;  3R2P A;  1SQV K;  3GF3 A;  5EFW B;  1ZR4 A;  1IFJ A;  3CCR P;  2FYU G;  1SLQ A;  4DCK A;  1FDO A;  4JPZ B;  2PRR A;  1FS0 E;  2FBW C;  3EFF K;  3AE3 C;  3GG2 A;  5APW A;  2A06 G;  1EDI A;  2QJK C;  3CX5 H;  5CHX A;  4N6J A;  2FYU K;  1RY3 A;  3SWF A;  2A45 H;  1L4A C;  2O1J A;  5AW6 B;  1BGY J;  5AW3 B;  2QEX P;  1HF9 A;  2JDI H;  3RL0 D;  3HUS A;  2QIW A;  1K9M Q;  4LGD E;  3KQG A;  1VF5 B;  4NPE A;  3TYY A;  2UWJ E;  1FDM A;  1LTI C;  5APU A;  2KUB A;  3H1L E;  1OWA A;  3V2P A;  1FOS E;  2G3A A;  3VP8 A;  3FX0 A;  4H0L C;  1VQ9 P;  2QG4 A;  4UB6 H;  3MHV A;  1FDI A;  2WSE J;  1FZF A;  3V4Q A;  3H1I E;  1CI6 B;  3H1J G;  3SWK A;  1R5L A;  5KLV E;  1T6A A;  2NRG A;  1N7S D;  1K05 A;  4EOT A;  1NTZ J;  1AFO A;  1RQU A;  2IFN A;  3AE8 C;  1L0L D;  2V7Q J;  1L0N J;  4U3F G;  2O01 H;  2PP6 A;  1DEE G;  1PGP A;  1ZME C;  3H1K G;  1Q81 Q;  3A0B E;  4EI2 A;  1RF1 A;  3BAT A;  1CSB A;  1LTJ B;  2CK3 H;  2G8Y A;  3KZI E;  1QVF O;  1SQQ J;  3C8V A;  4D6T J;  2O1K A;  2FY8 A;  1HVV A;  1BSH A;  2W6B A;  2QJP B;  3TGU J;  3TNU B;  2LKM A;  3WU2 H;  3AE7 C;  3U1C A;  2FFD A;  4YPC A;  3L70 E;  4OH8 B;  1PFI A;  4W7Z A;  4W80 A;  3AE5 C;  1PZQ A;  1RE3 A;  5AVS B;  1SQX D;  4C7R A;  4OVN F;  3VOP A;  1FZE A;  2JO1 A;  2KLU A;  1FZA A;  5CJ0 A;  2AEF A;  4ZKP A;  2O3J A;  3HUS C;  2AXT H;  3I55 P;  1P84 H;  1YJ9 P;  3II6 A;  2QE7 H;  3V4W A;  3E7K A;  5AW2 B;  4OGQ C;  1QGK B;  1BE3 J;  1AV1 A;  3OW2 O;  4OWF A;  4WBA A;  2BEQ D;  1EZV G;  5APS A;  5AW0 B;  1SQB E;  5CCG A;  2IYO A;  1FJP A;  1S5L H;  2FYU D;  1DH3 A;  1HBW A;  2QJK B;  3C1L A;  3HTK A;  2K9J B;  1HTL C;  1M56 D;  2A06 D;  2P7J A;  1L4A B;  1BGY G;  1MFZ A;  2QRX A;  2I1K A;  1LNQ A;  2YO2 A;  1YJN P;  2N9B A;  2QVA A;  1IZN B;  1YHQ P;  1G1J A;  1HJB A;  3VMA A;  1RF0 A;  5AW9 B;  3CC4 P;  2LXC B;  2JR8 A;  2MJZ A;  4GOF A;  5DJU B;  3JCU E;  2KS1 A;  3CWB G;  4BXL A;  4H0L B;  2W8Z A;  2IZ0 A;  4CPG A;  1RF1 C;  2NPS A;  1IO4 A;  3EFG A;  1URQ D;  1LTS C;  5KTB A;  2OTL P;  2GM4 A;  3Q5S A;  1M90 Q;  2WQY C;  4L76 A;  2XZR A;  2ZJS E;  1OFC X;  5KAF H;  3MD0 A;  2FFD C;  3H1J D;  2P58 A;  3H1H E;  2XDJ A;  1ZP0 C;  1NKN A;  2QM8 A;  1RE3 C;  1NTK E;  1L0N G;  1ZRT E;  2L5G B;  1Q7Y Q;  4TLF A;  2WSF H;  3O6Q B;  1JO5 A;  1YIT P;  5B5E E;  1KQG B;  2RN0 A;  3M06 A;  2FXO A;  1AVY A;  2KB7 P;  2WZ7 A;  4A7P A;  4U3F D;  1L0N K;  3MGN A;  4WY4 A;  1SQQ G;  3L72 E;  3H1K D;  4D6T G;  2B88 A;  4H13 C;  1JOC A;  3JC2 2;  2OTJ P;  1N86 A;  3TGU G;  3CCQ P;  3P32 A;  3F5H A;  1SQQ K;  1SQV J;  3LW5 H;  1IFM A;  5CCG C;  2FYN C;  1KQS O;  3IF4 A;  1DEB A;  3Q1M A;  1HJ0 A;  4LC1 A;  3U1A A;  3A0H E;  1XTG B;  1BDD A;  3L74 J;  5AW4 B;  1IFI A;  1X79 B;  2KOG A;  3CCM P;  3WMM 0;  2BCC J;  4RJT A;  3MP7 B;  1ZN5 A;  2HPC A;  4WB4 A;  3HUS B;  2OQQ A;  1BE3 G;  1JM0 A;  1RF0 C;  1ZLL A;  4GT1 A;  2ZT9 D;  1PL5 A;  4OGQ B;  4EIJ A;  3JSV C;  4L75 A;  5CCH A;  1QVG O;  1SVF A;  1QEX A;  3L75 J;  4IFF A;  4BWN A;  5AVW B;  5AVV B;  2Q3E A;  1LWU A;  1IFD A;  2NPS C;  1EZV D;  3BCC J;  3WU2 E;  4H44 D;  3PLN A;  4RKU J;  1YTZ T;  2KP8 A;  1GU4 A;  4GOE A;  1USD A;  3KZI H;  2KZJ A;  5AVQ B;  3GF7 A;  1UIX A;  1BGY D;  1KYO D;  1JTH A;  3SFD C;  1L0L E;  2YKO A;  3VYI A;  4PD4 D;  1EC5 A;  2JP3 A;  1KC8 Q;  1T3U A;  4MN4 C;  1P84 E;  3A5T A;  2K1A A;  3M9H A;  2QA4 P;  3AE4 C;  5L8R J;  4AQR D;  1RF1 B;  1X8Y A;  3CX5 I;  3AE9 C;  3CWB D;  2WT7 A;  2KNC A;  2A45 I;  2J59 M;  1Q2N A;  1S5L E;  3OAK A;  1QLE D;  2FFD B;  1BCC J;  1GK6 A;  2YO3 A;  5KLV J;  2ZYD A;  3CCS P;  1NTZ D;  3CI9 A;  1FE6 A;  1LTG C;  1SQX E;  4IL6 E;  1VQ7 P;  4DJG A;  2M0B A;  1L0N D;  1NAF A;  3FGA D;  3P8M C;  1H89 A;  1Q82 Q;  3P8C D;  1IC2 A;  2L91 A;  4C46 A;  2WPV B;  2WTY A;  1ZV8 A;  3Q5P A;  1QL1 A;  2KXP B;  3G4S P;  3MZW B;  1JY2 O;  1SQQ D;  5CCH C;  4D6T D;  1SQV G;  2OYI B;  2IBZ I;  1J1D C;  4R4L A;  3HE5 A;  2ZYG A;  3TGU D;  3HRN A;  3V5B A;  2FYN B;  3RK2 C;  3D6Y A;  1LWU C;  3CCU P;  2FYU E;  3JCU H;  2KYV A;  3L74 G;  5AVZ B;  2Q5U A;  5KAF E;  1VPC A;  3HTK B;  2A06 E;  2HOD A;  4WVZ A;  4XFJ A;  5APY A;  2M3E A;  2BCC G;  3B5N A;  5K5G B;  4IOI H;  1NH4 A;  2D2C C;  1FC2 C;  5H2F H;  1NKZ B;  2H89 C;  1DIP A;  1YJW P;  1N2D C;  2W27 A;  3CXH D;  3FXE A;  2Q3I A;  5AW1 B;  3VMY A;  1PPJ G;  1K04 A;  2R3C A;  3CPW O;  5KLI B;  3L75 G;  1IFN A;  1BE3 D;  1YTZ I;  1KIL D;  3A3Y B;  3AE1 C;  3KPE A;  5B5E H;  3ZDM A;  3BCC G;  1VQN P;  2NPS B;  5BU5 A;  1NU1 J;  3PJS K;  1SS1 A;  5AW7 B;  1N7S A;  3H1J E;  1KB9 I;  3CWB J;  2QM7 A;  1QX8 A;  1P84 I;  2Q1K A;  2M8R A;  2QSI A;  3PH0 A;  1RQV A;  3CCE P;  1PP9 E;  3A0H H;  1JNM A;  3B71 A;  5APT A;  1GU5 A;  4U3F E;  3WUU A;  5KAI H;  3PRJ A;  3WUV A;  4O9B A;  1GL2 A;  3H1K E;  1KFM A;  4GOD A;  3L73 E;  4AUW A;  1U57 A;  3H32 A;  2C9N Y;  2XV5 A;  4IFM A;  1W2B O;  1NTM E;  2WSC H;  1BCC G;  2YNY A;  1K8A Q;  1OVV A;  3EWK A;  5KLV G;  2HR3 A;  1OXZ A;  3VTP C;  1Y8A A;  2JKV A;  2OYH C;  2WWW A;  3CL3 D;  3KDP B;  4L73 A;  1N73 A;  3H1H J;  1H88 A;  3MTU E;  3AE2 C;  5KLV K;  3B5N C;  2B87 A;  2N1T D;  3M91 A;  3EQ2 A;  1NYH A;  3IFM A;  1VQ4 P;  3RL0 C;  2HPC B;  1M7L A;  2WPQ A;  2P67 A;  3RGU A;  2YIU C;  1KN7 A;  3NMD A;  3E1I A;  2YKP A;  1HWT C;  4ASW A;  3TK1 A;  1GD2 E;  1SFC D;  3F89 A;  3L72 J;  3N7N A;  3P7K A;  2KI7 B;  2H8P D;  5APQ A;  1J1D B;  3PTZ A;  4M3L A;  4N78 D;  2JWD A;  1M1K Q;  1LT1 A;  3RK2 B;  2PAJ A;  1SQV D;  1LWU B;  3VMX A;  1EZV E;  1MUU A;  4HYT B;  3CME P;  4I7Z C;  2K3R A;  1WT6 A;  3L74 D;  3OJA B;  3M0D A;  2IDB A;  5B66 E;  2W6J H;  1LT9 A;  4I1L A;  1IFP A;  4HKZ H;  2BCC D;  2D2C B;  1W2E A;  1BGY E;  1W5C E;  1KQF B;  1KYO E;  3RK3 D;  2RMZ A;  1HGV A;  1VQP P;  2O01 J;  2BAS A;  2FYZ A;  1X9V A;  2E76 C;  2K9Y A;  1GW4 A;  4IL6 H;  1PPJ D;  2KZI A;  4DT0 A;  3L75 D;  1M57 D;  1GL2 C;  3KHU A;  1OX3 A;  1NU1 G;  1LGH B;  3HD7 D;  2WT7 B;  3PHL A;  3VN0 A;  1URQ A;  3V2Q A;  1JY3 P;  3BCC D;  1S4X A;  3L71 E;  2OGU A;  1N7L A;  2PGD A;  5E79 E;  2ZVO B;  2O01 N;  1SQB K;  4XA4 A;  1NU1 K;  1A02 J;  2XND H;  1K73 Q;  1BSN A;  1NTZ E;  3Q5R A;  1N73 C;  2VRS A;  2N9Y B;  3AEG C;  1NO4 A;  3D71 A;  5H2F E;  1M1J A;  3CCV P;  3FWN A;  3G3Z A;  3V2N A;  4DOJ A;  3P8C E;  2P1J A;  2P10 A;  2GUS A;  3ITK A;  1PIX A;  3VP9 A;  1T2K D;  1Y9B A;  2NZ2 A;  1DD3 A;  3LID A;  4I2L C;  1SQQ E;  1MFT A;  1IK9 A;  4D6T E;  2IZ1 A;  1PGJ A;  5AW5 B;  3HE5 B;  3C9I A;  4W7Y A;  4I6M C;  1SQP J;  3T97 A;  3RL0 g;  3TGU E;  1NJI Q;  1VF5 D;  5BU8 B;  3N4X A;  4EYY Q;  1CI6 A;  5GTI H;  1BCC D;  1IJD B;  2OYH B;  2A45 G;  4UB8 E;  4JYC A;  1T8Z A;  3H1H G;  4ZMD A;  5KLV D;  1YI2 P;  1QL2 A;  1Z56 A;  2R5B A;  2OAR A;  1GK4 A;  3B5N B;  3M0D C;  1DD4 A;  1PGO A;  1GMJ A;  1LT9 C;  4QMA A;  3RL0 B;  2P2U A;  3B8E B;  1IK7 A;  3E1R A;  2HFE D;  4XE5 B;  1NTK K;  4Z1M H;  1VQ8 P;  2YIU B;  1OVR A;  3IAO A;  3CXH E;  1OMI A;  2J58 A;  3L72 G;  4RES B;  5KAI E;  2Y0D A;  2R32 A;  1HGZ A;  1Q90 D;  1RE4 A;  2WPS A;  1LTJ A;  3VMZ A;  1EDJ A;  4LLH A;  3BAS A;  1R8E A;  1N8R Q;  1LP1 A;  1U7J A;  1OZH A;  1JY2 N;  4I7Z B;  1URQ C;  2JJL A;  2IBZ G;  4HJG H;  3QH9 A;  2HLO A;  4TT3 H;  1VL2 A;  2E74 C;  5KJ7 D;  1AA0 A;  2QJY C;  3GMA A;  2IPP A;  2WSF J;  5CBO A;  2Q9I A;  2E76 B;  1M1J C;  4KHX A;  3V2R A;  2R3S A;  3G71 P;  4JF7 A;  2IFM A;  1E5W A;  2R5D A;  1GL2 B;  3AEF C;  1GW3 A;  3FXD A;  2DW3 A;  2ZXE B;  4RO0 A;  2YKQ A;  1NU1 D;  1VQO P;  2KLV A;  3RK2 D;  3D6Z A;  3LW5 J;  3I5C A;  1JCC A;  3H1L J;  4WY4 C;  1FBM A;  2V4H A;  4GKG A;  2WVR A;  1N73 B;  1S9K D;  3HE4 A;  4JBZ A;  2WMM A;  1VQ6 P;  2B87 B;  1AJY A;  3H1I J;  1PP9 J;  2B9B A;  1NOH A;  2IYP A;  2OYO A;  4PV1 C;  3CCL P;  1L4A D;  1FJK A;  1PV3 A;  1PGQ A;  5AVT B;  5B66 H;  2ZT9 C;  2LXB A;  1KYO H;  1SQP G;  4HB1 A;  3L73 J;  4N78 E;  4KT0 J;  1LTJ C;  1OW6 A;  2XNX A;  4PD4 H;  2Q6Q A;  1SQV E;  1NTM J;  3S1K A;  1OW7 A;  4B86 A;  3L4F A;  4H13 B;  2IX7 C;  4H44 C;  1SQP K;  4ZKU A;  3AE6 C;  3CX5 D;  2M5A A;  3TSI A;  1J2J B;  4H0L D;  2Y0C A;  3H1H D;  2WSE H;  1WMK A;  3Q3D A;  3RBZ A;  2C9L Y;  2AEJ A;  1LT9 B;  2ZYA A;  2BCC E;  1JCD A;  5E79 H;  2MKV A;  3I56 P;  3QWO C;  3B4S A;  3RK3 E;  3W67 A;  1SQX K;  1JMM A;  2E75 C;  3L70 J;  2W90 A;  1KIL A;  3L72 D;  1G2C A;  5AVY B;  3TF5 A;  2KK7 A;  2KIK A;  4JYB A;  3BVH A;  3L75 E;  1H0T A;  2XU6 A;  2V7Q H;  1FZB A;  3BRV B;  1FAV A;  1JMB A;  3NFQ A;  4HH2 A;  1URQ B;  2SPZ A;  3BCC E;  5GTI E;  3V6I A;  2KS1 B;  1FU1 A;  3USS A;  2IBZ D;  2Y9Y A;  2E74 B;  3S9O A;  1KV4 A;  5TJH A;  1Q86 Q;  1LTB C;  1ZXG A;  1SQB J;  2QJY B;  1KZU B;  1BDC A;  3B5N D;  1S3J A;  3L37 A;  1S72 P;  1NGM B;  3FWL A;  4UB8 H;  3L35 A;  1M1J B;  1JUN A;  2C0W A;  2M3B A;  1S5L X;  1T3J A;  5KKZ C;  4K3A A;  4PJ0 H;  4BRY A;  3CXH H;  3H1L G;  3AEC C;  3T97 B;  5C39 A;  3L71 J;  4IL6 X;  1USE A;  4WY4 B;  3MUD A; 
#chains in the Genus database with same CATH homology
 3WMM 0;  3NXS A;  1ZN5 A;  2HPC A;  4WB4 A;  1GL2 C;  1LTT C;  3HUS B;  1DX7 A;  1LGH B;  3HD7 D;  2WT7 B;  3VN0 A;  1URQ A;  3V2Q A;  1JY3 P;  1RF0 C;  1ZLL A;  2N1T A;  4GT1 A;  1ZR2 A;  1N7L A;  4EIJ A;  3PP5 A;  1XTC C;  5CCH A;  1SQB K;  4XA4 A;  1NU1 K;  3H6P A;  3HD7 B;  1SVF A;  4DZO A;  1VDF A;  1A02 J;  4IFF A;  1YYC A;  5AVW B;  5AVV B;  1FZC A;  1LWU A;  1IFD A;  2NPS C;  1H8A A;  1N73 C;  1SFC A;  2VRS A;  1NHL A;  1LTA C;  1KIL C;  1NO4 A;  3GHG A;  2Q7C A;  2OYH A;  1MV8 A;  3A7O A;  3R2P A;  1SQV K;  1YTZ T;  2KP8 A;  1GU4 A;  1M1J A;  1GL2 D;  2FXM A;  5AVQ B;  3G3Z A;  1ZR4 A;  5BVZ A;  1IFJ A;  3V2N A;  4DOJ A;  3P8C E;  1SLQ A;  2P1J A;  1J1E C;  2GUS A;  3NTN A;  5APW A;  3VP9 A;  1T2K D;  1JTH A;  1NTM K;  5APV A;  4I2L C;  3LID A;  5CHX A;  1HUC A;  1IK9 A;  2YKO A;  3VYI A;  4N6J A;  2FYU K;  5AW5 B;  1RY3 A;  3HE5 B;  2A45 H;  1WRG A;  3SWF A;  1MZ9 A;  3C9I A;  1T3U A;  4W7Y A;  1L4A C;  4I6M C;  2O1J A;  3T97 A;  5AW6 B;  3A5T A;  3M9H A;  4C7N A;  5BU8 B;  3N4X A;  1CI6 A;  1IJD B;  2OYH B;  2A45 G;  5AW3 B;  4JYC A;  1T8Z A;  4AQR D;  1RF1 B;  1X8Y A;  3RL0 D;  3HUS A;  5CMZ A;  2WT7 A;  1QL2 A;  4LGD E;  1Z56 A;  2R5B A;  2OAR A;  2A45 I;  3KQG A;  1GK4 A;  2J59 M;  1N7S C;  3B5N B;  3M0D C;  3TYY A;  1FDM A;  1LTI C;  3OAK A;  5APU A;  1LT9 C;  1OWA A;  3RL0 B;  2P2U A;  3B8E B;  2HFE D;  3V2P A;  3HD7 A;  4XE5 B;  2FFD B;  1FOS E;  1JTH B;  3VP8 A;  1NTK K;  2OYI A;  1GK6 A;  2YO3 A;  2J58 A;  1FZF A;  3CI9 A;  1LTG C;  1A02 F;  4RES B;  3V4Q A;  2R32 A;  1HGZ A;  1CI6 B;  1RE4 A;  2WPS A;  5AVX B;  1LTJ A;  1NAF A;  3P8M C;  3M9B A;  3VMZ A;  1H89 A;  4LLH A;  3BAS A;  2XKM A;  3P8C D;  1IC2 A;  4C46 A;  1N7S D;  1S9K E;  1JY2 N;  1EQ7 A;  4EOT A;  1URQ C;  3HE4 B;  2WTY A;  1ZV8 A;  1AFO A;  5CCG D;  2IFN A;  2JJL A;  1QL1 A;  1G1I A;  2N1T C;  2HLO A;  1JY2 O;  2Z4E A;  5CCH C;  2OYI B;  2O01 H;  1J1D C;  3HE5 A;  2PP6 A;  5KJ7 D;  3HRN A;  3V5B A;  3RK2 C;  1FZC C;  1LWU C;  2KYV A;  1SFC C;  5AVZ B;  2IPP A;  2KSJ A;  1RF1 A;  2Q9I A;  1GTW A;  3BAT A;  1CZQ A;  1CSB A;  2Q5U A;  4Y99 C;  3GHG C;  1LTJ B;  1VPC A;  3HTK B;  1M1J C;  2HOD A;  2O1K A;  4KHX A;  1HVV A;  4N3Y B;  5APY A;  3V2R A;  3B5N A;  4JF7 A;  2W6B A;  3UIA A;  2IFM A;  1E5W A;  1NH4 A;  3TNU B;  2LKM A;  2R5D A;  3U1C A;  1GL2 B;  3BRT B;  2FFD A;  1GW3 A;  1NKZ B;  2W6A A;  4OH8 B;  1PFI A;  4W7Z A;  4W80 A;  1N2D C;  2ZXE B;  2W27 A;  1RE3 A;  5AW1 B;  2Q3I A;  2YKQ A;  1FZG A;  3VMY A;  5AW8 B;  5AVS B;  2R3C A;  1JY3 N;  2KLV A;  4C7R A;  2NPS D;  3RK2 D;  3VOP A;  3M9Q A;  1FZE A;  3I5C A;  1IFN A;  1YTZ I;  1JCC A;  1KIL D;  4WY4 C;  1FZA A;  3RK3 C;  5CJ0 A;  3A3Y B;  1NTZ K;  3KPE A;  4GIF A;  1FBM A;  4ZKP A;  4GKG A;  1KFN A;  3HUS C;  2HOD B;  2NPS B;  1N73 B;  5BU5 A;  1S9K D;  1JY2 P;  3HE4 A;  1KIL B;  3II6 A;  3V4W A;  1G2C B;  5AW2 B;  1NOH A;  1SP4 A;  3HD7 C;  4WBA A;  5AW7 B;  1N7S A;  5APS A;  2CPB A;  2OYI C;  5AW0 B;  4AYC A;  2QM7 A;  5CCG A;  1L4A D;  1FJK A;  1J1E B;  5AVT B;  2M8R A;  1FJP A;  3A2A A;  3L36 A;  1DH3 A;  1HBW A;  1GDT A;  4WY4 D;  2I1J A;  3HTK A;  5KJ7 A;  1JNM A;  1HTL C;  4N78 E;  1LTJ C;  2P7J A;  1L4A B;  2Z5H A;  2XNX A;  5APT A;  1GU5 A;  2H7H A;  1MFZ A;  3IR9 A;  2I1K A;  2YO2 A;  4B86 A;  3TNU A;  3L4F A;  2IX7 C;  5APX A;  4O9B A;  1SQP K;  1GL2 A;  4ZKU A;  1KFM A;  2FKW B;  2N9B A;  4AUW A;  3TSI A;  1J2J B;  2WPR A;  1G1J A;  3H32 A;  1HJB A;  1N7S B;  2WSE H;  2C9N Y;  1RF0 A;  5AW9 B;  2XV5 A;  2WIT A;  4IFM A;  2C9L Y;  2MJZ A;  2WSC H;  1LT9 B;  2YNY A;  3CLQ A;  1JCD A;  3KYQ A;  1T2K C;  1OXZ A;  3VTP C;  1SQX K;  2OYH C;  2WWW A;  1JMM A;  3CL3 D;  1GZL A;  3KDP B;  1RF1 C;  2NPS A;  1N73 A;  1IO4 A;  1FOS F;  3EFG A;  1KIL A;  1HH0 A;  1H88 A;  3MTU E;  1URQ D;  1LTS C;  5KLV K;  3B5N C;  1G2C A;  2Z5I A;  5KTB A;  5AVY B;  2N1T D;  2ZFC A;  3M91 A;  2GM4 A;  4JYB A;  3EQ2 A;  3IFM A;  3RL0 C;  3BVH A;  2XZR A;  2HPC B;  5CCH D;  1M7L A;  2XU6 A;  3BRV B;  1FZB A;  3MD0 A;  2FFD C;  1FAV A;  2WPQ A;  2P67 A;  3H32 B;  2XDJ A;  3O8Z A;  3NFQ A;  4HH2 A;  1URQ B;  3NMD A;  1NKN A;  3E1I A;  2YKP A;  2QM8 A;  1RE3 C;  2H43 A;  2N1T B;  2JEE A;  2C0X A;  3SWY A;  1HWT C;  3TK1 A;  1GD2 E;  2L5G B;  2WSF H;  1SFC D;  3N7N A;  1JY3 O;  3P7K A;  5CJ4 A;  1JO5 A;  1FU1 A;  2YMY A;  2H8P D;  5APQ A;  1J1D B;  4M3L A;  4N78 D;  3M06 A;  3OA7 A;  1L4A A;  2KB7 P;  1LTB C;  2WZ7 A;  2PAJ A;  3RK2 B;  5AVU B;  1NWQ A;  1AQ5 A;  1FZC B;  1L0N K;  1KZU B;  1LWU B;  3MGN A;  3VMX A;  4WY4 A;  1MUU A;  1SFC B;  3B5N D;  4HYT B;  4Y99 B;  3GHG B;  3L37 A;  1JOC A;  1WT6 A;  3L35 A;  1M1J B;  1N86 A;  1JUN A;  3OJA B;  5AVR B;  3M0D A;  2C0W A;  3P32 A;  3U59 A;  2E42 A;  2M3B A;  1LT9 A;  4I1L A;  3LIE A;  1SQQ K;  5CCG C;  3LW5 H;  1L0L K;  1IFM A;  1W2E A;  1T3J A;  3M0A A;  4IFD K;  1DEB A;  4LC1 A;  3RK3 D;  3U1A A;  1RE4 C;  1CW5 A;  1HGV A;  3MIW A;  1XTG B;  2BAS A;  2FYZ A;  1X9V A;  5KJ7 C;  1KQL A;  2CPS A;  5AW4 B;  2POH A;  2GUV A;  1IFI A;  1X79 B;  2KOG A;  2HG5 D;  2HYN A;  4C7N B;  1GW4 A;  2E43 A;  4WY4 B;  3MUD A;  3RK3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...