1FJPA

Nmr solution structure of phospholamban (c41f)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
52
structure length
52
Chain Sequence
MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILIFLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of Phospholamban
pubmed rcsb
molecule tags Membrane protein
molecule keywords CARDIAC PHOSPHOLAMBAN
total genus 14
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fjpA00
2KB7P 1N7LA 2HYNA 1FJKA 1ZLLA 2M3BA 1FJPA 2KYVA
chains in the Genus database with same CATH superfamily
1L0ND 1QEXA 2K9JB 1XTCC 2LR2A 1USDA 2O1JA 4JQ0D 3A5TA 1PGJA 4W80A 5TISH 2WSSH 1IO4A 4RKUJ 4OH8B 1YITP 3SWKA 2ZXEB 1ZP0C 5DJTB 2G3AA 3L4FA 3NFQA 3Q5SA 2FBWC 3SWFA 1FJKA 3LW5J 3V5BA 4DJGA 2ZT9C 1OVRA 1YI2P 3HTKB 2KXPB 3H1IE 5E79H 1AQ5A 3RK2C 1LTJA 1PPJD 3PLNA 4RO0A 5KAIH 2Z4EA 1ZW0A 4B86A 4DCKA 4DOJA 1KC8Q 1JY2P 1T2KD 3L36A 3BRTB 2YO3A 5APQA 2Q3EA 2WSFJ 3AEFC 2QJPC 3IN6A 3AEGC 3H1HE 3BATA 3H1HD 4H0LC 1JOCA 2YIUB 1IFIA 4H44C 2Q6QA 3H1KJ 3KQGA 4I7ZC 3SFDC 2K9YA 1KILA 4C7RA 2L91A 5CBOA 1EDLA 3H1KE 1NTZE 3Q2YA 2OYHA 1VQ9P 2FFDA 3CC7P 3B5ND 1UIXA 3IAOA 3CMAP 2FY8A 1KILB 2LKMA 2SPZA 3AEAC 3JCUH 2FFDB 4Y28J 3H1LD 5EFWB 1Q81Q 2AXTH 3B8EB 4U3FG 3O6QB 2FXOA 4C46A 2C9LY 2KZIA 5B5EH 2KYVA 2ZYAA 4OGQB 2KNCA 3G6EP 1M57D 3A0BH 1DD4A 1SFCC 1ZRTD 1L4AB 3H32A 1M1JB 2HLOA 2R5BA 2RMZA 2UWJE 3EFFK 3IF4A 2R5DA 4YXDC 5APYA 2BCCD 3VTPC 3RL0D 1QLED 1E79H 3G71P 2J59M 3KPEA 4Y99B 4N78D 3U1CA 3L70D 1L0LD 1ZLLA 1URQD 2M3BA 3H1IJ 3HD7D 1BDDA 5APVA 1GL2B 1NTKE 1OVVA 2FKWB 1KQFB 3ABVC 1LT9C 2FXPA 1ZN5A 2KB7P 4UB6H 1GZLA 1J1EB 1EQ7A 4K3AA 2M5AA 2VRSA 3C9IA 3CI9A 4HYTB 1SQQG 2IZ1A 2K88A 1JO5A 2KK7A 1USEA 1PGOA 3PRJA 1PV3A 1EXJA 1FDMA 3GMAA 3RK3B 1NU1G 1H0TB 3SSUA 3V2PA 3GF3A 2JDIH 1YYCA 5AVSB 1LTJB 2POHA 1T8ZA 1EC5A 1Q90D 1VPCA 4GODA 3AE8C 5L8RJ 3CCRP 3L75G 1N7SA 3MD0A 1Q7YQ 1D7MA 1JCDA 1MFTA 1N7SB 3L71E 4PV1B 4LGDE 1NTZJ 2O01H 2WMMA 3A7OA 3KYQA 2QSIA 1NO4A 3AEDC 1OZHA 3USSA 3II6A 2KUBA 1JCCA 5K5GB 3D71A 2FXMA 1N7SD 3M0DC 1PGQA 1VL2A 3L74E 2QM8A 2JO1A 2ZT9D 1W2BO 2D2CD 4UB8H 2OYIB 2Q7CA 1NTKD 1EXIA 3FXDA 3P8MC 4GOEA 1X79B 2HG5D 5DJUB 2H88C 4ZMDA 1S4XA 2M5AB 1FOSE 1DIPA 3KZIH 3L75E 1SQPE 2Y0EA 4GOFA 3L73D 1NU1K 5KLVD 2E76B 2ITAA 5KLIC 3RK3E 3ZDMA 3E7KA 5CJ0A 1RF1B 1NTZD 1SFCD 1U7JA 1AVOA 3HE5B 1KYOE 2HR3A 1GL2C 2M3EA 5APTA 3A0HE 4YPCA 1KQLA 1VDFA 1Q86Q 1Z56A 2KS1A 2LXCB 5TJHA 3CD6P 3MZWB 2JR8A 3JSVC 1MV8A 1NU1J 3MHVA 1S5LE 2W6JH 4IL6X 4XE5B 5GTHH 5KLVJ 3Q5PA 5M1BA 1GU4A 2KNCB 2P67A 1SS1A 1L0NK 2WSEH 2HODB 5AVWB 4BRYA 1PIXA 3U59A 4PD4D 2Q9IA 1PP9D 1Q82Q 1GK6A 1MUUA 2W83C 1WMKA 1SQXJ 1P84E 4H13D 3TNUA 4EI2A 1YJNP 3V6IA 4UB6E 2B87B 1L4AD 2QVAA 2P58A 2YO2A 2Q3IA 2R32A 4EIJA 5E79E 2RKLA 4PJ0H 1N7SC 1EDJA 1NTMD 2QM7A 3L70J 4PV1C 1CSBA 3L74J 3HUSA 1DX7A 2BEQD 4PD4H 1S3JA 1VQ6P 4U3FE 3D6ZA 3G3ZA 1BSHA 1U7MA 2CK3H 5AVVB 1FZEA 3CCJP 4U3FJ 1YQ4C 1OWAA 5AW4B 2N1TD 5H2FH 2OGUA 2J58A 2ZVOB 3F89A 1KYOD 3L71G 1YHQP 2JWAA 2OYIC 1K9MQ 1KFNA 3BVHA 1KMIZ 1DEBA 4EDFA 2Q5UA 3D6YA 1KN7A 3HTKA 3UIAA 3E1IA 3TK1A 1FZCB 2O01J 1X9VA 3FWLA 1JM0A 1NKZB 2DW3A 2ZT9B 1EZVE 3H1HG 3HUSC 1VQOP 1FZGA 4NPEA 4AYCA 3KXDA 1PP9E 1MFZA 2O1KA 2WITA 2A45I 3H1ID 1GL2D 3FXEA 4Z1MH 1P84H 2ZFCA 3P8CE 3Q5RA 4BXLA 1SQQE 1KB9I 5AVTB 1NHLA 1FE6A 2P10A 3EWKA 4WVZA 1KORA 3WU2H 2AEMA 1LTGC 4R4MA 3VMAA 1Y47A 2QJYB 4D6TD 1MKMA 1PPJE 1X0TA 2XU6A 1FS0E 3H1LG 2IPPA 5AVRB 2H89C 4K35A 3WUVA 1L0LK 1G1JA 5CCHC 1VQNP 4H13B 2BEZF 1TU3F 1PL5A 3OA7A 4L74A 3L37A 1SQBE 1LGHB 2V7QJ 1LTTC 1YQ3C 3CXHH 3CX5I 3O6QA 5AVUB 2E42A 1KILC 1RE3A 2Y0DA 2YNYA 2M8RA 3T97B 1NGMB 1BDCA 1W5CE 3L72G 3BCCD 4EOTA 1IK9A 3L70G 3A2AA 4GT1A 3WMM0 2Q1KA 3H1KD 2A06E 4ZKUA 2FYZA 2OTJP 1FOSF 2A06D 3OJAB 1IC2A 3Q3DA 1SFCB 1WRGA 1L4AC 1M1JC 3PH0A 3L71J 2E76D 1YBKA 1T3JA 1RE4A 3CXHE 3HD7B 1FAVA 3CXHD 2WZ7A 3CC2P 1SP4A 1N73B 3RL0B 2HPCB 2IBZG 1GMJA 3L72E 3VP9A 1DD3A 1NU1D 5KLVK 1FZCC 1BCCD 3H6PA 1LT9B 2J5UA 4ASVA 3CWBD 1NU1E 1SQBG 2FYUE 3HUSB 1NTKK 3M9QA 5BU8B 3VYIA 1M7LA 1NAFA 1KILE 2JJLA 1HGZA 3HE5A 3L74D 2FYUJ 1PFIA 3GHGA 4HKZH 1Q2NA 3KZIE 4TLFA 2W6BA 1OXZA 2JWDA 2WSFH 5C39A 3RK3C 1X22A 3GW6A 3H25A 4O9BA 2N1TC 1R5LA 3TF5A 2WPSA 1FJPA 2P2UA 4IFMA 4N6JA 5AVXB 3RL0g 3CCVP 3CC4P 1JY3N 1HJBA 1NH4A 1OW6A 1RH5B 3I5CA 1OW8A 1PP9J 3EQ2A 1FBMA 1SQXK 2FYUG 1KYOH 2A45G 2WPQA 1PGPA 2M0BA 1DEEG 3H1JD 3RBZA 1RY3A 1IZNB 3SFEC 1KD1Q 5APSA 1SQBJ 2IYOA 5AW7B 2I8DA 1EDKA 2PFXA 4IL6H 3V2RA 1A02J 1LWUC 2KS1B 5CCGC 1KFMA 2IZ0A 2NPSB 4L76A 4L75A 4LLHA 2WT7A 3S4RA 4U7JA 3CWBJ 3AE3C 3GHGC 3M0AA 4PD4I 4UB8E 1G2CB 1BGYJ 1EZVD 1LP1A 1URQA 3PHLA 4JYBA 2ZVNB 3TGUG 3MIWA 1GU5A 1RF1A 1VQLP 1BGYE 1U57A 1OVUA 1PZQA 3P8CD 1GK4A 2E75D 2V7QH 1SFCA 1HF9A 1BSNA 4GIFA 1H0TA 1N73C 1IFPA 2AEJA 2E76C 1NAYA 2BASA 2ZAEB 3RL0C 2H8PD 1RF1C 1FZBA 1SQVG 3F5HA 1VQPP 3VMYA 1SQPK 1RE4C 2NPSD 2JEEA 4JBZA 2YMKA 1OFCX 1Y9BA 3RBXA 1GDTA 2P7JA 3N7NA 5AW0B 1GL2A 3G4SP 2OYHC 2GM4A 3OW2O 1KV4A 1S5LX 1PPJG 2FYUK 1GTWA 2B88A 2D2CC 1CZQA 2FYNB 4ASWA 1NVOA 1J1DC 2KZJA 1RE3C 2N1TB 2QRXA 1IK7A 2IBZI 1S9KD 1RQVA 3G9RA 1L0NE 3CPWO 3QH9A 2XNXA 4NPDA 3V2NA 2C0WA 2N9BA 2PGDA 1J2JB 1S2EA 1P84D 3CX5E 4D6TJ 1LNQA 2ZYDA 3K5BA 2OTLP 1JMMA 4DZOA 2IFNA 1SQQJ 2HYNA 4BWNA 3L71D 4W7YA 1FC2C 2WSCH 3L35A 5H2FE 3KHUA 1SQXE 3GLMA 3O8ZA 1JB0J 1SQBK 1LWUB 2NPSC 2W6AA 4W7ZA 1NTMK 1HVVA 2YKOA 3C1LA 3VMZA 1T6AA 3TDKA 1FZCA 5AVYB 1QVFO 1HGVA 1LWUA 3AE5C 3PTZA 5CCGA 1CI6B 2AXCA 1HTLC 3VMXA 3L70E 1SQPD 1NTME 2PAJA 2QE7H 1JY3O 5APWA 5APUA 1T3UA 5KJ7D 3WUTA 5AW1B 1S72P 1VQ8P 1L4AA 3H32B 1ZMEC 1NWQA 3MTUE 3M9BA 1BE3G 2N9YB 3M91A 4U3FD 2W27A 1AV1A 3AE1C 3MUDC 4I1LA 3NTNA 3WU2E 4KT0J 4WWIA 3TYYA 1CI6A 3S9OA 5B5EE 2GUSA 2ZXXA 1QVGO 2KLUA 5KKZC 2WSEJ 3IR9A 1ZV8A 1S5LH 4N3YB 5GTHE 3H1JE 3U1AA 1H8AA 3CCEP 2BCCG 4I6MC 3CCUP 2I1KA 2Y9YA 1H88A 2OYHB 2NRGA 4NPFX 5CMZA 2RH0A 5KJ7A 2H7HA 1KZUB 1N86A 1L0LG 5APXA 2D2CB 2FYNC 1QX8A 2QJYC 3JC22 1J1DB 2E5YA 3W67A 4IFFA 3R2PA 3L72D 3BCCG 4HJGH 4ZKPA 4OGQD 2KSEA 4EYYQ 2K9JA 1SQXD 4XFJA 3M06A 3P7KA 3KDPB 1SQQD 2PRRA 4H13C 1JY2O 4HB1A 1L0LE 1LT1A 1NTZK 1KYOI 4N78E 4PV1D 1A02F 2WPRA 1RF0C 3B5NB 1L2PA 2BCCE 2WPVB 1JY2N 2Z5IA 1AJYA 3Q1MA 3V2QA 1W2EA 3VP8A 4A7PA 3N4XA 2V4HA 3MP7B 2O01N 1VF5B 1FU1A 4YTPC 3TGUJ 1YJWP 1N7LA 3BRVB 1NTMJ 2E74D 2XV5A 3CWBG 1QL2A 1SQBD 1LJ2A 2ZJSE 1IFJA 3HD7C 1IFNA 1P84I 3L74G 2XDJA 1LTBC 3AE9C 3C8VA 4WY4B 3CCMP 2OYIA 1VF5D 1FDOA 2JKVA 3PJSK 4ZNCA 3CCQP 1RF0A 3I55P 2IYPA 1QL1A 1VQ7P 3CCLP 2Z5HA 3TSIA 1NTZG 2YMYA 1YIJP 2H43A 1URQB 2KSJA 2C0XA 1GW4A 3CXHI 3BASA 3JCUE 5KKZB 1QGKB 3CX5H 4JYCA 1BGYD 5AW8B 2E43A 3L73G 4IFDK 3FX0A 1HJ0A 4IOIH 4D6TE 1AQTA 5KJ7C 4WB4A 1BCCJ 5B66E 1PP9G 1JEKA 2LXBA 2E74C 3L73J 2K1AA 3IFMA 2GA1A 2QG4A 1L0NG 4KHXA 5AW5B 1K73Q 1EZVG 3L73E 3H1JJ 3RK3D 1DH3A 4RJTA 1M8OB 2YKQA 1EZVI 3R4YA 2MJZA 5AVZB 3LIDA 2OQQA 3TNUB 1K8AQ 3HD7A 1H89A 1FZAA 2HODA 1S1CX 5AW2B 3OAKA 3GHGB 1SQVD 2QJPB 2G8YA 3M9HA 2OARA 1VF5C 4AQRD 3AEBC 4WY4A 3W68A 1SQVE 3A3YB 5CHXA 1M1KQ 1RHZB 2W90A 2QA4P 2OTKE 1BE3J 4JF7A 4C7NA 1GD2E 1UIIA 1NTMG 1ZRTE 2O3JA 1YTZI 3E1RA 2HPCA 4XA4A 2K37A 1N73A 2YXQB 2P1JA 5BU5A 2JP3A 2XNDH 3M0DA 4PD4E 3D70A 4IL6E 5CJ4A 1JTHA 3B5NA 2WTYA 3GG2A 2W8ZA 4TT3H 1SQPJ 4GKGA 2WVRA 3H1LJ 5CBNA 1KILD 1URQC 2QJKB 1VQMP 1SLQA 1K05A 2KOGA 3L72J 3VOPA 5KAFE 5BVZA 1HWTC 1WT6A 3I56P 4KJMA 2Y9ZA 3EFGA 3T97A 3BCCJ 3RGUA 4DT0A 3WUUA 2MKVA 4OVNF 4Y99C 5KLVE 4WY4D 1L0LJ 3MGNA 4D6TG 3LW5H 3MUDA 3H1HJ 2IDBA 2E74B 2KLVA 1ZOYC 2R3SA 1NOHA 2BCCJ 3V4QA 1J1EC 1NKNA 2AEFA 3H1IG 1JMBA 2KI7B 1JTHB 1N2DC 2IX7C 1XTGB 1SQPG 1SQQK 3AEEC 4LC1A 1IFMA 1Y8AA 2R3CA 1SQVK 3A0HH 1NYHA 1E5WA 3AE7C 3QWOC 1LTIC 4OWFA 3SWYA 1LTAC 1BCCE 1BE3D 2GUVA 2E75C 1MZ9A 3S1KA 2WWWA 2NPSA 2WT7B 1LTJC 3B4SA 1BE3E 2AXTE 3NMDA 1JY3P 1CW5A 1HBWA 1SQVJ 4GDOA 2B89A 2KIKA 2KP8A 2WQYC 4RESB 2C9NY 3FWNA 1ZXGA 3CWBE 4I2LC 2NZ2A 3P32A 5AW6B 3V4WA 5CCGD 3CMEP 5AVQB 3TGUE 2IBZD 2B87A 1G1IA 1AA0A 1KB9D 3AECC 3H1KG 5KTBA 2A06G 1AFOA 1HH0A 2QIWA 1GW3A 4L73A 1M1JA 3AE2C 3L75D 4PJ0E 1R5SA 1K04A 1SQXG 1KB9E 3B71A 4BRYB 1LTSC 1OW7A 1OX3A 2QJKC 2ZYGA 1AVYA 5GTIE 2HFED 3CL3D 4MN4C 4M3LA 2XKMA 1FDIA 4C7NB 1IFDA 5CCHD 1VQKP 4R4LA 1ZR4A 1M56D 2K3RA 2L5GB 5KAIE 2QEXP 1BCCG 1S9KE 1ZR2A 2N1TA 1KQSO 1OIPA 4H44D 2OYOA 2IFMA 1LT9A 2B9BA 2WSCJ 3BCCE 1KTMA 5KLIB 4H0LD 1M90Q 3H1LE 3CX5D 1N8RQ 2CPBA 2E5TA 2PP6A 1VQ5P 3RK2B 5CCHA 1YTZT 1NTKG 2XZRA 1T2KC 3HE4A 5GTIH 1NTKJ 1IJDB 3H1JG 3HE4B 3AE4C 3B5NC 5AW9B 1L0NJ 4AUWA 1NJIQ 2YKPA 1RQUA 3RK2D 3ITKA 5KLVG 3GF7A 1JNMA 1JUNA 1KQGB 1HUCA 1FZFA 4H0LB 2E75B 2R44A 1VQ4P 3AE6C 2YIUC 1SVFA 4H44B 4I7ZB 3NXSA 1OMIA 2FYUD 3PP5A 2IBZE 4HH2A 4QMAA 3HRNA 3CLQA 4WBAA 4WY4C 3TGUD 2YXRB 1G2CA 1LP1B 2CPSA 3A0BE 5TISE 2I1JA 2A45H 4YXWH 1BGYG 2RN0A 1YJ9P 3VN0A 2Y0CA 5AW3B 4JPZB 5KAFH 3FGAD 2FFDC 1KB9H 3LIEA 3CCSP 1EDIA 3L75J 1R8EA 1X8YA 4OGQC 4CPGA 5B66H
chains in the Genus database with same CATH topology
2O1JA 1XTCC 3A5TA 4W80A 1IO4A 4OH8B 2ZXEB 3L4FA 3NFQA 3SWFA 1FJKA 3V5BA 3HTKB 1AQ5A 3RK2C 1LTJA 2Z4EA 4B86A 4DOJA 1JY2P 1T2KD 3L36A 3BRTB 2YO3A 5APQA 3BATA 1JOCA 1IFIA 2FFDA 3KQGA 4C7RA 1KILA 2OYHA 3B5ND 1KILB 2LKMA 2FFDB 3B8EB 4C46A 2C9LY 2KYVA 1SFCC 3H32A 1L4AB 1M1JB 2HLOA 2R5BA 2R5DA 5APYA 3VTPC 3RL0D 2J59M 3KPEA 4Y99B 4N78D 3U1CA 1ZLLA 3HD7D 1URQD 2M3BA 5APVA 1GL2B 2FKWB 1LT9C 1ZN5A 2KB7P 1H89A 1GZLA 1J1EB 1EQ7A 2VRSA 3C9IA 3CI9A 4HYTB 1JO5A 1FDMA 3RK3B 3V2PA 1YYCA 5AVSB 1LTJB 2POHA 1T8ZA 1VPCA 1N7SA 3MD0A 1JCDA 1N7SB 4LGDE 2O01H 3A7OA 3KYQA 1NO4A 3II6A 1JCCA 2FXMA 1N7SD 3M0DC 2QM8A 2OYIB 2Q7CA 3P8MC 1X79B 2HG5D 1FOSE 3U59A 1NWQA 1NU1K 1RF1B 5CJ0A 1SFCD 3HE5B 5APTA 1GL2C 1KQLA 1VDFA 1Z56A 1MV8A 4XE5B 1GU4A 2P67A 2Q9IA 1L0NK 2WSEH 2HODB 5AVWB 1GK6A 1MUUA 3TNUA 1L4AD 2YO2A 2Q3IA 2R32A 4EIJA 1N7SC 2QM7A 1CSBA 3HUSA 1DX7A 3G3ZA 5AVVB 1FZEA 1OWAA 5AW4B 2N1TD 2J58A 2OYIC 1KFNA 3BVHA 1DEBA 2Q5UA 3HTKA 3UIAA 3E1IA 3TK1A 1FZCB 1X9VA 1NKZB 1FZGA 3HUSC 4AYCA 2O1KA 1MFZA 2WITA 2A45I 1GL2D 2ZFCA 3P8CE 5AVTB 1NHLA 1LTGC 2XU6A 2IPPA 5AVRB 1L0LK 1G1JA 5CCHC 3OA7A 3L37A 1LGHB 5AVUB 1LTTC 2E42A 1KILC 1RE3A 2YNYA 2M8RA 4EOTA 1IK9A 4GT1A 3A2AA 3WMM0 4ZKUA 2FYZA 1FOSF 3OJAB 1IC2A 1SFCB 1WRGA 1L4AC 1M1JC 3HD7B 1T3JA 1RE4A 1FAVA 2WZ7A 1SP4A 1N73B 3RL0B 2HPCB 3VP9A 5KLVK 1FZCC 3H6PA 1LT9B 3HUSB 1NTKK 3M9QA 5BU8B 3VYIA 1M7LA 1NAFA 2JJLA 3HE5A 1HGZA 1PFIA 3GHGA 2W6BA 1OXZA 2WSFH 3RK3C 4O9BA 2N1TC 2WPSA 1FJPA 2P2UA 4IFMA 4N6JA 5AVXB 1JY3N 1HJBA 1NH4A 3I5CA 3EQ2A 1FBMA 1SQXK 2WPQA 4LLHA 2A45G 1GD2E 1RY3A 5APSA 5AW7B 1A02J 3V2RA 1LWUC 5CCGC 1KFMA 2NPSB 2WT7A 3M0AA 3GHGC 1G2CB 4JYBA 1RF1A 1URQA 3MIWA 3P8CD 1GK4A 1SFCA 4GIFA 1N73C 2BASA 3RL0C 1RF1C 2H8PD 1FZBA 3VMYA 1SQPK 1RE4C 2NPSD 2JEEA 1GDTA 2P7JA 3N7NA 5AW0B 1GL2A 2OYHC 2GM4A 2FYUK 1GTWA 1CZQA 1J1DC 2N1TB 1RE3C 1S9KD 2XNXA 3V2NA 2C0WA 2N9BA 1J2JB 1JMMA 4DZOA 2IFNA 2HYNA 4W7YA 2WSCH 3L35A 3O8ZA 1SQBK 1LWUB 2NPSC 2W6AA 4W7ZA 1NTMK 1HVVA 2YKOA 3VMZA 1FZCA 5AVYB 1HGVA 1LWUA 5CCGA 1CI6B 3VMXA 1HTLC 2PAJA 5APWA 5KJ7D 1JY3O 5APUA 1T3UA 5AW1B 1L4AA 3H32B 3MTUE 3M9BA 3M91A 2W27A 4I1LA 3NTNA 3TYYA 1CI6A 2GUSA 3IR9A 1ZV8A 4N3YB 1H8AA 3U1AA 4I6MC 2OYHB 2I1KA 1H88A 5CMZA 2H7HA 5KJ7A 1KZUB 1N86A 5APXA 1J1DB 4IFFA 3R2PA 4ZKPA 3M06A 3P7KA 3KDPB 1JY2O 1NTZK 4N78E 1A02F 2WPRA 1RF0C 3B5NB 2Z5IA 1JY2N 3V2QA 1W2EA 3VP8A 3N4XA 1FU1A 1N7LA 3BRVB 2XV5A 1QL2A 3HD7C 1IFJA 1GU5A 1IFNA 2XDJA 1LTBC 4WY4B 2OYIA 1RF0A 1QL1A 2Z5HA 3TSIA 2YMYA 2H43A 1URQB 2KSJA 2C0XA 1GW4A 3BASA 4JYCA 5AW8B 2E43A 4IFDK 5KJ7C 4WB4A 4KHXA 3IFMA 5AW5B 3RK3D 1DH3A 2YKQA 2MJZA 5AVZB 3LIDA 3TNUB 3HD7A 1FZAA 2HODA 5AW2B 3OAKA 3GHGB 3M9HA 2OARA 4AQRD 4WY4A 3A3YB 5CHXA 4C7NA 4JF7A 1YTZI 2HPCA 4XA4A 1N73A 2P1JA 5BU5A 3M0DA 5CJ4A 2WTYA 1JTHA 3B5NA 4GKGA 1KILD 1URQC 1SLQA 2KOGA 3VOPA 5BVZA 1HWTC 1WT6A 3EFGA 3T97A 4Y99C 4WY4D 3MGNA 3LW5H 3MUDA 2KLVA 1NOHA 3V4QA 1J1EC 1NKNA 1JTHB 1N2DC 2IX7C 1XTGB 1SQQK 4LC1A 1IFMA 4WBAA 2R3CA 1SQVK 3SWYA 1E5WA 1LTIC 1LTAC 2GUVA 1MZ9A 2WWWA 2NPSA 2WT7B 1LTJC 3NMDA 1JY3P 1CW5A 1HBWA 2KP8A 2C9NY 4RESB 4I2LC 3V4WA 5CCGD 3P32A 5AW6B 5AVQB 5KTBA 1G1IA 1AFOA 1HH0A 1GW3A 1M1JA 1LTSC 2HFED 3CL3D 4M3LA 2XKMA 4C7NB 1IFDA 5CCHD 1ZR4A 2L5GB 1ZR2A 1S9KE 2N1TA 2IFMA 1LT9A 2CPBA 2PP6A 3RK2B 5CCHA 1YTZT 2XZRA 1T2KC 3HE4A 1IJDB 3HE4B 3B5NC 5AW9B 2YKPA 3RK2D 1JNMA 1JUNA 1HUCA 1FZFA 1SVFA 3NXSA 4HH2A 3PP5A 3HRNA 3CLQA 4WY4C 1G2CA 2CPSA 2I1JA 2A45H 3VN0A 5AW3B 2FFDC 3LIEA 1X8YA 4AUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KB7 P;  1N7L A;  2HYN A;  1FJK A;  1ZLL A;  2M3B A;  1FJP A;  2KYV A; 
#chains in the Genus database with same CATH topology
 1L0N D;  1QEX A;  2K9J B;  1XTC C;  2LR2 A;  1USD A;  2O1J A;  4JQ0 D;  3A5T A;  1PGJ A;  4W80 A;  5TIS H;  2WSS H;  1IO4 A;  4RKU J;  4OH8 B;  1YIT P;  3SWK A;  2ZXE B;  1ZP0 C;  5DJT B;  2G3A A;  3L4F A;  3NFQ A;  3Q5S A;  2FBW C;  3SWF A;  1FJK A;  3LW5 J;  3V5B A;  4DJG A;  2ZT9 C;  1OVR A;  1YI2 P;  3HTK B;  2KXP B;  3H1I E;  5E79 H;  1AQ5 A;  3RK2 C;  1LTJ A;  1PPJ D;  3PLN A;  4RO0 A;  5KAI H;  2Z4E A;  1ZW0 A;  4B86 A;  4DCK A;  4DOJ A;  1KC8 Q;  1JY2 P;  1T2K D;  3L36 A;  3BRT B;  2YO3 A;  5APQ A;  2Q3E A;  2WSF J;  3AEF C;  2QJP C;  3IN6 A;  3AEG C;  3H1H E;  3BAT A;  3H1H D;  4H0L C;  1JOC A;  2YIU B;  1IFI A;  4H44 C;  2Q6Q A;  3H1K J;  3KQG A;  4I7Z C;  3SFD C;  2K9Y A;  1KIL A;  4C7R A;  2L91 A;  5CBO A;  1EDL A;  3H1K E;  1NTZ E;  3Q2Y A;  2OYH A;  1VQ9 P;  2FFD A;  3CC7 P;  3B5N D;  1UIX A;  3IAO A;  3CMA P;  2FY8 A;  1KIL B;  2LKM A;  2SPZ A;  3AEA C;  3JCU H;  2FFD B;  4Y28 J;  3H1L D;  5EFW B;  1Q81 Q;  2AXT H;  3B8E B;  4U3F G;  3O6Q B;  2FXO A;  4C46 A;  2C9L Y;  2KZI A;  5B5E H;  2KYV A;  2ZYA A;  4OGQ B;  2KNC A;  3G6E P;  1M57 D;  3A0B H;  1DD4 A;  1SFC C;  1ZRT D;  1L4A B;  3H32 A;  1M1J B;  2HLO A;  2R5B A;  2RMZ A;  2UWJ E;  3EFF K;  3IF4 A;  2R5D A;  4YXD C;  5APY A;  2BCC D;  3VTP C;  3RL0 D;  1QLE D;  1E79 H;  3G71 P;  2J59 M;  3KPE A;  4Y99 B;  4N78 D;  3U1C A;  3L70 D;  1L0L D;  1ZLL A;  1URQ D;  2M3B A;  3H1I J;  3HD7 D;  1BDD A;  5APV A;  1GL2 B;  1NTK E;  1OVV A;  2FKW B;  1KQF B;  3ABV C;  1LT9 C;  2FXP A;  1ZN5 A;  2KB7 P;  4UB6 H;  1GZL A;  1J1E B;  1EQ7 A;  4K3A A;  2M5A A;  2VRS A;  3C9I A;  3CI9 A;  4HYT B;  1SQQ G;  2IZ1 A;  2K88 A;  1JO5 A;  2KK7 A;  1USE A;  1PGO A;  3PRJ A;  1PV3 A;  1EXJ A;  1FDM A;  3GMA A;  3RK3 B;  1NU1 G;  1H0T B;  3SSU A;  3V2P A;  3GF3 A;  2JDI H;  1YYC A;  5AVS B;  1LTJ B;  2POH A;  1T8Z A;  1EC5 A;  1Q90 D;  1VPC A;  4GOD A;  3AE8 C;  5L8R J;  3CCR P;  3L75 G;  1N7S A;  3MD0 A;  1Q7Y Q;  1D7M A;  1JCD A;  1MFT A;  1N7S B;  3L71 E;  4PV1 B;  4LGD E;  1NTZ J;  2O01 H;  2WMM A;  3A7O A;  3KYQ A;  2QSI A;  1NO4 A;  3AED C;  1OZH A;  3USS A;  3II6 A;  2KUB A;  1JCC A;  5K5G B;  3D71 A;  2FXM A;  1N7S D;  3M0D C;  1PGQ A;  1VL2 A;  3L74 E;  2QM8 A;  2JO1 A;  2ZT9 D;  1W2B O;  2D2C D;  4UB8 H;  2OYI B;  2Q7C A;  1NTK D;  1EXI A;  3FXD A;  3P8M C;  4GOE A;  1X79 B;  2HG5 D;  5DJU B;  2H88 C;  4ZMD A;  1S4X A;  2M5A B;  1FOS E;  1DIP A;  3KZI H;  3L75 E;  1SQP E;  2Y0E A;  4GOF A;  3L73 D;  1NU1 K;  5KLV D;  2E76 B;  2ITA A;  5KLI C;  3RK3 E;  3ZDM A;  3E7K A;  5CJ0 A;  1RF1 B;  1NTZ D;  1SFC D;  1U7J A;  1AVO A;  3HE5 B;  1KYO E;  2HR3 A;  1GL2 C;  2M3E A;  5APT A;  3A0H E;  4YPC A;  1KQL A;  1VDF A;  1Q86 Q;  1Z56 A;  2KS1 A;  2LXC B;  5TJH A;  3CD6 P;  3MZW B;  2JR8 A;  3JSV C;  1MV8 A;  1NU1 J;  3MHV A;  1S5L E;  2W6J H;  4IL6 X;  4XE5 B;  5GTH H;  5KLV J;  3Q5P A;  5M1B A;  1GU4 A;  2KNC B;  2P67 A;  1SS1 A;  1L0N K;  2WSE H;  2HOD B;  5AVW B;  4BRY A;  1PIX A;  3U59 A;  4PD4 D;  2Q9I A;  1PP9 D;  1Q82 Q;  1GK6 A;  1MUU A;  2W83 C;  1WMK A;  1SQX J;  1P84 E;  4H13 D;  3TNU A;  4EI2 A;  1YJN P;  3V6I A;  4UB6 E;  2B87 B;  1L4A D;  2QVA A;  2P58 A;  2YO2 A;  2Q3I A;  2R32 A;  4EIJ A;  5E79 E;  2RKL A;  4PJ0 H;  1N7S C;  1EDJ A;  1NTM D;  2QM7 A;  3L70 J;  4PV1 C;  1CSB A;  3L74 J;  3HUS A;  1DX7 A;  2BEQ D;  4PD4 H;  1S3J A;  1VQ6 P;  4U3F E;  3D6Z A;  3G3Z A;  1BSH A;  1U7M A;  2CK3 H;  5AVV B;  1FZE A;  3CCJ P;  4U3F J;  1YQ4 C;  1OWA A;  5AW4 B;  2N1T D;  5H2F H;  2OGU A;  2J58 A;  2ZVO B;  3F89 A;  1KYO D;  3L71 G;  1YHQ P;  2JWA A;  2OYI C;  1K9M Q;  1KFN A;  3BVH A;  1KMI Z;  1DEB A;  4EDF A;  2Q5U A;  3D6Y A;  1KN7 A;  3HTK A;  3UIA A;  3E1I A;  3TK1 A;  1FZC B;  2O01 J;  1X9V A;  3FWL A;  1JM0 A;  1NKZ B;  2DW3 A;  2ZT9 B;  1EZV E;  3H1H G;  3HUS C;  1VQO P;  1FZG A;  4NPE A;  4AYC A;  3KXD A;  1PP9 E;  1MFZ A;  2O1K A;  2WIT A;  2A45 I;  3H1I D;  1GL2 D;  3FXE A;  4Z1M H;  1P84 H;  2ZFC A;  3P8C E;  3Q5R A;  4BXL A;  1SQQ E;  1KB9 I;  5AVT B;  1NHL A;  1FE6 A;  2P10 A;  3EWK A;  4WVZ A;  1KOR A;  3WU2 H;  2AEM A;  1LTG C;  4R4M A;  3VMA A;  1Y47 A;  2QJY B;  4D6T D;  1MKM A;  1PPJ E;  1X0T A;  2XU6 A;  1FS0 E;  3H1L G;  2IPP A;  5AVR B;  2H89 C;  4K35 A;  3WUV A;  1L0L K;  1G1J A;  5CCH C;  1VQN P;  4H13 B;  2BEZ F;  1TU3 F;  1PL5 A;  3OA7 A;  4L74 A;  3L37 A;  1SQB E;  1LGH B;  2V7Q J;  1LTT C;  1YQ3 C;  3CXH H;  3CX5 I;  3O6Q A;  5AVU B;  2E42 A;  1KIL C;  1RE3 A;  2Y0D A;  2YNY A;  2M8R A;  3T97 B;  1NGM B;  1BDC A;  1W5C E;  3L72 G;  3BCC D;  4EOT A;  1IK9 A;  3L70 G;  3A2A A;  4GT1 A;  3WMM 0;  2Q1K A;  3H1K D;  2A06 E;  4ZKU A;  2FYZ A;  2OTJ P;  1FOS F;  2A06 D;  3OJA B;  1IC2 A;  3Q3D A;  1SFC B;  1WRG A;  1L4A C;  1M1J C;  3PH0 A;  3L71 J;  2E76 D;  1YBK A;  1T3J A;  1RE4 A;  3CXH E;  3HD7 B;  1FAV A;  3CXH D;  2WZ7 A;  3CC2 P;  1SP4 A;  1N73 B;  3RL0 B;  2HPC B;  2IBZ G;  1GMJ A;  3L72 E;  3VP9 A;  1DD3 A;  1NU1 D;  5KLV K;  1FZC C;  1BCC D;  3H6P A;  1LT9 B;  2J5U A;  4ASV A;  3CWB D;  1NU1 E;  1SQB G;  2FYU E;  3HUS B;  1NTK K;  3M9Q A;  5BU8 B;  3VYI A;  1M7L A;  1NAF A;  1KIL E;  2JJL A;  1HGZ A;  3HE5 A;  3L74 D;  2FYU J;  1PFI A;  3GHG A;  4HKZ H;  1Q2N A;  3KZI E;  4TLF A;  2W6B A;  1OXZ A;  2JWD A;  2WSF H;  5C39 A;  3RK3 C;  1X22 A;  3GW6 A;  3H25 A;  4O9B A;  2N1T C;  1R5L A;  3TF5 A;  2WPS A;  1FJP A;  2P2U A;  4IFM A;  4N6J A;  5AVX B;  3RL0 g;  3CCV P;  3CC4 P;  1JY3 N;  1HJB A;  1NH4 A;  1OW6 A;  1RH5 B;  3I5C A;  1OW8 A;  1PP9 J;  3EQ2 A;  1FBM A;  1SQX K;  2FYU G;  1KYO H;  2A45 G;  2WPQ A;  1PGP A;  2M0B A;  1DEE G;  3H1J D;  3RBZ A;  1RY3 A;  1IZN B;  3SFE C;  1KD1 Q;  5APS A;  1SQB J;  2IYO A;  5AW7 B;  2I8D A;  1EDK A;  2PFX A;  4IL6 H;  3V2R A;  1A02 J;  1LWU C;  2KS1 B;  5CCG C;  1KFM A;  2IZ0 A;  2NPS B;  4L76 A;  4L75 A;  4LLH A;  2WT7 A;  3S4R A;  4U7J A;  3CWB J;  3AE3 C;  3GHG C;  3M0A A;  4PD4 I;  4UB8 E;  1G2C B;  1BGY J;  1EZV D;  1LP1 A;  1URQ A;  3PHL A;  4JYB A;  2ZVN B;  3TGU G;  3MIW A;  1GU5 A;  1RF1 A;  1VQL P;  1BGY E;  1U57 A;  1OVU A;  1PZQ A;  3P8C D;  1GK4 A;  2E75 D;  2V7Q H;  1SFC A;  1HF9 A;  1BSN A;  4GIF A;  1H0T A;  1N73 C;  1IFP A;  2AEJ A;  2E76 C;  1NAY A;  2BAS A;  2ZAE B;  3RL0 C;  2H8P D;  1RF1 C;  1FZB A;  1SQV G;  3F5H A;  1VQP P;  3VMY A;  1SQP K;  1RE4 C;  2NPS D;  2JEE A;  4JBZ A;  2YMK A;  1OFC X;  1Y9B A;  3RBX A;  1GDT A;  2P7J A;  3N7N A;  5AW0 B;  1GL2 A;  3G4S P;  2OYH C;  2GM4 A;  3OW2 O;  1KV4 A;  1S5L X;  1PPJ G;  2FYU K;  1GTW A;  2B88 A;  2D2C C;  1CZQ A;  2FYN B;  4ASW A;  1NVO A;  1J1D C;  2KZJ A;  1RE3 C;  2N1T B;  2QRX A;  1IK7 A;  2IBZ I;  1S9K D;  1RQV A;  3G9R A;  1L0N E;  3CPW O;  3QH9 A;  2XNX A;  4NPD A;  3V2N A;  2C0W A;  2N9B A;  2PGD A;  1J2J B;  1S2E A;  1P84 D;  3CX5 E;  4D6T J;  1LNQ A;  2ZYD A;  3K5B A;  2OTL P;  1JMM A;  4DZO A;  2IFN A;  1SQQ J;  2HYN A;  4BWN A;  3L71 D;  4W7Y A;  1FC2 C;  2WSC H;  3L35 A;  5H2F E;  3KHU A;  1SQX E;  3GLM A;  3O8Z A;  1JB0 J;  1SQB K;  1LWU B;  2NPS C;  2W6A A;  4W7Z A;  1NTM K;  1HVV A;  2YKO A;  3C1L A;  3VMZ A;  1T6A A;  3TDK A;  1FZC A;  5AVY B;  1QVF O;  1HGV A;  1LWU A;  3AE5 C;  3PTZ A;  5CCG A;  1CI6 B;  2AXC A;  1HTL C;  3VMX A;  3L70 E;  1SQP D;  1NTM E;  2PAJ A;  2QE7 H;  1JY3 O;  5APW A;  5APU A;  1T3U A;  5KJ7 D;  3WUT A;  5AW1 B;  1S72 P;  1VQ8 P;  1L4A A;  3H32 B;  1ZME C;  1NWQ A;  3MTU E;  3M9B A;  1BE3 G;  2N9Y B;  3M91 A;  4U3F D;  2W27 A;  1AV1 A;  3AE1 C;  3MUD C;  4I1L A;  3NTN A;  3WU2 E;  4KT0 J;  4WWI A;  3TYY A;  1CI6 A;  3S9O A;  5B5E E;  2GUS A;  2ZXX A;  1QVG O;  2KLU A;  5KKZ C;  2WSE J;  3IR9 A;  1ZV8 A;  1S5L H;  4N3Y B;  5GTH E;  3H1J E;  3U1A A;  1H8A A;  3CCE P;  2BCC G;  4I6M C;  3CCU P;  2I1K A;  2Y9Y A;  1H88 A;  2OYH B;  2NRG A;  4NPF X;  5CMZ A;  2RH0 A;  5KJ7 A;  2H7H A;  1KZU B;  1N86 A;  1L0L G;  5APX A;  2D2C B;  2FYN C;  1QX8 A;  2QJY C;  3JC2 2;  1J1D B;  2E5Y A;  3W67 A;  4IFF A;  3R2P A;  3L72 D;  3BCC G;  4HJG H;  4ZKP A;  4OGQ D;  2KSE A;  4EYY Q;  2K9J A;  1SQX D;  4XFJ A;  3M06 A;  3P7K A;  3KDP B;  1SQQ D;  2PRR A;  4H13 C;  1JY2 O;  4HB1 A;  1L0L E;  1LT1 A;  1NTZ K;  1KYO I;  4N78 E;  4PV1 D;  1A02 F;  2WPR A;  1RF0 C;  3B5N B;  1L2P A;  2BCC E;  2WPV B;  1JY2 N;  2Z5I A;  1AJY A;  3Q1M A;  3V2Q A;  1W2E A;  3VP8 A;  4A7P A;  3N4X A;  2V4H A;  3MP7 B;  2O01 N;  1VF5 B;  1FU1 A;  4YTP C;  3TGU J;  1YJW P;  1N7L A;  3BRV B;  1NTM J;  2E74 D;  2XV5 A;  3CWB G;  1QL2 A;  1SQB D;  1LJ2 A;  2ZJS E;  1IFJ A;  3HD7 C;  1IFN A;  1P84 I;  3L74 G;  2XDJ A;  1LTB C;  3AE9 C;  3C8V A;  4WY4 B;  3CCM P;  2OYI A;  1VF5 D;  1FDO A;  2JKV A;  3PJS K;  4ZNC A;  3CCQ P;  1RF0 A;  3I55 P;  2IYP A;  1QL1 A;  1VQ7 P;  3CCL P;  2Z5H A;  3TSI A;  1NTZ G;  2YMY A;  1YIJ P;  2H43 A;  1URQ B;  2KSJ A;  2C0X A;  1GW4 A;  3CXH I;  3BAS A;  3JCU E;  5KKZ B;  1QGK B;  3CX5 H;  4JYC A;  1BGY D;  5AW8 B;  2E43 A;  3L73 G;  4IFD K;  3FX0 A;  1HJ0 A;  4IOI H;  4D6T E;  1AQT A;  5KJ7 C;  4WB4 A;  1BCC J;  5B66 E;  1PP9 G;  1JEK A;  2LXB A;  2E74 C;  3L73 J;  2K1A A;  3IFM A;  2GA1 A;  2QG4 A;  1L0N G;  4KHX A;  5AW5 B;  1K73 Q;  1EZV G;  3L73 E;  3H1J J;  3RK3 D;  1DH3 A;  4RJT A;  1M8O B;  2YKQ A;  1EZV I;  3R4Y A;  2MJZ A;  5AVZ B;  3LID A;  2OQQ A;  3TNU B;  1K8A Q;  3HD7 A;  1H89 A;  1FZA A;  2HOD A;  1S1C X;  5AW2 B;  3OAK A;  3GHG B;  1SQV D;  2QJP B;  2G8Y A;  3M9H A;  2OAR A;  1VF5 C;  4AQR D;  3AEB C;  4WY4 A;  3W68 A;  1SQV E;  3A3Y B;  5CHX A;  1M1K Q;  1RHZ B;  2W90 A;  2QA4 P;  2OTK E;  1BE3 J;  4JF7 A;  4C7N A;  1GD2 E;  1UII A;  1NTM G;  1ZRT E;  2O3J A;  1YTZ I;  3E1R A;  2HPC A;  4XA4 A;  2K37 A;  1N73 A;  2YXQ B;  2P1J A;  5BU5 A;  2JP3 A;  2XND H;  3M0D A;  4PD4 E;  3D70 A;  4IL6 E;  5CJ4 A;  1JTH A;  3B5N A;  2WTY A;  3GG2 A;  2W8Z A;  4TT3 H;  1SQP J;  4GKG A;  2WVR A;  3H1L J;  5CBN A;  1KIL D;  1URQ C;  2QJK B;  1VQM P;  1SLQ A;  1K05 A;  2KOG A;  3L72 J;  3VOP A;  5KAF E;  5BVZ A;  1HWT C;  1WT6 A;  3I56 P;  4KJM A;  2Y9Z A;  3EFG A;  3T97 A;  3BCC J;  3RGU A;  4DT0 A;  3WUU A;  2MKV A;  4OVN F;  4Y99 C;  5KLV E;  4WY4 D;  1L0L J;  3MGN A;  4D6T G;  3LW5 H;  3MUD A;  3H1H J;  2IDB A;  2E74 B;  2KLV A;  1ZOY C;  2R3S A;  1NOH A;  2BCC J;  3V4Q A;  1J1E C;  1NKN A;  2AEF A;  3H1I G;  1JMB A;  2KI7 B;  1JTH B;  1N2D C;  2IX7 C;  1XTG B;  1SQP G;  1SQQ K;  3AEE C;  4LC1 A;  1IFM A;  1Y8A A;  2R3C A;  1SQV K;  3A0H H;  1NYH A;  1E5W A;  3AE7 C;  3QWO C;  1LTI C;  4OWF A;  3SWY A;  1LTA C;  1BCC E;  1BE3 D;  2GUV A;  2E75 C;  1MZ9 A;  3S1K A;  2WWW A;  2NPS A;  2WT7 B;  1LTJ C;  3B4S A;  1BE3 E;  2AXT E;  3NMD A;  1JY3 P;  1CW5 A;  1HBW A;  1SQV J;  4GDO A;  2B89 A;  2KIK A;  2KP8 A;  2WQY C;  4RES B;  2C9N Y;  3FWN A;  1ZXG A;  3CWB E;  4I2L C;  2NZ2 A;  3P32 A;  5AW6 B;  3V4W A;  5CCG D;  3CME P;  5AVQ B;  3TGU E;  2IBZ D;  2B87 A;  1G1I A;  1AA0 A;  1KB9 D;  3AEC C;  3H1K G;  5KTB A;  2A06 G;  1AFO A;  1HH0 A;  2QIW A;  1GW3 A;  4L73 A;  1M1J A;  3AE2 C;  3L75 D;  4PJ0 E;  1R5S A;  1K04 A;  1SQX G;  1KB9 E;  3B71 A;  4BRY B;  1LTS C;  1OW7 A;  1OX3 A;  2QJK C;  2ZYG A;  1AVY A;  5GTI E;  2HFE D;  3CL3 D;  4MN4 C;  4M3L A;  2XKM A;  1FDI A;  4C7N B;  1IFD A;  5CCH D;  1VQK P;  4R4L A;  1ZR4 A;  1M56 D;  2K3R A;  2L5G B;  5KAI E;  2QEX P;  1BCC G;  1S9K E;  1ZR2 A;  2N1T A;  1KQS O;  1OIP A;  4H44 D;  2OYO A;  2IFM A;  1LT9 A;  2B9B A;  2WSC J;  3BCC E;  1KTM A;  5KLI B;  4H0L D;  1M90 Q;  3H1L E;  3CX5 D;  1N8R Q;  2CPB A;  2E5T A;  2PP6 A;  1VQ5 P;  3RK2 B;  5CCH A;  1YTZ T;  1NTK G;  2XZR A;  1T2K C;  3HE4 A;  5GTI H;  1NTK J;  1IJD B;  3H1J G;  3HE4 B;  3AE4 C;  3B5N C;  5AW9 B;  1L0N J;  4AUW A;  1NJI Q;  2YKP A;  1RQU A;  3RK2 D;  3ITK A;  5KLV G;  3GF7 A;  1JNM A;  1JUN A;  1KQG B;  1HUC A;  1FZF A;  4H0L B;  2E75 B;  2R44 A;  1VQ4 P;  3AE6 C;  2YIU C;  1SVF A;  4H44 B;  4I7Z B;  3NXS A;  1OMI A;  2FYU D;  3PP5 A;  2IBZ E;  4HH2 A;  4QMA A;  3HRN A;  3CLQ A;  4WBA A;  4WY4 C;  3TGU D;  2YXR B;  1G2C A;  1LP1 B;  2CPS A;  3A0B E;  5TIS E;  2I1J A;  2A45 H;  4YXW H;  1BGY G;  2RN0 A;  1YJ9 P;  3VN0 A;  2Y0C A;  5AW3 B;  4JPZ B;  5KAF H;  3FGA D;  2FFD C;  1KB9 H;  3LIE A;  3CCS P;  1EDI A;  3L75 J;  1R8E A;  1X8Y A;  4OGQ C;  4CPG A;  5B66 H; 
#chains in the Genus database with same CATH homology
 2O1J A;  1XTC C;  3A5T A;  4W80 A;  1IO4 A;  4OH8 B;  2ZXE B;  3L4F A;  3NFQ A;  3SWF A;  1FJK A;  3V5B A;  3HTK B;  1AQ5 A;  3RK2 C;  1LTJ A;  2Z4E A;  4B86 A;  4DOJ A;  1JY2 P;  1T2K D;  3L36 A;  3BRT B;  2YO3 A;  5APQ A;  3BAT A;  1JOC A;  1IFI A;  2FFD A;  3KQG A;  4C7R A;  1KIL A;  2OYH A;  3B5N D;  1KIL B;  2LKM A;  2FFD B;  3B8E B;  4C46 A;  2C9L Y;  2KYV A;  1SFC C;  3H32 A;  1L4A B;  1M1J B;  2HLO A;  2R5B A;  2R5D A;  5APY A;  3VTP C;  3RL0 D;  2J59 M;  3KPE A;  4Y99 B;  4N78 D;  3U1C A;  1ZLL A;  3HD7 D;  1URQ D;  2M3B A;  5APV A;  1GL2 B;  2FKW B;  1LT9 C;  1ZN5 A;  2KB7 P;  1H89 A;  1GZL A;  1J1E B;  1EQ7 A;  2VRS A;  3C9I A;  3CI9 A;  4HYT B;  1JO5 A;  1FDM A;  3RK3 B;  3V2P A;  1YYC A;  5AVS B;  1LTJ B;  2POH A;  1T8Z A;  1VPC A;  1N7S A;  3MD0 A;  1JCD A;  1N7S B;  4LGD E;  2O01 H;  3A7O A;  3KYQ A;  1NO4 A;  3II6 A;  1JCC A;  2FXM A;  1N7S D;  3M0D C;  2QM8 A;  2OYI B;  2Q7C A;  3P8M C;  1X79 B;  2HG5 D;  1FOS E;  3U59 A;  1NWQ A;  1NU1 K;  1RF1 B;  5CJ0 A;  1SFC D;  3HE5 B;  5APT A;  1GL2 C;  1KQL A;  1VDF A;  1Z56 A;  1MV8 A;  4XE5 B;  1GU4 A;  2P67 A;  2Q9I A;  1L0N K;  2WSE H;  2HOD B;  5AVW B;  1GK6 A;  1MUU A;  3TNU A;  1L4A D;  2YO2 A;  2Q3I A;  2R32 A;  4EIJ A;  1N7S C;  2QM7 A;  1CSB A;  3HUS A;  1DX7 A;  3G3Z A;  5AVV B;  1FZE A;  1OWA A;  5AW4 B;  2N1T D;  2J58 A;  2OYI C;  1KFN A;  3BVH A;  1DEB A;  2Q5U A;  3HTK A;  3UIA A;  3E1I A;  3TK1 A;  1FZC B;  1X9V A;  1NKZ B;  1FZG A;  3HUS C;  4AYC A;  2O1K A;  1MFZ A;  2WIT A;  2A45 I;  1GL2 D;  2ZFC A;  3P8C E;  5AVT B;  1NHL A;  1LTG C;  2XU6 A;  2IPP A;  5AVR B;  1L0L K;  1G1J A;  5CCH C;  3OA7 A;  3L37 A;  1LGH B;  5AVU B;  1LTT C;  2E42 A;  1KIL C;  1RE3 A;  2YNY A;  2M8R A;  4EOT A;  1IK9 A;  4GT1 A;  3A2A A;  3WMM 0;  4ZKU A;  2FYZ A;  1FOS F;  3OJA B;  1IC2 A;  1SFC B;  1WRG A;  1L4A C;  1M1J C;  3HD7 B;  1T3J A;  1RE4 A;  1FAV A;  2WZ7 A;  1SP4 A;  1N73 B;  3RL0 B;  2HPC B;  3VP9 A;  5KLV K;  1FZC C;  3H6P A;  1LT9 B;  3HUS B;  1NTK K;  3M9Q A;  5BU8 B;  3VYI A;  1M7L A;  1NAF A;  2JJL A;  3HE5 A;  1HGZ A;  1PFI A;  3GHG A;  2W6B A;  1OXZ A;  2WSF H;  3RK3 C;  4O9B A;  2N1T C;  2WPS A;  1FJP A;  2P2U A;  4IFM A;  4N6J A;  5AVX B;  1JY3 N;  1HJB A;  1NH4 A;  3I5C A;  3EQ2 A;  1FBM A;  1SQX K;  2WPQ A;  4LLH A;  2A45 G;  1GD2 E;  1RY3 A;  5APS A;  5AW7 B;  1A02 J;  3V2R A;  1LWU C;  5CCG C;  1KFM A;  2NPS B;  2WT7 A;  3M0A A;  3GHG C;  1G2C B;  4JYB A;  1RF1 A;  1URQ A;  3MIW A;  3P8C D;  1GK4 A;  1SFC A;  4GIF A;  1N73 C;  2BAS A;  3RL0 C;  1RF1 C;  2H8P D;  1FZB A;  3VMY A;  1SQP K;  1RE4 C;  2NPS D;  2JEE A;  1GDT A;  2P7J A;  3N7N A;  5AW0 B;  1GL2 A;  2OYH C;  2GM4 A;  2FYU K;  1GTW A;  1CZQ A;  1J1D C;  2N1T B;  1RE3 C;  1S9K D;  2XNX A;  3V2N A;  2C0W A;  2N9B A;  1J2J B;  1JMM A;  4DZO A;  2IFN A;  2HYN A;  4W7Y A;  2WSC H;  3L35 A;  3O8Z A;  1SQB K;  1LWU B;  2NPS C;  2W6A A;  4W7Z A;  1NTM K;  1HVV A;  2YKO A;  3VMZ A;  1FZC A;  5AVY B;  1HGV A;  1LWU A;  5CCG A;  1CI6 B;  3VMX A;  1HTL C;  2PAJ A;  5APW A;  5KJ7 D;  1JY3 O;  5APU A;  1T3U A;  5AW1 B;  1L4A A;  3H32 B;  3MTU E;  3M9B A;  3M91 A;  2W27 A;  4I1L A;  3NTN A;  3TYY A;  1CI6 A;  2GUS A;  3IR9 A;  1ZV8 A;  4N3Y B;  1H8A A;  3U1A A;  4I6M C;  2OYH B;  2I1K A;  1H88 A;  5CMZ A;  2H7H A;  5KJ7 A;  1KZU B;  1N86 A;  5APX A;  1J1D B;  4IFF A;  3R2P A;  4ZKP A;  3M06 A;  3P7K A;  3KDP B;  1JY2 O;  1NTZ K;  4N78 E;  1A02 F;  2WPR A;  1RF0 C;  3B5N B;  2Z5I A;  1JY2 N;  3V2Q A;  1W2E A;  3VP8 A;  3N4X A;  1FU1 A;  1N7L A;  3BRV B;  2XV5 A;  1QL2 A;  3HD7 C;  1IFJ A;  1GU5 A;  1IFN A;  2XDJ A;  1LTB C;  4WY4 B;  2OYI A;  1RF0 A;  1QL1 A;  2Z5H A;  3TSI A;  2YMY A;  2H43 A;  1URQ B;  2KSJ A;  2C0X A;  1GW4 A;  3BAS A;  4JYC A;  5AW8 B;  2E43 A;  4IFD K;  5KJ7 C;  4WB4 A;  4KHX A;  3IFM A;  5AW5 B;  3RK3 D;  1DH3 A;  2YKQ A;  2MJZ A;  5AVZ B;  3LID A;  3TNU B;  3HD7 A;  1FZA A;  2HOD A;  5AW2 B;  3OAK A;  3GHG B;  3M9H A;  2OAR A;  4AQR D;  4WY4 A;  3A3Y B;  5CHX A;  4C7N A;  4JF7 A;  1YTZ I;  2HPC A;  4XA4 A;  1N73 A;  2P1J A;  5BU5 A;  3M0D A;  5CJ4 A;  2WTY A;  1JTH A;  3B5N A;  4GKG A;  1KIL D;  1URQ C;  1SLQ A;  2KOG A;  3VOP A;  5BVZ A;  1HWT C;  1WT6 A;  3EFG A;  3T97 A;  4Y99 C;  4WY4 D;  3MGN A;  3LW5 H;  3MUD A;  2KLV A;  1NOH A;  3V4Q A;  1J1E C;  1NKN A;  1JTH B;  1N2D C;  2IX7 C;  1XTG B;  1SQQ K;  4LC1 A;  1IFM A;  4WBA A;  2R3C A;  1SQV K;  3SWY A;  1E5W A;  1LTI C;  1LTA C;  2GUV A;  1MZ9 A;  2WWW A;  2NPS A;  2WT7 B;  1LTJ C;  3NMD A;  1JY3 P;  1CW5 A;  1HBW A;  2KP8 A;  2C9N Y;  4RES B;  4I2L C;  3V4W A;  5CCG D;  3P32 A;  5AW6 B;  5AVQ B;  5KTB A;  1G1I A;  1AFO A;  1HH0 A;  1GW3 A;  1M1J A;  1LTS C;  2HFE D;  3CL3 D;  4M3L A;  2XKM A;  4C7N B;  1IFD A;  5CCH D;  1ZR4 A;  2L5G B;  1ZR2 A;  1S9K E;  2N1T A;  2IFM A;  1LT9 A;  2CPB A;  2PP6 A;  3RK2 B;  5CCH A;  1YTZ T;  2XZR A;  1T2K C;  3HE4 A;  1IJD B;  3HE4 B;  3B5N C;  5AW9 B;  2YKP A;  3RK2 D;  1JNM A;  1JUN A;  1HUC A;  1FZF A;  1SVF A;  3NXS A;  4HH2 A;  3PP5 A;  3HRN A;  3CLQ A;  4WY4 C;  1G2C A;  2CPS A;  2I1J A;  2A45 H;  3VN0 A;  5AW3 B;  2FFD C;  3LIE A;  1X8Y A;  4AUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...