3L73G

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l73G00
1NU1G 1PPJG 3L74G 3BCCG 1BCCG 1BGYG 1BE3G 1KYOH 3CWBG 1SQBG 4D6TG 1SQQG 3L70G 1NTZG 3CX5H 3H1IG 3L72G 1L0LG 2A06G 1P84H 2BCCG 4PD4H 1SQXG 3H1JG 1EZVG 1SQVG 3L71G 1KB9H 4U3FG 3TGUG 1L0NG 5KLVG 3H1LG 1NTMG 3H1HG 3L73G 3H1KG 1NTKG 3L75G 1PP9G 2FYUG 3CXHH 2IBZG 1SQPG
chains in the Genus database with same CATH superfamily
2A45H 3BCCG 2HG5D 1PL5A 3RK3D 5AVXB 1SQXG 4HB1A 1P84D 4RKUJ 4I2LC 3GHGC 1FDOA 2IDBA 2IZ0A 3SWYA 2N9BA 5AW5B 4KT0J 3IR9A 3H1JE 1FAVA 2FYUG 3AEEC 2Z5IA 4GIFA 3H1ID 3N7NA 3RL0D 4IOIH 3UIAA 4Y28J 5CJ0A 2A06G 3V2NA 2JO1A 1RQUA 2BEQD 3P8MC 3BRVB 1N86A 2IYOA 1T8ZA 1KD1Q 1NAFA 3L70J 2A45G 4Z1MH 2VRSA 2XU6A 2YKPA 1HJBA 1ZP0C 3E7KA 1KORA 4M3LA 5B5EH 5KLVD 2W6BA 2WSEJ 1MKMA 1NTZJ 2JJLA 3L71E 3AECC 3RK3E 2V7QH 2QJPB 3I55P 1YHQP 3AEFC 1S5LX 3HRNA 3ITKA 3TK1A 2RN0A 1HF9A 4H44D 4L75A 2WSEH 3L75J 4ZKUA 3M0DC 1K05A 1FOSE 2KK7A 5AVZB 1NTKD 5AVVB 5AVUB 4D6TJ 4ZMDA 4LLHA 1QEXA 3QWOC 5KAFE 1N7SB 2SPZA 2XKMA 5CCGD 3Q3DA 1N73C 1L0LD 3M0AA 1LJ2A 1YJ9P 3FXEA 1URQB 1LP1B 1AQTA 1KB9H 3TGUG 5H2FE 3VTPC 1JY3N 1Q82Q 3VP8A 3CMAP 3MD0A 1NTKK 4L74A 1JY2N 1PPJG 3HE5A 3CMEP 1NU1K 3II6A 1Q81Q 1QGKB 4PV1C 5TISE 3IF4A 2HODA 1HVVA 2WZ7A 2KZJA 4QMAA 5KLVE 3M06A 1FZEA 2JWAA 4DCKA 2IBZI 2JEEA 3NXSA 1NTZG 5APSA 5CCGC 2BCCD 1JEKA 3H1KJ 1MFTA 3RK2B 1EXJA 1VQ4P 2QSIA 2FKWB 1QX8A 1OW6A 3Q5RA 3HTKB 4WY4D 3A0HH 2QVAA 3V5BA 2Q9IA 2YIUC 1EC5A 5APTA 2KSEA 5AVWB 4D6TG 2J5UA 3MGNA 5CBNA 2QJYC 2WSSH 3AEAC 2ZXXA 4ASWA 4CPGA 2CK3H 1X0TA 3HUSC 4H13B 1DEBA 3A3YB 3GF3A 1JNMA 2A45I 4JPZB 4GOFA 4LGDE 5CHXA 3KPEA 2LXCB 4PD4H 2K88A 1EZVG 1J1DB 3P8CD 1H88A 1L0NK 1JY3P 4IL6H 3CWBD 4AYCA 3FX0A 4W7ZA 3TF5A 5AVSB 3CL3D 1NU1J 3KYQA 1FS0E 2FFDB 5B66H 1KFMA 3L74D 2AXCA 3WU2H 2MJZA 4NPDA 3KDPB 3MTUE 3AEBC 5GTIE 1U57A 4A7PA 2Z4EA 2OYIB 3OW2O 1FDIA 1USEA 4EYYQ 1IC2A 1SFCC 2E5YA 1LNQA 3BCCD 1URQD 3L35A 1PGPA 1KTMA 4LC1A 1N7SA 2H89C 1LTJC 3L73J 4IFFA 3S4RA 1LT9B 1NJIQ 2POHA 3PJSK 1WRGA 4PJ0E 4YTPC 1JB0J 2W83C 4O9BA 1URQA 2E74C 1LP1A 5KJ7C 4WBAA 3H1HE 3C8VA 1BE3D 3P8CE 1S2EA 1W2BO 1N8RQ 3AE2C 3GG2A 1LWUB 3EFGA 1YTZI 2KS1B 1FZCC 1NTMD 3G71P 3OA7A 4B86A 2G3AA 5AW2B 1M57D 1SQXK 4BRYB 1BGYJ 3TYYA 1SQVE 2WSCJ 4ASVA 1ZR2A 4N78E 1TU3F 3GMAA 2I1KA 3W68A 4HH2A 1L0NJ 3L74E 3B4SA 2M5AB 4C7NB 1NH4A 1FOSF 1VL2A 2N1TC 1KQGB 1Q86Q 3LIEA 2NPSD 1GL2C 1OVRA 4U3FE 2Q7CA 1AFOA 4C46A 3HTKA 4IL6X 3RK3B 2FYUK 1IJDB 2HYNA 4H13D 3PHLA 1KV4A 2KXPB 5APVA 3MUDA 2FY8A 2NZ2A 3BVHA 1SQBJ 1YJNP 2B9BA 2L5GB 2JKVA 1KILC 4OGQC 5BU5A 5DJTB 2WPQA 1SQPK 1JCDA 3KZIH 4KJMA 1AVYA 3U59A 1G2CB 1DIPA 3BASA 2KP8A 1GW4A 2OYOA 3RL0B 3L72J 2WSFJ 3AE3C 3CXHE 1YQ3C 2ZVOB 1KZUB 3M9QA 2FYNC 1IFIA 3L4FA 3CX5E 2C0XA 4YXDC 5CCHC 1OXZA 4HYTB 1DD3A 2OYHC 3W67A 1HGVA 3CCSP 1L4AD 2WTYA 1KYOD 2W90A 2ZYGA 1PPJD 2NRGA 1QL1A 3WUTA 1S4XA 2FFDA 1MFZA 1SQXJ 3L70D 5AVRB 2E75C 2ZT9C 1YYCA 2QIWA 1SQQK 2Y0EA 2Y0DA 1X8YA 2ITAA 1SS1A 2OYIA 1G1JA 3BATA 4H44B 1NTZD 1GDTA 5KKZB 1SQBG 3SWFA 1CSBA 2QM8A 2FYUJ 2QJKC 3GF7A 1J1EB 2H8PD 1Q7YQ 3IN6A 3ABVC 1LT9A 3L75D 1BCCJ 4ZKPA 4OH8B 1JY3O 3CCJP 1GU4A 1JUNA 1EXIA 4D6TD 1PP9E 1KB9D 1JY2O 4H0LC 3L72G 1JM0A 1KQLA 1MUUA 1NTZK 1SQPJ 1LWUA 1RF0C 1OIPA 2I8DA 2KS1A 2QJYB 3SWKA 3H1LE 4UB6H 2OARA 4BRYA 1L2PA 1JTHB 1HGZA 3HUSB 1UIIA 4K3AA 1QVFO 1EZVD 3RBXA 3KQGA 4U3FG 2M5AA 4C7NA 2H7HA 3F89A 2IBZG 2O01H 5APWA 2QRXA 1WT6A 3V2RA 1IK9A 3IAOA 3S1KA 2R5BA 4WY4B 3AE6C 3H1KD 1SQQJ 4N3YB 5APQA 3MP7B 2B87B 1BCCG 3TGUJ 1EDJA 4JBZA 3S9OA 1GMJA 1T6AA 2YXQB 1G2CA 3VOPA 5GTHE 2KSJA 3A7OA 1SQPG 4PD4D 1KMIZ 1MZ9A 1KQFB 2MKVA 2V7QJ 2O3JA 2JR8A 3NTNA 3QH9A 2I1JA 2R32A 3E1RA 3CCUP 2FXMA 2LR2A 3E1IA 5KAIH 1E79H 4TLFA 1P84E 4Y99C 1RQVA 1EDIA 1OVUA 3LW5J 2HFED 4PV1D 1QLED 3PLNA 2Q3IA 5CMZA 1FZCB 1NU1D 4L76A 2M3BA 5APYA 1PGQA 3H1KE 2W27A 3LW5H 1SQQG 3OAKA 3JCUE 1QVGO 3H1IE 5KLIC 5CCGA 2ZYAA 1HBWA 1JO5A 3NMDA 2QE7H 1JMBA 4W7YA 3L73D 1VF5C 3H1LG 3TDKA 1X9VA 3EFFK 3F5HA 2IZ1A 1NKZB 2E76C 3R4YA 3V2QA 3CCEP 1T3UA 3L71J 1IK7A 1JTHA 3EQ2A 3HD7C 3HUSA 1BSHA 2OQQA 2OTJP 3D6YA 4GKGA 3FXDA 1VQMP 3G3ZA 1BGYD 3M9BA 1NTKE 5K5GB 2NPSB 1IFMA 3RBZA 2E42A 3BRTB 4YPCA 1L0ND 4NPEA 3H1JG 1GW3A 2FYNB 3EWKA 1L0LE 2Y9YA 3CC4P 4WY4A 2YNYA 2W6JH 5KAFH 3CXHI 4OWFA 1YI2P 1S3JA 2GUVA 3I5CA 1FDMA 2AEMA 2Q3EA 3CX5I 1QL2A 4U7JA 2B87A 1M7LA 5H2FH 1YQ4C 1SFCD 1ZW0A 1OVVA 1VQ7P 3JC22 1DEEG 1JCCA 1NAYA 1FZAA 4JQ0D 2BASA 1JY2P 3SFDC 3AEDC 1RH5B 1SFCA 3L71G 2E74D 5KJ7D 5TISH 1AJYA 1NVOA 2L91A 2BCCE 2QJKB 1R5LA 1LTJA 1BDDA 1SLQA 3L72D 5C39A 2PFXA 2KOGA 1VQ8P 2ZXEB 1L4AB 4I7ZC 1SQBK 4BXLA 1CW5A 1AA0A 1S72P 1RHZB 1DH3A 3D6ZA 1RF1B 3A2AA 4GOEA 5CJ4A 1D7MA 1GZLA 2N9YB 2KZIA 3R2PA 1FZCA 2N1TD 2YMYA 3H1IG 1BDCA 1SQXD 3A0BE 2C0WA 4RESB 3L37A 1NHLA 3IFMA 3C9IA 3H6PA 1GL2D 3B8EB 5AW9B 1IFDA 2YMKA 2IBZD 3KHUA 1A02F 1M90Q 1ZRTD 3I56P 3LIDA 3CCMP 5AW7B 3USSA 3GHGB 3M91A 4ZNCA 3CWBE 3VMXA 2QJPC 1T2KC 1FU1A 5KLVG 4JYBA 1AVOA 2FYUD 1KILD 2XDJA 4OGQD 1BCCD 1LTAC 2AXTE 2A06D 1GK6A 2ZYDA 1RE3A 1N7SC 1RE4C 3HE4B 1SQPD 4HKZH 2W6AA 1KN7A 5CCHD 2JP3A 2H43A 1IFNA 2R44A 3BCCE 1L0LG 3GLMA 1Y8AA 5GTIH 2NPSA 1HJ0A 4AQRD 1AV1A 5AW8B 3AE1C 1LGHB 1PGOA 2E75D 2ZT9D 5CBOA 1ZRTE 3H1HJ 1BE3E 3VP9A 4PJ0H 2YKQA 2CPSA 3D70A 2Y9ZA 4DT0A 1FC2C 1X22A 1S5LE 1P84I 1NTME 1SQQD 3RK2C 1SQVJ 2FYUE 1DD4A 3P7KA 2G8YA 2R5DA 5EFWB 1S9KD 2XV5A 1N2DC 2H88C 3TGUD 2BCCG 1N73B 3L74J 3AE7C 1FZBA 4H0LD 2WT7B 5KLIB 4U3FJ 2WPRA 2M3EA 2O01N 1YJWP 1L4AA 1VQ5P 4R4MA 2WPSA 2D2CC 3O6QB 1RF1A 3WUUA 4PV1B 3A5TA 1J1DC 3CPWO 4EI2A 3KXDA 3B71A 3H1HG 3HD7B 1OW7A 1FE6A 2KI7B 2Q6QA 5E79E 4DOJA 1MV8A 3D71A 1N7LA 1NO4A 2DW3A 1DX7A 3N4XA 2YIUB 1SQVG 3GHGA 2IX7C 1VQ9P 3CXHH 1S5LH 1M1JC 2PGDA 3L74G 1FBMA 2GM4A 2OYIC 2WVRA 1KYOE 3CX5H 1PPJE 3WMM0 2LXBA 2J58A 2O01J 3L70E 2CPBA 3MIWA 1JOCA 1PFIA 4HJGH 1HWTC 1H89A 3HE4A 3Q5PA 3B5NC 1LT9C 1YITP 4IFMA 1VDFA 2WPVB 3L71D 3SFEC 3M9HA 1NTZE 1OMIA 4XE5B 3V6IA 1W2EA 2JDIH 2B89A 1LWUC 1HUCA 3L75E 1BE3G 1M56D 3FWLA 1NWQA 4L73A 1PP9J 4D6TE 2ZFCA 1KB9E 3C1LA 2P67A 1NTMG 4I7ZB 2K3RA 3VMAA 2B88A 4K35A 3V2PA 2PAJA 2IPPA 1G1IA 2ZAEB 1FJPA 5E79H 2QG4A 3M0DA 4AUWA 2P10A 3H1LJ 1BSNA 1SFCB 1Y9BA 2ZVNB 4JYCA 5BVZA 3RK3C 4DZOA 1LTJB 1KFNA 1EZVE 1N73A 2WWWA 2KLUA 3K5BA 1ZLLA 4BWNA 3Q2YA 1KYOH 1U7JA 2E74B 2P1JA 2WT7A 1KC8Q 1T3JA 1VF5D 1X79B 5AW4B 2QA4P 1OZHA 1LTTC 1FZGA 1CI6B 1FJKA 2E76D 4IFDK 2Q1KA 1E5WA 3A0HE 5M1BA 1WMKA 1M8OB 3H1JJ 1Q2NA 3HD7D 3O6QA 1ZXGA 3RL0C 3MZWB 1R5SA 1OFCX 2K9JB 2R3SA 5DJUB 3H25A 1VQ6P 5BU8B 1PP9G 2P2UA 2N1TB 4GDOA 5KLVK 3HD7A 1A02J 1GL2B 4YXWH 2FXPA 1PZQA 2GA1A 3AEGC 4PD4E 1LTGC 3CI9A 2M8RA 1HTLC 1ZV8A 5GTHH 5TJHA 4EDFA 3PP5A 4IL6E 4DJGA 3FGAD 4NPFX 2OTKE 4MN4C 3T97B 3L70G 2O1JA 2IFNA 5KTBA 1KILB 2KUBA 1EDLA 4H44C 4OGQB 2Y0CA 2HPCB 1L0LK 1LT1A 5KKZC 5B66E 3TSIA 4EIJA 4C7RA 3TNUB 3WU2E 1P84H 1J1EC 2W8ZA 1NU1E 1FZFA 4WB4A 4JF7A 1U7MA 1Q90D 3L75G 3H1IJ 5AW0B 4EOTA 2YO3A 1K8AQ 2J59M 3G9RA 2OYHB 2K9YA 1EQ7A 1W5CE 3CCRP 2K1AA 3JCUH 3P32A 2KNCB 4KHXA 1YBKA 4WVZA 3VMYA 2E75B 2ZT9B 3H32B 3VN0A 2V4HA 1ZN5A 3L73E 1SQBD 5KLVJ 2GUSA 2FYZA 1KQSO 3L36A 2D2CB 1PIXA 2BEZF 3CC7P 1VQKP 5AVYB 3H1HD 1K9MQ 5APXA 4RO0A 4OVNF 2RH0A 3CLQA 2O1KA 1AQ5A 2KLVA 1SP4A 1ZOYC 1PV3A 4WY4C 1VQNP 3G6EP 5APUA 1K04A 1NTKJ 1T2KD 1SQVD 4N78D 1BGYE 3V4QA 4WWIA 5KJ7A 4H0LB 2R3CA 1LTSC 4XA4A 1VQOP 2RMZA 2AEFA 2WQYC 3H1KG 1L0NE 2XZRA 1L0LJ 4R4LA 1CI6A 3PH0A 1YIJP 1N7SD 3RGUA 1M1JB 3VMZA 1EDKA 1LTBC 2PP6A 2XNDH 4U3FD 1NGMB 1VPCA 1SQVK 3G4SP 1IFPA 2K9JA 1ZMEC 2C9NY 2N1TA 1RE4A 1KYOI 3B5NB 3KZIE 2OGUA 1SQBE 1GL2A 2IYPA 2LKMA 2XNXA 3AE5C 2C9LY 1ZR4A 2HR3A 2BCCJ 1H0TB 5AW1B 2JWDA 2FXOA 1NKNA 3CXHD 3T97A 1S1CX 1OWAA 3L72E 2Q5UA 3CC2P 1JMMA 4XFJA 5L8RJ 2P58A 1KILA 4RJTA 1NTKG 3CX5D 3RK2D 2ZJSE 2HPCA 1NU1G 2YO2A 1IO4A 3WUVA 1URQC 2QEXP 3TNUA 2RKLA 1CZQA 3U1CA 2WSCH 1KB9I 1K73Q 3FWNA 3AE9C 2YXRB 2Z5HA 4N6JA 1SQXE 1PGJA 1NTMK 5CCHA 2IBZE 1NOHA 3U1AA 1OW8A 2OYHA 2E5TA 3A0BH 3AE8C 1IZNB 4Y99B 3RL0g 1R8EA 1LTIC 1Y47A 2KIKA 3L73G 5AW6B 1RE3C 2D2CD 3CWBJ 1EZVI 5AW3B 5AVTB 2K37A 2QM7A 2KNCA 1GU5A 2FBWC 1Z56A 2UWJE 3H32A 3VYIA 4UB8E 2KYVA 1KILE 4W80A 3CCQP 1UIXA 3GW6A 1BCCE 2WMMA 3AE4C 3Q5SA 1USDA 1H8AA 1PP9D 1YTZT 2A06E 4GT1A 3MUDC 2NPSC 3NFQA 1NYHA 1IFJA 4UB6E 3PRJA 1HH0A 5AVQB 1BGYG 2KB7P 3JSVC 1SQPE 2AXTH 1GTWA 4H13C 1XTCC 2WSFH 3H1LD 2OTLP 1L0NG 3BCCJ 3Q1MA 1VF5B 1VQLP 1VQPP 1RF0A 2E76B 1GK4A 4PD4I 2P7JA 1XTGB 1M1JA 2HLOA 2M0BA 3B5ND 3PTZA 1BE3J 4I6MC 3ZDMA 2E43A 3O8ZA 3CWBG 1GD2E 3CCLP 1NTMJ 4GODA 3H1JD 2FFDC 1RY3A 1M1KQ 1SQQE 3SSUA 3B5NA 4TT3H 2PRRA 2AEJA 3MHVA 3HE5B 1SVFA 1S9KE 3TGUE 1L4AC 2WITA 3V4WA 1J2JB 4I1LA 4UB8H 3CD6P 1OX3A 1RF1C 5B5EE 3OJAB 2YKOA 1H0TA 3CCVP 2HODB 2IFMA 5KAIE
chains in the Genus database with same CATH topology
1NU1G 1PPJG 3L74G 3BCCG 1BCCG 1BGYG 1BE3G 1KYOH 3CWBG 1SQBG 4D6TG 1SQQG 3L70G 1NTZG 3CX5H 3H1IG 3L72G 1L0LG 2A06G 1P84H 2BCCG 4PD4H 1SQXG 3H1JG 1EZVG 1SQVG 3L71G 1KB9H 4U3FG 3TGUG 1L0NG 5KLVG 3H1LG 1NTMG 3H1HG 3L73G 3H1KG 1NTKG 3L75G 1PP9G 2FYUG 3CXHH 2IBZG 1SQPG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NU1 G;  1PPJ G;  3L74 G;  3BCC G;  1BCC G;  1BGY G;  1BE3 G;  1KYO H;  3CWB G;  1SQB G;  4D6T G;  1SQQ G;  3L70 G;  1NTZ G;  3CX5 H;  3H1I G;  3L72 G;  1L0L G;  2A06 G;  1P84 H;  2BCC G;  4PD4 H;  1SQX G;  3H1J G;  1EZV G;  1SQV G;  3L71 G;  1KB9 H;  4U3F G;  3TGU G;  1L0N G;  5KLV G;  3H1L G;  1NTM G;  3H1H G;  3L73 G;  3H1K G;  1NTK G;  3L75 G;  1PP9 G;  2FYU G;  3CXH H;  2IBZ G;  1SQP G; 
#chains in the Genus database with same CATH topology
 2A45 H;  3BCC G;  2HG5 D;  1PL5 A;  3RK3 D;  5AVX B;  1SQX G;  4HB1 A;  1P84 D;  4RKU J;  4I2L C;  3GHG C;  1FDO A;  2IDB A;  2IZ0 A;  3SWY A;  2N9B A;  5AW5 B;  4KT0 J;  3IR9 A;  3H1J E;  1FAV A;  2FYU G;  3AEE C;  2Z5I A;  4GIF A;  3H1I D;  3N7N A;  3RL0 D;  4IOI H;  3UIA A;  4Y28 J;  5CJ0 A;  2A06 G;  3V2N A;  2JO1 A;  1RQU A;  2BEQ D;  3P8M C;  3BRV B;  1N86 A;  2IYO A;  1T8Z A;  1KD1 Q;  1NAF A;  3L70 J;  2A45 G;  4Z1M H;  2VRS A;  2XU6 A;  2YKP A;  1HJB A;  1ZP0 C;  3E7K A;  1KOR A;  4M3L A;  5B5E H;  5KLV D;  2W6B A;  2WSE J;  1MKM A;  1NTZ J;  2JJL A;  3L71 E;  3AEC C;  3RK3 E;  2V7Q H;  2QJP B;  3I55 P;  1YHQ P;  3AEF C;  1S5L X;  3HRN A;  3ITK A;  3TK1 A;  2RN0 A;  1HF9 A;  4H44 D;  4L75 A;  2WSE H;  3L75 J;  4ZKU A;  3M0D C;  1K05 A;  1FOS E;  2KK7 A;  5AVZ B;  1NTK D;  5AVV B;  5AVU B;  4D6T J;  4ZMD A;  4LLH A;  1QEX A;  3QWO C;  5KAF E;  1N7S B;  2SPZ A;  2XKM A;  5CCG D;  3Q3D A;  1N73 C;  1L0L D;  3M0A A;  1LJ2 A;  1YJ9 P;  3FXE A;  1URQ B;  1LP1 B;  1AQT A;  1KB9 H;  3TGU G;  5H2F E;  3VTP C;  1JY3 N;  1Q82 Q;  3VP8 A;  3CMA P;  3MD0 A;  1NTK K;  4L74 A;  1JY2 N;  1PPJ G;  3HE5 A;  3CME P;  1NU1 K;  3II6 A;  1Q81 Q;  1QGK B;  4PV1 C;  5TIS E;  3IF4 A;  2HOD A;  1HVV A;  2WZ7 A;  2KZJ A;  4QMA A;  5KLV E;  3M06 A;  1FZE A;  2JWA A;  4DCK A;  2IBZ I;  2JEE A;  3NXS A;  1NTZ G;  5APS A;  5CCG C;  2BCC D;  1JEK A;  3H1K J;  1MFT A;  3RK2 B;  1EXJ A;  1VQ4 P;  2QSI A;  2FKW B;  1QX8 A;  1OW6 A;  3Q5R A;  3HTK B;  4WY4 D;  3A0H H;  2QVA A;  3V5B A;  2Q9I A;  2YIU C;  1EC5 A;  5APT A;  2KSE A;  5AVW B;  4D6T G;  2J5U A;  3MGN A;  5CBN A;  2QJY C;  2WSS H;  3AEA C;  2ZXX A;  4ASW A;  4CPG A;  2CK3 H;  1X0T A;  3HUS C;  4H13 B;  1DEB A;  3A3Y B;  3GF3 A;  1JNM A;  2A45 I;  4JPZ B;  4GOF A;  4LGD E;  5CHX A;  3KPE A;  2LXC B;  4PD4 H;  2K88 A;  1EZV G;  1J1D B;  3P8C D;  1H88 A;  1L0N K;  1JY3 P;  4IL6 H;  3CWB D;  4AYC A;  3FX0 A;  4W7Z A;  3TF5 A;  5AVS B;  3CL3 D;  1NU1 J;  3KYQ A;  1FS0 E;  2FFD B;  5B66 H;  1KFM A;  3L74 D;  2AXC A;  3WU2 H;  2MJZ A;  4NPD A;  3KDP B;  3MTU E;  3AEB C;  5GTI E;  1U57 A;  4A7P A;  2Z4E A;  2OYI B;  3OW2 O;  1FDI A;  1USE A;  4EYY Q;  1IC2 A;  1SFC C;  2E5Y A;  1LNQ A;  3BCC D;  1URQ D;  3L35 A;  1PGP A;  1KTM A;  4LC1 A;  1N7S A;  2H89 C;  1LTJ C;  3L73 J;  4IFF A;  3S4R A;  1LT9 B;  1NJI Q;  2POH A;  3PJS K;  1WRG A;  4PJ0 E;  4YTP C;  1JB0 J;  2W83 C;  4O9B A;  1URQ A;  2E74 C;  1LP1 A;  5KJ7 C;  4WBA A;  3H1H E;  3C8V A;  1BE3 D;  3P8C E;  1S2E A;  1W2B O;  1N8R Q;  3AE2 C;  3GG2 A;  1LWU B;  3EFG A;  1YTZ I;  2KS1 B;  1FZC C;  1NTM D;  3G71 P;  3OA7 A;  4B86 A;  2G3A A;  5AW2 B;  1M57 D;  1SQX K;  4BRY B;  1BGY J;  3TYY A;  1SQV E;  2WSC J;  4ASV A;  1ZR2 A;  4N78 E;  1TU3 F;  3GMA A;  2I1K A;  3W68 A;  4HH2 A;  1L0N J;  3L74 E;  3B4S A;  2M5A B;  4C7N B;  1NH4 A;  1FOS F;  1VL2 A;  2N1T C;  1KQG B;  1Q86 Q;  3LIE A;  2NPS D;  1GL2 C;  1OVR A;  4U3F E;  2Q7C A;  1AFO A;  4C46 A;  3HTK A;  4IL6 X;  3RK3 B;  2FYU K;  1IJD B;  2HYN A;  4H13 D;  3PHL A;  1KV4 A;  2KXP B;  5APV A;  3MUD A;  2FY8 A;  2NZ2 A;  3BVH A;  1SQB J;  1YJN P;  2B9B A;  2L5G B;  2JKV A;  1KIL C;  4OGQ C;  5BU5 A;  5DJT B;  2WPQ A;  1SQP K;  1JCD A;  3KZI H;  4KJM A;  1AVY A;  3U59 A;  1G2C B;  1DIP A;  3BAS A;  2KP8 A;  1GW4 A;  2OYO A;  3RL0 B;  3L72 J;  2WSF J;  3AE3 C;  3CXH E;  1YQ3 C;  2ZVO B;  1KZU B;  3M9Q A;  2FYN C;  1IFI A;  3L4F A;  3CX5 E;  2C0X A;  4YXD C;  5CCH C;  1OXZ A;  4HYT B;  1DD3 A;  2OYH C;  3W67 A;  1HGV A;  3CCS P;  1L4A D;  2WTY A;  1KYO D;  2W90 A;  2ZYG A;  1PPJ D;  2NRG A;  1QL1 A;  3WUT A;  1S4X A;  2FFD A;  1MFZ A;  1SQX J;  3L70 D;  5AVR B;  2E75 C;  2ZT9 C;  1YYC A;  2QIW A;  1SQQ K;  2Y0E A;  2Y0D A;  1X8Y A;  2ITA A;  1SS1 A;  2OYI A;  1G1J A;  3BAT A;  4H44 B;  1NTZ D;  1GDT A;  5KKZ B;  1SQB G;  3SWF A;  1CSB A;  2QM8 A;  2FYU J;  2QJK C;  3GF7 A;  1J1E B;  2H8P D;  1Q7Y Q;  3IN6 A;  3ABV C;  1LT9 A;  3L75 D;  1BCC J;  4ZKP A;  4OH8 B;  1JY3 O;  3CCJ P;  1GU4 A;  1JUN A;  1EXI A;  4D6T D;  1PP9 E;  1KB9 D;  1JY2 O;  4H0L C;  3L72 G;  1JM0 A;  1KQL A;  1MUU A;  1NTZ K;  1SQP J;  1LWU A;  1RF0 C;  1OIP A;  2I8D A;  2KS1 A;  2QJY B;  3SWK A;  3H1L E;  4UB6 H;  2OAR A;  4BRY A;  1L2P A;  1JTH B;  1HGZ A;  3HUS B;  1UII A;  4K3A A;  1QVF O;  1EZV D;  3RBX A;  3KQG A;  4U3F G;  2M5A A;  4C7N A;  2H7H A;  3F89 A;  2IBZ G;  2O01 H;  5APW A;  2QRX A;  1WT6 A;  3V2R A;  1IK9 A;  3IAO A;  3S1K A;  2R5B A;  4WY4 B;  3AE6 C;  3H1K D;  1SQQ J;  4N3Y B;  5APQ A;  3MP7 B;  2B87 B;  1BCC G;  3TGU J;  1EDJ A;  4JBZ A;  3S9O A;  1GMJ A;  1T6A A;  2YXQ B;  1G2C A;  3VOP A;  5GTH E;  2KSJ A;  3A7O A;  1SQP G;  4PD4 D;  1KMI Z;  1MZ9 A;  1KQF B;  2MKV A;  2V7Q J;  2O3J A;  2JR8 A;  3NTN A;  3QH9 A;  2I1J A;  2R32 A;  3E1R A;  3CCU P;  2FXM A;  2LR2 A;  3E1I A;  5KAI H;  1E79 H;  4TLF A;  1P84 E;  4Y99 C;  1RQV A;  1EDI A;  1OVU A;  3LW5 J;  2HFE D;  4PV1 D;  1QLE D;  3PLN A;  2Q3I A;  5CMZ A;  1FZC B;  1NU1 D;  4L76 A;  2M3B A;  5APY A;  1PGQ A;  3H1K E;  2W27 A;  3LW5 H;  1SQQ G;  3OAK A;  3JCU E;  1QVG O;  3H1I E;  5KLI C;  5CCG A;  2ZYA A;  1HBW A;  1JO5 A;  3NMD A;  2QE7 H;  1JMB A;  4W7Y A;  3L73 D;  1VF5 C;  3H1L G;  3TDK A;  1X9V A;  3EFF K;  3F5H A;  2IZ1 A;  1NKZ B;  2E76 C;  3R4Y A;  3V2Q A;  3CCE P;  1T3U A;  3L71 J;  1IK7 A;  1JTH A;  3EQ2 A;  3HD7 C;  3HUS A;  1BSH A;  2OQQ A;  2OTJ P;  3D6Y A;  4GKG A;  3FXD A;  1VQM P;  3G3Z A;  1BGY D;  3M9B A;  1NTK E;  5K5G B;  2NPS B;  1IFM A;  3RBZ A;  2E42 A;  3BRT B;  4YPC A;  1L0N D;  4NPE A;  3H1J G;  1GW3 A;  2FYN B;  3EWK A;  1L0L E;  2Y9Y A;  3CC4 P;  4WY4 A;  2YNY A;  2W6J H;  5KAF H;  3CXH I;  4OWF A;  1YI2 P;  1S3J A;  2GUV A;  3I5C A;  1FDM A;  2AEM A;  2Q3E A;  3CX5 I;  1QL2 A;  4U7J A;  2B87 A;  1M7L A;  5H2F H;  1YQ4 C;  1SFC D;  1ZW0 A;  1OVV A;  1VQ7 P;  3JC2 2;  1DEE G;  1JCC A;  1NAY A;  1FZA A;  4JQ0 D;  2BAS A;  1JY2 P;  3SFD C;  3AED C;  1RH5 B;  1SFC A;  3L71 G;  2E74 D;  5KJ7 D;  5TIS H;  1AJY A;  1NVO A;  2L91 A;  2BCC E;  2QJK B;  1R5L A;  1LTJ A;  1BDD A;  1SLQ A;  3L72 D;  5C39 A;  2PFX A;  2KOG A;  1VQ8 P;  2ZXE B;  1L4A B;  4I7Z C;  1SQB K;  4BXL A;  1CW5 A;  1AA0 A;  1S72 P;  1RHZ B;  1DH3 A;  3D6Z A;  1RF1 B;  3A2A A;  4GOE A;  5CJ4 A;  1D7M A;  1GZL A;  2N9Y B;  2KZI A;  3R2P A;  1FZC A;  2N1T D;  2YMY A;  3H1I G;  1BDC A;  1SQX D;  3A0B E;  2C0W A;  4RES B;  3L37 A;  1NHL A;  3IFM A;  3C9I A;  3H6P A;  1GL2 D;  3B8E B;  5AW9 B;  1IFD A;  2YMK A;  2IBZ D;  3KHU A;  1A02 F;  1M90 Q;  1ZRT D;  3I56 P;  3LID A;  3CCM P;  5AW7 B;  3USS A;  3GHG B;  3M91 A;  4ZNC A;  3CWB E;  3VMX A;  2QJP C;  1T2K C;  1FU1 A;  5KLV G;  4JYB A;  1AVO A;  2FYU D;  1KIL D;  2XDJ A;  4OGQ D;  1BCC D;  1LTA C;  2AXT E;  2A06 D;  1GK6 A;  2ZYD A;  1RE3 A;  1N7S C;  1RE4 C;  3HE4 B;  1SQP D;  4HKZ H;  2W6A A;  1KN7 A;  5CCH D;  2JP3 A;  2H43 A;  1IFN A;  2R44 A;  3BCC E;  1L0L G;  3GLM A;  1Y8A A;  5GTI H;  2NPS A;  1HJ0 A;  4AQR D;  1AV1 A;  5AW8 B;  3AE1 C;  1LGH B;  1PGO A;  2E75 D;  2ZT9 D;  5CBO A;  1ZRT E;  3H1H J;  1BE3 E;  3VP9 A;  4PJ0 H;  2YKQ A;  2CPS A;  3D70 A;  2Y9Z A;  4DT0 A;  1FC2 C;  1X22 A;  1S5L E;  1P84 I;  1NTM E;  1SQQ D;  3RK2 C;  1SQV J;  2FYU E;  1DD4 A;  3P7K A;  2G8Y A;  2R5D A;  5EFW B;  1S9K D;  2XV5 A;  1N2D C;  2H88 C;  3TGU D;  2BCC G;  1N73 B;  3L74 J;  3AE7 C;  1FZB A;  4H0L D;  2WT7 B;  5KLI B;  4U3F J;  2WPR A;  2M3E A;  2O01 N;  1YJW P;  1L4A A;  1VQ5 P;  4R4M A;  2WPS A;  2D2C C;  3O6Q B;  1RF1 A;  3WUU A;  4PV1 B;  3A5T A;  1J1D C;  3CPW O;  4EI2 A;  3KXD A;  3B71 A;  3H1H G;  3HD7 B;  1OW7 A;  1FE6 A;  2KI7 B;  2Q6Q A;  5E79 E;  4DOJ A;  1MV8 A;  3D71 A;  1N7L A;  1NO4 A;  2DW3 A;  1DX7 A;  3N4X A;  2YIU B;  1SQV G;  3GHG A;  2IX7 C;  1VQ9 P;  3CXH H;  1S5L H;  1M1J C;  2PGD A;  3L74 G;  1FBM A;  2GM4 A;  2OYI C;  2WVR A;  1KYO E;  3CX5 H;  1PPJ E;  3WMM 0;  2LXB A;  2J58 A;  2O01 J;  3L70 E;  2CPB A;  3MIW A;  1JOC A;  1PFI A;  4HJG H;  1HWT C;  1H89 A;  3HE4 A;  3Q5P A;  3B5N C;  1LT9 C;  1YIT P;  4IFM A;  1VDF A;  2WPV B;  3L71 D;  3SFE C;  3M9H A;  1NTZ E;  1OMI A;  4XE5 B;  3V6I A;  1W2E A;  2JDI H;  2B89 A;  1LWU C;  1HUC A;  3L75 E;  1BE3 G;  1M56 D;  3FWL A;  1NWQ A;  4L73 A;  1PP9 J;  4D6T E;  2ZFC A;  1KB9 E;  3C1L A;  2P67 A;  1NTM G;  4I7Z B;  2K3R A;  3VMA A;  2B88 A;  4K35 A;  3V2P A;  2PAJ A;  2IPP A;  1G1I A;  2ZAE B;  1FJP A;  5E79 H;  2QG4 A;  3M0D A;  4AUW A;  2P10 A;  3H1L J;  1BSN A;  1SFC B;  1Y9B A;  2ZVN B;  4JYC A;  5BVZ A;  3RK3 C;  4DZO A;  1LTJ B;  1KFN A;  1EZV E;  1N73 A;  2WWW A;  2KLU A;  3K5B A;  1ZLL A;  4BWN A;  3Q2Y A;  1KYO H;  1U7J A;  2E74 B;  2P1J A;  2WT7 A;  1KC8 Q;  1T3J A;  1VF5 D;  1X79 B;  5AW4 B;  2QA4 P;  1OZH A;  1LTT C;  1FZG A;  1CI6 B;  1FJK A;  2E76 D;  4IFD K;  2Q1K A;  1E5W A;  3A0H E;  5M1B A;  1WMK A;  1M8O B;  3H1J J;  1Q2N A;  3HD7 D;  3O6Q A;  1ZXG A;  3RL0 C;  3MZW B;  1R5S A;  1OFC X;  2K9J B;  2R3S A;  5DJU B;  3H25 A;  1VQ6 P;  5BU8 B;  1PP9 G;  2P2U A;  2N1T B;  4GDO A;  5KLV K;  3HD7 A;  1A02 J;  1GL2 B;  4YXW H;  2FXP A;  1PZQ A;  2GA1 A;  3AEG C;  4PD4 E;  1LTG C;  3CI9 A;  2M8R A;  1HTL C;  1ZV8 A;  5GTH H;  5TJH A;  4EDF A;  3PP5 A;  4IL6 E;  4DJG A;  3FGA D;  4NPF X;  2OTK E;  4MN4 C;  3T97 B;  3L70 G;  2O1J A;  2IFN A;  5KTB A;  1KIL B;  2KUB A;  1EDL A;  4H44 C;  4OGQ B;  2Y0C A;  2HPC B;  1L0L K;  1LT1 A;  5KKZ C;  5B66 E;  3TSI A;  4EIJ A;  4C7R A;  3TNU B;  3WU2 E;  1P84 H;  1J1E C;  2W8Z A;  1NU1 E;  1FZF A;  4WB4 A;  4JF7 A;  1U7M A;  1Q90 D;  3L75 G;  3H1I J;  5AW0 B;  4EOT A;  2YO3 A;  1K8A Q;  2J59 M;  3G9R A;  2OYH B;  2K9Y A;  1EQ7 A;  1W5C E;  3CCR P;  2K1A A;  3JCU H;  3P32 A;  2KNC B;  4KHX A;  1YBK A;  4WVZ A;  3VMY A;  2E75 B;  2ZT9 B;  3H32 B;  3VN0 A;  2V4H A;  1ZN5 A;  3L73 E;  1SQB D;  5KLV J;  2GUS A;  2FYZ A;  1KQS O;  3L36 A;  2D2C B;  1PIX A;  2BEZ F;  3CC7 P;  1VQK P;  5AVY B;  3H1H D;  1K9M Q;  5APX A;  4RO0 A;  4OVN F;  2RH0 A;  3CLQ A;  2O1K A;  1AQ5 A;  2KLV A;  1SP4 A;  1ZOY C;  1PV3 A;  4WY4 C;  1VQN P;  3G6E P;  5APU A;  1K04 A;  1NTK J;  1T2K D;  1SQV D;  4N78 D;  1BGY E;  3V4Q A;  4WWI A;  5KJ7 A;  4H0L B;  2R3C A;  1LTS C;  4XA4 A;  1VQO P;  2RMZ A;  2AEF A;  2WQY C;  3H1K G;  1L0N E;  2XZR A;  1L0L J;  4R4L A;  1CI6 A;  3PH0 A;  1YIJ P;  1N7S D;  3RGU A;  1M1J B;  3VMZ A;  1EDK A;  1LTB C;  2PP6 A;  2XND H;  4U3F D;  1NGM B;  1VPC A;  1SQV K;  3G4S P;  1IFP A;  2K9J A;  1ZME C;  2C9N Y;  2N1T A;  1RE4 A;  1KYO I;  3B5N B;  3KZI E;  2OGU A;  1SQB E;  1GL2 A;  2IYP A;  2LKM A;  2XNX A;  3AE5 C;  2C9L Y;  1ZR4 A;  2HR3 A;  2BCC J;  1H0T B;  5AW1 B;  2JWD A;  2FXO A;  1NKN A;  3CXH D;  3T97 A;  1S1C X;  1OWA A;  3L72 E;  2Q5U A;  3CC2 P;  1JMM A;  4XFJ A;  5L8R J;  2P58 A;  1KIL A;  4RJT A;  1NTK G;  3CX5 D;  3RK2 D;  2ZJS E;  2HPC A;  1NU1 G;  2YO2 A;  1IO4 A;  3WUV A;  1URQ C;  2QEX P;  3TNU A;  2RKL A;  1CZQ A;  3U1C A;  2WSC H;  1KB9 I;  1K73 Q;  3FWN A;  3AE9 C;  2YXR B;  2Z5H A;  4N6J A;  1SQX E;  1PGJ A;  1NTM K;  5CCH A;  2IBZ E;  1NOH A;  3U1A A;  1OW8 A;  2OYH A;  2E5T A;  3A0B H;  3AE8 C;  1IZN B;  4Y99 B;  3RL0 g;  1R8E A;  1LTI C;  1Y47 A;  2KIK A;  3L73 G;  5AW6 B;  1RE3 C;  2D2C D;  3CWB J;  1EZV I;  5AW3 B;  5AVT B;  2K37 A;  2QM7 A;  2KNC A;  1GU5 A;  2FBW C;  1Z56 A;  2UWJ E;  3H32 A;  3VYI A;  4UB8 E;  2KYV A;  1KIL E;  4W80 A;  3CCQ P;  1UIX A;  3GW6 A;  1BCC E;  2WMM A;  3AE4 C;  3Q5S A;  1USD A;  1H8A A;  1PP9 D;  1YTZ T;  2A06 E;  4GT1 A;  3MUD C;  2NPS C;  3NFQ A;  1NYH A;  1IFJ A;  4UB6 E;  3PRJ A;  1HH0 A;  5AVQ B;  1BGY G;  2KB7 P;  3JSV C;  1SQP E;  2AXT H;  1GTW A;  4H13 C;  1XTC C;  2WSF H;  3H1L D;  2OTL P;  1L0N G;  3BCC J;  3Q1M A;  1VF5 B;  1VQL P;  1VQP P;  1RF0 A;  2E76 B;  1GK4 A;  4PD4 I;  2P7J A;  1XTG B;  1M1J A;  2HLO A;  2M0B A;  3B5N D;  3PTZ A;  1BE3 J;  4I6M C;  3ZDM A;  2E43 A;  3O8Z A;  3CWB G;  1GD2 E;  3CCL P;  1NTM J;  4GOD A;  3H1J D;  2FFD C;  1RY3 A;  1M1K Q;  1SQQ E;  3SSU A;  3B5N A;  4TT3 H;  2PRR A;  2AEJ A;  3MHV A;  3HE5 B;  1SVF A;  1S9K E;  3TGU E;  1L4A C;  2WIT A;  3V4W A;  1J2J B;  4I1L A;  4UB8 H;  3CD6 P;  1OX3 A;  1RF1 C;  5B5E E;  3OJA B;  2YKO A;  1H0T A;  3CCV P;  2HOD B;  2IFM A;  5KAI E; 
#chains in the Genus database with same CATH homology
 1NU1 G;  1PPJ G;  3L74 G;  3BCC G;  1BCC G;  1BGY G;  1BE3 G;  1KYO H;  3CWB G;  1SQB G;  4D6T G;  1SQQ G;  3L70 G;  1NTZ G;  3CX5 H;  3H1I G;  3L72 G;  1L0L G;  2A06 G;  1P84 H;  2BCC G;  4PD4 H;  1SQX G;  3H1J G;  1EZV G;  1SQV G;  3L71 G;  1KB9 H;  4U3F G;  3TGU G;  1L0N G;  5KLV G;  3H1L G;  1NTM G;  3H1H G;  3L73 G;  3H1K G;  1NTK G;  3L75 G;  1PP9 G;  2FYU G;  3CXH H;  2IBZ G;  1SQP G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...