3L73G

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l73G00
1SQVG 3L70G 1NTMG 1BCCG 2IBZG 3L72G 1PPJG 1SQQG 3BCCG 4U3FG 5KLVG 2BCCG 1NTZG 4D6TG 3L73G 3L75G 1SQXG 1SQBG 1KYOH 1PP9G 3L74G 3H1HG 1BE3G 2A06G 4PD4H 3CWBG 1L0LG 3L71G 3H1KG 3CXHH 1KB9H 1BGYG 1L0NG 3H1JG 1SQPG 2FYUG 1EZVG 1NTKG 3H1IG 3H1LG 3TGUG 3CX5H 1P84H 1NU1G
chains in the Genus database with same CATH superfamily
1BGYE 1SQPK 3M0DC 3RK3E 1KYOD 1CI6A 1JTHA 3A0HE 3PJSK 1FZCB 4H44D 1DD4A 4U3FD 1H89A 1ZLLA 3H1KE 4HB1A 1Y47A 3AE6C 2I1KA 1JMMA 4WB4A 5APWA 2IFMA 3H1IE 1BE3D 3V4QA 1JY2N 3VMXA 2M5AB 2FYUD 1Z56A 3D6YA 1KFNA 2QEXP 5CHXA 3WU2E 2OTKE 1YIJP 1L2PA 2FYNB 1MZ9A 3HD7D 1JM0A 4EI2A 1RQVA 3OAKA 3T97A 1BGYD 1PPJE 2E75B 4EOTA 1YITP 1HBWA 4GOFA 3E1IA 3RK3D 1XTCC 4RESB 3L71J 1OVRA 4I2LC 1QGKB 3A7OA 4O9BA 3AEBC 2RH0A 4RKUJ 2CPSA 1J1EB 3H1KD 2H7HA 1LT1A 1NTZE 2A45I 3H1ID 2FFDC 3BATA 4I7ZC 4W7YA 2XZRA 2N1TD 2WT7B 1KB9I 4IL6X 3HRNA 1AA0A 5TJHA 4GOEA 3SFEC 2IZ0A 1KORA 2H8PD 1RF0C 2WWWA 1PPJD 5AW0B 3CX5D 2FXOA 3GF3A 3SWFA 1LT9C 1VQ6P 1S9KE 5GTHE 5AVSB 2QRXA 1KC8Q 5APVA 1HVVA 3FXDA 2DW3A 3U59A 2E42A 1EXIA 3BASA 2J59M 2KP8A 2IX7C 1VQOP 1NTZD 4WY4C 1YJNP 2OYHB 2V4HA 3FX0A 1LNQA 1NTMK 1PP9G 3V2PA 1J1DB 2P2UA 2A06G 1H0TA 1BDDA 4A7PA 1SFCB 3H1LG 3EWKA 2ZT9D 1IZNB 1JOCA 4XE5B 3NFQA 1ZMEC 1SQVJ 3ITKA 3RL0B 3L75G 3U1CA 3EQ2A 1NTME 2OTLP 2Z5IA 1M56D 4AYCA 1S9KD 2M5AA 1YI2P 1ZXGA 1IFIA 2ZAEB 3USSA 1L0LD 1T6AA 1FDOA 4H44C 4N6JA 1D7MA 3SWKA 3VN0A 3VMAA 5APQA 3LIEA 1EZVG 1NTKG 2ZYGA 1L0NE 1N7SD 1HF9A 4Y99C 1NAYA 2JWDA 2E74D 2YNYA 3E7KA 3V6IA 1EDKA 5B5EE 2BEQD 1K73Q 1WT6A 5CCHD 5DJUB 3JC22 2KYVA 1NTMD 4PJ0E 1AVYA 1H88A 2OQQA 3HD7C 3L70G 1L4AD 2WSCJ 2KI7B 2W8ZA 3GG2A 4HJGH 2WT7A 4OWFA 1HGZA 2XNXA 1Q7YQ 3HD7A 3TSIA 3I56P 2WPRA 3HE4B 3R2PA 3TGUG 1URQB 3AEFC 1YJ9P 2WPVB 3TNUB 3L72G 1FJKA 3JCUH 4L73A 1VQ8P 4IL6H 1S5LE 5H2FH 1L0ND 4OGQD 4XFJA 2IZ1A 4OVNF 3L36A 3PLNA 3VTPC 2N1TC 1NU1G 3KZIH 4H13D 1VDFA 4PD4E 2OYHA 2W6JH 2WSEJ 1PFIA 2N1TA 2XKMA 2IBZE 5CCGD 3D71A 1PP9J 4I6MC 5CJ4A 1KB9H 3H1HJ 3P8CE 2QJPC 2Q1KA 3R4YA 2PAJA 3M06A 1SFCA 2GM4A 1KZUB 3CLQA 3LIDA 4U3FG 1HUCA 3H32A 4JF7A 1DIPA 3L75J 1BE3G 5KLIC 3SFDC 1QL2A 2FYUG 1BDCA 3CC7P 2ZXXA 5AW4B 1NTKK 4ZNCA 2NRGA 1BCCE 2NZ2A 3RGUA 3B8EB 3NTNA 1BGYG 2ZT9C 1PL5A 2IBZD 1N2DC 3RK2D 3P7KA 4YPCA 4IFFA 1NTKJ 4AUWA 2E5YA 3P8CD 1JTHB 2WMMA 1SQQK 2KUBA 3V4WA 2KXPB 2AEFA 2JDIH 3H1KG 1M1JC 1W2EA 1S1CX 2JEEA 3H1IG 5AVUB 2C9LY 4R4MA 3H1JE 2IYPA 4H0LD 3L70J 1M1JA 1FZGA 4GDOA 3AEGC 1SQQE 2QJYC 1FZEA 2H43A 1BCCD 1GL2D 3HE4A 2R5DA 3TGUJ 1PPJG 2E74C 1NU1K 2QJKC 4JYBA 1N7SA 3CC4P 1FZAA 5CCHC 1SP4A 4L75A 1VQ5P 1K04A 1OVVA 2Y0DA 1CW5A 5CCHA 1VQ4P 3IAOA 4ZKUA 2D2CD 3M9BA 1NU1J 1NTZG 1L4AA 2W83C 3H1JD 1K8AQ 1GTWA 2HLOA 1KQGB 4JYCA 5APXA 1SQQD 2P1JA 3AEEC 3HTKA 2FFDB 3LW5J 4I7ZB 2FYUK 4U3FJ 2PP6A 3MUDC 3BCCJ 3L73J 2N9YB 2WSCH 2Z5HA 2Q3EA 3MIWA 1BE3J 4H13C 1DEBA 5K5GB 1JY2O 1QX8A 1VL2A 2FYUE 1VF5B 3Q5SA 2Q7CA 1NO4A 5CCGC 1EDLA 2IDBA 1G1JA 1DD3A 1LT9B 4I1LA 1SQBE 3S4RA 5E79H 1EQ7A 3C1LA 1G2CB 1NGMB 2KZIA 2ZXEB 2JR8A 1X79B 1ZN5A 2IYOA 1P84I 4WY4B 1PV3A 1IJDB 3FXEA 4DCKA 1H0TB 2GUVA 5CBOA 3CMEP 2OGUA 2Y9YA 3M0DA 2WSEH 1LWUC 2YKQA 3H1KJ 1SQPJ 1NTMG 2JP3A 1LWUA 4JQ0D 1S4XA 1VPCA 4BRYB 3RK2C 2AXCA 2P67A 1NOHA 1SQBD 2LXBA 2I1JA 4KHXA 4BWNA 1Q82Q 3AE9C 2SPZA 3AE3C 5B66H 3CD6P 3CX5E 1NTZK 1FOSE 3EFFK 5L8RJ 1L0NG 1GU4A 3JCUE 3HUSC 4IL6E 4IFDK 5H2FE 4H44B 3PHLA 4H0LC 1KTMA 2E5TA 1A02J 1CSBA 3V2NA 2O1JA 2ZJSE 1NTZJ 1IC2A 3KZIE 3GF7A 2ZVNB 2YXRB 1GL2C 3C8VA 2R44A 2O01N 1M7LA 2R3CA 1S3JA 3VP9A 2FFDA 3JSVC 3HD7B 1PIXA 1YQ4C 3PTZA 3QH9A 1MKMA 2D2CC 3WUVA 2KLUA 1L0LK 3RK3B 3IR9A 5TISH 3F5HA 1RF0A 3RL0g 3KHUA 1WRGA 2HYNA 1GW3A 3P32A 3GW6A 1N73C 2W6BA 1LT9A 1W2BO 3CPWO 2J5UA 1LP1A 2FYZA 1USDA 1VQLP 1JY3P 1FE6A 3CWBE 1L0LE 2IBZG 2K3RA 1G2CA 5KJ7D 4EDFA 2N1TB 3N7NA 2P7JA 3RBZA 1JO5A 2WSFJ 2YO3A 2JO1A 4WY4A 4WBAA 5CJ0A 1ZR4A 1KD1Q 1LTBC 1KB9D 2YO2A 5AW8B 1JB0J 2KSEA 1FZFA 3IFMA 3MP7B 2Y0EA 3H32B 1NTMJ 4ASVA 1VQ9P 1ZOYC 2V7QJ 1PGOA 3M91A 4ZMDA 3MZWB 1UIXA 1S72P 4BRYA 2KLVA 1BCCG 1L0NK 1SQVE 3CWBD 3B5ND 4U7JA 1E5WA 2B88A 2WSSH 2P10A 4JBZA 3CCRP 3II6A 2XDJA 4CPGA 2KOGA 3CCJP 1T8ZA 1FDIA 1QVGO 3ZDMA 1P84H 1VQMP 2HODB 2E75C 3H6PA 1LTSC 2POHA 1JY3N 2ZT9B 3OW2O 5AVTB 5AW9B 2YIUC 1RE4C 1J1EC 3H1JG 3L74E 3RBXA 3L37A 1FAVA 2KZJA 2KB7P 4K3AA 1N7LA 1SQQG 3HE5A 2KK7A 3B4SA 2FBWC 1M1JB 2H89C 1KILD 1QL1A 1HGVA 1MUUA 1SQVD 3CCLP 2QJYB 4MN4C 2R32A 1Y8AA 4GODA 3NXSA 1SS1A 1S2EA 2O01J 1N7SB 3UIAA 2W6AA 4D6TE 2E74B 3Q2YA 3I55P 1ZW0A 3BRTB 3CCUP 1KFMA 2QJKB 1Q2NA 2M3BA 3Q5RA 1QEXA 4PV1B 2J58A 1OZHA 5AW5B 2FY8A 3L74D 2A45H 5AW6B 4YTPC 1JUNA 5E79E 1L4AB 1OW8A 4AQRD 1LTJC 4N3YB 2WVRA 1OVUA 2ZYDA 1E79H 1KMIZ 2QSIA 2I8DA 3HTKB 4PD4I 5AVQB 2LXCB 1LTJA 1OW6A 3H1LJ 2KIKA 2IBZI 2FXMA 1IFMA 4ZKPA 5AVVB 4N78E 4WVZA 2QE7H 3C9IA 2JWAA 2KS1A 1SQXE 3AEDC 1RHZB 4OGQB 2K9JB 3H1HE 1NWQA 4D6TD 2IPPA 4OH8B 1AQTA 1OX3A 5KJ7C 2LR2A 2RMZA 4H13B 1BCCJ 3VMZA 1SQBG 1KQLA 2B89A 1RF1C 2NPSD 3TF5A 1J2JB 2MKVA 1GU5A 3W67A 1RF1A 4C46A 5B66E 1LGHB 1SLQA 2HODA 1H8AA 1JMBA 2R5BA 3GHGC 2XV5A 1NVOA 2YXQB 5CBNA 1U7MA 1NH4A 3CCQP 1G1IA 4EIJA 4N78D 2YKOA 3H1JJ 1SQXD 1EZVI 2WTYA 3H1HD 3B5NC 1LWUB 3CI9A 3A5TA 1ZRTE 1SQQJ 5EFWB 1EC5A 4RO0A 2AEJA 3B5NA 4W80A 1NJIQ 2K9YA 2IFNA 3D70A 1VQPP 2V7QH 1X8YA 1GMJA 3RK2B 3EFGA 3L72J 3VYIA 1AJYA 1MFZA 5TISE 4DZOA 5KKZC 5AW7B 1DX7A 4GT1A 2C0XA 2OARA 1YTZI 2VRSA 3CXHI 1HH0A 1KILC 5CMZA 2OYIC 1N86A 2HFED 4H0LB 5AW1B 3G9RA 1ZRTD 3TYYA 3AE4C 3B71A 1Y9BA 5GTIH 1GL2B 2E76D 5APYA 1YBKA 3IN6A 1TU3F 2CPBA 1GW4A 5KLVE 1UIIA 2UWJE 1SQBK 4LC1A 2C9NY 2BEZF 1M57D 2B87A 1KQSO 1KYOI 2K9JA 3MUDA 2FYUJ 1QVFO 2D2CB 3MTUE 1IFDA 5APUA 1SQBJ 4ASWA 1R5LA 3L73E 3N4XA 3CWBG 1NYHA 1L0LG 1LP1B 3AE7C 1IO4A 4XA4A 1JCCA 5CCGA 4NPDA 1EXJA 1BGYJ 3VP8A 1N73B 4YXWH 2OYOA 2GA1A 3S1KA 1OMIA 3MGNA 2XU6A 1RE3C 2M0BA 1IK9A 1W5CE 2BCCE 1T2KC 1JEKA 4PD4H 3PH0A 3WUUA 1YQ3C 1X22A 5KLVD 3O8ZA 3L4FA 2BASA 1OW7A 3H1IJ 3KYQA 2E75D 3FWNA 2NPSC 4C7NB 1OFCX 4IOIH 1RY3A 2YMKA 2B9BA 2ZVOB 2C0WA 4RJTA 2NPSA 1DH3A 3BCCD 2HR3A 3L73D 1SQVG 1ZP0C 1SQPE 1SVFA 3PP5A 4DOJA 4C7RA 1HJ0A 1LTGC 1HTLC 3IF4A 3TDKA 1BSNA 3M9HA 3MHVA 3V2QA 1P84D 2BCCD 1WMKA 4Y28J 2R3SA 1NKNA 1MFTA 3FGAD 4GIFA 1PGPA 4HKZH 2WZ7A 1YHQP 3A3YB 3H25A 3CX5I 3HUSA 3CL3D 3L74G 1FZBA 5KAIH 4Y99B 3CMAP 3O6QB 2Q5UA 2YIUB 2M3EA 2WPSA 3WMM0 3L71E 4L76A 3HE5B 2KNCA 1GL2A 3SSUA 3WUTA 1KB9E 2Q6QA 2QM7A 5AVZB 2L5GB 2HPCA 1SQPD 5BU5A 1JCDA 3TK1A 2ITAA 3KPEA 3A0BH 3MD0A 1FC2C 1FOSF 4D6TG 2RKLA 2FXPA 1M1KQ 1SFCD 3CCSP 4KT0J 3CXHH 1VF5C 3Q1MA 3CWBJ 1L0LJ 3P8MC 1A02F 4DJGA 3RL0D 4KJMA 2E76C 3QWOC 1YTZT 1N73A 5KAFH 3A2AA 3SWYA 3L71D 4NPFX 4BXLA 1FBMA 3KXDA 5KTBA 1VQKP 2CK3H 1JY3O 1K05A 3W68A 4K35A 1PZQA 1LTJB 2AEMA 1FZCC 1FU1A 1X0TA 3ABVC 2QJPB 1SQXG 1SQVK 1KYOH 3H1HG 4C7NA 2KS1B 1FZCA 2W27A 3LW5H 3Q3DA 2JKVA 4UB6H 2L91A 1KILE 1X9VA 5KLIB 4UB8H 2G8YA 2XNDH 2YKPA 1KQFB 1IFJA 1YJWP 3OJAB 2Y9ZA 1LTIC 5BVZA 3CCMP 2FYNC 4YXDC 4HYTB 1RF1B 4LGDE 1L0NJ 1KN7A 4IFMA 2AXTH 1M8OB 3GHGB 2JJLA 3L74J 3AE8C 1URQD 2P58A 3O6QA 3A0HH 1FJPA 3S9OA 4QMAA 1RE4A 1OIPA 2H88C 4JPZB 4GKGA 3K5BA 3G4SP 5GTIE 4W7ZA 3G3ZA 3NMDA 4PV1D 4TLFA 3B5NB 4TT3H 1OXZA 4LLHA 3CCEP 1EDJA 3VMYA 2MJZA 1Q86Q 4Z1MH 3WU2H 3KQGA 5C39A 4D6TJ 1GDTA 3RK3C 2QVAA 1K9MQ 1RQUA 3CX5H 3BVHA 5KKZB 1IFNA 3CCVP 1AV1A 1BSHA 1PGJA 1KILB 1SQXK 2OYHC 2OYIB 1EDIA 5AVXB 3D6ZA 1J1DC 1MV8A 3PRJA 5KLVG 1AVOA 1U7JA 1KV4A 3OA7A 2K1AA 1RH5B 1SFCC 1JNMA 1OWAA 1SQXJ 1S5LX 1PP9E 2B87B 1T2KD 3FWLA 3RL0C 2A06E 1LTTC 1FDMA 2LKMA 1GK4A 1QLED 3BCCG 2Q9IA 3H1LE 1FS0E 3L73G 2QIWA 3M0AA 4DT0A 5KJ7A 3L75E 1NHLA 1IK7A 1LTAC 5GTHH 1U57A 1ZR2A 3KDPB 3G6EP 2KSJA 1DEEG 1PGQA 2O1KA 3AE2C 3V5BA 1CZQA 1VQ7P 2BCCG 2K88A 1GZLA 1NKZB 2QG4A 4PD4D 3AECC 2O3JA 3GHGA 2HG5D 2QM8A 2WPQA 2GUSA 4R4LA 2WSFH 1M90Q 2Q3IA 1Q81Q 1PP9D 5KAIE 1ZV8A 1EZVE 2M8RA 1NTKE 1CI6B 1R5SA 2A06D 1LJ2A 1IFPA 3BRVB 5APSA 3H1LD 1NAFA 1AFOA 2NPSB 1SQPG 3I5CA 3L75D 2QA4P 2G3AA 3AE5C 2PGDA 2FKWB 3L70E 1GD2E 1URQC 3A0BE 3V2RA 3Q5PA 3AEAC 1N7SC 2Y0CA 5APTA 1URQA 3TNUA 3GLMA 4WWIA 3TGUE 3CC2P 3CXHE 5AW3B 4HH2A 3T97B 3HUSB 5DJTB 4PV1C 2A45G 3L72E 5KLVK 2K37A 3E1RA 1EZVD 2YMYA 1NTKD 1T3JA 1VQNP 3F89A 3L71G 5KAFE 1KILA 2OYIA 5B5EH 1L4AC 3GMAA 1USEA 2PRRA 1VF5D 5BU8B 5AVRB 1XTGB 2ZFCA 2KNCB 1T3UA 1NU1E 4PJ0H 5KLVJ 2HPCB 1HJBA 1Q90D 4L74A 2ZYAA 1HWTC 3L70D 1R8EA 1KYOE 1JY2P 3VOPA 4WY4D 2WQYC 5M1BA 5AVWB 4OGQC 3U1AA 4UB6E 4U3FE 1N8RQ 2W90A 4NPEA 5AW2B 3BCCE 2RN0A 3M9QA 3TGUD 3CXHD 4UB8E 1S5LH 3L72D 1BE3E 5AVYB 2WITA 2O01H 2PFXA 4M3LA 3AE1C 4B86A 2BCCJ 2E76B 3L35A 2N9BA 1P84E 2E43A 1GK6A 1NU1D 4EYYQ 3G71P 1YYCA 2Z4EA 1RE3A 2AXTE 1AQ5A 2OTJP
chains in the Genus database with same CATH topology
1SQVG 3L70G 1NTMG 1BCCG 2IBZG 3L72G 1PPJG 1SQQG 3BCCG 4U3FG 5KLVG 2BCCG 1NTZG 4D6TG 3L73G 3L75G 1SQXG 1SQBG 1KYOH 1PP9G 3L74G 3H1HG 1BE3G 2A06G 4PD4H 3CWBG 1L0LG 3L71G 3H1KG 3CXHH 1KB9H 1BGYG 1L0NG 3H1JG 1SQPG 2FYUG 1EZVG 1NTKG 3H1IG 3H1LG 3TGUG 3CX5H 1P84H 1NU1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV G;  3L70 G;  1NTM G;  1BCC G;  2IBZ G;  3L72 G;  1PPJ G;  1SQQ G;  3BCC G;  4U3F G;  5KLV G;  2BCC G;  1NTZ G;  4D6T G;  3L73 G;  3L75 G;  1SQX G;  1SQB G;  1KYO H;  1PP9 G;  3L74 G;  3H1H G;  1BE3 G;  2A06 G;  4PD4 H;  3CWB G;  1L0L G;  3L71 G;  3H1K G;  3CXH H;  1KB9 H;  1BGY G;  1L0N G;  3H1J G;  1SQP G;  2FYU G;  1EZV G;  1NTK G;  3H1I G;  3H1L G;  3TGU G;  3CX5 H;  1P84 H;  1NU1 G; 
#chains in the Genus database with same CATH topology
 1BGY E;  1SQP K;  3M0D C;  3RK3 E;  1KYO D;  1CI6 A;  1JTH A;  3A0H E;  3PJS K;  1FZC B;  4H44 D;  1DD4 A;  4U3F D;  1H89 A;  1ZLL A;  3H1K E;  4HB1 A;  1Y47 A;  3AE6 C;  2I1K A;  1JMM A;  4WB4 A;  5APW A;  2IFM A;  3H1I E;  1BE3 D;  3V4Q A;  1JY2 N;  3VMX A;  2M5A B;  2FYU D;  1Z56 A;  3D6Y A;  1KFN A;  2QEX P;  5CHX A;  3WU2 E;  2OTK E;  1YIJ P;  1L2P A;  2FYN B;  1MZ9 A;  3HD7 D;  1JM0 A;  4EI2 A;  1RQV A;  3OAK A;  3T97 A;  1BGY D;  1PPJ E;  2E75 B;  4EOT A;  1YIT P;  1HBW A;  4GOF A;  3E1I A;  3RK3 D;  1XTC C;  4RES B;  3L71 J;  1OVR A;  4I2L C;  1QGK B;  3A7O A;  4O9B A;  3AEB C;  2RH0 A;  4RKU J;  2CPS A;  1J1E B;  3H1K D;  2H7H A;  1LT1 A;  1NTZ E;  2A45 I;  3H1I D;  2FFD C;  3BAT A;  4I7Z C;  4W7Y A;  2XZR A;  2N1T D;  2WT7 B;  1KB9 I;  4IL6 X;  3HRN A;  1AA0 A;  5TJH A;  4GOE A;  3SFE C;  2IZ0 A;  1KOR A;  2H8P D;  1RF0 C;  2WWW A;  1PPJ D;  5AW0 B;  3CX5 D;  2FXO A;  3GF3 A;  3SWF A;  1LT9 C;  1VQ6 P;  1S9K E;  5GTH E;  5AVS B;  2QRX A;  1KC8 Q;  5APV A;  1HVV A;  3FXD A;  2DW3 A;  3U59 A;  2E42 A;  1EXI A;  3BAS A;  2J59 M;  2KP8 A;  2IX7 C;  1VQO P;  1NTZ D;  4WY4 C;  1YJN P;  2OYH B;  2V4H A;  3FX0 A;  1LNQ A;  1NTM K;  1PP9 G;  3V2P A;  1J1D B;  2P2U A;  2A06 G;  1H0T A;  1BDD A;  4A7P A;  1SFC B;  3H1L G;  3EWK A;  2ZT9 D;  1IZN B;  1JOC A;  4XE5 B;  3NFQ A;  1ZME C;  1SQV J;  3ITK A;  3RL0 B;  3L75 G;  3U1C A;  3EQ2 A;  1NTM E;  2OTL P;  2Z5I A;  1M56 D;  4AYC A;  1S9K D;  2M5A A;  1YI2 P;  1ZXG A;  1IFI A;  2ZAE B;  3USS A;  1L0L D;  1T6A A;  1FDO A;  4H44 C;  4N6J A;  1D7M A;  3SWK A;  3VN0 A;  3VMA A;  5APQ A;  3LIE A;  1EZV G;  1NTK G;  2ZYG A;  1L0N E;  1N7S D;  1HF9 A;  4Y99 C;  1NAY A;  2JWD A;  2E74 D;  2YNY A;  3E7K A;  3V6I A;  1EDK A;  5B5E E;  2BEQ D;  1K73 Q;  1WT6 A;  5CCH D;  5DJU B;  3JC2 2;  2KYV A;  1NTM D;  4PJ0 E;  1AVY A;  1H88 A;  2OQQ A;  3HD7 C;  3L70 G;  1L4A D;  2WSC J;  2KI7 B;  2W8Z A;  3GG2 A;  4HJG H;  2WT7 A;  4OWF A;  1HGZ A;  2XNX A;  1Q7Y Q;  3HD7 A;  3TSI A;  3I56 P;  2WPR A;  3HE4 B;  3R2P A;  3TGU G;  1URQ B;  3AEF C;  1YJ9 P;  2WPV B;  3TNU B;  3L72 G;  1FJK A;  3JCU H;  4L73 A;  1VQ8 P;  4IL6 H;  1S5L E;  5H2F H;  1L0N D;  4OGQ D;  4XFJ A;  2IZ1 A;  4OVN F;  3L36 A;  3PLN A;  3VTP C;  2N1T C;  1NU1 G;  3KZI H;  4H13 D;  1VDF A;  4PD4 E;  2OYH A;  2W6J H;  2WSE J;  1PFI A;  2N1T A;  2XKM A;  2IBZ E;  5CCG D;  3D71 A;  1PP9 J;  4I6M C;  5CJ4 A;  1KB9 H;  3H1H J;  3P8C E;  2QJP C;  2Q1K A;  3R4Y A;  2PAJ A;  3M06 A;  1SFC A;  2GM4 A;  1KZU B;  3CLQ A;  3LID A;  4U3F G;  1HUC A;  3H32 A;  4JF7 A;  1DIP A;  3L75 J;  1BE3 G;  5KLI C;  3SFD C;  1QL2 A;  2FYU G;  1BDC A;  3CC7 P;  2ZXX A;  5AW4 B;  1NTK K;  4ZNC A;  2NRG A;  1BCC E;  2NZ2 A;  3RGU A;  3B8E B;  3NTN A;  1BGY G;  2ZT9 C;  1PL5 A;  2IBZ D;  1N2D C;  3RK2 D;  3P7K A;  4YPC A;  4IFF A;  1NTK J;  4AUW A;  2E5Y A;  3P8C D;  1JTH B;  2WMM A;  1SQQ K;  2KUB A;  3V4W A;  2KXP B;  2AEF A;  2JDI H;  3H1K G;  1M1J C;  1W2E A;  1S1C X;  2JEE A;  3H1I G;  5AVU B;  2C9L Y;  4R4M A;  3H1J E;  2IYP A;  4H0L D;  3L70 J;  1M1J A;  1FZG A;  4GDO A;  3AEG C;  1SQQ E;  2QJY C;  1FZE A;  2H43 A;  1BCC D;  1GL2 D;  3HE4 A;  2R5D A;  3TGU J;  1PPJ G;  2E74 C;  1NU1 K;  2QJK C;  4JYB A;  1N7S A;  3CC4 P;  1FZA A;  5CCH C;  1SP4 A;  4L75 A;  1VQ5 P;  1K04 A;  1OVV A;  2Y0D A;  1CW5 A;  5CCH A;  1VQ4 P;  3IAO A;  4ZKU A;  2D2C D;  3M9B A;  1NU1 J;  1NTZ G;  1L4A A;  2W83 C;  3H1J D;  1K8A Q;  1GTW A;  2HLO A;  1KQG B;  4JYC A;  5APX A;  1SQQ D;  2P1J A;  3AEE C;  3HTK A;  2FFD B;  3LW5 J;  4I7Z B;  2FYU K;  4U3F J;  2PP6 A;  3MUD C;  3BCC J;  3L73 J;  2N9Y B;  2WSC H;  2Z5H A;  2Q3E A;  3MIW A;  1BE3 J;  4H13 C;  1DEB A;  5K5G B;  1JY2 O;  1QX8 A;  1VL2 A;  2FYU E;  1VF5 B;  3Q5S A;  2Q7C A;  1NO4 A;  5CCG C;  1EDL A;  2IDB A;  1G1J A;  1DD3 A;  1LT9 B;  4I1L A;  1SQB E;  3S4R A;  5E79 H;  1EQ7 A;  3C1L A;  1G2C B;  1NGM B;  2KZI A;  2ZXE B;  2JR8 A;  1X79 B;  1ZN5 A;  2IYO A;  1P84 I;  4WY4 B;  1PV3 A;  1IJD B;  3FXE A;  4DCK A;  1H0T B;  2GUV A;  5CBO A;  3CME P;  2OGU A;  2Y9Y A;  3M0D A;  2WSE H;  1LWU C;  2YKQ A;  3H1K J;  1SQP J;  1NTM G;  2JP3 A;  1LWU A;  4JQ0 D;  1S4X A;  1VPC A;  4BRY B;  3RK2 C;  2AXC A;  2P67 A;  1NOH A;  1SQB D;  2LXB A;  2I1J A;  4KHX A;  4BWN A;  1Q82 Q;  3AE9 C;  2SPZ A;  3AE3 C;  5B66 H;  3CD6 P;  3CX5 E;  1NTZ K;  1FOS E;  3EFF K;  5L8R J;  1L0N G;  1GU4 A;  3JCU E;  3HUS C;  4IL6 E;  4IFD K;  5H2F E;  4H44 B;  3PHL A;  4H0L C;  1KTM A;  2E5T A;  1A02 J;  1CSB A;  3V2N A;  2O1J A;  2ZJS E;  1NTZ J;  1IC2 A;  3KZI E;  3GF7 A;  2ZVN B;  2YXR B;  1GL2 C;  3C8V A;  2R44 A;  2O01 N;  1M7L A;  2R3C A;  1S3J A;  3VP9 A;  2FFD A;  3JSV C;  3HD7 B;  1PIX A;  1YQ4 C;  3PTZ A;  3QH9 A;  1MKM A;  2D2C C;  3WUV A;  2KLU A;  1L0L K;  3RK3 B;  3IR9 A;  5TIS H;  3F5H A;  1RF0 A;  3RL0 g;  3KHU A;  1WRG A;  2HYN A;  1GW3 A;  3P32 A;  3GW6 A;  1N73 C;  2W6B A;  1LT9 A;  1W2B O;  3CPW O;  2J5U A;  1LP1 A;  2FYZ A;  1USD A;  1VQL P;  1JY3 P;  1FE6 A;  3CWB E;  1L0L E;  2IBZ G;  2K3R A;  1G2C A;  5KJ7 D;  4EDF A;  2N1T B;  3N7N A;  2P7J A;  3RBZ A;  1JO5 A;  2WSF J;  2YO3 A;  2JO1 A;  4WY4 A;  4WBA A;  5CJ0 A;  1ZR4 A;  1KD1 Q;  1LTB C;  1KB9 D;  2YO2 A;  5AW8 B;  1JB0 J;  2KSE A;  1FZF A;  3IFM A;  3MP7 B;  2Y0E A;  3H32 B;  1NTM J;  4ASV A;  1VQ9 P;  1ZOY C;  2V7Q J;  1PGO A;  3M91 A;  4ZMD A;  3MZW B;  1UIX A;  1S72 P;  4BRY A;  2KLV A;  1BCC G;  1L0N K;  1SQV E;  3CWB D;  3B5N D;  4U7J A;  1E5W A;  2B88 A;  2WSS H;  2P10 A;  4JBZ A;  3CCR P;  3II6 A;  2XDJ A;  4CPG A;  2KOG A;  3CCJ P;  1T8Z A;  1FDI A;  1QVG O;  3ZDM A;  1P84 H;  1VQM P;  2HOD B;  2E75 C;  3H6P A;  1LTS C;  2POH A;  1JY3 N;  2ZT9 B;  3OW2 O;  5AVT B;  5AW9 B;  2YIU C;  1RE4 C;  1J1E C;  3H1J G;  3L74 E;  3RBX A;  3L37 A;  1FAV A;  2KZJ A;  2KB7 P;  4K3A A;  1N7L A;  1SQQ G;  3HE5 A;  2KK7 A;  3B4S A;  2FBW C;  1M1J B;  2H89 C;  1KIL D;  1QL1 A;  1HGV A;  1MUU A;  1SQV D;  3CCL P;  2QJY B;  4MN4 C;  2R32 A;  1Y8A A;  4GOD A;  3NXS A;  1SS1 A;  1S2E A;  2O01 J;  1N7S B;  3UIA A;  2W6A A;  4D6T E;  2E74 B;  3Q2Y A;  3I55 P;  1ZW0 A;  3BRT B;  3CCU P;  1KFM A;  2QJK B;  1Q2N A;  2M3B A;  3Q5R A;  1QEX A;  4PV1 B;  2J58 A;  1OZH A;  5AW5 B;  2FY8 A;  3L74 D;  2A45 H;  5AW6 B;  4YTP C;  1JUN A;  5E79 E;  1L4A B;  1OW8 A;  4AQR D;  1LTJ C;  4N3Y B;  2WVR A;  1OVU A;  2ZYD A;  1E79 H;  1KMI Z;  2QSI A;  2I8D A;  3HTK B;  4PD4 I;  5AVQ B;  2LXC B;  1LTJ A;  1OW6 A;  3H1L J;  2KIK A;  2IBZ I;  2FXM A;  1IFM A;  4ZKP A;  5AVV B;  4N78 E;  4WVZ A;  2QE7 H;  3C9I A;  2JWA A;  2KS1 A;  1SQX E;  3AED C;  1RHZ B;  4OGQ B;  2K9J B;  3H1H E;  1NWQ A;  4D6T D;  2IPP A;  4OH8 B;  1AQT A;  1OX3 A;  5KJ7 C;  2LR2 A;  2RMZ A;  4H13 B;  1BCC J;  3VMZ A;  1SQB G;  1KQL A;  2B89 A;  1RF1 C;  2NPS D;  3TF5 A;  1J2J B;  2MKV A;  1GU5 A;  3W67 A;  1RF1 A;  4C46 A;  5B66 E;  1LGH B;  1SLQ A;  2HOD A;  1H8A A;  1JMB A;  2R5B A;  3GHG C;  2XV5 A;  1NVO A;  2YXQ B;  5CBN A;  1U7M A;  1NH4 A;  3CCQ P;  1G1I A;  4EIJ A;  4N78 D;  2YKO A;  3H1J J;  1SQX D;  1EZV I;  2WTY A;  3H1H D;  3B5N C;  1LWU B;  3CI9 A;  3A5T A;  1ZRT E;  1SQQ J;  5EFW B;  1EC5 A;  4RO0 A;  2AEJ A;  3B5N A;  4W80 A;  1NJI Q;  2K9Y A;  2IFN A;  3D70 A;  1VQP P;  2V7Q H;  1X8Y A;  1GMJ A;  3RK2 B;  3EFG A;  3L72 J;  3VYI A;  1AJY A;  1MFZ A;  5TIS E;  4DZO A;  5KKZ C;  5AW7 B;  1DX7 A;  4GT1 A;  2C0X A;  2OAR A;  1YTZ I;  2VRS A;  3CXH I;  1HH0 A;  1KIL C;  5CMZ A;  2OYI C;  1N86 A;  2HFE D;  4H0L B;  5AW1 B;  3G9R A;  1ZRT D;  3TYY A;  3AE4 C;  3B71 A;  1Y9B A;  5GTI H;  1GL2 B;  2E76 D;  5APY A;  1YBK A;  3IN6 A;  1TU3 F;  2CPB A;  1GW4 A;  5KLV E;  1UII A;  2UWJ E;  1SQB K;  4LC1 A;  2C9N Y;  2BEZ F;  1M57 D;  2B87 A;  1KQS O;  1KYO I;  2K9J A;  3MUD A;  2FYU J;  1QVF O;  2D2C B;  3MTU E;  1IFD A;  5APU A;  1SQB J;  4ASW A;  1R5L A;  3L73 E;  3N4X A;  3CWB G;  1NYH A;  1L0L G;  1LP1 B;  3AE7 C;  1IO4 A;  4XA4 A;  1JCC A;  5CCG A;  4NPD A;  1EXJ A;  1BGY J;  3VP8 A;  1N73 B;  4YXW H;  2OYO A;  2GA1 A;  3S1K A;  1OMI A;  3MGN A;  2XU6 A;  1RE3 C;  2M0B A;  1IK9 A;  1W5C E;  2BCC E;  1T2K C;  1JEK A;  4PD4 H;  3PH0 A;  3WUU A;  1YQ3 C;  1X22 A;  5KLV D;  3O8Z A;  3L4F A;  2BAS A;  1OW7 A;  3H1I J;  3KYQ A;  2E75 D;  3FWN A;  2NPS C;  4C7N B;  1OFC X;  4IOI H;  1RY3 A;  2YMK A;  2B9B A;  2ZVO B;  2C0W A;  4RJT A;  2NPS A;  1DH3 A;  3BCC D;  2HR3 A;  3L73 D;  1SQV G;  1ZP0 C;  1SQP E;  1SVF A;  3PP5 A;  4DOJ A;  4C7R A;  1HJ0 A;  1LTG C;  1HTL C;  3IF4 A;  3TDK A;  1BSN A;  3M9H A;  3MHV A;  3V2Q A;  1P84 D;  2BCC D;  1WMK A;  4Y28 J;  2R3S A;  1NKN A;  1MFT A;  3FGA D;  4GIF A;  1PGP A;  4HKZ H;  2WZ7 A;  1YHQ P;  3A3Y B;  3H25 A;  3CX5 I;  3HUS A;  3CL3 D;  3L74 G;  1FZB A;  5KAI H;  4Y99 B;  3CMA P;  3O6Q B;  2Q5U A;  2YIU B;  2M3E A;  2WPS A;  3WMM 0;  3L71 E;  4L76 A;  3HE5 B;  2KNC A;  1GL2 A;  3SSU A;  3WUT A;  1KB9 E;  2Q6Q A;  2QM7 A;  5AVZ B;  2L5G B;  2HPC A;  1SQP D;  5BU5 A;  1JCD A;  3TK1 A;  2ITA A;  3KPE A;  3A0B H;  3MD0 A;  1FC2 C;  1FOS F;  4D6T G;  2RKL A;  2FXP A;  1M1K Q;  1SFC D;  3CCS P;  4KT0 J;  3CXH H;  1VF5 C;  3Q1M A;  3CWB J;  1L0L J;  3P8M C;  1A02 F;  4DJG A;  3RL0 D;  4KJM A;  2E76 C;  3QWO C;  1YTZ T;  1N73 A;  5KAF H;  3A2A A;  3SWY A;  3L71 D;  4NPF X;  4BXL A;  1FBM A;  3KXD A;  5KTB A;  1VQK P;  2CK3 H;  1JY3 O;  1K05 A;  3W68 A;  4K35 A;  1PZQ A;  1LTJ B;  2AEM A;  1FZC C;  1FU1 A;  1X0T A;  3ABV C;  2QJP B;  1SQX G;  1SQV K;  1KYO H;  3H1H G;  4C7N A;  2KS1 B;  1FZC A;  2W27 A;  3LW5 H;  3Q3D A;  2JKV A;  4UB6 H;  2L91 A;  1KIL E;  1X9V A;  5KLI B;  4UB8 H;  2G8Y A;  2XND H;  2YKP A;  1KQF B;  1IFJ A;  1YJW P;  3OJA B;  2Y9Z A;  1LTI C;  5BVZ A;  3CCM P;  2FYN C;  4YXD C;  4HYT B;  1RF1 B;  4LGD E;  1L0N J;  1KN7 A;  4IFM A;  2AXT H;  1M8O B;  3GHG B;  2JJL A;  3L74 J;  3AE8 C;  1URQ D;  2P58 A;  3O6Q A;  3A0H H;  1FJP A;  3S9O A;  4QMA A;  1RE4 A;  1OIP A;  2H88 C;  4JPZ B;  4GKG A;  3K5B A;  3G4S P;  5GTI E;  4W7Z A;  3G3Z A;  3NMD A;  4PV1 D;  4TLF A;  3B5N B;  4TT3 H;  1OXZ A;  4LLH A;  3CCE P;  1EDJ A;  3VMY A;  2MJZ A;  1Q86 Q;  4Z1M H;  3WU2 H;  3KQG A;  5C39 A;  4D6T J;  1GDT A;  3RK3 C;  2QVA A;  1K9M Q;  1RQU A;  3CX5 H;  3BVH A;  5KKZ B;  1IFN A;  3CCV P;  1AV1 A;  1BSH A;  1PGJ A;  1KIL B;  1SQX K;  2OYH C;  2OYI B;  1EDI A;  5AVX B;  3D6Z A;  1J1D C;  1MV8 A;  3PRJ A;  5KLV G;  1AVO A;  1U7J A;  1KV4 A;  3OA7 A;  2K1A A;  1RH5 B;  1SFC C;  1JNM A;  1OWA A;  1SQX J;  1S5L X;  1PP9 E;  2B87 B;  1T2K D;  3FWL A;  3RL0 C;  2A06 E;  1LTT C;  1FDM A;  2LKM A;  1GK4 A;  1QLE D;  3BCC G;  2Q9I A;  3H1L E;  1FS0 E;  3L73 G;  2QIW A;  3M0A A;  4DT0 A;  5KJ7 A;  3L75 E;  1NHL A;  1IK7 A;  1LTA C;  5GTH H;  1U57 A;  1ZR2 A;  3KDP B;  3G6E P;  2KSJ A;  1DEE G;  1PGQ A;  2O1K A;  3AE2 C;  3V5B A;  1CZQ A;  1VQ7 P;  2BCC G;  2K88 A;  1GZL A;  1NKZ B;  2QG4 A;  4PD4 D;  3AEC C;  2O3J A;  3GHG A;  2HG5 D;  2QM8 A;  2WPQ A;  2GUS A;  4R4L A;  2WSF H;  1M90 Q;  2Q3I A;  1Q81 Q;  1PP9 D;  5KAI E;  1ZV8 A;  1EZV E;  2M8R A;  1NTK E;  1CI6 B;  1R5S A;  2A06 D;  1LJ2 A;  1IFP A;  3BRV B;  5APS A;  3H1L D;  1NAF A;  1AFO A;  2NPS B;  1SQP G;  3I5C A;  3L75 D;  2QA4 P;  2G3A A;  3AE5 C;  2PGD A;  2FKW B;  3L70 E;  1GD2 E;  1URQ C;  3A0B E;  3V2R A;  3Q5P A;  3AEA C;  1N7S C;  2Y0C A;  5APT A;  1URQ A;  3TNU A;  3GLM A;  4WWI A;  3TGU E;  3CC2 P;  3CXH E;  5AW3 B;  4HH2 A;  3T97 B;  3HUS B;  5DJT B;  4PV1 C;  2A45 G;  3L72 E;  5KLV K;  2K37 A;  3E1R A;  1EZV D;  2YMY A;  1NTK D;  1T3J A;  1VQN P;  3F89 A;  3L71 G;  5KAF E;  1KIL A;  2OYI A;  5B5E H;  1L4A C;  3GMA A;  1USE A;  2PRR A;  1VF5 D;  5BU8 B;  5AVR B;  1XTG B;  2ZFC A;  2KNC B;  1T3U A;  1NU1 E;  4PJ0 H;  5KLV J;  2HPC B;  1HJB A;  1Q90 D;  4L74 A;  2ZYA A;  1HWT C;  3L70 D;  1R8E A;  1KYO E;  1JY2 P;  3VOP A;  4WY4 D;  2WQY C;  5M1B A;  5AVW B;  4OGQ C;  3U1A A;  4UB6 E;  4U3F E;  1N8R Q;  2W90 A;  4NPE A;  5AW2 B;  3BCC E;  2RN0 A;  3M9Q A;  3TGU D;  3CXH D;  4UB8 E;  1S5L H;  3L72 D;  1BE3 E;  5AVY B;  2WIT A;  2O01 H;  2PFX A;  4M3L A;  3AE1 C;  4B86 A;  2BCC J;  2E76 B;  3L35 A;  2N9B A;  1P84 E;  2E43 A;  1GK6 A;  1NU1 D;  4EYY Q;  3G71 P;  1YYC A;  2Z4E A;  1RE3 A;  2AXT E;  1AQ5 A;  2OTJ P; 
#chains in the Genus database with same CATH homology
 1SQV G;  3L70 G;  1NTM G;  1BCC G;  2IBZ G;  3L72 G;  1PPJ G;  1SQQ G;  3BCC G;  4U3F G;  5KLV G;  2BCC G;  1NTZ G;  4D6T G;  3L73 G;  3L75 G;  1SQX G;  1SQB G;  1KYO H;  1PP9 G;  3L74 G;  3H1H G;  1BE3 G;  2A06 G;  4PD4 H;  3CWB G;  1L0L G;  3L71 G;  3H1K G;  3CXH H;  1KB9 H;  1BGY G;  1L0N G;  3H1J G;  1SQP G;  2FYU G;  1EZV G;  1NTK G;  3H1I G;  3H1L G;  3TGU G;  3CX5 H;  1P84 H;  1NU1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...