3L73G

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l73G00
1SQBG 1NTZG 1SQXG 3H1JG 3L71G 1SQPG 2IBZG 1BCCG 3L74G 1P84H 2FYUG 3L75G 4U3FG 3L72G 3BCCG 3CX5H 1BGYG 2A06G 5KLVG 1L0NG 3L70G 3H1HG 3H1KG 3CWBG 1NTMG 3H1IG 4PD4H 3H1LG 1SQVG 3TGUG 3L73G 4D6TG 1KB9H 1PP9G 1SQQG 1BE3G 1PPJG 3CXHH 1NTKG 1KYOH 2BCCG 1NU1G 1L0LG 1EZVG
chains in the Genus database with same CATH superfamily
3CWBD 3FWNA 3HUSC 5CBNA 1JO5A 1PGJA 3V2PA 4TLFA 3TGUE 1KB9I 2O01H 2W6AA 1S5LH 1H8AA 4JPZB 2AXCA 2GUSA 3G3ZA 1YTZI 3VP8A 1SQXE 2HODA 1H88A 3AEAC 2J59M 2KZIA 2A45H 3CX5I 1LTJB 2JDIH 4Y99B 1FU1A 5BU5A 1FDMA 4U3FJ 1L0NG 2HPCB 3LIDA 3PP5A 1AQTA 1YQ3C 2I8DA 1LWUA 1PP9G 3P8MC 1KZUB 1BGYE 1JY3O 2Y0CA 2R32A 2FYUG 3L75G 1EDJA 3E1RA 3H1LE 3VMXA 5TISH 4D6TG 2FYUK 1J1DB 3G6EP 1URQB 3ZDMA 1S9KD 1HTLC 1KD1Q 1NTZG 2WT7B 4JYBA 2B87B 3GLMA 4H44D 2ITAA 4C7NA 1NTZK 4IL6H 1YBKA 3O8ZA 3Q5SA 3IF4A 1L0LE 1DD3A 1M7LA 2ZXEB 4XA4A 1OFCX 5APTA 3L4FA 1GK4A 4H0LB 4IFDK 2H43A 2Y0EA 1FJKA 1FZCA 3GHGB 4PV1B 1SQQE 2OARA 3CL3D 1HUCA 2IFNA 5AVTB 1EZVE 3Q3DA 1SFCC 1DIPA 3L74E 3HTKA 4WWIA 2A06E 1YI2P 2IBZG 3JC22 3PLNA 2P1JA 3OA7A 1GW4A 3I56P 2M5AA 3BRVB 3H1KG 3U1AA 5KJ7D 3RL0B 3C1LA 2OYIB 3H6PA 2VRSA 4RO0A 3QH9A 1BE3J 1DEEG 2E76C 3CCEP 3L72J 3CWBG 2N1TB 1PFIA 1T3UA 1S1CX 4U3FD 1IFNA 2KI7B 2E75B 2HLOA 4OGQD 1L0NE 1KFNA 1GU5A 1P84H 1RE3A 3O6QA 1WMKA 1VQPP 4M3LA 3CMEP 1PP9E 1FDIA 5AW6B 1NTMJ 3JCUE 1G1IA 1USEA 5E79H 2H7HA 1KILC 2OTKE 2FYUE 3L75E 2Q3IA 1JTHA 5CCHA 2KS1B 1NHLA 2GA1A 3G71P 4D6TE 5KLVJ 4PD4H 2ZAEB 3PHLA 2Q3EA 3H1IJ 1GK6A 1KB9H 2E74D 3KZIH 1NTZE 5B66H 4C46A 3L73J 2KB7P 1FE6A 3M9HA 2JR8A 1AA0A 4BXLA 3C8VA 3CX5H 2OYHA 2YKOA 4ZMDA 3L37A 2SPZA 5GTIH 1HJ0A 3MD0A 4GT1A 1VQ5P 2L91A 2KOGA 2QSIA 2KK7A 3PTZA 4GOFA 1N7SC 2H89C 2ZYAA 5KKZB 2ZVOB 3TSIA 3RK3C 1N73B 1X9VA 2FXPA 1W2BO 2H8PD 1S2EA 5CCHD 2KNCB 3Q5PA 1T6AA 2FYNB 2IYPA 3MHVA 1PGPA 1L4AC 3M06A 1CZQA 3VMZA 1VQ6P 3H1KE 1BE3D 2I1KA 2O01N 4NPEA 3SFEC 4ASVA 3N7NA 2QA4P 1E79H 3FXEA 1UIIA 1OX3A 3L72D 5AW3B 3P8CD 1GL2C 2DW3A 5EFWB 3EWKA 1CSBA 3A0BE 2WSEJ 3SFDC 1JB0J 1PZQA 1FS0E 2N1TA 2QJYB 4WY4C 2WVRA 3B4SA 4A7PA 1KN7A 1E5WA 1FOSF 2IFMA 4PV1D 1LP1B 2OTJP 1QX8A 2NRGA 1NTMD 2D2CD 3BCCE 4N6JA 4U3FG 3SSUA 1GZLA 1JNMA 3HE4A 1SQPJ 2QE7H 4LGDE 2W8ZA 1JY2O 1T2KC 3U1CA 5KLIB 4OH8B 3CCSP 3CCJP 3AE4C 2YXQB 5KLVD 3JSVC 3H1ID 1LJ2A 1LTGC 5APUA 2A45I 3I55P 3FWLA 4BWNA 2QJPC 2KIKA 1X8YA 1IO4A 2WITA 1AQ5A 1KQFB 2NPSA 2O01J 2LXCB 1KQSO 1LT9B 1RHZB 1VQLP 2N1TD 3BVHA 1S9KE 2KYVA 2QM8A 3RK2C 1OWAA 2O1KA 4JBZA 2Y9ZA 2JO1A 1PPJE 3CWBJ 4W7ZA 1Q86Q 2P67A 1SP4A 3UIAA 2JJLA 2XV5A 1HF9A 2HODB 2QG4A 1J1EB 1KQGB 4H44B 3CCLP 2QJKC 2Q7CA 3AE2C 3WUTA 3MUDA 1CW5A 1LWUB 4YXWH 2XDJA 2NPSD 1YIJP 1PIXA 1RE4C 3IR9A 4ZKPA 4EDFA 3NMDA 1RF1A 3EFFK 1FZFA 3B8EB 1KQLA 5C39A 3GW6A 1OW7A 1BE3G 2G3AA 1YITP 2CPBA 2ZT9D 2WSFJ 4RKUJ 3L72G 1X79B 3I5CA 1Q2NA 3V4QA 1Z56A 4OVNF 1SQPD 2C0WA 1NWQA 2V4HA 3RBXA 1XTCC 4KJMA 4U3FE 3JCUH 2FFDC 4DCKA 3VYIA 1FZCB 2KSJA 3VOPA 1NTMG 5AW8B 3AE7C 1SQBD 4EI2A 3F5HA 4GODA 4OGQB 1FJPA 1Y47A 3WUVA 2V7QH 3HTKB 5K5GB 1NAYA 3CCQP 2XKMA 1VQMP 2IZ1A 1P84I 1LTSC 3WUUA 1SQQK 5KLVG 1Y9BA 2OGUA 4DZOA 2M5AB 3H1IG 5AVWB 3TK1A 3VMAA 5AVRB 1IFPA 2UWJE 5KLVK 3M9BA 3CC2P 1EQ7A 5AVZB 4I7ZC 2KZJA 2JWDA 5GTHH 2YIUC 2E74B 4PD4I 4L76A 1GU4A 2G8YA 1VF5C 1M57D 4RJTA 3CXHI 3AEFC 3V2RA 3ITKA 4BRYB 3RBZA 2R3CA 2MJZA 3O6QB 3VP9A 4H13C 1U7JA 2YO3A 1NH4A 3V5BA 1ZRTE 1K04A 4XE5B 1L0NK 4JYCA 1JTHB 3M0DC 4W7YA 1BCCJ 1BSHA 3A0BH 1LTBC 1MV8A 2B88A 1SS1A 5DJUB 1SFCA 3L72E 1N8RQ 1GD2E 2OYHB 2PFXA 4GDOA 1GDTA 1MKMA 3D71A 1FOSE 2XU6A 3BASA 2IZ0A 1HBWA 3WU2H 3CCUP 2B9BA 1GL2B 1SQVD 1SQPG 2NZ2A 4IFFA 2M3EA 1EC5A 1BDCA 2C0XA 5AW4B 5APQA 2D2CB 3TGUJ 3IFMA 2Y0DA 1SQBG 1LTTC 1N2DC 2O1JA 5KLVE 1AFOA 1FDOA 3KHUA 3H1IE 1SFCD 1JY3N 1M1JC 1MFTA 1M1KQ 3L73E 3PH0A 4L75A 2WPVB 1NO4A 1YJWP 3CI9A 3V4WA 2FYZA 1KILA 4UB8E 1AJYA 1JCDA 1KTMA 2R5BA 2WPSA 1K9MQ 5KJ7C 2ZYGA 5AW9B 2Z5HA 3AE8C 2OTLP 2HYNA 3D70A 3A0HE 4PJ0H 2E76D 4PD4D 4BRYA 1QL2A 2YMYA 1NTKJ 1KB9D 4HJGH 1IFJA 1NU1J 4YTPC 1KV4A 3HE4B 3B5NC 1IC2A 3CX5D 2Q5UA 2QRXA 1BCCD 3NFQA 5AVVB 3A7OA 1DX7A 3L70D 1RQUA 1NAFA 1EZVI 1L0LJ 1KILD 2W83C 1T8ZA 3S4RA 2NPSB 1LT1A 4R4LA 3CXHH 1L4AA 1VQKP 4YXDC 4Y28J 3W68A 1EDKA 5KAFE 1SVFA 2IPPA 4HYTB 3HD7B 1N86A 2WPQA 1HJBA 1NOHA 4WB4A 4UB6E 1M56D 2ZT9B 1S3JA 1OZHA 1NVOA 1W5CE 1JMMA 4MN4C 1LTJC 4YPCA 4Y99C 5CJ0A 1GL2A 1S4XA 1NKZB 3TGUD 3BATA 2IDBA 3CLQA 5CJ4A 2LXBA 1JUNA 2E5TA 1SQVG 3RK3D 4WY4A 2B89A 1R5LA 3M9QA 2IBZE 2ZYDA 5CCHC 1L4AD 4B86A 2FFDB 1CI6A 1RF1B 1JY2P 3U59A 1OVUA 1KYOE 2ZJSE 1J1DC 5APSA 1URQC 3V2QA 2XNXA 1J2JB 1EDIA 5CHXA 4EOTA 2AXTE 3CPWO 3H1LD 3L71J 3CWBE 1NTKD 1GL2D 3CC4P 1PGOA 1NU1D 3M91A 4WVZA 3MIWA 3MTUE 4O9BA 2M3BA 2OQQA 4H0LC 1R5SA 2HFED 4WY4D 2GM4A 3HUSB 3H1JJ 3GHGC 4PV1C 2WMMA 1L0LD 3BRTB 3HRNA 4HKZH 1JOCA 2WZ7A 1Q82Q 2K37A 2QM7A 3II6A 1GTWA 2KP8A 4OWFA 4EIJA 1JEKA 1Q7YQ 2GUVA 1ZR4A 5AVQB 1ZV8A 1BCCG 1IZNB 2PRRA 1SQBJ 2IBZI 4KHXA 1KMIZ 3L70G 1X22A 2JWAA 2K3RA 1PV3A 3RL0C 2OYIC 1VQ4P 3P32A 1KYOI 5AW0B 3GF7A 2KLVA 1JMBA 2K9YA 4IFMA 5AW7B 3KQGA 5AW1B 1AV1A 1RE4A 3HD7A 3OW2O 1M8OB 1NGMB 2POHA 5BU8B 2E43A 1GMJA 2E75C 3D6YA 5CCGC 2K88A 2R3SA 3T97A 3SWFA 1H0TA 3L35A 1PGQA 1NKNA 1OVVA 1RQVA 1VL2A 3TGUG 2FY8A 1ZMEC 5APVA 1FZAA 4I1LA 3LW5H 1N7LA 2BCCJ 1FZBA 1EXJA 4UB8H 2AEFA 3S9OA 2FFDA 1IK9A 3BCCJ 2Z5IA 5AVSB 3AEBC 3GMAA 3L71D 3HD7D 1FAVA 5CMZA 2Z4EA 1SFCB 3NXSA 3A0HH 3AE1C 3R4YA 3Q5RA 3E7KA 3SWKA 5DJTB 3G4SP 1QGKB 3VMYA 1XTGB 4GOEA 3H1LG 3H1JD 2Y9YA 4AYCA 5APXA 1NTKG 5KKZC 1NU1G 5AVUB 5KAIE 3GG2A 1N73C 3M0AA 3HUSA 1KB9E 2P10A 2AEMA 3KZIE 2FYNC 1NU1K 1QL1A 2PGDA 2E76B 1QEXA 1T3JA 1SQVJ 3CX5E 3VTPC 1BCCE 1L0LG 3H32A 2WTYA 1NTMK 1YYCA 1SLQA 1OW8A 4AUWA 1KILE 2M8RA 3H1HJ 5KAFH 1AVOA 5L8RJ 1KILB 2KLUA 3P7KA 4UB6H 3GF3A 1IFMA 2E42A 3M0DA 2QJYC 2ZFCA 3MP7B 2W27A 3HE5A 1VF5D 3H25A 3A2AA 5KLIC 2FBWC 1QVGO 2BCCD 4N78D 5AW2B 5M1BA 3BCCD 3RK3E 1KYOH 1VQOP 4H13D 1ZOYC 3Q1MA 3R2PA 1N7SB 3TYYA 3W67A 2P2UA 3RK3B 1USDA 2AXTH 2PP6A 4C7RA 2M0BA 3L70J 1BE3E 1LT9C 1RF0C 4TT3H 1UIXA 3RGUA 1L4AB 3QWOC 1LNQA 1VPCA 2N9YB 3L71G 3P8CE 2R5DA 3KPEA 4I6MC 1M1JA 1WT6A 1W2EA 1NTKE 1HWTC 1NU1E 3OJAB 3TNUA 1Q90D 1J1EC 3CCMP 2L5GB 4H44C 4HH2A 4Z1MH 3H1JG 5APYA 1ZN5A 3L36A 2CK3H 5KJ7A 4EYYQ 1NTME 1PPJD 2K9JB 1A02J 1G2CA 4LLHA 1FC2C 1LWUC 1VDFA 2OYOA 1SQPK 4L74A 4WY4B 3MGNA 3CD6P 2ZXXA 4CPGA 3H1HD 2WSFH 3CCVP 1FZGA 4DOJA 1SQXJ 1CI6B 1ZLLA 1FBMA 4NPFX 1KORA 1VQ9P 2N9BA 3B5NA 1SQBK 1P84D 1AVYA 1DEBA 1EDLA 3N4XA 5B5EE 2A45G 3VN0A 2WSCH 1BGYJ 2QJPB 2YKQA 3AE6C 1VQ8P 1Q81Q 3H1LJ 4ASWA 1K73Q 2H88C 1QLED 2QVAA 3CXHD 1X0TA 1FZCC 2RMZA 4JF7A 5H2FE 1PL5A 1IJDB 3V6IA 3S1KA 3RK2B 2YMKA 4OGQC 2RN0A 2O3JA 1OMIA 3B5ND 5AVYB 3SWYA 4U7JA 2BCCG 3MZWB 3FXDA 1N7SA 1LTJA 1VQNP 4IOIH 3BCCG 2QJKB 2IYOA 3NTNA 3TDKA 2FXOA 2HPCA 4DJGA 2LKMA 4GKGA 5CBOA 3B71A 3L71E 1SQQJ 3AE5C 3KYQA 3FX0A 1OW6A 1ZP0C 3EFGA 1TU3F 3L74J 2E74C 5KAIH 1ZW0A 3K5BA 1URQA 2PAJA 3H1JE 1SQPE 2YXRB 3LW5J 4R4MA 2WT7A 5APWA 4N3YB 1RE3C 2B87A 3T97B 1H0TB 2K9JA 2WWWA 1A02F 1N7SD 3EQ2A 1SQXD 4GIFA 5GTHE 1PPJG 1SQBE 3Q2YA 3IN6A 1HGZA 1SQVK 3AEDC 1S5LE 2HG5D 2LR2A 1DD4A 3H1HG 1ZRTD 3GHGA 3G9RA 4WBAA 1L0NJ 1S5LX 2WSSH 1OIPA 1FZEA 1BGYD 2I1JA 1PP9J 3TF5A 3CCRP 2CPSA 1URQD 1DH3A 1S72P 2MKVA 2OYHC 4W80A 2W90A 1HH0A 2FYUJ 3L75J 1IFDA 1HGVA 2P7JA 4NPDA 3ABVC 2JKVA 2OYIA 2Q9IA 4D6TJ 2WQYC 2V7QJ 1LTAC 1NTZJ 1HVVA 4ZNCA 4I7ZB 1Y8AA 5TISE 4H0LD 2D2CC 2YIUB 2KSEA 1K8AQ 2QIWA 2BCCE 2KXPB 1BSNA 1VF5B 4N78E 4HB1A 3AEEC 1OXZA 3RL0g 3H32B 1T2KD 4L73A 4DT0A 5CCGA 3WU2E 3CMAP 2ZVNB 1SQQD 1MUUA 3A3YB 4IL6E 2YNYA 2IX7C 1EZVD 4H13B 3L74D 4IL6X 1IFIA 2JP3A 1EXIA 3IAOA 1VQ7P 1MFZA 2A06D 2XZRA 1YJ9P 2P58A 3FGAD 5AVXB 3RL0D 5KTBA 2YO2A 2W6JH 3D6ZA 3L73D 4QMAA 2KS1A 2R44A 2Q1KA 3PRJA 2N1TC 1ZXGA 3AEGC 2RKLA 1OVRA 3H1KJ 4I2LC 3CC7P 2HR3A 3A5TA 3RK2D 3HE5B 4XFJA 1JCCA 1WRGA 1D7MA 3AE3C 2W6BA 1K05A 2E75D 3V2NA 2JEEA 1SQVE 5CCGD 1U57A 3OAKA 2J5UA 3PJSK 2K1AA 1JY2N 1L0ND 3WMM0 3LIEA 2C9LY 2XNDH 1SQXG 3H1HE 1N73A 3KXDA 2BEQD 1PP9D 5B5EH 2QEXP 4PJ0E 2AEJA 2NPSC 2KNCA 1SQXK 1YHQP 2Q6QA 1MZ9A 2FYUD 3L75D 1P84E 5TJHA 1BDDA 3AECC 2FXMA 4KT0J 4D6TD 3HD7C 2RH0A 1BGYG 1LTIC 1NJIQ 1YQ4C 5E79E 2ZT9C 1M1JB 1NTZD 1U7MA 4K3AA 5H2FH 1M90Q 2BEZF 3TNUB 5BVZA 2WPRA 4ZKUA 4PD4E 3E1IA 1YJNP 3CXHE 1G1JA 1NTKK 2E5YA 4C7NB 5B66E 1G2CB 3KDPB 3MUDC 2YKPA 4LC1A 1LP1A 3C9IA 2C9NY 2FKWB 3USSA 5GTIE 1H89A 1RF1C 2WSEH 3L70E 2WSCJ 4JQ0D 1QVFO 1RH5B 1ZR2A 1L0LK 1RY3A 1IK7A 3B5NB 2IBZD 1SQQG 3F89A 1EZVG 3H1KD 4AQRD 1KFMA 1JM0A 1L2PA 1LGHB 4RESB 1NYHA 3L74G 1YTZT 2J58A 1KYOD 2A06G 1R8EA 4K35A 5AW5B 1KC8Q 3L73G 2KUBA 1LT9A 1RF0A 3AE9C 1GW3A 1JY3P 2BASA
chains in the Genus database with same CATH topology
1SQBG 1NTZG 1SQXG 3H1JG 3L71G 1SQPG 2IBZG 1BCCG 3L74G 1P84H 2FYUG 3L75G 4U3FG 3L72G 3BCCG 3CX5H 1BGYG 2A06G 5KLVG 1L0NG 3L70G 3H1HG 3H1KG 3CWBG 1NTMG 3H1IG 4PD4H 3H1LG 1SQVG 3TGUG 3L73G 4D6TG 1KB9H 1PP9G 1SQQG 1BE3G 1PPJG 3CXHH 1NTKG 1KYOH 2BCCG 1NU1G 1L0LG 1EZVG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQB G;  1NTZ G;  1SQX G;  3H1J G;  3L71 G;  1SQP G;  2IBZ G;  1BCC G;  3L74 G;  1P84 H;  2FYU G;  3L75 G;  4U3F G;  3L72 G;  3BCC G;  3CX5 H;  1BGY G;  2A06 G;  5KLV G;  1L0N G;  3L70 G;  3H1H G;  3H1K G;  3CWB G;  1NTM G;  3H1I G;  4PD4 H;  3H1L G;  1SQV G;  3TGU G;  3L73 G;  4D6T G;  1KB9 H;  1PP9 G;  1SQQ G;  1BE3 G;  1PPJ G;  3CXH H;  1NTK G;  1KYO H;  2BCC G;  1NU1 G;  1L0L G;  1EZV G; 
#chains in the Genus database with same CATH topology
 3CWB D;  3FWN A;  3HUS C;  5CBN A;  1JO5 A;  1PGJ A;  3V2P A;  4TLF A;  3TGU E;  1KB9 I;  2O01 H;  2W6A A;  1S5L H;  1H8A A;  4JPZ B;  2AXC A;  2GUS A;  3G3Z A;  1YTZ I;  3VP8 A;  1SQX E;  2HOD A;  1H88 A;  3AEA C;  2J59 M;  2KZI A;  2A45 H;  3CX5 I;  1LTJ B;  2JDI H;  4Y99 B;  1FU1 A;  5BU5 A;  1FDM A;  4U3F J;  1L0N G;  2HPC B;  3LID A;  3PP5 A;  1AQT A;  1YQ3 C;  2I8D A;  1LWU A;  1PP9 G;  3P8M C;  1KZU B;  1BGY E;  1JY3 O;  2Y0C A;  2R32 A;  2FYU G;  3L75 G;  1EDJ A;  3E1R A;  3H1L E;  3VMX A;  5TIS H;  4D6T G;  2FYU K;  1J1D B;  3G6E P;  1URQ B;  3ZDM A;  1S9K D;  1HTL C;  1KD1 Q;  1NTZ G;  2WT7 B;  4JYB A;  2B87 B;  3GLM A;  4H44 D;  2ITA A;  4C7N A;  1NTZ K;  4IL6 H;  1YBK A;  3O8Z A;  3Q5S A;  3IF4 A;  1L0L E;  1DD3 A;  1M7L A;  2ZXE B;  4XA4 A;  1OFC X;  5APT A;  3L4F A;  1GK4 A;  4H0L B;  4IFD K;  2H43 A;  2Y0E A;  1FJK A;  1FZC A;  3GHG B;  4PV1 B;  1SQQ E;  2OAR A;  3CL3 D;  1HUC A;  2IFN A;  5AVT B;  1EZV E;  3Q3D A;  1SFC C;  1DIP A;  3L74 E;  3HTK A;  4WWI A;  2A06 E;  1YI2 P;  2IBZ G;  3JC2 2;  3PLN A;  2P1J A;  3OA7 A;  1GW4 A;  3I56 P;  2M5A A;  3BRV B;  3H1K G;  3U1A A;  5KJ7 D;  3RL0 B;  3C1L A;  2OYI B;  3H6P A;  2VRS A;  4RO0 A;  3QH9 A;  1BE3 J;  1DEE G;  2E76 C;  3CCE P;  3L72 J;  3CWB G;  2N1T B;  1PFI A;  1T3U A;  1S1C X;  4U3F D;  1IFN A;  2KI7 B;  2E75 B;  2HLO A;  4OGQ D;  1L0N E;  1KFN A;  1GU5 A;  1P84 H;  1RE3 A;  3O6Q A;  1WMK A;  1VQP P;  4M3L A;  3CME P;  1PP9 E;  1FDI A;  5AW6 B;  1NTM J;  3JCU E;  1G1I A;  1USE A;  5E79 H;  2H7H A;  1KIL C;  2OTK E;  2FYU E;  3L75 E;  2Q3I A;  1JTH A;  5CCH A;  2KS1 B;  1NHL A;  2GA1 A;  3G71 P;  4D6T E;  5KLV J;  4PD4 H;  2ZAE B;  3PHL A;  2Q3E A;  3H1I J;  1GK6 A;  1KB9 H;  2E74 D;  3KZI H;  1NTZ E;  5B66 H;  4C46 A;  3L73 J;  2KB7 P;  1FE6 A;  3M9H A;  2JR8 A;  1AA0 A;  4BXL A;  3C8V A;  3CX5 H;  2OYH A;  2YKO A;  4ZMD A;  3L37 A;  2SPZ A;  5GTI H;  1HJ0 A;  3MD0 A;  4GT1 A;  1VQ5 P;  2L91 A;  2KOG A;  2QSI A;  2KK7 A;  3PTZ A;  4GOF A;  1N7S C;  2H89 C;  2ZYA A;  5KKZ B;  2ZVO B;  3TSI A;  3RK3 C;  1N73 B;  1X9V A;  2FXP A;  1W2B O;  2H8P D;  1S2E A;  5CCH D;  2KNC B;  3Q5P A;  1T6A A;  2FYN B;  2IYP A;  3MHV A;  1PGP A;  1L4A C;  3M06 A;  1CZQ A;  3VMZ A;  1VQ6 P;  3H1K E;  1BE3 D;  2I1K A;  2O01 N;  4NPE A;  3SFE C;  4ASV A;  3N7N A;  2QA4 P;  1E79 H;  3FXE A;  1UII A;  1OX3 A;  3L72 D;  5AW3 B;  3P8C D;  1GL2 C;  2DW3 A;  5EFW B;  3EWK A;  1CSB A;  3A0B E;  2WSE J;  3SFD C;  1JB0 J;  1PZQ A;  1FS0 E;  2N1T A;  2QJY B;  4WY4 C;  2WVR A;  3B4S A;  4A7P A;  1KN7 A;  1E5W A;  1FOS F;  2IFM A;  4PV1 D;  1LP1 B;  2OTJ P;  1QX8 A;  2NRG A;  1NTM D;  2D2C D;  3BCC E;  4N6J A;  4U3F G;  3SSU A;  1GZL A;  1JNM A;  3HE4 A;  1SQP J;  2QE7 H;  4LGD E;  2W8Z A;  1JY2 O;  1T2K C;  3U1C A;  5KLI B;  4OH8 B;  3CCS P;  3CCJ P;  3AE4 C;  2YXQ B;  5KLV D;  3JSV C;  3H1I D;  1LJ2 A;  1LTG C;  5APU A;  2A45 I;  3I55 P;  3FWL A;  4BWN A;  2QJP C;  2KIK A;  1X8Y A;  1IO4 A;  2WIT A;  1AQ5 A;  1KQF B;  2NPS A;  2O01 J;  2LXC B;  1KQS O;  1LT9 B;  1RHZ B;  1VQL P;  2N1T D;  3BVH A;  1S9K E;  2KYV A;  2QM8 A;  3RK2 C;  1OWA A;  2O1K A;  4JBZ A;  2Y9Z A;  2JO1 A;  1PPJ E;  3CWB J;  4W7Z A;  1Q86 Q;  2P67 A;  1SP4 A;  3UIA A;  2JJL A;  2XV5 A;  1HF9 A;  2HOD B;  2QG4 A;  1J1E B;  1KQG B;  4H44 B;  3CCL P;  2QJK C;  2Q7C A;  3AE2 C;  3WUT A;  3MUD A;  1CW5 A;  1LWU B;  4YXW H;  2XDJ A;  2NPS D;  1YIJ P;  1PIX A;  1RE4 C;  3IR9 A;  4ZKP A;  4EDF A;  3NMD A;  1RF1 A;  3EFF K;  1FZF A;  3B8E B;  1KQL A;  5C39 A;  3GW6 A;  1OW7 A;  1BE3 G;  2G3A A;  1YIT P;  2CPB A;  2ZT9 D;  2WSF J;  4RKU J;  3L72 G;  1X79 B;  3I5C A;  1Q2N A;  3V4Q A;  1Z56 A;  4OVN F;  1SQP D;  2C0W A;  1NWQ A;  2V4H A;  3RBX A;  1XTC C;  4KJM A;  4U3F E;  3JCU H;  2FFD C;  4DCK A;  3VYI A;  1FZC B;  2KSJ A;  3VOP A;  1NTM G;  5AW8 B;  3AE7 C;  1SQB D;  4EI2 A;  3F5H A;  4GOD A;  4OGQ B;  1FJP A;  1Y47 A;  3WUV A;  2V7Q H;  3HTK B;  5K5G B;  1NAY A;  3CCQ P;  2XKM A;  1VQM P;  2IZ1 A;  1P84 I;  1LTS C;  3WUU A;  1SQQ K;  5KLV G;  1Y9B A;  2OGU A;  4DZO A;  2M5A B;  3H1I G;  5AVW B;  3TK1 A;  3VMA A;  5AVR B;  1IFP A;  2UWJ E;  5KLV K;  3M9B A;  3CC2 P;  1EQ7 A;  5AVZ B;  4I7Z C;  2KZJ A;  2JWD A;  5GTH H;  2YIU C;  2E74 B;  4PD4 I;  4L76 A;  1GU4 A;  2G8Y A;  1VF5 C;  1M57 D;  4RJT A;  3CXH I;  3AEF C;  3V2R A;  3ITK A;  4BRY B;  3RBZ A;  2R3C A;  2MJZ A;  3O6Q B;  3VP9 A;  4H13 C;  1U7J A;  2YO3 A;  1NH4 A;  3V5B A;  1ZRT E;  1K04 A;  4XE5 B;  1L0N K;  4JYC A;  1JTH B;  3M0D C;  4W7Y A;  1BCC J;  1BSH A;  3A0B H;  1LTB C;  1MV8 A;  2B88 A;  1SS1 A;  5DJU B;  1SFC A;  3L72 E;  1N8R Q;  1GD2 E;  2OYH B;  2PFX A;  4GDO A;  1GDT A;  1MKM A;  3D71 A;  1FOS E;  2XU6 A;  3BAS A;  2IZ0 A;  1HBW A;  3WU2 H;  3CCU P;  2B9B A;  1GL2 B;  1SQV D;  1SQP G;  2NZ2 A;  4IFF A;  2M3E A;  1EC5 A;  1BDC A;  2C0X A;  5AW4 B;  5APQ A;  2D2C B;  3TGU J;  3IFM A;  2Y0D A;  1SQB G;  1LTT C;  1N2D C;  2O1J A;  5KLV E;  1AFO A;  1FDO A;  3KHU A;  3H1I E;  1SFC D;  1JY3 N;  1M1J C;  1MFT A;  1M1K Q;  3L73 E;  3PH0 A;  4L75 A;  2WPV B;  1NO4 A;  1YJW P;  3CI9 A;  3V4W A;  2FYZ A;  1KIL A;  4UB8 E;  1AJY A;  1JCD A;  1KTM A;  2R5B A;  2WPS A;  1K9M Q;  5KJ7 C;  2ZYG A;  5AW9 B;  2Z5H A;  3AE8 C;  2OTL P;  2HYN A;  3D70 A;  3A0H E;  4PJ0 H;  2E76 D;  4PD4 D;  4BRY A;  1QL2 A;  2YMY A;  1NTK J;  1KB9 D;  4HJG H;  1IFJ A;  1NU1 J;  4YTP C;  1KV4 A;  3HE4 B;  3B5N C;  1IC2 A;  3CX5 D;  2Q5U A;  2QRX A;  1BCC D;  3NFQ A;  5AVV B;  3A7O A;  1DX7 A;  3L70 D;  1RQU A;  1NAF A;  1EZV I;  1L0L J;  1KIL D;  2W83 C;  1T8Z A;  3S4R A;  2NPS B;  1LT1 A;  4R4L A;  3CXH H;  1L4A A;  1VQK P;  4YXD C;  4Y28 J;  3W68 A;  1EDK A;  5KAF E;  1SVF A;  2IPP A;  4HYT B;  3HD7 B;  1N86 A;  2WPQ A;  1HJB A;  1NOH A;  4WB4 A;  4UB6 E;  1M56 D;  2ZT9 B;  1S3J A;  1OZH A;  1NVO A;  1W5C E;  1JMM A;  4MN4 C;  1LTJ C;  4YPC A;  4Y99 C;  5CJ0 A;  1GL2 A;  1S4X A;  1NKZ B;  3TGU D;  3BAT A;  2IDB A;  3CLQ A;  5CJ4 A;  2LXB A;  1JUN A;  2E5T A;  1SQV G;  3RK3 D;  4WY4 A;  2B89 A;  1R5L A;  3M9Q A;  2IBZ E;  2ZYD A;  5CCH C;  1L4A D;  4B86 A;  2FFD B;  1CI6 A;  1RF1 B;  1JY2 P;  3U59 A;  1OVU A;  1KYO E;  2ZJS E;  1J1D C;  5APS A;  1URQ C;  3V2Q A;  2XNX A;  1J2J B;  1EDI A;  5CHX A;  4EOT A;  2AXT E;  3CPW O;  3H1L D;  3L71 J;  3CWB E;  1NTK D;  1GL2 D;  3CC4 P;  1PGO A;  1NU1 D;  3M91 A;  4WVZ A;  3MIW A;  3MTU E;  4O9B A;  2M3B A;  2OQQ A;  4H0L C;  1R5S A;  2HFE D;  4WY4 D;  2GM4 A;  3HUS B;  3H1J J;  3GHG C;  4PV1 C;  2WMM A;  1L0L D;  3BRT B;  3HRN A;  4HKZ H;  1JOC A;  2WZ7 A;  1Q82 Q;  2K37 A;  2QM7 A;  3II6 A;  1GTW A;  2KP8 A;  4OWF A;  4EIJ A;  1JEK A;  1Q7Y Q;  2GUV A;  1ZR4 A;  5AVQ B;  1ZV8 A;  1BCC G;  1IZN B;  2PRR A;  1SQB J;  2IBZ I;  4KHX A;  1KMI Z;  3L70 G;  1X22 A;  2JWA A;  2K3R A;  1PV3 A;  3RL0 C;  2OYI C;  1VQ4 P;  3P32 A;  1KYO I;  5AW0 B;  3GF7 A;  2KLV A;  1JMB A;  2K9Y A;  4IFM A;  5AW7 B;  3KQG A;  5AW1 B;  1AV1 A;  1RE4 A;  3HD7 A;  3OW2 O;  1M8O B;  1NGM B;  2POH A;  5BU8 B;  2E43 A;  1GMJ A;  2E75 C;  3D6Y A;  5CCG C;  2K88 A;  2R3S A;  3T97 A;  3SWF A;  1H0T A;  3L35 A;  1PGQ A;  1NKN A;  1OVV A;  1RQV A;  1VL2 A;  3TGU G;  2FY8 A;  1ZME C;  5APV A;  1FZA A;  4I1L A;  3LW5 H;  1N7L A;  2BCC J;  1FZB A;  1EXJ A;  4UB8 H;  2AEF A;  3S9O A;  2FFD A;  1IK9 A;  3BCC J;  2Z5I A;  5AVS B;  3AEB C;  3GMA A;  3L71 D;  3HD7 D;  1FAV A;  5CMZ A;  2Z4E A;  1SFC B;  3NXS A;  3A0H H;  3AE1 C;  3R4Y A;  3Q5R A;  3E7K A;  3SWK A;  5DJT B;  3G4S P;  1QGK B;  3VMY A;  1XTG B;  4GOE A;  3H1L G;  3H1J D;  2Y9Y A;  4AYC A;  5APX A;  1NTK G;  5KKZ C;  1NU1 G;  5AVU B;  5KAI E;  3GG2 A;  1N73 C;  3M0A A;  3HUS A;  1KB9 E;  2P10 A;  2AEM A;  3KZI E;  2FYN C;  1NU1 K;  1QL1 A;  2PGD A;  2E76 B;  1QEX A;  1T3J A;  1SQV J;  3CX5 E;  3VTP C;  1BCC E;  1L0L G;  3H32 A;  2WTY A;  1NTM K;  1YYC A;  1SLQ A;  1OW8 A;  4AUW A;  1KIL E;  2M8R A;  3H1H J;  5KAF H;  1AVO A;  5L8R J;  1KIL B;  2KLU A;  3P7K A;  4UB6 H;  3GF3 A;  1IFM A;  2E42 A;  3M0D A;  2QJY C;  2ZFC A;  3MP7 B;  2W27 A;  3HE5 A;  1VF5 D;  3H25 A;  3A2A A;  5KLI C;  2FBW C;  1QVG O;  2BCC D;  4N78 D;  5AW2 B;  5M1B A;  3BCC D;  3RK3 E;  1KYO H;  1VQO P;  4H13 D;  1ZOY C;  3Q1M A;  3R2P A;  1N7S B;  3TYY A;  3W67 A;  2P2U A;  3RK3 B;  1USD A;  2AXT H;  2PP6 A;  4C7R A;  2M0B A;  3L70 J;  1BE3 E;  1LT9 C;  1RF0 C;  4TT3 H;  1UIX A;  3RGU A;  1L4A B;  3QWO C;  1LNQ A;  1VPC A;  2N9Y B;  3L71 G;  3P8C E;  2R5D A;  3KPE A;  4I6M C;  1M1J A;  1WT6 A;  1W2E A;  1NTK E;  1HWT C;  1NU1 E;  3OJA B;  3TNU A;  1Q90 D;  1J1E C;  3CCM P;  2L5G B;  4H44 C;  4HH2 A;  4Z1M H;  3H1J G;  5APY A;  1ZN5 A;  3L36 A;  2CK3 H;  5KJ7 A;  4EYY Q;  1NTM E;  1PPJ D;  2K9J B;  1A02 J;  1G2C A;  4LLH A;  1FC2 C;  1LWU C;  1VDF A;  2OYO A;  1SQP K;  4L74 A;  4WY4 B;  3MGN A;  3CD6 P;  2ZXX A;  4CPG A;  3H1H D;  2WSF H;  3CCV P;  1FZG A;  4DOJ A;  1SQX J;  1CI6 B;  1ZLL A;  1FBM A;  4NPF X;  1KOR A;  1VQ9 P;  2N9B A;  3B5N A;  1SQB K;  1P84 D;  1AVY A;  1DEB A;  1EDL A;  3N4X A;  5B5E E;  2A45 G;  3VN0 A;  2WSC H;  1BGY J;  2QJP B;  2YKQ A;  3AE6 C;  1VQ8 P;  1Q81 Q;  3H1L J;  4ASW A;  1K73 Q;  2H88 C;  1QLE D;  2QVA A;  3CXH D;  1X0T A;  1FZC C;  2RMZ A;  4JF7 A;  5H2F E;  1PL5 A;  1IJD B;  3V6I A;  3S1K A;  3RK2 B;  2YMK A;  4OGQ C;  2RN0 A;  2O3J A;  1OMI A;  3B5N D;  5AVY B;  3SWY A;  4U7J A;  2BCC G;  3MZW B;  3FXD A;  1N7S A;  1LTJ A;  1VQN P;  4IOI H;  3BCC G;  2QJK B;  2IYO A;  3NTN A;  3TDK A;  2FXO A;  2HPC A;  4DJG A;  2LKM A;  4GKG A;  5CBO A;  3B71 A;  3L71 E;  1SQQ J;  3AE5 C;  3KYQ A;  3FX0 A;  1OW6 A;  1ZP0 C;  3EFG A;  1TU3 F;  3L74 J;  2E74 C;  5KAI H;  1ZW0 A;  3K5B A;  1URQ A;  2PAJ A;  3H1J E;  1SQP E;  2YXR B;  3LW5 J;  4R4M A;  2WT7 A;  5APW A;  4N3Y B;  1RE3 C;  2B87 A;  3T97 B;  1H0T B;  2K9J A;  2WWW A;  1A02 F;  1N7S D;  3EQ2 A;  1SQX D;  4GIF A;  5GTH E;  1PPJ G;  1SQB E;  3Q2Y A;  3IN6 A;  1HGZ A;  1SQV K;  3AED C;  1S5L E;  2HG5 D;  2LR2 A;  1DD4 A;  3H1H G;  1ZRT D;  3GHG A;  3G9R A;  4WBA A;  1L0N J;  1S5L X;  2WSS H;  1OIP A;  1FZE A;  1BGY D;  2I1J A;  1PP9 J;  3TF5 A;  3CCR P;  2CPS A;  1URQ D;  1DH3 A;  1S72 P;  2MKV A;  2OYH C;  4W80 A;  2W90 A;  1HH0 A;  2FYU J;  3L75 J;  1IFD A;  1HGV A;  2P7J A;  4NPD A;  3ABV C;  2JKV A;  2OYI A;  2Q9I A;  4D6T J;  2WQY C;  2V7Q J;  1LTA C;  1NTZ J;  1HVV A;  4ZNC A;  4I7Z B;  1Y8A A;  5TIS E;  4H0L D;  2D2C C;  2YIU B;  2KSE A;  1K8A Q;  2QIW A;  2BCC E;  2KXP B;  1BSN A;  1VF5 B;  4N78 E;  4HB1 A;  3AEE C;  1OXZ A;  3RL0 g;  3H32 B;  1T2K D;  4L73 A;  4DT0 A;  5CCG A;  3WU2 E;  3CMA P;  2ZVN B;  1SQQ D;  1MUU A;  3A3Y B;  4IL6 E;  2YNY A;  2IX7 C;  1EZV D;  4H13 B;  3L74 D;  4IL6 X;  1IFI A;  2JP3 A;  1EXI A;  3IAO A;  1VQ7 P;  1MFZ A;  2A06 D;  2XZR A;  1YJ9 P;  2P58 A;  3FGA D;  5AVX B;  3RL0 D;  5KTB A;  2YO2 A;  2W6J H;  3D6Z A;  3L73 D;  4QMA A;  2KS1 A;  2R44 A;  2Q1K A;  3PRJ A;  2N1T C;  1ZXG A;  3AEG C;  2RKL A;  1OVR A;  3H1K J;  4I2L C;  3CC7 P;  2HR3 A;  3A5T A;  3RK2 D;  3HE5 B;  4XFJ A;  1JCC A;  1WRG A;  1D7M A;  3AE3 C;  2W6B A;  1K05 A;  2E75 D;  3V2N A;  2JEE A;  1SQV E;  5CCG D;  1U57 A;  3OAK A;  2J5U A;  3PJS K;  2K1A A;  1JY2 N;  1L0N D;  3WMM 0;  3LIE A;  2C9L Y;  2XND H;  1SQX G;  3H1H E;  1N73 A;  3KXD A;  2BEQ D;  1PP9 D;  5B5E H;  2QEX P;  4PJ0 E;  2AEJ A;  2NPS C;  2KNC A;  1SQX K;  1YHQ P;  2Q6Q A;  1MZ9 A;  2FYU D;  3L75 D;  1P84 E;  5TJH A;  1BDD A;  3AEC C;  2FXM A;  4KT0 J;  4D6T D;  3HD7 C;  2RH0 A;  1BGY G;  1LTI C;  1NJI Q;  1YQ4 C;  5E79 E;  2ZT9 C;  1M1J B;  1NTZ D;  1U7M A;  4K3A A;  5H2F H;  1M90 Q;  2BEZ F;  3TNU B;  5BVZ A;  2WPR A;  4ZKU A;  4PD4 E;  3E1I A;  1YJN P;  3CXH E;  1G1J A;  1NTK K;  2E5Y A;  4C7N B;  5B66 E;  1G2C B;  3KDP B;  3MUD C;  2YKP A;  4LC1 A;  1LP1 A;  3C9I A;  2C9N Y;  2FKW B;  3USS A;  5GTI E;  1H89 A;  1RF1 C;  2WSE H;  3L70 E;  2WSC J;  4JQ0 D;  1QVF O;  1RH5 B;  1ZR2 A;  1L0L K;  1RY3 A;  1IK7 A;  3B5N B;  2IBZ D;  1SQQ G;  3F89 A;  1EZV G;  3H1K D;  4AQR D;  1KFM A;  1JM0 A;  1L2P A;  1LGH B;  4RES B;  1NYH A;  3L74 G;  1YTZ T;  2J58 A;  1KYO D;  2A06 G;  1R8E A;  4K35 A;  5AW5 B;  1KC8 Q;  3L73 G;  2KUB A;  1LT9 A;  1RF0 A;  3AE9 C;  1GW3 A;  1JY3 P;  2BAS A; 
#chains in the Genus database with same CATH homology
 1SQB G;  1NTZ G;  1SQX G;  3H1J G;  3L71 G;  1SQP G;  2IBZ G;  1BCC G;  3L74 G;  1P84 H;  2FYU G;  3L75 G;  4U3F G;  3L72 G;  3BCC G;  3CX5 H;  1BGY G;  2A06 G;  5KLV G;  1L0N G;  3L70 G;  3H1H G;  3H1K G;  3CWB G;  1NTM G;  3H1I G;  4PD4 H;  3H1L G;  1SQV G;  3TGU G;  3L73 G;  4D6T G;  1KB9 H;  1PP9 G;  1SQQ G;  1BE3 G;  1PPJ G;  3CXH H;  1NTK G;  1KYO H;  2BCC G;  1NU1 G;  1L0L G;  1EZV G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...