3L73G

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l73G00
1BGYG 1NTZG 3H1LG 2IBZG 3L75G 2A06G 3L71G 4U3FG 1P84H 1PPJG 1BCCG 2FYUG 3CXHH 1SQQG 1EZVG 3H1JG 1KYOH 4PD4H 1NTKG 1SQBG 1L0NG 1SQXG 3H1HG 1BE3G 3TGUG 3L73G 1SQPG 1KB9H 3L72G 5KLVG 3CX5H 4D6TG 1SQVG 1PP9G 1L0LG 3L74G 2BCCG 3L70G 3H1IG 1NTMG 1NU1G 3H1KG 3CWBG 3BCCG
chains in the Genus database with same CATH superfamily
4WVZA 3S4RA 2QE7H 5AW6B 1YI2P 1AFOA 2D2CD 1EZVI 2QA4P 1J2JB 1HWTC 3M0AA 3P32A 4OWFA 2HR3A 2JO1A 4EI2A 1VQ7P 2E74B 1OVRA 1GL2A 1LT9C 1RF0C 2FYUG 2NZ2A 1IO4A 1SQQG 2Q9IA 4DOJA 5AW9B 1KTMA 4CPGA 3A0HH 3TGUE 2N9BA 3HD7C 3H32B 3G4SP 2POHA 1L0ND 5KKZB 1BCCJ 3TGUG 1EC5A 1FAVA 2QJPC 1PIXA 3CLQA 2K9JA 1QX8A 2YKOA 3ITKA 1URQA 4ASVA 3CCRP 3B5ND 1IK7A 2ZT9C 2Q3EA 2JWAA 3HD7D 1VQPP 2WPVB 2HPCB 1JUNA 1LWUC 2FYNC 5CCGA 2E75B 1SFCA 1IFPA 2JDIH 2WSFH 2I1KA 3O8ZA 2WSCJ 5KLVK 3OW2O 1N7SB 3I55P 1VDFA 1ZMEC 1HBWA 1KYOI 1M7LA 1ZRTD 2KNCA 1N86A 2WITA 1VQ9P 1PPJG 1P84I 3MHVA 2ZXEB 1VQ8P 2HODB 5TISH 1D7MA 1SFCB 5APSA 1AVYA 4H13C 2K9JB 3U1CA 5KJ7D 3V4QA 4KHXA 3H1JD 3CC7P 5KTBA 3GF3A 1JNMA 4I1LA 4XFJA 3PP5A 2FYUE 3HUSA 1MKMA 1DD3A 3VTPC 1GD2E 1FZAA 1IFMA 1JY2N 2N1TB 1FOSF 2L91A 1JTHB 3HD7B 1GDTA 4R4LA 1U57A 2KIKA 2BCCG 1NOHA 3TDKA 1S72P 2BCCJ 1VQ6P 3SWYA 2QJPB 3OA7A 1GL2C 1LT9A 1NKNA 3I56P 2C0WA 3U59A 1L0LK 1M56D 3H1KE 4H0LB 5K5GB 2R5BA 4C46A 4JF7A 3L72J 4BXLA 1L0NK 1URQC 4YPCA 3B5NB 4BRYA 3WUVA 2ZYGA 3CWBJ 1NVOA 2GUVA 2KNCB 1P84E 4XE5B 3O6QB 4XA4A 3EFFK 4EDFA 1A02J 2QJKB 3WU2E 3T97B 5APYA 5DJUB 3G6EP 1FBMA 3AEFC 1YJNP 1FZCA 2WT7B 5GTIH 1LGHB 2WSEH 1N73B 1K05A 2QJYB 1KILB 3GF7A 1EDLA 1KB9D 1YQ3C 3G9RA 3RK3E 2QM7A 2JWDA 1FE6A 2HLOA 1NTMD 3AE7C 3S1KA 3L74J 2K37A 2ZVOB 1PGPA 4EYYQ 1NTKK 1HUCA 1LTGC 3AECC 3RGUA 3Q5PA 1J1EC 1IFDA 1Q2NA 4JBZA 2AEFA 5CBOA 3B5NA 1PFIA 2KLUA 2KZJA 2XNDH 3HTKA 4PJ0H 2FYZA 5AW1B 1FDIA 1N2DC 1OZHA 1OW7A 2WT7A 2Z4EA 5BU8B 2KXPB 3SFEC 1VF5D 3Q5SA 1LTJC 1SQXG 1G1IA 1NTKD 4TT3H 3A5TA 3A0HE 3MUDA 2WMMA 3L73D 1OWAA 2YXQB 4D6TJ 2OYIB 1EDJA 2KSEA 3AE2C 3E7KA 4IL6X 1FZFA 1FZCB 3CX5H 4W80A 3MUDC 4JYBA 4D6TG 1M57D 1L0NE 3L37A 3IN6A 1NU1D 2IX7C 2YMKA 3H1IG 4TLFA 4C7RA 2OYHA 1H0TA 1L2PA 1LP1B 2FBWC 3FX0A 1T8ZA 5E79H 1BGYD 3BATA 2HODA 3RBZA 1L0LJ 1VF5C 1NTZG 2OTJP 1RF1A 3RK2B 3W67A 1PP9E 1SQVE 4R4MA 1GL2D 1JEKA 4UB8E 3WUTA 1P84H 4GODA 4YXDC 1Q81Q 1OVVA 2WVRA 1LTSC 3A3YB 1JCDA 2KI7B 1BCCG 1OFCX 3H1HJ 3CXHH 1ZRTE 1NU1J 3TGUJ 1SQQK 1YTZT 3HUSB 5AVXB 5C39A 1CSBA 3M0DC 2FYUK 2YIUB 2DW3A 4ZKUA 1NWQA 2PFXA 3CC4P 5APWA 2KOGA 3A0BH 2LXCB 3FWLA 1IJDB 3BVHA 2E74C 2FYNB 2O01H 3CWBE 3L75J 3UIAA 3RK3B 3G3ZA 1LP1A 3V5BA 3CCSP 3CMEP 3HE4B 3SWFA 3L72D 2K1AA 5CBNA 3EQ2A 1U7MA 2K9YA 1S9KE 1SFCD 3FWNA 3AE4C 5CHXA 3CCQP 1SQVK 3L70J 3L70D 1OW8A 3M9BA 2FFDA 3H1KG 1H89A 2YIUC 3CX5D 1P84D 1L4AB 3SFDC 1GW3A 3HRNA 2A45I 2NRGA 3F5HA 3RK2D 4W7YA 2P2UA 3CMAP 1QL2A 1SQXE 2E76C 4I6MC 1R5LA 3NFQA 3L75D 3RK3D 1PGJA 2BCCE 1M1JA 3Q3DA 2ZT9B 2IFNA 2IYOA 3CD6P 5KJ7A 1SP4A 1NTMJ 1LWUB 1MFZA 1PV3A 1YQ4C 3WUUA 1FOSE 3GHGB 4IL6H 4GOFA 2M3EA 2O01N 5TISE 2M5AB 3RK2C 1DH3A 1DIPA 1NAFA 4Z1MH 1SQXD 2RH0A 1LTBC 4Y28J 1M1KQ 2V7QJ 3C8VA 5H2FH 5AW8B 3A0BE 3D70A 5AVUB 1HJ0A 2Z5IA 3RL0B 1SFCC 3PHLA 4H13B 4N78D 2AEJA 3CX5I 1SQXJ 2PP6A 2W8ZA 3GG2A 4WBAA 2YO3A 3HE4A 3Q5RA 5CJ0A 4L76A 2BASA 2G3AA 4NPFX 3E1RA 1T2KC 4PV1C 1HJBA 2WZ7A 4OH8B 2E5TA 3AE3C 2ZYDA 5GTHH 1M90Q 3H1LD 2QJKC 1G2CA 1T6AA 3LW5H 1NTZD 4I2LC 3PTZA 2A06G 1GZLA 2RMZA 4RESB 1DEEG 5M1BA 3USSA 2HG5D 3CL3D 2IDBA 3GHGA 4N3YB 1MV8A 3CXHI 1BCCD 2FYUD 4JPZB 3KZIE 1KN7A 2A45G 1EZVG 1SQQD 1KYOD 2GA1A 1KYOH 1MUUA 1RE3C 2JR8A 2QG4A 2W90A 1L0LE 1KORA 1YYCA 4IFMA 4U3FE 1FZBA 5KJ7C 1YIJP 1PP9J 1RH5B 1SQVJ 1KQFB 3VMYA 2OQQA 1VQKP 4Y99B 2AXCA 5KLVD 4H0LD 2HPCA 4I7ZC 3TK1A 4HKZH 4ASWA 3H1IE 1MZ9A 1NU1E 2ZFCA 3I5CA 1Q82Q 3H1HE 2NPSB 1PGOA 1PP9D 1SQVD 2O3JA 4M3LA 1QVGO 1Y9BA 2A45H 2BEQD 2WSSH 3KDPB 3L74D 3M9HA 2IPPA 5AW2B 4D6TE 1K73Q 2H7HA 5B66H 1NTMK 2IZ1A 1HGZA 1URQD 3BCCD 3H1JE 4O9BA 1HF9A 2CPSA 5APVA 4YXWH 3RL0D 2ZT9D 3N4XA 3H25A 3L71J 1L4AA 4PV1B 1M8OB 4L73A 2OYIC 3L71E 4WWIA 5AVZB 4N78E 5AW4B 4NPEA 4GOEA 1KQGB 2H8PD 2PGDA 3VYIA 4BRYB 1SQXK 2QIWA 3FXEA 1J1EB 1SQPE 5AW7B 1YITP 1JMBA 3CCEP 2Q6QA 1PZQA 1RY3A 3TGUD 4PD4E 1KQSO 5B5EE 3O6QA 2E75C 4RJTA 1KB9H 1N7SD 1FZEA 1R5SA 2N9YB 2MKVA 2W83C 5CJ4A 3IAOA 1ZR2A 2GM4A 1H0TB 1NTME 1L0LD 1BGYJ 2GUSA 3PJSK 4AUWA 3BCCJ 3L36A 5GTHE 3PLNA 2BCCD 2RN0A 4IFFA 1NO4A 1NTMG 1BCCE 3G71P 1H8AA 2E42A 2FKWB 2WSFJ 1DEBA 3LIDA 2WSCH 2WWWA 3P8CE 5KAFH 1W2BO 1ZN5A 5AVTB 1GTWA 4IOIH 1EXIA 1RHZB 2O1KA 3C9IA 1RF1C 4U3FG 1RE4C 2W6BA 1AQTA 3C1LA 3L70E 4U3FJ 2CPBA 5APUA 3H1LE 1DD4A 4OGQC 3AE5C 1YHQP 3SWKA 1YBKA 1S5LE 1VF5B 2FY8A 2OGUA 2Y0DA 3H1JG 3II6A 3B4SA 3KQGA 4GDOA 4K35A 2B88A 3L75E 1BE3D 1AQ5A 2H88C 1XTCC 3TSIA 2M3BA 3CXHD 3CCMP 2G8YA 1SQPD 2XNXA 1LJ2A 1XTGB 3CX5E 1ZW0A 3HUSC 3FGAD 1GL2B 3KPEA 3Q1MA 1NJIQ 5AVRB 3HE5A 4H0LC 5GTIE 1S2EA 1JY3N 1KZUB 2I8DA 2YXRB 4OGQB 2B87B 5APQA 1Q7YQ 1EXJA 1HVVA 3AEAC 3JSVC 2K88A 3P8MC 3VP8A 1G1JA 2WQYC 2ZVNB 5AW0B 2P1JA 3CWBD 2E76D 3GHGC 1BGYG 1Y8AA 3TNUA 4OVNF 1BDDA 2Q3IA 2JEEA 1ZR4A 1JY2O 1T3JA 1IK9A 2M5AA 1L0NJ 2B89A 2LKMA 1RQVA 1FU1A 2A06E 2KLVA 2ZJSE 3L35A 2QJYC 1CZQA 1Q90D 4LC1A 1S5LX 1RE3A 1PPJE 1EDIA 2FXMA 5H2FE 2OTLP 1S5LH 3GLMA 5BVZA 2UWJE 2E76B 5L8RJ 1T2KD 1BSHA 3ZDMA 1VQLP 1FJKA 1X9VA 3AEGC 1HGVA 3R2PA 3T97A 1AV1A 1PGQA 3P7KA 5AW3B 4D6TD 1IZNB 2BEZF 4ZMDA 1NGMB 1K8AQ 3V6IA 2Y0CA 3M0DA 1GU5A 3H1IJ 5KAIE 4W7ZA 2I1JA 1N7SA 2M0BA 5EFWB 1USEA 4GKGA 1N73A 3GMAA 3V2QA 3R4YA 5AVWB 3M9QA 5BU5A 1Z56A 5CCHD 5KKZC 4Y99C 4K3AA 3IFMA 3QH9A 1KQLA 2J58A 1VQ4P 1SQPK 4U7JA 1PPJD 2N1TC 2Z5HA 1DX7A 5CCHA 4A7PA 2YMYA 3VMXA 2Y9ZA 2FFDC 2P67A 2VRSA 1L0NG 1JTHA 2Q5UA 3HD7A 3IF4A 3AEDC 1BE3G 3KYQA 4WY4A 4C7NB 1N7LA 2YKPA 2KZIA 2XKMA 3VMZA 1NTZK 3VN0A 3V2NA 1QGKB 1SQPG 2LR2A 2XZRA 3M91A 4L74A 1W2EA 2WSEJ 3W68A 1VQNP 2C9LY 1KD1Q 1EQ7A 5E79E 4WY4B 4C7NA 1LTJA 1ZXGA 4EIJA 5B66E 3B8EB 1LWUA 1N8RQ 3H1KD 1HH0A 2FXPA 1LT1A 2ZXXA 1VL2A 2IBZD 2B87A 3B71A 3M06A 3NTNA 3H1LG 4UB8H 4DJGA 1VQMP 1VQOP 1RE4A 3HE5B 1UIXA 1FZCC 3H32A 3AEBC 3BRTB 2KS1A 4L75A 1BDCA 1J1DC 5APXA 3Q2YA 2WPRA 2IZ0A 2Q1KA 4GT1A 4JYCA 4PV1D 1AA0A 1FS0E 1KILA 1SQQJ 3PRJA 4UB6E 3AE6C 5B5EH 1SQBG 3H1HG 3GW6A 1SQQE 1AVOA 5AVQB 1KMIZ 1GMJA 3IR9A 4B86A 1RF0A 4HH2A 2O01J 2D2CB 4ZNCA 1NAYA 3KHUA 1G2CB 2JKVA 3AE1C 5AW5B 5KLVJ 1L4AC 4PD4I 3VMAA 5KLVG 3CI9A 1ZV8A 3OJAB 2IBZI 1J1DB 1PL5A 1NHLA 2CK3H 1ZLLA 4JQ0D 1X22A 4AQRD 1K9MQ 3BRVB 1U7JA 1WRGA 1NU1K 1WT6A 1K04A 2OYIA 2E43A 3CCVP 1IFJA 1LTIC 1JY2P 2IFMA 3JCUH 2JJLA 5KAFE 3RK3C 2KYVA 2KSJA 3L75G 2YNYA 4DZOA 1GK6A 3L71G 4H44D 4WY4C 2A06D 3RL0g 2Y9YA 1R8EA 4H13D 5TJHA 2M8RA 3E1IA 2QRXA 4IL6E 3H1LJ 2P7JA 4RKUJ 2OYHB 3WU2H 3P8CD 3CC2P 2K3RA 3VP9A 1NYHA 1EZVD 2NPSA 4PD4H 1S9KD 1QVFO 4DCKA 3KZIH 3L72E 4UB6H 3MIWA 3K5BA 2YKQA 1NTKE 2KB7P 2ITAA 3L73J 1KFMA 2XDJA 3L73G 5CMZA 3BCCE 3LW5J 3PH0A 3TYYA 2RKLA 1OX3A 1BGYE 1LT9B 2IYPA 2XV5A 4LLHA 2FXOA 3ABVC 1S4XA 1L0LG 3QWOC 4N6JA 2R32A 1OVUA 3BASA 2R44A 1NU1G 5AVVB 3RBXA 3H1ID 4ZKPA 1KV4A 3D6YA 3MP7B 2LXBA 1Q86Q 1FDMA 1JO5A 1JB0J 2WPQA 3OAKA 2IBZG 4H44C 5CCGD 5APTA 1SQBE 2P58A 3KXDA 2OTKE 2E5YA 3JCUE 4NPDA 2Q7CA 2L5GB 1IFIA 4U3FD 2ZAEB 2PRRA 3TNUB 2AXTH 3MTUE 1KYOE 3VOPA 1S1CX 1S3JA 1ZP0C 2R3SA 3CPWO 4OGQD 1OW6A 1QL1A 1NH4A 2KS1B 1OIPA 4DT0A 3H1JJ 1W5CE 1KB9I 3CCLP 1QEXA 1SQBD 2JP3A 2N1TA 2B9BA 2J59M 1L4AD 3A2AA 3H1HD 1JOCA 1JMMA 1WMKA 2MJZA 3A7OA 3V4WA 1FJPA 4LGDE 4H44B 2N1TD 2W27A 3MD0A 3L4FA 3WMM0 1FZGA 1M1JC 1YJWP 2H43A 1ZOYC 1USDA 1SQBJ 1KFNA 1PP9G 1SQVG 4QMAA 5KLIB 1E5WA 1E79H 1MFTA 1NKZB 1X8YA 2SPZA 2WPSA 3L74G 3U1AA 2C9NY 1SS1A 3NMDA 4BWNA 4PD4D 1GU4A 4IFDK 5CCGC 2E75D 3L74E 3BCCG 3CCUP 2FFDB 2XU6A 1UIIA 1X79B 3N7NA 1AJYA 1OXZA 5KAIH 2HFED 1IFNA 1Y47A 3L71D 4EOTA 1BE3J 1EZVE 3EFGA 4WB4A 1N73C 2QVAA 3LIEA 1JY3O 3JC22 1NTKJ 1BSNA 1M1JB 1QLED 1SLQA 2H89C 1JCCA 3L73E 4PJ0E 1KILC 1KILE 2YO2A 4WY4D 3V2PA 2AXTE 2QEXP 3D71A 3D6ZA 1NTKG 2KP8A 1TU3F 1IC2A 2W6JH 1SVFA 2OARA 1KB9E 1URQB 3MGNA 1YTZI 5AVSB 4KT0J 4HB1A 3B5NC 4KJMA 2QM8A 1VQ5P 1LNQA 3F89A 3NXSA 2NPSD 3H1KJ 4MN4C 1RF1B 1JM0A 1HTLC 3L70G 5KLVE 1BE3E 3EWKA 2QSIA 2V4HA 4YTPC 1YJ9P 1FC2C 1KC8Q 3TF5A 1H88A 1JY3P 2V7QH 3RL0C 1T3UA 2Y0EA 3SSUA 4HYTB 5CCHC 2FYUJ 1LTJB 1CI6A 1GK4A 5KLIC 3AE9C 1RQUA 1OMIA 1KILD 2P10A 3HTKB 2D2CC 1NTZJ 2R3CA 1VPCA 3AE8C 3S9OA 1CW5A 1EDKA 1LTTC 1NTZE 2NPSC 2HYNA 3CXHE 2KUBA 1SQBK 2W6AA 1LTAC 3MZWB 2KK7A 2PAJA 5AVYB 1X0TA 1SQPJ 4GIFA 1GW4A 3CCJP 3L72G 2O1JA 2R5DA 2E74D 3AEEC 5DJTB 1N7SC 2J5UA 2WTYA 2AEMA 2ZYAA 1FDOA 2OYOA 4HJGH 4RO0A 2OYHC 2IBZE 4AYCA 1A02F 3CWBG 3V2RA 3FXDA 1CI6B 3H6PA 2C0XA 4I7ZB
chains in the Genus database with same CATH topology
1BGYG 1NTZG 3H1LG 2IBZG 3L75G 2A06G 3L71G 4U3FG 1P84H 1PPJG 1BCCG 2FYUG 3CXHH 1SQQG 1EZVG 3H1JG 1KYOH 4PD4H 1NTKG 1SQBG 1L0NG 1SQXG 3H1HG 1BE3G 3TGUG 3L73G 1SQPG 1KB9H 3L72G 5KLVG 3CX5H 4D6TG 1SQVG 1PP9G 1L0LG 3L74G 2BCCG 3L70G 3H1IG 1NTMG 1NU1G 3H1KG 3CWBG 3BCCG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY G;  1NTZ G;  3H1L G;  2IBZ G;  3L75 G;  2A06 G;  3L71 G;  4U3F G;  1P84 H;  1PPJ G;  1BCC G;  2FYU G;  3CXH H;  1SQQ G;  1EZV G;  3H1J G;  1KYO H;  4PD4 H;  1NTK G;  1SQB G;  1L0N G;  1SQX G;  3H1H G;  1BE3 G;  3TGU G;  3L73 G;  1SQP G;  1KB9 H;  3L72 G;  5KLV G;  3CX5 H;  4D6T G;  1SQV G;  1PP9 G;  1L0L G;  3L74 G;  2BCC G;  3L70 G;  3H1I G;  1NTM G;  1NU1 G;  3H1K G;  3CWB G;  3BCC G; 
#chains in the Genus database with same CATH topology
 4WVZ A;  3S4R A;  2QE7 H;  5AW6 B;  1YI2 P;  1AFO A;  2D2C D;  1EZV I;  2QA4 P;  1J2J B;  1HWT C;  3M0A A;  3P32 A;  4OWF A;  2HR3 A;  2JO1 A;  4EI2 A;  1VQ7 P;  2E74 B;  1OVR A;  1GL2 A;  1LT9 C;  1RF0 C;  2FYU G;  2NZ2 A;  1IO4 A;  1SQQ G;  2Q9I A;  4DOJ A;  5AW9 B;  1KTM A;  4CPG A;  3A0H H;  3TGU E;  2N9B A;  3HD7 C;  3H32 B;  3G4S P;  2POH A;  1L0N D;  5KKZ B;  1BCC J;  3TGU G;  1EC5 A;  1FAV A;  2QJP C;  1PIX A;  3CLQ A;  2K9J A;  1QX8 A;  2YKO A;  3ITK A;  1URQ A;  4ASV A;  3CCR P;  3B5N D;  1IK7 A;  2ZT9 C;  2Q3E A;  2JWA A;  3HD7 D;  1VQP P;  2WPV B;  2HPC B;  1JUN A;  1LWU C;  2FYN C;  5CCG A;  2E75 B;  1SFC A;  1IFP A;  2JDI H;  2WSF H;  2I1K A;  3O8Z A;  2WSC J;  5KLV K;  3OW2 O;  1N7S B;  3I55 P;  1VDF A;  1ZME C;  1HBW A;  1KYO I;  1M7L A;  1ZRT D;  2KNC A;  1N86 A;  2WIT A;  1VQ9 P;  1PPJ G;  1P84 I;  3MHV A;  2ZXE B;  1VQ8 P;  2HOD B;  5TIS H;  1D7M A;  1SFC B;  5APS A;  1AVY A;  4H13 C;  2K9J B;  3U1C A;  5KJ7 D;  3V4Q A;  4KHX A;  3H1J D;  3CC7 P;  5KTB A;  3GF3 A;  1JNM A;  4I1L A;  4XFJ A;  3PP5 A;  2FYU E;  3HUS A;  1MKM A;  1DD3 A;  3VTP C;  1GD2 E;  1FZA A;  1IFM A;  1JY2 N;  2N1T B;  1FOS F;  2L91 A;  1JTH B;  3HD7 B;  1GDT A;  4R4L A;  1U57 A;  2KIK A;  2BCC G;  1NOH A;  3TDK A;  1S72 P;  2BCC J;  1VQ6 P;  3SWY A;  2QJP B;  3OA7 A;  1GL2 C;  1LT9 A;  1NKN A;  3I56 P;  2C0W A;  3U59 A;  1L0L K;  1M56 D;  3H1K E;  4H0L B;  5K5G B;  2R5B A;  4C46 A;  4JF7 A;  3L72 J;  4BXL A;  1L0N K;  1URQ C;  4YPC A;  3B5N B;  4BRY A;  3WUV A;  2ZYG A;  3CWB J;  1NVO A;  2GUV A;  2KNC B;  1P84 E;  4XE5 B;  3O6Q B;  4XA4 A;  3EFF K;  4EDF A;  1A02 J;  2QJK B;  3WU2 E;  3T97 B;  5APY A;  5DJU B;  3G6E P;  1FBM A;  3AEF C;  1YJN P;  1FZC A;  2WT7 B;  5GTI H;  1LGH B;  2WSE H;  1N73 B;  1K05 A;  2QJY B;  1KIL B;  3GF7 A;  1EDL A;  1KB9 D;  1YQ3 C;  3G9R A;  3RK3 E;  2QM7 A;  2JWD A;  1FE6 A;  2HLO A;  1NTM D;  3AE7 C;  3S1K A;  3L74 J;  2K37 A;  2ZVO B;  1PGP A;  4EYY Q;  1NTK K;  1HUC A;  1LTG C;  3AEC C;  3RGU A;  3Q5P A;  1J1E C;  1IFD A;  1Q2N A;  4JBZ A;  2AEF A;  5CBO A;  3B5N A;  1PFI A;  2KLU A;  2KZJ A;  2XND H;  3HTK A;  4PJ0 H;  2FYZ A;  5AW1 B;  1FDI A;  1N2D C;  1OZH A;  1OW7 A;  2WT7 A;  2Z4E A;  5BU8 B;  2KXP B;  3SFE C;  1VF5 D;  3Q5S A;  1LTJ C;  1SQX G;  1G1I A;  1NTK D;  4TT3 H;  3A5T A;  3A0H E;  3MUD A;  2WMM A;  3L73 D;  1OWA A;  2YXQ B;  4D6T J;  2OYI B;  1EDJ A;  2KSE A;  3AE2 C;  3E7K A;  4IL6 X;  1FZF A;  1FZC B;  3CX5 H;  4W80 A;  3MUD C;  4JYB A;  4D6T G;  1M57 D;  1L0N E;  3L37 A;  3IN6 A;  1NU1 D;  2IX7 C;  2YMK A;  3H1I G;  4TLF A;  4C7R A;  2OYH A;  1H0T A;  1L2P A;  1LP1 B;  2FBW C;  3FX0 A;  1T8Z A;  5E79 H;  1BGY D;  3BAT A;  2HOD A;  3RBZ A;  1L0L J;  1VF5 C;  1NTZ G;  2OTJ P;  1RF1 A;  3RK2 B;  3W67 A;  1PP9 E;  1SQV E;  4R4M A;  1GL2 D;  1JEK A;  4UB8 E;  3WUT A;  1P84 H;  4GOD A;  4YXD C;  1Q81 Q;  1OVV A;  2WVR A;  1LTS C;  3A3Y B;  1JCD A;  2KI7 B;  1BCC G;  1OFC X;  3H1H J;  3CXH H;  1ZRT E;  1NU1 J;  3TGU J;  1SQQ K;  1YTZ T;  3HUS B;  5AVX B;  5C39 A;  1CSB A;  3M0D C;  2FYU K;  2YIU B;  2DW3 A;  4ZKU A;  1NWQ A;  2PFX A;  3CC4 P;  5APW A;  2KOG A;  3A0B H;  2LXC B;  3FWL A;  1IJD B;  3BVH A;  2E74 C;  2FYN B;  2O01 H;  3CWB E;  3L75 J;  3UIA A;  3RK3 B;  3G3Z A;  1LP1 A;  3V5B A;  3CCS P;  3CME P;  3HE4 B;  3SWF A;  3L72 D;  2K1A A;  5CBN A;  3EQ2 A;  1U7M A;  2K9Y A;  1S9K E;  1SFC D;  3FWN A;  3AE4 C;  5CHX A;  3CCQ P;  1SQV K;  3L70 J;  3L70 D;  1OW8 A;  3M9B A;  2FFD A;  3H1K G;  1H89 A;  2YIU C;  3CX5 D;  1P84 D;  1L4A B;  3SFD C;  1GW3 A;  3HRN A;  2A45 I;  2NRG A;  3F5H A;  3RK2 D;  4W7Y A;  2P2U A;  3CMA P;  1QL2 A;  1SQX E;  2E76 C;  4I6M C;  1R5L A;  3NFQ A;  3L75 D;  3RK3 D;  1PGJ A;  2BCC E;  1M1J A;  3Q3D A;  2ZT9 B;  2IFN A;  2IYO A;  3CD6 P;  5KJ7 A;  1SP4 A;  1NTM J;  1LWU B;  1MFZ A;  1PV3 A;  1YQ4 C;  3WUU A;  1FOS E;  3GHG B;  4IL6 H;  4GOF A;  2M3E A;  2O01 N;  5TIS E;  2M5A B;  3RK2 C;  1DH3 A;  1DIP A;  1NAF A;  4Z1M H;  1SQX D;  2RH0 A;  1LTB C;  4Y28 J;  1M1K Q;  2V7Q J;  3C8V A;  5H2F H;  5AW8 B;  3A0B E;  3D70 A;  5AVU B;  1HJ0 A;  2Z5I A;  3RL0 B;  1SFC C;  3PHL A;  4H13 B;  4N78 D;  2AEJ A;  3CX5 I;  1SQX J;  2PP6 A;  2W8Z A;  3GG2 A;  4WBA A;  2YO3 A;  3HE4 A;  3Q5R A;  5CJ0 A;  4L76 A;  2BAS A;  2G3A A;  4NPF X;  3E1R A;  1T2K C;  4PV1 C;  1HJB A;  2WZ7 A;  4OH8 B;  2E5T A;  3AE3 C;  2ZYD A;  5GTH H;  1M90 Q;  3H1L D;  2QJK C;  1G2C A;  1T6A A;  3LW5 H;  1NTZ D;  4I2L C;  3PTZ A;  2A06 G;  1GZL A;  2RMZ A;  4RES B;  1DEE G;  5M1B A;  3USS A;  2HG5 D;  3CL3 D;  2IDB A;  3GHG A;  4N3Y B;  1MV8 A;  3CXH I;  1BCC D;  2FYU D;  4JPZ B;  3KZI E;  1KN7 A;  2A45 G;  1EZV G;  1SQQ D;  1KYO D;  2GA1 A;  1KYO H;  1MUU A;  1RE3 C;  2JR8 A;  2QG4 A;  2W90 A;  1L0L E;  1KOR A;  1YYC A;  4IFM A;  4U3F E;  1FZB A;  5KJ7 C;  1YIJ P;  1PP9 J;  1RH5 B;  1SQV J;  1KQF B;  3VMY A;  2OQQ A;  1VQK P;  4Y99 B;  2AXC A;  5KLV D;  4H0L D;  2HPC A;  4I7Z C;  3TK1 A;  4HKZ H;  4ASW A;  3H1I E;  1MZ9 A;  1NU1 E;  2ZFC A;  3I5C A;  1Q82 Q;  3H1H E;  2NPS B;  1PGO A;  1PP9 D;  1SQV D;  2O3J A;  4M3L A;  1QVG O;  1Y9B A;  2A45 H;  2BEQ D;  2WSS H;  3KDP B;  3L74 D;  3M9H A;  2IPP A;  5AW2 B;  4D6T E;  1K73 Q;  2H7H A;  5B66 H;  1NTM K;  2IZ1 A;  1HGZ A;  1URQ D;  3BCC D;  3H1J E;  4O9B A;  1HF9 A;  2CPS A;  5APV A;  4YXW H;  3RL0 D;  2ZT9 D;  3N4X A;  3H25 A;  3L71 J;  1L4A A;  4PV1 B;  1M8O B;  4L73 A;  2OYI C;  3L71 E;  4WWI A;  5AVZ B;  4N78 E;  5AW4 B;  4NPE A;  4GOE A;  1KQG B;  2H8P D;  2PGD A;  3VYI A;  4BRY B;  1SQX K;  2QIW A;  3FXE A;  1J1E B;  1SQP E;  5AW7 B;  1YIT P;  1JMB A;  3CCE P;  2Q6Q A;  1PZQ A;  1RY3 A;  3TGU D;  4PD4 E;  1KQS O;  5B5E E;  3O6Q A;  2E75 C;  4RJT A;  1KB9 H;  1N7S D;  1FZE A;  1R5S A;  2N9Y B;  2MKV A;  2W83 C;  5CJ4 A;  3IAO A;  1ZR2 A;  2GM4 A;  1H0T B;  1NTM E;  1L0L D;  1BGY J;  2GUS A;  3PJS K;  4AUW A;  3BCC J;  3L36 A;  5GTH E;  3PLN A;  2BCC D;  2RN0 A;  4IFF A;  1NO4 A;  1NTM G;  1BCC E;  3G71 P;  1H8A A;  2E42 A;  2FKW B;  2WSF J;  1DEB A;  3LID A;  2WSC H;  2WWW A;  3P8C E;  5KAF H;  1W2B O;  1ZN5 A;  5AVT B;  1GTW A;  4IOI H;  1EXI A;  1RHZ B;  2O1K A;  3C9I A;  1RF1 C;  4U3F G;  1RE4 C;  2W6B A;  1AQT A;  3C1L A;  3L70 E;  4U3F J;  2CPB A;  5APU A;  3H1L E;  1DD4 A;  4OGQ C;  3AE5 C;  1YHQ P;  3SWK A;  1YBK A;  1S5L E;  1VF5 B;  2FY8 A;  2OGU A;  2Y0D A;  3H1J G;  3II6 A;  3B4S A;  3KQG A;  4GDO A;  4K35 A;  2B88 A;  3L75 E;  1BE3 D;  1AQ5 A;  2H88 C;  1XTC C;  3TSI A;  2M3B A;  3CXH D;  3CCM P;  2G8Y A;  1SQP D;  2XNX A;  1LJ2 A;  1XTG B;  3CX5 E;  1ZW0 A;  3HUS C;  3FGA D;  1GL2 B;  3KPE A;  3Q1M A;  1NJI Q;  5AVR B;  3HE5 A;  4H0L C;  5GTI E;  1S2E A;  1JY3 N;  1KZU B;  2I8D A;  2YXR B;  4OGQ B;  2B87 B;  5APQ A;  1Q7Y Q;  1EXJ A;  1HVV A;  3AEA C;  3JSV C;  2K88 A;  3P8M C;  3VP8 A;  1G1J A;  2WQY C;  2ZVN B;  5AW0 B;  2P1J A;  3CWB D;  2E76 D;  3GHG C;  1BGY G;  1Y8A A;  3TNU A;  4OVN F;  1BDD A;  2Q3I A;  2JEE A;  1ZR4 A;  1JY2 O;  1T3J A;  1IK9 A;  2M5A A;  1L0N J;  2B89 A;  2LKM A;  1RQV A;  1FU1 A;  2A06 E;  2KLV A;  2ZJS E;  3L35 A;  2QJY C;  1CZQ A;  1Q90 D;  4LC1 A;  1S5L X;  1RE3 A;  1PPJ E;  1EDI A;  2FXM A;  5H2F E;  2OTL P;  1S5L H;  3GLM A;  5BVZ A;  2UWJ E;  2E76 B;  5L8R J;  1T2K D;  1BSH A;  3ZDM A;  1VQL P;  1FJK A;  1X9V A;  3AEG C;  1HGV A;  3R2P A;  3T97 A;  1AV1 A;  1PGQ A;  3P7K A;  5AW3 B;  4D6T D;  1IZN B;  2BEZ F;  4ZMD A;  1NGM B;  1K8A Q;  3V6I A;  2Y0C A;  3M0D A;  1GU5 A;  3H1I J;  5KAI E;  4W7Z A;  2I1J A;  1N7S A;  2M0B A;  5EFW B;  1USE A;  4GKG A;  1N73 A;  3GMA A;  3V2Q A;  3R4Y A;  5AVW B;  3M9Q A;  5BU5 A;  1Z56 A;  5CCH D;  5KKZ C;  4Y99 C;  4K3A A;  3IFM A;  3QH9 A;  1KQL A;  2J58 A;  1VQ4 P;  1SQP K;  4U7J A;  1PPJ D;  2N1T C;  2Z5H A;  1DX7 A;  5CCH A;  4A7P A;  2YMY A;  3VMX A;  2Y9Z A;  2FFD C;  2P67 A;  2VRS A;  1L0N G;  1JTH A;  2Q5U A;  3HD7 A;  3IF4 A;  3AED C;  1BE3 G;  3KYQ A;  4WY4 A;  4C7N B;  1N7L A;  2YKP A;  2KZI A;  2XKM A;  3VMZ A;  1NTZ K;  3VN0 A;  3V2N A;  1QGK B;  1SQP G;  2LR2 A;  2XZR A;  3M91 A;  4L74 A;  1W2E A;  2WSE J;  3W68 A;  1VQN P;  2C9L Y;  1KD1 Q;  1EQ7 A;  5E79 E;  4WY4 B;  4C7N A;  1LTJ A;  1ZXG A;  4EIJ A;  5B66 E;  3B8E B;  1LWU A;  1N8R Q;  3H1K D;  1HH0 A;  2FXP A;  1LT1 A;  2ZXX A;  1VL2 A;  2IBZ D;  2B87 A;  3B71 A;  3M06 A;  3NTN A;  3H1L G;  4UB8 H;  4DJG A;  1VQM P;  1VQO P;  1RE4 A;  3HE5 B;  1UIX A;  1FZC C;  3H32 A;  3AEB C;  3BRT B;  2KS1 A;  4L75 A;  1BDC A;  1J1D C;  5APX A;  3Q2Y A;  2WPR A;  2IZ0 A;  2Q1K A;  4GT1 A;  4JYC A;  4PV1 D;  1AA0 A;  1FS0 E;  1KIL A;  1SQQ J;  3PRJ A;  4UB6 E;  3AE6 C;  5B5E H;  1SQB G;  3H1H G;  3GW6 A;  1SQQ E;  1AVO A;  5AVQ B;  1KMI Z;  1GMJ A;  3IR9 A;  4B86 A;  1RF0 A;  4HH2 A;  2O01 J;  2D2C B;  4ZNC A;  1NAY A;  3KHU A;  1G2C B;  2JKV A;  3AE1 C;  5AW5 B;  5KLV J;  1L4A C;  4PD4 I;  3VMA A;  5KLV G;  3CI9 A;  1ZV8 A;  3OJA B;  2IBZ I;  1J1D B;  1PL5 A;  1NHL A;  2CK3 H;  1ZLL A;  4JQ0 D;  1X22 A;  4AQR D;  1K9M Q;  3BRV B;  1U7J A;  1WRG A;  1NU1 K;  1WT6 A;  1K04 A;  2OYI A;  2E43 A;  3CCV P;  1IFJ A;  1LTI C;  1JY2 P;  2IFM A;  3JCU H;  2JJL A;  5KAF E;  3RK3 C;  2KYV A;  2KSJ A;  3L75 G;  2YNY A;  4DZO A;  1GK6 A;  3L71 G;  4H44 D;  4WY4 C;  2A06 D;  3RL0 g;  2Y9Y A;  1R8E A;  4H13 D;  5TJH A;  2M8R A;  3E1I A;  2QRX A;  4IL6 E;  3H1L J;  2P7J A;  4RKU J;  2OYH B;  3WU2 H;  3P8C D;  3CC2 P;  2K3R A;  3VP9 A;  1NYH A;  1EZV D;  2NPS A;  4PD4 H;  1S9K D;  1QVF O;  4DCK A;  3KZI H;  3L72 E;  4UB6 H;  3MIW A;  3K5B A;  2YKQ A;  1NTK E;  2KB7 P;  2ITA A;  3L73 J;  1KFM A;  2XDJ A;  3L73 G;  5CMZ A;  3BCC E;  3LW5 J;  3PH0 A;  3TYY A;  2RKL A;  1OX3 A;  1BGY E;  1LT9 B;  2IYP A;  2XV5 A;  4LLH A;  2FXO A;  3ABV C;  1S4X A;  1L0L G;  3QWO C;  4N6J A;  2R32 A;  1OVU A;  3BAS A;  2R44 A;  1NU1 G;  5AVV B;  3RBX A;  3H1I D;  4ZKP A;  1KV4 A;  3D6Y A;  3MP7 B;  2LXB A;  1Q86 Q;  1FDM A;  1JO5 A;  1JB0 J;  2WPQ A;  3OAK A;  2IBZ G;  4H44 C;  5CCG D;  5APT A;  1SQB E;  2P58 A;  3KXD A;  2OTK E;  2E5Y A;  3JCU E;  4NPD A;  2Q7C A;  2L5G B;  1IFI A;  4U3F D;  2ZAE B;  2PRR A;  3TNU B;  2AXT H;  3MTU E;  1KYO E;  3VOP A;  1S1C X;  1S3J A;  1ZP0 C;  2R3S A;  3CPW O;  4OGQ D;  1OW6 A;  1QL1 A;  1NH4 A;  2KS1 B;  1OIP A;  4DT0 A;  3H1J J;  1W5C E;  1KB9 I;  3CCL P;  1QEX A;  1SQB D;  2JP3 A;  2N1T A;  2B9B A;  2J59 M;  1L4A D;  3A2A A;  3H1H D;  1JOC A;  1JMM A;  1WMK A;  2MJZ A;  3A7O A;  3V4W A;  1FJP A;  4LGD E;  4H44 B;  2N1T D;  2W27 A;  3MD0 A;  3L4F A;  3WMM 0;  1FZG A;  1M1J C;  1YJW P;  2H43 A;  1ZOY C;  1USD A;  1SQB J;  1KFN A;  1PP9 G;  1SQV G;  4QMA A;  5KLI B;  1E5W A;  1E79 H;  1MFT A;  1NKZ B;  1X8Y A;  2SPZ A;  2WPS A;  3L74 G;  3U1A A;  2C9N Y;  1SS1 A;  3NMD A;  4BWN A;  4PD4 D;  1GU4 A;  4IFD K;  5CCG C;  2E75 D;  3L74 E;  3BCC G;  3CCU P;  2FFD B;  2XU6 A;  1UII A;  1X79 B;  3N7N A;  1AJY A;  1OXZ A;  5KAI H;  2HFE D;  1IFN A;  1Y47 A;  3L71 D;  4EOT A;  1BE3 J;  1EZV E;  3EFG A;  4WB4 A;  1N73 C;  2QVA A;  3LIE A;  1JY3 O;  3JC2 2;  1NTK J;  1BSN A;  1M1J B;  1QLE D;  1SLQ A;  2H89 C;  1JCC A;  3L73 E;  4PJ0 E;  1KIL C;  1KIL E;  2YO2 A;  4WY4 D;  3V2P A;  2AXT E;  2QEX P;  3D71 A;  3D6Z A;  1NTK G;  2KP8 A;  1TU3 F;  1IC2 A;  2W6J H;  1SVF A;  2OAR A;  1KB9 E;  1URQ B;  3MGN A;  1YTZ I;  5AVS B;  4KT0 J;  4HB1 A;  3B5N C;  4KJM A;  2QM8 A;  1VQ5 P;  1LNQ A;  3F89 A;  3NXS A;  2NPS D;  3H1K J;  4MN4 C;  1RF1 B;  1JM0 A;  1HTL C;  3L70 G;  5KLV E;  1BE3 E;  3EWK A;  2QSI A;  2V4H A;  4YTP C;  1YJ9 P;  1FC2 C;  1KC8 Q;  3TF5 A;  1H88 A;  1JY3 P;  2V7Q H;  3RL0 C;  1T3U A;  2Y0E A;  3SSU A;  4HYT B;  5CCH C;  2FYU J;  1LTJ B;  1CI6 A;  1GK4 A;  5KLI C;  3AE9 C;  1RQU A;  1OMI A;  1KIL D;  2P10 A;  3HTK B;  2D2C C;  1NTZ J;  2R3C A;  1VPC A;  3AE8 C;  3S9O A;  1CW5 A;  1EDK A;  1LTT C;  1NTZ E;  2NPS C;  2HYN A;  3CXH E;  2KUB A;  1SQB K;  2W6A A;  1LTA C;  3MZW B;  2KK7 A;  2PAJ A;  5AVY B;  1X0T A;  1SQP J;  4GIF A;  1GW4 A;  3CCJ P;  3L72 G;  2O1J A;  2R5D A;  2E74 D;  3AEE C;  5DJT B;  1N7S C;  2J5U A;  2WTY A;  2AEM A;  2ZYA A;  1FDO A;  2OYO A;  4HJG H;  4RO0 A;  2OYH C;  2IBZ E;  4AYC A;  1A02 F;  3CWB G;  3V2R A;  3FXD A;  1CI6 B;  3H6P A;  2C0X A;  4I7Z B; 
#chains in the Genus database with same CATH homology
 1BGY G;  1NTZ G;  3H1L G;  2IBZ G;  3L75 G;  2A06 G;  3L71 G;  4U3F G;  1P84 H;  1PPJ G;  1BCC G;  2FYU G;  3CXH H;  1SQQ G;  1EZV G;  3H1J G;  1KYO H;  4PD4 H;  1NTK G;  1SQB G;  1L0N G;  1SQX G;  3H1H G;  1BE3 G;  3TGU G;  3L73 G;  1SQP G;  1KB9 H;  3L72 G;  5KLV G;  3CX5 H;  4D6T G;  1SQV G;  1PP9 G;  1L0L G;  3L74 G;  2BCC G;  3L70 G;  3H1I G;  1NTM G;  1NU1 G;  3H1K G;  3CWB G;  3BCC G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...