1WRGA

Light-harvesting complex 1 beta subunit from wild-type rhodospirillum rubrum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
55
structure length
55
Chain Sequence
AEVKQESLSGITEGEAKEFHKIFTSSILVFFGVAAFAHLLVWIWRPWVPGPNGYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Light-harvesting protein B-880, beta chain
publication title Solution Structures of the Core Light-harvesting alpha and beta Polypeptides from Rhodospirillum rubrum: Implications for the Pigment-Protein and Protein-Protein Interactions
pubmed doi rcsb
total genus 14
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00556 LHC Antenna complex alpha/beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.250 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1wrgA01
2FKWB 1JMMA 1NKZB 1IJDB 1WRGA 3WMM0 1DX7A 1JO5A 1LGHB 1KZUB
chains in the Genus database with same CATH superfamily
3TNUB 2RMZA 1Y9BA 3H1ID 4PV1D 2BCCG 3SSUA 2ZAEB 3L70J 4I6MC 3C1LA 1URQB 3V4QA 1RE3A 1BGYE 5GTHH 5CJ0A 3AEAC 3BCCE 1KQSO 4H0LB 4D6TJ 2KZJA 2WPRA 2AXTE 3GMAA 4LGDE 2E74D 2WITA 2Y9ZA 1J1EC 1QEXA 1SFCD 1FZCC 4N78E 3GW6A 2D2CD 2WSEH 3CCLP 1LWUC 2HG5D 4GT1A 5CCGA 5H2FH 1SQPG 2ZYGA 3H1HE 3G4SP 1BGYJ 5AVUB 3BCCJ 2YIUC 2BEZF 1Q2NA 2JJLA 2PAJA 1VQNP 1NTZD 2DW3A 3HUSB 1FDIA 1SQQD 4QMAA 4YPCA 2BASA 2HPCA 2GUVA 2GUSA 3S1KA 4H0LC 3BASA 1VF5B 5KKZC 3OW2O 4DCKA 1PV3A 1AJYA 2ZFCA 3H1HJ 3HTKA 3B71A 1P84H 1N86A 3L73D 1YJ9P 4GKGA 2MJZA 3H1JG 1JOCA 3B5ND 4WBAA 3A5TA 2QJPB 4XFJA 4BWNA 1BGYG 1FDMA 1JO5A 4DT0A 2QJKC 1IJDB 5DJTB 5KAIH 1HTLC 1Q81Q 1HBWA 3RK3E 1L4AC 1OWAA 4PJ0H 1LP1A 2LR2A 1JEKA 2QM8A 4AYCA 4U7JA 3HUSC 1VQ5P 4CPGA 1ZP0C 4ZKPA 3O6QB 1IK7A 1R5SA 1RF1C 3RL0B 1PFIA 4BRYB 4PD4E 3VTPC 2FYUD 3EFFK 3ABVC 3H1LJ 2Q3IA 3A0BH 5AVRB 4ZKUA 1J1DB 2YO2A 3EFGA 1BCCG 4EYYQ 1SQQK 1S9KD 1N8RQ 2HFED 3L74J 2QJPC 2FYZA 1OVRA 1KILD 1NH4A 1HGVA 1LTSC 4WB4A 2P7JA 2NPSA 2WT7A 2JKVA 1OW6A 3AEDC 3B4SA 3CCJP 1M1KQ 1ZXGA 1LTAC 1WT6A 1NTMD 1VQ4P 2OTKE 1M7LA 3A0BE 1RHZB 1X9VA 2FBWC 3MTUE 1XTGB 1JCDA 1PP9E 2OARA 1NTKK 3LW5J 1BDDA 1CI6A 1QVFO 1L0ND 3CX5H 2HYNA 1IK9A 1NGMB 1SQBG 3L36A 1T3UA 3AE5C 5AVWB 2E43A 1RE4C 4N6JA 4WY4B 3OJAB 1SQXE 1LNQA 2FYUK 1BE3D 2IBZE 2QVAA 2POHA 4H13C 1JY2P 2W83C 4C7NB 1L4AD 1LGHB 1OMIA 1EXIA 1GW3A 2FXOA 4U3FE 2KI7B 1NU1E 5AVXB 1KD1Q 2M3EA 3PJSK 5EFWB 1YYCA 3EQ2A 1S72P 5APWA 3HD7A 1PGQA 2WPQA 3W67A 3AE9C 4RKUJ 2J59M 3GF3A 1ZN5A 1PPJG 2IPPA 1FAVA 3L71E 3CX5E 4YTPC 5B5EH 1NTKJ 4TT3H 2YKPA 5APQA 1MZ9A 1L0LE 4H44B 4MN4C 2KP8A 1HH0A 1GU5A 3MZWB 1ZW0A 5AVQB 4U3FJ 1MFTA 1USDA 2OYIC 4PV1B 1AV1A 1VDFA 1EZVI 4JBZA 4WVZA 1FOSE 4KHXA 3I56P 3VMZA 2RN0A 5CCHA 1PP9G 1KB9D 2O01J 1L0NK 3AE1C 5KLVK 1L0LJ 5KJ7A 2WTYA 1T8ZA 3BRTB 3M0AA 3F5HA 5B5EE 1OVUA 2E74B 3TNUA 4BXLA 1N73C 1SQXG 3B8EB 4IOIH 1SFCB 2YMKA 2IBZG 1URQA 2D2CB 4NPDA 1T2KC 2ZVNB 1KZUB 1KORA 1ZRTE 4U3FG 1T6AA 5KLIC 2SPZA 1NU1G 4IFMA 3FWNA 1ZMEC 3CCQP 3AECC 3AEGC 2R3CA 1S5LH 1WRGA 2M5AB 3CC4P 2JWAA 1Q90D 1ZV8A 3L71G 1M56D 3PP5A 4DJGA 3KQGA 2Z5IA 4H13D 1PZQA 1M57D 5KLVJ 3CD6P 1PGOA 4IFDK 1KYOD 2V7QH 1OFCX 5AVSB 3AEEC 1LTJB 1RF0C 4OGQC 4L76A 5TISH 1JMMA 2AEJA 1X79B 3CWBE 1MV8A 1LT9C 1NKNA 1KMIZ 3B5NB 2N9BA 3H1JD 5AVYB 1QL2A 3H32B 1QX8A 2QSIA 3H1KJ 5KAFH 2NZ2A 1NAFA 1HF9A 3BATA 4I7ZC 3GHGC 2C9LY 4L74A 5AW6B 4DZOA 3MIWA 1FOSF 1GTWA 3G6EP 3S4RA 2BEQD 1QLED 2XNDH 1E5WA 1KFMA 2IX7C 1U7JA 1J1EB 4IL6E 2AXTH 2A45I 5AW7B 1FZCB 1LT1A 1AFOA 1BCCD 1EDLA 1LWUB 2IDBA 2O01N 1T2KD 4D6TE 2YKQA 4BRYA 1UIIA 4Z1MH 1KILB 3AEFC 1FZEA 3CXHH 1RQUA 2CPBA 2FFDC 4RO0A 3HE4B 1JY2N 5AW5B 1VQ9P 5E79E 2OYHC 3CWBG 2ZYDA 3AE4C 2LXBA 3C8VA 1X8YA 2KS1A 5APUA 2A06E 3RBXA 3WUUA 1VQ6P 2J5UA 1DEEG 3G9RA 5KKZB 2YMYA 4OGQD 1HGZA 3L75E 4JYBA 4C7RA 3TGUD 3BRVB 3RK3D 1SLQA 4L75A 1Q86Q 3MD0A 1SQBD 1JM0A 3CXHE 5APSA 3VMYA 2E75C 2QJKB 1KILC 2HODB 2KZIA 1WMKA 1P84I 1P84D 3R4YA 1SQVD 3TK1A 2N1TC 3AE2C 2O3JA 1L4AB 1GW4A 2FYNC 3L70G 1M1JB 1LTTC 3L75J 3NMDA 2O1KA 3Q3DA 2W6BA 4UB6E 4D6TG 2K37A 3RK2C 3FX0A 3P8MC 1YBKA 4WY4A 1RF1B 4KT0J 2KYVA 1DEBA 2XU6A 1PPJD 1VQ7P 1VQKP 2OYOA 4EI2A 1VQOP 1Z56A 1NWQA 4PD4H 1YIJP 2WPSA 4DOJA 1JY2O 1GL2A 4NPFX 2A06G 2B87B 3Q2YA 2IYPA 1RH5B 1D7MA 2YKOA 3BCCG 3H1IE 3H1LE 1Y47A 3L75G 4A7PA 1YQ4C 3LW5H 3L74E 1IZNB 1M1JC 3L4FA 3WUTA 1EDJA 3RL0g 1U57A 3PRJA 4HH2A 3CCSP 2KOGA 1KFNA 1GMJA 3H1HG 3L72J 1SQVK 1H0TB 2ZVOB 3GLMA 3H1IJ 1G1IA 2WSSH 3D6ZA 3SFDC 2JO1A 4JYCA 2XNXA 1NTZK 3M9QA 3MP7B 3VYIA 3G71P 3CL3D 3GG2A 1S4XA 1FE6A 3CCMP 4UB8E 1S3JA 2R44A 1SFCA 2E75D 4AUWA 2WSCJ 2NRGA 3AE6C 3L71D 3CX5D 1SQQE 4H13B 3CCRP 3TGUJ 2N1TD 3V2NA 3M0DA 4LC1A 1X22A 5APYA 1GZLA 1OW7A 3USSA 3KDPB 3RK2D 2K9JB 2M5AA 4TLFA 5CBNA 3PLNA 3H1IG 3H1LG 3L73E 2C9NY 1VQLP 1JUNA 1RY3A 2V4HA 1N7SC 1DD3A 1NTZJ 4YXWH 2O01H 2PFXA 3L74G 1VQ8P 4HKZH 1SQQJ 3AE3C 1MUUA 3F89A 1LTJA 1AQ5A 3ITKA 1S5LX 3HE5B 3SWYA 2OYIB 1NTKE 1FZAA 1VQPP 3NXSA 1Q7YQ 5C39A 4IFFA 1OZHA 3B5NA 1MKMA 2YXQB 3L73J 3V2PA 5DJUB 3H32A 3A2AA 1ZRTD 3MUDA 1RE3C 1R5LA 3Q1MA 2FYUE 1SS1A 1FJPA 1N73B 3V4WA 1OW8A 1N2DC 1AQTA 1GK6A 1SQQG 2G3AA 1T3JA 2FKWB 3D6YA 1IC2A 1MFZA 3QWOC 5KLIB 1FC2C 2WVRA 5CCGC 3I5CA 3M91A 2E5YA 2KB7P 1NO4A 1YQ3C 1IFPA 2QE7H 1NTMK 2G8YA 2Q6QA 3IN6A 2W6AA 3MHVA 1LTBC 2QRXA 1FZCA 2FYUJ 1YJWP 3IFMA 2PP6A 2BCCD 3CWBD 1LWUA 3IF4A 4M3LA 1LP1B 1KB9I 1GDTA 1IFIA 2IFMA 2E76C 1VL2A 1XTCC 1ZR2A 2L91A 4JPZB 1NVOA 4OGQB 3HE4A 2AXCA 1NTKG 4K3AA 2CK3H 3VP8A 4R4LA 1L0NE 2QJYC 1LT9B 4L73A 3RK3B 2YO3A 1E79H 5KLVE 2PGDA 3L35A 2P10A 1N7SD 3SWKA 3NTNA 1IFDA 3P32A 1BDCA 2H89C 3P8CE 3H6PA 3D70A 1SQPD 1BE3E 2Q9IA 1FDOA 1NTMJ 3II6A 2AEFA 5AW9B 1GD2E 1EDKA 4I7ZB 3L70D 3GHGB 4N3YB 3W68A 3CMAP 1L0NJ 1L0LG 2QG4A 3Q5SA 1SP4A 2K9YA 4D6TD 1G1JA 3H1KE 5CHXA 3CCUP 1KYOI 4HJGH 2HODA 2R5DA 3S9OA 1L4AA 3RBZA 2Y0CA 1M1JA 5GTIH 1BE3J 2W8ZA 3HUSA 3RK3C 3TF5A 1OXZA 1G2CB 2OTJP 1RF1A 4IL6H 4B86A 3TDKA 1BGYD 1BSHA 1K05A 3BCCD 4JF7A 5CCGD 2YXRB 4W80A 1EZVE 3OAKA 2ZT9D 5AW2B 2FFDB 3IAOA 1QL1A 1YJNP 5K5GB 2H8PD 2QM7A 5TJHA 2OYHB 1DIPA 5KLVG 2P1JA 3VMXA 1W5CE 4N78D 2B87A 2NPSC 1BSNA 4OH8B 2Y9YA 2E76D 1ZOYC 5E79H 3CXHD 1ZR4A 3HD7B 1Y8AA 1IFJA 5GTIE 1KTMA 1JY3P 1SQPK 1DH3A 2I1JA 3H1HD 1K04A 1KC8Q 2WMMA 4GIFA 3PH0A 4XE5B 2GA1A 3O6QA 1CW5A 1OIPA 2KNCB 1KQFB 3H1KG 1FS0E 2E75B 3CCVP 2LXCB 1KQLA 2JP3A 3WMM0 2W90A 2IZ0A 1H0TA 2KLVA 2N1TB 2XV5A 2FYNB 3E1IA 1JNMA 2JDIH 1HWTC 1KYOE 1USEA 2RKLA 3V2RA 1RE4A 3RK2B 1AVOA 3V2QA 3M9BA 2W6JH 2WWWA 2H88C 1SQPJ 2H43A 1TU3F 2LKMA 2KUBA 3HD7C 4UB6H 2IYOA 1EZVG 3H1LD 5APXA 2XKMA 3H1JE 3H25A 2A45H 1EDIA 3L74D 3AEBC 1JTHA 1HVVA 2Y0EA 2K9JA 1H88A 2ZXXA 4Y99C 2QIWA 1YHQP 5BU8B 1JMBA 1FZBA 1LTIC 3V5BA 4PD4I 4W7ZA 4PD4D 4GOFA 2ZJSE 1HJBA 2JR8A 5CCHC 2I1KA 4OWFA 2ZYAA 3H1JJ 2NPSD 1S2EA 3HE5A 2OYIA 4I1LA 3T97B 1FZGA 5KJ7C 3U59A 3E1RA 4NPEA 1RQVA 5GTHE 1PGJA 1BCCE 4KJMA 1AVYA 2WSCH 4C7NA 1URQC 2R5BA 4AQRD 1SVFA 3N7NA 1N73A 2K88A 2CPSA 1X0TA 4GODA 3L72E 2WSFJ 2XZRA 3AE8C 5AW4B 3UIAA 1IO4A 3RGUA 3A3YB 1ZLLA 4UB8H 5H2FE 3K5BA 4LLHA 5KTBA 1PP9D 3PHLA 2KIKA 1BCCJ 3OA7A 5AW3B 1SQBK 3VMAA 1H89A 1IFMA 2HLOA 1S1CX 4XA4A 1PIXA 2PRRA 1K9MQ 1NTKD 3TGUE 1FBMA 5M1BA 1NOHA 3HD7D 5CBOA 1SQXD 3CLQA 1SQBE 2IBZI 4GDOA 1N7SB 2IBZD 1EC5A 2WSEJ 2C0WA 2KSEA 1Q82Q 3FGAD 2AEMA 3VP9A 4U3FD 1RF0A 2OTLP 1NU1D 2KXPB 1YITP 1P84E 1SQVE 2UWJE 2WPVB 1VF5C 3CC2P 3FXEA 1LT9A 3FWLA 3FXDA 1NTZE 1JTHB 2A45G 3CX5I 1L0LD 1SQBJ 2KS1B 5KAIE 5CCHD 5CJ4A 3U1CA 1M8OB 1PPJE 1NKZB 4RJTA 1JY3N 3NFQA 4PJ0E 2RH0A 5KJ7D 3L72G 2VRSA 1GK4A 3GHGA 4R4MA 2K1AA 1SQVJ 2Q5UA 2L5GB 1LTGC 1URQD 1M90Q 3QH9A 2KK7A 3A0HH 2KSJA 3LIDA 3RL0C 3CCEP 2ZT9B 4H0LD 5CMZA 1K73Q 2W27A 5AVTB 3TSIA 3TGUG 5BVZA 2IZ1A 4OVNF 1SQXK 1EXJA 1G2CA 1YTZT 2YNYA 1J1DC 5KLVD 1U7MA 2P67A 3HRNA 2E76B 2FY8A 1QVGO 1N7LA 2HPCB 3L37A 3R2PA 2Z4EA 1NU1K 3P8CD 4I2LC 2FFDA 1LJ2A 2FXPA 3I55P 5L8RJ 1SQVG 1DX7A 2OYHA 3TYYA 2QJYB 1CSBA 3JCUH 2O1JA 2FXMA 2C0XA 1NTZG 2B89A 1FZFA 1S9KE 3WUVA 3HTKB 1PP9J 3A0HE 5AW0B 4YXDC 1OX3A 1L0LK 1JCCA 1CZQA 4IL6X 3P7KA 2P58A 1GL2B 2R3SA 3H1KD 2E42A 4W7YA 5AW8B 1KILE 1YTZI 2Y0DA 2ZT9C 1VF5D 3CMEP 4K35A 1SQXJ 4HYTB 1JY3O 4GOEA 1AA0A 3CPWO 2MKVA 1QGKB 3L73G 1VQMP 1R8EA 1KV4A 2KNCA 3VN0A 1NTME 1NU1J 1KILA 5APTA 3JCUE 2K3RA 4WY4C 2N1TA 2OQQA 3VOPA 1EZVD 3BVHA 1NYHA 1DD4A 3JC22 3M06A 3CC7P 3L71J 4Y28J 1L2PA 2ITAA 3N4XA 1HJ0A 5AW1B 1A02J 1VPCA 2Q7CA 3CI9A 3WU2H 1GL2C 2R32A 3RL0D 2E5TA 2FYUG 3O8ZA 3U1AA 3SWFA 3Q5RA 3SFEC 2KLUA 2B9BA 4H44C 3M9HA 1NHLA 2WT7B 2NPSB 1KB9H 2J58A 2M0BA 4JQ0D 3KZIH 3EWKA 4ZMDA 2Z5HA 4PV1C 2HR3A 1CI6B 2Q1KA 1K8AQ 3WU2E 1PL5A 1W2EA 3T97A 2WQYC 5BU5A 3ZDMA 5AVZB 2A06D 2JWDA 5B66H 1NTMG 2M3BA 2E74C 2OGUA 4EDFA 4EOTA 2JEEA 2BCCE 3C9IA 3PTZA 1NJIQ 1OVVA 1SFCC 1KB9E 3L75D 2D2CC 2N9YB 1NAYA 1L0NG 1EQ7A 1FU1A 3KZIE 1KQGB 1S5LE 2H7HA 3M0DC 5APVA 4ZNCA 2M8RA 1YI2P 3AE7C 1A02F 1H8AA 2Q3EA 3CXHI 1PGPA 3KYQA 2P2UA 4O9BA 1IFNA 4EIJA 1KYOH 4WY4D 1UIXA 1BE3G 2WZ7A 2BCCJ 1JB0J 3CWBJ 3IR9A 3GF7A 3JSVC 3D71A 5B66E 3G3ZA 5TISE 1SQPE 4Y99B 1HUCA 3A7OA 1J2JB 4ASWA 4RESB 2I8DA 2QA4P 1LTJC 3E7KA 1GL2D 2GM4A 3L70E 1KN7A 2ZXEB 2B88A 1N7SA 4ASVA 1GU4A 4C46A 4HB1A 3Q5PA 1W2BO 3KPEA 4WWIA 2QEXP 4H44D 3B5NC 2IFNA 2XDJA 5AVVB 5KAFE 3KXDA 2V7QJ 3KHUA 3MGNA 3LIEA 2YIUB 3MUDC 3L72D 2WSFH 3V6IA 1FJKA
chains in the Genus database with same CATH topology
3KQGA 3TNUB 3H32A 2Z5IA 1H89A 1IFMA 2HLOA 4XA4A 3A2AA 3MUDA 1RE3C 1FBMA 1FJPA 1NOHA 3HD7D 1N73B 4I6MC 1URQB 3CLQA 4IFDK 3V4WA 3V4QA 1RE3A 1N7SB 5CJ0A 5AVSB 1N2DC 1LTJB 1RF0C 2C0WA 1GK6A 2WPRA 1JMMA 1T3JA 4LGDE 3VP9A 1X79B 1MV8A 2FKWB 1LT9C 1NKNA 1RF0A 1IC2A 1MFZA 2WITA 3B5NB 1J1EC 5CCGC 1LT9A 2N9BA 1SFCD 3I5CA 1FZCC 3M91A 4N78E 5AVYB 2KB7P 1JTHB 1NO4A 1QL2A 2A45G 2WSEH 3H32B 1LWUC 2HG5D 1NTMK 4GT1A 5CCGA 2W6AA 1LTBC 1FZCA 3IFMA 2PP6A 1LWUA 4M3LA 5CCHD 5AVUB 5CJ4A 3U1CA 1NAFA 1GDTA 1IFIA 2IFMA 3BATA 1NKZB 1JY3N 3GHGC 3NFQA 2C9LY 5KJ7D 5AW6B 2JJLA 2PAJA 1XTCC 1GK4A 2VRSA 3MIWA 4DZOA 1ZR2A 1FOSF 1GTWA 3GHGA 3HUSB 3HE4A 2BASA 2HPCA 3VP8A 2Q5UA 1LT9B 2L5GB 3RK3B 2GUVA 2YO3A 2GUSA 1E5WA 1KFMA 2IX7C 3L35A 1LTGC 1URQD 3BASA 1J1EB 1N7SD 2A45I 2KSJA 3LIDA 5AW7B 3NTNA 1IFDA 1FZCB 3RL0C 1AFOA 3P32A 2ZFCA 5CMZA 1LWUB 2W27A 3HTKA 3P8CE 1T2KD 3H6PA 5AVTB 1N86A 3TSIA 4GKGA 2YKQA 2Q9IA 5BVZA 1SQXK 3II6A 1G2CA 1YTZT 2MJZA 2YNYA 1J1DC 5AW9B 1KILB 1JOCA 3B5ND 4WBAA 3A5TA 1FZEA 1GD2E 2P67A 3HRNA 1FDMA 2CPBA 1JO5A 3GHGB 4N3YB 2FFDC 3HE4B 1JY2N 5AW5B 1IJDB 1N7LA 2HPCB 3L37A 3R2PA 2Z4EA 1HTLC 1SP4A 2OYHC 1NU1K 3P8CD 4I2LC 1G1JA 2FFDA 1HBWA 5CHXA 1X8YA 1L4AC 1OWAA 5APUA 1DX7A 2HODA 2OYHA 3TYYA 1CSBA 2QM8A 4AYCA 2O1JA 2FXMA 2R5DA 2C0XA 3HUSC 1L4AA 1FZFA 1S9KE 4ZKPA 3HTKB 1M1JA 5AW0B 1JCCA 1L0LK 2YMYA 1CZQA 3RL0B 1RF1C 1HGZA 3HUSA 3P7KA 1PFIA 3RK3C 1OXZA 4JYBA 3VTPC 1G2CB 1GL2B 4C7RA 2E42A 3BRVB 1RF1A 3RK3D 4W7YA 5AW8B 1SLQA 4B86A 2Q3IA 1YTZI 3MD0A 5AVRB 4ZKUA 1J1DB 2YO2A 3EFGA 4JF7A 5CCGD 4W80A 3OAKA 4HYTB 1SQQK 5APSA 1S9KD 1JY3O 5AW2B 3VMYA 2FFDB 2HFED 1QL1A 1KILC 2H8PD 2HODB 2QM7A 2OYHB 2FYZA 3TK1A 2P1JA 3VMXA 2N1TC 1L4AB 1GW4A 3VN0A 1KILD 1KILA 1NH4A 4N78D 2NPSC 1M1JB 1LTTC 5APTA 4OH8B 1HGVA 1LTSC 3NMDA 4WY4C 2N1TA 2O1KA 3VOPA 1ZR4A 2W6BA 3BVHA 3HD7B 4WB4A 1IFJA 2NPSA 2P7JA 1JY3P 2WT7A 1SQPK 3RK2C 1DH3A 3M06A 3P8MC 4WY4A 1RF1B 2I1JA 2KYVA 1DEBA 2XU6A 4GIFA 3N4XA 5AW1B 1LTAC 1WT6A 4XE5B 1M7LA 1Z56A 1A02J 1VPCA 2Q7CA 1NWQA 1X9VA 3CI9A 3MTUE 1GL2C 1XTGB 1JCDA 2R32A 3RL0D 2OARA 1NTKK 1CW5A 2WPSA 1CI6A 4DOJA 3O8ZA 3U1AA 1KQLA 1JY2O 1GL2A 2HYNA 3WMM0 3SWFA 1IK9A 3L36A 2YKOA 2KLVA 2N1TB 3M9HA 2XV5A 1NHLA 1T3UA 3E1IA 5AVWB 1JNMA 2WT7B 2NPSB 2E43A 1RE4C 4N6JA 2J58A 1HWTC 4WY4B 3OJAB 2FYUK 3LW5H 3V2RA 1RE4A 3RK2B 2POHA 3V2QA 1M1JC 2Z5HA 1JY2P 3M9BA 2WWWA 3L4FA 4C7NB 1L4AD 1LGHB 2H43A 1GW3A 2LKMA 3HD7C 4HH2A 5AVXB 5APXA 2KOGA 2XKMA 1YYCA 3EQ2A 1CI6B 5APWA 1KFNA 3HD7A 1W2EA 2WPQA 3T97A 2A45H 1SQVK 2J59M 1ZN5A 5BU5A 1G1IA 2IPPA 1FAVA 5AVZB 1HVVA 4JYCA 2M3BA 2XNXA 1NTZK 3M9QA 1H88A 4Y99C 2YKPA 3VYIA 4EOTA 5APQA 1MZ9A 2JEEA 3CL3D 3C9IA 2KP8A 1SFCC 5BU8B 1HH0A 1GU5A 1FZBA 1LTIC 3V5BA 4W7ZA 1EQ7A 5AVQB 1FU1A 1SFCA 1HJBA 2H7HA 3M0DC 4AUWA 5APVA 2M8RA 2OYIC 5CCHC 2I1KA 1A02F 1H8AA 2N1TD 1VDFA 1FOSE 3KYQA 3V2NA 2P2UA 3M0DA 4KHXA 4O9BA 1IFNA 4EIJA 4LC1A 5APYA 2NPSD 3VMZA 3HE5A 2OYIA 4I1LA 5CCHA 1FZGA 5KJ7C 4WY4D 1GZLA 1L0NK 2WZ7A 3U59A 3KDPB 5KLVK 3RK2D 5KJ7A 2WTYA 3IR9A 1T8ZA 2WSCH 3BRTB 3M0AA 4C7NA 3G3ZA 3TNUA 2C9NY 4Y99B 1HUCA 1N73C 3A7OA 1JUNA 1J2JB 1URQC 1RY3A 4RESB 2R5BA 1N7SC 4AQRD 3B8EB 1SVFA 1SFCB 1LTJC 1GL2D 2O01H 2GM4A 3N7NA 1N73A 2CPSA 1URQA 3V2PA 2ZXEB 1T2KC 2XZRA 1MUUA 1N7SA 5AW4B 1GU4A 1LTJA 1KZUB 4C46A 3UIAA 1AQ5A 1IO4A 3KPEA 3HE5B 3A3YB 3SWYA 2OYIB 1ZLLA 3B5NC 1FZAA 4IFMA 3NXSA 2IFNA 2XDJA 5AVVB 4LLHA 5KTBA 4IFFA 2R3CA 1WRGA 3MGNA 3LIEA 3OA7A 3B5NA 5AW3B 1SQBK 1ZV8A 2WSFH 3PP5A 1JTHA 1FJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKW B;  1JMM A;  1NKZ B;  1IJD B;  1WRG A;  3WMM 0;  1DX7 A;  1JO5 A;  1LGH B;  1KZU B; 
#chains in the Genus database with same CATH topology
 3TNU B;  2RMZ A;  1Y9B A;  3H1I D;  4PV1 D;  2BCC G;  3SSU A;  2ZAE B;  3L70 J;  4I6M C;  3C1L A;  1URQ B;  3V4Q A;  1RE3 A;  1BGY E;  5GTH H;  5CJ0 A;  3AEA C;  3BCC E;  1KQS O;  4H0L B;  4D6T J;  2KZJ A;  2WPR A;  2AXT E;  3GMA A;  4LGD E;  2E74 D;  2WIT A;  2Y9Z A;  1J1E C;  1QEX A;  1SFC D;  1FZC C;  4N78 E;  3GW6 A;  2D2C D;  2WSE H;  3CCL P;  1LWU C;  2HG5 D;  4GT1 A;  5CCG A;  5H2F H;  1SQP G;  2ZYG A;  3H1H E;  3G4S P;  1BGY J;  5AVU B;  3BCC J;  2YIU C;  2BEZ F;  1Q2N A;  2JJL A;  2PAJ A;  1VQN P;  1NTZ D;  2DW3 A;  3HUS B;  1FDI A;  1SQQ D;  4QMA A;  4YPC A;  2BAS A;  2HPC A;  2GUV A;  2GUS A;  3S1K A;  4H0L C;  3BAS A;  1VF5 B;  5KKZ C;  3OW2 O;  4DCK A;  1PV3 A;  1AJY A;  2ZFC A;  3H1H J;  3HTK A;  3B71 A;  1P84 H;  1N86 A;  3L73 D;  1YJ9 P;  4GKG A;  2MJZ A;  3H1J G;  1JOC A;  3B5N D;  4WBA A;  3A5T A;  2QJP B;  4XFJ A;  4BWN A;  1BGY G;  1FDM A;  1JO5 A;  4DT0 A;  2QJK C;  1IJD B;  5DJT B;  5KAI H;  1HTL C;  1Q81 Q;  1HBW A;  3RK3 E;  1L4A C;  1OWA A;  4PJ0 H;  1LP1 A;  2LR2 A;  1JEK A;  2QM8 A;  4AYC A;  4U7J A;  3HUS C;  1VQ5 P;  4CPG A;  1ZP0 C;  4ZKP A;  3O6Q B;  1IK7 A;  1R5S A;  1RF1 C;  3RL0 B;  1PFI A;  4BRY B;  4PD4 E;  3VTP C;  2FYU D;  3EFF K;  3ABV C;  3H1L J;  2Q3I A;  3A0B H;  5AVR B;  4ZKU A;  1J1D B;  2YO2 A;  3EFG A;  1BCC G;  4EYY Q;  1SQQ K;  1S9K D;  1N8R Q;  2HFE D;  3L74 J;  2QJP C;  2FYZ A;  1OVR A;  1KIL D;  1NH4 A;  1HGV A;  1LTS C;  4WB4 A;  2P7J A;  2NPS A;  2WT7 A;  2JKV A;  1OW6 A;  3AED C;  3B4S A;  3CCJ P;  1M1K Q;  1ZXG A;  1LTA C;  1WT6 A;  1NTM D;  1VQ4 P;  2OTK E;  1M7L A;  3A0B E;  1RHZ B;  1X9V A;  2FBW C;  3MTU E;  1XTG B;  1JCD A;  1PP9 E;  2OAR A;  1NTK K;  3LW5 J;  1BDD A;  1CI6 A;  1QVF O;  1L0N D;  3CX5 H;  2HYN A;  1IK9 A;  1NGM B;  1SQB G;  3L36 A;  1T3U A;  3AE5 C;  5AVW B;  2E43 A;  1RE4 C;  4N6J A;  4WY4 B;  3OJA B;  1SQX E;  1LNQ A;  2FYU K;  1BE3 D;  2IBZ E;  2QVA A;  2POH A;  4H13 C;  1JY2 P;  2W83 C;  4C7N B;  1L4A D;  1LGH B;  1OMI A;  1EXI A;  1GW3 A;  2FXO A;  4U3F E;  2KI7 B;  1NU1 E;  5AVX B;  1KD1 Q;  2M3E A;  3PJS K;  5EFW B;  1YYC A;  3EQ2 A;  1S72 P;  5APW A;  3HD7 A;  1PGQ A;  2WPQ A;  3W67 A;  3AE9 C;  4RKU J;  2J59 M;  3GF3 A;  1ZN5 A;  1PPJ G;  2IPP A;  1FAV A;  3L71 E;  3CX5 E;  4YTP C;  5B5E H;  1NTK J;  4TT3 H;  2YKP A;  5APQ A;  1MZ9 A;  1L0L E;  4H44 B;  4MN4 C;  2KP8 A;  1HH0 A;  1GU5 A;  3MZW B;  1ZW0 A;  5AVQ B;  4U3F J;  1MFT A;  1USD A;  2OYI C;  4PV1 B;  1AV1 A;  1VDF A;  1EZV I;  4JBZ A;  4WVZ A;  1FOS E;  4KHX A;  3I56 P;  3VMZ A;  2RN0 A;  5CCH A;  1PP9 G;  1KB9 D;  2O01 J;  1L0N K;  3AE1 C;  5KLV K;  1L0L J;  5KJ7 A;  2WTY A;  1T8Z A;  3BRT B;  3M0A A;  3F5H A;  5B5E E;  1OVU A;  2E74 B;  3TNU A;  4BXL A;  1N73 C;  1SQX G;  3B8E B;  4IOI H;  1SFC B;  2YMK A;  2IBZ G;  1URQ A;  2D2C B;  4NPD A;  1T2K C;  2ZVN B;  1KZU B;  1KOR A;  1ZRT E;  4U3F G;  1T6A A;  5KLI C;  2SPZ A;  1NU1 G;  4IFM A;  3FWN A;  1ZME C;  3CCQ P;  3AEC C;  3AEG C;  2R3C A;  1S5L H;  1WRG A;  2M5A B;  3CC4 P;  2JWA A;  1Q90 D;  1ZV8 A;  3L71 G;  1M56 D;  3PP5 A;  4DJG A;  3KQG A;  2Z5I A;  4H13 D;  1PZQ A;  1M57 D;  5KLV J;  3CD6 P;  1PGO A;  4IFD K;  1KYO D;  2V7Q H;  1OFC X;  5AVS B;  3AEE C;  1LTJ B;  1RF0 C;  4OGQ C;  4L76 A;  5TIS H;  1JMM A;  2AEJ A;  1X79 B;  3CWB E;  1MV8 A;  1LT9 C;  1NKN A;  1KMI Z;  3B5N B;  2N9B A;  3H1J D;  5AVY B;  1QL2 A;  3H32 B;  1QX8 A;  2QSI A;  3H1K J;  5KAF H;  2NZ2 A;  1NAF A;  1HF9 A;  3BAT A;  4I7Z C;  3GHG C;  2C9L Y;  4L74 A;  5AW6 B;  4DZO A;  3MIW A;  1FOS F;  1GTW A;  3G6E P;  3S4R A;  2BEQ D;  1QLE D;  2XND H;  1E5W A;  1KFM A;  2IX7 C;  1U7J A;  1J1E B;  4IL6 E;  2AXT H;  2A45 I;  5AW7 B;  1FZC B;  1LT1 A;  1AFO A;  1BCC D;  1EDL A;  1LWU B;  2IDB A;  2O01 N;  1T2K D;  4D6T E;  2YKQ A;  4BRY A;  1UII A;  4Z1M H;  1KIL B;  3AEF C;  1FZE A;  3CXH H;  1RQU A;  2CPB A;  2FFD C;  4RO0 A;  3HE4 B;  1JY2 N;  5AW5 B;  1VQ9 P;  5E79 E;  2OYH C;  3CWB G;  2ZYD A;  3AE4 C;  2LXB A;  3C8V A;  1X8Y A;  2KS1 A;  5APU A;  2A06 E;  3RBX A;  3WUU A;  1VQ6 P;  2J5U A;  1DEE G;  3G9R A;  5KKZ B;  2YMY A;  4OGQ D;  1HGZ A;  3L75 E;  4JYB A;  4C7R A;  3TGU D;  3BRV B;  3RK3 D;  1SLQ A;  4L75 A;  1Q86 Q;  3MD0 A;  1SQB D;  1JM0 A;  3CXH E;  5APS A;  3VMY A;  2E75 C;  2QJK B;  1KIL C;  2HOD B;  2KZI A;  1WMK A;  1P84 I;  1P84 D;  3R4Y A;  1SQV D;  3TK1 A;  2N1T C;  3AE2 C;  2O3J A;  1L4A B;  1GW4 A;  2FYN C;  3L70 G;  1M1J B;  1LTT C;  3L75 J;  3NMD A;  2O1K A;  3Q3D A;  2W6B A;  4UB6 E;  4D6T G;  2K37 A;  3RK2 C;  3FX0 A;  3P8M C;  1YBK A;  4WY4 A;  1RF1 B;  4KT0 J;  2KYV A;  1DEB A;  2XU6 A;  1PPJ D;  1VQ7 P;  1VQK P;  2OYO A;  4EI2 A;  1VQO P;  1Z56 A;  1NWQ A;  4PD4 H;  1YIJ P;  2WPS A;  4DOJ A;  1JY2 O;  1GL2 A;  4NPF X;  2A06 G;  2B87 B;  3Q2Y A;  2IYP A;  1RH5 B;  1D7M A;  2YKO A;  3BCC G;  3H1I E;  3H1L E;  1Y47 A;  3L75 G;  4A7P A;  1YQ4 C;  3LW5 H;  3L74 E;  1IZN B;  1M1J C;  3L4F A;  3WUT A;  1EDJ A;  3RL0 g;  1U57 A;  3PRJ A;  4HH2 A;  3CCS P;  2KOG A;  1KFN A;  1GMJ A;  3H1H G;  3L72 J;  1SQV K;  1H0T B;  2ZVO B;  3GLM A;  3H1I J;  1G1I A;  2WSS H;  3D6Z A;  3SFD C;  2JO1 A;  4JYC A;  2XNX A;  1NTZ K;  3M9Q A;  3MP7 B;  3VYI A;  3G71 P;  3CL3 D;  3GG2 A;  1S4X A;  1FE6 A;  3CCM P;  4UB8 E;  1S3J A;  2R44 A;  1SFC A;  2E75 D;  4AUW A;  2WSC J;  2NRG A;  3AE6 C;  3L71 D;  3CX5 D;  1SQQ E;  4H13 B;  3CCR P;  3TGU J;  2N1T D;  3V2N A;  3M0D A;  4LC1 A;  1X22 A;  5APY A;  1GZL A;  1OW7 A;  3USS A;  3KDP B;  3RK2 D;  2K9J B;  2M5A A;  4TLF A;  5CBN A;  3PLN A;  3H1I G;  3H1L G;  3L73 E;  2C9N Y;  1VQL P;  1JUN A;  1RY3 A;  2V4H A;  1N7S C;  1DD3 A;  1NTZ J;  4YXW H;  2O01 H;  2PFX A;  3L74 G;  1VQ8 P;  4HKZ H;  1SQQ J;  3AE3 C;  1MUU A;  3F89 A;  1LTJ A;  1AQ5 A;  3ITK A;  1S5L X;  3HE5 B;  3SWY A;  2OYI B;  1NTK E;  1FZA A;  1VQP P;  3NXS A;  1Q7Y Q;  5C39 A;  4IFF A;  1OZH A;  3B5N A;  1MKM A;  2YXQ B;  3L73 J;  3V2P A;  5DJU B;  3H32 A;  3A2A A;  1ZRT D;  3MUD A;  1RE3 C;  1R5L A;  3Q1M A;  2FYU E;  1SS1 A;  1FJP A;  1N73 B;  3V4W A;  1OW8 A;  1N2D C;  1AQT A;  1GK6 A;  1SQQ G;  2G3A A;  1T3J A;  2FKW B;  3D6Y A;  1IC2 A;  1MFZ A;  3QWO C;  5KLI B;  1FC2 C;  2WVR A;  5CCG C;  3I5C A;  3M91 A;  2E5Y A;  2KB7 P;  1NO4 A;  1YQ3 C;  1IFP A;  2QE7 H;  1NTM K;  2G8Y A;  2Q6Q A;  3IN6 A;  2W6A A;  3MHV A;  1LTB C;  2QRX A;  1FZC A;  2FYU J;  1YJW P;  3IFM A;  2PP6 A;  2BCC D;  3CWB D;  1LWU A;  3IF4 A;  4M3L A;  1LP1 B;  1KB9 I;  1GDT A;  1IFI A;  2IFM A;  2E76 C;  1VL2 A;  1XTC C;  1ZR2 A;  2L91 A;  4JPZ B;  1NVO A;  4OGQ B;  3HE4 A;  2AXC A;  1NTK G;  4K3A A;  2CK3 H;  3VP8 A;  4R4L A;  1L0N E;  2QJY C;  1LT9 B;  4L73 A;  3RK3 B;  2YO3 A;  1E79 H;  5KLV E;  2PGD A;  3L35 A;  2P10 A;  1N7S D;  3SWK A;  3NTN A;  1IFD A;  3P32 A;  1BDC A;  2H89 C;  3P8C E;  3H6P A;  3D70 A;  1SQP D;  1BE3 E;  2Q9I A;  1FDO A;  1NTM J;  3II6 A;  2AEF A;  5AW9 B;  1GD2 E;  1EDK A;  4I7Z B;  3L70 D;  3GHG B;  4N3Y B;  3W68 A;  3CMA P;  1L0N J;  1L0L G;  2QG4 A;  3Q5S A;  1SP4 A;  2K9Y A;  4D6T D;  1G1J A;  3H1K E;  5CHX A;  3CCU P;  1KYO I;  4HJG H;  2HOD A;  2R5D A;  3S9O A;  1L4A A;  3RBZ A;  2Y0C A;  1M1J A;  5GTI H;  1BE3 J;  2W8Z A;  3HUS A;  3RK3 C;  3TF5 A;  1OXZ A;  1G2C B;  2OTJ P;  1RF1 A;  4IL6 H;  4B86 A;  3TDK A;  1BGY D;  1BSH A;  1K05 A;  3BCC D;  4JF7 A;  5CCG D;  2YXR B;  4W80 A;  1EZV E;  3OAK A;  2ZT9 D;  5AW2 B;  2FFD B;  3IAO A;  1QL1 A;  1YJN P;  5K5G B;  2H8P D;  2QM7 A;  5TJH A;  2OYH B;  1DIP A;  5KLV G;  2P1J A;  3VMX A;  1W5C E;  4N78 D;  2B87 A;  2NPS C;  1BSN A;  4OH8 B;  2Y9Y A;  2E76 D;  1ZOY C;  5E79 H;  3CXH D;  1ZR4 A;  3HD7 B;  1Y8A A;  1IFJ A;  5GTI E;  1KTM A;  1JY3 P;  1SQP K;  1DH3 A;  2I1J A;  3H1H D;  1K04 A;  1KC8 Q;  2WMM A;  4GIF A;  3PH0 A;  4XE5 B;  2GA1 A;  3O6Q A;  1CW5 A;  1OIP A;  2KNC B;  1KQF B;  3H1K G;  1FS0 E;  2E75 B;  3CCV P;  2LXC B;  1KQL A;  2JP3 A;  3WMM 0;  2W90 A;  2IZ0 A;  1H0T A;  2KLV A;  2N1T B;  2XV5 A;  2FYN B;  3E1I A;  1JNM A;  2JDI H;  1HWT C;  1KYO E;  1USE A;  2RKL A;  3V2R A;  1RE4 A;  3RK2 B;  1AVO A;  3V2Q A;  3M9B A;  2W6J H;  2WWW A;  2H88 C;  1SQP J;  2H43 A;  1TU3 F;  2LKM A;  2KUB A;  3HD7 C;  4UB6 H;  2IYO A;  1EZV G;  3H1L D;  5APX A;  2XKM A;  3H1J E;  3H25 A;  2A45 H;  1EDI A;  3L74 D;  3AEB C;  1JTH A;  1HVV A;  2Y0E A;  2K9J A;  1H88 A;  2ZXX A;  4Y99 C;  2QIW A;  1YHQ P;  5BU8 B;  1JMB A;  1FZB A;  1LTI C;  3V5B A;  4PD4 I;  4W7Z A;  4PD4 D;  4GOF A;  2ZJS E;  1HJB A;  2JR8 A;  5CCH C;  2I1K A;  4OWF A;  2ZYA A;  3H1J J;  2NPS D;  1S2E A;  3HE5 A;  2OYI A;  4I1L A;  3T97 B;  1FZG A;  5KJ7 C;  3U59 A;  3E1R A;  4NPE A;  1RQV A;  5GTH E;  1PGJ A;  1BCC E;  4KJM A;  1AVY A;  2WSC H;  4C7N A;  1URQ C;  2R5B A;  4AQR D;  1SVF A;  3N7N A;  1N73 A;  2K88 A;  2CPS A;  1X0T A;  4GOD A;  3L72 E;  2WSF J;  2XZR A;  3AE8 C;  5AW4 B;  3UIA A;  1IO4 A;  3RGU A;  3A3Y B;  1ZLL A;  4UB8 H;  5H2F E;  3K5B A;  4LLH A;  5KTB A;  1PP9 D;  3PHL A;  2KIK A;  1BCC J;  3OA7 A;  5AW3 B;  1SQB K;  3VMA A;  1H89 A;  1IFM A;  2HLO A;  1S1C X;  4XA4 A;  1PIX A;  2PRR A;  1K9M Q;  1NTK D;  3TGU E;  1FBM A;  5M1B A;  1NOH A;  3HD7 D;  5CBO A;  1SQX D;  3CLQ A;  1SQB E;  2IBZ I;  4GDO A;  1N7S B;  2IBZ D;  1EC5 A;  2WSE J;  2C0W A;  2KSE A;  1Q82 Q;  3FGA D;  2AEM A;  3VP9 A;  4U3F D;  1RF0 A;  2OTL P;  1NU1 D;  2KXP B;  1YIT P;  1P84 E;  1SQV E;  2UWJ E;  2WPV B;  1VF5 C;  3CC2 P;  3FXE A;  1LT9 A;  3FWL A;  3FXD A;  1NTZ E;  1JTH B;  2A45 G;  3CX5 I;  1L0L D;  1SQB J;  2KS1 B;  5KAI E;  5CCH D;  5CJ4 A;  3U1C A;  1M8O B;  1PPJ E;  1NKZ B;  4RJT A;  1JY3 N;  3NFQ A;  4PJ0 E;  2RH0 A;  5KJ7 D;  3L72 G;  2VRS A;  1GK4 A;  3GHG A;  4R4M A;  2K1A A;  1SQV J;  2Q5U A;  2L5G B;  1LTG C;  1URQ D;  1M90 Q;  3QH9 A;  2KK7 A;  3A0H H;  2KSJ A;  3LID A;  3RL0 C;  3CCE P;  2ZT9 B;  4H0L D;  5CMZ A;  1K73 Q;  2W27 A;  5AVT B;  3TSI A;  3TGU G;  5BVZ A;  2IZ1 A;  4OVN F;  1SQX K;  1EXJ A;  1G2C A;  1YTZ T;  2YNY A;  1J1D C;  5KLV D;  1U7M A;  2P67 A;  3HRN A;  2E76 B;  2FY8 A;  1QVG O;  1N7L A;  2HPC B;  3L37 A;  3R2P A;  2Z4E A;  1NU1 K;  3P8C D;  4I2L C;  2FFD A;  1LJ2 A;  2FXP A;  3I55 P;  5L8R J;  1SQV G;  1DX7 A;  2OYH A;  3TYY A;  2QJY B;  1CSB A;  3JCU H;  2O1J A;  2FXM A;  2C0X A;  1NTZ G;  2B89 A;  1FZF A;  1S9K E;  3WUV A;  3HTK B;  1PP9 J;  3A0H E;  5AW0 B;  4YXD C;  1OX3 A;  1L0L K;  1JCC A;  1CZQ A;  4IL6 X;  3P7K A;  2P58 A;  1GL2 B;  2R3S A;  3H1K D;  2E42 A;  4W7Y A;  5AW8 B;  1KIL E;  1YTZ I;  2Y0D A;  2ZT9 C;  1VF5 D;  3CME P;  4K35 A;  1SQX J;  4HYT B;  1JY3 O;  4GOE A;  1AA0 A;  3CPW O;  2MKV A;  1QGK B;  3L73 G;  1VQM P;  1R8E A;  1KV4 A;  2KNC A;  3VN0 A;  1NTM E;  1NU1 J;  1KIL A;  5APT A;  3JCU E;  2K3R A;  4WY4 C;  2N1T A;  2OQQ A;  3VOP A;  1EZV D;  3BVH A;  1NYH A;  1DD4 A;  3JC2 2;  3M06 A;  3CC7 P;  3L71 J;  4Y28 J;  1L2P A;  2ITA A;  3N4X A;  1HJ0 A;  5AW1 B;  1A02 J;  1VPC A;  2Q7C A;  3CI9 A;  3WU2 H;  1GL2 C;  2R32 A;  3RL0 D;  2E5T A;  2FYU G;  3O8Z A;  3U1A A;  3SWF A;  3Q5R A;  3SFE C;  2KLU A;  2B9B A;  4H44 C;  3M9H A;  1NHL A;  2WT7 B;  2NPS B;  1KB9 H;  2J58 A;  2M0B A;  4JQ0 D;  3KZI H;  3EWK A;  4ZMD A;  2Z5H A;  4PV1 C;  2HR3 A;  1CI6 B;  2Q1K A;  1K8A Q;  3WU2 E;  1PL5 A;  1W2E A;  3T97 A;  2WQY C;  5BU5 A;  3ZDM A;  5AVZ B;  2A06 D;  2JWD A;  5B66 H;  1NTM G;  2M3B A;  2E74 C;  2OGU A;  4EDF A;  4EOT A;  2JEE A;  2BCC E;  3C9I A;  3PTZ A;  1NJI Q;  1OVV A;  1SFC C;  1KB9 E;  3L75 D;  2D2C C;  2N9Y B;  1NAY A;  1L0N G;  1EQ7 A;  1FU1 A;  3KZI E;  1KQG B;  1S5L E;  2H7H A;  3M0D C;  5APV A;  4ZNC A;  2M8R A;  1YI2 P;  3AE7 C;  1A02 F;  1H8A A;  2Q3E A;  3CXH I;  1PGP A;  3KYQ A;  2P2U A;  4O9B A;  1IFN A;  4EIJ A;  1KYO H;  4WY4 D;  1UIX A;  1BE3 G;  2WZ7 A;  2BCC J;  1JB0 J;  3CWB J;  3IR9 A;  3GF7 A;  3JSV C;  3D71 A;  5B66 E;  3G3Z A;  5TIS E;  1SQP E;  4Y99 B;  1HUC A;  3A7O A;  1J2J B;  4ASW A;  4RES B;  2I8D A;  2QA4 P;  1LTJ C;  3E7K A;  1GL2 D;  2GM4 A;  3L70 E;  1KN7 A;  2ZXE B;  2B88 A;  1N7S A;  4ASV A;  1GU4 A;  4C46 A;  4HB1 A;  3Q5P A;  1W2B O;  3KPE A;  4WWI A;  2QEX P;  4H44 D;  3B5N C;  2IFN A;  2XDJ A;  5AVV B;  5KAF E;  3KXD A;  2V7Q J;  3KHU A;  3MGN A;  3LIE A;  2YIU B;  3MUD C;  3L72 D;  2WSF H;  3V6I A;  1FJK A; 
#chains in the Genus database with same CATH homology
 3KQG A;  3TNU B;  3H32 A;  2Z5I A;  1H89 A;  1IFM A;  2HLO A;  4XA4 A;  3A2A A;  3MUD A;  1RE3 C;  1FBM A;  1FJP A;  1NOH A;  3HD7 D;  1N73 B;  4I6M C;  1URQ B;  3CLQ A;  4IFD K;  3V4W A;  3V4Q A;  1RE3 A;  1N7S B;  5CJ0 A;  5AVS B;  1N2D C;  1LTJ B;  1RF0 C;  2C0W A;  1GK6 A;  2WPR A;  1JMM A;  1T3J A;  4LGD E;  3VP9 A;  1X79 B;  1MV8 A;  2FKW B;  1LT9 C;  1NKN A;  1RF0 A;  1IC2 A;  1MFZ A;  2WIT A;  3B5N B;  1J1E C;  5CCG C;  1LT9 A;  2N9B A;  1SFC D;  3I5C A;  1FZC C;  3M91 A;  4N78 E;  5AVY B;  2KB7 P;  1JTH B;  1NO4 A;  1QL2 A;  2A45 G;  2WSE H;  3H32 B;  1LWU C;  2HG5 D;  1NTM K;  4GT1 A;  5CCG A;  2W6A A;  1LTB C;  1FZC A;  3IFM A;  2PP6 A;  1LWU A;  4M3L A;  5CCH D;  5AVU B;  5CJ4 A;  3U1C A;  1NAF A;  1GDT A;  1IFI A;  2IFM A;  3BAT A;  1NKZ B;  1JY3 N;  3GHG C;  3NFQ A;  2C9L Y;  5KJ7 D;  5AW6 B;  2JJL A;  2PAJ A;  1XTC C;  1GK4 A;  2VRS A;  3MIW A;  4DZO A;  1ZR2 A;  1FOS F;  1GTW A;  3GHG A;  3HUS B;  3HE4 A;  2BAS A;  2HPC A;  3VP8 A;  2Q5U A;  1LT9 B;  2L5G B;  3RK3 B;  2GUV A;  2YO3 A;  2GUS A;  1E5W A;  1KFM A;  2IX7 C;  3L35 A;  1LTG C;  1URQ D;  3BAS A;  1J1E B;  1N7S D;  2A45 I;  2KSJ A;  3LID A;  5AW7 B;  3NTN A;  1IFD A;  1FZC B;  3RL0 C;  1AFO A;  3P32 A;  2ZFC A;  5CMZ A;  1LWU B;  2W27 A;  3HTK A;  3P8C E;  1T2K D;  3H6P A;  5AVT B;  1N86 A;  3TSI A;  4GKG A;  2YKQ A;  2Q9I A;  5BVZ A;  1SQX K;  3II6 A;  1G2C A;  1YTZ T;  2MJZ A;  2YNY A;  1J1D C;  5AW9 B;  1KIL B;  1JOC A;  3B5N D;  4WBA A;  3A5T A;  1FZE A;  1GD2 E;  2P67 A;  3HRN A;  1FDM A;  2CPB A;  1JO5 A;  3GHG B;  4N3Y B;  2FFD C;  3HE4 B;  1JY2 N;  5AW5 B;  1IJD B;  1N7L A;  2HPC B;  3L37 A;  3R2P A;  2Z4E A;  1HTL C;  1SP4 A;  2OYH C;  1NU1 K;  3P8C D;  4I2L C;  1G1J A;  2FFD A;  1HBW A;  5CHX A;  1X8Y A;  1L4A C;  1OWA A;  5APU A;  1DX7 A;  2HOD A;  2OYH A;  3TYY A;  1CSB A;  2QM8 A;  4AYC A;  2O1J A;  2FXM A;  2R5D A;  2C0X A;  3HUS C;  1L4A A;  1FZF A;  1S9K E;  4ZKP A;  3HTK B;  1M1J A;  5AW0 B;  1JCC A;  1L0L K;  2YMY A;  1CZQ A;  3RL0 B;  1RF1 C;  1HGZ A;  3HUS A;  3P7K A;  1PFI A;  3RK3 C;  1OXZ A;  4JYB A;  3VTP C;  1G2C B;  1GL2 B;  4C7R A;  2E42 A;  3BRV B;  1RF1 A;  3RK3 D;  4W7Y A;  5AW8 B;  1SLQ A;  4B86 A;  2Q3I A;  1YTZ I;  3MD0 A;  5AVR B;  4ZKU A;  1J1D B;  2YO2 A;  3EFG A;  4JF7 A;  5CCG D;  4W80 A;  3OAK A;  4HYT B;  1SQQ K;  5APS A;  1S9K D;  1JY3 O;  5AW2 B;  3VMY A;  2FFD B;  2HFE D;  1QL1 A;  1KIL C;  2H8P D;  2HOD B;  2QM7 A;  2OYH B;  2FYZ A;  3TK1 A;  2P1J A;  3VMX A;  2N1T C;  1L4A B;  1GW4 A;  3VN0 A;  1KIL D;  1KIL A;  1NH4 A;  4N78 D;  2NPS C;  1M1J B;  1LTT C;  5APT A;  4OH8 B;  1HGV A;  1LTS C;  3NMD A;  4WY4 C;  2N1T A;  2O1K A;  3VOP A;  1ZR4 A;  2W6B A;  3BVH A;  3HD7 B;  4WB4 A;  1IFJ A;  2NPS A;  2P7J A;  1JY3 P;  2WT7 A;  1SQP K;  3RK2 C;  1DH3 A;  3M06 A;  3P8M C;  4WY4 A;  1RF1 B;  2I1J A;  2KYV A;  1DEB A;  2XU6 A;  4GIF A;  3N4X A;  5AW1 B;  1LTA C;  1WT6 A;  4XE5 B;  1M7L A;  1Z56 A;  1A02 J;  1VPC A;  2Q7C A;  1NWQ A;  1X9V A;  3CI9 A;  3MTU E;  1GL2 C;  1XTG B;  1JCD A;  2R32 A;  3RL0 D;  2OAR A;  1NTK K;  1CW5 A;  2WPS A;  1CI6 A;  4DOJ A;  3O8Z A;  3U1A A;  1KQL A;  1JY2 O;  1GL2 A;  2HYN A;  3WMM 0;  3SWF A;  1IK9 A;  3L36 A;  2YKO A;  2KLV A;  2N1T B;  3M9H A;  2XV5 A;  1NHL A;  1T3U A;  3E1I A;  5AVW B;  1JNM A;  2WT7 B;  2NPS B;  2E43 A;  1RE4 C;  4N6J A;  2J58 A;  1HWT C;  4WY4 B;  3OJA B;  2FYU K;  3LW5 H;  3V2R A;  1RE4 A;  3RK2 B;  2POH A;  3V2Q A;  1M1J C;  2Z5H A;  1JY2 P;  3M9B A;  2WWW A;  3L4F A;  4C7N B;  1L4A D;  1LGH B;  2H43 A;  1GW3 A;  2LKM A;  3HD7 C;  4HH2 A;  5AVX B;  5APX A;  2KOG A;  2XKM A;  1YYC A;  3EQ2 A;  1CI6 B;  5APW A;  1KFN A;  3HD7 A;  1W2E A;  2WPQ A;  3T97 A;  2A45 H;  1SQV K;  2J59 M;  1ZN5 A;  5BU5 A;  1G1I A;  2IPP A;  1FAV A;  5AVZ B;  1HVV A;  4JYC A;  2M3B A;  2XNX A;  1NTZ K;  3M9Q A;  1H88 A;  4Y99 C;  2YKP A;  3VYI A;  4EOT A;  5APQ A;  1MZ9 A;  2JEE A;  3CL3 D;  3C9I A;  2KP8 A;  1SFC C;  5BU8 B;  1HH0 A;  1GU5 A;  1FZB A;  1LTI C;  3V5B A;  4W7Z A;  1EQ7 A;  5AVQ B;  1FU1 A;  1SFC A;  1HJB A;  2H7H A;  3M0D C;  4AUW A;  5APV A;  2M8R A;  2OYI C;  5CCH C;  2I1K A;  1A02 F;  1H8A A;  2N1T D;  1VDF A;  1FOS E;  3KYQ A;  3V2N A;  2P2U A;  3M0D A;  4KHX A;  4O9B A;  1IFN A;  4EIJ A;  4LC1 A;  5APY A;  2NPS D;  3VMZ A;  3HE5 A;  2OYI A;  4I1L A;  5CCH A;  1FZG A;  5KJ7 C;  4WY4 D;  1GZL A;  1L0N K;  2WZ7 A;  3U59 A;  3KDP B;  5KLV K;  3RK2 D;  5KJ7 A;  2WTY A;  3IR9 A;  1T8Z A;  2WSC H;  3BRT B;  3M0A A;  4C7N A;  3G3Z A;  3TNU A;  2C9N Y;  4Y99 B;  1HUC A;  1N73 C;  3A7O A;  1JUN A;  1J2J B;  1URQ C;  1RY3 A;  4RES B;  2R5B A;  1N7S C;  4AQR D;  3B8E B;  1SVF A;  1SFC B;  1LTJ C;  1GL2 D;  2O01 H;  2GM4 A;  3N7N A;  1N73 A;  2CPS A;  1URQ A;  3V2P A;  2ZXE B;  1T2K C;  2XZR A;  1MUU A;  1N7S A;  5AW4 B;  1GU4 A;  1LTJ A;  1KZU B;  4C46 A;  3UIA A;  1AQ5 A;  1IO4 A;  3KPE A;  3HE5 B;  3A3Y B;  3SWY A;  2OYI B;  1ZLL A;  3B5N C;  1FZA A;  4IFM A;  3NXS A;  2IFN A;  2XDJ A;  5AVV B;  4LLH A;  5KTB A;  4IFF A;  2R3C A;  1WRG A;  3MGN A;  3LIE A;  3OA7 A;  3B5N A;  5AW3 B;  1SQB K;  1ZV8 A;  2WSF H;  3PP5 A;  1JTH A;  1FJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...