2ZYDA

Dimeric 6-phosphogluconate dehydrogenase complexed with glucose
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
464
structure length
464
Chain Sequence
b'KQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
total genus 169
structure length 464
sequence length 464
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zydA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zydA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zydA01
1P3DA 2HKIA 3D1LA 2X8LA 4RVFA 4R3WA 3FR7A 1ZSYA 5AXAA 3CH6A 2NSDA 4XWYA 2AMFA 1ID1A 3VPFA 2O7QA 3DQPA 3T7EA 4MVJE 1OBFO 4IUYA 5C7LO 2EHDA 3KSUA 1EQUA 2C5AA 4FJ2A 5DULA 1E7SA 1ZJYA 2I99A 3PHHA 4DYVA 2FPGA 4R54A 3MEQA 1LDMA 3W6ZA 1KEPA 1VJTA 2PD3A 1DO8A 4EEXA 3QHAA 4M1QA 3M2PA 5A04A 4B4OA 2UVDA 1WZIA 3RFTA 2FWMX 2UDPA 5L40A 4JIGA 2V7PA 2RH4A 2P9GA 1PWZA 1PJ3A 2Y0EA 1YQXA 3R6DA 4DTIA 3OECA 2C2YA 3WBBA 4F6CA 1V3VA 1O89A 5TJHA 1Q7GA 1EMDA 3SC6A 1HDCA 1JAXA 2EGGA 4DMLA 3GOHA 1MFPA 2OORA 1X15A 3WGIA 1EBUA 3C7CB 2FZWA 3LVFO 4PZDA 3N7UA 4L8VA 3R0IA 4DBZA 2WD7A 5KVSA 4FFPA 2PGDA 1E3EA 1XELA 2B35A 4EZBA 1X0VA 3OJEA 3OM9A 1V35A 4WCFB 1KVTA 1F0YA 2Y05A 4UVHA 3OP4A 1HRDA 4PZCA 1ZW1A 4II2A 1R4NB 5TX7A 3RKUA 4IQ0A 2EEZA 3A06A 5TLSA 2HK9A 3RASA 2EWMA 4FFRA 4LSMA 2W2LD 2FY8A 3KOUA 3ZW8A 5JC8A 4EUHA 3DONA 4U5QA 3CEAA 5B4VA 2FR0A 2GZ3A 3WB9A 4CM1A 5IZ4A 4RDIA 5LDHA 3OJFA 4ZVVA 3KLMX 3DFUA 5BR7A 2DBVO 3DOOA 4MO2A 4W7HA 1XQ1A 1ZUD1 1L7EA 2BI8A 2IEBA 4H16A 4IPTA 4E2WA 4D44A 1NAIA 4L76A 4XDZA 1PR9A 1FDTA 3TSCA 3L9WA 1F14A 1KERA 4OXYA 5A1TA 3GPDG 2GPTA 2XF8A 3LC7O 3OICA 2YHIA 2Z1MA 4BNYA 2NU6A 1PL6A 4XQGA 3BMOA 1U28A 4P8RA 5CDYA 1IPEA 5G2OA 7ADHA 1B0AA 2VWHA 2C2XA 5CDSA 3ZWBA 2X5KO 3ZWPA 1IL0A 1XU7A 2JAPA 1ZZEA 2PKQP 2R6JA 3EYWA 1U4OA 3ZU3A 1PGPA 1YOVB 5IDYA 2VYND 4BKRA 1UH5A 1P9LA 1RM0A 1UUFA 3PQDA 4FJ0A 4DLBA 3IP3A 4XIYA 2LDBA 4O59O 4P38A 4YWJA 4RZIA 4ZICA 1R37A 3VPGA 2FN7A 5TIIA 3NUGA 5HA5A 3E9MA 1QMGA 3MTJA 5ES3A 1BTOA 4GGPA 1H6AA 4HKTA 1T2FA 3BMNA 1MP0A 3PYMA 4KWIA 4RF3A 1EFLA 3TFQA 4DC1A 1YKFA 4MVJG 4XRRA 2QRJA 2I5PO 5CHEA 4KP7A 1LRKA 4WGGA 2Y1OA 4I5GA 2DTDA 3K73O 5GY7A 3W1VA 5FEUA 3B1JA 1I32A 5IFLA 1Y8RB 3ZWMA 4KUHA 2Y1GA 4PFJA 5ICMA 3ROKA 2IRWA 5JCXA 2QZ9A 4G81A 4HX5A 4NPCA 2VZ0A 1Q0LA 3AUAA 3KB6A 2O48X 5AOVA 1GADO 4D45A 4K1LA 3BHJA 1EK6A 3S2IA 3FTNA 3PWZA 2WYVA 2DPHA 4FBGA 3TZ6A 1NR7A 4QFCA 5TC4A 3WGYA 5I9LA 5DBGA 4Y9DA 5G4KB 4WECA 4BNUA 1K3TA 3H7AA 1C3VA 4CV2A 2DBRA 1P1JA 1UXIA 3GUYA 1GPDG 1YRLA 2IZ1A 1DDOA 3EDMA 1ZIDA 4YJFA 1DLIA 1VSVA 3HJAA 4E13A 3LDHA 4UVIA 4HNHA 2NVWA 4CMCA 4WCFC 5JFOA 4PCVA 4XB2A 5DBIA 4BNHA 3W4IA 1E3JA 4CLOA 5HS4A 4CMHA 4IXTA 2PNFA 4NK5A 4B79A 5FYDA 4YAJA 3JCZA 3JYNA 4WEOA 1HETA 4BO2A 3N58A 1AVYA 4JN6B 4BNFA 4ND2A 1AE1A 4RF2A 3CINA 2WYUA 4JBHA 3GVXA 2Y66A 1C0IA 3GPIA 4XGKA 3RC9A 3UCEA 3PGJA 4B3HA 1ZK3A 4BNXA 1UJMA 5JAIA 4CM7A 3WSWA 5A3JA 3C3XA 3LT2A 1OZAA 3UICA 3L6EA 3PDJA 1NX6A 3WQQA 2R00A 5CDUA 1BXZA 4ZD6A 3ZCXA 5JXWA 1IYZA 2Q2QA 1ZK1A 2PH3A 2NUAA 1Q2XA 3ADOA 1YONA 2JCYA 2VT2A 4MVJI 3TPCA 3WWYA 4FW8A 2D1YA 1H6CA 1KVQA 2X22A 1NPYA 2NM0A 1E6EA 1IE3A 1GUFA 4OSPA 4YQYA 3P2YA 4J6FA 1TT7A 2NNLD 5U1PA 3UN1A 1WAMA 5BSHA 3SX2A 1DIHA 4D0SA 1PGNA 3CIFA 4I5FA 4W9NC 4L4SA 3RBXA 3WTBA 1M6WA 4BNGA 1I36A 3LT0A 2WTBA 2C82A 2W4QA 2CD9A 3C85A 5I9MA 4WPGA 2VWGA 3E9QA 2V6MA 4CMAA 4E2YA 1NQOA 1MFZA 4CMEC 3HADA 3I9JA 1I0ZA 3RAJA 3TJRA 4PLWA 3TN7A 4JP2A 3HB4X 1CWUA 4UUOA 2AEMA 3DAGA 3V2HA 1QLHA 2D0IA 2X0IA 3PFWO 3H5RA 5TQVA 3S8MA 4NBUA 4NBVA 1HEUA 1WMBA 3B1FA 1I3LA 2H63A 3NT4A 3DL2A 5KKCA 4BO0A 3PXXA 3LK7A 4YT8A 3WGQA 3KSDO 1C1XB 2GERA 1QKIA 2OBYA 1P31A 4FDAA 4MIEA 2DM6A 4CM8B 2GF2A 3W8FA 4GQAA 4IS2A 1UAYA 1RYEA 1RPNA 2ZTVA 2Q1TA 4FS3A 1P1RA 1DAPA 3F6YA 4UUNA 1TB4A 2P9EA 3SLGA 4PLGA 2VHZA 1PL7A 5JAZA 2W2KB 2VRCA 3RU7A 3HHPA 4PLZA 4WLUA 3CUKA 5F21A 2GR9A 3GG2A 1Q0HA 4OGWA 1EZ4A 2J5QA 1UDCA 3DBLB 5JAQA 3E82A 3EUWA 2HK7A 1IOLA 1F8FA 4FOSA 4LCJA 4TZKA 1EVZA 3ROQA 4K6CA 1Z74A 1MG5A 1LDGA 4OMUA 5IXSA 4FFMA 5JBIA 2PA3A 1SCUA 4L9RA 4WJZA 4DYDA 1R6DA 3S2GA 3VH1A 3HB5X 3KYCB 1CDOA 2G17A 1TT5A 4UEJA 5AXDA 1NM5A 4KTTE 4NFYA 2FPIA 4K26A 4ZU3A 4OHUA 1ZBQA 4W4TA 2IYOA 3DXFA 3WR5A 3U0BA 5CEFA 1Z45A 3GF4A 1HYEA 1OOEA 1BVUA 3UFXA 3GT0A 4IQ8A 4RZHA 1HZZA 4J4HA 4DIOA 3V1UA 5KNLA 4CLHA 4OIMA 3ZU2A 4GLLA 3VC7A 2POQX 4J1QA 4BNKA 4DXHA 4CMIA 4EW6A 2Q4EA 3WGHA 2D59A 2ZYDA 2PKQO 1U8XX 2XXBA 3AUTA 3T4XA 1A72A 1ADCA 1HE4A 2ILTA 2VUUA 4L74A 3NX4A 3K92A 4M8SA 3JD1A 4U0JA 4AJKA 2EG9A 4YAGA 4E5MA 3DBLA 4XGIA 3CTVA 1FXSA 4R1UA 1C14A 2CDCA 3ZN2A 2VTEA 9LDBA 3HFSA 3Q0EA 1PEDA 5K6AC 3HE3A 1E0DA 3O38A 3U9LA 3A28A 4E12A 1T2DA 1U7TA 4JJFA 1TT5B 5K0ZA 3QA9A 1HE5A 3HNPA 4WCFA 2Q1UA 4UVEA 2WM3A 1OFGA 2ZIZA 4B3IA 1MX3A 1SMKA 4PG4A 3VZPA 5HWSA 3ZWXA 4CMGA 4F46A 4EJ0A 5KWEA 4IZIA 2VOEA 3F47A 1R4NA 3OIDA 3SJUA 2YZ7A 5AXBA 3O4RA 2B5VA 1DSSG 2ET6A 1B8UA 3C7AA 4ND5A 3AOGA 1HL3A 1O94A 5T5QA 4MPDA 4YRBA 4RGBA 5T67A 3MJEA 4BO6A 4ZGWA 1LLDA 1I01A 2EKLA 3Q1LA 3T7CA 1B8VA 3U49A 1BMDA 2CNBA 3PHJA 3QVSA 2FZEA 5EERA 5LDGA 4EBFA 3ZHBA 2DTEA 5MDHA 1J49A 1DC6A 4O5OA 1BXGB 2DFVA 4UVDA 3EVTA 3NT2A 4C7JA 2BGMA 4EEZA 1N9GB 4NHEA 1XG5A 1LU9A 3W4JA 5F1OA 5G4KA 4M55A 4B7XA 1I8TA 3IS3A 3RQSA 3AK4A 1PU2A 3MJSA 5KTKA 1TVEA 2BF7A 4OO3A 3BMQB 4IXWA 4QXMA 4NQZA 1E7QA 3U4DA 1U3UA 2Q45A 4NIMA 3MZ0A 3OH8A 1NXQA 3S1LA 3NTRA 4YBZA 3S55A 1E92A 1PJ4A 3ENNA 3VPXA 2ZJ1A 4WLOA 5LC1A 4AVYA 1E1KA 2EF1A 4JCOA 1WDKA 1B15A 1UAGA 1GY8A 1DRUA 1PJCA 4A10A 4B8ZA 3AWDA 3QWBA 2YQ4A 1UXKA 1JKJA 1LSUA 4F6LA 3I9OA 5EQDA 2BHLA 1IHXA 1XGKA 2CUKA 2IEDA 2ZCVA 1KIFA 5CEEA 4TVOA 2HK8A 5EN4A 3CTMA 1N7HA 1HSOA 3GZ4A 2WDZA 4DL9A 3GY0A 2D4AA 2X0NA 4CM6A 5BSGA 4XYBA 3RC7A 3UKOA 2Y68A 4ONEA 5CP8A 3WJAA 4XX0A 1OI7A 2HUNA 3IAHA 4ZQHA 2BI7A 2W98A 4IZHA 4E32A 3DMTC 3RU9A 1N7GA 3LLVA 4CMEA 3JQ8B 5I7FA 2AQ8A 1DC5A 3HZZA 4PRLA 4NG5A 4NBRA 1IHYA 3ZV6A 4N5NA 4U6QA 4YRAA 3WOHA 5KJCA 3P7MA 1ZCJA 2IZZA 1VJ1A 4BNVA 1SO8A 3DZBA 3KEQA 4L73A 4Q3CA 4QFDA 3ZWWA 4LK3A 4YAKA 1NBOA 3PQEA 4Q3DA 3MTGA 3U3XA 5THKA 4PLTA 5DP2A 4CM9D 2AW5A 4H3VA 2I3AA 1DEHA 3G0OA 5EESA 4MIOA 3JQ6A 1UP4A 1PL8A 4YR9A 1A4UA 4HWKA 1NAYA 1HYHA 4MVJF 4GLOA 2IYPA 3ETGA 4LISA 3PHGA 2HLPA 1BWSA 2NQ8A 2WSBA 2X9NA 3VZRA 1YWGO 1B26A 4IS3A 2WMDA 3QW2A 3U4IA 4IDAA 4BKUA 2PKRA 3E9NA 4LVUA 2AEFA 3JQFA 4CM4A 1W8DA 2W2KA 2IXAA 2HMWA 3ASVA 3UF0A 1E7WA 4NH4A 3RI3A 4YXFA 1E7YA 4DVJA 4Z3DA 4BVAA 3IOYA 1DRWA 3AY3A 1W0CA 4Q3NA 5HRUA 5A9SA 4CQMA 1LA2A 5IN4A 2GGSA 1LTHR 2B4QA 3WLEA 4ND4A 5TF4A 3A9WA 3DHNA 2AQIA 2H5LA 3GUCA 4LMRA 3EZYA 1ADFA 3K2BA 2Q2VA 4TMFA 3I6IA 4DQVA 4K9DA 3HDQA 4FGWA 3PWKA 4IDGA 1P74A 4R5MA 5L4NA 4AJ1A 1VJ0A 5L51A 1TLTA 4NK4A 4IMPA 4R41A 1JDJA 1I10A 4F45A 4Y8VA 3AU9A 2JAHA 3BMCB 2HQ1A 3ICPA 2EIHA 3WLFA 5I7EA 1CYDA 3GRPA 1NQAO 1AA0A 2DUUA 3ANMA 4ALIA 4FFLA 3V1TC 2X58A 1SOVA 3NV9A 2CF6A 3JD2A 1MXFA 2ZATA 4FJ1A 4ESOA 4W7IA 4BO7A 5C37A 2DFDA 1BXGA 5K9ZA 4GKVA 1C1DB 2AE2A 2X9VA 3AY6A 4W82A 1DRVA 3TF5A 3OHSX 2E4AA 1NFQA 3UCFA 1W4ZA 3AFNA 1QP8A 3Q9NA 4FC7A 1NVMB 5COQA 3RCBA 1YH3A 4FFNA 3H2SA 2VHWA 3CMMA 3D3EA 1KEUA 4J90A 1D3AA 3SXPA 1GYPA 1AGNA 1BG6A 4M89A 4I9NA 2FMUA 4BIIA 1MXHA 1H6BA 4BUCA 3FWNA 2GO1A 4HFJA 1JLLA 3INRA 3R3SA 1H5QA 1TEHA 2SCUA 2J3KA 4Z9FA 1E6WA 4NJOA 1EVIA 2X5OA 3WIDA 2V6BA 3MOIA 5DP1A 3DBHA 1M2WA 1A9ZA 2CY0A 1Y81A 5KKAA 3GN1A 3T4EA 2RAFA 3BHMA 4O0LA 4E6PA 4C7KA 1N5DA 3KYCA 3GQVA 4G2NA 2JD2A 4AICA 5IJZA 5CDTA 4R4JA 1DFHA 4ROSA 3OBBA 3TWOA 2YHIB 3BMQA 2CZCA 4QECA 1TI7A 2IXBA 2ZB4A 4NJMB 5CDGA 1CERA 3H8VA 2QQ5A 4NJMA 2NTJA 4Z6KA 4MOWA 3KO8A 1SB8A 3PTZA 1T1SA 4E5PA 3ZI0A 3GK3A 4RLHA 2HU2A 2A92A 2YJZA 4PLHA 3I3OA 2ZYAA 1B8PA 3JTMA 3RIHA 1UXHA 4BO4A 1Y8QA 1VL0A 5ENVA 4YQZA 3ZV3A 5JO9A 3BZUA 4W99A 1VKOA 3VPSA 3JYPA 4INAA 5C7IO 4IY1A 1K0UA 1JWAB 6LDHA 3Q3CA 3L9XA 5COBA 1HYGA 4H7PA 3GNSA 3PRJA 3TNLA 3EC7A 5A9TA 5A3VA 1RKXA 3SVTA 5CAEA 1MB4A 3CXRA 1XU9A 2AG8A 4ZQGA 1OX3A 3K31A 4J1NA 3Q9UA 4WLFA 4BNMA 3VVCA 3RUCA 1I30A 1H9BA 3GAFA 2Y0CA 2X86A 4P4GA 1PJQA 1ZMTA 5L7WA 4TROA 2O7SA 2ZB3A 3P2OA 2IE0A 3E03A 3IUSA 3JQBA 3H5NA 2YDXA 5G0UA 3WQSB 3K5PA 4D0RA 4YAIA 3D3WB 1Y5RA 1HDZA 4A73A 3RKRA 4P22A 1PQUA 1VC2A 1ZK4A 5A5EA 3D4PA 1XCBA 2OO5A 1GFSA 3DTYA 5A9SB 4CQMB 1J0XO 4MP6A 3O8QB 2RH8A 4J2OA 4IJVA 4PGFA 5B37A 1VRWA 2VHXA 1SPXA 4LN1A 2WE7A 1M75A 3GMDA 4BGEA 4YJDA 4OSOA 2V65A 4PLCA 3PJDA 1X7HA 4B4UA 3IIEA 1SZJG 1Y7TA 4J43A 4M54A 1HT0A 4GKBA 4Q9NA 2A9FA 3MJVA 4WE3A 1NVTA 4AJPA 3JQCA 5IDXA 1HLPA 4ILKA 3VDRA 3QIVA 3NJ8A 1A4IA 3ETDA 4YCAA 5T8KA 4NNJA 5CFZA 1NFFA 4JX8A 1L1FA 4CPDA 1ZO8A 1HDYA 4AJLA 2E6UX 1Q1NA 3DO5A 1YQDA 3WS7A 3K96A 1DJNA 1L7DA 3JV7A 3WGGA 4E0BA 4AJ2A 1LBEA 2EJVA 2GNAA 1E3SA 2CMDA 4R1SA 2VCYA 2UV8A 1DC3A 4JK3A 3ANLA 4E31A 1OC4A 9LDTA 1ENPA 1T1RA 2VYNA 3D5QA 3VVBA 3WJ7A 3ZW9A 2XPCA 3OA2A 2D3TA 4FGSA 1ENZA 2GZ2A 4JQCA 3WMXA 4ALNA 1ISFA 2C5EA 4OQYA 1ULSA 3NGXA 2BRUA 4RCVA 5JAMA 2Z5LA 1EUZA 1JU9A 1IZ9A 1NASA 4DPKA 3I83A 4YACA 3WIEA 3B20A 2TMGA 3DR3A 3RBZA 4BL5A 3LZ6A 2NU7A 3ZNPA 4D3DA 4HBGA 1EFKA 4DBVO 1JAYA 3PI7A 1P1FA 1AXGA 3GZNA 3QWFA 4J16A 3A14A 1XYGA 5L7YA 3RD5A 1W73A 1XIVA 2VHYA 3PP8A 4BO1A 4AL4A 2OXIA 1U3VA 3DFZA 1E1LA 4A5OA 1SEVA 1A7AA 4Q39A 4RVHA 3UCXA 1VLLA 1R0KA 3K9QO 4UEOA 3GNTA 2Y1DA 1MGOA 1I3KA 1NFRA 3E5RA 2XAAA 3GR6A 2NQTA 3EHEA 4BQRA 3D64A 1EQ2A 4MIYA 1MA0A 2J5KA 2PH5A 2Q4BA 2VN8A 4WNCA 2VOJA 3BAZA 3C1AA 2DTXA 2UUPA 4D7AA 3WDSA 3WYEA 3KXDA 5TNXA 1R12A 3JQAA 1FJHA 2QW8A 4DUPA 2A94A 5G0VA 1HWYA 4XYEA 3CPSA 3NKLA 2W90A 5EIOA 5IN5A 2D5CA 4E5KA 4CL8A 1ENOA 5B1YA 3HN2A 4DLLA 2J6IA 3QVXA 4W6ZA 1EVJA 4B4VA 4AJHA 2ZB7A 1PQPA 3Q11A 2VT3A 2D8AA 1MLDA 3F46A 3RUHA 2Y1EA 3KETA 1T2AA 4EJ6A 5A9RA 3LC1O 3AM4A 3H3JA 4OOFA 5BSEA 1AHIA 2NVBA 1IULA 1Z6ZA 1U9JA 3GFGA 5A5FA 3GMSA 1KY4A 1E1NA 3PVZA 4EGFA 4DIBA 5U9CA 5THQA 4AG3A 1P1KA 4PIVA 4Q3EA 1P0FA 1T24A 4BKPA 3GDFA 3KV3O 2FPPA 4BO3A 3FN4A 4RO0A 3CKYA 3I9MA 1NWHA 4ALKA 1ZK0A 5L53A 3W8DA 2AA3A 3VZQA 5IDQA 2PZJA 2G5CA 1V6AA 3VKVA 5KVQA 4IINA 3AUUA 4WNIA 3CE6A 3GA0A 1UR5A 3EMKA 2X5JO 4XEHA 2LDXA 4D41A 1U5CA 1FDVA 4YT5A 3ENKA 3NRCA 5BSFA 3JSAA 4XCVA 1T25A 1U5AA 3QWHA 4FFOA 4L75A 1K89A 1NHWA 2RIRA 5C7OO 4O6VA 2EW2A 3SBOA 4QX6A 4IDBA 1B3RA 4EJMA 3DHEA 3D4OA 3DOCA 5L9AA 1SB9A 1GQQA 3FCOA 2QG4A 1Y9EA 1Z82A 4YRDA 3UAGA 3FTPA 2DBZA 4CLRA 3PJEA 2P4HX 4PLVA 4ZQEA 3E8XA 3BTSA 3JQ9C 3NEPX 1T26A 4OYRA 4Q3AA 1ONPA 1ZXLA 3ZWVA 5IF3A 1B7GO 3GNQA 5FFFA 5F3RA 1ORRA 3LF2A 3ZH2A 3WTCA 1V8BA 1PS8A 1PS9A 2I9PA 4GAEA 1LUAA 1WWKA 2GASA 3BYZA 3OMLA 4KTVE 1Y9AA 3JQDA 4N18A 4ZQBA 1Z73A 3FF4A 4ALLA 4NZ9A 2C59A 3H9GA 5G4LA 3BTVA 1WMAA 4R3NA 3WX0A 3ZWNA 5EL0A 5ER6A 1QORA 4DPLA 3S2FA 1YBVA 3KSZO 1NQ5A 4R16A 4CJXA 2Q3EA 3IDSA 4LGVA 4BNWA 5KOIA 2E48A 4PRKA 1DIRA 1PSDA 3I52A 4EI2A 3ONDA 2IZ0A 2VZ8A 3NDRA 2W8ZA 4DQXA 2YUTA 3HDYA 3WWZA 4GI2A 3M1AA 4CL3A 4I9HA 1GL3A 2YW9A 3ORFA 4TSKA 2B4TO 4B8WA 4BB5A 4RJTA 8LDHA 1HKUA 5IG2A 4RF4A 1UXGA 1QSGA 3I5MA 4GSLA 2VUTA 1P1IA 1ZMOA 4UEKA 3PLRA 2BFMA 2GN4A 3GHYA 4MVJD 3JQ7B 2B5WA 1LDEA 2C0CA 2FOIA 1N1GA 4J2HA 4YT2A 1NPTO 5GMOA 5L3ZA 4OKNA 1XA0A 3GH3A 4Y98A 4XIJA 1IZ0A 2A4KA 2P2SA 1LJ8A 1D8AA 1CQJA 4YB8A 2B69A 1GCUA 1P44A 5F1KA 4BKOA 1ISGA 3F1LA 1KOLA 4CV0A 2NU8A 3E18A 3ZZNA 4ID9A 2OZPA 2ZTLA 1HDOA 5ICSA 2GCGA 2VYVA 3VDQA 4PG6A 1WPQA 4RVSA 1QYWA 2CDAA 3BTOA 3C8MA 4PG7A 2P4QA 1Y6JA 3INTA 3PYLA 1LSJA 4E21A 2B4RO 4U6SA 5JNLA 3D5TA 1U7HA 3JQ7A 1ADGA 4BB6A 2W2LA 3EVNA 4FR5A 3D3WA 3TL3A 3EY4A 1M76A 4BOYA 1M6HA 1PX0A 3W4KA 5EJ2A 3UGKA 4XDYA 7MDHA 1ZJZA 1GUYA 2ZQYA 1U3WA 3AU8A 5G0TA 5TT1A 1Z7EA 4CLXA 5B12A 3NAQA 3CZRA 1X14A 3K8ZA 1TA4A 3DWFA 3F1KA 4IDEA 1FF9A 5TT0A 2O3QA 2P5UA 4CR8A 2UYYA 1E3LA 1ZSNA 4YJGB 1C0KA 3VH3A 3ZWOA 5IAAA 4BNNA 4PLFA 3IMFA 2CF5A 4UREA 1ISMA 4CV1A 1HDGO 3KM0A 4YDRA 3TZQA 3AOEA 3HN7A 4N7RA 1YBAA 3OIGA 1MG0A 1RM3A 5KIAA 2QX7A 3I9KA 3ZV4A 1R4MA 3GZNB 1GCOA 4CM4B 1LNQA 3G1UA 3I9LA 2EERA 3DEYX 1CRWG 1E77A 5EINA 2P5YA 4PLPA 1PZGA 1PQWA 4WOKA 2AXQA 2Q50A 3HG7A 4IBOA 3ROPA 1PS0A 4D46A 3FI9A 3F5SA 4BV9A 1AHHA 4J1TA 3L4BC 2Q2WA 4IJWA 3ONFA 3CMCO 1NR1A 4W9NA 3GEDA 4MJLA 1YJ8A 1ZNQO 2J3IA 2Q1SA 1LC0A 3GN2A 1AN9A 3X2EA 4I1IA 4QSMA 4Z0TA 2PGLA 4RPHA 4Q3BA 1UXJA 4K6FA 1C0PA 2RCYA 1Y5MA 4D3FA 3ABIA 3G49A 3H6KA 4ZQFA 3ONEA 5BNFA 1CIVA 3SC4A 1GTMA 4ZRNA 3VTZA 2X23A 4RPKA 1I5RA 4OKIA 1DPGA 3KVOA 3H2ZA 4D43A 1Y8RA 1GUZA 1PZHA 1WLYA 1CEQA 3GEMA 4UULA 3M2TA 3OQBA 3QLJA 1VI2A 3TDKA 1ML3A 2EJWA 3WGZA 5K6AA 4CM5A 2CSUA 4DA9A 4IDCA 2PZKA 3PGXA 2EGHA 3S2EA 4ZJUA 1PGQA 2B37A 3QVTA 1UZLA 1N9GA 3ZHZA 3LF1A 4Y6SA 2C7GA 3IJRA 2I67A 3FBGA 2F00A 3MJCA 1BDMA 1JVSA 2O3SA 3Q2IA 4TWRA 5JS6A 1OAAA 4WKGA 1K6JA 2Q99A 4Y6PA 3PDUA 1X13A 3VOSA 1EK5A 5JCJA 3B6ZA 3VH4A 4QT0A 2FR8A 4RORA 3ZHXA 3BMOB 3AI3A 3L0DA 2NVUB 3PZBA 2AHRA 3Q6IA 2P9CA 4B4WA 4GBJA 4MP8A 3H9EO 2Q46A 4E33A 1RM4A 3EZLA 1I33A 1P45A 3DAPA 4OXKA 3DTTA 4CMBA 3C1TA 4KMSA 1Q7CA 2AQKA 1EE9A 3F5QA 4BGVA 2P68A 2EXXA 2NADA 2YY7A 4R5HA 3PWSA 1KYQA 3HWRA 1I2ZA 5ITVA 5KJ6A 4GGOA 4FIZA 1LEHA 3N74A 2EW8A 4XD2A 3O8QA 3PJFA 1BGVA 1GQYA 1GZ6A 1SOWA 1GD1O 1IY8A 2DKNA 2ZB8A 4Y6RA 4CMKA 1ZVMA 3BMNB 3HDJA 3I9NA 3ZWYA 3ICCA 3WSVA 1E3IA 1Q0QA 2JHGA 1KEVA 3GEGA 3KHUA 3X2FA 4BMSA 3DOJA 3CZMA 2B83A 4NFSA 1ZK2A 6ADHA 3F4LA 1LC3A 3AY7A 3I4CA 3NGLA 4GL4A 5C3MA 2O4CA 1PJ2A 5A02A 4KDEA 4WLVA 5A4DA 1Y8QB 5JLAA 4UUPA 3EW7A 3NT5A 5G0WA 2G0TA 5DOZA 1PGJA 1EUDA 2E37A 4BO5A 1EDZA 1Z75A 3LU1A 4NBTA 4RV9A 1HTBA 2OP0A 3RUDA 1RWBA 4J9VA 1U8FO 1PIWA 4PG8A 1DC4A 3PIDA 5FF9A 1ISJA 1N2SA 1QG6A 2AG5A 3UXYA 4R68A 3U62A 2GZ1A 3FPLA 2PD6A 3JYLA 5HBRA 3NJ4A 1RYDA 1NNUA 2WEKA 2NTNA 3AOEC 4PVCA 3L4SO 4RPLA 1KS9A 4OXNA 3VHRA 3FPCA 1PZFA 2CVQA 1I2BA 1UP6A 4J7UA 1LLUA 4LW8A 4TQGA 1MC5A 2CDBA 2DU8A 1ZFNA 1YDEA 4JJGA 4XYGA 4AJEA 1C0LA 2BGKA 2OL4A 4RQUA 1CQIA 5DT9A 3PYXA 1ZH8A 4C4OA 3OQ6A 1E5QA 2YQ5A 3K6JA 3IL2A 2EKQA 3ITKA 4DC0A 1G1AA 4F3YA 3OQ1A 3TQHA 3QSGA 5HM8A 1W6UA 4QO7A 4BGIA 2OUIA 1S7CA 1J4AA 4MKZA 4NU6A 4GVLA 2WE8A 2BD0A 1T4DA 4XQEA 1GV1A 4YJHA 3OIFA 4CM8A 3GGOA 3UVEA 4GX5A 1YDWA 4RF5A 1YVEI 3ZGYA 3L07A 3VTFA 3NDIA 4EYEA 5L95A 3WGOA 4GH5A 4KUEA 4XKJA 4OM8A 3KZVA 3FNEA 4XJTA 4D3SA 4P4LA 2UAGA 1J6UA 1PJBA 1NPDA 2I6TA 3WNQA 1NYTA 2HAEA 1K2WA 5LCXA 3DZHA 3SJ7A 3H3FA 3RUAA 1R66A 4QQRA 2EKPA 2WD8A 3DZKA 4FPXA 3KUXA 3JQ9A 3RUFA 3RFXA 4N5LA 4J4TA 4TRRA 3E1KA 4PVDA 2FR1A 4BNJA 1VKNA 4YEDA 3WG9A 3ZNNA 2HJSA 4HUJA 3KRTA 2X7HA 4IMRA 1A5ZA 3AJRA 4HXYA 4JGBA 2V6GA 4KZPA 1E3WA 3PJGA 3GGPA 3PZRA 4J91A 4LSWA 1YO6A 3JQAB 4DQUA 2HMUA 2I76A 2PFGA 5L4LA 1CJCA 1B14A 2PK3A 2ZKLA 3UHAA 3TOXA 1PTJA 3WYCA 5U4QA 1V0JA 2JFGA 3DAFA 1KVSA 4Y67A 5AXCA 4BS9A 3PEFA 2AEJA 4L4XA 2HSDA 1FDUA 5JDCC 2E82A 2RHCA 2ZQZA 2NTVA 3JQGA 1LDNA 4M49A 2QIOA 1E6UA 4A27A 5L45A 3VAZA 1SAYA 4GX2A 3RSHA 4R1TA 1IB6A 5EPOA 1NAHA 4GX0A 3MJTA 1X1TA 3MJ4A 2PZLA 1WZEA 1MC4A 4FCCA 4D42A 4HFMA 4WOJA 3FNGA 2V6FA 4GX1A 2DBQA 2JHFA 2UUOA 4CR6A 2E49A 4AJOA 2HRBA 4QTZA 5F5NA 1LRJA 4H15A 5ER9A 4LMPA 2PY6A 3F3SA 2GN8A 3NTOA 5I8WA 4ALMA 4IDDA 3RFVA 1KY5A 2O3UA 3M1LA 4JXKA 1JKFA 4QEDA 1N92A 1F12A 4WEQA 3ON5A 4NMHA 5I7SA 1ULUA 3LLSA 1JN0A 4DGSA 3GGGA 4MVJH 2DVMA 4I8XA 4MVJP 1HDXA 3AM3A 3V8BA 1M67A 1PR3A 3O03A 3VKUA 1VE9A 4E3ZA 3STHA 1PZEA 3B1KA 4LRSB 3U09A 4OOEA 3UH1A 1NWCA 1YXMA 3IP1A 4A0SA 3HSKA 2X0JA 5IDWA 5IZCA 4OQZA 1LSOA 1DFIA 1GR0A 3A4VA 1DLJA 5I8ZA 3ROMA 2JCVA 1U4SA 4OAQA 4HNGA 2HO5A 3FD8A 1VPDA 4RPGA 3RWBA 2VUSA 1LLCA 1XSEA 1H9AA 4PZEA 5TSDA 4B7CA 2JJYA 2C20A 1A27A 4BHTA 4DREA 3FRJA 4YVFA 4CM3A 3G79A 4E4YA 2X4GA 3OJLA 5DNAA 4AJJA 3QE3A 3NYWA 3QVOA 4RDHA 5G0SA 3ZWCA 2H1SA 1XLTA 4ND3A 4CLOB 1QYVA 3WMWA 3AW9A 2BKAA 3SLKA 2BLLA 1ZKMA 3ULKA 1H6DA 1JVBA 3KYBA 3DMYA 1EUCA 1IUKA 1YOVA 3IUPA 3GHHA 3I1JA 3OSUA 4G5HA 1GPJA 4PG5A 1F8GA 1S6YA 1HLDA 1LLQA 4GWKA 3ZU4A 4NI5A 1G0OA 4EUEA 5JYEA 3IQDB 1GYQA 5CPFA 2CVZA 5HS6A 2IODA 1SBYA 4UUMA 3A1NA 1O8CA 3F9IA 5FI5A 4BNTA 2C07A 1NQTA 1D1SA 4YJHB 4KQWA 1QV7A 4FQ8A 3OJ0A 4J9UE 4XQCA 5JPIA 4U0KA 4XR4A 5CG1A 4DLAA 3W8EA 3E6AA 1YL6A 5DDIP 3GFBA 3HUDA 1R16A 1CETA 5AVOA 2ZYGA 1NTOA 3L6DA 4XYMA 4RVUA 2GN6A 2HMVA 3AUSA 3TZCA 3RBVA 3U4CA 2OBNA 1YB1A 4PN3A 4A2CA 5CG2A 2CFCA 4AJIA 5F1PA 1DAOA 2WD7B 4IQGA 5DZSA 1HXHA 2BGLA 4IIVA 5KVCA 1F17A 1DHTA 1K6XA 1XWFA 2F1KA 4J0EA 2PTGA 4TRMA 1QLJA 3ADPA 1Y1PA 3H65A 2Q1WA 3QP9A 3HQ4O 4L0QA 2HCTA 1PJSA 4YAEA 5CPBA 2JFFA 4YPOA 1EBFA 1EEHA 4GPD1 1XKQA 4BNLA 1ISIA 3PQFA 4YYZA 4MDHA 3U5TA 5JDCA 3JD3A 4A26A 2OOSA 4XRGA 2YFHA 2IDZA 3JQ8A 2G1UA 4BMNA 1K6IA 4CQLA 1O0SA 2NU9A 3UOGA 5BQFA 4J3FA 4GSKA 2Y99A 1DIBA 2H6EA 5JDIA 3L77A 1GEGA 1UZMA 4CLEA 3ZWAA 5JW6A 4BQPA 4ITUA 1IPFA 4B7UA 1BDBA 1NP3A 3C24A 2GDZA 3DZJA 5KVVA 2PZMA 4B3JA 2DQ4A 5BNTA 2WJPA 5DCWA 4GWGA 5JDIC 2RHRA 5ENDA 2FP4A 2Y0DA 1YQGA 2DC1A 3NTQA 2YFQA 1TXGA 1KBZA 2HMTA 3H9JA 4MKXA 1O95A 1ZEJA 3DMTA 3TZHA 4YJGA 3Q2KA 1YL7A 4XJSA 3IKVA 3OFSA 3QJ5A 5DN9A 2Y1CA 3DC2A 1RJWA 3WBFA 1WDMA 4TRJA 3DDNA 1BHSA 1GYRA 3DZFA 1Z7BA 4CMIB 1ZSVA 4YA6A 4BO9A 1SEPA 3IC5A 1YB4A 1B2LA 1YE3A 3TZKA 3CSDA 2FRDA 1JQBA 1KC3A 3B70A 2QRKA 3I23A 1R15A 3QV1A 1C1DA 4NBWA 1O6ZA 1A71A 2PGJA 3GDOA 5T8KC 3ZNOA 5GZ3A 1GAEO 3COSA 5KJ1A 1DHRA 3MWEB 2VTDA 1JTVA 3BXXA 3H5AA 4R51A 4U8GA 4FSHA 3OF2A 3GVCA 2VHVA 1FMCA 3LC2O 3LSYA 4JNKA 2EP5A 1DOHA 3GG9A 1U1IA 1QYCA 1KC1A 3E5MA 4BV8A 2GN9A 5KJEA 1XQ6A 4CODB 2ZTMA 3I6QA 1D4FA 2Q49A 4BGUA 1HSZA 4FC6A 4IM7A 4G65A 3JD0A 1FDWA 4MVJM 5I7VA 2FHSA 1QRRA 3GRKA 3HFGA 5EMHA 5B4TA 2H9IA 3WICA 5CEJA 4DPMA 5ITWA 3GDGA 4XB1A 4AFNA 4JBIA 3OETA 4QO8A 1E7RA 1V3UA 3UUWA 4IGEA 1LQUA 4X54A 5B4UA 2B36A 2VRBA 3PIIA 1J5PA 3ETEA 4DIFA 2YYYA 3R1IA 3IKTA 2D2IA 4R9RA 2Z95A 4YT4A 2O2YA 1E1MA 3DBHB 3E48A 5HTOA 3AI2A 1ARZA 4RVGA 4MP3A 1HZJA 4U7WA 3AI1A 3O9ZA 3BIOA 5COAA 4HV4A 1EDOA 4CM9A 3I4FA 4QUKA 3DB2A 3DZIA 1R0SA 2DPGA 5IZCC 3RJ9A 1ADBA 2FSSA 2HJRA 3FSRA 4ZHSA 1YJQA 5JO0A 5JMPA 3VPHA 1XHLA 1GDHA 4M86A 1X7GA 4XA8A 5AQ1A 2VNSA 1I24A 5H83A 1LRLA 2XXJA 4RPJA 2BFAA 4HADA 4RVDA 4BNIA 2EV9A 1B16A 3ANNA 3QVWA 3LYLA 1EE2A 3O26A 4TKLA 1MUUA 4CUZA 3G1TA 2AQHA 1UP7A 2XOXA 1HF3A 2NACA 3JQGB 1YB5A 4R01A 4BKQA 2CVOA 5JY1A 4DWVA 3WFJA 3FWZA 4MINA 4CMJA 3ZNQA 3OA0A 3PPIA 4A7PA 5A05A 5BNIA 2B0JA 1VM6A 2YHUA 3ST7A 1KETA 1NHGA 1D7OA 2TMDA 4E2ZA 1QYDA 2QZZA 2J5RA 3GC6A 3GVHA 1I3MA 2O50A 1M66A 2X9GA 4DRYA 4HFNA 4J1SA 1YS4A 4DMMA 3M6IA 4HP8A 1JA9A 2ZTUA 4BMVA 1HDRA 1CF2O 1Q7BA 5AYVA 3RROA 1BXKA 4M87A 5BT9A 1OMOA 1G6KA 1UDAA 1WDLA 5JYDA 5T57A 3WXBA 3U4HA 2FSVA 2YV2A 1QV6A 3K30A 3RJ5A 1I2CA 1WW8A 4NDNE 3MOGA 5T64A 1AUPA 3GAZA 1XDWA 3EGOA 2QHXA 1GQ2A 3JQBC 3H4VA 4JBGA 2JKVA 1KVRA 4CQMD 4UVGA 3H9QA 1H94A 1WVGA 2Y67A 1DIAA 2J3HA 4NFHA 5DCYA 4D79A 2P91A 4GMGA 5DOVA 4IIUA 2R2GA 3D7LA 4ND1A 2NWQA 3V2UA 3LT1A 3C1OA 2I66A 2O2SA 2OFPA 3W6UA 4CV3A 4N5MA 3GVPA 1QYXA 2GUGA 3KTDA 1E5LA 4P4NA 2Z1NA 4IJUA 2ZCUA 4JROA 3LQFA 4CR7A 5ADHA 1NVGA 2A35A 2DAPA 2DLDA 2JL1A 3G3EA 2R00C 4JJIA 5TS3A 1PGOA 3GVIA 4PLYA 8ADHA 1T4BA 4E5YA 3DZGA 1BSVA 2QYSA 2NLOA 3K2EA 3DBRB 4LRTB 3L6OO 4Z0PA 5TJ9A 3QY9A 5FI3A 4EITA 1BVRA 1P1HA 5H81A 3ITDA 4TZTA 1LSSA 3F4BA 2WYWA 1RM5A 4Z9YA 5KJFA 3PHLA 5DF1A 2VQ3A 2PV7A 2X6TA 3HDHA 5EQFA 4N54A 2VWPA 1R0LA 1FDSA 2BELA 3H9UA 2BFPA 5GZ1A 3JYOA 3P5SA 4XYLA 3EK2A 3KBOA 2OP1A 1LXCA 1E7MA 1PWXA 1H0KA 3TFOA 1V3TA 5DBFA 1F06A 4OJNA 1BW9B 1LQTA 4NR0A 2O23A 4WK6A 5DCUA 4BNZA 1V9LA 1KVUA 4I5DA 2VNAA 5IXYA 1KEWA 3ZHYA 3JYQA 5MGBA 1SNYA 3EAGA 4E2XA 4R1NA 4ZRMA 3PK0A 2Y1FA 3DBRA 1YBMA 3SEFA 4RLSA 3C7DB 1B3BA 2BH9A 3OEWA 4J7CA 3WQRA 2BMAA 3P19A 3D4NA 3KYDB 1H2BA 3UW3A 5F5LA 1P77A 3KYDA 2G82A 3PFFA 4HFRA 3V2GA 1ENYA 2BFOA 4URFA 5TRTA 2JCXA 2C29D 4KOAA 1VL6A 1WXDA 4BO8A 1C1XA 2PD4A 3TL2A 2GYYA 1VSUA 3FBTA 3QWIA 1X0XA 5TGDA 1JWBB 2YV1A 3KEOA 3KLPX 5GZ6A 2JFHA 4II3A 4XR9A 1I3NA 3MWDB 4WLNA 2C7VA 5JSFA 1DFGA 2O3RA 3FNFA 4CUJA 5JE8A 4TVBA 2NVUA 2O3TA 1QR6A 1BW9A 4NU5A 3ZV5A 3RVDA 4CQLB 4S3MA 4GMFA 2GLXA 1O5IA 1H2HA 3L4BA 4JLWA 2ZJ0A 3JD4A 1HE2A 2X0RA 4WCDA 3RC1A 3FR8A 1D1TA 1U2DA 2HDHA 4E5NA 3AM5A 1ONNA 1BRMA 5JMWA 2J3JA 5KCZA 1LI4A 5A06A 1DIGA 1U2GA 2VWQA 3MCVA 3JQEA 2WWRA 3NDJA 3OJOA 4WUVA 3WNVA 1WNTA 1GEEA 5FWNA 3QWAA 4TRNA 4YTEA 4K28A 1YGYA 1H93A 1T2CA 1LDYA 1ISHA 3IJPA 1GV0A 1X7DA 2C54A 4WASA 3RUIA 1GZ4A 4S1VA 1N8KA 2DUWA 3TRIA 2NV6A 4EUFA 1E3WB 2OHXA 1UDBA 1OC2A 3VZSA 5C5IA 2PR2A 3WYBA 1XEAA 1T2EA 4JP3A 3WGTA 1PJTA 2X1HA 1U3TA 4Z9XA 4CLDA 3BMCA 1ONOA 4CLRB 3TOZA 1R4MB 1AXEA 3PHIA 1EVYA 3JQAD 2PLAA 3ZU5A 2YDYA 3V1YA 3R3JA 4ZN6A 4Z3KA 1SC6A 4J0FA 4A03A 4LCEA 5JY6A 5L4SA 4I9UA 2GRAA 3VH2A 3RUEA 1DBVO 1G0NA 5A03A 5L7TA 1ZXBA 3ASUA 2VYVD 1P0CA 5J23A 1WP4A 4J49A 1A9YA 1VL8A 3JQFC 3WFIA 2O3JA 5T6BA 4I5EA 2QRLA 4ALJA 4O63O 1P33A 3BTUA 1GU7A 4KQXA 4GVXA 1FK8A 2OGUA 4O1MA 3INGA 4OH1A 4E30A 3LT4A 2AE1A 1MV8A 2VZ9A 3OEYA 4CUKA 2GD1O 4ZA2A 4YJFB 1JKIA 4XGNA 4WLEA 2O4UX 4J4BA 4KDFA 1XR3A 3G17A 4KWHA 4RQTA 4XZ3A 1DB3A 2I65A 4FD3A 3BA1A 3ZDFA 4I08A 3QRWA 1DJQA 4MVJA 4EDFA 2OMEA 4FB5A 4IGFA 2YV3A 1DXYA 3AFMA 4FOOA 4R9SA 4LVCA 2D5AA 1N1EA 4AJ4A 2JD0A 4OL9A 1UZNA 1GZ3A 2HMSA 2ZK7A 2RBEA 1HE3A 4L4RA 3QQPA 5I9NA 4IJKA 4RL6A 5JCJD 1X1EA 3BHIA 4TKMA 1LX6A 4J7XA 2VRCD 1QXSA 4AJNA 4FN4A 3GLQA 3RC2A 2PWZA 2JD1A 1ZEMA 5ILOA 4Z0HO 2EP7A 2Y93A 3D0OA 3V5NA 4IDFA 5JC1A 4UAGA 2I3GA 4HY3A 4KUGA 1PJLA 2HRZA 2QYTA 1A7KA 3FHLA 1K5HA 4R69A 1O9BA 4XQ9A 5ILGA 1JW9B 3DHYA 1YL5A 2GSDA 5H82A 3DBVO 4MKRA 2G76A 2J8ZA 3PLNA 3FNHA 2DT5A 1LDBA
chains in the Genus database with same CATH superfamily
3JRWA 2LKMA 2X8LA 3LXUX 4RVFA 4X65B 1L5YA 3UH0A 3MNFA 4OQQA 3O94A 3SSNA 3I62A 2MSDB 5FLYA 1A2KC 1SS1A 2O7QA 4FHGA 2A84A 1UKEA 2P77A 3GJZA 1RQ7A 5IU6A 2W6JD 3AE5C 2W2QA 3KLBA 5C7LO 2ILVA 2QVBA 3V1KA 5IVHA 1CUZA 1LDMA 4IFEA 3KVYA 3AP3A 3W6ZA 1KEPA 1Z4PX 4X1KB 2RAUA 1DO8A 3HA5A 1NSFA 4C2BA 1EFPA 4L07A 4WUTA 5AVXB 5DXJA 4F8JA 2NTYC 3MB5A 4PPNA 1V7ZA 3I1YA 1KYXA 5L40A 1XFAA 1NU1D 1Y1QA 3C8VA 4DLYA 5F64A 1CDDA 2P9GA 3EODA 1FP2A 5FA6A 1NUAA 5CCEA 3DMPA 1A9RA 5IABA 3KYQA 1TF2A 2ZAYA 1JEKA 1WKCA 1FFHA 1WZ2A 4JYMA 4QARA 1K04A 1M7BA 3D6NB 1V3VA 3RF7A 3MMPA 1GHTA 4K6GA 1O89A 2V54A 1T9KA 1EMDA 1HDCA 3O2QB 5D3ZA 3AEEC 4DMLA 3QK7A 1SD1A 1LD3A 2FZWA 3DKIA 4M76B 4PZDA 4MDFA 3JALA 2I4IA 2WD7A 1ZD1A 4AQRD 1N0VC 1SC1A 4N6NA 4HUTA 3HJNA 1DCFA 1J0BA 1GT91 4C0QC 1BCCJ 3EWIA 3MLEA 2CT8A 3BXFA 1E3EA 1RMTA 1XELA 1OMIA 3IB6A 2GAJA 4EY8A 4HMQA 4DSZA 1WSDA 1NW8A 4CIXA 4XUCA 1NVKA 4Z3OA 2GTHA 4QREA 3OM9A 1K75A 1XDUA 3L8EA 2XUKA 4P6VF 4RK5A 3UJ3X 4BFLA 3VNAA 5E2AA 4F71A 1QV9A 2OXFA 5E38A 4I81A 1BXRA 3FHJA 1WMFA 2W22A 2CLFB 3WFZA 2ZIVB 4RSRA 4DUGA 1DKOA 3COJA 4GXQA 1I4DD 2PR7A 2OG1A 3F67A 3H97A 1T4GA 3K70C 4NCBA 5EHGA 3HLYA 4H27A 3ZTTA 2C7RA 4KIGA 2WAYA 5JI3E 5DLPA 5JSHA 3KOUA 2RONA 3QUTA 5J9FA 1O6CA 3DONA 5KB3A 4BBPA 3RB8A 3FLMA 3CN7A 2DR0A 1K5DA 2SECE 2BFCB 2IGTA 1U2TA 4RKEA 4L85A 2V8OA 3DFUA 5BR7A 1XZLA 3DOOA 4MO2A 2DP4E 4Y98A 4W7HA 4JYZA 2HNAA 1XQ1A 1ZVKA 3PX7A 4JUFA 1A5BB 1L7EA 2K37A 4ZIRA 3GLMA 5BYAA 2IEBA 3EFEA 3EXG1 1GG2A 1ODFA 1T6XA 2NZ8A 4ZIRB 4JOCA 4X7MA 1NAIA 4L76A 2XADA 4XDZA 1SBZA 3U5ZB 1FDTA 1D9ZA 3B5JA 3EGXB 3M6VA 1F14A 2ID4A 4OXYA 4OXRA 5A1TA 2P11A 2PZ8A 4IOMA 3W5JA 1BD4A 1QHGA 5KYGA 5EIAA 1SUDA 2Z1MA 3ZH9B 3CXHI 4OKSA 2XYHA 5AH0A 2NU6A 3VNVA 3AL3A 3NG1A 3VX3A 3O1JC 4GMXA 2CXPA 4FINA 1EP2B 1VHJA 1FLAA 2BM0A 3UMRA 1SBQA 4DXAA 5ELXA 3IQEA 1QU2A 2HA7A 5D86A 1U28A 1XI2A 4P8RA 4EJSB 5G2OA 5E6RA 5F2EA 3ZLVA 2C2XA 1G5TA 3ZWBA 3H1LJ 4NOJA 5AW5A 4KAJA 2P3QA 1YI2P 1YTZT 1ZZEA 3C97A 4WDQA 2N1MA 3ZU3A 1G2OA 1D2RA 1X8XA 1N73B 1YOVB 1GQSA 2O05A 1JR3A 1CQXA 2G04A 4IHJF 1BCCG 2RGNC 1RM0A 3BASA 1C80A 3KYJB 3OPYI 3PQDA 1DNPA 3SQOA 3L71J 2LDBA 4O59O 5EKUA 3MTEA 4FT4A 3F2IA 4BWGA 4RZIA 3NFYA 5DM2A 4I6JA 1JIVA 1U3GA 3NUGA 3ZLUA 1DADA 3A1SA 3D2LA 4HDRA 4QYTA 3MTJA 4LDNA 4ICIA 3V4OA 3OFND 4R5MA 5EHZA 4FWIB 4RKWA 3GUVA 1T3HA 3NASA 5HQ3B 1NDHA 1F5SA 5KQGA 1R5NA 1PWEA 2F17A 5BP7A 4OP3A 3CWQA 4XRRA 5E95A 2OZVA 1Q1GA 3EHDA 4KP7A 5CHEA 4WGGA 5HR5A 3LFTA 4Q4AA 1L2TA 2PRJA 2V7GA 3LLUA 5EJMA 5EMNA 1GZ5A 5FBRB 3UPUA 2LWIA 1VLHA 1GVHA 4NPFX 5IFLA 2UZ1A 3V4PB 2BRUC 3E9EA 3HP4A 2IRWA 3CNHA 4L0MA 5E9JA 3HUUA 2UZ1B 3U7FB 4PJ0H 2QZ9A 1Y9JA 1ATIA 1U0TA 2OZLB 4NPCA 3T1TA 4UKDA 3SS9X 2P9YA 3KB6A 2DKOA 1VIVA 4PXAA 5AOVA 1YR3A 4WK4B 4D45A 1Z0JA 2PN1A 4KE9A 5HRCA 5JQGF 3ER9A 4KYVA 1K7YA 3M4YA 3PWZA 3AVVA 1C3JA 1R9JA 1NTKG 2WYVA 3ZWDA 3FUCA 2CGEA 3IUYA 4FBGA 2ZAIA 4L9SA 4QFCA 4ARZB 4ECEA 5I9LA 4H0CA 2QRZA 5CBNA 5B2ZA 4WECA 4M3LA 1JSLA 1NJ8A 2C3MA 3EBLA 4HH3C 4QUJA 3BVPA 4DNOA 3MWFA 4ZGGA 1J2UA 1C3EA 3ZCVA 5CD1A 4Q47A 1W2EA 4FCVA 3U40A 1UXIA 4OF4A 1URQC 1YRLA 1RBZA 1I4EB 3BT7A 4CU5A 2UZ3A 2PNJA 4YJFA 3LOQA 2M9MA 2BH2A 1AQUA 1N0WA 2NVWA 1WABA 2IKSA 3D8NA 1HYBA 4M1SA 4M8LA 4RD4A 4W5WA 4WCFC 5JFOA 3N2GA 4OD0A 3M70A 2DH5A 4K86A 1KOFA 2ORED 1EXIA 1E3JA 1KO5A 5TF0A 1O08A 3E53A 3EDYA 4CLOA 4IXTA 2PZEA 4NK5A 1RBMA 3U59A 5JSYA 4WBSA 5B1EA 1NT4A 4L4YA 2Q7XA 1TKBA 5JQGA 5TARA 2BMDA 4V0QA 1AE1A 3W2HA 1XA3A 2WJ3A 1FFEA 4LVOA 3OOWA 3OLVA 4M8IA 4QOJA 4QYMA 4ZEMA 2XNDA 2F9MA 1E1YA 2O6LA 4JUBA 3TCXB 1K5GA 3UCEA 1QANA 1NGMB 2B8EA 1GK4A 2BFBA 4B3HA 1IBCA 1UJMA 2COUA 5JAIA 4U3JA 3EFFK 3WSWA 5CFNA 1KMIY 3UICA 4QDOA 3A2NA 4ZD6A 3GT3A 2FETA 2QDXA 1IYZA 1UJNA 3EIQA 2Q2QA 2QJWA 3EVBA 3IX7A 4L2IB 1ZK1A 3H86A 3KK0A 1Q2XA 3ADOA 3QVLA 2EIXA 5DV9A 3WWYA 5E79E 2P2CA 3RSOA 1H0RA 1N6OA 2EFCB 1F6DA 3CVWA 4QYXA 2QPTA 2X22A 2NM0A 2XE4A 4B3RB 4OHMA 1GUFA 3I5AA 2OYHC 3QVMA 4HLDA 2F3UA 3L7KA 4M98A 2ZM5A 4OYHA 4YQYA 3WYGA 2WMMA 4X64B 1U63A 1QX8A 3E0QA 2NNLD 1SU7A 2ECPA 1PR6A 1RZUA 1WAMA 1NW3A 4HUQA 1GTL1 4JGGA 5AJHA 4QLAA 4ZV9A 3SX2A 2IIPA 2YXEA 1XZMA 1PGNA 4RIEA 4YMGA 2O8DB 1R0ZA 1YGPA 4W9NC 3G0DA 3WTBA 3R4CA 2QD2A 2RI0A 3LY8A 3DDHA 1XBTA 2ZBRA 2C82A 4IUCS 2W4QA 3HXPA 3IAM1 4WPGA 2VWGA 3LFUA 4G24A 4E2YA 4F0JA 1NQOA 2R8BA 3BB4A 3HADA 1OR8A 1FJKA 2WSLA 2HYIC 3RT9A 3UWDA 1EVLA 3TRFA 3O8DA 3VNSA 5IX8A 4MUHA 3HB4X 3AM1A 3UOWA 2AEMA 2F1HA 1ZHOA 2G0AA 1BMFA 2PKYX 4IOKA 4DV3B 1EFPB 1VQ4P 3A2LA 1FU8A 2VDKB 5AI9A 4D8WA 4NBVA 1WMBA 4HQKA 1M2NA 5B57C 4OHRA 2FSPA 3DL2A 5AKYA 4FFBB 1YS7A 2M98A 3PXXA 2KI7B 4ENPA 1Y37A 3LK7A 1LPOA 3VR6A 1LK0A 1WKVA 5AVRB 2GERA 1QKIA 2Z8ZA 4FDAA 5I7AA 2PMKA 4ACBA 1NMZA 2DM6A 1FLVA 1ZX1A 4C3ZA 4RM2A 2YVLA 1O58A 3PD1A 2GF2A 2QE7H 1U8EA 3GEIA 4HAIA 4I19A 4OREX 4UHCA 3W8FA 4ECAA 3NZEA 5BSKA 4JC8A 4H1VA 3CPWO 2Q1TA 3T5BA 4FS3A 3EXHC 3ZDCA 1DAPA 3NHLA 5LZ7A 2FX2A 1NU1J 1DAKA 2VHZA 5CB8A 1BH2A 3HHPA 4BN4A 1VTKA 2DBYA 2B7BA 4D57A 1VIDA 3SKVA 1G3IA 1M2GA 1Q0HA 1NBHA 2I7TA 3SJBA 2J5QA 3MD0A 3P2KA 3PGA1 1FP7A 1L2PA 1K27A 4TZKA 1IOLA 4ENRA 2BCCD 4X3OA 5C8VA 4HGZA 5A1JA 5IPFA 4RY0A 3DTVD 2KXPB 1EDEA 2PG3A 1DEKA 4K7JA 1NTMJ 2CUNA 2PA3A 2RH5A 2BTOA 3HNRA 2FEKA 5B5EH 4KIFA 5D1NA 3S2GA 1VQPP 2XY4A 3HB5X 2DB3A 1IB0A 2X76A 2H8KA 1TT5A 2HWXA 5D2CA 5EIHA 2QN7A 1YB7A 3PKJA 5HG0A 3S6JA 4G97A 1XQ9A 1NKVA 3L35A 2IZOA 3NJRA 4AKGA 3DQZA 3WR5A 4BBAA 5JWOA 1Z45A 2D2XA 2Z83A 4DR1B 1OOEA 4HCJA 1BVUA 1QO9A 4RXTA 3RTGA 4YMLA 3M06A 5KNLA 4J4HA 5CT9A 2J6HA 4CLHA 3E35A 4OIMA 4V3BA 4J1QA 2IX7C 3T1VA 4YCMA 4KWEA 2Q4EA 3JQRA 1PR2A 4Z86A 5CUQA 1U8XX 3AUTA 5K8IA 4TM7A 1ULHA 4ARBA 4KE8A 2ILTA 1WZCA 3NX4A 2C7QA 3K92A 2GSWA 2Q4DA 4M8SA 1X8JA 4U0JA 5AOAA 4YAGA 4R9NA 5FAXA 1CZQA 1RXUA 4DILA 2D00A 1BX0A 1IBKB 5TE9A 4DT1A 4R1UA 4V1CB 2X2OA 3ML1A 3QBDA 3V4QA 1LLFA 2VTEA 1BS9A 2PBLA 1FU1A 1SOUA 2AD5A 4Y9TA 1RCUA 4G1EB 1QQAA 5KLVE 3S99A 4D3YA 3RSSA 1Z56A 3O38A 4I9FA 3U9TA 4E12A 1LW6E 2XNHA 3IBSA 4JUDX 4QYSA 3W5BA 3QA9A 3A6FA 3HNPA 2ZRLA 4HWTA 4WCFA 1N2IA 3NIBA 2YKGA 1J8YF 4KB5A 2BGUA 1ZOPA 1T4CB 5DGXA 1DQRA 1LVUA 4BFTA 5C4IA 2QTVA 2I4RA 1NU1G 1SMKA 2EW1A 4CI0B 3IAS1 3ZWXA 1SQVE 2QTVB 1QG4A 1HNZB 3KPJA 2VOEA 1SD2A 3IOMA 3PCTA 1VIMA 5KKZC 2YVKA 4AZ0A 1MJNA 3FGPA 4QICA 1YD7A 2B5VA 4MB0A 4YUWA 4X7RA 2EQBA 3CLUC 3AOGA 4FB4A 1O94A 2P8SA 3F96A 1G66A 3PDHA 5HK8A 4I8IA 4GZ6A 4BO6A 1LLDA 3V5NA 1XQXA 4XIGS 2D7JA 5EP2A 4BJ3A 4DMHA 3ZKWA 4F4UA 1CJUC 3ZHCA 3LQ4A 1XCPA 2BHTA 3U49A 4EBFA 1E5DA 5LDGA 1JTEA 3OX3A 1J49A 3KVVA 1ZRTE 1AZSC 2C77A 1BGYD 4UHHA 1FUYB 2OCPA 4WK0B 1EWTA 2NOGA 1T6YA 3GJYA 4UVDA 5AI4A 5JVDB 2BGMA 1N9GB 1EZ1A 4NHEA 4DLTA 5I01A 5G4KA 3SYTA 3GPCA 1DG9A 2DLCX 3BMQB 4H3SA 1ESEA 1YI8A 1H0SA 2LPMA 2WZDA 4JXZA 1XTGB 5DNCA 4Z2YA 1Q2NA 1WS6A 2YJGA 4C2UA 1U3UA 1RHQA 1TF7A 2P5TB 1RIIA 2Q45A 2ZW9A 3L6RA 3QXJA 4CF3A 4Z4QA 2O1XA 2ZIEA 3MZ0A 3OH8A 5JMTA 3KVNA 2Q2OA 4L22A 3NTRA 5CCGD 1KYOD 2B7CA 2VDUE 2WT7A 1OFTA 4N0MA 3S55A 1E92A 3M4NA 1PJ4A 5F12A 1GZDA 5LB4A 3DUFB 3VPXA 3HABA 3MM4A 4YMTA 1RLIA 1TQ8A 4RZXA 1R8EA 4QU8A 4WLOA 1P6XA 4KQMA 1N3BA 1NW6A 2VF5X 3NCHA 1PFVA 4TX1A 1S02A 3EZXA 3K1ZA 1B15A 3WL8A 5BR8B 3FTCA 1UAGA 1DRUA 1PJCA 2AS0A 3C39A 3IBCA 3ZG6A 3TW8A 3RVPA 1XDDA 4GYJA 4DG5A 1IWOA 1P5JA 5FIUA 1W19A 3QWBA 3K15A 1VE6A 2BEJA 1JXAA 3K9GA 3C15C 5JVDA 1XGKA 2ETXA 3V46A 2SKDA 2IEDA 3F7TA 2CHVA 3L1KA 4H7HA 5AW8A 3N8HA 4PGAA 1WXFA 4P7JA 1Q0UA 1N7HA 1GD2E 3EF3A 4DB2A 4YROA 4UQOA 1P3JA 5F1YA 5JJ5A 4QUGA 1VE3A 3BCSA 3GZ4A 5CFOA 2HZBA 4KMMA 4JBWA 3WY9A 2X0NA 4DL9A 2B2NA 3AUXA 4MR7A 1VQ7P 4CCSA 4H0FA 1U9IC 1DGQA 5CP8A 4D9EA 5JAHA 1OI7A 4BQQA 2BI7A 2W98A 1SXHA 3GFSA 1O95C 1ACMA 3F6PA 3T9DA 3A7EA 1EGQA 4RIIA 1N7GA 2VPPA 3D6ZA 1NJIQ 4N49A 1ZUHA 2HA3A 5K5GB 3ESBA 2P7HA 1OZGA 4Z1OA 5I7FA 1U2DC 4AWBA 1QGAA 3H0KA 4NG5A 4NBRA 3CM0A 3ODPA 1EFVB 5A4IS 3QY0A 2ABWA 4KQ9A 4JP5A 4N5NA 4U6QA 3C16C 3N86A 4N5IX 3VMFA 2IZZA 2PUTA 4BC0A 4BMZA 5KJCA 4LF7B 1SO8A 4L73A 3DZBA 4Q3CA 3ZWWA 4LK3A 2EZUA 2QX6A 2VJMB 4ZXPA 4W5OA 3U3XA 1VQ9P 4R8RA 2VLBA 2WTEA 4BFYA 3ABQB 3DA8A 1FFXB 4JLVA 5DP2A 1RWXA 5CYOA 3H1PA 3T3DA 2C0QA 1DEHA 1GDTA 1KMQA 5D5HA 1LTJC 1OJ7A 2HCJB 4JQZA 3N8DA 3T9BA 3SWWA 4AY6A 1RQNA 1A4UA 4YFVA 1NAYA 1HYHA 1N8SA 1JEEA 3GBSA 3M6WA 2FEXA 5IC4A 3Q9LA 2ZSEA 5EAIA 3IV7A 4N6GA 4LISA 2WSCJ 2JIZD 1A88A 1IY0A 1JTHB 5CHYA 4DLKA 3ZPXA 3WGUA 1B23P 1E18A 3SX0A 2X9NA 2NQ8A 2A78A 3B5NC 3EWAA 4D9IA 5CA1B 4HDMB 4HDKA 1FVOA 2YJNA 2P9TA 3SXJA 3NAZA 1FSPA 2ASVA 1T4MA 3GH1A 3OPVA 3OZEA 3QW2A 4H3HB 4Y7DA 1EUYA 2PBRA 5FT9A 3ZD7A 2YHAA 3DP7A 3L49A 1Q22A 4QD3A 4F3KA 2QBYB 4FYYA 4Q9LA 3IP9A 5GTIE 3JQFA 1N2GA 5I7RA 1L7RA 3L7CA 3UF0A 4BRWA 4KQGA 3RI3A 4YXFA 1E7YA 1S2GA 2PSJA 2YASA 4N8SA 4BVAA 3D70A 1G8AA 2CHGA 2EGUA 3IOYA 5EOVA 4A2QA 1TUBB 5HRUA 4CQMA 1LA2A 5LQSA 2YWGA 5B1DA 3RE1A 4DMCA 5IN4A 2E87A 3GNLA 2G9NA 2I4LA 3CWCA 1L4UA 2CD7A 1LTHR 1SCJA 5ESDA 1BOOA 3X1ZA 2UUBB 3A9WA 3DHNA 3U19A 3WL3A 1XU4A 2AQIA 2ZS9A 2ZBDA 3BFPA 3GUCA 2YRFA 3MHPA 4LMRA 2YCLA 2JEYA 3SZLA 2V7TA 3GLGE 5DK6A 1GP2A 4KT0J 1T3LA 4TMFA 4AD8A 2FYTA 5D3MA 3G9RA 2F43A 1SLQA 3EZ7A 4K9DA 1NXWA 1A2BA 1S8FA 2W2MA 3HDQA 3LY5A 3X0DA 4DFDA 4YUAA 3H2YA 5L4NA 3DTVB 2VSOA 1WRBA 4JFRA 1VJ0A 3CE9A 4GXRA 4M53A 4PBTA 1J90A 1QGUB 1ND5A 4MV7A 4IMPA 5CX1B 4F2WA 3IEMA 3V3KA 1YZGA 4F45A 4Y8VA 3RK3C 3DS8A 3HGMA 2XKKA 2TMYA 2QX8A 1KF0A 1P2GA 3BMCB 3G8AA 4NMMA 5EZ5A 1VHDA 4UB6H 2E2WA 4URVR 4YONB 3ICPA 3WLFA 4PC2A 2B9BA 2W83C 6CHYA 4NCJA 4ALIA 3J80A 3HRNA 1LTGC 2PP6A 3LBAA 4HXEB 2FUCA 3KJNA 3NV9A 5ERXA 2HUPA 2NPOA 2P4EA 3PUWA 4IYRA 1NBMA 2H00A 4W7IA 3DUWA 2DFDA 1FBNA 1YDGA 3PNMA 4GKVA 1C1DB 4HTAA 3GXOA 2CJWB 1XEWX 2OLKA 3KFXA 3C6YA 3OHSX 4CKBB 2K87A 3ITEA 3M6LA 4BJ1A 2ZAOA 1QP8A 1ESDA 1ORWA 5ALXA 5EWJA 4RA6B 1NBAA 4ZO7A 1DTEA 1QFYA 5COQA 4P0PB 2W8BB 3RCBA 4O4IF 1J9EA 1OREA 4ZT4A 4B3TB 4MAMA 1F3LA 2ODBA 2CKDA 2LCIA 1LT9C 4DLNA 3FUVA 1DEBA 1G3RA 1GYPA 2NXEA 1AGNA 1BG6A 4M89A 2PWAA 4I50B 2XVAA 2HMYB 3VVLA 3TTTA 1JPNA 1TA0A 1Y7HA 2R1UA 2F4VB 4FBMA 2R6DA 2BGJA 2Q8PA 1TO2E 3KZOA 3L75D 4Y7CA 4BUCA 3CX8A 4EGSA 3TTWA 4ZDIA 2GO1A 2J7PD 3R3SA 4HFJA 3NYQA 5JT1A 1H5QA 3PVCA 2QSUA 2XVZA 4Z9FA 2P75A 2IUUA 2X5OA 4TT8A 3GJ5A 3WIDA 5I4CA 5KAFE 3MOIA 4QAQA 5AQEA 4F72A 3A2AA 3DBHA 1M2WA 3CCJP 3H1IG 1E2IA 2FYUJ 2IPLA 3QEOA 2W37A 3O74A 4M0CA 2NSYA 2RAPA 4O2AB 5KKAA 3T4EA 5LU9A 3A9RA 1H5UA 2OCBA 1WUYA 2IXDA 2RAFA 4RD6A 1FTWA 1ZYUA 3P8CD 1UOEA 5AW9A 2OC9A 2QRQA 1XX6A 2Z6VA 4UJ5A 1BMQA 4X5OA 1C81A 2Q41A 3M6FA 4RS4A 1GRNA 3CUEF 5E8RA 4ROSA 3EEQA 4D6TE 3RNLA 5JD5A 4L28A 2GCNA 1MHPA 2D1RA 3PC3A 4GU5A 4I2LC 1NTZK 3GRUA 4QECA 5G1PA 1RVV1 5TPWB 3PFIA 2C2ZA 3WQHA 1R5JA 1A5AB 4M1MA 4LTMA 5CDGA 3B1YA 4L5YA 3FYSA 1RKUA 3GBPA 2QQ5A 1JQ3A 3KDPA 2UXDB 4Z6KA 4IFFA 3HFJA 4E5PA 4CKCB 3OA7A 2CBXA 4INPA 4Z8YA 1S5PA 4PLHA 3WL5A 1B6TA 3I3OA 3BK2A 2HWKA 3AKCA 2ZYAA 1IMJA 4KGXA 4AURA 1JNMA 4TYYA 1X1QA 1Y8QA 1VL0A 3TLGB 1SQBE 3GLKA 4YQZA 3W06A 1QIHA 1N73A 5AUQA 1VKOA 2ZT6A 1M10A 1L1RA 1FRQA 4INAA 5EPUA 1L7XA 1SVOA 4IY1A 1K0UA 1VYHA 3P20A 1JWAB 2WUVA 2YMLA 4RY8A 3Q3CA 1VHTA 3L9XA 4H7PA 2HRDA 5COBA 5ALWA 4EPXA 4JI8B 2WABA 1EUQA 4PO1A 5A3VA 1RKXA 1WHTB 3NHSA 3IP6A 1UMCB 2L69A 3H5IA 3PNSA 2JJ2D 4DSOA 5CAEA 1MB4A 2JDIA 3H05A 5JS8A 1PFIA 3CXRA 1T9GS 4DCOA 4X6UA 3WIOA 2AG8A 2VH5R 3H8JA 1N4AA 4EI7A 3G2QA 4OFWA 3UK1A 1BJRE 3K31A 1DX7A 1ZBDA 2ZE8A 4R2KA 3CX5H 2X3YA 4V0OA 1PNOA 1Z22A 3DMFA 4KPUA 2HGZA 5K3CA 4P2BA 3RK0A 3BXPA 3C5VA 4PO8A 5GINE 1GFWA 1ZD4A 1D5CA 3TLAA 2Y0CA 1FQKA 1PL0A 2CUZA 2WSSD 4LDJA 2OZKA 3T5TA 1B8NA 2O7SA 1PZNA 1YR2A 3DLAA 3O6VA 4EHAA 3NOVA 3ZEAA 2IE0A 4AY5A 3MELA 3DPIA 3FSEA 1FA9A 3ZYCA 5CDHA 5CVDA 4C07A 2YDXA 1K9MQ 1R8QA 2FYNC 4MRMB 3T5AA 4Y99C 1EKXA 3FJ1A 3HP1A 4P5EA 1SCKA 1HDZA 2E3JA 2AOTA 4M9UA 2PRIA 5NLLA 4JI5B 3OT4A 3V8PA 4EYOA 3IDZA 1HT3A 2OD2A 2ZYWX 3KUCA 3F74A 5A5EA 3GEHA 3H1JE 1ODIA 3ZJTA 3TIIA 2ESRA 3IF4A 1J0XO 1SQ6A 2IXGA 1W5FA 3A9UA 3A6HA 1GTZA 2JI4A 3A4TA 2NUAB 5BWCA 1G8HA 4L7QA 4GS5A 5ALZA 1SPXA 1T6NA 1M75A 2HY7A 4PYLA 1W1WA 3GMDA 3UT5A 4YMVA 1SQGA 4DG9A 1MJGA 2YMKA 5LQRA 3O8NA 4DCSA 4PV7A 2V65A 5FWXB 1JJVA 2OTCA 5LVAA 3AINA 3T1QA 4EHKA 5E7JA 1X7HA 4QPZA 3OOHA 1M1KQ 1ZNZA 4BFVA 3CCVP 3SE7A 3H1KE 4WFQA 4RIGA 3CMAP 2WSFJ 2K3RA 3FPJA 3K0FB 4Q9NA 1GSOA 2YIUB 4ME6A 4WE3A 4WHMA 3REQA 3RS9A 4CCYB 1FRVA 1HLPA 1Y48E 3QIVA 3K0FA 1A4IA 1D0SA 4YCAA 2BY4A 2QTBA 4KX5A 2QN1A 4C89A 1KOGA 4DV0B 1ES9A 2CXTA 1ZO8A 2CXRA 4REMA 1GPYA 3KT8A 1SXJA 3ESZA 1QH1B 2FPRA 2V5AA 1YVRA 3UA3A 2A2ZA 4QOSA 5LXTB 3FIUA 5FTNA 4CEJA 2GXSA 1FBTA 2QLTA 5DX1A 3WGGA 3L74E 4PC7A 4GXTA 4JBNA 5CMZA 4AJ2A 1KRHA 2GVNA 1E4EB 2UV8A 1FU7A 3RG2A 1KGDA 3BPSA 4H0LD 4P4UA 4E31A 1DKPA 1OC4A 1JY3O 1ENPA 3GHGA 3VVBA 1KFCB 2OBMA 3USSA 4NARA 1I2AA 2AKAB 3BCCD 5YASA 1ENZA 3UXEA 3DV9A 1ISFA 3FLBA 3BB1A 4N7BA 2C5EA 5AM3A 3KPEA 4LKOA 3QKSB 2FEMA 4I1SA 3Q5SA 2KI5A 3VR6H 1EUZA 5JQWA 4BX8A 3EH2A 4WXEA 1NASA 2VPIA 3UG7A 4YACA 3DSRA 4Y2GA 3IP5A 2VPTA 4CKZA 2R8PA 1G5PA 2A06D 1W87A 4IJ6A 4TXNA 2BVNA 2FSFA 2IP2A 5B3AA 3LDUA 2C8LA 4K9KA 3DOFA 4YRSA 5EE0A 1ORTA 1IC2A 3A14A 5KMGA 1ZRMA 5K3EA 1XYGA 2H59A 5L7YA 1W73A 2P2GA 1Z5VA 2V5VA 3GB9A 3T35A 2ZIGA 1T0IA 4K6MA 3ZV7A 4AL4A 3NNSA 2OXIA 2WWTA 3TSZA 1AK9A 3B9RA 1P2BA 3DFZA 2NYVA 1PWHA 1HJBA 1U4NA 4Q39A 3Q40A 4RVHA 3UCXA 4C4PA 1X9IA 1PV4A 2BKVA 4UEOA 1P17A 2ACWA 2CUTA 3EARA 1JE0A 1SR8A 2OXRA 5LWQA 2C4WA 1IONA 4TS1A 3EX7C 1P2UA 2JNWA 3EHEA 2F55A 2BF4A 3D64A 4BQRA 4HB4A 4OQNA 5CFMA 1ZS9A 1RH5B 1EQ2A 2XMCA 5J59A 3IVXA 1MA0A 4JLBA 4LDRA 2Q4BA 2PT5A 3EGCA 4MUBA 4OAPA 3O4IA 4WNCA 3R9IA 2JLZA 4X3PA 3G59A 1CDEA 2EC5A 1ZRTD 3UK6A 1ZW6A 3HVHA 2QRHA 3HCCA 1CW2B 2UUPA 3OMWA 5DTMA 2C96A 1SQXD 3AF3A 3UFXB 3KXDA 1U2RA 3WDSA 1L4AD 1RVDA 6PFKA 2W6JA 5JI2E 1WHSA 5LP6A 3DKKA 1CHNA 3Q5GA 5TEWA 3W3AD 4RMIA 1GM5A 1XXLA 3E27A 2CXNA 2W90A 5EIOA 1DP4A 1S2DA 5B1YA 1VIAA 2XUQA 1TPYA 2CJYA 3VDNB 1PJZA 1PQPA 2JKYA 2JLXA 2VT3A 3D6UA 2O07A 4KG7A 1E2JA 2WPSA 2Y1EA 3HU1A 2J07A 3LCMA 3KETA 1ZJWA 1ATZA 2CZQA 2CVFA 3V6MA 1UKAA 4EB6B 3MBKA 3OPXA 1NN1A 3FVRA 3H3JA 4WZ6A 2ZANA 3R0VA 5AJWA 1O0BA 3ZGZA 1NF2A 5BWOA 5AVQA 1IULA 1FZTA 1V5GA 1J39A 1NYHA 2OBLA 2X19A 3B3AA 1CY0A 2VDLB 5IJ9B 4DIBA 2I2CA 1K0FA 4WY5A 1OKKD 2WNSA 3MUDC 2UVPA 4ZAFA 5AM4A 1P1KA 5JPCA 5U9CA 5M2QA 3PLAE 4A0HA 5LBTA 4C88A 3GCGA 3ENWA 1TZJA 1A82A 4Q3EA 4AZ3B 3NHWA 4BKPA 1U8UA 1JS1X 2Z2IA 3N0WA 4P5PA 3KV3O 3FRIA 5KNCH 1M2VB 1X3LA 3FN4A 3L41A 3ZX4A 2BFFB 3MWKA 3M4XA 4DMGA 1FIUA 13PKA 4IIDA 1U0GA 2GBLA 3TKLA 1DTWA 3CRVA 3T9AA 3AESA 3ZWKA 3AY0A 2AA3A 4MITA 3VZQA 4N01A 4OLHA 5IDQA 2H1CA 2QNBA 1IY9A 3DAHA 3BD8A 1V6AA 1AQYA 4MH0R 1W59A 3TW0A 3R3WA 3OLYA 1H3NA 1ZUNA 1MABB 3MERA 3SHTA 3T95A 1OX5A 3C14C 2VTBA 1E5XA 2F4NA 3AR3A 2XI4A 5LJLA 3E2MA 3DWIA 1HUQA 1KDOA 3TRJA 4D41A 4ADSG 1JG3A 4EOGA 1FNNA 1RWNA 3A7DA 4YT5A 2ATXA 3SBDA 1XQYA 5C1BA 2ZYHA 4XW2A 3T5MA 3JSVC 4XCVA 1FXWF 5J43A 4L75A 3AB8A 3CCRP 5F23A 1S2LA 3BOSA 3RRZA 1S2IA 2E6KA 2Z2XA 2J6BA 3PUZA 3DHEA 3W0LB 1GT6A 2XMRA 4TLAA 3FCOA 4P1ZA 1ZN7A 1CUJA 1CZKA 2WRZA 1MQ8B 1Y9EA 3H1AA 3LA6A 1YQQA 4G1UC 4LZOA 5AJYA 3TQFA 3FTPA 5LKRA 5HFAA 3GJQA 4G8DA 1ZUIA 4IV5A 1AKWA 2DBZA 4JJ6A 1XMSA 1F6BA 2BDUA 2QL6A 1AUVA 3EQ6A 3PX2A 3I1FA 4JYPA 4XDGA 1KDTA 3WBJA 1Y9ZA 1UM8A 2V0CA 4F1JA 4OTZA 3W5DA 4S0XA 3THOA 1QPZA 2GKOA 3IEIA 4LNAA 3ZKWB 3C3BA 3TG2A 1G20E 1ORRA 4WFJA 4DLPA 1NXVA 1V8BA 3QPVA 2I9PA 2IOQA 1O54A 4KTVE 3BGDA 4URZR 3H1LE 2E18A 4BLQA 5D6NA 4HJXA 3GUUA 5ARDA 5C18A 4JWKA 1GTG1 3MMSA 2C59A 2OGTA 4NZ9A 3H9GA 3AL0C 3BTVA 4JEIA 5IYZA 4QAJA 3V4WA 2WBLC 3AF5A 3ZU6A 1IIRA 1DAGA 1NJFA 1R18A 5ALHA 4DPLA 3KKNA 3KBBA 3KKQA 3MMXA 4JJ8A 1EFHA 3C5EA 3K71B 1RLOA 3PF8A 2X0EA 5DNEA 5DN6D 1LPBB 4BTLA 3HKEA 3PXAA 4NE9A 4EI2A 2ZE6A 2TSYB 1SVLA 2PKWA 2PQ0A 1Q16A 4RD0A 3WLTA 5IFKA 3U26A 2C4VA 5K3FA 4R2IA 2YICA 2XB6A 1EQAA 2WI8A 3NDRA 4YNBA 1O6FA 4KI7A 1TOAA 4LC0A 4HTFB 1NIJA 1EI9A 2FWAA 1Q5PA 4GI2A 3WWZA 1L7AA 4ZYXA 3CWBG 1F51E 3L75J 2YW9A 4GIBA 1Z7WA 3ORFA 4I9HA 4RNDB 4PNPA 4RJTA 1T0BA 3U37A 3A3YA 1QVFO 2HM7A 1ILEA 4PGHA 1FRFS 1KFEB 3VISA 2AWOA 1KILB 3KU4A 4AIRA 2X1LA 1QSGA 5DBEX 1KARA 4BY9E 2QL7A 2VBIA 1ZR2A 1N2XA 2O0KA 1Y7LA 1ZMOA 1Z06A 2IBSA 5JS1A 3GHYA 2AB0A 1IFJA 2QEXP 3DTNA 1VGQA 2MIIA 5H3HA 1NPTO 1WUKS 3IERA 4AS2A 5ABPA 1CZHA 1J21A 2ZETA 1WPGA 2YUIA 1DEAA 2XZPA 4LRQA 1GRQA 1OLOA 3IQXA 3OESA 4IXDA 2P2SA 4P93A 4R2XA 1D8AA 1CQJA 3TO5A 2B69A 3G9TA 5K7SA 4KSCA 5F1KA 1VSBA 1Z28A 2C83A 2RARA 4PZAA 3UT5B 4J0IA 3NBYC 3F1LA 1N7SA 4G4IA 1T8TA 4J6EA 3HKDB 4ZREA 1KOLA 2NU8A 2W6ID 4CV0A 3UAZA 6YASA 3G9UA 1VMDA 1RYFA 1UJBA 3BE5A 1BCSA 1VZ2A 4D9KA 3THRA 3UWKA 5KDDA 2Q6LA 4JQSA 4Z54A 3VDQA 3A3OA 4EHFA 3UT6A 3L0IB 4ML3A 5TVKA 4RVSA 3BTOA 3FKSA 2P41A 1VGRA 3PYLA 4A0GA 2GZDA 4WFKA 4A8JB 4IRXA 1Q1BA 1F8YA 2QMYA 1PPJD 1ZH2A 1DDGA 2Z98A 4GL2A 4DSAA 3DR5A 4U6SA 1RLTA 1CZLA 3E61A 4A8JA 3D5TA 3JQ7A 1G18A 4PZUA 4Y6OA 5HNKA 3D3WA 3TL3A 3EY4A 2PS1A 4CG0A 4DCTA 1M6HA 3NBFA 3OZGA 3TNYA 3UHJA 5IVIA 7MDHA 1H0TA 4JMLA 3GLUA 4RVCA 1GA1A 1R5BA 2FW1A 1MNQA 3FSJX 5TT1A 2JKZA 4LGCA 1GL7A 2J09A 5DNWA 3JPWA 3W9BA 1REQB 2IPAB 2RGWA 3NAQA 1X14A 3TB6A 4KFSA 2XWSA 4YALA 5T4HA 3X1KA 4NXMB 4D6TJ 2WLSA 1SXQA 5TT0A 1N7SB 2O3QA 5HUJA 3RVJA 3QPDA 4MDYA 1L5HA 2CW5A 2G9RA 4PRYA 4TV9A 2AFIA 4FHEA 4BB9A 3WAJA 3E23A 3PG5A 2OV4A 2RHGB 1CPYA 1L4AC 2JJ1D 5IAAA 5GADl 4TWAA 1QG0A 3TS1A 4WY2A 4MW9A 4CV1A 3D43A 3C87A 3KM0A 2FOXA 3AOEA 4P3OA 4K35A 3STVA 4K5QA 4OGFA 4OUKX 1MG0A 5DJTB 3SWYA 2GM9A 4KBGA 4NYMQ 4S1NA 2BEWA 5KIAA 3HCFA 5DWDA 3I9KA 1JAIA 1IBMB 1WETA 4GYWA 1GCOA 3BA6A 1KAMA 3GJ3A 2F6RA 3LD9A 3WLPA 3W7VA 3I2GA 2WZCA 2EERA 3QX8A 1JQEA 5EINA 3A9VA 4N39A 5F7ZA 5TB5A 4D46A 1PS0A 4A0RA 3T5CA 4BV9A 4Y2RA 1VA4A 3B5ND 3DD1A 3GLSA 3L4BC 4IJWA 1ZN9A 2XUDA 3CMCO 2MMCA 5H2FH 2L91A 3FZGA 3GEDA 3ONFA 1GTWA 1RAAA 1EFRA 2BFDB 2DHEA 2J3IA 4XCQA 1R8XA 3FUXA 4LXUA 4MJ7A 5HBGA 4EMBA 3IALA 2LKCA 2JLBA 2A0FA 4I1IA 1Z0KA 3HCPA 4UMFA 1ZA2A 3C3DA 2PGLA 4MKFA 4RPHA 2IIVA 1UXJA 1NOKA 2R96A 4L0DA 3H6KA 3G49A 3HDTA 2FPMA 5C3UA 5BN4A 2HSGA 4RXMA 2E0IA 3C6KA 2VR1A 4OFXA 5KSZA 4ZRNA 2VPXA 4NOLA 4IX1A 1UK7A 2X23A 4S12A 3IDFA 3ZCQA 1KI4A 4KJZA 3UJNA 5J2TB 4JUAA 1TCCA 4RPKA 1YZTA 2HPHA 3QVUA 4OKIA 1DPGA 4XASA 2VT6A 4HLUA 4GIFA 3OWOA 1Y8RA 2HJHA 2C2BA 3KHSA 2FWJA 3JC22 1TCAA 2F3PA 2PWYA 3OFVA 4FD2A 4OK5A 4ENWA 1AGXA 5KSYA 1MN6A 3M2TA 3F5FA 4U9UA 4EMUA 5F4ZA 1VI2A 3OJXA 1F0PA 4NH0A 4ZVOA 1N2CA 4EYYQ 1ML3A 2EJWA 2PWBA 3AEAC 3QOFA 1WUIS 3T7DA 4YP0A 4Z1MD 9GPBA 2A0XA 2ADOA 1XNRB 3SDZA 1SOMA 2BFDA 4X1YA 3KTAA 3OF3A 4L5JA 2A5FA 1LTBC 3CT4A 1Z8DA 3RK3D 3S2EA 1IXZA 2COKA 2B37A 4HLCA 4O0MA 1UZLA 4DN6A 3K0SA 3L75E 3NTLA 5CA1F 1AV6A 4MR8B 4UPEA 4Z7OB 4GOXA 3MIZA 1RI2A 1JVSA 3Q2IA 4IWYA 3E7KA 2FSGA 2QN6A 4Q6BA 4TWRA 2ZSDA 1XCJA 1L5OA 1RHRA 2ZVNB 3ZYZA 5BMVA 2Z58A 1OD6A 1V48A 2QU8A 3PNPA 1P75A 1VBNA 2WFLA 4G1BA 4AKTA 2WJJA 3IMCA 3KUUA 1CC1S 1ECBA 2H4XA 3HBNA 4KFUA 4LXGA 5DLDA 3VH4A 4MHTA 4QT0A 2IDJA 4Z4IA 4YASA 2XYQA 1WUJS 3NEAA 4X95A 3E70C 4QUEA 2E1PA 3ECSA 2OYHA 2VHCA 2X13A 1Q3TA 2EKBA 1NVEA 2Q46A 3HCWA 4LOHA 2VC2B 2XR1A 2REOA 1IWBB 1VBMA 3COVA 5HDBB 4GPBA 4D25A 3CWBE 3WL6A 3EVCA 2QTTA 3F5MA 5BU8B 2M6LA 2CSXA 2C9CA