2ZYDA

Dimeric 6-phosphogluconate dehydrogenase complexed with glucose
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
464
structure length
464
Chain Sequence
KQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Escherichia coli
total genus 169
structure length 464
sequence length 464
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zydA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zydA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zydA01
4GX2A 2NNLD 4W9NC 4DPMA 4O5OA 3GG2A 3IQDB 1N8KA 1HDXA 2P4HX 1NBOA 4K6CA 1VL6A 2AXQA 2J3KA 4MP3A 4D3DA 1A5ZA 4RF5A 3ZWAA 3VVBA 4S3MA 5I9MA 3JYQA 4BMNA 1PEDA 5KVVA 4PG4A 3BMQB 3OSUA 4HADA 1DEHA 4FDAA 1VJTA 3WFJA 1I36A 3DDNA 2CD9A 3VH1A 4HP8A 3U4IA 1HYEA 5IG2A 4JXKA 3ZV5A 2I76A 4RDIA 2OHXA 5A9RA 3I3OA 1I3NA 2A94A 3RFVA 4YRBA 5A9TA 4XQEA 1LDNA 3KSUA 5U4QA 1GPJA 1U1IA 2YYYA 3RI3A 3RU9A 5HS6A 3UOGA 4GQAA 1GPDG 4BQRA 1BMDA 2WYVA 3DEYX 5JW6A 3RC9A 3HG7A 1AHHA 3K5PA 1RM3A 4CMEA 1YKFA 2OOSA 1IZ0A 3JYOA 3S2IA 4JP2A 4WUVA 1IHXA 2Y1OA 3PRJA 3VPHA 2C7GA 3U62A 4YJFA 4MKZA 3E18A 3TFOA 2YQ4A 4M86A 1YBVA 3GGOA 2OMEA 1GZ6A 1ZIDA 4F3YA 1RYDA 3WTCA 4PLHA 3ROQA 3WGZA 2HO5A 5I7SA 3VZRA 3DOOA 3E48A 4WCFC 2YV2A 5LC1A 2EP5A 4EUHA 1H6CA 3BMOB 2OGUA 2BF7A 4L74A 3QSGA 5HTOA 1M2WA 5AQ1A 1VKOA 2BLLA 3ORFA 2NLOA 1WAMA 3CMCO 1GUZA 1GAEO 4CLXA 4NMHA 2PV7A 5DCUA 2GNAA 4I9UA 4W9NA 5DULA 3AFMA 4EUEA 2HMSA 1U5CA 4ID9A 3CKYA 2EGHA 1SBYA 4WOJA 4GBJA 1R15A 2UAGA 4YB8A 4A73A 2O2SA 3HUDA 1SAYA 1TT5B 3KEOA 3UHAA 4OAQA 3JQ8A 3F3SA 1D1TA 3H9JA 4BGVA 1PGNA 1KYQA 2QHXA 4E5MA 3OHSX 2YY7A 4OKNA 4HXYA 4BNMA 3IIEA 1E1KA 3WMWA 5A3VA 2X8LA 4YT8A 1EVYA 4M8SA 1N5DA 4BO7A 3C7AA 4E32A 3DBVO 4YJGB 2E49A 1K89A 4ALKA 4W7IA 4FFMA 2Q46A 4Y6RA 1U3UA 1U7TA 2OP1A 1DRVA 2I3GA 1E6EA 2VHWA 4PG8A 1DC5A 4CUKA 4NK5A 1MGOA 3LU1A 1ZEJA 3K30A 5KVQA 1E3IA 2GO1A 5T64A 5THQA 3BTOA 2CNBA 2EG9A 4GH5A 2Y66A 1Q2XA 2JHFA 1V35A 5DP1A 4CMHA 2EWMA 1JAYA 3F5QA 4NJMB 3M2TA 3RC7A 1ZSYA 2JFFA 3ZV4A 2XF8A 3IUPA 5EESA 3RWBA 1WZIA 4C7KA 1HSOA 1Y1PA 1N9GB 2C59A 1DRWA 2O7QA 4MKXA 3TL3A 2FWMX 1NAYA 1V6AA 2WD8A 3BZUA 2RHCA 4H15A 5EMHA 3LT0A 4J90A 4BV8A 3RFTA 2GR9A 2VTDA 2ZCUA 1B3BA 3JD2A 1JVSA 5JDCC 5IZCA 1KC3A 1X14A 1PX0A 2ZCVA 4WCFA 4F6CA 2HMWA 2ZATA 4L73A 1N7GA 2JHGA 3BXXA 2J8ZA 1UXJA 4CMKA 2GCGA 3KRTA 1KOLA 1R4MA 4BL5A 1G6KA 1O89A 1HE3A 1Y9EA 2YUTA 3L4SO 1GZ4A 3JV7A 1YS4A 3E9NA 3ADOA 3E8XA 4GVXA 2PGDA 2J5RA 4R01A 1Y7TA 2GPTA 4MVJM 1TB4A 1UXKA 5DP2A 1MC5A 5F21A 4H3VA 5LCXA 3DL2A 5JCJA 3JQAB 3M1AA 2J6IA 2Y67A 1BWSA 5A9SA 1XQ1A 1ZBQA 5IAAA 1BSVA 4YYZA 2VCYA 4AJ4A 4WLVA 3RUHA 3TZ6A 2D59A 2BGKA 3Q6IA 3WWYA 5JAQA 2OZPA 4R68A 1WP4A 1N92A 3OICA 4TSKA 3CXRA 3IP1A 4CV1A 4YJFB 3BTVA 3IKVA 3V2UA 5JY1A 4RZHA 5L9AA 3ZCXA 1HTBA 4XQ9A 3ZWBA 4FJ2A 2I6TA 3ZWWA 1ISJA 4BO8A 3GDOA 4NH4A 2EERA 5AXDA 1VKNA 1N1EA 3C1OA 1Z6ZA 4PRKA 4AJKA 3EMKA 3UCFA 3N74A 4WGGA 1BGVA 2XAAA 4KOAA 3P19A 2A4KA 2IDZA 4ALLA 1RYEA 1K6IA 4BB6A 2WYWA 4Q39A 4C7JA 2VUTA 4CV0A 3WQQA 3NTQA 3RKRA 4BHTA 4CLEA 3S8MA 3KYCA 3WQSB 5L45A 5TGDA 2A92A 2X0IA 5HBRA 1PZFA 3WOHA 3FF4A 4J4TA 1EFKA 3HN7A 2WSBA 1LDMA 2VRCA 5FFFA 3VZQA 4FC7A 2YFHA 2EGGA 3PZRA 3F5SA 4YCAA 3JQCA 3UGKA 3EYWA 1PR9A 4MVJD 5JYEA 1EBUA 5CPFA 3WICA 4AVYA 3WBFA 3I83A 2QIOA 2GZ1A 2FR8A 1X7HA 1KEUA 2HRZA 1GV0A 3C1TA 4RCVA 3PHHA 4YQZA 1K6JA 3NDJA 2NTJA 3FTPA 1HE5A 2NACA 4BKOA 2BFAA 3JYLA 2C5AA 5DOZA 3GUCA 1LSSA 1OZAA 5ENDA 4DIBA 4GKVA 1IULA 1O9BA 4GL4A 4BUCA 1K3TA 1U2GA 3HN2A 5C5IA 4EZBA 4UVGA 3DZHA 3AUSA 4OHUA 3ZDFA 5KWEA 1UJMA 2P68A 2PA3A 3E6AA 3D4NA 5JDIC 1ZXBA 3T7CA 3Q1LA 3FBTA 1ZEMA 2AEMA 1DIAA 2X0RA 5L4LA 2EJWA 2EW2A 3KSZO 4FJ1A 2Y1CA 5JMWA 1PL6A 1H0KA 2AQ8A 3DB2A 3ANMA 1LRKA 1KY5A 5BNIA 1PJQA 2C82A 3JD1A 2NADA 1WDMA 4Y8VA 3K31A 5HS4A 4KP7A 4YRAA 2J3HA 3KYBA 4WCFB 4BMSA 4OO3A 3UAGA 3Q11A 4DIFA 3RVDA 3WMXA 4UUPA 5BSEA 2XOXA 5DT9A 3JQ7A 3WIEA 2E48A 3GPIA 4NNJA 2O2YA 1U28A 1UAYA 5CDGA 1K6XA 3COSA 2YJZA 4XRGA 2O48X 4HWKA 2VHYA 4RPLA 1YB1A 3I6IA 1E5LA 1HKUA 2PTGA 3BMCA 4RPJA 4N5MA 3PDJA 4QFCA 4OM8A 5TJHA 2VWGA 2FRDA 3AI1A 4EYEA 4B4UA 2NQTA 3K92A 1UDBA 4CR6A 1YOVA 3BAZA 4OMUA 1XYGA 4PG7A 3ZZNA 3QW2A 4JN6B 2FN7A 5F1OA 4IPTA 4L4XA 3ZU3A 4IJVA 1ML3A 4KMSA 4CUZA 4YEDA 1ZSNA 1CYDA 2B4QA 2GASA 2X58A 4QECA 4D41A 1C1DB 2RIRA 4ND5A 5H81A 2X9GA 2DC1A 5K6AA 1QRRA 3BHJA 1V3TA 1EDZA 1K2WA 3VZSA 2Y1DA 5L53A 2HUNA 3LLSA 4CLDA 2JD1A 4E2XA 4FFNA 5TSDA 2YHIB 4MVJP 3TZQA 3UCEA 1YQXA 4BGIA 3HSKA 5EQDA 3AOEA 3OECA 5T57A 4R5MA 4N7RA 2VYVD 1R37A 5T67A 2NVUB 3DZGA 3ZH2A 5FF9A 4Y67A 3GVXA 2PY6A 2VT3A 1P3DA 2P5UA 1EEHA 4JROA 2OBNA 2D2IA 4CMAA 3NGXA 3W4IA 3ADPA 5CDYA 2P9CA 4RVSA 2FZEA 1YXMA 4N5NA 4MIEA 1N7HA 2CSUA 2O7SA 3ROMA 3V5NA 4DC1A 4BB5A 1JKIA 3ANLA 1XWFA 3GNTA 4DPLA 3OQ1A 4BO0A 1CEQA 3LLVA 3GVHA 2W4QA 3TSCA 4E0BA 4PLYA 1FDVA 3GGGA 4AJIA 4FFLA 3AK4A 1VI2A 4PG6A 4QO8A 3RSHA 2AQHA 1ADBA 3TF5A 2DPGA 1E1MA 3RBXA 1DFGA 1HDCA 3DOJA 1LUAA 4BV9A 2V6BA 1BXGB 4HUJA 2DTDA 1PGPA 5ER6A 4E2ZA 4NFYA 1SB9A 4UVDA 3JQEA 4FOSA 4UUNA 1HDOA 4BVAA 4CM1A 3A4VA 4ZICA 3QA9A 4CL3A 3G0OA 1E6UA 2JD2A 2Z1MA 3NYWA 2YV1A 3PGJA 4H7PA 2IRWA 3RUCA 4CM9A 3I23A 1BVRA 4IQGA 1VM6A 4DWVA 2PFGA 1OOEA 3D3WB 1FMCA 5IFLA 1E92A 1EVJA 1MX3A 4XEHA 1SCUA 2UDPA 1P1FA 3LYLA 2O23A 4WLFA 1PWZA 3GA0A 4XGNA 4XX0A 2AQKA 3NKLA 4HFJA 1ZK2A 1SEPA 4PLWA 4O0LA 2OORA 3QWFA 2IYOA 1YONA 2B5WA 2X5JO 3NDRA 3ZHXA 4M87A 4KTVE 2I9PA 2O4UX 4GX0A 4JJGA 4R4JA 1G1AA 4AJOA 3ENNA 3I9JA 1I5RA 3H3FA 1DSSG 4TRRA 2DBVO 4L4RA 4RORA 3A9WA 2Z5LA 2P5YA 2PZLA 2QW8A 1RPNA 1H93A 3U49A 3L9XA 3AOGA 1Q7GA 5I8WA 2VOJA 1E5QA 2IXAA 1E3WB 3HNPA 2EKLA 1I3MA 1ISHA 3GNSA 4ZQHA 5DDIP 1I0ZA 1LXCA 1GV1A 1YOVB 4ND1A 5L4SA 1IY8A 1M66A 4PRLA 5JFOA 3AM3A 3DBLB 4HBGA 1NWCA 4HKTA 3RUFA 5G0WA 1VL8A 1Z73A 3OA2A 1A9YA 3PDUA 3N58A 2BMAA 5B4VA 4UEKA 5G0TA 2FPGA 4IMPA 4W6ZA 1DC6A 4E5YA 5JY6A 3C7CB 3VH2A 3VVCA 4DA9A 5TLSA 3I4CA 3ITKA 4CV3A 2GZ3A 3FBGA 3T4EA 1ULUA 2Y1EA 3Q3CA 1DXYA 1GYQA 1F8GA 3PYXA 5ILOA 1ZSVA 5I7VA 5DNAA 4WJZA 3D0OA 1D7OA 2B4RO 1PJSA 5KJ1A 1ID1A 1PJ2A 4IDEA 1P9LA 4DQXA 2I65A 5JAZA 2C5EA 3H9GA 4BNIA 3ASVA 5L40A 4R5HA 4NU6A 5BSHA 1E3EA 1C0IA 3CMMA 1UAGA 4D3SA 1ENZA 4IZHA 2LDXA 2IODA 2WWRA 3WSVA 3K6JA 3QP9A 5EQFA 3V2HA 5H83A 4P38A 7MDHA 1EQUA 1DDOA 1J6UA 3UCXA 4BMVA 1BRMA 1MXHA 4Q3NA 2HRBA 1SOVA 4XR9A 3K96A 2F1KA 3ZV3A 4TQGA 1AGNA 4RV9A 7ADHA 3LZ6A 4GVLA 3C1AA 4ALMA 2D8AA 1X1EA 1SB8A 3OP4A 5JAMA 4K26A 3BMOA 2QX7A 4RO0A 4IGEA 4YVFA 4IY1A 4RL6A 3GOHA 2HSDA 3CH6A 1I24A 5ILGA 1AXGA 1PSDA 3GMDA 4UVIA 3ULKA 3ZU4A 2ZK7A 4HV4A 3MJVA 1ENOA 1NAIA 4JBGA 4LN1A 5COBA 5G4LA 2QYSA 3QRWA 4FFOA 3U09A 1YL7A 4QX6A 1QMGA 4YDRA 1X0VA 2RAFA 2EF1A 3K2EA 3S2GA 1D3AA 1LX6A 1TT5A 3O8QB 3WNQA 1Z75A 4ZQGA 3ZHBA 5GZ1A 1XIVA 1YDEA 3R3JA 5BT9A 1KVTA 4R1SA 3H2SA 1I01A 2POQX 1BXKA 4RQUA 2JCXA 1E3LA 1RM5A 2WTBA 3IDSA 1L7DA 4XDYA 3VPXA 4GLLA 2EJVA 5ICMA 3SLKA 3Q2IA 1QV7A 3AW9A 5ITVA 1TA4A 3JYPA 3UVEA 5F3RA 3K9QO 3E1KA 3B1FA 4O59O 4RPGA 1Q0QA 3GEDA 4DQUA 4E4YA 1A27A 1ISFA 3LC2O 4OOEA 2EHDA 2PGJA 4LSWA 4IZIA 3PJEA 1C3VA 1X1TA 4J7UA 2H9IA 2WEKA 4J1SA 3ZU2A 4W4TA 3FRJA 4KUEA 3WGYA 5T5QA 1M6WA 1F17A 4CM6A 4DYVA 1FK8A 1EK5A 1N9GA 2X9VA 4UUMA 1B16A 1WZEA 3MJSA 4CM4B 4OGWA 3KTDA 4RGBA 1I30A 2W2LA 4J0EA 3ZWXA 1B0AA 1P31A 3DMYA 3MTJA 4U5QA 1M76A 2NWQA 1NR7A 4HNGA 2GERA 4JCOA 1VJ1A 3TWOA 1LQUA 1ZJZA 4B7UA 4YBZA 3ROKA 2BFOA 5JBIA 3P7MA 2CMDA 4GMGA 5THKA 4A2CA 4O63O 3H8VA 5C7OO 2ZJ0A 1DIRA 3KVOA 4GPD1 4PIVA 4BNVA 2Q4BA 4IM7A 5FEUA 1GUFA 4RJTA 3I9MA 2DAPA 3PZBA 4WECA 3VH3A 5KNLA 1E7YA 5DZSA 2UV8A 3CSDA 3NJ4A 3RFXA 4ROSA 1CJCA 1H9AA 1KVQA 4KTTE 1JQBA 1J4AA 3JQAA 1NHGA 3FNEA 2ZYGA 5CDSA 1ZO8A 2JD0A 3H9EO 2G17A 4LCJA 3DONA 1GL3A 1GQ2A 4R3WA 1C1XB 1VLLA 2Z95A 1ZFNA 4UUOA 4XQGA 4YRDA 3ZHZA 5JCJD 4HY3A 1SPXA 4NU5A 3MJTA 4EGFA 3GNQA 3ZWNA 1GQYA 3AFNA 2PH3A 3P2YA 4M89A 3H9UA 3NT4A 3PP8A 1T2CA 3OIDA 3PHGA 4J2OA 2XXJA 4EBFA 1YB5A 4FSHA 3KEQA 4FPXA 1PR3A 4AJHA 4B4WA 1YBMA 1W8DA 2IE0A 4GLOA 3WDSA 5JPIA 3W6UA 4CR8A 2O3QA 4HNHA 2E4AA 3GR6A 1LRLA 3AY3A 3FWZA 2C0CA 3GZ4A 2PKQP 3Q2KA 3DXFA 1LLUA 4A26A 3U3XA 2QRLA 4BKRA 1GQQA 2NSDA 2CZCA 2HLPA 4XB1A 4B8ZA 3DBHB 1OI7A 3OF2A 2BKAA 1PJBA 4BO2A 1H9BA 4GGOA 1KBZA 4ZGWA 1YE3A 2X5KO 4WOKA 3WWZA 3MOIA 2DBZA 3ASUA 5BSGA 5ADHA 1FDWA 3C3XA 3LC1O 1IB6A 1MB4A 1I33A 1YB4A 4TVOA 2FPIA 4FIZA 4JBIA 4CPDA 1ONNA 5JMPA 3RROA 5AYVA 2AG5A 1P45A 1T2EA 1QP8A 3MOGA 2JCYA 2VRCD 5DF1A 5F1KA 3QIVA 4U7WA 3EZYA 1H5QA 2C29D 4LCEA 3G1UA 3PWKA 1TT7A 2DQ4A 3FHLA 3PK0A 4BO3A 1U8FO 4JX8A 1BW9B 4J91A 2E6UX 2FMUA 3O4RA 4YR9A 1P1KA 1BG6A 3K73O 4CM7A 4ND3A 1NXQA 4GI2A 3JQFC 3HJAA 4BNJA 1HZJA 2GRAA 4IJKA 5ITWA 1X15A 4XYEA 3P2OA 4B7XA 1Y6JA 3DQPA 1UR5A 3C24A 4EW6A 3JQ9C 4J9UE 4ZHSA 3FR7A 1OC2A 3HE3A 3IL2A 1FF9A 4NJOA 4XWYA 1O6ZA 4FD3A 1KEWA 2FSSA 3NDIA 4D0SA 3VKVA 4AG3A 4DMLA 3EGOA 3OJ0A 4E6PA 3IAHA 4XGKA 2WDZA 3OIGA 4I5EA 1LNQA 3PXXA 2JAHA 1QLJA 5TC4A 3RUAA 1CDOA 1MFZA 1EDOA 4JJIA 4I5FA 3JQDA 5EPOA 9LDTA 2X4GA 2GYYA 2TMDA 4WPGA 1UDCA 4QQRA 3LQFA 3PIDA 1O95A 1PZGA 3SJ7A 4Z6KA 2O50A 3MEQA 5JNLA 4J49A 5TIIA 1R4NB 1LLQA 2CUKA 2Y93A 5IDYA 5MDHA 3DHEA 6ADHA 2E82A 4M54A 1XDWA 5COQA 1GD1O 5L3ZA 5I7EA 1GUYA 4WLEA 4FJ0A 4CM5A 2AQIA 4PZEA 4NBRA 4NI5A 4DREA 5KCZA 2XPCA 2FZWA 4BNLA 2W8ZA 4GX1A 3WBBA 3IJPA 3GFBA 4FC6A 3W8FA 3QY9A 4XGIA 3GMSA 4CQMB 3QE3A 1ULSA 4GWKA 1ZVMA 2PZKA 2JFGA 1HLDA 4OSOA 2ZTMA 2EXXA 1ARZA 1P1IA 3DMTC 2CF6A 3PEFA 5JO9A 1XR3A 4XRRA 4JJFA 4II3A 3TQHA 2X86A 3A28A 5TT0A 1R0LA 2Y99A 2DTEA 4GKBA 4W99A 4BGUA 4FQ8A 3HB5X 3HDQA 3TOZA 1C1DA 1KIFA 4CMGA 1PQPA 3UN1A 1LDGA 2D3TA 3V8BA 1LTHR 1HE2A 4H16A 5B1YA 3ANNA 2G82A 1KERA 2ET6A 1KY4A 4N5LA 5J23A 4Q3CA 3D4PA 3DAGA 2G5CA 2YHIA 4FOOA 5C7LO 5L4NA 4WLNA 4TWRA 2YFQA 5DBIA 4D7AA 1EQ2A 2C07A 3H7AA 3VKUA 1DJNA 3RASA 1K5HA 3JQ9A 4JK3A 3Q9UA 2NVUA 3IOYA 1HXHA 3E5RA 3OBBA 2FPPA 1UH5A 3GAFA 1MG0A 2FOIA 1UP4A 3QVSA 4AJJA 4YWJA 5EINA 1GDHA 2DT5A 4YQYA 4CM3A 2PLAA 1ZMOA 4ND4A 4GAEA 1PWXA 6LDHA 2X22A 5A1TA 4EITA 4U6SA 1GYRA 3ETDA 4PZDA 3GY0A 4OYRA 3MJ4A 4RZIA 3R6DA 4XQCA 1CERA 3AU9A 2EKPA 2H5LA 5JDCA 1AA0A 3QWBA 3AY6A 1PGQA 4ZJUA 3KOUA 4ZN6A 4LK3A 3NV9A 2PKQO 3ZWOA 4DBVO 1YJ8A 4D44A 1I8TA 1QSGA 1U3WA 2AA3A 1ISMA 1U5AA 5IJZA 4E31A 5JSFA 2BFPA 3WYCA 3ROPA 3A06A 1VJ0A 4OOFA 2VHVA 2WMDA 1E7WA 2G0TA 4IDFA 2O3JA 1PL8A 2AG8A 1NPDA 1XGKA 4QFDA 4Q9NA 1UP6A 5A02A 4IMRA 1BXGA 2ZIZA 4L76A 1R0SA 4LVUA 1XA0A 1JKFA 3QV1A 4DUPA 4E30A 4PLVA 1HEUA 2OP0A 2X1HA 1HDZA 5H82A 3SC4A 5A04A 4ITUA 4RVGA 4JGBA 3WNVA 2NQ8A 1DHRA 1TLTA 5COAA 1F8FA 3GZNB 4BNGA 4CM8B 1JLLA 4R9RA 1H6BA 3D3WA 1G0NA 4RVDA 1YL5A 3RJ5A 3KETA 4FFRA 2FHSA 3VOSA 4ZQFA 4TRJA 4CM9D 4LW8A 2HK9A 4B3IA 3W4KA 2HJSA 1XLTA 1N2SA 2ZYAA 3SX2A 4D46A 3ICPA 1B26A 3L6EA 3Q9NA 1ZK3A 2ZQZA 4BNYA 3F4LA 4I08A 4DGSA 3FPCA 2PD3A 2R00C 3JQBC 3EDMA 4UEJA 4MVJI 1D4FA 1JWBB 1P1HA 2LDBA 4Z3DA 5GZ3A 2JFHA 1MLDA 2UVDA 2PKRA 3RAJA 4NR0A 4R69A 1E3WA 2NU6A 1PJ3A 1VSUA 5JLAA 2C54A 4N18A 2VZ8A 2HK7A 1NAHA 1Z7EA 3G1TA 4ALJA 4XA8A 2RH4A 4EJ6A 1CQIA 3MWDB 1PJTA 1P44A 3DBLA 1HRDA 1D1SA 4MVJG 3F6YA 3KV3O 4BQPA 4QXMA 2ZJ1A 4LSMA 5HA5A 1E3JA 4QSMA 2X23A 4NFSA 4IDCA 3BTSA 3CTMA 3GF4A 3PVZA 5KVCA 3PPIA 3KSDO 2RHRA 3BHMA 1GYPA 1I32A 4XYMA 1E7SA 3VPFA 3IUSA 5K9ZA 1GU7A 4YT5A 1HF3A 1JKJA 1H94A 1HT0A 3QJ5A 4P4LA 4RDHA 3GDFA 3E5MA 3OH8A 3PYMA 1SZJG 3F1KA 1LRJA 1VL0A 1NPTO 1M67A 1GCOA 3ONEA 2VHXA 2EP7A 3GAZA 2X0JA 4IIVA 5JDIA 2P9GA 2ZB7A 1B3RA 5I9NA 3GVIA 4LRTB 1OFGA 1XQ6A 2D5CA 1P77A 3DFZA 3I52A 3W8EA 4B79A 5CEJA 2WE7A 2Q49A 2P91A 3VDRA 4IS2A 5L7WA 1NR1A 3D4OA 1B8UA 1IUKA 8ADHA 4IGFA 3WLEA 3DZIA 3KZVA 4NBTA 5EIOA 3TJRA 1ENYA 3BYZA 3MWEB 1LDYA 1T25A 3DTYA 3MCVA 4EEXA 2YHUA 1T2FA 1NVGA 4W7HA 3NTRA 3O9ZA 4AJ1A 2GUGA 4BKQA 4E2WA 5DBFA 3Q0EA 1BDBA 1YQDA 4ILKA 4AJPA 1AHIA 2B36A 5KIAA 1SEVA 2C20A 2NVWA 3LF1A 4U0KA 3D1LA 3PHJA 4L75A 1E1LA 3RQSA 2EV9A 1DIBA 1E3SA 4WEQA 1WDLA 3OM9A 3O26A 3ONDA 1NM5A 3CPSA 3GRKA 3VAZA 4CL8A 4AFNA 1Z7BA 4ZVVA 2Y0CA 2YDYA 5CEFA 3O8QA 4MIYA 4ZQEA 5A03A 1B2LA 2VZ0A 4RF4A 2OXIA 2HCTA 1IOLA 2OBYA 3U4CA 1C0KA 3FPLA 1RWBA 3UH1A 2HU2A 4B3HA 3G3EA 3VTFA 5JCXA 4YJDA 1DLIA 4X54A 2NTNA 3IMFA 3VC7A 1JW9B 1YJQA 1MP0A 2O3SA 3B20A 2IZ0A 2PK3A 4FGSA 1WVGA 2NU7A 4J1TA 4DBZA 1YGYA 3OA0A 3BIOA 1GZ3A 4B3JA 3PQEA 4ALNA 4BNFA 1RM4A 4A27A 4P22A 2HK8A 1MA0A 2CF5A 3U4HA 2AMFA 2DFDA 3NEPX 1RM0A 3KB6A 1A4UA 3L4BC 1P0FA 1Y81A 3UICA 1HWYA 3SXPA 2QYTA 1XEAA 2W98A 5G0UA 4PN3A 1LDEA 4WK6A 3WGOA 3OEWA 3WS7A 2Y1FA 3PWSA 3WXBA 3ICCA 3HFGA 4BO4A 4CM4A 5TQVA 2FY8A 1E7MA 3H3JA 4J6FA 1J5PA 1MV8A 2E37A 4XDZA 4BOYA 4BO1A 3C85A 1UXHA 1YBAA 1CWUA 3INRA 4KWIA 4Z9XA 4URFA 5EN4A 4D42A 5KKCA 3EAGA 2W2LD 3EHEA 1SMKA 4I8XA 1G0OA 4N54A 2BRUA 4NK4A 3PLNA 5IN5A 1E6WA 3RU7A 2R6JA 2VWHA 3LSYA 5L7YA 1WMBA 5FI3A 2VUUA 2B35A 4IBOA 3TL2A 4EEZA 1B8VA 2HMVA 2GN9A 3AY7A 4ONEA 4CQLB 4FFPA 3NT2A 3BHIA 2NM0A 5AXAA 4UULA 2GZ2A 1T1RA 1PS0A 1SOWA 5TS3A 1KETA 4LGVA 5ER9A 2ZQYA 2YZ7A 2RH8A 4HFNA 4E5KA 1EK6A 3V1TC 1C1XA 1IE3A 5JS6A 3JQAD 3H65A 2XXBA 4LRSB 4XIJA 1YWGO 4KUHA 1PJ4A 3D64A 5T6BA 4PVCA 3MTGA 3TZCA 1PS9A 1P1JA 4L0QA 1TXGA 1ZMTA 1GTMA 3OJOA 3DAPA 2H6EA 1LSUA 1W0CA 2PZMA 2CDBA 4I9HA 4M49A 3SVTA 1NFRA 2AHRA 3GDGA 1FJHA 4CR7A 3UF0A 3DZKA 1C0LA 1DAOA 2Q1SA 4YAGA 3QLJA 3DHYA 3JSAA 3GHYA 4AJEA 2ZB8A 3C8MA 2VT2A 3I9NA 4R9SA 2BGMA 4MINA 3EW7A 4BIIA 1Y8RB 2HMTA 1EVIA 2NUAA 5EJ2A 1O5IA 4CMIB 3ZNOA 1V3VA 4IXWA 4PZCA 1LC0A 3DBHA 4QUKA 3TPCA 3BMNB 5HWSA 1RJWA 3OETA 4PVDA 4DMMA 4E12A 4AJLA 1NQOA 4AJNA 3ENKA 3X2EA 1PZHA 1NX6A 4D43A 4XYLA 3SJUA 3JQGA 3VPGA 2W2KB 4A03A 1H6AA 3LT1A 5G0VA 4ZU3A 1U3VA 1EZ4A 4FGWA 3L6OO 5AXCA 4B8WA 1F14A 1E0DA 3LT2A 1XSEA 4OH1A 2G1UA 1R6DA 4F6LA 1FDUA 1LBEA 1OAAA 4YAIA 4J4HA 3FN4A 1U4SA 1BW9A 1ZJYA 3UW3A 5CEEA 3HDHA 4G81A 1Q0HA 4TZTA 3M2PA 3RBVA 1V9LA 5KOIA 4KQXA 2NV6A 4IDAA 4EI2A 3ZWPA 1XG5A 3QVXA 3RKUA 4CMEC 2GN4A 5KJEA 1Y9AA 1EUDA 3PYLA 1HSZA 4A10A 4EJMA 2IZZA 4OXYA 5G4KB 1ZW1A 3K2BA 1HE4A 3T4XA 1J0XO 4GWGA 2Y1GA 3FWNA 2JAPA 3CINA 4O1MA 1DFIA 2OUIA 3IKTA 2GD1O 3G79A 1ENPA 2VZ9A 2Y05A 1A7AA 3ZI0A 5KVSA 4BS9A 3AI3A 4IQ0A 1ZK1A 5JO0A 4BNHA 3WR5A 2PGLA 4PLCA 4DLLA 4FW8A 3IS3A 4BKUA 4RPHA 1JWAB 2WD7B 1PGJA 4PLZA 4TVBA 1R4NA 4DIOA 1QKIA 2BFMA 4J7XA 4OJNA 1GFSA 4PLPA 4UVEA 4PLFA 5I7FA 2F00A 2FP4A 3W8DA 2O3TA 2GF2A 3DOCA 3KO8A 3RUEA 1BTOA 4CJXA 3GVPA 3WGGA 4YPOA 3E03A 1UP7A 3PJFA 4U6QA 4NFHA 5A5FA 4IJUA 1Z45A 3QQPA 4DVJA 5JXWA 4BGEA 1E7RA 1DOHA 4CQMA 3CE6A 2DUWA 5LDHA 2A35A 4OXNA 4L4SA 1F0YA 4E5PA 4XCVA 1WNTA 1I3KA 4O6VA 3G49A 3SEFA 1DC3A 9LDBA 1QYVA 5B37A 4F46A 4OIMA 4B4VA 1P1RA 4QEDA 2HQ1A 3TNLA 1ADCA 3OIFA 3U0BA 4ZD6A 3GUYA 1HLPA 2CY0A 3BTUA 3F1LA 3QVWA 1QG6A 2P9EA 2EIHA 5U1PA 3JYNA 1UZNA 3IC5A 1T26A 3A1NA 4UAGA 1QYDA 4TKMA 3N7UA 1T24A 3ST7A 3GRPA 1DHTA 1WDKA 3MJCA 3H4VA 5TJ9A 3DR3A 1Q1NA 5GY7A 2JCVA 1ADGA 4HX5A 1E77A 2PH5A 3IP3A 4DXHA 2V6GA 2Y68A 1FDSA 1MXFA 3WYEA 5L95A 2CDCA 1DIGA 3LVFO 4DLBA 1HDYA 1VE9A 1B15A 4C4OA 3RCBA 3WJAA 4WLOA 3TZKA 5IDWA 1YVEI 3WGQA 1YQGA 4FBGA 3RD5A 1ZH8A 3FNGA 5IZCC 4BNZA 3EUWA 2Q99A 3W1VA 2BI7A 4MIOA 2CVZA 1EBFA 1U3TA 3PLRA 2SCUA 3L9WA 3M6IA 1PJCA 3ZNQA 3VZPA 4CV2A 1PIWA 3H5AA 3JQGB 3ZWVA 2VOEA 2JKVA 1NVTA 3DTTA 4UREA 4IS3A 1PGOA 3PFFA 5C37A 1FDTA 3WTBA 4R16A 3R3SA 3HFSA 3GEMA 4GGPA 3QWAA 3GC6A 4PLGA 4YJHB 3M1LA 1S7CA 4ZQBA 2Q50A 3ZU5A 3KXDA 4AJ2A 4BNTA 2IEDA 1I2CA 1Q7BA 2PD4A 4RQTA 4OL9A 4FN4A 3DZBA 3S55A 2X0NA 3ABIA 2UUPA 3F9IA 3ZNNA 2CFCA 2CVOA 5T8KC 4CLRB 1NFFA 3UUWA 3UXYA 4B7CA 1E1NA 5JC1A 1UZMA 4GSLA 1IZ9A 2B4TO 2VN8A 5A4DA 1XKQA 3DFUA 5GZ6A 1NTOA 3VH4A 1V8BA 1LSJA 4ND2A 2ILTA 5IF3A 3S2EA 4R41A 3V1UA 5AOVA 3I9OA 2Q1UA 5FWNA 1YDWA 1TI7A 1NHWA 1DBVO 3GZNA 5F1PA 4CM8A 4IINA 1Z82A 3B6ZA 4OXKA 2BGLA 4IJWA 5KJ6A 4XZ3A 2IZ1A 2I67A 3KLMX 1WMAA 1FXSA 3DO5A 5B12A 1L1FA 5BR7A 3QWIA 3B1JA 1JDJA 2B37A 4ZRMA 1QR6A 4B4OA 5HM8A 1VC2A 5CFZA 5DBGA 1QYXA 5CG2A 4KUGA 4M55A 5CP8A 5IDXA 3V2GA 5FI5A 2VWQA 3VDQA 2VNSA 3I9KA 1JA9A 1JAXA 3ZWMA 3PQFA 4Z0HO 1BHSA 3AJRA 1VSVA 4JLWA 4PG5A 2TMGA 4NHEA 1PQWA 5KJCA 4CLOA 1H2HA 2D0IA 2PR2A 2NVBA 1K0UA 1EUZA 1NQAO 2I3AA 2DUUA 1ZK4A 3DHNA 4XKJA 4BNXA 4U8GA 2OFPA 1UUFA 4MJLA 3KM0A 3B1KA 4E3ZA 2H1SA 3GPDG 3D5QA 4XR4A 1EUCA 4TRMA 1PU2A 2YDXA 4RPKA 2VHZA 2Y0DA 3TFQA 1W73A 4K1LA 3BA1A 1P33A 1Y5RA 4Z9FA 1MC4A 1HL3A 2DBQA 4I9NA 1VRWA 2VQ3A 2QQ5A 2Z1NA 4XIYA 4J7CA 3S1LA 1DB3A 4RF2A 1OX3A 2I66A 1NPYA 2GSDA 1PJLA 1X7GA 4KWHA 5KKAA 3PI7A 1ZUD1 3H9QA 3I9LA 3LT4A 1GEEA 2J3IA 3JD3A 4J3FA 2NTVA 1ISIA 1ZKMA 1U4OA 1WWKA 4P4NA 4TMFA 4UEOA 4WASA 1U8XX 1GCUA 4DQVA 2D1YA 2NU8A 3PQDA 2Y0EA 2X6TA 5T8KA 2IYPA 5G0SA 1V0JA 3GLQA 4AL4A 3I6QA 5IZ4A 2BHLA 3JQFA 4IQ8A 1OC4A 1IPFA 3RC1A 3H5NA 3JCZA 4NQZA 3D5TA 1O0SA 3CUKA 3SBOA 2DKNA 4J9VA 4DRYA 4NIMA 3PGXA 3CZMA 5U9CA 1T4DA 2YV3A 3EK2A 2ZB4A 2X9NA 1H6DA 1I3LA 3KUXA 4G2NA 4I1IA 2JJYA 1OBFO 4D3FA 1JN0A 4RVFA 3L07A 4RLSA 2V65A 4E33A 4YXFA 5F5NA 2CDAA 3FTNA 4Y6SA 4MO2A 3D3EA 2FSVA 1GY8A 3NX4A 3S2FA 1I10A 4EJ0A 2C7VA 3AWDA 2VTEA 3UKOA 3GN2A 1M6HA 5CDUA 1X13A 4ESOA 4QT0A 2B83A 1PZEA 2V7PA 1DIHA 3KBOA 1LSOA 3G17A 2DU8A 2GN8A 5FYDA 2AE1A 1T2AA 3OJFA 2FR1A 2HKIA 3E9QA 4BNNA 3FNFA 4BKPA 1NNUA 3F4BA 3GQVA 4Q3DA 4Y9DA 4P4GA 1CF2O 1A72A 1QV6A 3JQ8B 1YRLA 3PIIA 1HDGO 1CQJA 4MP6A 3MZ0A 4NG5A 3DBRA 3WX0A 3ZW9A 5TRTA 4R1TA 1U2DA 4OQYA 4XD2A 1YH3A 1OMOA 3ZWYA 3DAFA 4S1VA 3DMTA 3H5RA 5BNFA 2PD6A 4J1QA 3INTA 4XJSA 4A0SA 4DYDA 2PZJA 2UYYA 1E7QA 1HZZA 1I2ZA 1UXGA 4Q3AA 1LJ8A 3LC7O 4RF3A 5K6AC 3TDKA 3OQBA 4G65A 5IXSA 4U0JA 1MUUA 3GGPA 1J49A 1BXZA 2GLXA 4DL9A 1PQUA 4IDGA 2EKQA 3EVNA 5A05A 4J1NA 2QRKA 5CDTA 2BD0A 3GFGA 2FR0A 3RIHA 4BO5A 1R66A 3AOEC 3JD0A 4R1UA 5DN9A 3ZN2A 2BI8A 3VTZA 3E82A 3RUIA 1HDRA 1R16A 5TX7A 4MPDA 5JYDA 4Y6PA 3PFWO 1D8AA 4MOWA 4FS3A 4CLOB 1AXEA 4XJTA 4QTZA 1KVSA 1NVMB 2WJPA 1DC4A 3GG9A 4IXTA 3ZNPA 1T1SA 2DPHA 4YTEA 4JNKA 1TVEA 1O94A 4JQCA 4Z9YA 1X7DA 2O3UA 4BNKA 4KZPA 3FSRA 4HFMA 1LC3A 3SLGA 1I2BA 2VNAA 1NP3A 5ENVA 1S6YA 2Q3EA 4FCCA 3STHA 1R4MB 4IDBA 3INGA 5A5EA 2VYND 3HADA 5I9LA 5CPBA 3AM4A 3ZW8A 4YT2A 5ES3A 1DO8A 1ADFA 5I8ZA 5LDGA 4AICA 2BH9A 1C14A 2X5OA 2I5PO 4IUYA 3HDJA 3FR8A 1VPDA 1IHYA 2QZZA 3WGTA 5A9SB 3U5TA 2Q2WA 4II2A 3JTMA 3HWRA 3AU8A 2IXBA 3WLFA 3F46A 4HFRA 3GH3A 3PJDA 4CQLA 2RCYA 5JAIA 5GMOA 1MG5A 1YL6A 3FD8A 2A9FA 1KS9A 4YACA 4FR5A 3L6DA 1AUPA 2QRJA 3KYDA 1ZXLA 1DFHA 1KVUA 3ETEA 1UZLA 4F45A 1T4BA 3ETGA 4L9RA 3L77A 1IPEA 5G2OA 1DRUA 3LK7A 3I4FA 2GDZA 4YAJA 1P74A 3TRIA 3CTVA 3P5SA 4ZRNA 2EEZA 3PTZA 4WKGA 5A3JA 3T7EA 4EUFA 4MVJE 2ZTVA 4D0RA 2Q2VA 4TROA 4KDEA 3L0DA 4WLUA 3RC2A 4GMFA 1YO6A 2DFVA 3KYCB 5L51A 2R00A 2HMUA 1Q7CA 3JQBA 1PTJA 3NT5A 2J3JA 4Z0PA 5CHEA 4MVJH 2C2XA 1Y8RA 4R51A 1CRWG 1AVYA 2J5KA 3NGLA 4MVJA 5B4TA 1UDAA 2I99A 1SO8A 4CMIA 1NWHA 1IL0A 1Y8QA 1ZNQO 3CEAA 3O03A 3NRCA 1QYWA 3VHRA 3DBRB 3BMNA 4W82A 2W90A 4E2YA 3NAQA 1QORA 4D79A 2WE8A 4WE3A 3CIFA 1KC1A 5B4UA 1LU9A 3EC7A 5L7TA 4RLHA 2Q1WA 3E9MA 5DOVA 2QG4A 5TT1A 2W2KA 1XCBA 2IEBA 4YT4A 4E5NA 1F12A 4PFJA 1B8PA 3R1IA 1NQ5A 4PLTA 1NYTA 1Y5MA 1EE9A 4G5HA 1H2BA 1AE1A 5C7IO 3FNHA 4GX5A 5CAEA 3WIDA 1C0PA 4TZKA 3UFXA 3AUTA 1QXSA 1A71A 3WGHA 2WM3A 1NQTA 2B5VA 1SC6A 3FI9A 3TN7A 4XB2A 4LVCA 4BNWA 3A14A 4DLAA 3OFSA 1SNYA 5BQFA 1HETA 3EY4A 5IDQA 1HYHA 4JP3A 3W6ZA 4FB5A 1XELA 2C2YA 3WB9A 2VRBA 2HAEA 2RBEA 3JD4A 3OJLA 5DCWA 1ZK0A 3RUDA 3PHIA 3U4DA 1DLJA 3ON5A 3DWFA 4PCVA 2D4AA 4D45A 3MJEA 2AE2A 5G4KA 4LMPA 1CETA 3HQ4O 1ONOA 3F47A 3B70A 1EE2A 3ZGYA 3AUUA 4Y98A 1PL7A 4J2HA 3R0IA 1W6UA 4LISA 5JE8A 3ONFA 1EFLA 2O3RA 2VYNA 5BNTA 1QLHA 4K28A 4K6FA 4EDFA 4I5DA 1JTVA 4CLHA 3JQ7B 3WYBA 1U7HA 3H6KA 1N1GA 4Q3BA 2HDHA 4R54A 2GN6A 2Q2QA 4TKLA 5EL0A 3ZHYA 4IDDA 1XHLA 1ZZEA 4E13A 2WD7A 3QWHA 2PWZA 4J43A 1Z74A 1LI4A 3QVTA 1JU9A 3ITDA 2J5QA 3BMCB 5BSFA 1DJQA 3EVTA 4MKRA 4QO7A 3HHPA 2AEJA 4NBVA 4TRNA 1KEPA 3WFIA 2DBRA 3DZFA 5MGBA 2P2SA 3RBZA 3NUGA 5A06A 1B14A 2OO5A 3V1YA 2CVQA 1BDMA 2Q4EA 4BO9A 3DZJA 4P8RA 3GHHA 3NTOA 4OQZA 3BMQA 3HB4X 4INAA 4MVJF 1JVBA 1L7EA 4A5OA 3RJ9A 3GK3A 4CQMD 3KYDB 5EERA 1MFPA 3O38A 4K9DA 4NBWA 2YQ5A 1P0CA 5IXYA 4RVUA 1LLCA 3JQ6A 1GEGA 2WYUA 4J16A 4BNUA 4YA6A 4MDHA 2VYVA 4KQWA 5TF4A 2ZYDA 3KHUA 1X0XA 2DVMA 2Q45A 3ZV6A 1WXDA 1ONPA 1W4ZA 1GR0A 4XYGA 1PS8A 4M1QA 1Q0LA 4CUJA 1WLYA 1EMDA 2DLDA 2HJRA 3C7DB 1CIVA 1F06A 2JL1A 1U9JA 3QHAA 1NFQA 3OJEA 1IYZA 4DPKA 4YAKA 2O4CA 3I5MA 1BVUA 3WQRA 5TNXA 3AM5A 4A7PA 3PJGA 3EZLA 3GVCA 3LF2A 1QYCA 3L4BA 1V3UA 1WPQA 3OQ6A 3GN1A 5K0ZA 4R1NA 3AI2A 4GSKA 4DTIA 3PWZA 2ZKLA 3NJ8A 4WNCA 4JIGA 4NZ9A 3K8ZA 2V6FA 4DC0A 5C3MA 1Y8QB 4KDFA 4NPCA 5AXBA 1EVZA 3TOXA 2GGSA 4CMCA 1AN9A 1LLDA 2NU9A 3TZHA 4Z0TA 2BELA 2Q1TA 4J4BA 5AVOA 2B69A 2B0JA 3CZRA 1A4IA 4YAEA 8LDHA 3GEGA 4WCDA 4ALIA 4ZA2A 4XYBA 3WGIA 2VUSA 3D7LA 1HYGA 3KLPX 1A7KA 2D5AA 5ICSA 2AW5A 1LQTA 5IN4A 3H2ZA 1ISGA 1ORRA 2VWPA 2ZTLA 3AUAA 1RKXA 4PGFA 2DTXA 5JC8A 2PNFA 1ZCJA 1O8CA 3ZWCA 3SC6A 4YJHA 3GT0A 3IJRA 1KVRA 3HZZA 1NASA 1LA2A 4UVHA 4OKIA 2DM6A 1B7GO 1LDBA 3OEYA 4J0FA 4Q3EA 4WEOA 4WNIA 4Z3KA 2V6MA 2ZB3A 1DPGA 2YW9A 1LEHA 2P4QA 3VPSA 4CLRA 1T2DA 2AEFA 1TEHA 3DC2A 3FCOA 4OSPA 3X2FA 5KTKA 4E21A 2QZ9A 3PHLA 4NDNE 5DCYA 4CMBA 3WJ7A 4JBHA 2G76A 5HRUA 2ZTUA 1DAPA 1R12A 4YJGA 1WW8A 5KJFA 4BO6A 1XU9A 4NBUA 3OMLA 1A9ZA 2EW8A 4LMRA 3I1JA 4R3NA 4RVHA 1M75A 4L8VA 3QVOA 4CMJA 1R0KA 2UUOA 2H63A 4I5GA 2X7HA 3HDYA 1XU7A 3U9LA 2R2GA 4MP8A 5F5LA 4CODB 2OL4A 3W4JA 1UXIA 4NJMA 3WSWA 3WG9A 5CG1A 3LDHA 4IIUA 1KEVA 1GADO
chains in the Genus database with same CATH superfamily
4ZZ2A 4NZZA 5FFMA 2XTAA 3V3KA 2GSWA 3KAJA 4C08A 3MMNA 2ETXA 5FL3A 4RF5A 3ZWAA 1CQXA 1NF3A 1SUAA 1PE0A 4TZ0A 3L35A 3BDIA 5CXUA 4MB2A 4JL6A 3KHTA 5L6LB 1LX7A 3RFVA 5BMVF 2QB5A 3PRKE 1G66A 1L4UA 1V7PC 1DUSA 4Y2XA 4QARA 3K9BA 2C78A 1MIOB 1IXRC 2V9CA 2EFCB 1XF1A 1IHXA 2Y1OA 2C7GA 1QIKA 3OPQA 1GSOA 4YYEA 1FBMA 1W76A 2Y71A 3DOOA 5DLPA 3CSUA 4ZVSA 5AW7A 1H6CA 4EAQA 2OGUA 3WU2H 2BLLA 3S8YA 1KC8Q 2NLOA 2ZVQX 5K3EA 3UV7A 3DEFA 1ZJ5A 4WX2B 4A73A 3VU9B 1SAYA 3VKWA 5BU8B 3I55P 2QHXA 3GFRA 4AUNA 1K86A 4DT1A 5C1BA 1IN4A 4BO7A 4FEEA 2F64A 4IIGA 1LZLA 3DMDA 1VPVA 2WILA 3RGGA 4NK5A 1E3IA 2WSFJ 1JUNA 5FKJA 1LJ2A 1ZHHA 5DP1A 2QVGA 2CNLA 3L8EA 3THXB 3E8MA 1WUJS 3T12A 2JVIA 2FN9A 3E4CA 1Z0ZA 3F9RA 3HI6A 2OE2A 2VTDA 3RYTC 1U7UA 3D7KA 4P3NA 4MUKA 2JGDB 2GCGA 3GCZA 2XUOA 2A1UA 4AMUA 5C53B 1G6KA 1O89A 2YWRA 4HVTA 1GZ4A 1QYRA 1SBNE 5AUOB 1M1UA 4KNWA 3PGKA 2NSHA 1UXKA 1RZRA 5FAKA 3QEMA 1Y3AA 1T4MA 5JH7A 5FOVA 1BWSA 1ZBQA 2XBLA 3UXHA 1YR1A 1HEYA 3CXRA 4MGEA 4B5KA 1YBHA 2R5WA 2XYVA 2FE4A 4JJ4A 5F76A 5AXDA 1VKNA 1D07A 1UJ5A 4WGGA 1J1IA 2TMKA 2JRLA 3ZD7A 4H59A 1CRLA 1EGMB 4B86A 3IAM1 4CLEA 1Z39A 4I4LA 4S05A 1XA4A 5FFFA 1UZAA 1GNQA 1NMQA 1A9TA 2E3JA 3UQYS 4GP9A 3WICA 2Q6OA 2NTJA 2GQ0A 3FTPA 3JYLA 3BSFA 3SDBA 3RNLA 1O9BA 4QEKA 4BFLA 2ZUCA 2BEWB 1UJMA 2P0YA 4MHSA 4F71A 4ESHA 4ETWA 1JVNA 1ZEMA 1EAYA 4XD7A 4LV6A 2GLUA 2C82A 3A0HH 1NW7A 2GZDA 3FYUA 1U6IA 3DP9A 1X22A 3SHOA 5T6MA 4WNAA 3WMXA 1XZMA 5EHGA 4W1PA 3EIFA 1T8SA 1TAHA 1OFHA 3QFTA 4RPJA 2I4NA 2R8RA 2NQTA 1KI9A 4CR6A 1YNOA 2QYOA 1XYGA 4JN6B 4ARBA 3ZU3A 2DWPA 4M53A 3G5MA 1EXIA 2X9GA 3PX3A 2HADA 2WUEA 2EDCA 1YS7A 4OPMA 2F7SA 4N7RA 1W0KD 4I1SA 3FXDA 3SJZA 1E5TA 1XNQB 2P5UA 4JROA 2PNJA 3KL4A 3NGXA 4L3OA 4GR9A 1JE1A 3OQ1A 2J7PD 1GARA 1KFEB 3EDRA 3QVGA 2L5GB 5HKOA 2R8YA 2ATIA 1V6SA 1NZFA 2NUPA 4UVDA 1EAMA 1RQLA 2FFAA 2G9ZA 4Y1RA 1Z5ZA 3S9OA 5J2UA 1U04A 4EATA 2E6KA 3DKKA 5ERYA 1YDMA 3LE8A 3IQEA 5ICGA 3ETLA 2IQIA 3I9V6 2GDJA 4F85A 3FPKA 4JSTA 3L1KA 4HNQA 1CDEA 3X0DA 4AJOA 1MKMA 1E8DA 3H3FA 4QUEA 3OZBA 3I01M 4TRRA 3TINA 3DTVD 3TOVA 4D9CA 4NE7A 3RIEA 1E0KA 5KC8A 2NTEA 4XFJA 2DH6A 3GFVA 3DBLB 1L3BA 4KIWA 2C9LY 2R11A 4DA9A 1Z06A 3L4KA 2Q7CA 4ZAFA 1EFAA 1W0KA 5K0JA 1OV6A 1F8GA 5IKMA 5C0OE 1U7DA 3D0OA 2CHGA 1PJ2A 3ZE8A 4DQXA 3CVXA 3ZVRA 5FNZA 1AH2A 1TU3F 4HN2A 4IXNA 1NXVA 3GBVA 1PT9A 3OZGA 1FFAA 4H4EA 3TIVA 3KYJB 1GPYA 3P7KA 5SICE 4J0QA 2G4CA 1Z2OX 3L8CA 4TQGA 5TMPA 4FSXA 5FA5A 1SB8A 2VTBB 3I64A 4IY1A 1N3IA 3OZIA 4H31A 4EYSA 3V2NA 3GFTA 3L75G 3HD7C 3SR4A 3EVAA 4KQ1A 2YMPA 2WSCH 3LKBA 5ALEA 3R3JA 3AVQA 2WJWA 2WF5A 1TEVA 3VPXA 4HYYA 1VA5A 1QP4A 1TA4A 3VYTB 5BWLA 4BLQA 2AOXA 3DTVA 1KMQA 4HDOB 3FRJA 1FRFS 2Z5GA 4ZT5A 1KI8A 3ZWXA 1SU8A 4B6PA 2NWQA 1NR7A 4HNGA 1T1JA 2JZNA 3P7MA 2VKQA 4DN6A 2WAXA 2Q4BA 3PZBA 2E7ZA 1UAAA 1CJCA 3WO1A 2FYNC 4TMVA 1QOPB 4YRLA 5BRJA 3ROGA 5APUA 1P6UA 3QF4A 2P1JA 4OV6B 5BN5A 4UFNA 3E84A 5C8ZA 3NT4A 2WJ3A 2C9CA 5KREA 4B4WA 4DLUA 3U7GA 2GETA 1TMKA 1L4EA 4A26A 1OI7A 3R3WA 1KAOA 1YE3A 5BPFA 3WIBA 3WWZA 1ABBA 1XZEA 1NR5A 2JCYA 4JB8A 3VRHA 2C29D 4HT3B 2VYFA 3TBKA 5DM60 1BDCA 1Y6JA 4B3RB 3FR7A 4PC3A 3IL2A 1SQ5A 4XWYA 2NIPA 1O6ZA 4E22A 1AKNA 1T29A 4G9GA 2P79A 4QGFA 2WDZA 2PUGA 2X1LA 4KVAA 3DXXA 1QLJA 4L02A 3H17A 2PXCA 1COWD 1R8JA 4PAGA 2WHPA 1I3CA 2PBFA 2P1RA 1GUYA 3UB2A 2FZWA 2VC2B 4XX1A 5EC8A 3HD7B 1PNVA 3W2IA 4OSOA 2YOFA 3L7YA 4HNSA 1J07A 1C3LA 2VJNA 2AFIB 3I9V1 4P54A 3BIXA 1Z83A 3D6VA 2IHJA 3TOZA 1QO7A 4II7A 2ZYVX 4QXPA 5LOVF 3N7TA 3LYHA 1QF6A 4TWRA 1IFMA 3VKUA 2ZDGA 5CYFA 3KR1A 3QVSA 2R8PA 1ZMOA 1BDDA 5L8VA 2YS6A 2Z2YA 4RIHA 3VBEA 2DF8A 1IM2A 4RK7A 2QQ0A 3FROA 4I4NA 2E18A 5KTTA 2IYNA 4B1FA 2IEGA 1GTWA 1ISMA 2QVXX 1ODSA 3WYCA 4K3UA 1QYIA 2LD4A 5LXTB 3QE0A 2K7FA 2OB1A 1OGIA 2FYNB 4ITUA 4GEGA 4Q9KA 4BNGA 3JZMA 2FCAA 1COWA 1G0NA 4Y6GB 4L6CA 3LKVA 3N2YA 2C0XA 4MEBA 3ICPA 3BWVA 1G42A 3LRXA 4Z4GA 4W63A 1JLHA 1SGWA 1G16A 2JFHA 3ORQA 4KPUA 3BD6A 4X91A 1NM5C 1Z7EA 2AXNA 3IR6A 1AHNA 3MWDB 1HRDA 3D02A 2K88A 4CW7A 2F9LA 2Q3MA 3ZHQA 4WWIA 2X23A 1RYMA 1XE3A 4UMEA 5KYKA 4ED9A 4OFXA 4RJKA 1H94A 4EP1A 3WGLA 2XNCA 1HT0A 2J9RA 3PD7A 1SHKA 4IIVA 4NV3A 5JSKA 2D1TA 2C98A 3T0FA 4MWSA 4JSRA 2P91A 3AEQB 4CG2A 4ESVA 3HMKA 3WLEA 4AUEA 3JALA 4NBTA 3FZQA 2VJQA 1NVKA 1J70A 1MZPA 4ND8B 2G8LA 2OQQA 5EUQB 2QZPA 1YQDA 4AJPA 4GPAA 4JOBA 2NVWA 1YJBA 3DLPX 3CRQA 1Y7PA 3HP7A 1CB7A 2GJ8A 1RAAA 3UMBA 5BUQA 5C1OA 5GWXA 2I2DA 2NTNA 1ESZA 2PK3A 3OA0A 4U9IS 1JP7A 3JZIA 1VMEA 1XTUA 3VBCA 3U4HA 2X4DA 5AI4A 5AW5A 3KDAA 2DHEA 5M04A 2Q6KA 1LDEA 3OEWA 1RP1A 5TQVA 2BJVA 3TQSA 4MUYA 2HPHA 4FX2A 4AG5A 1JCCA 2I3DA 3EHEA 3H1JG 2F3RA 4RKRA 4AS1A 2AG0A 2B92A 3CGGA 3AY7A 4L5BA 3NTLA 2CLHB 1BC5A 2Q3BA 2RH8A 1EK6A 1QE0A 1JNMA 1DMRA 1YWGO 3G2IA 5CNIA 3HE5B 1P1JA 5BR1A 1L1EA 2Z5FA 5AVRB 5C8YA 5IVPA 1D0VA 3IPRA 4ZYZA 2VT2A 2IYXA 2UZ4A 2B2XA 1T0BA 3G2QA 5CH8A 2B2CA 1AUOA 3SIWA 1LC0A 4K9NA 1GRVA 3T5DA 1IM5A 1JHYA 5FP0A 1NX6A 3L8ZA 3LG2A 2NXEA 4G09A 4U8HA 5CAEB 4B9EA 2B4KA 5IMSA 5I8PA 5AVSA 3MQ2A 4HHEA 3RKUA 3D6FA 4FZJA 2AI3A 3CZCA 3K2BA 3CZ5A 4WXPA 3FWNA 4TV8B 1CZKA 1KA9H 1Z4JA 1N36B 3BG5A 1XZKA 3SC2B 1E2QA 4ZMDA 2H1LA 4OEHA 2H08A 1XXHE 1GFSA 4I6EA 3O2SB 2FP4A 3ND5A 1AA6A 4CKXA 2WUWE 2ZWPA 5HKAA 3Q5SA 1RLUA 2A35A 2Z8XA 1T5SA 1YIAA 2G3YA 3UPUA 3UWKA 3KWLA 4B4VA 1N33B 2HQ1A 4NESA 1ZRSA 2UKDA 3WP0A 3G4SP 3F1LA 3H11B 3WYDA 3MRVA 1JMVA 4Q02A 3MJCA 1RCFA 4RAOA 3F96A 2XMCA 5L3QB 3QELA 1U8TA 5GM2A 5IAGA 1NLZA 4D9KA 2R7KA 3FXEA 3KU1A 2RG1A 2YTZA 1H0TA 4PC6A 4MA0A 4JYMA 1PJCA 1YVUA 1XPJA 4IICA 1KU6A 3QWAA 4AJ2A 1S7CA 4ZQBA 2XU6A 3WYNA 4C6RA 4G0OA 3N0VA 3DZBA 5CA1F 4AWXA 4C0LA 3F9IA 2WVAA 4CLRB 3BULA 2BAGA 5JC1A 1VXRA 3DFUA 1PJAA 3TK1A 4ER7A 1GW3A 1RHUA 5KTBA 2Q1UA 2QTRA 3WLQA 3GZNA 2XOEA 2W6ID 3OHMA 1E98A 1SUCA 4HGRA 1L1FA 5HFAA 4JQYA 2WWYA 2XRMA 1V43A 2CJYA 1Q19A 4GOXA 2FQQA 3I9KA 3FA2A 1S3IA 2CCKA 4A3SA 1VSVA 4RXMA 5DTQA 3JQPA 1ZK4A 1Q20A 1U99A 3WB0A 4TRMA 3A3YB 2VHZA 2DY0A 4OBBA 1BHO1 1AS0A 1OWMA 4LF7B 4X44A 2F1JA 3LBAA 2E74D 2I66A 1HC7A 3MWJA 3KPYA 3UATA 4V2IA 1PLJA 2YJTD 3JD3A 4J3FA 3MSXA 1U4OA 2W2NA 5LSAA 2JC3A 1E1RA 4R1LA 1NRJB 4NQZA 5JYBA 3WLAA 1X2EA 3AIIA 3SHVA 4CKEA 2C3OA 3UWMA 1AHPA 4D3FA 2JJQA 4JWKA 1MVLA 1DKQA 1YHYA 3PPWA 1IXSB 3D3EA 4OK3A 1I10A 5H1YA 4RTOA 2OTJP 5A5DA 2Q4OA 5K4AA 1TO6A 5TGTA 1TGVA 3DS8A 3LP6A 4UNQA 1FS0E 4B0OA 4H7IA 1M56D 2OTKE 1V47A 4BMCA 5BNFA 1VQNP 3ABQB 4WV3A 1I2ZA 4Q3AA 4FGZA 3TNUB 5APTA 4NYJQ 3DTNA 2ECQA 3R6LA 5JAUA 5CTAA 2NMVA 3GFGA 4EG0A 1ZOOA 4DWOA 1G3QA 2BI8A 5ITZB 1VSQA 3RUIA 1QFJA 3CZPA 4E1BA 3M06A 3PF8A 1Z7WA 1ST3A 1XZCA 2QE7D 3TAUA 2F3PA 2PT9A 1KMNA 3L0CA 1O97D 1OKKD 1JR4A 3RV4A 4QUIA 621PA 2XUQA 3MJFA 3RSZA 3ZW8A 3VU3A 2A9QA 3EA5A 1T36B 3FR8A 5KYXB 4TYQA 5CT8A 3CLTD 2VDWB 2FP3A 3OMWA 3NAGA 3AVTA 1WB9A 1OZFA 3VNBA 2OORC 5DWQA 1NKVA 3UJDA 1X7YB 1NI3A 2XW6A 1VP9A 3T94A 1LW7A 1BX1A 4HRXA 3E15A 3KYCB 1Q7CA 1KB9E 4UBJA 2IS1A 4RMJA 4CMIA 4KYIB 2BEJA 3DBRB 5HZGA 2CNKA 1VI5A 1LU9A 1EJ0A 5TT1A 4FKMA 4RA9A 2V5UA 1THTA 3E3AA 3IOMA 2JAWA 3FNHA 2Q07A 2PUEA 3D1JA 1NQTA 1IDN1 2VAVA 3A14A 2LV8A 3AT1A 1SCQA 3WB9A 3EF0A 2WMYA 1X7XB 3CJRA 2XVMA 3LIPA 5FBVB 1RAHA 1WIWA 1FJGB 3F47A 1SQBD 3HR8A 4MRRA 4Q19A 2G4LA 2PWBA 5TMEA 4RTNA 1SY7A 1QLHA 4AMVA 2R4TA 3JQ7B 3H6KA 3IESA 3AETB 1BE3D 1LI4A 4TYPA 3AY0A 1QG4A 4TRNA 3GLFA 1KEPA 4KLCA 2NO9A 2OO5A 3FNIA 4E70A 3J81k 1OLXB 1T3SA 3MCZA 3GCWA 5LZ9A 4Z49A 1QHNA 2D74A 1JIIA 3O38A 2YQ5A 1UFRA 2B0CA 5A7HA 3TGLA 4G5SA 4R9VA 1QQ5A 2GEVA 3L02A 2JL1A 4WFIA 1MB2A 4KVFA 1MJ5A 3V8NA 3L4BA 3OQ6A 4ROTA 4DMCA 4GU5A 3NJ8A 1RC1A 4WNCA 4NZ9A 1JTFA 3K8ZA 3CCUP 5KAIH 4WERA 2A45G 2YWHA 2EJCA 4JI5B 1JFRA 4R2KA 1SULA 4YAEA 3ACBA 1VLHA 2BCEA 5DBHX 4XA4A 2D7JA 4PGFA 3C48A 4BFCA 4LSZA 1IG3A 2DZDA 4WEOA 2PS0A 3ISTA 4JLOA 3QYPA 2VYQA 4P4TA 4PNPA 3VC3A 5KJFA 4BO6A 4H7JA 4EPYA 4MW9A 4L8VA 1FQJA 4PTLA 2L18A 2QUKA 4WAUA 2OL4A 3NKFA 1NDQA 5CG1A 3LBNA 4ZYUA 1BD4A 4GX2A 4CRWB 3E8SA 5E7IA 3GG2A 3M5WA 1N8KA 3ZI7A 4MWBA 2AXQA 3KC2A 2D0OB 2GZMA 3ZY6A 3HJBA 3BMQB 1M8PA 2K5UA 4FDAA 4K8RB 3PLAE 1UM9A 2DR0A 4EGJA 5IG2A 4TVKA 2OHXA 3ONVA 3AG6A 1I3NA 3FRIA 2J67A 3ZVLA 1RW4A 5ALTA 1WRBA 2K4MA 3ZJ4A 3AF3A 4CMEA 2VK4A 3V8MA 4X1KB 1RVV1 4TVSA 5C9ZA 1FVXA 4M86A 2FFJA 4EB0A 4Y6OA 4K1XA 5LC1A 2HZBA 3ADCA 2VI5A 3ND9A 2ZVNB 5DM4A 3QSGA 1US8A 4FLFA 4OTZA 4UOZA 1FTGA 3RRJA 4EUEA 3TGUJ 1HQCA 4H6XA 1SQVD 4I66A 2OA0A 5JNUA 5FUWA 1Z17A 3EMDA 1KFCB 1UOQA 3OHSX 2VJAA 3K9HA 1TZJA 2X8LA 1J2JA 3C7AA 3LPCA 4YJGB 4GKJB 1RJ9B 3ZU6A 5E1OA 2KIKA 4UTPA 1ZGJA 2OP1A 4QRIA 1DC5A 3SXJA 1L5RA 4X93A 4EVSA 1Q2XA 3MAGA 4WWHA 2JFFA 3ZV4A 2CLSA 3TNFA 4PW0A 2BSXA 4OGFA 1DRWA 3UBMA 2WD8A 3R23A 1RKUA 4H15A 4WXMA 4AZWA 3IV7A 3MD0A 5IZCA 2IZOA 1JXAA 3S1AB 5MGNA 3W79A 1S4XA 5LYJA 3MPUA 1I3OA 2AWNA 1II9A 2GXQA 5LCXA 5K3OA 1ZUWA 4NV0A 1BSVA 2DWQA 4L8LA 2ZRQA 3RUHA 5JAQA 5AQEA 4DIUA 3OICA 4DSZA 1YULA 1P7CA 3ZCXA 3EODA 2IU0A 2ORYA 4AJKA 3ZBUA 4PYMA 1EJBA 4ALLA 3K2QA 4JEHA 1UJBA 3M6VA 2I22A 2O2GA 5TGDA 5BY2A 4ZEOA 5IS2A 3AE2C 3HP1A 2VPTA 1HBWA 1XDGA 1R9NA 1EWTA 3W3AA 3F7OA 1W75A 3ETNA 1OZAA 1HRKA 1IULA 7REQA 4MDEA 3RVJA 3ILVA 2YXDA 4OHUA 3QLUA 1KNQA 3E6AA 5DWDA 2IYAA 1NRXA 5L4LA 3IERA 1RPAA 1H0KA 5JFGA 1KYVA 4BX3A 3TUIC 4UU8A 1CIPA 3S29A 2FJUA 3G68A 2Y9MB 1SFCA 5FPSA 4BMYA 3MRXA 4XSHA 1VHDA 1NTZG 4KACA 4L6AA 5HIJA 2WG1A 1XL0A 2PZFA 1FU1A 1YOVA 5GTIE 5AW6A 2V1XA 4JITA 2H8PD 2B20A 4YEDA 1TIBA 5D2CA 3HWWA 4ND5A 4ERNA 4PONA 1K2WA 2ISSD 4K88A 2LXCB 3H0KA 5DLQC 3DQZA 2HHAA 2WJZB 3OPVA 3O1HB 3V42A 4U7HA 1B6TA 1CNFA 3W05A 4A2WA 1KILD 4N5NA 3G6EP 3ANLA 2OHFA 1OPXA 1VG9B 1R8SA 2OXFA 1VP3A 1SXJA 2W4QA 5HGXA 4PG6A 2IH4A 2V0NA 4NDAA 2ZRDA 3RS7A 1GXSA 1Z0SA 3NCTA 4X20A 1J22A 4CM1A 5ED4A 2IDKA 4CL3A 3GXOA 2O8BA 1NF9A 1ACLA 4CGYA 2DLNA 1OT3A 3NPAA 2L42A 1URQC 4IQGA 2ZWVA 5C18A 3PNKA 5CIWA 3C6KA 2UYHA 1G41A 1ZJ6A 4OLAA 2JLVA 1RI4A 3DLBA 5IEJA 1OXKB 2P5YA 1G2CB 1KYOH 2Q5LA 3MLAA 2EKLA 1MX5A 1YAHA 3N59A 4MPRA 1VL8A 4I50A 3N58A 4IMPA 2BJWA 2G1AA 1ECPA 2B1IA 4KQJA 4M1SA 3VH2A 5TLSA 2ESRA 4CV3A 3GUHA 2HPVA 2V7QH 1SHTX 1ULUA 3IFMA 3BQMB 4FNGA 3I2HA 4AF7A 4C7RA 4GC5A 5AJZA 4JOQA 3HJNA 3FCCA 1ID1A 4IDEA 4KRYA 5DNWA 5JAZA 2XCIA 4R2HA 4Z4CA 3DXYA 2F1HA 3KQTA 4DUGA 1LGYA 4Q3NA 1LW6E 2CL5A 4PS1A 2HR1A 2XVZA 5KPJA 1SVMA 4TMWA 2HSZA 1O9HA 4K26A 4C6SA 2H1IA 1PD0A 3CH6A 2FSIA 5G4LA 4JBGA 4ZVQA 4M37A 4FFOA 3UPTA 1IFXA 3RS3A 2W6AA 1KO7A 2P5TB 1TEXA 1I01A 4HNTA 1U1CA 5EJ4A 4RADA 3BB1A 3N8NA 5CCDA 3Q2IA 3Q10A 1Q0QA 1XU4A 4OOEA 1C3VA 4W4TA 2N1TC 3BERA 1KHTA 3ABSB 3DAYA 1DEBA 3V48A 1S5LE 4QQFA 3DNMA 4U5XA 2IUSA 2WWWA 3KG2A 2KOGA 3H8VA 1OX4A 2DAPA 4ZAVA 4MGIR 5DZSA 2QUJA 4KVZA 2RKOA 2P3LA 4KAFA 3OD5A 5B66E 4DEVA 1N2ZA 3H1JJ 4UOQA 3H9EO 2APJA 2OYHA 2D13A 2W11A 1GQ2A 3ZHZA 4CDRA 1S2DA 1URQB 1U0TA 3A7OA 3MJTA 4M89A 1E4VA 3FJ1A 2DYKA 1H8HD 3SQWA 1O95C 1P7ZA 2OTCA 5CCGC 4CR8A 2FYUJ 3FWZA 3OPMA 1GPWB 3IE1A 4XB1A 2YJGA 3CHYA 4FILA 4JELA 2X5KO 2QMHA 2QN9A 4N7MA 4NCXA 4P7KA 5CT9A 2JFOA 3W67A 2FPIA 2WOOA 4EQZA 3NU1A 1M9NA 1ONNA 3EZ7A 1IK6A 4CQNA 1H5QA 1ZI9A 4DBLE 3PWKA 3S4YA 4G25A 4B4KA 5JVDA 1ZMEC 2IPMA 4TYNA 3H3XA 4XYEA 6REQA 3D6NB 5BWNA 3VOTA 4Y2SA 2FVXA 1OHHD 2ZTSA 4DMLA 3V7YA 4EKNB 4PZ0A 1T0UA 4NCHA 1L5NA 4JJIA 1PZGA 3SJ7A 1TTPB 5CA1B 1NTMJ 5D3KA 6ADHA 2E82A 1GD1O 3VYSB 1EM6A 4CM5A 2DH5A 1I1OA 3PEFA 5EMNA 4RK6A 2OQVA 2C7QA 4FQ8A 2Y3IA 4NCNA 1HE2A 2IX9A 2X3YA 3GHGC 4N5LA 1P5FA 2W6JD 2G5CA 5C7LO 4FOOA 2QMYA 2IYSA 2VRWA 5LXTF 3GX1A 3JQ9A 2N1TB 3IXLA 5JUWA 5KSOA 4QATA 4MRMA 2RGXA 4H17A 3EWNA 4UATA 4OG2A 1OLOA 4DY4A 1S7GA 4IJ5A 4IO0A 2JA2A 4RMGA 3NV9A 4KAJA 4EG7A 2AA3A 1IRXA 4H3SA 4JHLA 3T9DA 4FQ7A 4ZVRA 4QOGA 3OOJA 1XD8A 1QIHA 1JY3N 1U5BB 2C1ZA 3UJPA 3GIWA 1GFZA 4IEFB 4WADA 2BEQD 1DHRA 1GZHB 1VIVA 121PA 3TLGA 3RJ5A 4RE6A 1ZN8A 3EIEA 4G9EA 2XQGA 3OLWA 1B00A 3N28A 2D06A 4UEJA 4Z3DA 2UVDA 2Y77A 4LY0A 1DTEA 2IYEA 5JLAA 4ALJA 3L0BA 1K8XB 4P1ZA 1PP4A 3F6YA 3KV3O 1G6Q1 2LR0A 2ZPUA 4WGFA 1KDVA 5K6TA 4FYJA 5CBKA 5CLFA 2LUOA 3QI7A 2RGWA 1JKJA 3JASB 3ZWKA 1FEZA 3E5MA 4FTWA 3OZTA 2Q4RA 3I1YA 5JDIA 2QUZA 4LRTB 3DFZA 1J2YA 4B79A 1DBWA 4BU1A 4EWLA 2AFHA 2RHDA 2PRIA 8ADHA 3M9BA 3LO5A 1JE0A 4U6NA 2QDKA 1UJ4A 1G9TA 2I6FA 3D8SA 5CCBA 1FNCA 4EPRA 3O9ZA 1Y63A 4BMXA 3IKJA 3U37A 1Z5VA 4ILKA 1AHIA 5AW1B 4L75A 1E1LA 3IFSA 4F4HA 3IDAA 4OCZA 2ZE6A 4JP5A 4R3UC 2XMPA 1TZMA 2BMFA 3RS5A 3EXG1 4BUJA 2KI7B 4C1BA 3W5CA 3GHGB 5IM4A 1P17A 4KO4S 3B5NC 1Z2CA 4BNFA 3BCUA 1L4KA 3KUDA 2M8RA 3RL0C 3MXTA 1TKCA 3JVDA 5C8DA 4ZI7A 1VQPP 2OQIA 4WK6A 3PWSA 4AKGA 2HCFA 4P36A 4XDZA 1KYTA 3C85A 3FCAA 4URFA 1BSHA 4HH2A 2P1ZA 3FVQA 3JC22 1VG0B 5CDFE 3NBUA 2AC7A 4AP9A 1D2EA 1PP9G 4NK4A 3RU7A 1J42A 2CXHA 4CQLB 3AR4A 3HCWA 2YZ7A 1QDLB 2PRYA 2D3WA 2A06G 4BDSA 3GPCA 4L50A 1WSAA 3MTGA 2G07A 4BLWA 1CNEA 1W0CA 2JHAA 1FYVA 3GDGA 3LFUA 1HFJA 4K0RA 1NSFA 3DHYA 1RWKA 2ZB8A 2CV2A 3KVNA 2BFCA 1VE6A 3TX6A 5HRCA 4UCXA 3LC0A 3BMNB 4PVDA 4AJLA 3OE7D 4D43A 2YNMD 1QRSA 1H4SA 4YAIA 4JCCA 1LI5A 2AJBA 2VPWA 3AR7A 1Q91A 1V9LA 4EI2A 2QAJA 1Y9AA 3ZDEA 1ZC3A 4IHJA 2X7JA 2IZZA 1SKYE 3G5UA 3CINA 2IXFA 2OUIA 1ZNXA 3X1ZA 2XUKA 2P4EA 1RI2A 3GZTB 4RHFA 5EJMA 1ZVJA 4IQ0A 2YXNA 2P6RA 2ZCJA 3NOVA 1L8AA 5CIYA 1L0LG 3FZNA 4N5IX 4H44C 5CTJA 1NA5A 3W2TA 4UARA 1OH5A 3PC3A 4YRIA 4BNDB 5JXWA 1DO0A 1WCIA 3HM2A 3N2GB 1QFYA 3D71A 1RRPA 1MTOA 4J75A 4EFDA 5REQB 3BTUA 1ODFA 3SFTA 1SQSA 2EIHA 4G1BA 4V0OA 3B5NB 1W5FA 2A9KA 3PD1A 2E76C 3SEZA 1Q1NA 1E77A 2PH5A 4EOGA 3GUVA 4BYMA 4DXHA 1YZQA 1VTKA 4TMYA 3RL0B 2CDCA 4DNQA 1L7XA 1DIGA 1HDYA 3HXOA 1TM7E 3V6IA 3WJAA 1USGA 2YHSA 3W77A 1QQTA 3H5AA 3ZWVA 4P5DA 1N25A 3CIOA 2E42A 2BCGY 2OYOA 4PFQA 1W9HA 3TMYA 4PHCA 3PXUA 5T8KC 3UMRA 2KSQA 4GSLA 3ETCA 1SVWA 1LSJA 4HZUB 1Q0SA 4Y2QA 2IZ6A 2VEDA 5F1PA 1WD7A 3FH0A 4QVIA 4U4AA 2I67A 3W90A 4JQOA 1VC2A 3K9GA 1J00A 4DDVA 1UWCA 1GK6A 3T1TA 2I8CA 4JLWA 2YNYA 2H7YA 1GL2D 5KJCA 3S44A 5IKXA 2HK6A 2LPMA 3EQ7A 3FOBA 2XJ4A 4QYSA 2FPXA 1DKRA 1IJFA 3INYA 3GOQA 4E3ZA 4BXLA 5FA6A 1W73A 1Z8FA 1HL3A 4HF7A 4M1EA 1I2AA 1I7PA 4X61A 1L7RA 4TMFA 4DCVA 2GEUA 2D1YA 1ZMRA 1ZD9A 4AL4A 1DXOA 1ZD1A 4M0DA 3JCZA 4DRYA 4JBXA 4NIMA 2RGYA 4UU1A 3HM9A 3PDHA 4PHFA 1OBFO 4X65B 4YXFA 1W5CE 3IBTA 5CD9A 2SCUB 3P20A 3MWEA 2VTEA 4YLGA 3N05A 4MB6A 4H44B 1LSOA 1N7LA 2G5GX 2AE1A 2JGLA 3GZJA 1Z8NA 1B0ZA 2GUSA 3OKAA 2XXAB 3UXEA 3CX3A 1KYXA 1G8GA 5FWYB 1QE3A 1N34B 3ZWYA 2PD6A 2ILVA 3R5HA 4A0SA 5AUNB 4BEBA 1T4CA 1ATZA 1C7IA 1Y3DE 4D4KA 5DHFA 1DX6A 3GLTA 3P0HA 3MD9A 5HIIA 4Z2YA 4BO5A 3SIRA 1DS6A 2YC2C 1VDFA 1I14A 2ZSAA 1O57A 4GT1A 2HF9A 5HQTA 3D3KA 2NZVG 3KB1A 3I92A 3PFWO 3DVSX 4F12A 3AF2A 4JNKA 3P9PA 2NPSC 1EUCB 1FP4B 1DWPA 3ITNA 1SPBS 3K53A 5JSZA 2Y1XA 4IDBA 2WVRA 3A4YA 1RF0C 3CF0A 3RTBA 1WD5A 2KJQA 2NPFA 2W27A 2LNDA 2I7XA 5DNEA 4AICA 5IF9A 1UK9A 2QPLA 2JFPA 5F7OA 2PVPA 3L7OA 3M1YA 2VL7A 2IPLA 1KS9A 4ZZ1A 1ZW0A 4PV1C 2HWKA 3QI2A 3LK7A 5DTJA 4I55B 2GDZA 3P4YA 3CTVA 1WOYA 1JEQB 2ZTVA 4GMFA 3H5OA 3WL5A 1KFNA 1AVYA 1ZINA 2X40A 5KKZC 1GFWA 5B4TA 1UDAA 1ZNQO 3VHRA 1PJZA 4W82A 2W90A 1ZOPA 5B4UA 1RWMA 1KB9H 4V1CI 2EZUA 1FDOA 5FBKA 3PQ5A 4BFXA 1WF3A 1EE9A 2PO5A 4XGRA 3MYRA 2F43A 3IJEB 3VX3A 1I4LD 1LPAB 1UC4B 1QR2A 1J8DA 5FQNA 1U57A 4GMHA 1NATA 1Q86Q 2B5OA 2V0CA 3IKLA 1BGYJ 4D45A 2AE2A 5LQDA 1Q1AA 2BISA 1CETA 3M0AA 4P5PA 4HL6A 1QJCA 3MA0A 4JI1B 4Q7KA 5EI5A 4LNAA 4Y7CA 6Q21A 3MZWB 2YWJA 1ZHOA 1B8OA 3ZHYA 1XHLA 1ZZEA 2PWZA 4FU0A 4X7RA 3BMCB 1NG9A 2ZUVA 2FMIA 1P4HA 1TMYA 4P7GA 2WJVA 2X14A 4FYHA 2XE6A 4GMXA 4N9WA 3EPKA 3W78A 3SEQA 4OYLA 5BW8A 2IHTA 4A5OA 2E55A 1KRWA 5KSZA 3RG8A 4EHFA 5IXYA 1SOMA 4RVUA 3SY8A 3L04A 3WDKA 3VHQA 2H1WA 4OJYA 3HXKA 4DSTA 1RXYA 2AFRA 4R0VA 1WXDA 4RETA 4M1QA 1EMDA 3C7DB 4O4HA 1OILA 2WIAA 3KVYA 3WQRA 2O19A 3QTBA 1GMJA 2N9UA 3BOSA 3C3WA 3UT5A 4R1NA 2Q3HA 3AI2A 3QFCA 1JIJA 1X94A 2QY9A 5HK9A 2J7PA 2ZI5A 4KDFA 4DDKA 2GGSA 6PFKA 2WTUA 3PA6A 1OI4A 4BEJA 1A7KA 1KFKB 4TS3A 3ZWCA 5GAJA 4JBWA 1ZHFA 1AX9A 3HZZA 4DKJA 5CB4F 4UVHA 3HU1A 1U7MA 3TGUE 1PVOA 4TLLB 1SURA 3X2FA 4MZDA 3QPWA 4NDNE 2HMAA 2QTLA 1K7CA 1RADA 3GLIE 4PV1B 3QKTA 1SCUB 1Q21A 1T9DA 1N2GA 3VMXA 2KNCA 2C4HA 1DEOA 2O8FA 1M2VA 1GZSA 4M0EA 4LRYA 5JXHA 1SH7A 3R3YA 1VKHA 3IQDB 1B42A 1MIHA 1NBOA 1W59A 5KKZB 4UM7A 3NQ41 5TPZD 1RRKA 5F7JA 2OCIA 1EZVG 3IPLA 5J2TA 3NUQA 3E1GA 3OSUA 1FTWA 4G89A 1I36A 3WRXC 1T1IA 1G8FA 3U4IA 2RKBA 2D1SA 1CW5A 1W4RA 3B9QA 4EF5A 5A7GA 1MX9A 3NXSA 4S2EA 1HTLC 1GPJA 4UD2A 1FB5A 1RKBA 4G1EB 1X80B 3S2IA 4JP2A 5EE0A 4IQFA 1TMGE 4H7KA 3GGOA 4MUXA 5K3DA 4MCIA 1GKLA 4LXGA 4GNKA 5I7SA 2KZIA 1LTGC 5AW9A 3BMOB 4CQJA 2PUFA 2FF7A 3WKBA 3AE6C 3PUHA 4WOJA 1WCWA 3DDWA 1JLKA 2Z30A 1ZIPA 4OAQA 3ENVA 2DCUA 3KTFA 2QTVB 1G8JA 2JLUA 2FPRA 4AZTA 1H9CA 2YC4C 4M3NA 3B2QA 1LY1A 4K9PA 3FBWA 1U7TA 5KYYA 4KO8A 4XVQA 4FKZA 2WIGA 1CW2B 2CNBA 3SHQA 1DG9A 4ZTZB 1CJBA 3UWPA 1VQ1A 5EESA 4MKXA 3AF5A 3TL3A 5LQCA 3MB8A 5IBQA 2X8AA 3QXHA 5KWIA 4CMKA 1R9GA 2J9FA 1ZN9A 1T9CA 4BL5A 1E5VA 1BMFD 1V9SA 3WBKA 1MC5A 3GJSA 5JXGA 3JQAB 2J6IA 4YRRA 2ZS8A 3FGNA 1X8JA 1OIXA 5CITA 1IJKA 1LTKA 1CUAA 5LJIA 3OZEA 4CV1A 4D82A 2FK8A 3D54D 2M6RA 3EMKA 3MHPA 3WY9A 4XFDA 2FPWA 5FB3A 4IIXA 1TLLA 1OR8A 3BCRA 3KHSA 2ZE7A 3HN7A 1LDMA 1ZOLA 4LHEA 1KQFA 1BS1A 2RGUA 3ZXYA 3WV4A 2XCTB 3QXGA 2ADOA 3AIMA 3P8CE 3C1TA 1X7HA 1KEUA 2O2DA 4RCVA 1QH8A 2SKDA 1M6VA 1V11B 4PAQA 4TXLA 3UMSA 2FB9A 3TD9A 5C5IA 3HUSC 3IXMA 2EZ9A 1I94B 2HT1A 5A6VA 1U0HC 4F93B 1EVEA 3G2JA 2J3HA 1IDOA 4JHXA 5GOTA 2XI4A 1BMFA 4DIFA 2ZJYA 5A7FA 5BSEA 4D92A 3FYCA 1DDGA 3WKCA 4MPPA 3I6IA 3MGNA 5DI3A 2A9RA 3C8UA 3L72G 3C0KA 1XTRA 3ZGVA 4NZMA 3CBQA 3ZZNA 3BCCD 4IO1A 1SQPD 1S4QA 4AN1A 5JAHA 5APQA 3GUZA 3LUJA 1XMOB 2VT7A 1L5GB 4F86A 3ESCA 4JVSB 2Q29A 3TJMA 4FFNA 4FE4A 1LBIA 1JB9A 1XDBA 1PR1A 3AR3A 2YRFA 2FSPA 3P2JA 4RULA 3VKHA 1X2BA 3FDZA 5EFOA 3O7WA 1OGYA 1JMMA 2ZI3A 3F5FA 4Q47A 1WM1A 3W5SA 2FEMA 3ZD9A 3DMPA 2FWJA 5JMTA 3GRUA 3T52A 3CPEA 3VUFA 4IL6E 4UUNA 2BGGA 2C2HA 3OZCA 2KS1A 3ZUGA 3PGJA 4H7PA 4KKVA 1SQXD 4KHXA 1TQ8A 3ND7A 2C9MA 4BP9A 1IG0A 3A4TA 1EVJA 4XEHA 5A0VA 3GA0A 2WQ6A 5EKDA 1ZK2A 4ZKPA 2O4UX 1JYEA 4EMBA 1NQWA 3I9JA 2CK3H 2I87A 2NSJA 4IUCS 1E5QA 1T1GA 4ZQHA 3FPGA 1I0ZA 1NBMD 3DGFC 2YN4A 4PTYA 4GPTA 4ASUD 2QIWA 2GWHA 2HF8A 3L8DA 3ITKA 1YHZA 3BH6A 1E79H 1XRNA 2RGNA 4V1CA 4JJ7A 2RKLA 5I7VA 4D9MA 3FETA 4NPEA 3I05A 3H1JE 4ABYA 1Z15A 1UAGA 4B71A 2IODA 1ESNA 1K05A 2IU4A 1UPCA 4JUDX 5JPCA 1EQUA 2ZBUA 4WBNF 3LFHA 1BJRE 1TADA 3UK0A 1JA0A 5JAMA 3QEBZ 2ODNA 1P7YA 4BE9A 1Z3IX 4MAMA 4UVIA 3KR0A 2FYUE 4YDRA 1D3AA 1MPXA 3EVGA 1DO2A 1WPRA 1D4AA 5HIAA 2PX6A 5B58T 3ZDDA 5C8XA 1GUDA 5AJWA 5K3SA 5KBYA 4PHTA 3W2EA 4LRQA 1PDVA 5F3RA 2WU8A 5IASA 3E1KA 3GEDA 3CX7A 1DTSA 4QULA 4TWIA 3TVTA 3GF7A 4JOCA 2FPLA 4G4IA 5JS1A 2ZQ5A 1NY5A 2X6RA 4BX2A 3EQZA 2RE8A 4L85A 4LE2A 1EFRD 2XIJA 5KMGA 2E5YA 3DEHA 2F8MA 4A0RA 3ROKA 3PTAA 5E6UA 2WNSA 4HRVA 1NTME 2M3EA 4RD2A 1S5LH 2PMKA 3VH3A 5A5VA 4UNPA 1YE8A 4EB8A 3MAJA 4AN4A 2G17A 3VKFA 4IX1A 1JXQA 5JCJD 2XAUA 4NEHB 3EF1A 3KSBC 1YD7A 2A6PA 3QVJA 5FV7A 1YKSA 3K20A 2PL5A 5B6PA 5KO2A 4EFLA 2B9VA 4QXAA 3AY3A 1LLUA 1RZ3A 3I61A 3MBOA 2HLPA 3DBHB 2D2EA 4DLTA 1L5FA 4WSOA 3SOZA 1OW7A 3MOIA 4N3AA 1OH6A 3IIJA 1T2EA 4DQDA 1XK6A 4MV0A 2HRRA 3H84A 4BZZA 5HYVA 2PEYA 4GI2A 4BZQA 2YR0A 1JHMA