2ZYDA

Dimeric 6-phosphogluconate dehydrogenase complexed with glucose
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
464
structure length
464
Chain Sequence
b'KQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 169
structure length 464
sequence length 464
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zydA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zydA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zydA01
3OP4A 4JGBA 5F1OA 4IDEA 3OICA 3Q2KA 3X2EA 1WNTA 1K6JA 3E6AA 3W8EA 4BO3A 1YE3A 3NTOA 3DBRB 3EYWA 5JCJD 1HE4A 4D3FA 4EI2A 1HTBA 4YA6A 2PD3A 5ENDA 4QUKA 3JQ7A 4NK4A 5TJ9A 4CMBA 1A9ZA 2C29D 5JCJA 2LDXA 1A4UA 1ONNA 3H2SA 5DBFA 2W98A 3LVFO 3KVOA 3PYMA 5G0VA 3KXDA 1NWCA 2IXBA 4CR8A 2BRUA 4HP8A 5CG1A 3G0OA 2BFPA 1QLJA 3RUHA 1M66A 1BTOA 4AL4A 4GMFA 3UCXA 3S1LA 4AJHA 5B37A 2DU8A 5DP2A 1XCBA 2NNLD 1ORRA 1DC5A 5JSFA 5KJFA 1XDWA 3ROKA 5MGBA 3F6YA 5ITVA 1M2WA 3VPGA 2HKIA 4MVJI 4NFHA 2Q2WA 2HSDA 1VC2A 4GKVA 4NI5A 3H8VA 4J4HA 2XXBA 3RASA 4QT0A 3G1TA 3K73O 5JYEA 2H63A 4MP8A 3SVTA 1UAYA 3E9QA 4U0KA 3TRIA 3IP1A 1YONA 4A2CA 3D5TA 1GL3A 1Y5RA 1IZ0A 1HDGO 1YB4A 2HRBA 5KTKA 3U5TA 5DBIA 1IZ9A 4GX1A 3WGGA 1DIGA 2NM0A 4RL6A 3GVHA 1DO8A 4IQ0A 1NPDA 2QHXA 4J7XA 4R54A 4CJXA 3JQAD 3ZI0A 1A7AA 1HLPA 4YTEA 4F45A 4M55A 2H9IA 1Y8QB 4DQVA 4YAEA 3JD2A 4LK3A 3DC2A 2AEFA 5JXWA 1X7HA 2WDZA 1O95A 1TB4A 2EP7A 4FD3A 4N7RA 4TRJA 4DWVA 2EJWA 3KYCA 3NDRA 1EDOA 1VLLA 3GVXA 4JQCA 2IDZA 4PLPA 1MG0A 1Z7BA 2X86A 4J9UE 2QRKA 4OSPA 1FK8A 3PGXA 4RZIA 3PDJA 4BMNA 4CV0A 3I9JA 3BYZA 2X6TA 3EVTA 4W99A 1NQ5A 4CLHA 4KQXA 1PSDA 1UP4A 2H6EA 1P1IA 5ILGA 2X0NA 3RBVA 1IYZA 5JAQA 2PD4A 1XKQA 2ZB8A 4GQAA 2DKNA 2EKQA 5KJCA 4PZCA 5BQFA 3OBBA 5TX7A 5JFOA 3ZWMA 1R12A 3BMQA 1N92A 2Y0EA 4MJLA 1CETA 2YUTA 3I4FA 2FMUA 1NP3A 3PPIA 3QJ5A 2EJVA 4WLFA 3X2FA 3ASVA 1C0IA 3PHGA 3W4KA 2VYNA 4I1IA 4TWRA 1LLUA 2VTEA 1QYWA 2GGSA 4L9RA 4LGVA 3WYEA 1BRMA 4DYDA 3CPSA 1HDRA 5CEFA 3DFUA 1B16A 1DRVA 5KKAA 3W8DA 2Q1SA 2I76A 1EE2A 2JCYA 3Q3CA 1XSEA 3MJCA 1RJWA 4CLOA 2B5WA 3HB5X 1UXHA 1LXCA 2GD1O 1PS9A 3FHLA 3F47A 4L4RA 3SX2A 2GRAA 3FF4A 3RUDA 1ADFA 1U9JA 1KBZA 3GG9A 3JQCA 2QW8A 2VWHA 4BNXA 2X5JO 1T2FA 1HSOA 3DOCA 4BO9A 3TF5A 2HDHA 3JYLA 5TT1A 4DLAA 4YXFA 4BMSA 1P1JA 5JC1A 3I4CA 4ND3A 4IJWA 3KBOA 3Q2IA 3UN1A 1M6WA 5L4LA 1E7SA 1W0CA 1V3TA 3DAPA 1QYDA 4N5MA 4CM4B 5TQVA 2QRLA 4Z0TA 2HMVA 1SO8A 4YCAA 3GAZA 4B8WA 3PP8A 2I99A 5F3RA 4MIOA 1D3AA 2GZ3A 4NBWA 1DHTA 2EXXA 3ABIA 3I9OA 5T6BA 3ANMA 4R4JA 2BMAA 5F1PA 5FI5A 7MDHA 5BNFA 4JBIA 5IDQA 3RSHA 3ZWPA 1UZMA 4WCDA 3ANLA 2BELA 4QEDA 2HMSA 3FPLA 4W4TA 4E2XA 1E3EA 3KSUA 2D0IA 3ETDA 3WYBA 5KJ6A 1GFSA 4ZRNA 2B35A 3DXFA 1ZEJA 5HA5A 3I23A 2Z5LA 5FF9A 3ENKA 5HBRA 4KOAA 4XWYA 4Y6PA 4O6VA 3ROPA 3VPXA 4CUZA 4Q3CA 3QWHA 3LT4A 3IOYA 3GK3A 1RPNA 1J0XO 3HFGA 2P4QA 1GPJA 2DVMA 2ZTMA 1ZSNA 1DB3A 1P0CA 3NT2A 3RBZA 4A27A 1JWBB 1ULUA 3T4XA 3O4RA 3RROA 5GZ6A 4D43A 1B8UA 2WE7A 4RF2A 5AXAA 3ZHYA 4I9HA 4PLYA 3WGHA 3GFGA 3DMTA 3CMMA 4DPLA 1ZZEA 1MB4A 2V6BA 5CG2A 2D1YA 1LDMA 3DHYA 4L73A 4LSMA 2P9GA 3TZCA 1ZMOA 1GEGA 1M67A 1I5RA 5HS4A 1OAAA 1ZVMA 2P2SA 4BO0A 4E5KA 4MVJD 3B1KA 3VKUA 2VUSA 3JQFA 4I9NA 1GDHA 4IDAA 5G0WA 1YQGA 1BHSA 2X0RA 5IZCC 6LDHA 3TFOA 4IDBA 4PGFA 4E5YA 5U4QA 4DYVA 4IS2A 4MVJA 4CPDA 2AEJA 3ANNA 1BW9B 3Q1LA 3OJEA 3VPFA 2FZEA 2Q1UA 3S2IA 2Y1EA 5I9NA 3IKTA 4ID9A 3H65A 4R1SA 3DQPA 4Z0HO 3AOEC 1VJTA 3PGJA 4NFYA 3WFIA 4BO5A 3B6ZA 4ILKA 4RPLA 3HFSA 2ZTVA 3SJ7A 4NJOA 4I8XA 3VKVA 1YXMA 3JYQA 2OBYA 4IINA 2YDXA 4I08A 4LISA 1C0KA 1UXKA 3S8MA 1B8VA 1A7KA 3C8MA 4XEHA 4BGEA 1KETA 1ZXBA 3WSWA 4JK3A 1Y5MA 4B79A 2B37A 1XLTA 2O7SA 1H6AA 2ZB3A 3G1UA 4JJFA 3C1TA 3UH1A 3I1JA 2FHSA 3PK0A 5A1TA 4D44A 4FFOA 4XYBA 5L4NA 4MPDA 2DFDA 3RC1A 1RM5A 2ZQYA 2I65A 2GR9A 2JD2A 2ZB4A 4LCJA 4NPCA 4KWHA 3WGTA 5FFFA 1K0UA 4RO0A 3OJOA 2P5YA 3WTBA 4F6CA 1SOWA 4IBOA 2J5KA 3GHHA 4I5EA 4CUJA 4EBFA 3KSZO 3WIEA 3FNFA 4AJPA 1LNQA 1XGKA 1YB1A 3ZWVA 1LSJA 4DREA 1Q2XA 3DBRA 4R69A 1GQQA 4PG5A 1P3DA 3MJ4A 3JQ7B 3PFFA 1UR5A 5DDIP 3R3SA 3JQ9C 1D7OA 2CDCA 1PGNA 1KVSA 1YOVA 4WKGA 5IN5A 3WNQA 5EQDA 4CUKA 2VHZA 1H2BA 4CR6A 1KERA 4Z3KA 2WEKA 4ZQEA 4U6QA 3VH1A 2HMWA 4BNWA 2NVUB 3AI1A 5I7EA 3MEQA 2CF6A 4AJEA 2V65A 4YT2A 2YDYA 4W7HA 3O8QB 2NQTA 3UGKA 4KMSA 4OSOA 4PFJA 4KUEA 1SCUA 2EGGA 2B0JA 2YW9A 2R00C 3WOHA 2F1KA 3ULKA 1U28A 1AA0A 3AUAA 4OL9A 3GGOA 5DULA 1V8BA 3K2BA 4UVEA 5G0TA 4M89A 2B5VA 2Q3EA 1T25A 4KUHA 1CWUA 4DLLA 1G1AA 3VH3A 4JN6B 4IQGA 3RWBA 1HRDA 3ZNPA 4WLOA 1E92A 3ZWXA 3CTMA 3SBOA 3WX0A 3NJ8A 5CDTA 4RLSA 3HB4X 3W8FA 1NPTO 3RFTA 3ROMA 5L3ZA 2GN4A 2Y1CA 3B1JA 3DO5A 5F21A 4EUFA 1NHGA 5B4UA 4CMIB 3ICPA 3A4VA 2LDBA 5HRUA 4NU5A 3KTDA 2I66A 3RUIA 3E5RA 3NEPX 2Q49A 4D46A 5IXYA 4NR0A 4A5OA 4EYEA 4KZPA 1U1IA 1N5DA 2JHGA 2Q2VA 3F5QA 4HKTA 2Y1GA 3BIOA 1QKIA 2A94A 4IIUA 4BQRA 4FC7A 2Q1WA 2ZB7A 3AFNA 3HG7A 1A72A 3JQAB 4ZQBA 1H0KA 1V35A 4EDFA 4Y8VA 4AJ1A 2Y68A 1IUKA 1UXJA 3JQ6A 2P5UA 1VPDA 1I01A 4XB1A 3PXXA 1R0LA 3GQVA 1LSOA 1V0JA 3F4BA 4K6FA 1VL0A 4XGNA 1NAHA 3O38A 5AXBA 3LK7A 2X7HA 3RCBA 2PLAA 1MG5A 3GN2A 3OFSA 5A3VA 2OXIA 4CQLA 5CAEA 4HBGA 2C2YA 2WD7B 3BMOA 5FI3A 1WDLA 1QORA 1UZNA 3C7AA 3L4BA 2JD0A 1HXHA 5BR7A 1N8KA 4ZRMA 1ULSA 3ADOA 2HMTA 3L9WA 2JL1A 3KM0A 1O8CA 3QSGA 5DZSA 2GF2A 4YT8A 3QP9A 3H9JA 4MIYA 3UAGA 3OM9A 4YEDA 4J9VA 3AUSA 2XPCA 1UDCA 2VNSA 4XJSA 1NX6A 2NVBA 4RVGA 3ZV3A 4CLEA 2QZ9A 4EJ0A 4QO8A 2IXAA 4TMFA 2GLXA 3CIFA 5KKCA 5DCUA 5CPBA 5TC4A 3PTZA 5HTOA 1W73A 2VWGA 3WLEA 2FSVA 1CF2O 3GOHA 1HE5A 4QO7A 4TRMA 3RU7A 3NV9A 2RHRA 5JDIC 3WGOA 5L7WA 1E3JA 4WLUA 1ID1A 1PJ2A 2C82A 4D0RA 2O4UX 2O3JA 1ARZA 5TGDA 3NTQA 5IZCA 1T4BA 2VUTA 4BO8A 2WYUA 4IMPA 5DF1A 4RPHA 2UVDA 3DEYX 1R16A 1CQIA 3WNVA 2POQX 3W6ZA 1HDXA 2ZYGA 1F8FA 1DIBA 1JW9B 3U4HA 1B8PA 1NAIA 4B4UA 1RWBA 2ZK7A 4J2HA 3IDSA 3GHYA 4DC1A 2B36A 1Y1PA 4EJMA 3H5NA 1KEWA 1HDYA 2GN6A 1I10A 5IDXA 2WSBA 5EN4A 1P33A 1E7QA 2JCVA 1E1MA 3GNTA 2ZQZA 4OQYA 4CM4A 4GX2A 4E30A 1NFFA 2OHXA 1PR9A 1NFRA 4YAKA 3ONEA 1M75A 3PJFA 1EDZA 1JVSA 1OC2A 2ZCUA 4E6PA 1AN9A 2D3TA 3AI3A 4WCFC 3C7DB 2JFFA 3QV1A 3W6UA 4KQWA 4UREA 3I6QA 5TSDA 1GCOA 3CZRA 5FWNA 2GDZA 4K9DA 4YJHA 4OOFA 1O89A 2O4CA 1PL7A 1V3UA 3H6KA 1IHXA 1RYDA 1Z6ZA 3AOGA 3LC2O 4G81A 6ADHA 3D5QA 2B69A 3DL2A 4AVYA 3PDUA 3ON5A 4XYGA 4YYZA 3VPSA 4XQEA 1DAPA 2Y05A 5B4TA 1U4SA 3QVOA 4O0LA 1Z7EA 3FNHA 3UOGA 3QHAA 3P19A 1L7DA 1GYRA 1MV8A 2O2YA 3M1LA 2O2SA 4ZGWA 1WZIA 1UH5A 2J3KA 4XGKA 3B1FA 4MVJE 3DZGA 4XJTA 5JMWA 1BXZA 4GWGA 2QYTA 4TRNA 1PU2A 4E2YA 2WMDA 4BB6A 4PG4A 3BHIA 3ITKA 2UUPA 4JNKA 3JQ9A 3PZBA 4M86A 2ZTLA 2ILTA 3SC4A 1EBFA 4K28A 5F1KA 1GUZA 3TWOA 3HWRA 3ZWWA 4DGSA 4DQXA 3PVZA 1F14A 4XR9A 2CDAA 4XRGA 3ST7A 4IDGA 1B0AA 2C5AA 3E1KA 1PR3A 3U9LA 2Y99A 2H5LA 1ISJA 1DFGA 1H6BA 1SEVA 2VZ0A 4PLFA 4DMLA 4J43A 3DZFA 1LLCA 4CMEC 2GYYA 4ZICA 1U3WA 3A06A 3RJ5A 2Y1OA 4GGPA 3MTJA 1X15A 3S2GA 3UFXA 4A0SA 3B20A 1ZW1A 1CJCA 4KDEA 1DIHA 3JQGB 3NGLA 1VL6A 4OM8A 1DIAA 2QG4A 4FJ1A 4JCOA 5TLSA 1C0PA 3WWYA 1QRRA 3O03A 4FSHA 3PRJA 3H9GA 4DVJA 3GEMA 4EEZA 3H5AA 2BFMA 1OMOA 5ENVA 1PZHA 1I32A 5EPOA 1IY8A 1DC6A 1EBUA 1EUCA 4WNIA 3ZWAA 4BNJA 4BMVA 3TOZA 3HDYA 5JCXA 2Z1NA 2BFOA 2GSDA 4E12A 3NT5A 2EIHA 3IC5A 3JD3A 4RQTA 2DTDA 1AUPA 1E7MA 1Q7BA 1S6YA 1WDMA 4OOEA 1X7GA 3EVNA 2HU2A 1X13A 2E6UX 1ZXLA 4NJMA 2AA3A 3DOOA 4XIJA 2QQ5A 1GR0A 3C3XA 2YQ4A 1N1GA 3OIDA 3OQ1A 2ZJ1A 4JBHA 1XEAA 4PLZA 2PZMA 4FCCA 3UVEA 1DLJA 1E3WA 3N58A 3H7AA 3DBLB 3D3WA 1H9BA 1VKNA 2D5CA 4J1SA 3R6DA 2WYWA 3QRWA 3STHA 3DOJA 1YVEI 4E13A 4JLWA 2AQHA 2BGKA 2I67A 3LDHA 4HUJA 4R51A 1UP7A 1PGPA 3BTUA 3CXRA 2VZ9A 4W82A 3P5SA 5BNTA 1VSVA 1CDOA 1ZUD1 2X5KO 1F0YA 4UAGA 2EKLA 3D1LA 3ETEA 5TS3A 5A03A 1YOVB 1IPEA 1X14A 2I6TA 4CM1A 1GQ2A 3UHAA 1FDVA 1V3VA 2HAEA 3C1AA 1WLYA 5GMOA 4F46A 3A1NA 4J1TA 1JTVA 1GZ6A 4ESOA 1HDOA 1R66A 3TZQA 5T64A 4R1NA 2HQ1A 2Q2QA 3CMCO 2OO5A 2NVUA 3RD5A 1U5AA 3DZHA 3U49A 4BV9A 1DBVO 3DTYA 3HUDA 3O8QA 2BI8A 2NTNA 4X54A 4GL4A 3A9WA 1KVTA 3FBGA 4IGEA 4E21A 4QFDA 5EMHA 1HEUA 2PD6A 4FFMA 1P77A 4TZTA 4BNGA 2NLOA 2V7PA 4CMJA 2VOEA 4M8SA 4ZQGA 4RVDA 1BGVA 2EERA 3R3JA 4RDIA 3VAZA 2YFQA 2VNAA 1JAYA 2DLDA 5L45A 1LBEA 4FFNA 3D0OA 4WNCA 3TZHA 4D7AA 4E4YA 2FPPA 4AG3A 3D64A 1H9AA 1IHYA 5T8KC 1I3MA 3U62A 2I3AA 3EGOA 2I9PA 1GYPA 1OFGA 1YWGO 4B4WA 5C7OO 3DBHA 3ZCXA 4CMIA 1SC6A 3PEFA 1VL8A 3MCVA 2UV8A 2PZLA 4JBGA 3EY4A 4PN3A 2CUKA 4TROA 5JLAA 1NVMB 5K9ZA 2DQ4A 4LVCA 4F6LA 3ITDA 3ZN2A 1LC3A 5COQA 2FP4A 1DOHA 3RKRA 3GUCA 3HE3A 3M2PA 4RF5A 4K26A 5GZ1A 3JQAA 3V5NA 1JAXA 3QWBA 5A5FA 1RM0A 3D4NA 2CVQA 3LT1A 4BGIA 4YAGA 2DFVA 1EMDA 3PYLA 2OBNA 4CQLB 2JAHA 3V1UA 4FFPA 4HX5A 5KVCA 1I8TA 2NWQA 3BMOB 2X4GA 1XELA 4UEOA 4J4TA 2WD7A 2NQ8A 2YHUA 1W4ZA 2YY7A 2HK8A 4BNHA 1DC4A 4MIEA 5J23A 4GKBA 1SAYA 3G49A 2HO5A 3GFBA 4W9NA 2W8ZA 2GN8A 1RKXA 3RBXA 4LW8A 3GLQA 1E7YA 3QLJA 4A73A 1JA9A 4ROSA 5L4SA 2NU8A 3FNGA 4WLEA 5IAAA 4NFSA 1LDYA 2O7QA 1ZSYA 2X5OA 4HADA 3RFXA 3JD1A 4AJ2A 1BVRA 3VOSA 3ONDA 3GUYA 2PNFA 1YGYA 4GGOA 4B4VA 4MDHA 3U3XA 1U3UA 3UUWA 1I2ZA 2R2GA 3OH8A 4CM7A 3JQBA 4KDFA 1LSUA 3KYBA 4J0FA 3WBBA 1M76A 1VKOA 4KWIA 4E5PA 4U6SA 3GRKA 2R6JA 3TN7A 1E0DA 3U4IA 4N5NA 3IUPA 1JQBA 5L40A 2OL4A 5JDCC 3JYNA 1PL6A 4PCVA 3RUAA 1ONPA 2O3TA 4R3WA 3RQSA 1B3RA 4Q3DA 2X9NA 3RU9A 4Z6KA 4PLTA 1O6ZA 2WD8A 3F4LA 3PLNA 3PWSA 4NBVA 1R4NA 4R5MA 3RVDA 2AQKA 1EVJA 4UEKA 2QZZA 1T1SA 1XU9A 2FWMX 5I7VA 3WBFA 2EW8A 1LA2A 2EHDA 3Q11A 3M1AA 3FR7A 4PVCA 1PS0A 4DIFA 4YT4A 5JAIA 1G0OA 4MP3A 4LRSB 3B70A 4ZVVA 3PZRA 5A9SA 1XYGA 2B4TO 1N7GA 1P44A 4YJFA 4J1NA 1UXGA 3PJGA 3MWEB 4UUMA 3T4EA 3P2YA 1PZGA 3GDOA 4MINA 3H3FA 3FCOA 4ALIA 3DWFA 4OJNA 3ASUA 4YJHB 1KEUA 3FSRA 5AOVA 3KRTA 2YHIB 3OA2A 4RVSA 3Q6IA 3FWZA 1MGOA 4BO2A 4B7XA 3ZWNA 4ALJA 3IQDB 2G17A 3V2UA 1NASA 2NUAA 1HZJA 1G0NA 1KVQA 1EE9A 2UDPA 3F9IA 4CLRA 4OMUA 4BIIA 4BGVA 2OORA 4PLWA 2O3RA 1QP8A 1E6EA 1GV0A 2V6MA 3DAFA 3E8XA 4PRKA 4YJDA 1PGQA 4HV4A 3H9EO 3OEYA 4IDDA 2C2XA 2A4KA 3ZW8A 3E82A 1AVYA 2UUOA 1HE3A 3AW9A 1EFKA 3Q9UA 1PZFA 2HJSA 1HF3A 2A35A 4II3A 3WMXA 5A9TA 3D4PA 1YRLA 4PVDA 1NXQA 4BO7A 3HJAA 1K6XA 2EV9A 1DFIA 2W2KA 3I9MA 4YJGB 5COAA 1FDSA 1B26A 3IUSA 3CTVA 3ZV6A 3TOXA 4ZN6A 1DAOA 2FY8A 2TMGA 3QWIA 3JYPA 3LQFA 2Y93A 2P9EA 3BTOA 3E03A 1SB8A 1ZMTA 3G79A 2X9GA 4FOOA 3QW2A 1HWYA 1E5QA 4BNKA 3V1YA 5FYDA 1CRWG 2AQ8A 2YV2A 5ICMA 5G0SA 4Y98A 5CDGA 1I3NA 3SLKA 2BD0A 1DSSG 1T2EA 1UXIA 3KYDA 4H7PA 3VVCA 3S2FA 1TT7A 2GN9A 1FDWA 4CMKA 4LMRA 1B3BA 4B3HA 5GY7A 3WYCA 1FJHA 1BSVA 4D79A 4R41A 2P68A 3JQGA 5T8KA 3DHNA 1U3VA 3PJDA 3O26A 2Y0CA 4GX5A 1ML3A 3QVSA 1JWAB 1CEQA 2J6IA 3TZKA 4IZHA 1K6IA 3L6DA 2VHWA 4NDNE 1C0LA 3DBVO 3QE3A 4JJGA 3MJSA 4M87A 5G4KA 3RUCA 3VPHA 2PKQP 3DZJA 4J91A 4DBZA 1R0SA 3BXXA 2O3QA 3ZW9A 4K6CA 3IJRA 1UP6A 4NJMB 1K2WA 3INRA 1I3KA 3EZYA 1C1DA 1VM6A 2J5RA 3H3JA 4XQCA 2X0IA 2QYSA 2OFPA 4YVFA 1E3WB 3VH4A 3WSVA 1LDNA 3N74A 2AMFA 4JROA 1KS9A 1NVTA 4R5HA 3D3WB 3EUWA 4IPTA 4CM3A 1X7DA 4AJOA 1PGJA 1EVZA 2ZIZA 3F1KA 1N9GA 1NQTA 1EEHA 1Y7TA 3DBLA 4L74A 4R3NA 3NDJA 3SC6A 4OH1A 3OMLA 4RPKA 4BUCA 4D3SA 2O48X 2Z1MA 2WM3A 2YQ5A 2PWZA 3GEDA 3FTNA 4B7CA 4FGWA 4RQUA 1P9LA 5KWEA 4ALKA 3I83A 2CVOA 3LC1O 1OC4A 2WJPA 4GX0A 4LMPA 2GUGA 1GD1O 3UCEA 3RUFA 5CEEA 5I9LA 4UUPA 3T7EA 4ND1A 3GPIA 1FDTA 3AY6A 1SBYA 3E9NA 4PG6A 4EZBA 1ENZA 4NBTA 3HDHA 4HXYA 3ZHZA 1E1KA 1MA0A 5BNIA 4AJLA 3W1VA 3PHHA 2ZKLA 1QYVA 4CODB 5KVVA 3I9LA 1T2DA 4HFJA 4L8VA 1Q7CA 3CSDA 3BAZA 2GO1A 1NNUA 3TPCA 3NAQA 2YV1A 1LQUA 4D45A 1ENOA 4YWJA 4M1QA 3TJRA 2E82A 1LLQA 5IXSA 1CQJA 5JDCA 5JNLA 1H6DA 1HSZA 5I7FA 4ALNA 4YQZA 1GAEO 3VTFA 2PK3A 4BKOA 1LRLA 4C7JA 5U1PA 1OZAA 5B1YA 2AHRA 3DBHB 4N18A 1TEHA 4UUNA 3AUUA 3WIDA 1XG5A 5JY1A 3ENNA 2VCYA 4OXNA 2OP1A 3IJPA 4OXKA 3FWNA 4ALMA 3M2TA 4D42A 4QFCA 1HZZA 1MUUA 1ZK0A 4AJKA 3ZHBA 2OGUA 3INTA 4TVOA 4BS9A 5IFLA 5CDSA 5JC8A 2VQ3A 4H16A 1EK5A 1Q0HA 5IG2A 2BH9A 2PH3A 2DTXA 2HJRA 2DPHA 3PFWO 4WCFB 1P0FA 4GLOA 3ZDFA 5A9RA 1IB6A 2JHFA 4MO2A 1A27A 2E37A 4WUVA 5A05A 1GUYA 4IXWA 2JKVA 4MOWA 1HLDA 3V8BA 3MJTA 1P1KA 1IL0A 1YKFA 2IODA 1WVGA 2GPTA 4R9RA 1ZEMA 1YH3A 3D3EA 4UVDA 4BNLA 5DOVA 4CV1A 3JSAA 3S2EA 4IJVA 3RC2A 1C3VA 5HWSA 1NAYA 4H3VA 4YACA 3OA0A 4QXMA 2AQIA 3GEGA 1TXGA 4J2OA 5CDUA 1O5IA 2OOSA 4ZA2A 4YDRA 3WB9A 2OUIA 4Q3BA 4II2A 2G1UA 4R1TA 4EJ6A 2AEMA 4R01A 2O3UA 3QA9A 1ONOA 3F46A 4L4SA 5ICSA 3BMCB 1Q7GA 1YQDA 3S55A 3ZWBA 2FR1A 3AM3A 1JN0A 2DAPA 1YB5A 3HSKA 2PA3A 2PGJA 4IMRA 3LLSA 3I52A 1DEHA 4J7UA 3HZZA 3HQ4O 4AJNA 4GWKA 1U2GA 2HMUA 1DRWA 2O3SA 2X58A 2ZCVA 5BSFA 1PQUA 3ZU4A 4NK5A 1OOEA 1XR3A 2EP5A 3GGGA 2EW2A 5JO9A 2OZPA 3GN1A 3ONFA 5CDYA 1GV1A 5C7IO 4LN1A 3KHUA 5G0UA 3K30A 1DHRA 1TVEA 1BXGB 3FBTA 4J16A 2C7VA 2YYYA 2VTDA 3GC6A 3IAHA 3I5MA 5KJ1A 1R4NB 4WK6A 1PJ4A 4S1VA 3GGPA 2Q4BA 1SPXA 4DRYA 4NMHA 3ETGA 1LRKA 3SEFA 4CM9D 2A92A 4FGSA 3NGXA 3WWZA 3VC7A 2G5CA 3AOEA 4JP3A 4XX0A 2RH8A 5G4LA 1PEDA 3R1IA 5JY6A 1IULA 3DDNA 4PLHA 1VE9A 3BMNA 3ORFA 3W4IA 5A9SB 3FNEA 4CM9A 3N7UA 5CFZA 2GERA 4J49A 4R1UA 4YJFB 1T2AA 3ZV4A 2V6FA 3LYLA 4RZHA 3WR5A 4CM8A 4IY1A 3FPCA 4CV2A 5JS6A 2NACA 4OHUA 1NR1A 1PJCA 3QQPA 4UVGA 4GPD1 5JAZA 3EMKA 1FXSA 4IS3A 1D8AA 4CMCA 3DAGA 1EVIA 2PY6A 2YHIA 4JIGA 4RV9A 1U5CA 4HNHA 5THQA 2CFCA 3FN4A 1B7GO 1QR6A 3ZU5A 4CLRB 4EUHA 5L95A 2PZJA 1NYTA 2EEZA 2Y1FA 4J0EA 2D5AA 2FPIA 2GCGA 1MC5A 3NTRA 5K0ZA 3ZV5A 4XIYA 3QVWA 1BVUA 1TA4A 3RIHA 4FB5A 5K6AC 2JFGA 3LF1A 4QTZA 1YL7A 1WZEA 1L1FA 1DPGA 4FW8A 1K3TA 5C3MA 2G76A 2FPGA 4FFLA 3TSCA 1PS8A 4RVHA 2W2KB 4FIZA 1ZH8A 1AXGA 1C1XB 1TLTA 1O9BA 1Z82A 4YJGA 1WPQA 3L77A 4YB8A 4YRBA 5A4DA 1V6AA 4ZU3A 5AQ1A 2AW5A 3DZBA 3NKLA 5ITWA 3LF2A 1IOLA 3VHRA 4XA8A 3LT0A 2Q45A 1AHIA 3C1OA 4WGGA 4XQ9A 2O50A 1ZK2A 2X1HA 4OIMA 3PHJA 2R00A 1R4MB 5I8ZA 2CVZA 3K92A 1LSSA 1T2CA 2D2IA 3KYDB 3SJUA 2PKRA 4OGWA 1B15A 1DRUA 3L9XA 2WYVA 1ZKMA 3UICA 3D4OA 3C24A 3TL2A 3KSDO 3PI7A 1SMKA 1LC0A 1SOVA 4TVBA 2FZWA 5H82A 4XRRA 4FDAA 4IJKA 1RYEA 1Q0LA 3NDIA 1MC4A 1P1FA 3OSUA 5G4KB 4ND2A 4AICA 3QVXA 4CMAA 1P1HA 3EW7A 1QV7A 4ONEA 1C1DB 1VSUA 2NV6A 1DJNA 4C7KA 3GG2A 2BLLA 5KVSA 1KC1A 2BFAA 4BNMA 3CUKA 4XGIA 1JLLA 1YS4A 4UEJA 1JU9A 4YAJA 3PLRA 1J5PA 3K31A 4I5FA 4BV8A 2YV3A 1QXSA 2A9FA 1Q1NA 1N9GB 3AFMA 3H4VA 3WMWA 4TKMA 4BNFA 2NADA 3MTGA 4MP6A 4Y9DA 2Q50A 1HT0A 7ADHA 5KOIA 1E5LA 2GZ1A 3HDQA 4Y6RA 5BSHA 3H9QA 1KOLA 1PGOA 2DBRA 1GYQA 4BKRA 1ZK4A 2EGHA 3LT2A 3CH6A 3LSYA 5ER6A 1MXHA 4PIVA 3PWZA 2FN7A 4EEXA 5U9CA 2E4AA 4M54A 2IEBA 3HADA 1MFPA 3CE6A 1F17A 4URFA 4N5LA 2VHYA 1LU9A 1CERA 1I2BA 3KETA 2VUUA 4IIVA 4RVFA 4FBGA 4AJ4A 1YBAA 2X22A 1PJLA 4UVIA 1NR7A 1OX3A 3HNPA 1NBOA 4B7UA 5LDHA 2AG5A 5F5NA 2VRBA 1YO6A 3BTSA 5BT9A 1YJ8A 2GASA 5B4VA 5JDIA 4BGUA 1NM5A 1ENYA 3DMTC 5FEUA 1T26A 3Q0EA 4WECA 1MLDA 5KJEA 2QX7A 2IRWA 3PJEA 4BO6A 4DPKA 4E33A 1TT5B 2JJYA 1GQYA 4ZD6A 4WPGA 4QECA 3H5RA 2B4QA 2VZ8A 2FR0A 3QIVA 3ZU2A 1HE2A 3KV3O 1U8XX 5TF4A 3JQEA 1EK6A 3RC7A 1ZBQA 2HK9A 3JQFC 4JP2A 4L0QA 3FTPA 3P7MA 5L9AA 1ISMA 4FR5A 1W8DA 5LC1A 4BB5A 2EWMA 3OQ6A 2JCXA 1IE3A 3E5MA 3JQ8A 1O0SA 3QY9A 3OECA 4MKRA 1R15A 3L4SO 1PX0A 3ZH2A 1ZCJA 1I36A 1EFLA 2Q99A 2SCUA 1BWSA 3DMYA 3NJ4A 4HWKA 1KC3A 3AY3A 4DLBA 3AWDA 2VHVA 4PLVA 4XYLA 9LDBA 3WGIA 2C5EA 1I2CA 4HFMA 4DA9A 4WCFA 2V6GA 4N54A 3JCZA 3M6IA 3WGQA 3GVPA 3ZNOA 1R6DA 4Q3NA 5A06A 4A26A 5TIIA 1NHWA 2XXJA 2Q1TA 5H81A 1OI7A 1UDAA 2DUUA 1MP0A 2CF5A 2D59A 3PHIA 3VZPA 3EZLA 3AK4A 4DL9A 1E7WA 5G2OA 4GBJA 5CEJA 2VN8A 4TRRA 1N2SA 1BDMA 4G5HA 5K6AA 4O1MA 5KVQA 4CV3A 3ROQA 2NVWA 3GR6A 4A03A 2C20A 3EDMA 3R0IA 4HFNA 4OKNA 4CL8A 1ADGA 1I33A 5TJHA 4BHTA 3A28A 5JPIA 3NYWA 1MFZA 4QSMA 5DNAA 1YL6A 5KNLA 3K8ZA 3UXYA 4EUEA 3BMCA 5A3JA 2EG9A 2Z95A 4RPJA 5TNXA 1XQ6A 2DBVO 3KEOA 4MVJG 4AFNA 1Y81A 1B14A 5TRTA 5ER9A 4H15A 3WFJA 4BNNA 4WOJA 1E77A 3U09A 2J3JA 3JD4A 3GRPA 5JBIA 4BVAA 4F3YA 1AXEA 1KY4A 2Q46A 5JE8A 1DLIA 1Z45A 4L75A 2XOXA 2NU6A 2VYND 1X1TA 3PHLA 4XR4A 4D3DA 5I8WA 4INAA 1BMDA 4FS3A 1DC3A 1U3TA 2UYYA 4NHEA 2H1SA 4P8RA 1BXGA 4NH4A 4CMEA 1ZK3A 1AHHA 4W6ZA 4G65A 1D1SA 1FDUA 4B3JA 3BHJA 3U4DA 4IM7A 2C7GA 3HDJA 4O5OA 3JTMA 4CQMD 4FN4A 3Q9NA 4XYMA 5AYVA 2JFHA 3MOGA 4OAQA 3TQHA 1A9YA 2W2LD 2AXQA 1HYGA 1UUFA 3MZ0A 2G0TA 3TDKA 4OXYA 3WGYA 2PH5A 1X0XA 2E49A 2I5PO 2O23A 2BHLA 1J49A 2DUWA 3BMNB 4CQMA 1WDKA 4DPMA 4EW6A 1R0KA 2ZYDA 4I5GA 2W2LA 3G3EA 3JQDA 3ZWOA 4CM8B 1F06A 1YDEA 2HRZA 4QX6A 5ES3A 2VT2A 2C0CA 4NBUA 5EINA 2PGDA 2NSDA 3INGA 1HYHA 2BI7A 4DXHA 3OJFA 2AE1A 4WEOA 4E5NA 1BXKA 4PZEA 1VJ1A 3TZ6A 3WS7A 4MVJH 1TI7A 4PZDA 2PR2A 3IP3A 5MDHA 4BL5A 5COBA 3GF4A 1HDZA 2PGLA 4CMHA 4IDCA 3GVCA 4RORA 4R9SA 1E6UA 3ZWYA 4KTTE 2DT5A 2FSSA 2BKAA 3DONA 5EIOA 5IDYA 1W6UA 3KO8A 1G6KA 5C5IA 1O94A 4KTVE 1MX3A 4MVJM 3JD0A 2QIOA 2XAAA 1KVUA 1ZJZA 3NUGA 1BG6A 4GI2A 3ZHXA 4UVHA 1ISGA 1I24A 4FC6A 1U4OA 2XF8A 5DCWA 3RAJA 5T57A 5CHEA 1H2HA 1WP4A 2ZYAA 2W4QA 1ZK1A 4NQZA 4L76A 5THKA 1XQ1A 1C1XA 3L4BC 1XHLA 2CMDA 4Z3DA 4E31A 1T24A 4J7CA 1JVBA 4YBZA 3WG9A 1P45A 3OEWA 4BKUA 2DM6A 2VOJA 3GMSA 5KCZA 1J4AA 1Z75A 5HM8A 3EK2A 4DIOA 2ZATA 4LVUA 2B83A 3SXPA 2D4AA 3WXBA 2CY0A 1A4IA 4MVJF 4IQ8A 2PTGA 4HNGA 2EF1A 1R4MA 3CKYA 3KLMX 1E3SA 1KIFA 1BDBA 3VH2A 3IMFA 1A5ZA 1Y9AA 2DPGA 4U0JA 3CEAA 3GY0A 4DIBA 1UZLA 1LX6A 1RM4A 4DC0A 5T67A 4WLNA 2DC1A 1WMAA 2WWRA 4CR7A 1QYXA 1FMCA 4LRTB 1E1NA 3KUXA 2NTVA 4E32A 1F8GA 4PG7A 1WMBA 5JO0A 5CP8A 1N1EA 3UCFA 4IDFA 4MKXA 3ZZNA 5DOZA 1QG6A 4IZIA 3QWAA 4GH5A 2DTEA 4DUPA 1ISFA 2J8ZA 1YQXA 3BA1A 3EHEA 4OKIA 2J5QA 3BHMA 3TNLA 3PIDA 2CSUA 2OP0A 2CNBA 4NIMA 2GNAA 1R37A 4TKLA 2ZJ0A 3GZNA 2P4HX 1WAMA 1ISIA 4XB2A 3RKUA 5L53A 5IF3A 1ZSVA 1K89A 3GH3A 4OO3A 4RGBA 4Z9XA 1H6CA 3VZQA 1I3LA 1ZFNA 4XDYA 1AGNA 1JDJA 1DFHA 1GU7A 1PJBA 2OMEA 4B8ZA 3OQBA 1T1RA 1Y9EA 1NQOA 5EERA 4L4XA 8ADHA 4HFRA 2RHCA 3V2GA 3RI3A 1B2LA 1GCUA 4XYEA 4WEQA 3WGZA 4XDZA 5LCXA 5IZ4A 3U0BA 3EAGA 2X0JA 4BOYA 5BSEA 3VDRA 1PJQA 3VTZA 4CLDA 3KOUA 1YDWA 1EZ4A 3ICCA 2UAGA 4I9UA 5AXDA 4DMMA 1Y8RA 1GZ4A 1YBMA 2D8AA 4CLXA 4BNTA 3IS3A 4FFRA 5JAMA 4NG5A 4DTIA 2HLPA 4XQGA 2X9VA 2YJZA 3ZNNA 2PFGA 3F1LA 4KP7A 1RM3A 3F5SA 2RIRA 1QSGA 2RCYA 4BQPA 4ZQHA 1J6UA 1Q0QA 4RLHA 4Z9FA 2JAPA 3AM4A 3SLGA 1PJSA 4GSLA 3WQSB 3AUTA 4XZ3A 4TQGA 4EITA 1QMGA 4C4OA 3U4CA 1KYQA 3P2OA 2IYOA 4J3FA 4YT5A 4IXTA 1TT5A 1LLDA 4FJ0A 4RF4A 2IZZA 2PKQO 3MOIA 3V2HA 4AJIA 1UJMA 4BO4A 4WJZA 1A71A 4JX8A 1CIVA 4BKPA 5TT0A 2NU7A 2F00A 1XU7A 3COSA 4WLVA 5DN9A 1NPYA 4GVXA 4J90A 5AVOA 3DHEA 5A04A 3JQ8B 3WICA 3I9NA 4YR9A 1HDCA 4E2ZA 2NTJA 4B3IA 8LDHA 2VWQA 4YQYA 1P1RA 4ITUA 4DQUA 4BO1A 1XIVA 3W4JA 2Y0DA 3HHPA 9LDTA 2IYPA 1GADO 4G2NA 2AG8A 3UF0A 4U5QA 1GPDG 2P91A 3PQEA 1PWZA 1DXYA 3FD8A 3OIGA 1EVYA 1YJQA 2CZCA 4NU6A 4UUOA 5BSGA 4E2WA 1LTHR 3RFVA 4Q3AA 3BZUA 2YZ7A 1LDBA 4WOKA 5C37A 3C7CB 3V1TC 3GA0A 3H9UA 1KEPA 4GLLA 5EQFA 1NTOA 2HUNA 4U8GA 1C14A 1ADCA 1VJ0A 4Y67A 5H83A 5IN4A 2JD1A 2X8LA 1HETA 1Y8QA 4GSKA 5C7LO 1YL5A 3RJ9A 1NFQA 5ILOA 3ZNQA 1SB9A 3KYCB 4RPGA 1GZ3A 3VDQA 3AJRA 3UW3A 1ZNQO 4D0SA 4NNJA 3VVBA 1Y6JA 2Y66A 3PQFA 3K9QO 1UDBA 1PQWA 4P4GA 5LDGA 2J3HA 1E1LA 4YAIA 3E48A 4KUGA 1KEVA 5DP1A 4P22A 1JKFA 1E7RA 4A10A 3T7CA 1LJ8A 3PWKA 1QYCA 4RDHA 2FOIA 3WJ7A 2VT3A 1PZEA 3L0DA 3K6JA 3L07A 1DDOA 3I9KA 1NQAO 2J3IA 4MKZA 1LRJA 2NU9A 2Q4EA 1X0VA 3BMQB 1T4DA 2CD9A 5CPFA 1H93A 2VWPA 1MXFA 2HK7A 3A14A 3PQDA 3QWFA 4GAEA 1SEPA 2ET6A 4FQ8A 4QQRA 4TSKA 4XD2A 2PZKA 1E6WA 3L6EA 4A7PA 3LZ6A 2Y67A 1XWFA 3CZMA 3CINA 3RC9A 1WWKA 1VI2A 5EL0A 3G17A 5JW6A 1OBFO 1LDGA 1HYEA 1SZJG 4NZ9A 5IJZA 1JKJA 3D7LA 3WQRA 5B12A 2CDBA 1PTJA 1E3LA 4GVLA 3GPDG 4EGFA 1DJQA 4HY3A 1QV6A 4CQMB 3F3SA 1V9LA 3AU9A 4CLOB 1PJTA 4XCVA 3RUEA 2E48A 4J1QA 3GDFA 4Q39A 2YFHA 4J4BA 2C07A 4UULA 1PWXA 2VRCD 4BNIA 4J6FA 1L7EA 3GNQA 4O59O 3K5PA 4CL3A 4PLCA 4WASA 4E5MA 5L7TA 1EUZA 4LSWA 3UKOA 3GAFA 5DBGA 3O9ZA 1YBVA 2VRCA 1VRWA 1GTMA 3AM5A 3GMDA 3TL3A 4JXKA 3HN2A 3MJVA 3LC7O 3OHSX 3VZRA 3DR3A 1ZIDA 1LDEA 4ZJUA 5GZ3A 3ZGYA 3NT4A 4BKQA 1PL8A 2RBEA 4M49A 1CYDA 3WTCA 2RH4A 4NBRA 1GUFA 3GDGA 4ND5A 4RF3A 3DFZA 2RAFA 2W90A 4Y6SA 2IE0A 3MWDB 3KLPX 3K96A 3JYOA 1U7TA 3OJLA 5T5QA 2TMDA 3ADPA 3LU1A 3PIIA 4RVUA 4FOSA 1U8FO 2DBZA 4TZKA 1D1TA 1DIRA 3GNSA 2B4RO 3I3OA 3FR8A 1ZO8A 4FJ2A 1U7HA 5EESA 4Z0PA 3OIFA 1PQPA 5DCYA 4E0BA 3WLFA 4RCVA 1WW8A 3C85A 1AE1A 1I30A 1H94A 2FRDA 1ISHA 1Z74A 3PYXA 3OETA 3QVTA 2BF7A 4D41A 4BNZA 1EQUA 4P4NA 5AXCA 1M6HA 4OQZA 1ZJYA 2P9CA 1D4FA 2BGLA 3GZ4A 2GZ2A 1LQTA 3MJEA 3DTTA 3TFQA 4P38A 2X23A 4W9NC 3DZIA 4GMGA 3KZVA 3OF2A 3EC7A 2VYVD 3LLVA 2PV7A 1SNYA 1HKUA 4CM6A 1X1EA 4PRLA 3JV7A 3K2EA 1ENPA 2VYVA 3I6IA 4DBVO 1LI4A 2C54A 3AI2A 5I7SA 4BNYA 1LUAA 4Z9YA 3FI9A 1XA0A 1K5HA 2WE8A 3E9MA 4IUYA 4RJTA 1N7HA 1Z73A 3JQBC 2IZ0A 5L7YA 4PG8A 1PJ3A 1ADBA 4K1LA 3ZU3A 1EUDA 3NRCA 3ZWCA 1I0ZA 4AJJA 4S3MA 1NVGA 3AY7A 3FRJA 3H2ZA 2EKPA 1QLHA 2HCTA 4LCEA 3WQQA 1UAGA 2FR8A 4ZHSA 1FF9A 2QRJA 3NX4A 1NWHA 4JJIA 4Q3EA 4MVJP 4CMGA 4IJUA 3WJAA 1JKIA 1S7CA 5HS6A 5I9MA 3KB6A 4W7IA 3WDSA 4WE3A 4YRAA 1BW9A 1E3IA 2AE2A 3GZNB 3IIEA 4FPXA 3VZSA 3IKVA 3OJ0A 5EJ2A 1P74A 4I5DA 4PLGA 3E18A 4ND4A 4E3ZA 4ALLA 5DT9A 1KVRA 4CM5A 4P4LA 5A02A 3AU8A 4XKJA 1GEEA 1U2DA 4B4OA 5IDWA 1WXDA 4IGFA 3GT0A 3KEQA 1HL3A 2C59A 2IZ1A 1PIWA 2I3GA 5L51A 1KY5A 2WTBA 4R68A 5F5LA 4BNVA 1P31A 5KIAA 1LEHA 1H5QA 4ZQFA 1EQ2A 3BTVA 5JYDA 2G82A 5A5EA 4U7WA 4Q9NA 2DBQA 5ADHA 3L6OO 3DB2A 1F12A 3HN7A 4BNUA 1IPFA 1GY8A 2ZTUA 3IL2A 1Y8RB 4O63O 2BGMA 2Y1DA 3GVIA 4YPOA 2VHXA 4OYRA 5JMPA 2IEDA 4R16A 4YRDA 3DZKA
chains in the Genus database with same CATH superfamily
4H2DA 1RPZA 3OP4A 2XHEA 1JYSA 3I55P 5GQSA 2VDWA 2Q3IA 3D6VA 3RVNA 4F72A 1AUVA 5LB2A 1TU4A 1U7UA 3DE3X 2FJPA 3MERA 1BTOA 5CIQA 3D8HA 5KJFA 1OTYA 2OM2A 5AI5A 2H59A 2HGZA 1VC2A 5DM0A 1THZA 3P52A 5AW4A 5JYEA 1I9CA 5LKAA 1S4MA 1H1LA 1GL3A 3BCUA 3QPAA 1J2JA 4BUJA 3QVKA 1QHNA 5ADVA 1N7SC 3DOFA 3I62A 1HLPA 2IW1A 3E81A 5JALA 5TEWA 3KYCA 4PLPA 4HRXA 4U3FD 3NMDA 1NNEA 4AZSA 2R6R1 5A0FA 3DW1X 2R62A 1SZPA 3QPVA 3PXEA 5FQNA 2PD4A 3OBBA 2A14A 5CVCA 5BR1A 1GDTA 3OAKA 3UJ9A 1YCDA 1TCAA 2YUTA 3WUTA 4V0OA 2EJVA 3N5CA 3K2IA 4Q16A 1KJNA 5TR9A 2R1VB 4LJ4A 1P4JA 3HABA 3ER6A 5IX8A 4MTLA 3OW2O 3MJCA 5JT1A 4P54A 1JM0A 1XQYA 1XOIA 2ZUSA 3SX2A 1WKVA 3FF4A 1DC8A 4CKBA 4YLGA 4BO9A 1HSOA 1T4CB 2X15A 3JYLA 1IZNB 4Q3OA 5LFAA 1SQQK 3KBOA 2E1RA 4P53A 4H6VA 1QYDA 4N5MA 2WAAA 4RZUA 1W0KA 1YTZT 3LC0A 3PRHA 1VRVA 4XFKA 5FI5A 4MMYB 2XQJA 4RETA 5K01A 3D0QA 1W6RA 2ZPTX 4F3KA 3MTUE 4KOAA 3H1GA 4CUZA 2WHPA 2ERCA 3L3BA 1TZCA 2QAIA 2H2HA 3HCWA 4DPLA 1S72P 1T9AA 4JUFA 2DBYA 3IAM1 1EHIA 3CPJB 4QEKA 4N6OA 1ZN8A 1K7YA 5I9SA 3VOBA 1NF2A 1BW9B 2R6ZA 4JEMA 4IWNA 1XRQA 1AKYA 2EGUA 4LY0A 3O3OB 4BO5A 3MIIA 2R48A 1XXLA 3S8MA 1SQQE 1ZY2A 3WSWA 3G2LA 4OJQA 4BECA 1WW2A 4LI3X 4AX8A 5JRDS 4CEJB 1YNSA 4CIVA 2VPPA 1TNDA 3LWDA 4RVCA 3DE4X 5DV9A 3GARA 2ZS9A 4LF4B 2J5KA 4Q0MA 4I5EA 1UC9A 1YB1A 2CLLB 2DR2A 3UMBA 2YO2A 4KPUA 5DDIP 1QONA 4WKGA 2O8VA 1Q1AA 2XTJA 4C0QC 2AXPA 1U28A 3AUAA 3AP3A 5ESWA 5APXA 3DTVA 3VDXA 3MUNA 1T1GA 4IW3B 2O1JA 1MO3A 3DO5A 4G1UC 2FLKA 3R24A 4A5OA 4YQFA 2R5BA 2Y1GA 3ZIAD 2YX1A 1MOSA 3TDMA 3K1YA 3I1YA 3H1HD 2WP8J 3LK7A 2VDNB 2RHJA 4NXMB 1W4RA 4CQLA 2H4JA 3D3QA 3L4BA 1EHCA 5EWMA 2GKSA 3U9SA 4MIYA 3B5ND 4XJSA 2C9CA 3GCGA 3QEKA 5HTOA 3EWIA 2F3SA 1KMHA 3QMVA 2DFNA 5FV7A 5KBYA 2UVDA 3HVIA 1EM8A 1CNMA 2AMLA 1DIBA 1JW9B 4V3BA 5JHHB 4B4UA 1Y8ZA 4J2HA 4D82A 4DC1A 3NBFA 4URXR 4IQFA 1P33A 3HR8A 3DDWA 2B34A 3GEEA 4MVCA 2JKZA 4M4SA 3HPRA 4LZNA 2I1VB 4A23A 1M75A 4V03A 3H1KE 2FEPA 1Q17A 3RUPA 4RV4A 5TQ0B 2ODPA 3JZDA 2HPVA 1PVDA 4J0CA 3DL2A 1JHZA 1XZAA 4FYJA 2XCRB 3O5AA 2Y9ZA 3M1LA 2GI4A 1UH5A 5JMWA 2K7ZA 3BHIA 2XYQA 2UUPA 2RB4A 4QU5A 4KN5A 4DGSA 1V26A 2HBYA 1IM8A 1OBOA 2F8MA 2YJ5A 2E76B 2Y99A 1SEVA 1BIFA 1VSBA 4TS4A 1L4GA 3T94A 5CA1A 1DIHA 1AMNA 2P65A 2BHSA 4JCOA 4O29A 4FSHA 4EEZA 4FYMA 4MI6A 1PZHA 3I42A 1DC6A 4YROA 2Z1NA 3ZE8A 3O8RA 3ADBA 3A2AA 2QBYA 4DVGA 2YIMA 1AUPA 3JAKB 4BATA 1X7GA 4O4JB 2OXFA 1BNCA 3AF6A 3C3XA 4DRZA 2YQ4A 4EMTA 4A8TA 5JQWA 4IJQA 2WIJA 1ZA1A 5FWDA 5DYNA 1NWQA 1H9BA 3B2NA 1BVHA 4XE5A 2BMEA 2HRCA 4XSGA 3TR0A 1FP6A 4X7PA 2EFHB 3DVQX 1QFZA 1S9KE 2QA5A 3C8UA 1XL1A 5E9WA 4DSNA 2EC5A 4MEAA 1YK1A 5JSUA 4HNVA 4N4AA 3CZPA 4QFDA 4JI7B 2VOEA 4EHKA 4ZQGA 2FVYA 3R3JA 3C5WP 2FYUD 4WNCA 5EXEA 3OTOB 2VUHB 2PS9A 1I2AA 1YWGO 5IASA 1E9EA 5ALHA 2NV0A 4X6YA 3H0CA 1L3BA 3ZN2A 4GM4A 4DLRA 4JA0A 3VR4H 3OQIB 3LPLA 5JXGA 1H0SA 4EHFA 3FGAD 5DNDA 1RWVA 4H44B 2C5HA 3R4YA 3T5CA 2F1RA 4AMVA 4W9NA 1RWXA 3I2GA 3U3MA 3GLQA 3SX4A 3ZJYA 5ESXA 3VJRA 3SHWA 1COZA 2XSZA 1FFXB 1GKLA 3GJYA 1ZSYA 3ADCA 4NAVA 4Q37A 4MDHA 3T3IA 4MS4A 1D8TA 4KWIA 3IERA 3QYJA 5DIZA 3BHNA 3AB7A 4BU1A 4RH0A 1GTSA 4Z1MD 4MW5A 4DQLA 2C4WA 5JNRA 3UMGA 5J2TA 2YZGA 4TXNA 4WD3A 1QV9A 5C4IA 2FSHA 5K8CA 1Y63A 1W87A 3O31A 1RBYA 1G66A 1FOSE 4G5SA 5DTIA 3FWZA 2I7TA 1D1QA 3HJTA 3KKLA 4ALJA 3SVLA 1NASA 3AR9A 5EHQA 5KHOC 1SP4A 1QP8A 5E4FA 4KXUA 3B7GA 1RJ9A 1RYZA 1Z4OA 5KQGA 5DJTB 1DI0A 1RHKA 2CFOA 4ZZ1A 3QXCA 2IH5A 1CB0A 4X93A 4Q4LA 3A7EA 3LHDA 1NUHA 1NVAA 3HBJA 3IALA 2VCHA 5BORA 1L4MA 4QOEA 1HNNA 4YX9A 2N47A 3S2FA 2J5UA 2HEGA 3C4QA 4OHPA 4B48A 1C7QA 4BVLA 4YMHA 4GX5A 3KKPA 3QVSA 3BE6A 4RK5A 3UK1A 5KQRA 2H9AA 1FBTA 3LKDA 1FP1D 4G67A 3HPQA 3QUCA 2X0IA 1D2GA 2I3ZA 1L8LA 1IB0A 3CR7A 2C99A 2QJRA 2RH9B 3UMFA 1SIWA 3JY6A 2NXCA 3VYIA 4KMMA 3VV3A 3SC6A 1GZHB 3H19A 4X20B 1OH8A 3HEBA 4R31A 1G2CB 3E3OA 3Q1MA 1N7LA 1O5OA 4F5EA 2JG3A 3NHBA 1KTVA 1GNVA 4N3YB 3LIDA 1MAWA 4KXFB 3ILXA 1FNMA 2RH0A 3TJRA 1RPAA 2GAFA 3KTFA 5HEKA 5MN6A 2CV2A 4MR7B 5DWVA 5HUQA 3U13A 1DKPA 2PK3A 1JDBB 4PZLA 3Q3HA 4IVQA 4JL8A 3HCFA 2QZPA 5IKEA 4CCAA 3IE0A 4DAEA 3ZHBA 1SUAA 2G6TA 3MG9A 1G5QA 2PH3A 3OPVA 4M0CA 2O01J 3IP8A 2E37A 3A0BE 3LBNA 3OZRA 2OQRA 3WHIA 2RAPA 2A2ZA 3G5MA 3QPUA 3RC2A 1Y1TA 1G59A 2RHGB 4YACA 3HI6A 2Y77A 4PTYA 1QAOA 3H2YA 3NTUA 1I3CA 5ICSA 5HGJA 3L2OB 5BUSA 1REQA 1JN0A 3KZXA 3VQTA 4J7UA 4QDZA 4G9EA 2HMUA 2X58A 1EFRA 2AB0A 1XR3A 1K1EA 3GGGA 2OZLB 2BM0A 3AR6A 1IFNA 1JQ5A 1IZZA 1XB2A 4GR5A 3IUMA 1XN1A 1VPCA 2FPXA 2XNDA 3FKQA 1R4NB 1E6LA 4RZ3A 1TEVA 5FR1A 4BRWA 2Q4BA 2CLOB 3O8OB 3R1IA 3RYCB 1W52X 4PSKA 3MELA 4RZHA 5CD1A 2FQ1A 1LJLA 3UQYS 4X97A 4UM9D 4UVGA 5HGXA 1QM5A 3ELDA 4R3UC 2ANCA 2YHIA 1J9GA 4Z8YA 5FNZA 4DUZB 4CU5A 3TAHA 2M8RA 3LHIA 4XIYA 3UKDA 3QFRA 5P8WA 4IIYA 4RM3A 2PIDA 3AEFC 4RVHA 4MJXA 3EBPA 2GNPA 3VHQA 3R75A 4YRBA 1E79H 2NPSD 4QQFA 2AW5A 2B2XA 4C7MA 3UAYA 1JQEA 1JO5A 3OIYA 3TDNA 3LOQA 3PL1A 2P3SA 2KYRA 4L8LA 3SJUA 2VDUE 3RW9A 1GP2A 5CCEA 5H82A 4HWOA 1KNXA 1MR3F 5G4KB 1U57A 3PD7A 3RRFA 2PRJA 2QJPB 1NI3A 2ZJ7A 4TT3A 4B32A 3BMXA 2V4HA 1IRXA 1KPHA 5FOWA 2GQ0A 1NSYA 5KKZB 2CB9A 5EOVA 3T7RA 5E6RB 4L5BA 2XH8A 4FCVA 5JS2A 3PLRA 3K31A 1QXSA 5KWJA 3WMWA 5E9JA 3DLBA 3PCRB 2CHFA 2CYBA 4Z4IA 2DBRA 1YZVA 2FZGA 1TUEA 2E4AA 4M54A 1PZMA 2CK3H 4N5LA 2REQB 3FE2A 4QNRA 2HFJA 4HDMA 3FZEA 3GRUA 5BQPA 4BGUA 2AZMA 3IMEA 2DWPA 1CQJB 3PJEA 3QOFA 2ZVOB 4BO6A 1GQYA 1AM4D 3RS5A 3KV3O 3EUFA 1FSPA 5JZ9A 2HK9A 4JP2A 4U7TB 3TKYA 3TW6A 3VSAA 4UTZA 4YHHB 3HDGA 1QGDA 3O95A 2WUVA 4Y28J 1KC3A 4A2PA 1N36B 3ABSB 3SX0A 3ZS8A 1C30B 3G82C 3FLAA 1KYZA 5TIIA 4R9VA 1OI7A 3PHIA 3KJZA 5G2OA 4LG1A 1VE5A 4O1MA 4Q21A 1H23A 2E7ZA 2GCIA 3UPUA 3OZWA 2XD9A 1T0BA 2JI4A 1S02A 4K6GA 3EEFA 2AN1A 5JPIA 1YI8A 2HCBA 5KNLA 2Q5EA 4AROA 5A3JA 4BTLA 5I48A 2B21A 4ZIRA 4UB6E 4QUJA 3GPCA 1W7AA 4D9CA 4BVAA 4JAVC 1U98A 4QARA 3EODA 1UBJS 1ORIA 4W5JA 2PAAA 4FS3A 1D2NA 2H1SA 2FQQA 2OEPA 3AE2C 2KB7P 3L7KA 5FLYA 5LBIA 3ZDZB 3JQDA 2LPMA 3EQ7A 1ONSA 3C16C 2CHUA 3OM1A 2HA5A 5ES3A 2VT2A 3CX6A 3MWYW 3ELWA 4BMDA 5GM2A 1ZUNA 4WEOA 1BXKA 3R5KA 4N5HX 3AX6A 5FFNA 4U2DA 1XZBA 4MZXA 2BKAA 3QK7A 1NJ1A 1NUUA 3LWNA 1HH4A 3M4ZA 4KAXA 4GI2A 1TJNA 4WXHA 1U4OA 2B9VA 1RJEA 5KDOA 1U8AA 2A59A 3MRSA 3PE4A 1XQ1A 2OZEA 3L4BC 4BFLA 5J4KA 2ZROA 3DT8A 2ZSFA 4UTOA 2Z2ZA 1MIOA 2GJ4A 1K3UB 3EK2A 2B83A 3NU1A 4HNGA 4JUCA 3NATA 3VR2A 2P1ZA 3KPWA 3OI7A 4M0UA 1A02J 1D9ZA 4S0ZA 4MWZA 1WB9A 1K6EA 1Y6RA 3V1KA 4KLCA 3W7BA 3T5PA 4MS1B 1FTYA 5FNVA 4U9HS 4E32A 2MHCA 5ECGC 2OAGA 1LP1B 3A3OA 4MKXA 4GH5A 5JOQA 4I5IA 2J5QA 1T2KD 3E3NA 2GNAA 2DE0X 1KFKB 4W7YA 1M90Q 1GU7A 4HF7A 5B2ZA 1KSJA 4HB2A 5CDHA 3EW9A 2R9VA 1P7CA 4A92A 2H5EA 3KEMA 3DSRA 4F1WA 4DJFC 3VTZA 2IDKA 3HUEA 4QBGB 4BNTA 3TR6A 5IU6A 5KNBA 2HRDA 1FRQA 4KWEA 3ZLTA 3LL4A 4E22A 2ZUDA 3KSBC 4X1OA 4BAZA 3UJBA 2H1OA 3O4JA 2NP6A 2Q6QA 1KI2A 3WICA 4I6EA 1P1RA 4QBHA 2V7BA 1TLLA 4IDNA 1XJWA 5ALDA 1XD2B 4ACBA 3RH0A 3F0TA 2PX2A 1L0LK 4NU6A 1IVSA 2NO6A 3G88A 3I6BA 1LDBA 3NWPA 3C7CB 4JQ0D 2QDXA 2GBFA 2BM8A 3GLHA 1M57D 4GQBA 2VNHA 2G7ZA 1Y8QA 4E4RA 4RE6A 2FKNA 2MTBA 3ZNQA 4TMTA 2I22A 4WSOA 1GPNA 4BZPA 4D0SA 1K86A 3GP3A 4NNJA 1W44A 2QT9A 1ODTC 2J3HA 4H6WA 1JKFA 1G16A 4UXJA 3ET4A 1W4AA 5LNK1 1BH2A 4XFJA 2VWPA 3AI7A 4FQ8A 4LE0A 2YMLA 4JLSA 5JW6A 3CS3A 5I5EA 3EVAA 1BH6A 1J7JA 2VRSA 3S3TA 2ZZMA 3GNQA 2WAXA 1EUZA 3S0JA 1U0OC 4KLAA 3TUJC 2W2MA 3MJVA 3ZGYA 3ZH9B 4DY4A 3QUTA 2ZI6A 1L0LE 1FLVA 4GDMA 4FOSA 4MV1A 1OE0A 3SQOA 1TD1A 5LQRA 2P79A 3TJZA 1WW8A 2HSZA 1H94A 2V59A 4X00A 4B3DA 4IV5A 4QOFA 2PCLA 5TPZA 3DNMA 2REBA 2Z57A 2EVWX 4WCVA 4W9NC 3OF2A 3RTDA 1ZD3A 4L02A 5IJ9B 3A9RA 4AKTA 5EE0A 2FWBA 2P7HA 2PUGA 1Y6GA 3K20A 1KILD 1AV6A 3N76A 3NRCA 4AJJA 2DUNA 1MABB 1Z5NA 3KQQA 1WVMA 4HDSA 1JKIA 4W7IA 3QKIA 5CM2Z 4FNMA 4HXEB 3MZWB 4PLGA 3E18A 1S2EA 2ZIEA 1DO2A 1J8DA 1RKBA 3CR8A 1I4TD 3ZTWA 2XCIA 5I7AA 2ONJA 3RLFA 1H5QA 3AJAA 4BNUA 5B2EA 2AC2A 3ENQA 4HGPA 5I4BA 4D6YA 2H52A 4TKUA 1KI6B 1V1RB 4JI2B 4MWTA 1Z6PA 5AI0A 1YA6A 1YMQA 2EDCA 3W8EA 5BU5A 4R0VA 3T1HB 1B74A 1G5PA 1PJ8A 2R1TB 3JQ7A 2C9LY 2ST1A 3V33A 4FKBA 2W98A 4N5IX 3KKQA 3KXDA 2IXBA 5TVKA 3ORYA 2FG7C 3FGPA 4I36A 5JI3E 5AW0A 4LC1A 2BTQA 4OK6A 5FLEX 2WJYA 4GKVA 1ZMRA 1JY3N 3SVTA 3KNZA 4I14A 1ZA2A 2E89A 1RQGA 4WESA 3TQFA 5AR1A 4C7OB 4FHFA 1QQBA 1CQPA 4PC7A 5B1HA 1T6ZA 3H6HA 3LCVB 5KLVD 4CEHA 4WQMA 4B0PA 4ZKUA 5KC9A 4MYCA 3SSAA 3F6EX 1MW8X 2WDZA 1Q3HA 4DWVA 3L70D 2EJWA 1INLA 1VLLA 5CAEB 4A2WA 4D8UA 1KI3A 3CWCA 3QNUA 1VBMA 4EUSA 4HEQA 3R8FA 4G5YA 1LZKA 3OUUA 4A1OA 3R6LA 5CNMA 1R12A 1V9CA 1CETA 3USES 3B38A 4AQ7A 2XA2A 3JATA 3B7PA 1MJGM 5DVZA 5J2TF 3CXHD 5A6SA 5F1YA 5SYAA 1FP7A 4JQYA 3TQTA 1ZVVA 1GT91 3CF4A 2JCYA 4HQKA 5LDDC 4MYTA 1PS9A 4WUTA 3I61A 1Q84A 1GMJA 3OTWA 2OAP1 3TF5A 5B5EH 5LZ5A 1KI7A 1P1JA 1U0NA 4HQNA 2CWWA 2JLQA 4ASUD 1RRCA 1QG2A 1SO8A 4YCAA 1H1DA 2OTCA 2I99A 1VKHA 3AVYA 4XM0A 2OHHA 1OXXK 3EH2A 5BNZA 1CSEE 2BELA 1K4MA 4JY7A 3IA2A 4URWR 2WSIA 1ZEJA 1N7JA 1IEXA 1KP9A 1N3LA 2DVMA 2O8EB 1PR6A 2JFBA 3Q3GE 2JLVA 3HH8A 5AM4A 3QUBA 5CBOA 3IR5A 4JT4A 2QN6A 2V6BA 4DY6A 3DHYA 1EUDB 4D99A 4BO0A 3K9FC 2ZSHA 1GDHA 1N0HA 4B6JA 3HGTA 1NJ6A 3MCAA 4PWYA 1EG7A 4YS6A 2QVBA 4D80A 3H65A 4BZZA 4NFYA 3OJXA 1OAKA 1E1DA 3K35A 5A2GA 4FR2A 3WZ2A 2Q21A 4XEHA 5H9WA 2KBFA 3I8OA 4Q9HA 2EJTA 4JP8A 5JRJA 1J0DA 5L4NA 4NRDA 1EX6A 2YWRA 3NRJA 2ZQYA 5EJ4A 5EJIA 3LDUA 2Y1KA 4CUJA 4A4DA 2WWTA 4Z4HA 3K70D 1TQ4A 1VXOA 1GQQA 2NT4A 1NBHA 3RRNA 1G7TA 3R3SA 2VHZA 4XH9B 1UODA 3F6BX 1KMMA 1X42A 2QZJA 3WAJA 3A6FA 2YOHA 2WNIA 3VR5H 5DULA 5AKIA 2GK4A 1V3QE 4DLLA 2D0DA 5BUCA 1E92A 2H0AA 4NCIA 1IEWA 3D4IA 3NJ8A 1IC6A 3RFTA 4QXQA 1CBUA 3U4QB 3A4VA 1UK7A 3VO8A 3OC0A 4D46A 5G02A 4C6TB 1SVOA 3H8WA 2DQYA 1RACA 4JWTA 3PXBA 4LWQA 4J7AA 2JHGA 1D6NA 5BT8A 1U0FA 2OCIA 5EJ8A 4Y8VA 4XB1A 2ZCJA 2JAQA 4GYKA 4XGNA 1KOGA 3RCBA 3GN2A 2XNCA 5A3VA 1KFJB 3IEVA 4X1IB 3L1VA 3EH1A 1QORA 2JA1A 1UZNA 4KFTA 1O8CA 1TTPB 3H9JA 1CJSA 3WK4A 5AVJA 4AYCA 4Q02A 4YEDA 2JP3A 2VNSA 1NX6A 4RCZA 4B3MB 2QZ9A 3ZIUA 4RTSA 4NZZA 2XLBA 3FFWA 1G2QA 4QO7A 3NBMA 1QO0D 4QYIB 1PJ2A 1GOTA 1TCCA 1ARZA 2AWOA 1NE7A 1LTJA 3GF7A 3UJPA 2XB9A 3B7WA 3GCDA 1R16A 2POQX 2G4VA 1P2TA 1RW4A 1Z36A 3ESRA 2WSBA 1FQOA 4AYWA 2OHXA 3RARA 1KI9A 4YAKA 2R85A 3LGSA 1N6NA 1MEEA 1WB6A 2ZBUA 1IHUA 3O7MA 4IG4A 4B40A 5JQGA 1DQZA 4OOFA 1YSCA 2NUAB 1QC5A 1Z2EA 2EFJA 5INTA 1QGYA 4YYZA 3QVOA 1MV8A 1AUXA 4OK5A 3U0VA 3VO1A 1CZHA 2ICAA 3FUXA 3NHUA 3EIWA 4KPYA 1FZAA 1QUEA 4ZTBA 1JG7A 5F1KA 1ABFA 3PVZA 3SD7A 2P4UA 2QMZA 3R9KA 1KO7A 1G63A 3J7AC 1LLCA 1ZNWA 1XN4A 3B82A 1KY3A 5AVVB 1Z12A 1Z7YA 3X1JA 3EGIA 5TLSA 3MBKA 3PRJA 2H1CA 4MR8A 5E3HA 2V8OA 5DW3A 4OHFA 3Q0IA 5EIWA 1UQUA 3TNUB 1N1GA 5FPSA 5JEEA 5CCXA 4WGFA 1E3WA 5EFWB 1ZNZA 2YHAA 1Q22A 4ZO4A 3CURA 4GQIA 4Z7NB 1KMIZ 1ZL0A 3K0FB 2OYCA 4J03A 3EFFK 2AQHA 2R1UA 2FWPA 1PGPA 1G3UA 2W5UA 1MEJA 4PPGA 4KRXA 1DX7A 5HZKA 1HT3A 5ILQA 1R66A 2Q2QA 1KAOA 4EOGA 3TNDA 5B3KA 1JB1A 4JYCA 1TF2A 4BV9A 3DD1A 3O8QA 2NX2A 3VAZA 3WRVA 3M9BA 4Y9UA 1WM1A 1YI0A 1SOMA 4M9ZA 4TKVB 1H9AA 5TPWA 2I9PA 3VKHA 2BF4A 1BE3D 4PZYA 4IHKA 4RANA 3OCVA 1ZJ5A 2IYTA 3LCUA 3ITDA 2R47A 5K2MA 1DOHA 3AHHA 2CVQA 4G9BA 1MRZA 1LBTA 3MQ2A 1F8UA 2YWHA 4P0TA 3BM5A 4BMZA 4J4TA 5CJ2A 3R5SA 1UM9B 1Y1LA 3V2IA 3D3NA 1OXKB 1R5JA 2GN8A 3B9BA 2E4WA 4QQNA 1H5NA 3U59A 1UZAA 3HSSA 3MYRA 4M7WA 2PNFA 3NVAA 4WWHA 3PFIA 2NUBA 4U2EA 3HCOA 4C7NB 4MV9A 2CT8A 4N5NA 5JDCC 1HJ0A 3B8EB 4Q3DA 1Z0IA 3SR4A 1IN6A 4LRXA 4PV1B 4AO6A 2GTPA 4HAIA 4PVCA 4DIFA 2AFIA 4CDMA 3B70A 4OHWA 3FHOA 5KSZA 3TMAA 1UXGA 1XCGB 3PJGA 4O4IA 4MINA 4W8GA 1OTHA 4JNCA 4FUTA 1QH1B 1G9TA 1IWOA 1GUAA 2CLIB 4TV8A 3CRNA 3D2LA 1T9BA 3OEYA 4KFUA 1AVYA 4ZALA 1Z0FA 3A1FA 1B26A 4AP9A 1GTZA 3NNNA 3ZV6A 4EL0A 2HPCA 2W6MA 5ALZA 2C97A 1F9AA 2Z5GA 1E1YA 1SB8A 3LRTA 4LF9B 3G2OA 3SYRA 1FYDA 2QJOA 4RS4A 4ZTUB 4RU1A 1ABBA 5JCOC 2GN9A 3E4CA 2FPRA 1G60A 1GLGA 1X7WA 4YCJA 4YXWD 5BNWA 1PK8A 5KS2A 4J91A 2PSJA 1SCDA 1OXMA 3INRA 2Y2UA 5C0OE 4O0MA 1NKVA 1YRWA 1RAGA 2J30A 1JE1A 2IEGA 4IPTA 1EVZA 1W19A 2F90A 2PXHA 3DE0X 5E6UB 3OMLA 3T9DA 2OVBA 2O48X 1TUBA 3V2QA 3R3WA 1HH0A 3KHSA 2PBRA 1VMAA 4FOLA 4NH0A 4TQUS 1YR3A 5I9LA 4TXHA 4I4LA 1UIIA 2GNOA 1ENZA 2LR2A 2PQ0A 1L4LA 2G6BA 4A82A 3W1VA 4Z51A 3R7DA 4JOBA 2QRVA 1ZVKA 3HTKB 4OVKA 4S2EA 1R8EA 2JZNA 1MZPA 2XRYA 5JY1A 1XG5A 5ETJA 1GNRA 4WY5A 4TTAA 4M3LA 1JIXA 1JIQA 2C2ZA 4P86A 4EG5A 3EXFA 4D5EA 4FFVA 4OP3A 1DV1A 1T8WA 1PPJG 3E3MA 1VECA 2QW1A 1Y3FE 1KPGA 5BV2P 1Z8DA 5DJ5A 1K4KA 1WCXA 4H3VA 5KYWA 4OJYA 1XZKA 3EDYA 3AHDA 4D9BA 1XTTA 3LQRA 4KT0J 3M5CA 5HJEA 2J7KA 4P82A 3HZZA 3HQ4O 3Q5PA 2ZAYA 3CCCA 3DCJA 3L02A 1JR3D 3GN1A 3VRHA 1QVRA 2HJWA 4ZYVA 3EY9A 1E2FA 5FTNA 3K5HA 4EG6A 3O94A 3KPEA 1P4HA 4UU8A 1WZNA 2LNDA 3Q5DA 4IIXA 1X7XB 2B5OA 1PVVA 3WL8A 4ITVA 4R1UA 5DN6D 4UEWA 4HDKB 3FX0A 3DAYA 4IYRA 1AVOA 4DJGA 5DPMA 1XWWA 1QNLA 4B9EA 1U8EA 1PT8A 1QGUB 2VYFA 4BQSA 2XMSA 4TL7A 2Y1FA 4WH0A 1UBHS 4J0EA 4CKWB 4EYQA 5LPNA 4IL6E 5K0ZA 3M0AA 2RFLA 2QX6A 4C03A 4AURA 2CHVA 4NY1A 4S12A 4QICA 2IS4A 2FPGA 3JARB 2ODBA 2G5GX 2QRZA 4O4LA 4I2LC 4NOLA 3G8DA 1RE1A 2I8CA 3EFBA 3WHLA 1OVVA 1JMKC 4K05A 3BIXA 4XQ9A 2O50A 4HJXA 3QU9A 3OP1A 2LV8A 5IK2A 3LXUX 2E74C 3KWMA 3DDZX 1W25A 1E5TA 3QXXA 3RTEA 3BAFA 1VF5D 4ZMRA 2V7QJ 1R50A 4NCAA 2JKYA 4FDAA 5BMVA 3QVXA 3CD6P 1N7SB 4OUDA 1DJNA 1W35A 3GG2A 3CRW1 4LEIA 2PZBA 1IM2A 4F3RA 1TU3A 2GN2A 3NASA 1N86A 1JU9A 4YAJA 2ZIGA 5DWDA 1FSZA 4NCBA 3VA7A 1YUNA 1KZHA 1GL2D 2EJUA 3USCS 1HT0A 7ADHA 1FFCA 2AN4A 4ZYYA 1X9HA 3LSYA 1VJRA 1TCVA 2FN7A 3SS9X 3EMVA 2FKAA 4WZBE 4BX8A 5ALVA 3NHRA 2WT9A 1F17A 3IR6A 1Y8CA 3OLWA 2H31A 1CERA 1QVZA 1CJTC 4BVEA 5K0GA 5CH8A 1G2IA 4I2VA 4O8ZA 2WIAA 4BBAA 3ZZUA 1PJRA 1Q12A 3P9ZA 4QREA 1YJ8A 1NM5A 1XZHA 5FEUA 1HQYE 3GGJA 1SQXK 1FRZA 3SOZA 4DT1B 4GU5A 3WO1A 1FPMA 1BN7A 4AB1A 1KIAA 1BWSA 4QSHA 5GJWC 1I2CA 3D6MA 1AZSC 1F6WA 2ESRA 2Z08A 3D4LA 1SZCA 1A82A 2DKFA 5A06A 4EELA 5H81A 2M1XA 2DFPA 2ZJOA 1MP0A 4ZI7B 1X8LA 2HU5A 4OYYA 4I1VA 1E9AA 4F6RA 1Y5IA 4MRRA 4Q24A 3EZFA 2EG9A 2WW8A 4TTIA 4AMBA 4LNAA 5ER9A 4BP9A 1TAHA 3KQWA 1FFYA 2GZRA 2WYIA 2XE8A 2EJCA 1DC3A 5K6TA 2XE7A 1ZK3A 2IDMA 4W6ZA 1M54A 3GH1A 1WULS 3KJEA 4DPMA 1SQXE 3SSOA 2W2LA 1LT9A 4KVFA 5CGZA 1HMPA 5BW6B 5MDHA 3D6AA 1HDZA 4P34A 1UJ2A 5EIOA 3KO8A 1DD4A 4DSTA 2GN1A 3KG2A 5D00A 2XNXA 3NWOA 3LUDA 3WNDA 4DIUA 1PYOA 2OD2A 2CMDA 3GLIB 1T24A 2WJHA 4R2XA 3OEWA 5F2KA 4K35A 2NZ2A 1JEDA 3H84A 1V6SA 1VIVA 4XVQA 4JITA 1V7QA 4PSDA 2RD2A 5CDFA 4JBXA 1NI4B 1FMCA 2G40A 1ZR4A 1LTJC 4FLMA 5IMBA 3EBLA 1PFVA 3TLYA 1A04A 2ZUVA 3N59A 5A4KA 2H4YA 4H31A 4OEHA 1LS6A 4OU4A 2WWXA 1YT5A 1LCIA 4OHXA 3OQBA 4L4XA 3T35A 1NU1K 1NBMA 1BA3A 1A77A 2FW1A 3LRPA 1B2LA 4OBBA 2JBHA 2OCXA 4X24A 4MLCA 2PX8A 3M9WA 1YDWA 4ZEOA 3UHFA 1XDSA 2FSGA 4M1WA 3UJ7A 4RD1A 4S1OA 4MRMA 3TSZA 3Q8MA 2YZKA 4LA4A 3OHMA 5AVYB 1XLUA 4Z9FA 5EYPB 1YRBA 4O2BA 4V0QA 5APUA 4MH0R 4C4OA 1DH3A 1JPJA 3Q0TA 5KNDD 3AVPA 5KAPA 2RC6A 1VI5A 4F7DA 2IEZA 3Q8XB 4JX8A 1RZRD 1COWD 3GQBB 5GAJA 3GAMA 4IX9A 8LDHA 2AUNA 3U17A 1VZ3A 2Y0DA 3HHPA 5LZ2A 1T2NA 4KQEA 5SV2A 1XLWA 4M0PA 5C8XA 1ZP6A 1KFNA 1PZQA 3CLHA 3FD8A 5TISE 1U1CA 2AW3A 2WTMA 5AHXA 1OFUX 4KHPB 4DA7A 4ZI7F 2VXCA 3CUTA 2CL6X 1ADCA 4Y67A 2WK1A 4LTNA 4KO1S 1NTKD 3AJRA 3SMVA 4QFMA 5KKNB 1FYEA 4FDVA 1BE1A 4NVRA 5AJWA 5LDGA 1II0A 3E48A 3K2QA 2WZCA 5HK9A 1SVWA 5K5GB 2Q4EA 2XB8A 2YIJA 2MR6A 1R0WA 4A7PA 3PE6A 2OYRA 1WBDA 5EL0A 4W8HA 3X0DA 2CV0A 1JKJA 2DPMA 1A97A 4EGFA 1QV6A 4DDMA 2P5SA 3OQHA 3JZIA 3ZHUA 3TX2A 1L7EA 3D5EA 3ICWA 4OSEA 5JQGF 5J1SB 5DYGA 3LXXA 1WUTA 3JPYA 4ARUA 4KE9A 1VRWA 4UBLA 1G8KA 3ROFA 1CUVA 2D2CD 1LDEA 3GLGA 1PL8A 3KKEA 2J3QA 2C7PA 3ZJ4A 3ZVRA 2IE0A 1ID8A 1HGVA 4RXUA 1LWNA 2OV6A 2H18A 3CGWA 1DEAA 4BYMA 4UASA 4ZMSA 1JE0A 3MGBA 4GMXA 3R2PA 1Y4SA 4BLOA 1ISHA 2CNLA 5CDFE 1JSRA 3U3JA 1CRPA 1M8GA 3G9TA 1LQTA 3C5EA 3KOYA 1RYBA 3HP4A 2VF5X 3ENWA 4IKOA 2GEDA 3T0FA 1ZH0A 4IUYA 3C4JA 3I34X 3STYA 4CF7A 3KLNA 4GIBA 4RIGA 3DPSA 3G6KA 4DDVA 4QRIA 4RDXA 3G9QA 4JJIA 3OEHA 3DGFC 3VPCA 1I4WA 5EJ7A 4YRAA 4G23A 1QCCA 4D6TE 3IKVA 2RG1A 1R3DA 2B1QA 4ON9A 1U90A 2OTJP 3F6CA 5AVSB 1DAIA 4NOMA 2W42A 5M1BA 4DCJA 1SQGA 5CM9C 3GT0A 1U5BB 1UMBB 4IVPA 4WTOA 2VRWA 4OHZA 2YV4A 4S24A 1NSTA 2OXTA 1HE8B 3S2YA 3U39A 3FWKA 3HVRA 4IWXA 2UVPA 3TQRA 1N4DA 3E6AA 1K6JA 3HD7D 1YE3A 2GLUA 2PXAA 1E8MA 2PD3A 1E0JA 5TJ9A 1A9ZA 4JLAA 1IXSB 4WZBB 4KCGA 2CPBA 5CFNA 3K72B 1GRRA 3VYWA 5KNCD 1NWCA 1YVUA 1R4AA 1XTRA 5IBPA 2LXNA 1GKKA 4UTRA 5G3ZA 2Q6KA 2ZJFA 4LQDA 1L9KA 1UKBA 4QT0A 4JI3B 3PQ8A 3UWDA 1ZISA 3L6BA 1I7NA 4AECA 4RA9B 2WFZA 5DBIA 3K53A 1GGFA 3V48A 3D3KA 1G20A 4JQSA 1WOMA 3EDRA 4R54A 2ZBDA 3EUEA 4C43A 4KACA 4ARZA 3HVUA 3CVJA 3GHGC 2G83A 4DJJA 1JFRA 4FP9A 3Q8LA 2X86A 3DL4A 4TS9A 3WGLA 1CI6B 1VLMA 4TXLA 5M04A 1O9GA 1ZGGA 3JX9A 1QK4A 2IUEA 1IYZA 3NHJA 4K88A 4M2LA 5TX7A 1ZG3A 5L3SA 4WV3A 3T3DA 4CF5A 2AXEA 4TWRA 2PRRA 4M1ZA 4XX1A 2QJTA 4PX9A 1ZM4A 3C5CA 4Z54A 4PYRA 1LJ2A 4O4IF 3VR4A 3RUDA 5G1PA 5CFMA 1ZZGA 2FETA 2PLRA 3TTVA 5K0SA 1HEIA 4R7ZA 5E1OA 3P0FA 4DNQA 4NFLA 3ZGOA 4F06A 4TV8F 5KI6A 2HMVA 3PP8A 4D8TA 4MIOA 1Q16A 4U1RA 2DR0A 4R4JA 2AUMA 2QTVA 2XDQA 4FYHA 3Q1KA 4QEDA 2C0WA 2HMSA 4AO8A 3WYBA 2OZKA 5J2UA 4LXXA 1JY2O 3EZNA 2G70A 5AICA 4FYYA 3VYRB 4MIKA 1H3NA 1ULUA 3T4XA 2ZAGA 2VQFB 5EGSA 2BMFA 3H1IE 1IK7A 2JHAA 1ZZEA 2XWPA 1U2QA 2D1YA 4LSMA 4NPAA 4P80A 1GEGA 1UDWA 4XWWA 3K6SA 4YONB 3DG9A 5E9QA 3U3ZA 3C6BA 1BCCD 1ZNXA 5ES4B 1CKEA 2J9RA 3N2GB 4UM5A 2OXCA 1N6OA 1PNVA 2ZB3A 2FHSA 5CMLA 5K8TA 3FOCA 5KZMB 4KYUA 1C9MA 2GPWA 3MMZA 3IQWA 2H8KA 3AMVA 5FFFA 2I7DA 1JY3P 4RO0A 1VIMA 4URUR 4EUNA 4LJ8A 4BEJA 3BXZA 3LOUA 2Z9DA 3WXMA 2HF7A 2Y0BA 1N6KA 3JVEA 5IN5A 5I47A 2HPHA 2HMWA 2NVUB 3AI1A 1HI9A 3FSGD 1K08A 1G20E 1D2AA 4PFJA 3R2JA 3NTNA 3K2BA 3TPFA 5AW4B 4W5OA 3RWBA 3A36A 1ECLA 1H1LB 5LJLA 4V39A 3UWPA 5LU8A 5EXXA 1J2JB 2LDBA 2OM6A 3RJZA 4CETA 2Q5IA 4FIDA 3CNQS 2E75D 4HKTA 1GUBA 2FLVA 1FIUA 1VPDA 4GI7A 4GMKA 2OZVA 2OXIA 2QL5A 2WD7B 4EHLA 1FFWA 3L72E 4YGYA 1HXHA 3QSGA 4OL0A 3IODA 3QP9A 4Q34A 4XPIA 4OGLA 4MO9A 2PU7A 3A9UA 3HHEA 1VYTA 4D98A 3ANXA 2GLXA 3PTZA 1OZGA 1W73A 4OXXA 5BUQA 2Q4TA 3RU7A 3VYTB 1NM5C 3W2IA 5FBZA 4US2R 2QUBA 1EFPA 1WQ1R 4POOA 1SQ0A 1F8FA 4C4PA 1TM4E 2J0VA 2H8PD 2QVCA 1KEWA 1HDYA 1I10A 3HXQA 1NY5A 2IS6A 3IDOA 4TTJA 4Z4GA 4GX2A 4G0ZA 3FHCB 1Z25A 4KOEC 5F52A 2FPOA 3ZVNA 1LTSC 4ICIA 4O4LF 2ZE5A 3AOGA 6ADHA 5APQA 2ZE7A 4BE7B 2CPSA 4XQEA 1DAPA 3B6JA 2WHPB 1K9SA 2WB2A 3QHAA 2Y71A 2IHNA 1P62B 3UBMA 1EK0A 1O9HA 3T5AA 4GGMX 4P3XA 2QYTA 1IFXA 3DF9A 3P71T 2XRMA 3EDOA 1GUZA 2ISQA 3S8EA 1QIFA 3V2RA 1SQPG 4Y2QA 5BMVF 3OZDA 3V7FA 3ST7A 2QSUA 3CE9A 4C0SA 1RE4A 2OTKE 1NLMA 4GGPA 3IUEA 3B20A 1O08A 5JS1A 4EAQA 3RK2B 2MSWA 5EPOA 3TOZA 1YHQP 4OD0A 2QOEA 1LT9C 2EIHA 4HN2A 4JP5A 1I6MA 3DOOA 5ELMA 1CRLA 3OIDA 1GHTA 3IEMA 1Y7PA 1BCRA 5C8VA 2WUEA 3KVNA 4KPUB 1UPXA 1ZUD1 1OW8A 3D02A 1XFDA 2V8BA 4DCVA 4X63A 5TV2A 5GMOA 4F46A 1KBQA 1GZ6A 3KTOA 1NP7A 4PRZA 1RRKA 1T4MA 4X54A 3DTVB 4TZTA 3KJNA 3ZKWA 3V6IA 4I1SA 4JYBA 1ZI6A 4AG3A 5HUJA 4B75A 1RQPA 3QKUA 4QYSA 1OB2A 1U0TA 2BGUA 4JBGA 2WPVB 4MI1A 2GJSA 4QPDA 2XDAA 3H11A 1QZ3A 1E58A 2CK3A 3GUCA 1UBKS 3JQAA 5AVUA 4EG8A 4K1XA 4LJ5A 4CQLB 3V1UA 1OIPA 4UEOA 2A5JA 5JSQA 1SAYA 2XWBF 2OILA