2ZYDA

Dimeric 6-phosphogluconate dehydrogenase complexed with glucose
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
464
structure length
464
Chain Sequence
KQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
total genus 169
structure length 464
sequence length 464
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zydA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zydA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zydA01
1FDUA 3DEYX 2VT2A 3BHIA 4Y6PA 4D7AA 4HX5A 1BHSA 4GQAA 5ILOA 4R54A 1E3EA 5DNAA 1MX3A 3HFSA 1I0ZA 1YBMA 2RIRA 1GV1A 1R6DA 4J3FA 1E7QA 4WEOA 4E2ZA 2VYNA 3GLQA 5BR7A 5EN4A 1Y9EA 4XIYA 4XWYA 4AJNA 5HTOA 1C1DA 4D79A 5L53A 4IS2A 5JDIC 3AU9A 4JROA 3G1UA 4IDFA 4FOSA 4FSHA 4B3JA 2HDHA 4DPMA 2CDAA 1ISFA 4TROA 3RFVA 3FWZA 4WASA 4RJTA 5KJFA 2E48A 3G17A 5KJ6A 2ZJ1A 1YB5A 4QSMA 5KJCA 2BH9A 5CDYA 5G0UA 2AEJA 4EITA 2B5VA 4Q3NA 1KVQA 4OL9A 2XOXA 1I5RA 3O03A 1FDWA 3GT0A 3IUPA 3HHPA 1LA2A 3TSCA 1ADBA 4GH5A 4WPGA 5KVCA 3PEFA 4GKBA 4DYDA 1C1DB 1EDZA 1PU2A 1MP0A 1PJCA 4NH4A 5CEFA 4XGIA 5FFFA 3D0OA 4D3SA 1GL3A 1SMKA 1V35A 4MJLA 3E82A 3L4BA 1LLQA 3EZYA 5L4SA 2HLPA 5H82A 2D3TA 1E1NA 3A14A 1Q2XA 2CVQA 1LC0A 3ROPA 5KIAA 1ZKMA 2J5KA 3BMNA 1YO6A 4QQRA 2D2IA 4M55A 2AG5A 5TRTA 4M1QA 5A9TA 1YONA 4J91A 4P4NA 3DWFA 3SLKA 2EKQA 4QECA 2Z95A 2JFHA 2PZJA 4MP3A 3VPSA 1JLLA 4R51A 3SJ7A 5FI3A 1EUCA 1YDWA 4HKTA 3HDQA 5K6AC 1BTOA 1AXGA 5GZ1A 5FEUA 2G17A 5DBGA 1I8TA 2C7GA 2W2LD 4BKUA 1VL6A 1I01A 3MWEB 3S2FA 1GR0A 1UAYA 3WIDA 1JA9A 2F00A 4IXWA 1DJNA 4F6LA 4MP6A 1ZMOA 4YPOA 3TJRA 4ZICA 3D1LA 4CQMD 3CZRA 4TQGA 4Z3DA 4OQYA 1GEGA 1LXCA 3VOSA 1ZW1A 3CMMA 4YRDA 3BIOA 4FBGA 2C2XA 2ZB8A 5COAA 3SVTA 4E5YA 3I9MA 4AG3A 1P1FA 3WBBA 2X9GA 2PD4A 4ITUA 2TMGA 2ZB7A 3MJTA 3ZDFA 4NK4A 1NQAO 2O3SA 3CTVA 4GGPA 3X2EA 2ILTA 4ZRNA 1SNYA 2GN8A 3U49A 2GF2A 3ZV3A 3RJ9A 4YYZA 4Q9NA 3WLFA 3I9NA 2IXBA 2PY6A 5CEJA 2I67A 3GVCA 4GX2A 3F47A 1EE2A 4CM5A 4AJIA 1YH3A 5GZ6A 4BMSA 3JQEA 2EJWA 1QYXA 1BXKA 3NV9A 4QX6A 2QYSA 1QYVA 5DDIP 1X1TA 3C85A 5DOZA 2CMDA 1AE1A 1E5LA 2GGSA 3QVWA 2NNLD 4RPJA 4XR9A 4CMKA 3OA0A 2PTGA 3UXYA 4PFJA 1VLLA 3F6YA 2IXAA 3QVOA 3K30A 1JKJA 3PHGA 3WQSB 2UV8A 1C0KA 4BNKA 1K6IA 1A4IA 3H5RA 3ST7A 3NX4A 1Q0HA 3RUEA 3ZWXA 4BNNA 4D46A 1H6AA 1QKIA 2W2KB 2X0RA 2HKIA 3I6QA 1PJLA 1YDEA 4XDYA 4IDBA 2Q99A 2NVUB 4BNMA 3RUAA 4BKOA 1KVUA 4Y6RA 5JC8A 3Q9UA 3PRJA 4RDIA 1SOWA 4WECA 1WLYA 1PZGA 2CF6A 3FCOA 3PXXA 4W9NA 4EZBA 1IYZA 1PWXA 2CVOA 3AUTA 1D7OA 3FR7A 4RL6A 2DVMA 2VZ8A 1F06A 2EJVA 3WFJA 3ROMA 5L40A 1YKFA 1VI2A 3VPXA 4IJVA 4CUKA 3GG9A 2DQ4A 4BNIA 4EUEA 1H6DA 3AI2A 4PG4A 3LC7O 4FJ0A 1OI7A 2AQHA 2FP4A 3GDOA 4YJHA 3UN1A 2HMVA 2A4KA 4BIIA 2G76A 1IHYA 1BDBA 1GQYA 2GZ3A 3IMFA 3ZWVA 1K2WA 5LC1A 1DO8A 3TPCA 3I23A 3UVEA 1CJCA 4NHEA 2PD6A 4A26A 1PJ2A 2VHZA 1MV8A 4RCVA 1GV0A 3I1JA 5I7EA 3OJLA 3ZZNA 3DZBA 4D44A 5TT0A 2ZKLA 2V65A 1UJMA 3GY0A 1U3VA 1B7GO 2C7VA 3AM5A 3FSRA 3G79A 4EEXA 4RPHA 4ZJUA 3FPLA 5L7YA 5TSDA 3PFFA 2V7PA 2VQ3A 3HDYA 1DFHA 2QZZA 3VDRA 4E2WA 4DYVA 1L1FA 8LDHA 3U5TA 3ZV6A 3HDJA 4BB5A 1RPNA 3D4OA 3GFBA 3HB4X 4GI2A 4ONEA 5EINA 3QE3A 3RU7A 3WG9A 4AJPA 3VVCA 5DOVA 4G2NA 5DP1A 3ZH2A 2Y1CA 3SC4A 3Q2IA 3ZI0A 3NDIA 1M66A 5ADHA 1KY5A 2VWHA 3DB2A 4MPDA 2DAPA 5KCZA 1A5ZA 1T25A 2C5AA 4FS3A 1YQDA 1J5PA 2EHDA 5EJ2A 3PHJA 2XXBA 1AGNA 3INRA 3ZHYA 2Q49A 3GNQA 4YAIA 3X2FA 4Z6KA 1DHRA 2B83A 3EZLA 1PJ3A 1TXGA 4NBTA 1P1IA 4R5HA 3I9OA 4XYLA 1GYPA 1BXGA 4K26A 2YHIB 1EUZA 1DPGA 1I2ZA 5JY1A 2R00C 1GPDG 1D8AA 3RD5A 4CR6A 5CDTA 1HDZA 1ZXLA 3GEGA 1GCUA 4NU6A 3V2UA 3IJRA 4CLRB 3GA0A 4J1TA 2HJSA 3F4LA 4KQWA 3UW3A 1DFIA 1ZK0A 5C37A 2PV7A 1AHIA 3Q9NA 5HS4A 5KKCA 3AJRA 3O8QB 4D41A 3QSGA 4IDCA 4R41A 4RPLA 3VPHA 2RH8A 3U3XA 3GG2A 5JPIA 4RF3A 1I33A 2W98A 1DRUA 1RWBA 1SCUA 2HMUA 3TZQA 1LC3A 1KBZA 1Q7CA 1N92A 1UDAA 1ZEMA 3D4NA 2RAFA 4BUCA 2VRCA 5T64A 1TEHA 1A7AA 1J6UA 3K5PA 4EUHA 4CODB 1GUFA 1FDTA 1LJ8A 4E2YA 1KVRA 5F1PA 4Z9XA 5L4LA 2VRCD 3IKVA 1QSGA 4UUMA 5JW6A 5JNLA 1SB9A 1S6YA 1H5QA 3ONFA 1VL0A 1ZXBA 1P74A 4WLEA 2I5PO 5MDHA 1ISIA 3GPIA 4OXKA 4W9NC 2AEMA 4XB2A 5JMPA 1WDKA 3KYBA 1K89A 3B1KA 3GGPA 1IUKA 3RC7A 4Q3BA 5IZCA 2X23A 2BFOA 4DLLA 4DXHA 4YBZA 2AE2A 2PKQP 2NWQA 4E2XA 4BNGA 4D43A 4G5HA 3O4RA 2DKNA 3OH8A 2AE1A 3OEWA 3I52A 4S1VA 4LMPA 1CDOA 5T6BA 1RYDA 1U9JA 4DL9A 3D64A 1ZEJA 2I6TA 1VM6A 4IGEA 3BMOA 1DIGA 3MEQA 5AQ1A 5IN4A 3DAPA 2FSSA 2VWQA 4GX0A 4I08A 4BNVA 3H9GA 3KUXA 4QO7A 1YE3A 4OOFA 3DTTA 5THKA 4R69A 1FK8A 5COQA 4L74A 1PIWA 3Q11A 3HJAA 3HUDA 4PIVA 4U7WA 3KETA 1NHGA 4IZHA 1B26A 5TLSA 2NU9A 3GC6A 3LT0A 1WZIA 2P9GA 4LCJA 1ZUD1 3EVNA 4BNZA 3DONA 3DMYA 4DQVA 4U0JA 4GBJA 2ZJ0A 1QYDA 5DZSA 4PG7A 4AJLA 3TFOA 1QLJA 1ONPA 5ITWA 3OJ0A 1XKQA 3ZNNA 3TL3A 3U9LA 2Q1SA 4BO2A 2TMDA 4GLOA 5JMWA 4NJMB 1N9GB 1A4UA 3V2GA 3DFUA 3ROQA 2XPCA 1UDCA 4CQLB 5JDCA 4A0SA 1SB8A 1EVJA 1CRWG 4CR7A 2OMEA 3BTUA 4HNGA 4GLLA 3TZ6A 3GMSA 3G49A 3BMCA 4H15A 1JN0A 4UUNA 4CM8A 1C1XB 3MCVA 4ND1A 1JQBA 3LT1A 4D45A 2R00A 3DZIA 4FN4A 1BDMA 4FFOA 1X1EA 1NWCA 1D3AA 5C7OO 4XX0A 3VH2A 2O3UA 3K2EA 1ZK3A 3C7CB 3JYOA 1V3UA 4JJFA 5L3ZA 2DM6A 4NFSA 4JJIA 3TQHA 1KOLA 1DAOA 4CM9A 1ADFA 2HSDA 4A2CA 2FPIA 4AFNA 1P0CA 2C54A 4E32A 1U8XX 1CERA 2G0TA 5AXBA 1PS8A 1NVMB 5EQDA 2DBVO 4OXNA 1QLHA 1SEVA 4QFDA 4E6PA 2DTEA 2E49A 2ZB3A 1UZLA 3VPFA 5I9NA 1CEQA 2GDZA 2NSDA 4DMMA 3D3WA 2I99A 5BNFA 3KSZO 4UUOA 4RVUA 3U62A 1M2WA 4YTEA 3ON5A 3UCXA 1SEPA 1OOEA 2FR0A 4WEQA 1UXKA 3R3JA 2CNBA 1ONOA 4WJZA 3UKOA 3ZHBA 4EEZA 3TOXA 3RSHA 1I32A 4NDNE 1NTOA 4FC6A 3LSYA 2E6UX 3UFXA 3C1AA 3IOYA 3UCFA 4M8SA 1XYGA 3JQ9C 2VTEA 1ZJZA 1NP3A 1EEHA 1GU7A 1R0SA 2OBNA 3KB6A 3LT4A 4HUJA 3RI3A 2E37A 4YJGA 3ROKA 3T4XA 3QVSA 5B4UA 5JO0A 3E1KA 1LSOA 1DLIA 3WMXA 3JD1A 5JO9A 3IIEA 1PGQA 4R1UA 1PZFA 4PLHA 4YRBA 3QJ5A 6LDHA 2HRBA 1PGOA 2AG8A 4NMHA 3RUHA 2O2SA 4LK3A 4LN1A 1DXYA 4Q3EA 1YRLA 4CMEC 1P31A 3IP1A 4XZ3A 2JFGA 1B8PA 1B0AA 4ZGWA 4YAGA 1NFQA 2O3QA 1QP8A 2DBZA 3GUYA 2NLOA 3NJ8A 1E3WB 3HWRA 2I9PA 1CQIA 4WLFA 4CLOB 1XWFA 3JQCA 5EESA 1DBVO 4JBHA 1GD1O 4BNLA 4FB5A 2H1SA 1ONNA 2Q50A 2SCUA 3BMQB 3CH6A 1PJSA 5G4KA 2O3JA 3BA1A 4J43A 3VTFA 1Y7TA 5U9CA 2I76A 5U4QA 3SC6A 3PQDA 1A9ZA 3H5NA 3ZCXA 3KM0A 4RQTA 3P19A 4NFHA 5KJ1A 2PGDA 1E7MA 4R9SA 9LDBA 3I3OA 4EYEA 4CMBA 3HADA 1YQXA 2LDXA 3LQFA 1LRLA 4RGBA 4YAJA 2Q4BA 1KEVA 3ICPA 4O5OA 3WDSA 5I9LA 1PS9A 2AXQA 5BSFA 2FHSA 1E3WA 4HV4A 1XEAA 3JQAB 2PKRA 2ZTVA 4WLVA 2D1YA 1HDYA 2C07A 2EEZA 2AEFA 4JCOA 3W4IA 3C7DB 1LUAA 3MZ0A 4CM9D 3A28A 3E03A 3K92A 4B7XA 1A7KA 2B37A 3PPIA 4DIOA 1E3JA 2G5CA 4GVLA 2GERA 3DHNA 3P2OA 3QV1A 4E0BA 4IQ0A 3GAFA 4AJEA 5G4KB 4IJUA 1HETA 1BGVA 2BKAA 2FWMX 1Q7BA 2JAPA 4J2OA 1MLDA 4AJOA 4EI2A 3GDGA 3RCBA 3A06A 2JFFA 4FPXA 4U8GA 5ENVA 3ASUA 1N1GA 4PZDA 4OO3A 4R1SA 3FNFA 3M2PA 3ZWAA 4DRYA 4E30A 1H6BA 5A05A 3KV3O 4CUZA 2GASA 2H6EA 4UEOA 5BSGA 2JD1A 1H2BA 4QXMA 4CJXA 2DT5A 5H81A 3G0OA 4ALLA 1JDJA 4B4UA 4J0FA 3VKUA 1Y1PA 5CDGA 2BI8A 4R16A 4Y98A 1U3UA 3OBBA 4CMHA 1BMDA 1MFZA 2VRBA 4NJOA 1DIHA 3TRIA 4XQEA 1ZJYA 1C0IA 4AJHA 5BT9A 1M6WA 4IY1A 1GZ3A 3WJ7A 4RVDA 1N9GA 4MVJH 4JNKA 5G0WA 4GMFA 1LLDA 5DCUA 2GNAA 4LVUA 3H4VA 3S55A 3H9JA 3H7AA 1D4FA 1UP6A 3QIVA 4MIYA 5GMOA 3HN2A 2VWGA 3VH3A 1GCOA 3AW9A 2WTBA 2JKVA 3C3XA 3WWZA 1YB1A 4GWKA 3AUAA 1U5AA 4TZKA 4XYBA 4B7UA 4IPTA 5JFOA 1R4NA 4IIVA 4KTVE 3H3FA 4JK3A 1CF2O 1LSSA 1LRJA 4A73A 3ANNA 1PGJA 2C0CA 3D5QA 5AXAA 2VHVA 1T2FA 4B4VA 1QYCA 2NU8A 1XCBA 3OEYA 2D5CA 1ZZEA 1TI7A 2GN6A 3R3SA 2O2YA 1QORA 6ADHA 1P0FA 3OMLA 1TLTA 2X0JA 4XD2A 3GK3A 4H16A 2X7HA 3JQBC 3KYDB 1ENPA 2C20A 4URFA 2YW9A 4HWKA 3WLEA 3KRTA 3WYBA 1WPQA 4AJJA 1E1LA 4YT2A 3JQ6A 4CQMB 4D42A 2DBQA 5L9AA 1HEUA 4F3YA 3DZGA 2B0JA 3IC5A 3M2TA 1VSVA 3FI9A 3WGTA 4YXFA 1P1HA 1HZJA 1S7CA 2HK7A 2Y0CA 1YOVA 4AJ1A 4YR9A 4CMCA 5IN5A 4XJTA 1XR3A 2DLDA 2NU6A 4NBRA 3AUUA 1ULSA 1EK6A 1VL8A 2HAEA 3ZNPA 4B79A 1JKIA 4BO9A 3ZW8A 1O5IA 1PGPA 2OUIA 3NDJA 4IQ8A 4HFJA 1OC4A 1PZHA 1RM5A 1LNQA 4A10A 1W4ZA 1OMOA 3GQVA 4NNJA 3RKUA 4NI5A 5A04A 4DA9A 5EPOA 3GOHA 3WNQA 3AFNA 3EK2A 5DCWA 4PG8A 5CDUA 1DLJA 1UDBA 1B8VA 1NYTA 2Y67A 3ITKA 3RFXA 5KKAA 2IZZA 4F45A 1GTMA 5DBFA 5BNTA 3G1TA 1R4MB 2H63A 3ASVA 4G65A 3DHYA 5JY6A 4J4TA 2A9FA 1DRVA 4ESOA 2R2GA 1Q1NA 1ADCA 3WXBA 2OZPA 4Q39A 1PR9A 4FGWA 1KERA 3ITDA 3LDHA 1P1RA 3PZBA 3ZWPA 2Y0EA 4I5DA 1HDGO 5JDIA 3FWNA 3OIDA 1XLTA 4IS3A 5I9MA 5TQVA 4PZCA 1AHHA 1TT5A 2HRZA 2GD1O 3CMCO 4CLHA 4PLZA 1C14A 2BHLA 5JYDA 1KEUA 1R15A 3AI3A 4KP7A 3CINA 5IZ4A 4UEKA 4ROSA 8ADHA 5G0SA 4O63O 4DLBA 3WX0A 4K1LA 1ZH8A 2HU2A 2BMAA 1NAYA 4XRRA 3RBZA 2B4TO 1F8FA 2BGMA 3OA2A 1P33A 3BMCB 4YJFB 1ZO8A 3HN7A 3BTVA 4WOJA 1P1JA 5AXCA 5A5EA 2JCXA 4CQLA 2HQ1A 5AVOA 4ZQGA 5TGDA 3P5SA 1ZBQA 3MTJA 4CMAA 2RCYA 3Q3CA 1R4NB 2Q4EA 4ZHSA 5JC1A 4BO8A 5B12A 3RC2A 4WKGA 3TZCA 2VWPA 3HFGA 4S3MA 3GF4A 1NX6A 3HDHA 3VDQA 4IM7A 3OQBA 3WR5A 3FRJA 3O38A 3PDUA 3IDSA 4FFNA 4KOAA 1EBFA 1LQUA 5MGBA 5BSHA 4R68A 1IL0A 3S2IA 5A06A 3N7UA 3ZHZA 1O6ZA 3ICCA 4PGFA 3LK7A 3L4SO 3MJSA 3H2SA 3QWIA 1ZMTA 4FR5A 4X54A 2WYWA 1UXGA 4PRLA 3DR3A 1WP4A 3VHRA 3IAHA 2J8ZA 1FDSA 2IRWA 3A9WA 7MDHA 2YFQA 2DTXA 3WGHA 1P77A 3JQGB 2O4UX 3GVXA 1VPDA 1OC2A 3GGOA 3K2BA 3I4CA 4HNHA 1PL6A 2YDXA 2FPPA 1NWHA 2GO1A 1HDXA 1QRRA 3GN2A 3TDKA 3MOIA 3C8MA 4PN3A 4MVJI 4UREA 5BSEA 1G0NA 3DOJA 3COSA 3JYPA 4HFRA 3IJPA 4L0QA 1OZAA 4R01A 1EMDA 2BGKA 1CQJA 3DBRB 3LF1A 3QHAA 3F46A 4BV9A 2X58A 3HNPA 5CG1A 1GUZA 4I9UA 4RVSA 3TN7A 3GFGA 3WGQA 3ONDA 1O9BA 5I7VA 1ZFNA 4XQ9A 3I4FA 2EGHA 4OJNA 5CP8A 4DIBA 5BQFA 3PZRA 1TT5B 1ZK1A 4E21A 1DDOA 4XYMA 1GDHA 1AVYA 3KVOA 2YY7A 3JD2A 4K6FA 4OSPA 1Q0QA 4UULA 4BO0A 5JCJD 3ETDA 4HP8A 2P4HX 1NQTA 4ZN6A 3SBOA 1QMGA 4WCFC 4N5MA 3DOOA 3H9QA 4CMJA 4RF5A 1RJWA 4OKIA 3QWBA 3BMQA 3NUGA 3PLRA 2AQIA 3PIIA 5I8ZA 5C5IA 3M1AA 1OAAA 4JN6B 2OO5A 3JSAA 1PQWA 1R37A 4GAEA 2YFHA 2GSDA 2VUUA 1P44A 4ZVVA 1BVRA 1GQQA 2BGLA 2NADA 2NTVA 3PQFA 4OSOA 1PR3A 4CQMA 1LLUA 2ZYAA 3ZU4A 2O4CA 2G82A 2IZ0A 1DC4A 4IDAA 1XU9A 3WQQA 5CDSA 2CD9A 2YHIA 1YQGA 2VTDA 2VN8A 3ZNQA 2CSUA 4OGWA 4TRMA 3VH1A 4IMPA 5IF3A 4N7RA 4C7KA 4UEJA 2X1HA 1LDEA 3QVXA 3JQAA 1NFRA 1KY4A 2B4RO 4LISA 4L76A 1LDNA 3OF2A 1EBUA 2NACA 3MWDB 3F5QA 1AN9A 3RROA 4BKRA 1U4OA 3JQAD 1GY8A 3KYCB 4AVYA 1WNTA 2OHXA 2ZCVA 3OM9A 2D5AA 1Q7GA 3U0BA 1E3IA 2BF7A 1BG6A 2YV3A 4TZTA 2AQKA 5JAMA 4XR4A 4DREA 3CEAA 3DBHA 1T4DA 1I3KA 1T2AA 1R4MA 4WLNA 5HM8A 5ES3A 1DFGA 5ICSA 1E92A 4KDEA 3L77A 1E6UA 1Z75A 2J3JA 3IUSA 1RM3A 3E5RA 1XA0A 5BNIA 3NT5A 5A9SA 4MVJM 1VJTA 2Y05A 1YVEI 1GADO 1R16A 1HYEA 3PLNA 1D1SA 1QXSA 4J9VA 4NQZA 4WLUA 4AL4A 3A4VA 3V5NA 3D5TA 5HA5A 1FF9A 3L07A 3NAQA 4FOOA 5HBRA 5A02A 3OQ6A 1FXSA 1HYHA 3SXPA 1HKUA 1NNUA 4CM6A 5T8KA 4IUYA 2WSBA 2P68A 3ADPA 3KLPX 1SAYA 2BFPA 5LCXA 3ETGA 3T7CA 3ZU5A 2HUNA 1PJ4A 4RF2A 2Q1UA 3JQ7A 1HYGA 3K31A 4ID9A 1N5DA 3LVFO 4PVCA 4XCVA 3QWAA 4L4XA 2DFVA 4W6ZA 2J3HA 4MVJF 2QQ5A 3TF5A 4YACA 4BGVA 3JD0A 4E5NA 4RQUA 5TX7A 3C24A 1GPJA 1X13A 5G0VA 3UH1A 1CETA 3AM4A 2H5LA 5B4VA 4YAEA 4BMNA 1J49A 2O7QA 3ETEA 3GZNA 2C29D 1I36A 3IS3A 3L4BC 4HXYA 5A4DA 2YHUA 3RJ5A 2YQ5A 2P5YA 3IP3A 4GSKA 4WNCA 1YL7A 2CDCA 1KEWA 2VHXA 2YQ4A 1TB4A 1IZ0A 4YT4A 2CUKA 3L6DA 2C82A 4YVFA 3WTCA 5CAEA 1K3TA 1HLDA 2Y66A 4XYEA 1BW9A 3M1LA 3DZFA 3R1IA 3JYNA 4WCFA 3WQRA 4CM7A 3QW2A 4CV2A 5K6AA 3GVPA 3LU1A 4YEDA 4XIJA 3F3SA 3UUWA 4NIMA 3VZSA 1Z7BA 1ZVMA 2PKQO 2VUTA 3FNGA 4F6CA 1I2BA 2Y1OA 3NGXA 2QX7A 5IDWA 3GEMA 1ZSNA 3OHSX 1HSZA 4IIUA 2PH5A 3K6JA 1E6WA 1A72A 3WFIA 2P2SA 3PTZA 3KZVA 2B35A 4DIFA 2HK8A 4IXTA 4IDGA 2VOJA 2EP7A 3BZUA 2X5KO 5DT9A 2PR2A 2PGJA 4AJKA 4Z9FA 2BLLA 4B4WA 3DL2A 5HS6A 2ZQZA 3E5MA 3OIFA 1EK5A 2HMSA 4D0SA 4YRAA 3PJGA 4IDEA 2X6TA 4E3ZA 2WE8A 3PQEA 4J7UA 4E13A 4A5OA 4WLOA 2D8AA 3RQSA 1EQUA 2Q1WA 1T26A 4TKMA 3VC7A 1UUFA 1E7YA 4B7CA 1NVTA 3F9IA 1ENZA 2EF1A 3O26A 3MJ4A 4DLAA 5EL0A 1Y8RB 5ITVA 3C7AA 2GN4A 2J5QA 2EKLA 1MA0A 3RIHA 4F46A 2BELA 3DMTC 4OHUA 3BYZA 4KUHA 3UHAA 1IY8A 4XA8A 3LT2A 4CLRA 1DC6A 3GNSA 3PWSA 2EIHA 2AQ8A 3KYDA 4XYGA 4W4TA 4BHTA 3PK0A 3QY9A 4JGBA 2YZ7A 1LX6A 2I3GA 2PFGA 2FPGA 3I83A 1X7DA 1NVGA 3L9XA 1JWAB 4I5FA 1MXHA 3UICA 1O95A 3NT2A 1NQOA 3DAGA 1NAIA 1W6UA 4FJ1A 1QG6A 2ZTUA 3OICA 3U4HA 1JKFA 4FGSA 5G0TA 2Q1TA 1YWGO 2GLXA 3D4PA 3EUWA 4C4OA 1ZSYA 3JQFA 3O8QA 4CM4A 3EC7A 3STHA 3DZHA 1PJQA 1WZEA 4UVIA 1I30A 3K73O 1CWUA 4JBGA 2VCYA 1U28A 1BRMA 1I3MA 1K6JA 3PYMA 1O89A 1JAYA 4CM3A 3PJDA 1K5HA 1LDBA 4YDRA 4LW8A 4BNJA 1L7EA 4CV3A 1F12A 5DBIA 5F3RA 4RDHA 4TVOA 3FHLA 3AOEC 4LRTB 1QYWA 3KO8A 2W2KA 2YUTA 2LDBA 3CTMA 4TSKA 5J23A 5IAAA 1K0UA 3JTMA 1YGYA 3E9NA 1QV6A 1B3RA 1FJHA 1W0CA 3BMOB 3QA9A 4IINA 4YA6A 5C7IO 5KOIA 3GZ4A 4FIZA 1GQ2A 4E4YA 4NG5A 2X9VA 1X0XA 1Z82A 4P22A 1AXEA 3AWDA 1RM0A 1ZNQO 3K8ZA 2PGLA 2NQTA 2UVDA 3EW7A 2HJRA 2OBYA 3HE3A 3MTGA 4KWIA 4GMGA 4PG5A 4E31A 3OQ1A 5B1YA 1WXDA 2DFDA 4OIMA 4U5QA 2W4QA 4RLHA 2EW8A 5T57A 1JW9B 1V8BA 2PLAA 5JSFA 1XGKA 4R3WA 5A5FA 4RV9A 4YJGB 4EJMA 2B4QA 2PH3A 4CLDA 1X7HA 4BO7A 4NFYA 3AY6A 4O59O 4PLGA 3NYWA 1YJ8A 3GHYA 4TKLA 2BI7A 3BAZA 3TL2A 3ULKA 5F1OA 4H7PA 2PZMA 4W82A 3NKLA 4DPLA 3V8BA 3KBOA 2POQX 3UCEA 3GAZA 4MVJG 4WUVA 4ALMA 4KTTE 4ILKA 2Y99A 3CXRA 5C7LO 4GX5A 3ZN2A 3LYLA 5JCXA 3FBGA 1J4AA 2NVWA 3SLGA 1PTJA 2NVBA 1DAPA 3DHEA 2D0IA 4NBWA 4WK6A 4YQZA 3T4EA 3B20A 1M6HA 3D3WB 3WYCA 5TJHA 2FR1A 4RPKA 3QLJA 4BO6A 4L8VA 4WCDA 3H3JA 1EE9A 4YWJA 3AFMA 3H8VA 3WGGA 4A7PA 2JHGA 5JAQA 4DC1A 1D1TA 1HDCA 3LF2A 5EQFA 4FFMA 4AJ4A 1U5CA 1SBYA 1JVBA 1IZ9A 4LRSB 3K9QO 2IYPA 4TRNA 4ZQFA 3FPCA 2P91A 1V3TA 1WMBA 2WD7A 1VJ0A 3UGKA 1PL8A 5L7WA 1BWSA 2IZ1A 1B14A 1UXHA 2EP5A 1U2GA 5FWNA 4ALNA 1PQUA 3FR8A 2O23A 1A9YA 3RC1A 3GGGA 2DC1A 4I8XA 1CIVA 2QYTA 2DU8A 1EFKA 1V0JA 1VRWA 3NEPX 2J3IA 3RUDA 5IJZA 2O50A 4MKXA 4BQPA 5CHEA 1LRKA 4IZIA 1XIVA 2X5OA 3GR6A 2O7SA 2FZEA 3HG7A 4EJ0A 1MC5A 3W4JA 4BNFA 1U1IA 1O94A 4HBGA 1GYQA 3E6AA 4KUEA 1HSOA 1I3NA 2OGUA 3CPSA 4RZHA 4L9RA 5A1TA 3ZWMA 1EZ4A 3PJEA 4GL4A 1H9BA 4R5MA 4L75A 1MUUA 1H2HA 1BVUA 3RFTA 3IQDB 5KVQA 3SJUA 1G6KA 2HMTA 4WGGA 3LZ6A 4CV1A 4ZRMA 4Z3KA 3KSUA 1Y5MA 1H6CA 2AA3A 3GRKA 4ALKA 3ZW9A 2IYOA 5A03A 4ZQHA 4A03A 2ZTMA 1B8UA 1LBEA 4P4LA 4FFLA 4PCVA 5F21A 1XELA 2HMWA 1WAMA 2ZYGA 1EQ2A 1XG5A 5TIIA 2YV1A 1ISGA 4ZA2A 5KVVA 4M89A 2Y1DA 4R3NA 1PWZA 4Z9YA 4CR8A 3A1NA 2VNAA 1U2DA 5F5LA 3ZV4A 1FMCA 1IB6A 4RORA 4JLWA 4KMSA 2BFAA 4B8ZA 1LSJA 4YCAA 4WCFB 5TF4A 1KS9A 2EW2A 1G0OA 1NR7A 1T24A 1F17A 1TT7A 1NHWA 4PZEA 4RO0A 3VH4A 5I7FA 3WGIA 4RLSA 4PLWA 4CLXA 1BXGB 4ZQBA 2OOSA 4II3A 1E7RA 2GZ2A 5G4LA 3EYWA 4I9HA 1N8KA 4Q3CA 3OECA 4Z0PA 1YS4A 1EVYA 5AXDA 1L7DA 2FMUA 5HRUA 1U8FO 1ARZA 4RVFA 3QWFA 3CSDA 3I9KA 1LI4A 1IPEA 1C0LA 3Q6IA 4LSWA 5K9ZA 3E18A 2F1KA 1IOLA 1N1EA 1JVSA 1XQ6A 3GVHA 2Y1EA 1V3VA 5IG2A 4AJ2A 3JQDA 3EHEA 4YJFA 1LSUA 4DPKA 3JQGA 1SC6A 1XDWA 4QTZA 2WYUA 4BNUA 2NV6A 4ZD6A 1YBAA 4ALJA 5TJ9A 1R66A 1YB4A 1MGOA 4FQ8A 1CYDA 4PLYA 1WVGA 4EDFA 5AYVA 2HO5A 2E4AA 5A3VA 1DIAA 3W6UA 2UUPA 2O48X 3PDJA 3ADOA 2Q2WA 3TFQA 1HTBA 1Y8QA 1UZNA 1UR5A 1XSEA 5JBIA 3DXFA 5L45A 3E48A 2AMFA 1DOHA 3PFWO 4M87A 2P9EA 3BHJA 3BXXA 1P1KA 1X15A 5DN9A 5G2OA 5B4TA 3OJOA 2YJZA 2ZTLA 2A92A 1OBFO 3WB9A 3OJEA 3WNVA 2CDBA 5JE8A 1KYQA 3KEOA 1LTHR 3DZJA 1GZ4A 3S1LA 2W90A 2D59A 3L9WA 2QRLA 1P45A 3GH3A 1NPDA 5DULA 2JCVA 2I3AA 1HDRA 2DPGA 3GHHA 1Y5RA 1IULA 4J6FA 1N7HA 5KWEA 1HT0A 2FN7A 3T7EA 1NAHA 1U7TA 3OJFA 1PSDA 4W99A 3ZWOA 4YB8A 1U4SA 3AM3A 4DUPA 1MC4A 3PVZA 4RZIA 3ZGYA 3L0DA 1ENYA 3I6IA 1WW8A 2JAHA 2C59A 2Q46A 3JD4A 3GNTA 3WMWA 4EBFA 3EMKA 5IZCC 4M49A 4P8RA 3V1UA 4BNYA 5C3MA 5ER6A 1ISMA 3WGYA 3ZWBA 4E33A 1LDGA 4J0EA 3DBRA 2OORA 4CLEA 1XU7A 1E3SA 2WD7B 1F0YA 1IHXA 2VNSA 4E5KA 4L4RA 1B3BA 3ENNA 4N18A 4BO3A 2Q2VA 2Y93A 3JYQA 1ENOA 2X0IA 5FF9A 4XDZA 3CKYA 1UH5A 2HCTA 2VOEA 3JQ7B 1PJBA 1P9LA 2Y1FA 5IFLA 1A71A 2X0NA 3MJEA 1VSUA 3SEFA 3KLMX 4MVJE 3RUIA 1R0KA 4PLTA 3PHLA 3WBFA 3B1FA 4KQXA 1N2SA 2GR9A 4BO4A 2YYYA 4TVBA 3U4CA 1XHLA 4YAKA 2V6GA 4Z0HO 2X4GA 3H65A 3Q2KA 5K0ZA 2Y1GA 1H93A 3PJFA 3VKVA 1I3LA 3W8DA 1ZSVA 4PVDA 1DJQA 1PQPA 4Z0TA 3FBTA 3GEDA 3NGLA 2ZYDA 4OM8A 4BMVA 1AA0A 1LLCA 1U3WA 5CPBA 1GAEO 1RKXA 4MDHA 4Q3AA 3OSUA 4ALIA 4IDDA 2NU7A 1KETA 4KWHA 2OXIA 4LSMA 1HF3A 4QO8A 4MOWA 3KSDO 2DBRA 3TZKA 4GX1A 1B15A 2P9CA 4XKJA 2X9NA 2R6JA 2JL1A 2NQ8A 1E0DA 2FOIA 5FI5A 2Y68A 2P4QA 1ISHA 2YV2A 4FC7A 4J7CA 3I9JA 5CG2A 9LDTA 1IPFA 5FYDA 2EERA 1Q0LA 4J1QA 2ZK7A 4HY3A 3GUCA 4GVXA 5H83A 2C5EA 2XF8A 3DO5A 3HSKA 1T4BA 4CM8B 3DOCA 4TRRA 1U3TA 1EVIA 5ENDA 3WGOA 1E5QA 4GWGA 1W73A 1ZIDA 4NR0A 1C3VA 4QEDA 3O9ZA 1HWYA 1I10A 3PYLA 2W2LA 3BTSA 3EY4A 4BV8A 4K28A 1X14A 3GZNB 4FW8A 3GVIA 3H2ZA 5KVSA 4NBUA 2XAAA 4J1SA 1ZK2A 4UAGA 1Y8RA 3VZPA 1YXMA 2OFPA 4IGFA 2CY0A 5CFZA 1NR1A 1E77A 4D3FA 1J0XO 3CE6A 3DBHB 3EVTA 1DIRA 4R1NA 3E9MA 1ID1A 1HE3A 1UAGA 2FY8A 2CFCA 2RBEA 1TA4A 2J3KA 4IJWA 4BO5A 4CM4B 3GRPA 2G1UA 3N58A 3QVTA 4UVDA 1OFGA 4GSLA 2PZLA 3FNEA 3IKTA 4J9UE 4L73A 5IXSA 2PNFA 4J1NA 4ND2A 4ND3A 3AOGA 2JCYA 1ULUA 4MIOA 7ADHA 5A9SB 1T2DA 5TC4A 2VYVA 3F4BA 5IXYA 3EAGA 2NVUA 1LEHA 1LDYA 4MKRA 4YQYA 4ZU3A 4U6QA 1ADGA 1ISJA 3JQ9A 4OKNA 5JXWA 2WMDA 3ORFA 2Y0DA 4QFCA 4MO2A 4U6SA 4J16A 1DRWA 2BFMA 2Q2QA 3F1KA 5GY7A 1I24A 2V6FA 3JQBA 2QRKA 3Q0EA 3U4IA 2RHRA 5L51A 3KYCA 3CZMA 3VVBA 4CL3A 1YL6A 1Z45A 3H9EO 3PI7A 1EUDA 1ZK4A 3EGOA 1WMAA 2VHWA 3D7LA 4LVCA 1EDOA 2Z1NA 4CV0A 1TVEA 3AY7A 2ET6A 4DWVA 1Z74A 3JYLA 1O8CA 2WJPA 4CMEA 2O3RA 1GEEA 3ZWNA 2PA3A 4O1MA 4CMIB 2OP0A 4YT5A 4II2A 1NPYA 4HADA 4B3HA 4UVEA 4A27A 2NTNA 1HZZA 1Y81A 1DC5A 4L4SA 1UP7A 3RWBA 4KZPA 4I5GA 4MVJA 2CF5A 5EERA 3B1JA 4JIGA 4LGVA 3D3EA 3DTYA 2IEBA 3PYXA 4D3DA 5GZ3A 3NRCA 3F1LA 3ZWWA 5I8WA 1SO8A 2YDYA 2EXXA 4WOKA 2J6IA 2JHFA 2PK3A 5JYEA 1H0KA 2DTDA 4EW6A 3CUKA 1NM5A 4CMGA 5JCJA 1MG0A 1W8DA 5A9RA 1PL7A 4BS9A 2A94A 4RVHA 3WICA 5HWSA 2UYYA 4OOEA 1UXJA 1K6XA 1WDLA 3DBLB 3ENKA 1IE3A 2W8ZA 3NDRA 4FFPA 4BO1A 1T2EA 4R4JA 1SZJG 4BVAA 2DPHA 1RM4A 1Y8QB 3AOEA 2VZ0A 1WWKA 5T5QA 4FDAA 1ML3A 2QZ9A 2FRDA 4LMRA 3RUCA 2AHRA 2Q45A 3B70A 4OXYA 4TWRA 1VE9A 3HQ4O 3Q1LA 2UAGA 3U4DA 4GPD1 1M76A 4J2HA 3RKRA 1BW9B 3QP9A 1WDMA 3BTOA 2X86A 2FR8A 5IDXA 1F8GA 4PLVA 2VZ9A 2EG9A 4NZ9A 1DC3A 3ZNOA 2X8LA 4K6CA 2I66A 3BMNB 4JXKA 2WYVA 4N5NA 5T8KC 5F5NA 3TNLA 2CVZA 2GYYA 3UOGA 3WSVA 3GPDG 1T1RA 1JWBB 5COBA 2QHXA 2GUGA 1NFFA 1ORRA 1NQ5A 4FCCA 3CIFA 4QUKA 4W7IA 1YL5A 4BB6A 2NUAA 3AUSA 2C2YA 4UVHA 4DTIA 2DUWA 1B2LA 5B37A 5THQA 1PGNA 1YBVA 2CZCA 5AOVA 1U7HA 4IBOA 5KTKA 5DP2A 3W6ZA 4OH1A 2ZCUA 3INGA 4DQXA 2WWRA 2QW8A 3ABIA 5JDCC 4INAA 4RVGA 2PZKA 4GGOA 4I9NA 3WS7A 1C1XA 3G3EA 3R6DA 3W1VA 4BGEA 3JCZA 3KTDA 1PZEA 3PGXA 3WOHA 1PEDA 3RUFA 1Z73A 5EMHA 4XGNA 2FSVA 3PHIA 4PLCA 1E3LA 3ZU3A 4BNHA 1C0PA 4NJMA 3RASA 1VKNA 2Z1MA 1HE5A 5I7SA 5IDQA 3LLSA 2X22A 5TT1A 3GMDA 4HFNA 4NK5A 3RBVA 3ZV5A 4J4BA 5F1KA 4BNWA 2B36A 2OL4A 1YOVB 3W8EA 4BKPA 1V6AA 2A35A 4R1TA 3I9LA 4JX8A 4I1IA 3EDMA 5DCYA 2H9IA 5LDGA 4BNXA 5ER9A 4NPCA 1Y6JA 3HZZA 2J5RA 4M86A 3ZWYA 4DBZA 1DEHA 3KEQA 1P3DA 4J7XA 4Y67A 4EUFA 3W4KA 3I5MA 3DC2A 4W7HA 1N7GA 3L6OO 1E6EA 2EV9A 4DQUA 3P2YA 1V9LA 3DDNA 5IDYA 4YT8A 3TZHA 1GYRA 4E5PA 1UZMA 1E7SA 4Q3DA 3GDFA 3TOZA 1BXZA 1HXHA 4O6VA 5TS3A 5A3JA 1M75A 1HE4A 2UDPA 4BNTA 3C1OA 2GRAA 4IQGA 2HK9A 4JP2A 3WSWA 4CMIA 2QRJA 2E82A 4PLPA 3K96A 3MJVA 3DBLA 2PWZA 1EFLA 3NJ4A 4ND5A 1E1MA 2B69A 4BOYA 5KJEA 3W8FA 2OP1A 1QR6A 3KOUA 3PIDA 2ZB4A 4RF4A 1I2CA 4MVJD 3DMTA 1KVSA 3QWHA 4MVJP 4K9DA 4YJDA 2ZQYA 2GCGA 3AK4A 4FD3A 4MKZA 4RPGA 4MINA 3ZWCA 4O0LA 4MP8A 4OYRA 4TRJA 1RYEA 2VT3A 4E12A 4NU5A 3LC1O 5L7TA 4NBVA 4OQZA 1GUYA 1LQTA 1H94A 1E7WA 1DIBA 4P4GA 4CUJA 4J4HA 1NXQA 5EIOA 3AU8A 1EVZA 2V6BA 4XEHA 5T67A 3RAJA 3S2EA 5JLAA 4KDFA 1SOVA 1T2CA 1MB4A 3NTQA 1NASA 4JP3A 5U1PA 3VZRA 4UVGA 3PHHA 3PWZA 1BSVA 1G1AA 2WEKA 1MG5A 4OMUA 1UXIA 3JQFC 5JAZA 4H3VA 2WD8A 4CPDA 2B5WA 4FJ2A 1AUPA 4XGKA 3M6IA 1JU9A 3FF4A 3MOGA 5L95A 3V2HA 1QV7A 2NM0A 2VUSA 3QRWA 4JBIA 2O3TA 3ANLA 3JD3A 3WJAA 4P38A 3L6EA 1DB3A 1F14A 2VYND 3C1TA 1KVTA 1HE2A 2Q3EA 3FNHA 3RVDA 3WWYA 3PWKA 3OP4A 2DUUA 5ICMA 3VAZA 1MFPA 3E9QA 2RH4A 1HLPA 4DC0A 3MJCA 3VPGA 3AI1A 2AW5A 4BL5A 4BGIA 4EGFA 2ZATA 1Y9AA 3OETA 4XB1A 3S2GA 1FDVA 1VC2A 4N5LA 3FTPA 4B4OA 2BRUA 3E8XA 3ZU2A 4B8WA 5LDHA 4WNIA 1JTVA 3HB5X 2GZ1A 3JQ8B 3KHUA 5JS6A 1Z6ZA 3U09A 3OFSA 4PRKA 5CPFA 2JD0A 4BQRA 3DQPA 4B3IA 1HRDA 2RHCA 1MXFA 3V1YA 1KEPA 2V6MA 5DF1A 3QQPA 4DMLA 4ZQEA 3VZQA 4ND4A 2IODA 4D0RA 4KUGA 1KC1A 1A27A 3NT4A 1VKOA 3DZKA 3F5SA 3P7MA 3JQ8A 3GN1A 2VYVD 3ANMA 3IL2A 2JJYA 4QT0A 1X0VA 3DAFA 4OAQA 3ZHXA 4Y6SA 4GKVA 4J49A 4BGUA 5JAIA 1XQ1A 4WE3A 2X5JO 1E1KA 2Z5LA 2WDZA 2EGGA 1GZ6A 1LU9A 3WTBA 3PGJA 1NPTO 3PP8A 4PLFA 3NTOA 1HDOA 4DVJA 3H5AA 4Y8VA 3DBVO 4JJGA 2WM3A 2UUOA 3S8MA 3UF0A 1R12A 1T1SA 3H6KA 4N54A 4TMFA 4XQGA 4G81A 2P5UA 2GPTA 2PD3A 4C7JA 2ZIZA 3JV7A 3LC2O 2JD2A 1VJ1A 2IDZA 2QIOA 1ZCJA 4CL8A 2BD0A 3V1TC 3R0IA 4Y9DA 4CLOA 1O0SA 2I65A 2XXJA 1HL3A 4R9RA 3BHMA 1PJTA 2NTJA 2VHYA 4EJ6A 1UP4A 3WYEA 4DBVO 1X7GA 1SPXA 3RU9A 3VTZA 1OX3A 1DSSG 3ONEA 4IJKA 2QG4A 1NBOA 4HFMA 5TNXA 1LDMA 4AICA 2IEDA 3OIGA 4I5EA 3KXDA 1JAXA 1PX0A 3TWOA 1YJQA 5KNLA 4YJHB 3FN4A 3AY3A 1KC3A 2EWMA 4U0KA 5CEEA 3DFZA 4PG6A 5L4NA 1GFSA 1KIFA 4M54A 3INTA 3RBXA 3UAGA 4J90A 3RC9A 3N74A 4E5MA 4XJSA 3WGZA 4FFRA 1H9AA 2D4AA 4JQCA 4LCEA 4DGSA 3FTNA 4IMRA 3WIEA 3H9UA 3LLVA 4UUPA 4BKQA 2WE7A 4XQCA 1M67A 1DHTA 1PS0A 1Z7EA 1B16A 3B6ZA 3FD8A 4XRGA 2IE0A 1R0LA 2GN9A 4MIEA 3SX2A 3NTRA 5ILGA 2FZWA 4CM1A 2EKPA
chains in the Genus database with same CATH superfamily
1T10A 1FDUA 2QE7H 1II8A 1QE3A 1OVUA 2VT2A 1P6QA 3BHIA 3HCRA 1YBFA 4KRXA 2GDJA 4GQAA 4MRRA 5DNAA 1NP7A 3FVWA 1MX3A 3HFSA 2RIRA 1ZD8A 1YFLA 5AWFC 3SYNA 1R6DA 3IAS6 2IWRA 3THOA 2RGRA 2PRIA 1B4DA 4OM7A 4PC3A 3GLHE 5E4FA 1JLMA 2VYNA 2F3RA 5BR7A 2NU7B 1XZPA 2UXDB 3B3AA 2ZT9D 2XT0A 1DCKA 4XIYA 3BB3A 4K87A 5KPDA 2UYQA 1KPHA 3OG9A 1YK1A 4IG9A 4AJNA 4ZYYA 5B5SA 4AO6A 3PXCX 1SC1A 5CFMA 4FSHA 3GMIA 1NY6A 3L1VA 4TROA 1W0JA 4GSYA 1U28C 1GRVA 2I2WA 4RULA 4EMUA 2OFXA 2QX9A 5B1HA 3ZWKA 4A2QA 3O73A 3FUVA 1R6UA 3VR5A 1GG2A 2AXNA 4MYHA 1DWUA 1TQ8A 3SDBA 2PX2A 3KR9A 5AIAA 3ND9A 5B55A 5CDYA 5G0UA 4BVJA 4EITA 2AOTB 1JV2B 1U0SY 3E1IA 3M9QA 4U39A 4W5WA 5T4EA 5BN1A 4MWEA 3QU4A 2IV7A 1OXBB 2QMOA 4OWFA 3JVUA 2E5YA 3GT0A 3IUPA 1SVLA 1GTZA 3LCVB 3ILSA 1CZRA 4YS6A 4LXTA 5BVZA 1CTQA 5GINE 4GH5A 3WIOA 1BE3J 1R2QA 2E87A 4WPGA 3HY4A 3ZJYA 4EG0A 3PEFA 1YTLA 4GKBA 4JI7B 1FFAA 4AQRD 2IOYA 1Z4OA 5EXPA 3ZX5A 5IVHA 1U04A 4ZCSA 4OATA 3L8EA 1MDFA 4D3SA 1GL3A 1SMKA 2AZXA 5L3SA 3IIIA 3BCSA 3LI2A 4PWYA 2Y27A 3EZYA 4JBZA 4CKBB 5H82A 3UJDA 5KSWB 3ZDYB 3DQQA 3SX0A 3W2IA 1E1NA 1KI1A 1BMFA 3PF8A 3S2ZA 4ZZ0A 1ZKMA 3RT1A 2G71A 3BMNA 4GFDA 4UM9D 4PFSA 5A6SA 2AG5A 3MGGA 1HH0A 1TCAA 3AEBC 1MGPA 1JE1A 1IN4A 4IIDA 4TGLA 2Z5HA 4P4NA 5FOVA 1N0WA 4J0KA 4FZVA 1Q74A 4QECA 1JH9A 1E2DA 2PZJA 1VOTA 4MP3A 5C8VA 3SJ7A 3MRSA 3OOEA 5FI3A 1JSXA 5B36A 4O4JB 3HDQA 3JPYA 4ZP1A 5K6AC 1RC8A 1M2OB 3B5JA 4LHSA 2IHTA 2FG7C 2G17A 2O2IA 3N8DA 3A7EA 3O8NA 4NCKA 3EWAA 4TWIA 2M3EA 1RWPA 1HK7A 1AQ6A 2HFKA 1EA5A 1UAYA 3L5OA 4OFBA 4M1MA 4IXWA 1BRTA 2B7CA 3MJDA 4BBAA 1ZMOA 2BCCE 2XUFA 2OCLA 3TJRA 1FFXA 3UMSA 3D1LA 1ORDA 1P2GA 4CQMD 4DLTA 3CZRA 2BJVA 2O2XA 1FLDA 3TNUA 3TG8A 1E2PA 1URPA 1CLUA 4AIIA 2HHHB 5AVYB 3I9FA 1LXCA 2PM8A 1EINA 1H8HD 1M0TA 1OYYA 4UM9B 5BP7A 1COZA 1JZSA 1Y3DE 2C2XA 3SVTA 2PFKA 5I51A 5AK4A 5IWCA 4IIJA 2PMKA 5EHIA 2G7MC 2R11A 1KJZA 1JG7A 3H86A 2B1RA 4JFRA 2B99A 5J4YA 2HUPA 5K0NA 4XVQA 3O2JA 4ITUA 4BFYA 3UK1A 4BFCA 1CE8A 2ZBFA 2A2ZA 3NHPA 4K86A 2H4XA 3S1SA 2J46A 1W2BO 1CSBA 1E9AA 2NZVG 3M8KA 4YRQA 3O83A 5LQJA 2V6IA 3K0AB 4YYZA 1VMKA 4OVNF 1KPIA 3EDOA 3I9NA 3RIYA 4B73A 4KFRA 1CK4A 4IDPA 4PCLA 3S4RA 1H1DA 3MLEA 4ZDIA 4Q9JA 1HFJA 3KAKA 2I67A 3VJRA 2CHQA 4M76B 1F2UB 3Q3EA 4BTLA 4OLBA 4DMGA 2IJGX 3BBPA 3NEAA 4I9FA 2EJWA 2Q8NA 2WM8A 2ECFA 5AVYA 4NE2A 3KJFA 3VO1A 3AEGC 1NQVA 2HSEA 3MWJA 3KB2A 3BOSA 2QYSA 4MQUA 4WFJA 1FPMA 3C85A 3HE5A 3H1EA 4QDKA 2GGSA 1E5LA 1SVSA 2VSXA 3N2EA 3PPXA 3W9YA 5K4HA 4U1RA 3QPCA 3NOXA 4FW9A 2K7ZA 2AJTA 3V46A 1JKJA 3PHGA 3WQSB 4BNKA 2WPNA 4K9NA 3H5RA 4BNNA 2AN9A 1Q0HA 3LIDA 3LOUA 2PQ6A 3W6OA 4B7ZA 2W2KB 1W4CA 1P0QA 3HEBA 3LD9A 1KKMA 1EU1A 1OA1A 5KAIE 1XRLA 2VF8A 2IWHA 2G8LA 3K0CA 3P26A 2NVUB 2WC1A 3QVGA 2GYUA 3OZSA 4BNMA 1ZVVA 1XCPA 1KVUA 1W47A 2EJCA 4TX1A 1BGYD 5KQPA 3UJ7A 3P9QA 1BROA 1DTWA 3QXSA 1SOWA 2XHEA 4WECA 3H19A 2CF6A 4BRYA 2J1LA 5C4IA 1PWXA 1TD9A 1Z34A 2YS7A 3FR7A 3RC8A 1FU7A 4ETWA 2JLYA 2DVMA 3AUFA 1DWQA 1F06A 1KFCB 3C0KA 3WFJA 1ULBA 3FAZA 4WKCA 3ROMA 5C53B 2ZT7A 1VI2A 4GOXA 1PFYA 3AE5C 4EUEA 5IUNC 2PLWA 1KK2A 4FJ0A 4G0PA 3L73D 4O29A 2COUA 3R6GA 4QODA 3TI9A 3KK0A 3K9BA 2YJ4A 5ALMA 3UN1A 4BIIA 2J87A 1GQYA 4WBAA 2MSNA 3AETB 4QQNA 2GH1A 4IZOA 5BVHB 1BEUB 2K37A 1NXTA 2J3QA 3UVEA 1AA9A 2NW6A 3I23A 3C39A 3F3MA 5DTRA 2PV0A 3GFOA 4HF7A 2AMLA 2ACKA 2VHZA 4RCVA 5HRCA 4C2AA 5KJ7C 1GV0A 3I1JA 1XD2B 2QNRA 1SQBJ 1SBCA 2Y4OA 4U3JB 2NPFA 3GJRA 4MW2A 3L7DA 3ZZNA 4E51A 4ZYVA 5KHLB 3B5ND 1PQYA 2XGOA 4CKCB 1C9MA 4UFNA 4YCLA 1XZKA 1JY3P 3O92A 3PCTA 4PE5B 4Y2RA 7MHTA 1MX1A 3WLAA 1DBQA 1SUCA 3P9KA 4RBNA 2B1QA 1P5JA 3LPDA 3PFFA 1NTZD 1ODCA 4I8DA 1ONBA 2NT3A 2NPIA 4JU8A 3L1HA 1U6IA 4Q3OA 4EY6A 3HDYA 1XMOB 3I1FA 1NV9A 2J6CA 1ECLA 2SHKA 4Q7JB 2O1EA 3VR3A 2PBLA 3M9XA 5EXSA 2MKVA 4KBFA 3U5TA 1GRCA 1RPNA 4L27A 4BB5A 4Z4QA 2Q6TA 1G21E 3D4OA 3GFBA 4LYEA 3QE3A 1UBFA 3HP7A 1E1CB 3QOWA 4OU4A 2OENG 4NPHA 4Z9AA 4GKAA 5C8ZA 3T5AA 2ESRA 2FA9A 3KKLA 4MRMA 2W2MA 1M66A 1G9XA 3LX6A 4WX2B 1KY5A 2NAFA 4TMKA 4P34A 1UMBA 3DF7A 3SS7X 4CG1A 3ABSB 3AONB 2IPPA 2BZ1A 4JMLA 2C5AA 5E8RA 3SQWA 2IUTA 2VC2B 1ISRA 1YQDA 5EIBD 3L6RA 2YXPX 3JWJA 3PHJA 5IJ0A 2JJMA 3PRKE 5E1BA 1RKBA 2FU5C 3X2FA 4YAIA 4TLEA 3K9NA 2B83A 3MTQA 1ZUWA 3K0AA 4LSZA 1TXGA 1C1YA 4D6XA 1OB2A 3QENA 3OZEA 2C4NA 4MWOA 3WYDA 5HZGA 4U3FD 3TX2A 1RXIA 3U7HB 1KKLA 4XYLA 1T8PA 1CPYA 1D09A 1QO0A 1ZVKA 4MUNA 5ALNA 4MPTA 3BCCD 1CY4A 2Z1DA 1Z8FA 3ANSA 1OY1A 1OTYA 3ZGLA 2ADMA 1HDZA 1ZXLA 2FN9A 1XJ5A 3C2QA 2E5FA 3T97A 3GEGA 2I1KA 1RXEA 2ECKA 2IU4A 3KJHA 4CLRB 3Q85A 1CG6A 1TJNA 2IBMA 3R41A 4J1TA 2HJSA 2EOAA 4DLSA 1K08A 2Z2KA 1VIMA 2BM8A 4QRIA 4IRUB 3RABA 1AHIA 4EVQA 5HS4A 4KR3A 3SC2A 2QJPB 1E4EA 1TX4B 2FW7A 5K51A 1JRLA 2R62A 4Q1CA 3VTAA 4UFPA 4UE3S 3O8QB 4D41A 3QSGA 4R41A 2J3EA 4RPLA 3FDJA 3A1EA 3GG2A 2Y4NA 2PRKA 2XCQA 5JPIA 2W98A 5DM70 1SCUA 4D6PA 5ESRA 4QUAA 1KSJA 2HCFA 3UTDA 2WWIA 1WUYA 2SECE 1B0ZA 1N92A 4BFZA 1ZEMA 4D80A 1HOXA 2RAFA 2OKCA 3HKBB 3LW7A 1A7AA 1H88A 1F9AA 1DC7A 2ONKA 4EUHA 1LJ8A 1QHIA 2Z2JA 3BRTB 3ZE1B 1DG3A 1V95A 2QR2A 3A9VA 1KZHA 4KE7A 4PS1A 3G5TA 4H0FA 2WQZA 4HLDA 3L72D 1RLMA 2V45A 5LLTA 1G9TA 1S3SA 1GT6A 3GDHA 1UXOA 5ECGC 1RPAA 3L70G 3ONFA 4H31A 1S3JA 4HGRA 2ZRQA 4ANFA 4QUHA 5MDHA 4E4TA 4F9TA 1ISIA 3GPIA 4OXKA 1UCFA 4XXHA 4DQKA 1Z6TA 2JGJA 2AEMA 5EIFA 4YXDC 2R4UA 2F6RA 3P4XA 3U60B 1Q0UA 2DYKA 2WSSH 5LJIA 1J0CA 4Q3BA 2FI1A 2UYOA 5AKYA 2X23A 5HKLA 1UBKS 1NM5C 2VDUE 2QLNA 3W9UA 1AQIA 2FWJA 4ISCA 5ITZB 1OX4A 3MRXA 4PX9A 3O4RA 2DKNA 4DFDA 1SN7A 1OVMA 3CCQP 1WXXA 3OEWA 4MTCA 4S1VA 4LMPA 2Q5UA 2EG5A 3M6MD 4JR1A 4JVNA 2XI4A 2WAOA 3TUZC 1FSGA 1UWKA 4N1AA 2XXAB 3SHTA 1D6SA 1NU1D 2JBAB 1PHPA 2WT4A 4Q4HA 5FXMA 1ZEJA 1UAAA 4MW9A 2X8BA 2Z43A 2NUPA 1OFIA 3MEQA 3DAPA 4ZIRA 3QLUA 4DLVA 3SZMA 1SULA 1PW7A 3KQPA 3P71T 4G8DA 3VU8A 5K0SA 3H9GA 3KUXA 1VIYA 4KXWA 3UWDA 4DSNA 1WR8A 2H54A 1FK8A 5K1ZA 4DAEA 3RK3C 4G01B 5ED0A 2UZAA 2X4LA 2YRWA 4MS4A 3TW8B 2OV6A 4P7BA 4LOLA 3MWFA 2XBLA 4U7WA 3KETA 4LJ7A 4BMZA 1Y34E 3ESRA 1ZCBA 2H48A 2O7VA 3FVTA 4F6RB 3CR7A 4BCDA 2Q0XA 2P9GA 4QBFA 4AROA 3RYFA 4NESA 1H66A 1LQ2A 3DONA 1NW3A 1PFUA 4DQVA 4D8TA 2QBYB 2YH2A 1LT1A 5DZSA 3NHFA 3QX9A 5IC4A 1O4VA 2QM7A 2RMKA 2YQZA 2MHCA 4AM8A 2O8CA 2HWWA 4EA9A 3ZNNA 3TL3A 3ILXA 2BHTA 4Q4HB 2RKBA 5B7PA 2QRUA 4HAIA 1FXWF 4FZRA 4LXIA 4V03A 4MX8A 5K0GA 4GLOA 2K1AA 1X6VA 4EECA 4N3YB 1YAJA 4L57A 1L0LJ 1F6BA 4RTMA 1GTRA 3OZIA 3IIJA 4YCNA 4Q9IA 4BMOB 2XQVA 5JDCA 4A0SA 3W06A 1CUXA 1GRQA 4P35A 2J5UA 4HNGA 2ECOA 2XY4A 3DFMA 3UGTA 3H1LD 3LQQA 2IF2A 3BMCA 5GJWC 3C4JA 1GUBA 1L5HA 3GRVA 4HZGA 4ZK6A 1KRXA 1SXIA 2WWHA 9MHTA 3L0OA 1FOSE 2QT0A 3WB0A 3THXB 4GE3A 1LTJC 1X1EA 1TUGA 5C7OO 4JB2A 4XX0A 3E2IA 3NFRA 3IAEA 1VJRA 3SQNA 2FN8A 3LBIA 2HH9A 3PA6A 1M1JC 4N8EA 3BFXA 2FYUJ 4PBTA 4F5WA 2POCA 2QN9A 1DQRA 4JJFA 1JHDA 1JIIA 2YXQB 3OI7A 2IPAB 2R8XA 3WNBA 3M5WA 2GEFA 1G2QA 4EB0A 3CNBA 1ADFA 4TTQA 4KGVA 5FWXA 4HVLA 1OYVA 5KAMA 3HR7A 1E98A 2NN3C 5AXBA 1T9HA 1NVMB 1SBTA 2PSFA 4OXNA 3VC3A 1AV6A 3UFBA 4A0GA 4D4MA 2X5XA 4L0MA 2E49A 5FRDA 1ZL0A 2C5FA 3WL3A 4GT1A 1NU6A 5EUBA 4OP1A 1LTIC 1YZYA 1NVVQ 1CEQA 1T0BA 1ZNYA 2XMSA 1YZTA 3DFIA 3FXEA 4MW7A 3D3WA 2J41A 5EXDA 2I99A 3UK2A 1XPOA 3VNAA 5IASA 4UUOA 4RVUA 3U62A 4D96A 3D71A 1CUJA 4YTEA 4DEYA 1RRPA 2JGDB 3TUIC 1GZDA 3AFGA 4BDTA 1E2MA 1V3QE 2FR0A 3CKLA 4L85A 1NBHA 1NTZJ 2ZSHA 1S3FA 1WTAA 3QKIA 1EFRA 1ONOA 1UBRS 4QIHA 4TV9A 2FJPA 4WVLA 3H2GA 3TOXA 1VYTA 3AIIA 3RSHA 3SHVA 4Z54A 3U7FB 3QXGA 1I51A 1VHLA 3NHJA 5FTWA 4FC6A 4ZC1A 1GL2D 1EYZA 2IOFK 2QX8A 2ZDHA 3NYRA 4X85A 4S12A 3MMXA 5HIIA 4I1PA 1EGAA 3C1AA 2Z8YM 3DP7A 3ZCPA 4M8SA 5E79H 3NHMA 2BMWA 3COZA 3JQ9C 3O4FA 2FSUA 1R0SA 4DCPA 2ZM5A 1IWBB 4A91A 4YJGA 5F73A 3RJMA 4QU9A 3OPNA 2XU6A 1PN3A 1TUBA 1Z0DA 2NXJA 2HLDA 3H2YA 1CIJA 3KD3A 1VF5C 4UB6H 2FPPB 4I1OA 4JP8A 3Q6MA 1HTTA 4FXOA 2I1JA 5ALZA 4EKDA 4F71A 1I7LA 1PV1A 1ZOLA 5DWDA 5JO9A 4KGXA 3WMXA 3PKIA 2Q5IA 1A2QA 2V7XA 4PLHA 5B57C 4YRBA 1O96A 3NBYC 2KIKA 1A1SA 1OXXK 1QONA 1VRVA 2HRBA 4H3HB 3L73E 5KAFE 2FCAA 5H2FH 4X6YA 2BFCA 2RK3A 4NMHA 1NMSA 1PBNA 3D8TA 4HTFA 3QU5A 2WNIA 4LN1A 2WD9A 2FEWB 4MV9A 1YRLA 2JAUA 2OZLB 3A4YA 1Z2NX 4NZZA 1N9ZA 1VBFA 3L04A 3QKTA 1B0AA 4X20B 4XZ3A 4EVSA 1NFQA 2XGJA 2O3QA 1N2JA 2VK1A 4U7DA 5F3WB 1P72A 5HW0A 3GUYA 4YRTA 2XTMA 2AG0A 5K3AA 4R8KA 1RR6A 5D1NA 1T3HA 4BX2A 2FG6C 1CQIA 1CZLA 1W7AA 1UJ5A 1XWFA 3AVXA 2YWDA 1ID8A 2O8DA 2QEQA 1GSOA 4ZCPA 5HDBB 2YNMC 3E4CA 1R6AA 4YUWA 5BQ3A 1R5OA 3D8SA 1ONNA 2Q50A 4IQ4A 1NI4B 5G1OA 1USEA 4BQOA 4YREA 4J43A 2G67A 4UNIA 4KHPB 2GPJA 3ELUA 5KLVG 1GZHB 1OAOA 1XD8A 4IP0A 3NTNA 1E99A 1H2AS 2A06D 1N5KA 2O2GA 3W6NA 4JUAA 1YQUA 4B46A 4C5CA 3SC6A 1L4BA 1LGYA 4J0DA 3CRQA 1M5UA 3NKVA 3ISJA 4RQTA 3ZCXA 1Q6YA 5IKEA 3B6EA 5TQJA 5KJ1A 1OF1A 4BCBA 4H17A 5DNEA 3I3OA 4G0ZA 4EYEA 5AVRA 5CLGA 1YQXA 2W6QA 1FCJA 2CE7A 5I9LA 5LVAA 3CX5D 1YF3A 1ZN8A 1PS9A 8OHMA 5BSFA 2OESA 2P3OA 2VJLA 4JUDX 3AKZA 1B6TA 2EYQA 3NDPA 4ZU1X 2YFKA 1WSBA 2ZTVA 3SBXA 2NPOA 5BV2P 1C0EA 2IW3A 3LUFA 5KOYA 4DZOA 4ZV9A 1J0EA 1HDYA 3EA4A 2EEZA 4JCOA 4UMVA 4YPFA 1LUAA 1ANKA 1P84E 2P7HA 1BXRB 3IP5A 4TV8F 1OLOA 3O90A 1A7KA 4UB8H 2B37A 2IELA 1OXUA 1E3JA 3EA5A 1QJCA 3PPIA 4TKZA 2G5CA 4GVLA 3TTYA 2XNJA 3DHNA 3ZYCA 5FH9A 4E0BA 2ZFCA 2BLNA 3ZIUA 5CXQA 4IJUA 3CMAP 1A2BA 4ZU6X 2O9JA 1KMNA 1G8GA 4X1YB 5JS7A 1PPJE 3EIHA 1CEYA 2NO7A 2ZWMA 1QVAA 4AJOA 4JYAB 1PL0A 4KYTA 3GDGA 1HEIA 3O2QB 3O4VA 3A06A 4EKIA 4ON9A 2NUAB 1CEEA 4FPXA 5H4HA 2VNJA 1JCDA 4IKOA 1N6NA 3W3AA 4N3AA 4M0LA 1UK6A 3KKZA 4OO3A 3M2PA 4PFKA 4Q1FA 5TMBA 4HYTB 4DRYA 1QYRA 3E27A 3W4IA 4E30A 2RJOA 1RCTE 3DSRA 4UCXA 3VAAA 1S0UA 2WHXA 1MT3A 1U7PA 2GASA 5E3IA 4F84A 4DR1B 2ZZNA 4QXMA 3OCJA 4CJXA 1QAQA 1QCDA 4BPBA 3GLFA 1Q21A 1YQTA 4ALLA 4BEJA 1JDJA 4RIEA 2Q3CA 1VQNP 4J0FA 1C8LA 1V5FA 1XTRA 1G3UA 4JBXA 4RPIA 3VKUA 1Y1PA 4GICA 4B6QA 5AK0A 1WLSA 2UZ1A 4OQQA 2RD2A 1QRSA 1D7AA 4RYDA 4CMHA 4JJKA 4NMMA 1W2HA 1DUIA 1DIHA 4LNAA 4D97A 4DKJA 4FU0A 2FYZA 2DERA 4HQ6A 4ZO6A 5BT9A 4PEVA 3EAQA 3RVLA 4PO8A 4P7KA 1WPRA 1YIAA 1N9GA 5FI1B 4GMFA 1LLDA 5TMDA 2DWPA 2GNAA 3JZIA 5L6MB 5LYJB 3AFIA 2A57A 3KU1A 3DT8A 4QYSA 3D4LA 2GZMA 4P80A 2HIGA 3GYBA 2H88C 1S4MA 1L4AB 1Q95A 2VWGA 3VH3A 1SHTX 4GM1A 2W93A 5H68A 4TZKA 1MNAA 4XYBA 1E79H 3KL2A 1OW7A 1DUVG 2ERXA 3CLRC 4HL6A 4IPTA 1QDEA 1X1SA 1E20A 3L8ZA 3Q6NA 4NMXB 1EGQA 1T8YA 2CLSA 1KZ1A 2J08A 4MVXA 1CF2O 1MABB 1LSSA 2WWFA 1LRJA 2FFDC 3CU5A 4N78E 4NKRA 3PXDA 3SR0A 3WQBA 4AZWA 4B5KA 5JNUA 2ONYA 3D5QA 2REXB 4FOLA 2VHVA 1T2FA 3OD5A 3FAKA 3H2KA 5BRAA 2ERCA 4UHJA 1ZL2A 1JLRA 3STWA 1RLUA 2YNYA 1OWMA 2B8WA 2JHCA 2LCFA 4BNXA 5KTMA 2D5CA 2W2TA 2WPQA 3H04A 2GN6A 1JY3O 3VO8A 3AFHA 2P65A 4YLEA 1SBQA 5UKDA 4DV7B 1JEKA 3EIFA 3LUAA 2A1IA 2W70A 4GP7A 1XOIA 3ZHCA 2BMJA 4CI9A 3BT7A 2KE5A 3HUSC 2LCQA 1V16A 4A8JB 4BWGA 4H16A 4LC0A 5IKOA 4BE7B 1N9KA 1VCNA 2C20A 3KT3A 4URFA 2IH4A 4IFEA 3IVCA 3UUEA 1VMDA 3WLEA 3DEIA 3CVVA 3GJ8A 4M53A 2C00A 2FPIB 2FSGA 5G1NA 1BE1A 3TAXA 1Z06A 4K5QA 3K20A 1Z56C 3D8HA 2A7XA 5CGZA 2I71A 2J3DA 4EKNB 4EI7A 3BXZA 2B0JA 3Q98A 2BKLA 4U7FA 1EESA 2R5NA 2Y0CA 1J2TA 1S7CA 4JYCA 1U9ZA 2HIAA 2HK7A 4ZOAA 3WY9A 1YOVA 5JECA 1J21A 2ZIAA 1YV9A 4RKRA 1EHCA 5EE3A 2JLVA 4HI0E 2XGGA 4UU7A 3ZI4A 2OV3A 1OA0A 3OU2A 3WMGA 4L6CA 2VXBA 2R6FA 3ZNPA 2WHEA 3JZFA 4Z8YA 1O5IA 2P1JA 2OUIA 1ZKDA 5ALUA 4DJDC 3MWKA 4GPBA 3QPVA 3IT0A 4R4MA 3IQWA 2WA2A 3OZXA 1W4ZA 3RKUA 2Q07A 4G4GA 1Z0SA 1LI7A 1SH7A 2X40A 2XNKA 1SUSA 3BH7A 4TTTS 2DFPA 4FDLA 4LHVA 3T1QA 3DEAA 3EK2A 3NIFB 3R4VA 5DCWA 1E3MA 4HT3B 2V7QJ 3QFSA 1PBTA 1UDBA 3RFXA 3R9XA 5KKAA 1NOKA 1GTMA 1N6RA 1NZJA 1U0TA 1UBSB 1WXGA 1W85B 5AHOA 3RRZA 3FZQA 1V1MB 1R4MB 1QVGO 3BJZA 2V7BA 2R1VA 3ASVA 4JLMA 2EKZA 4G65A 3OC6A 5JY6A 3ERCA 2NT4A 1NW6A 2O59A 2R2GA 1Q1NA 1YQ9A 3LE8A 3DLHA 1G60A 1P73A 3NC1C 3WXBA 4B43A 4I0WB 1LWNA 5A4KA 5TEWA 1CRPA 1QNFA 4QKQA 1PR9A 3R5TA 1GFWA 1CF4A 2Y0EA 3QMWA 4O4LF 5JDIA 1USGA 3I61A 4MR9B 5AHWA 4XUGB 2M6SA 3BWMA 3M9LA 3UT6A 2Q5JA 2GQ0A 1T0IA 2G4VA 4YRKA 3KXPA 3CLKA 1VE7A 3ZG6A 1C14A 4CLHA 1FMJA 5AESA 4JMPA 5D5PA 2J59A 3HRNA 4Z49A 2JGDA 3CINA 1Q1EA 2AMJA 1W0KA 1WT6A 3DT9A 5GIOE 5G0SA 5FAXA 3ZDZB 2E85A 1LZLA 4O63O 3C3KA 4ZDJA 2H07A 2QLTA 3FPHA 3JQPA 1RQGA 4QPZA 1GNPA 4C3VA 1F8FA 1NTZK 1RHRA 1KI2A 3LBFA 4G4IA 3A04A 3EVCA 3BMCB 1AV1A 4FDUA 4KJXA 5LZ8A 1M1YB 2SKEA 3QE0A 4HDNB 5A5EA 4P3OA 1GZSA 2WIDA 4CQLA 1YJ9P 1NKTA 2GAFA 2N46A 3EZNA 5DGHA 5AVOA 5LB4A 3MTJA 5JZBA 3Q3CA 5DW3A 1QGUA 5T7BA 1CS0A 2PT9A 3FG9A 4URUR 1OXZA 5ELLA 4A0RA 4D8WA 4YLYA 5BORA 3V32A 1KP2A 4Q1VA 2Y6VA 3IEMA 1M7BA 1FAVA 1B8OA 2EBWA 4GEGA 4KSYA 2JRCA 4DIMA 4E5SA 2O07A 4S3MA 3GF4A 3IAM6 4REMA 1ZH2A 2W5UA 3OQBA 2R2AA 3WR5A 2HF2A 1YZHA 2GT1A 4F93B 3Q87B 3NP7A 4G63A 1E2LA 2I2CA 1Q17A 1URQC 4NCHA 3WYFA 3H6GA 3AHEA 4OI4A 1IY2A 5JPCA 2PGIA 4Q19A 2AZTA 2PU5A 3K16A 1V25A 4ES6A 4OA8A 3TKLA 3N7UA 4YRLA 2Q5CA 5I7OA 5GZ1A 1QVWA 4WWHA 3HCCA 4X71A 4HATA 2Z2IA 3B8HA 4BN5A 1WBJB 5C8YB 3L4SO 4MGIR 2BCCJ 1S8AA 4DZZA 4TVKA 3Q8KA 2CUZA 3EULA 5K8UA 3ZZUA 2WJ4A 1RWKA 4RANA 2FYNB 3ER6A 4PC7A 1W4LA 3DR3A 3KDSE 3TZEA 3UAZA 3FOEC 3VHRA 1J2YA 1L4HA 5GTHE 3RNOA 1FDSA 1KR5A 2KMLA 4JP1A 2CMGA 4NAHA 2XDYA 4EBBA 1KI3A 3LYUA 3SFVA 5H59A 7MDHA 3WAJA 2DTXA 3BFPA 3WGHA 3VRHA 1RMTA 5F4ZA 1I80A 1J33A 1BAPA 1XCJA 1YMUA 1LTQA 4D3XA 4JI3B 1OC2A 4GZ3A 2JA2A 1FDIA 3F0TA 3K2BA 4HNHA 3NFQA 1IY1A 2GO1A 3MA0A 1HDXA 4KG7A 4PN3A 1CQPA 2QWXA 2R7AA 4R2MA 4Y1EA 2GHQA 1JL3A 2PANA 1R18A 5LR6A 3TINA 3COSA 4HFRA 1GGEA 3VISA 2FGJA 4C2UA 1JSZA 1R8YA 4J03A 1OZAA 3NXKA 1EMDA 1CQJA 3LF1A 1S1MA 1ULAA 2ZUWA 1M0WA 1EAMA 1T9AA 2DWOA 1PAUA 1KQGA 2JI4A 2KLHA 2ZE6A 5MFZA 1RAEA 2GJ9A 3K70B 2JIDA 5C8YF 2EGHA 2ZPUA 3GJSA 3L6UA 4FLFA 1YHZA 1MORA 4PSUA 4TM8A 5CP8A 2ZRHA 3UJAA 4CCWA 4DM3A 5BQFA 2G9RA 1ZK1A 3BCUA 4I8IA 4LZJA 4EG8A 1N6LA 3N07A 2J5BA 3E5NA 1VQMP 3R3HA 2YY7A 1Q20A 3AECC 1XMXA 4N7JA 4RHXA 3U0VA 2HRQA 4RSRA 4BO0A 2BKEA 1EGVB 3NIBA 4HB0A 5BYBA 3T0GA 2KSQA 1COWA 4XE5B 2ZIFA 1QMGA 3HYTA 3WGVA 1WX1A 4WCFC 1B1AA 3DOOA 3PC8A 1UK8A 2DPMA 3BXPA 3EASA 2J0UB 3N8IA 3HD7C 3L92A 4RF5A 4UBJA 5C34B 1QH8A 1P17A 1ADJA 1PL5A 3IUMA 2W48A 3NUGA 1TZ2A 1UBNA 4DWJA 3N2GA 5C5IA 3GXOA 3LA6A 3IVGA 3SZUA 3VX4A 3M1AA 1OAAA 2GBGA 4JN6B 3R8FA 4GAEA 1R37A 1G42A 2YFHA 2C9ZA 5CYPA 2RGUA 1P44A 2VUUA 3L7KA 1CNEA 2HA7A 2NTVA 3L71D 4TYPA 3CONA 2F3UA 3O74A 4ZRDA 2ZANA 4PYOA 1JY2O 3D6ZA 1DQPA 1G6Q1 1HMPA 3O3MB 4F7WA 2IZ0A 1R9JA 3EEFA 1XU9A 3KR0A 4GIBA 1S5LX 4L5IA 5CDSA 3UV3A 1NQXA 3PX3A 2ACVA 1J42A 1DQNA 1RQNA 5CCDA 2LW7A 3FKSD 4UUBA 3T7SA 4O2BF 4P08A 1MQ8B 2FEXA 2B6HA 3O8BA 4N7RA 1YNOA 3QVXA 3CKKA 1UT6A 1G2CB 2Q2OA 1JAHA 4HDRB 3IB3A 4RJLA 3UMMA 2C7RA 2XZPA 2YYAA 4L76A 1JNMA 1W2GA 2DFLA 4KFUA 1QPBA 3TLJA 3FHTA 3OWXA 3KXLA 3I32A 4IDNA 2RONA 4N78D 1U4OA 2KB0A 1GY8A 3LH5A 2C8KA 4KX5A 3KSMA 1CX9B 2ZCVA 2D5AA 4Y2UA 3JARB 1V9CA 4HEA1 1PR5A 4JYBA 3ZXUB 1Q7GA 2VBIA 1G8YA 4HLUA 5GONF 1IBLB 3ND8A 2DB3A 5EEHA 3NO4A 2YV3A 2WU3A 3IV6A 3OMXA 2AQKA 3Q7IA 4RHTA 4TZTA 5IAEA 2FAXA 1TRHA 5K0LA 5BUCA 1XZNA 2X2OA 3C5HA 1J1UA 1I3KA 3UV7A 4XVUA 3ABZA 4IGAA 4K7JA 4WLNA 1DX9A 1A8PA 2VPWA 3PRYA 1OASA 1XZBA 1E92A 3ETJA 4AZSA 1E6UA 2FPLA 5ICSA 1QRTA 1KB9H 4MB2A 3K4QA 1VLVA 4W63A 1L7RA 1RM3A 2YKPA 1Z3IX 3EXFB 2XITA 1ORTA 4KREA 5A9SA 4Q1DA 2Y05A 4C9BA 3OWHA 4Q1EA 1ZOPA 2QI9C 3DLBA 2OHHA 4IWNA 2LCIA 4GOEA 3A4VA 5B2EA 3A31A 4MUAA 1SXQA 1FF9A 5T6MA 1KY3A 4FOOA 2H8PD 4O5AA 3SXPA 3WRXC 1Y5IA 5LZ2A 3OAAD 2P68A 4TKUB 1EE1A 5E9WA 3JAKA 3KLPX 1SAYA 2JW5A 3ZU5A 4FGUA 5BMOA 5LIRA 2FKAA 4GOJA 4PQEA 1U3DA 1PJ4A 2HUNA 3CW2A 5CHXA 3B7WA 3OOSA 5FOWA 3LW8A 1HYGA 3E61A 4PVCA 1IBRA 3UWKA 2IFTA 4ITRC 2ZZKA 2BFCB 1HFKA 4QOIA 1PE0A 3IV9A 2FYUD 2HYNA 3TF5A 2DFVA 4MVJF 4U8HA 4W6ZA 1Y1KE 1SK9A 3GJ0A 5FB3A 3U80A 3I05A 3ZXSA 3JD0A 4N39A 1EUYA 4Q03A 4DUYB 4I2LC 3CUWA 2QLLA 1CETA 3X1JA 3HCBA 2C2BA 4CRWB 5B4VA 4HDKA 2C3PA 3RFCA 1XTTA 4YJKA 2KS1A 1CDDA 4ED9A 2V6JA 2C0WA 3EAFA 3ETEA 3IJEB 4GHWA 4B2IA 5CCHC 2ZJ2A 4HO1X 4B81A 5AKEA 2YHUA 5DM1A 1JQAA 2P5YA 4BO6A 3TTWA 3HE4A 1FQOA 1KEWA 1KZ9A 1SHJA 2XLBA 3AB3A 4H3SA 3I12A 5DBOA 5IYZF 4LYYA 3TB4A 1RH5B 2AI3A 2FX3A 3JALB 1KILC 3EXAA 2C82A 3UC9A 2Q3JA 2MTBA 3WTCA 1W2WB 1HLDA 3ZE0B 4BEVA 5IUJC 2ZWIA 4KPUB 2E76D 3M6XA 1RQPA 3BE8A 3QM1A 3QUSA 3CH7A 4PZ9A 2YXLA 3DZFA 1P4GA 1TIBA 2RDMA 2FSPA 4M7RA 4ND8B 1TEZA 2QN7A 5FNVA 1UBMS 4KH0A 4NV1A 4V3BA 5DH9A 2HHCA 3D7MA 3QW2A 1JR4A 4ENTA 2F8TA 4HYQA 5K6AA 2DP4E 2ZFUA 2G28A 3IOCA 2ZXFA 2CJWA 4XIJA 1AO3A 1D07A 3UUWA 1EP2B 4LHYA 1Z7BA 1ZVMA 2FSFA 1JHMA 3LIPA 3TQOA 3LTNC 3RADC 1H65A 1Z37A 2JC3A 1I2BA 2Y1OA 4PR3A 1W25A 2QX7A 2PYIA 1L7OA 3ZGVA 3GEMA 3TQFA 3CVOA 1MRNA 5E1MA 5FL7A 2CNNA 1KN7A 2C3UA 3UW1A 1A9XA 1E5XA 2K4MA 5AVVB 1LF0A 1A72A 5JBNA 1MQSA 3AHGA 2GRUA 4DRXA 1QQBA 5D3QA 4W1RA 2IPMA 4I6JA 2WQ6A 3LHSA 2AKEA 4WB4A 1A5SB 2B35A 3Q3DA 2EQAA 2J07A 2ZYTX 4TN5A 4TL7A 5EFOA 5EZYB 3SQMA 1JFVA 3JALA 4EJ2A 4CIAA 2Q5OA 4N41A 1CY1A 1YVPA 4TKVA 4IO0A 3ZXXA 2X5KO 4HRYA 5EUCA 3IE2A 4MVYA 3QOFA 3NHKA 3M4JA 4PD4E 1R0RE 3WDMA 1OZHA 2OD7A 3E5MA 1GRRA 1EK5A 1OSNA 1E61A 3BREA 4H77A 2HMSA 3LCUA 3PJGA 3IVXA 4IDEA 4B6RA 1RWOA 1KJWA 2ZRMA 4E3ZA 4J7UA 5HJ2A 4E13A 2B34A 4A5OA 5EJ8A 2XZDA 3RQSA 1H4QA 2RG7A 4UB6E 4JQOA 4TKMA 3ZWQA 5FAKA 5JCJD 3U17A 1NVFA 2IUEA 2XZOA 3QWOC 3WUUA 4LRXA 4MQLA 1E7YA 4NBKA 4CU5A 2YJGA 4MR8B 4OJMX 1U9IA 3L70J 3CX5E 2ZSIA 3FIJA 3K94A 5ICGA 3MJ4A 3VGPA 2JJ1D 4RTLA 4EF4A 3Q1MA 3CUVA 3DTVB 1JALA 5BYAA 1W36B 1TCBA 1LPNA 5ITVA 1RQ2A 4WJKB 4CETA 4CLEA 3UOWA 2ASVA 2J5QA 5HFNA 1JSLA 1SQPJ 1MF7A 4MRSA 2D1RA 2WV7A 1RHJA 2FHPA 3OX3A 1IY8A 4OHUA 5KX5B 4XA8A 4DJGA 4BRYB 4OB7A 5FPKA 5JVDF 5KTSA 2RN0A 1TDJA 3MCTA 3PWSA 3TX6A 3T5MA 3VDXA 3QTLA 5B1SA 1TM3E 1UADA 2JLXA 2X8AA 3KYDA 4EG1A 2JFYA 4W4TA 5NULA 4UATA 3PK0A 3R9IA 5CA0F 3TSOA 1CB0A 1BXRA 3PC7A 3TPFA 3UK6A 2HC9A 1IB0A 5HM6A 2HA0A 3BVPA 5FQOA 1M2JA 4C08A 1K8QA 2V7QA 1GK4A 2C94A 3LWNA 1JFTA 2WP8J 1O95A 1TF2A 4H13D 2XYHA 2HCRA 4WBNB 1NAIA 4FJ1A 2JLRA 3B9PA 4MLCA 5D85A 4PNEA 4EL5A 5KOJB 2DR2A 3W05A 3B82A 3JCUH 3EMBA 4GM4A 5K3FB 3RRXA 2QD5A 3C74A 3HB7A 5K3EA 4V1CI 1NH4A 2GCNA 1UKVY 3LHIA 5DB4A 1FZCB 3B1VA 2X0KA 4N6OA 5G0TA 3G6EP 1YWGO 1TLLA 2FEPA 5L3SB 3IAM1 4GBGA 2X9QA 4EHLA 1A76A 1RIFA 2J5XA 2BBSA 3DOEA 3JQFA 5D5QA 3T7IA 4CM4A 2FZGA 4JQSA 5BSMA 2QPOA 2H1RA 3EH2A 3MTEA 2B92A 3L72E 2J31A 2O8VA 3K73O 4JBGA 1SIUA 4EMBA 5AW4A 1AJEA 3EXHA 1Z63A 1RADA 2NO6A 4LDJA 1OW3B 1S2OA 2XMZA 4QQ8A 3T35A 3NH9A 2P9FA 4U3FJ 1O89A 4BAUA 3R5XA 1QANA 4A5SA 4D9HA 3PJDA 2ZCJA 2V7GA 4BNJA 5KLVJ 3UIAA 4ND6A 3HE4B 4GMXA 1L7EA 4PC2A 4CV3A 3WADA 4URWR 1M0EA 1RIIA 2WITA 3TVTA 3AOEC 1T43A 3UO8B 2W6ZA 3CZQA 2V5VA 4BLSA 3CVUA 1QYWA 2XH8A 4PY2A 5JTTA 2CDRA 5I3CA 3N5KA 4YMWA 4C01A 3CTMA 2YKOA 4BJHB 4HLCA 2XHZA 4AKIA 3JTMA 2II6A 3MAAC 3CTPA 2W6IA 5ELXA 4X90A 1B3RA 1FJHA 5B53A 4IINA 5EVCA 3THWA 4G1EB 4E4YA 4M1OA 4NG5A 2X9VA 1X0XA 1Z82A 3AETA 4NWIA 4OK6A 4L8LA 2XUGA 1N3IA 2ODPA 2H29A 3OM8A 2FW9A 2H17A 4P3YA 4F4FA 3W5BA 4FM9A 3BGWA 1Y7PA 1GU0A 1RYYA 2CKMA 2PGLA 3K8ZA 4JLVA 2ZUSA 5DYGA 4CN8A 1QPGA 5HUQA 5JZSA 3FBWA 4PG5A 1BDHA 3UC5A 2JH9A 3JCUE 2QJKB 4KQMA 1L8AA 2AJDA 2FFRA 3GEEA 4IIEA 5KYYA 5LKAA 7REQB 2BP7A 3G2HA 2MSDB 3LS2A 5KAFH 3JQQA 4CEJA 1BKSB 3SKXA 4PAMA