2ZYDA

Dimeric 6-phosphogluconate dehydrogenase complexed with glucose
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
464
structure length
464
Chain Sequence
KQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEFVESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFTKKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAASKVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIFRAGCIIRAQFLQKITDACAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPTFSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-phosphogluconate dehydrogenase, decarboxylating
publication title Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 169
structure length 464
sequence length 464
chains with identical sequence B
ec nomenclature ec 1.1.1.44: Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating).
pdb deposition date 2009-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2zydA02
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 2zydA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zydA01
1E7WA 3PPIA 2PKQP 2I66A 1VJTA 5COQA 4IDGA 3DB2A 4FFNA 1LLQA 2Y0CA 3ENNA 1R37A 1PSDA 5L95A 3QY9A 1I30A 2GDZA 3JD0A 5FEUA 1M6HA 3P5SA 3O9ZA 4Z9YA 1O0SA 3C3XA 3HFGA 4M54A 3VH2A 4A5OA 1SC6A 5TRTA 5JCJD 4BKQA 3MJSA 4XX0A 4PVCA 4RPHA 4GGOA 2E6UX 2J3IA 5TX7A 2RCYA 3WGIA 1GEEA 3LVFO 4OO3A 3DR3A 4O5OA 3ZI0A 4CV3A 2Y93A 4DPLA 1VLLA 2IDZA 2VRCA 3W8DA 1U3VA 1LDYA 1CQJA 2ZYAA 3CZRA 3P2OA 4MVJP 2E4AA 3JD3A 4YRAA 2Y05A 3OP4A 4PZCA 1HZJA 4BUCA 2Y1FA 3DHEA 1P1KA 3G3EA 3VZSA 3R0IA 1H0KA 5DF1A 4LCEA 4PRKA 1XU7A 3DAGA 4R1TA 1PR9A 1ISIA 1JN0A 2NV6A 4RVFA 4XR4A 1MXHA 2AQHA 2OL4A 3ADPA 2BFAA 1C14A 3ZU3A 1R0KA 4IDDA 3V1UA 1XIVA 1K3TA 1FXSA 3IJRA 1ZK1A 4J7XA 1NX6A 2PZKA 3KO8A 2VHWA 4AVYA 3VTZA 4R1NA 4CM6A 2HJRA 4AJ2A 1AN9A 1EFKA 1B16A 3H2SA 4KP7A 3I9JA 3DHNA 3S2IA 3OQ1A 1FMCA 3ZWVA 4NU5A 4ZHSA 2CMDA 4FN4A 3GPDG 2J3JA 2XPCA 4FGSA 4FFOA 3LF2A 4JP2A 3WYCA 1OZAA 1GZ3A 4DL9A 5A5FA 4DQXA 1SAYA 3TWOA 1GDHA 2EP7A 3AI2A 3NGLA 1GQ2A 3WGHA 3GMDA 4NI5A 1ZKMA 1SMKA 2X1HA 1JVSA 2ZYDA 3H9UA 3PHIA 3PIIA 1Y9EA 2QZZA 3GT0A 1G1AA 1U2DA 1RKXA 5A5EA 2UVDA 3AUSA 5BSHA 3CMCO 2J3HA 1M2WA 1LUAA 4WASA 5DBIA 3PWKA 3KYBA 4NJMB 1HF3A 1Y7TA 2H63A 2WJPA 3H5AA 4HWKA 4RVSA 1K5HA 1GD1O 2WSBA 4B7XA 4D43A 4ZICA 4J1NA 3ZWXA 4I9UA 1WDLA 4OXKA 2FSVA 2TMDA 1WAMA 3NDJA 2NTVA 1JKJA 5TC4A 5B4TA 4D42A 3HG7A 3TL3A 3GN2A 2Q1WA 2BFPA 2DTDA 4Q3CA 1XQ6A 3TZ6A 1WW8A 4BNJA 3RFXA 1LQTA 4P22A 3W4KA 3FF4A 1EDZA 1GPDG 3AY7A 3C1TA 5KJFA 2D3TA 3F9IA 4J7UA 5U4QA 3Q0EA 4TRNA 3VKUA 4AL4A 3IL2A 4BO3A 5L53A 2DUWA 3BMQB 5JDIC 1CJCA 4IPTA 2GD1O 2OP0A 3QP9A 4NJMA 4R51A 4RGBA 4BMNA 2PZMA 1O8CA 3LZ6A 1NP3A 1GU7A 3EAGA 1DIAA 5HWSA 3TNLA 5CDUA 4L4RA 3JQ8A 2DUUA 4JBGA 5BNTA 1ZIDA 3F4BA 2AQKA 3E9MA 1YE3A 4NZ9A 1ADCA 3DOJA 1UXIA 5JMWA 2VTDA 2PTGA 1QR6A 3NDIA 2GASA 5DBGA 1JA9A 5JNLA 2GF2A 2QZ9A 3GNSA 1JAYA 1U28A 4R01A 1YB5A 1LA2A 4OOEA 4YRDA 3K96A 1P0FA 3RUHA 1U7HA 2Q2WA 2O7QA 4BO9A 3WS7A 1DFHA 1QLHA 3KM0A 9LDTA 3QRWA 1P77A 2C82A 4YJDA 2Q4BA 3ONFA 3VPHA 3OICA 3GMSA 4B4VA 2X0IA 3STHA 3IIEA 1RM5A 3PJGA 3BMQA 4I9NA 3LT1A 4TKMA 1ONOA 4RO0A 1E3LA 4BV8A 2VNSA 1E3JA 3M2TA 4CM4B 1C1XA 1PIWA 3LDHA 3P19A 5F21A 4E0BA 3HJAA 3DZBA 3PJEA 2RHCA 1YBAA 3X2EA 3U09A 2NVUB 1QYXA 1HYHA 3V2HA 2FZWA 3DXFA 1TLTA 1J5PA 1UXJA 2I6TA 1TT5A 1UJMA 2YY7A 4W7HA 3I6QA 4OIMA 1ZJYA 3UICA 1ENPA 1LI4A 3AU9A 3CH6A 5G0UA 5TNXA 5IXYA 2BELA 4Q3AA 3BMNB 3HDYA 4OMUA 3ZV6A 4B3HA 4U6QA 4CODB 1NQTA 4QO8A 4CLOA 2GN4A 5HRUA 1LRLA 3RC9A 1H2BA 4BO4A 3NTQA 1S6YA 5DNAA 4JP3A 2H6EA 1ENOA 2O4CA 3VZRA 5G0VA 3ZNNA 4IMRA 1VJ0A 4YR9A 5AXAA 2J8ZA 1GUZA 3ZV4A 1LSJA 2JFGA 1CDOA 4DC1A 2YHUA 1B8UA 3FNFA 2CDBA 3GZ4A 1Y1PA 4CLRB 4CM4A 3SJUA 3LLSA 4FJ1A 1G0NA 4MVJF 3FSRA 4DQUA 1YO6A 4GAEA 3UCFA 3ICPA 3QIVA 4WLEA 4AJLA 3EVNA 3UH1A 1OX3A 4MVJH 3RUDA 5KJ1A 4A2CA 5JY6A 4GBJA 1ZSNA 3HNPA 1KEVA 2O3RA 2DPHA 3HFSA 3TOXA 3JQFC 2C2XA 1T2EA 1DLJA 4DIBA 1HE4A 1XR3A 5JO9A 2QYTA 3QWHA 1PEDA 2PD6A 1NQOA 2E49A 1G0OA 4W6ZA 4CM5A 1NR7A 1T2CA 2CUKA 2HAEA 2Q45A 5DZSA 4CM1A 4DLAA 4KTVE 3LLVA 2X9NA 1GCUA 4D45A 5K0ZA 1UZLA 3EYWA 4GI2A 3A4VA 1E6WA 3VC7A 4CUZA 3GNQA 4A73A 1NYTA 3U49A 3M1AA 3QJ5A 1FF9A 1VL6A 4Q39A 1P1RA 4GSLA 4R3WA 5JYEA 2V6FA 5JDCC 5JDIA 4R68A 3DC2A 2EW8A 2EKPA 3DQPA 1UP6A 3ZNQA 2GSDA 4BNFA 4S3MA 4DBVO 1YVEI 5ICMA 1ZFNA 2D2IA 4ILKA 1X7HA 3SXPA 4OQYA 4OKIA 1X14A 3KUXA 2HUNA 3E9QA 5H82A 3GVPA 3PXXA 2Y66A 2BLLA 2ZQYA 2EV9A 3O38A 4YTEA 2PGLA 3ZWCA 1E5QA 3LC7O 1K0UA 1PQPA 3WMWA 4ALIA 4FDAA 3R1IA 2CVOA 2IZZA 2PH5A 2FR8A 5CEJA 2BI7A 5DOVA 3LQFA 4HNHA 1IY8A 5IZCC 4GLLA 1E7SA 1V0JA 5G0TA 3ANMA 3RUIA 4FFLA 3JCZA 2NM0A 3DBHB 2RHRA 4EITA 1LRKA 1LXCA 1ZVMA 4WKGA 3NEPX 4DYVA 4L73A 4MP6A 4E2XA 1ZK4A 4XB1A 3KHUA 4AJOA 1ZEMA 2BGLA 4QFDA 1PGQA 1ONPA 2E48A 2VNAA 4NBWA 4OJNA 3U62A 5HS4A 4XDYA 5KVSA 1HRDA 1QMGA 1GV0A 1VRWA 4RF4A 4OSPA 1D7OA 5ENDA 3D3WA 8ADHA 4PCVA 3GDFA 4K9DA 4EEXA 1I3KA 1PL7A 1DB3A 5CEEA 5JAZA 1KVRA 1K2WA 2QG4A 3GG2A 2DLDA 1E3EA 2YW9A 4XYGA 3DL2A 1Q0QA 3WR5A 1H93A 1EZ4A 5KVQA 1UR5A 5TT1A 4ZQGA 3T4XA 1VPDA 3VH1A 1I2ZA 2C5EA 1ZXBA 2NQTA 4IGEA 5EESA 2AG8A 3ZWAA 4RF3A 3I83A 3DOCA 4J6FA 4QUKA 1ADGA 3GOHA 3JTMA 3JQ7B 3UN1A 1IHYA 4J2OA 4KQXA 1ISHA 3DZGA 3BTUA 3DBRA 4HFMA 3FNHA 1U8FO 2DKNA 2BRUA 3RUCA 3U0BA 1F8GA 4JGBA 1KEWA 2VHYA 2X58A 1R16A 4IIUA 4BGIA 5JCXA 5CPBA 2NUAA 1EDOA 1PWZA 1U1IA 3JQFA 3H8VA 4HP8A 4IXWA 2V65A 1SB9A 2VUUA 3U4CA 3VZPA 3OFSA 3HDJA 4IBOA 5DDIP 4WCDA 1N7HA 1YONA 1XEAA 1VKNA 3I9LA 4CLEA 3AI1A 1WPQA 2NU9A 3NGXA 1VSVA 3WNVA 4D46A 1HLPA 2OZPA 5CDSA 4IJVA 1N5DA 4AJPA 4YT2A 4DIFA 2OHXA 4BKRA 1DLIA 2YV2A 4BNUA 4Y9DA 1AE1A 2HK9A 3BA1A 2VN8A 4UUPA 2PZJA 4R69A 1H6CA 3G49A 2AEMA 3C8MA 3GUYA 4UVHA 4JLWA 5EQFA 3CXRA 5JDCA 5KCZA 2B69A 4P38A 5L9AA 1Q7GA 4IDFA 4BO2A 4IDBA 2PD3A 4RJTA 1PTJA 4WE3A 1LJ8A 2OO5A 3FTPA 1U3WA 4ND4A 1ZMOA 4AJ1A 3PFFA 5ITWA 1R0SA 2Y68A 1WZIA 3IUSA 1KVQA 2X86A 4C4OA 3VH4A 3WXBA 2D4AA 1I36A 1B8VA 3PVZA 4Q3EA 5L7YA 4BKUA 4HNGA 3HADA 1JTVA 4RPJA 4EGFA 1E1LA 3JD1A 4TRRA 2YV1A 4K6FA 3EVTA 1HE5A 2C07A 4CM3A 4PLVA 3H7AA 3FPLA 4O59O 3WYBA 3N7UA 5IZCA 2X23A 3OMLA 3UUWA 2AHRA 2OMEA 4R4JA 4UEKA 3RROA 2I3AA 4ZQBA 4LK3A 4HXYA 4IUYA 2HKIA 2GO1A 4EUFA 3EZLA 3JQEA 3ICCA 3NAQA 4F6CA 1I0ZA 4HKTA 1EE9A 4MOWA 5JS6A 3ZW9A 1BSVA 1YL6A 1YRLA 1ISFA 4CL8A 3UCXA 2B0JA 2EWMA 3WWYA 4WLNA 1PZGA 3F5SA 4MVJA 3ZHYA 4BV9A 2AMFA 5CG2A 4IS2A 1HDGO 2HMUA 2QW8A 2UUOA 1P1FA 3WGZA 3A9WA 3GFGA 1PJ2A 1B2LA 4L4XA 2ZJ1A 1LX6A 3I52A 2BH9A 1O94A 3ZHBA 2ZB7A 3Q2KA 1NFRA 4XJTA 1NFFA 4J0EA 2Y0DA 3OIGA 5JMPA 4CQMB 4YJHB 2Q1TA 4CM7A 1T2AA 1ADBA 1E7YA 1OAAA 5G2OA 4B4WA 1DO8A 1YS4A 5H83A 3CUKA 4A03A 1AGNA 3AUAA 4J16A 3QVSA 4WEQA 1TA4A 2GLXA 2YFHA 5JC1A 2GN8A 1NPDA 4RZIA 4CR8A 1E6EA 3C7AA 4FBGA 5LDGA 4I08A 1PU2A 1H6DA 1PJ4A 1QLJA 4XYMA 4R5MA 1JDJA 3V5NA 1BRMA 3M2PA 1SBYA 1U3TA 2QQ5A 1I3MA 3GZNB 5C37A 4FSHA 4MIOA 4UULA 4M1QA 2BD0A 3RBXA 3TZHA 4XGIA 1SOWA 3ZDFA 4R54A 4E33A 2G5CA 4YAJA 1HDYA 2O3SA 2P9GA 4BS9A 2F1KA 4CQLA 4J2HA 1T4DA 2Q49A 2IE0A 4DTIA 3JQ6A 4BNZA 4LN1A 4CM9D 3Q9NA 4XYLA 1PJCA 3MTJA 4IJKA 5TJHA 1KEPA 2NVWA 1U3UA 3WICA 1WVGA 1Q7CA 3WLEA 3GQVA 3INRA 1TT7A 4QECA 5JPIA 1PJ3A 4NH4A 3ETEA 3SC4A 5TF4A 4Y98A 2VWHA 3OSUA 4TRJA 2C5AA 5JFOA 3FWZA 2QIOA 2ZIZA 4KTTE 3HE3A 4DGSA 1K6XA 3H9JA 3MWEB 3KV3O 2BFOA 4YBZA 4IS3A 1H94A 3Q3CA 3BMOA 3FD8A 3KEQA 4J1QA 1JQBA 3BYZA 4XIJA 2AQIA 3Q9UA 4TMFA 4NMHA 2YDYA 4CPDA 1PGOA 1T1SA 1LSOA 3C24A 3S2FA 1PJBA 1BVUA 2JD0A 2FOIA 3S1LA 4MVJM 3VPFA 3VTFA 1GY8A 2P68A 3RI3A 4D0SA 1E6UA 4LMPA 3C1AA 5THKA 3GHHA 2J3KA 3AI3A 3BTSA 4LMRA 3KSUA 1Q2XA 4CLXA 3ITKA 4E12A 5JW6A 5JXWA 5JO0A 1PGPA 2O7SA 3KLMX 5TS3A 3PYLA 3QQPA 2C59A 4RDHA 3R3SA 3AY3A 2YJZA 5IF3A 1Y81A 3VVCA 1HTBA 3A1NA 4I5GA 2JAPA 3L4SO 2BKAA 4FS3A 3GN1A 4RL6A 3H2ZA 5DCYA 1D4FA 3DZJA 1M76A 4NFHA 5K9ZA 4HFNA 3TN7A 1MX3A 2CVQA 1HETA 4GQAA 5JC8A 4BVAA 4DLLA 1OC4A 1H9AA 4GGPA 3ZWWA 3WX0A 4ND3A 3WMXA 1UDCA 1GADO 4CL3A 2YFQA 3GRKA 5KJEA 3D4PA 1BG6A 1E0DA 4CQMD 2DTXA 2AEJA 4J7CA 4QSMA 1DJQA 5G0WA 4WUVA 3M6IA 1I10A 2R00C 3VH3A 4YAGA 1V9LA 1MB4A 3V2UA 2G1UA 1DC3A 4OL9A 3AU8A 1CERA 3KOUA 1MXFA 5AXBA 1DIGA 3GAZA 1G6KA 2F00A 1B3BA 1YBVA 2C20A 5EL0A 1SCUA 5IN5A 2X8LA 2NADA 4GKBA 4L8VA 5DBFA 4IY1A 4W4TA 1PS8A 1DEHA 1UAGA 4U5QA 2ET6A 5C7LO 4XR9A 4DBZA 2I67A 5IDQA 1UDBA 3WQQA 2RAFA 2VQ3A 5F5NA 3WBBA 1Y6JA 4ND1A 4EJMA 4URFA 5B12A 4DVJA 4L74A 3CPSA 4CMGA 1P31A 3AFNA 3EMKA 2Y0EA 1ZO8A 2WTBA 3GGGA 4YT5A 2QX7A 2DPGA 4F45A 4CMKA 4R1UA 5J23A 4JXKA 3WIEA 4PG5A 3OH8A 1GZ4A 1B26A 4WECA 3TF5A 4INAA 4PLZA 3PQDA 2Z5LA 4FFPA 1I3NA 4N5LA 3CIFA 2P91A 4A27A 1UDAA 2W98A 3UF0A 3MZ0A 2HCTA 3ASUA 1ADFA 3OJOA 5DULA 1CIVA 1F14A 1LQUA 3EGOA 2BMAA 3IAHA 1H2HA 2HSDA 2A92A 1HL3A 2PGJA 5ADHA 3DZHA 2CF6A 4ZVVA 4Q9NA 1R4NA 3UFXA 4WNCA 4ALMA 3RC1A 3WBFA 1ENYA 1FDVA 1XGKA 3RJ5A 2FR1A 3C7CB 4S1VA 1N1GA 1JAXA 1V3TA 4G2NA 2VHZA 1LC0A 3L07A 4LSMA 1MLDA 2FY8A 3H9GA 4BNIA 2EERA 4IZIA 1YXMA 1ZK0A 1MFPA 1KOLA 4GLOA 4GPD1 2FN7A 1F12A 3D4NA 1I5RA 1VM6A 3TZCA 2B5VA 4PN3A 4FFMA 3GUCA 4YAEA 1ULUA 5KVCA 3E03A 2DBQA 3V1YA 4BO5A 2VRCD 3W6UA 1GZ6A 3JQ8B 3QWAA 2I9PA 4NPCA 1LLDA 4CR6A 3FBGA 3ETGA 4J1TA 4WGGA 4Z0TA 3L6OO 3T4EA 2RH4A 7MDHA 4ZQHA 4LRTB 5IJZA 1SO8A 3RKUA 2WYUA 4MKRA 3DTYA 3K31A 6LDHA 3EK2A 4EYEA 3QV1A 3VKVA 3WFJA 4NBRA 1Q1NA 1EVIA 3IOYA 2O2SA 3OA0A 3RAJA 4ROSA 4CUKA 1EUDA 4P8RA 3DFZA 3I1JA 4BO6A 4J43A 1BDMA 1NHGA 2X22A 2YV3A 5IAAA 1X1EA 3JV7A 4M89A 4R41A 4Z9XA 2EJWA 2DTEA 2R00A 1ZW1A 4TRMA 5KIAA 1ONNA 2UYYA 4WOJA 3K5PA 3MOIA 4FJ2A 1C1XB 3OJ0A 5LCXA 1PGNA 1IYZA 4XQEA 2ZKLA 3H4VA 4YRBA 3U4IA 2NVBA 1CRWG 2V6BA 1B14A 1EBFA 1JU9A 3V8BA 5C7OO 1EQ2A 1K6IA 3DEYX 1KY5A 5HM8A 4PLTA 1PJLA 1TT5B 1O9BA 1W8DA 4NHEA 4BNXA 2PWZA 3ROMA 3UVEA 2HLPA 3VPXA 4BKOA 1XQ1A 5CDGA 5CAEA 3NYWA 4YB8A 3TPCA 4J91A 2P4QA 3DWFA 2GZ3A 1GYRA 3GAFA 3CMMA 4CLOB 3TDKA 1YBMA 4IGFA 5LDHA 3K9QO 2PR2A 4XB2A 5EN4A 3WNQA 3CSDA 1JVBA 4Q3BA 3L0DA 9LDBA 4MO2A 1SEVA 1Z73A 1XKQA 3D4OA 1LDMA 1Y8RB 2VOEA 3HHPA 2DFDA 1F06A 3HSKA 4YJGA 5GMOA 3AW9A 4DYDA 4LSWA 4LISA 4KWIA 1R6DA 5C5IA 1R12A 2V6MA 5GZ3A 4A26A 4PLHA 4GX5A 2H9IA 5I7VA 5IDYA 3IP3A 1DAOA 2PGDA 3JYOA 4AFNA 5GZ1A 1HT0A 1TVEA 3F46A 4DLBA 3E6AA 1LDBA 3DZIA 3IJPA 1JKIA 3OJLA 2H5LA 3QVTA 3WJAA 5TGDA 3ZWPA 1BXZA 3OEYA 2D1YA 3I5MA 1LTHR 5A3JA 1GUFA 2WE7A 5A1TA 4WCFC 4OOFA 1M66A 4YQYA 2WDZA 4O6VA 2VT2A 3RC2A 1A71A 2FR0A 4BKPA 5L40A 4EZBA 2VWPA 4E2ZA 2QHXA 4BNYA 2G76A 2X0NA 3PQEA 3DZKA 2ZK7A 3VPGA 2AEFA 5A02A 4CMBA 2Y1OA 3ONEA 4YVFA 5TJ9A 1Y8RA 2D5AA 4OSOA 2X5KO 3GLQA 3NJ8A 2AW5A 2FHSA 4RQTA 3IQDB 4MVJG 4NFYA 3MCVA 2DM6A 4PG7A 2G17A 2GCGA 3KRTA 4ALNA 4EW6A 4CMIB 3G17A 4MIYA 2X5OA 2IODA 2EHDA 1R15A 1DIHA 3OBBA 1EVZA 4OAQA 3ETDA 4ONEA 4B79A 2Q2VA 3HUDA 4ND5A 3U5TA 4IM7A 3BMCB 3GPIA 2VRBA 3EUWA 4B4UA 3WFIA 4BNMA 1PL6A 3GK3A 4OKNA 5ILGA 3AOEC 4R16A 1NPTO 1PZFA 4IDCA 1UH5A 5JE8A 4O63O 1GTMA 1RWBA 4JJGA 1QKIA 4MJLA 3GC6A 5F1OA 4WLVA 2X9VA 1U4OA 2P4HX 1M75A 2GN6A 3FRJA 3T7CA 4CLDA 1QYVA 3AUUA 3GGPA 1I32A 4LRSB 4NK5A 4ZRNA 1YH3A 2G82A 1HDRA 2W2LA 1KEUA 5EIOA 3PK0A 4JIGA 1U9JA 4ZRMA 1A7AA 4D3DA 3KTDA 2HJSA 4PG6A 2IXAA 2Z1NA 4QX6A 4CMIA 2NU8A 1MFZA 4R9SA 3WOHA 4EDFA 1U4SA 4YAIA 5DP2A 3JQBC 3CTVA 3TQHA 3WGTA 4FFRA 4JROA 4E5MA 4UUNA 1LLUA 1V6AA 5AXCA 5I7SA 3S2GA 3BMCA 5FI3A 3TZQA 3ADOA 4EUEA 3PI7A 4MINA 1KC3A 2PH3A 2O4UX 1E5LA 3HN2A 1VC2A 3D3EA 3E5MA 1PGJA 1C3VA 1HXHA 2CFCA 3TOZA 5T6BA 1BHSA 2EJVA 3WGGA 5COBA 3KBOA 1A5ZA 2EF1A 5A9TA 4HY3A 3D3WB 4JNKA 1DBVO 4FCCA 3QWFA 4KUHA 4D7AA 3RUEA 1IZ9A 4XZ3A 1P1HA 3RASA 2WE8A 2O2YA 4UUMA 5BSFA 1U5CA 3A28A 3M1LA 3O8QB 2NLOA 1WDKA 1P1IA 2D59A 3RU7A 1DDOA 1E7RA 2AXQA 3OHSX 3MOGA 5L3ZA 3SC6A 4EJ0A 3IC5A 4Q3NA 2WD7A 4A10A 1BVRA 2VYVA 4M49A 3BIOA 3D1LA 1OI7A 5KNLA 4CLHA 3D64A 3FNGA 3W1VA 1VI2A 3DBRB 2IZ1A 4HADA 8LDHA 1X1TA 2JCXA 3I6IA 1N92A 1UXKA 1I33A 4XQCA 5G4KA 1HKUA 3QLJA 4E6PA 2Q2QA 3LC1O 3DZFA 4PZEA 2ZCUA 3ON5A 1P9LA 3GG9A 4IDEA 4J1SA 2ZTUA 1K6JA 3WSWA 1N1EA 4WCFA 4TROA 5MDHA 3PDUA 5TLSA 3JQAA 3O8QA 1EK6A 4EEZA 3RWBA 2Z95A 4HFJA 4CMCA 2WEKA 4PLWA 4RPLA 4U8GA 4J4HA 3FWNA 1T25A 2Q3EA 4U0JA 5T5QA 3NDRA 1AUPA 2EGHA 4AJEA 1YL5A 1WP4A 4BMVA 2PKRA 1Y8QB 3UXYA 1FDSA 2PZLA 1AVYA 5CP8A 3VDRA 2FWMX 2X5JO 1BW9A 4I9HA 3WJ7A 2VUTA 4KUEA 1I2CA 1ZXLA 2BI8A 5TQVA 4TQGA 3HDHA 3WIDA 1YJ8A 1A9ZA 1Y5MA 4IQGA 3PDJA 2ZB3A 1HE2A 1W4ZA 1XCBA 2E37A 4W82A 4BNGA 1Z75A 3PIDA 3DAFA 3S2EA 4YDRA 1XYGA 3ONDA 3AOEA 5A06A 5A9SB 4YA6A 4ZA2A 5I7FA 3ROKA 3PRJA 1I01A 5EQDA 4IXTA 3N58A 2EKQA 3ASVA 2C7VA 3GVCA 3MTGA 4ZQEA 1A4UA 2X6TA 3PHHA 3FR7A 4GSKA 3RCBA 4E30A 1QSGA 4A0SA 2X4GA 3D5TA 1KETA 3JYPA 1Y8QA 4Z9FA 3MJVA 4W9NC 1D1SA 1J4AA 2XXJA 1N9GA 3DBVO 2PFGA 4MDHA 2V7PA 2YYYA 1E1NA 4CUJA 4DQVA 2DQ4A 3HWRA 4G65A 3E9NA 3LF1A 2LDXA 1EUCA 2LDBA 2IYOA 3JQBA 4BNKA 1JWBB 2IXBA 3UW3A 3ZGYA 1RM3A 1Z74A 5L4LA 2RBEA 1U5AA 1GAEO 4JBHA 1FDWA 3D7LA 3NKLA 5A9SA 3BTVA 3LU1A 3K2EA 2AA3A 1A4IA 3PLNA 5I9LA 1IL0A 2JHGA 3EHEA 3PWSA 2O23A 2XF8A 3AM4A 4TVOA 5IDXA 2DBRA 4FC6A 2VTEA 2Y99A 1ZCJA 5I9MA 2HMWA 1NFQA 5FI5A 4FB5A 1NAYA 1KVTA 5CPFA 2A94A 3QVOA 4PLGA 3ZNOA 4UUOA 5JY1A 2JCYA 1LDGA 4NU6A 4PLYA 2DFVA 2A35A 2J5RA 5A05A 2GN9A 3PYXA 2GUGA 5AXDA 1M6WA 1Z7BA 4CM8A 3PGJA 1KVSA 3UGKA 4Z6KA 3UAGA 5KWEA 1A72A 3TFOA 1HZZA 1YDWA 2FRDA 1HE3A 3QVXA 5CEFA 1E3WA 4I8XA 1EBUA 3H6KA 3T7EA 3ZU5A 3DAPA 1P44A 4TZTA 5JSFA 4E21A 3D5QA 4AG3A 1E1MA 1HLDA 5L51A 4XGNA 4L9RA 4CQLB 3W4IA 1T2DA 2A4KA 2NTJA 1GQYA 4RF5A 2A9FA 1HSZA 2GERA 1HYEA 2JD2A 4XDZA 2B37A 2EGGA 2ILTA 5EMHA 1MV8A 2NNLD 1Q0HA 1IHXA 4XWYA 4HFRA 3GVXA 1MG5A 4R1SA 2POQX 3IDSA 2NACA 4OH1A 2GGSA 2EEZA 4WLOA 2IZ0A 3OETA 5BNIA 3BMOB 4BQPA 2DU8A 3IKVA 2VZ9A 2B35A 4O0LA 3ST7A 1NWHA 2CDAA 4NDNE 2Y67A 4ND2A 3KYCA 2OFPA 2J6IA 5U1PA 1UUFA 1C0LA 1E1KA 3F47A 2JCVA 5HBRA 3RD5A 3RJ9A 2Q4EA 3ZV3A 2W2KA 4XEHA 4D3FA 4B4OA 2ZTMA 1T1RA 1U8XX 1NM5A 1OFGA 2EXXA 5BR7A 1QXSA 1RPNA 2OGUA 3S55A 4FW8A 1U7TA 3ZWOA 4MKZA 2J5KA 4UREA 1X7GA 1YB4A 4J4BA 2C7GA 3MJEA 4NJOA 1NTOA 4DIOA 1BXGA 2GZ1A 4YQZA 5I7EA 5KOIA 1UAYA 2UV8A 3RC7A 4AJIA 3UOGA 3ULKA 1DC6A 3AK4A 3DO5A 4AJNA 2YUTA 3TZKA 2B4RO 2BFMA 5TT0A 1XLTA 3SVTA 2HDHA 4MVJD 1B15A 4M8SA 4B8WA 2ZB8A 4W9NA 2VYNA 1PQUA 3RQSA 1WXDA 6ADHA 4WLFA 2Y1GA 4GX0A 5AOVA 3FNEA 2W4QA 4YCAA 4MP3A 4QO7A 1GEGA 4WK6A 4YXFA 3QWBA 3GDOA 1IPEA 1H6BA 1EVYA 2PA3A 4RVDA 2DC1A 1KY4A 4KZPA 4EBFA 4KQWA 3B6ZA 2XAAA 4A7PA 3VHRA 4B7UA 1O5IA 4HV4A 1ARZA 1YDEA 5AVOA 3CEAA 4AJHA 1MGOA 3ANNA 3JSAA 1GYPA 2X9GA 4FJ0A 4GVXA 5F1KA 1ZEJA 3RFTA 1CF2O 2VCYA 2JL1A 3U9LA 5JCJA 4RLSA 3NT5A 4CMJA 3DHYA 4CV2A 1MP0A 1LDNA 1ZK3A 2CD9A 2NQ8A 2O48X 3GEDA 3GR6A 4R3NA 3ZCXA 4F6LA 1ISMA 5CDTA 3MJTA 4C7KA 3VAZA 1I2BA 2VOJA 1HDXA 4CMEC 3HZZA 5BQFA 4P4LA 4NNJA 2ZTVA 3A14A 3NT2A 4RVGA 5ER9A 2FMUA 4PIVA 2ZJ0A 1LNQA 2AG5A 4ZU3A 3DTTA 4ESOA 1Z6ZA 2FP4A 5IZ4A 3OECA 2GPTA 1N8KA 4GH5A 4UVEA 1YWGO 4YJFA 4DPMA 4W99A 1PZEA 4CMHA 4QQRA 4RV9A 4NBVA 3RU9A 3V2GA 3ZU4A 3KLPX 1E3IA 4L0QA 4NQZA 1SZJG 3ANLA 2NSDA 2VYND 1R4MA 3PHGA 4J90A 5JAMA 4N5NA 4JK3A 4PLCA 3RKRA 4ALJA 4BO8A 2Q46A 2B4TO 2HMSA 3GF4A 1ORRA 2NU7A 4KMSA 1E7QA 1A7KA 3OQBA 3L9XA 4I1IA 4R5HA 3KSDO 4CMAA 3NJ4A 1R4NB 5L45A 4GWKA 4F46A 4IJWA 2VUSA 2O3QA 1YGYA 3WQSB 1QYWA 2YHIA 1YQGA 5BSGA 2B5WA 4MVJE 1PQWA 1DFIA 3F5QA 3AFMA 3JQGA 1HWYA 3PTZA 4I5DA 4JJFA 1Q7BA 1W0CA 4MPDA 3GEGA 5T64A 3PZBA 1DC5A 1KC1A 1PR3A 2J5QA 5FWNA 2XOXA 1MG0A 1ZBQA 1JW9B 2CSUA 4Q3DA 4RZHA 4XKJA 3PYMA 1CQIA 5F1PA 4M86A 1F17A 4I5FA 4YPOA 2P9CA 1PL8A 3DBLA 4XQGA 5I8ZA 2CY0A 3RUAA 4X54A 4TVBA 1IPFA 4YEDA 1DXYA 4J9UE 3JD4A 3KZVA 3QVWA 5HS6A 3AY6A 3PHJA 2E82A 3UCEA 3ZWNA 4XCVA 4HBGA 4BL5A 2G0TA 1T4BA 4H16A 5DCUA 3JD2A 3JYQA 3PP8A 1H6AA 2EG9A 5U9CA 5B4UA 1J6UA 3L77A 4Y6SA 5GZ6A 4WEOA 1O89A 1ZSYA 1KBZA 2Y1DA 1ZUD1 3OF2A 1YOVB 1EUZA 4WJZA 3IP1A 1J49A 1VKOA 2GR9A 4JX8A 3H9EO 1X0VA 1NAIA 5B1YA 3PJDA 3F3SA 4O1MA 3WTBA 1RM0A 1V35A 4PFJA 1ISJA 4P4GA 1C1DB 2Q1UA 4RDIA 3BHIA 2CZCA 4DUPA 3AWDA 4P4NA 2RIRA 4J49A 3O26A 3RBVA 3NX4A 4BIIA 2HRBA 3RSHA 2Y1EA 4FOSA 5CFZA 1EMDA 1C0IA 3ZH2A 2PKQO 4B3IA 1Z45A 2HK8A 1SPXA 4H15A 3DMTC 3B1FA 1NQAO 4PG4A 4GWGA 4BNNA 5DT9A 4XYEA 2IRWA 1PWXA 4BMSA 2AQ8A 1TI7A 1V3VA 4E2WA 4CMEA 1LDEA 2O3UA 4J3FA 1YOVA 1EEHA 3GHYA 1SNYA 4L4SA 4W7IA 4GX2A 2WYWA 5DP1A 1HDZA 2HRZA 2EP5A 3I4FA 1EK5A 3KYDB 3PGXA 2VZ0A 4IINA 5CG1A 1L1FA 5THQA 3VOSA 1E7MA 2YQ4A 1PS9A 2ZTLA 4E2YA 1Q0LA 3ORFA 4IMPA 1C1DA 3VVBA 1JLLA 1KIFA 5F5LA 3V1TC 5AQ1A 1A9YA 1BMDA 1GQQA 2VWQA 4YJGB 1C0KA 1YQDA 5JBIA 1PZHA 4QXMA 3G1TA 1W73A 2WWRA 1XHLA 4FQ8A 4TSKA 5HTOA 4DREA 3GFBA 1I8TA 3MJCA 1E3SA 3WTCA 3H5NA 2Q1SA 4U6SA 1V3UA 2H1SA 1NPYA 3H65A 2PNFA 3PJFA 5K6AC 1GFSA 1QRRA 4C7JA 2UDPA 2PV7A 3IS3A 1SEPA 1FDTA 3GY0A 1S7CA 3WB9A 5L7WA 1RYEA 3HB4X 3GGOA 1OMOA 3X2FA 5C7IO 2FPIA 3KYDA 3H3FA 5B4VA 1XG5A 3DONA 5BT9A 4CR7A 1QORA 4FC7A 2AE1A 4NBUA 4YWJA 2CF5A 7ADHA 3P2YA 4GL4A 3ZHXA 2JFHA 1WLYA 5A04A 2DBZA 2B4QA 3K73O 3UHAA 3ZWBA 1UZMA 5CDYA 2YZ7A 1IULA 4JQCA 3PZRA 1ISGA 4E5YA 1B8PA 2Y1CA 1XDWA 1ML3A 2TMGA 3SX2A 5ILOA 1WWKA 2I76A 5FFFA 1GUYA 3GA0A 1BWSA 1HSOA 1CYDA 3VPSA 1HEUA 4D3SA 2AE2A 3I23A 2FPGA 1NVGA 4ZD6A 5EJ2A 3DOOA 4BNWA 2DVMA 5CHEA 1D8AA 2WYVA 1LLCA 1VSUA 2O3TA 1R66A 2BGMA 4M55A 2IEDA 4ID9A 3ZN2A 4H7PA 3FN4A 5KJCA 3FTNA 3H5RA 1IB6A 4LGVA 1X15A 2PD4A 5I9NA 2VZ8A 4N5MA 4RF2A 5KJ6A 1YQXA 4QFCA 3LSYA 2I3GA 1CEQA 1L7EA 3TL2A 3QSGA 3FR8A 1T2FA 3WWZA 2GNAA 1UXHA 1IE3A 2EKLA 4KDEA 3GNTA 3SEFA 3OEWA 4HX5A 3FHLA 3NRCA 3FPCA 1AA0A 1YKFA 4E32A 1WDMA 1MC4A 3GRPA 1BGVA 3HN7A 3A06A 3U4DA 4BO0A 1DSSG 1IOLA 4DWVA 3JQ9C 4N18A 3ROPA 4E13A 3PEFA 1WMAA 4BNHA 2NU6A 2I65A 3GH3A 4RVHA 3RVDA 2R6JA 1DRWA 4NG5A 1K89A 1NWCA 1SOVA 4PLPA 1OC2A 2ZYGA 1WMBA 3DMTA 3MWDB 2DBVO 5L4NA 3RFVA 5MGBA 2VHVA 4DPKA 3E48A 3I9OA 1XU9A 4YYZA 1ULSA 1DHRA 4OHUA 1QV7A 5COAA 4BNLA 4LVUA 2NVUA 2EIHA 5H81A 3FBTA 4G5HA 4RORA 1H9BA 4Y6PA 4L76A 2P2SA 5T67A 4JCOA 5KVVA 4II3A 2CDCA 1ZZEA 2OUIA 4D79A 2P9EA 3W8FA 3VDQA 5IG2A 3GEMA 2IYPA 1UZNA 1NXQA 3BMNA 3RUFA 3MEQA 4XYBA 5IDWA 1NAHA 1NNUA 1D3AA 2OP1A 1GV1A 1MC5A 3OJFA 4J4TA 4J9VA 2WD7B 3RIHA 3LT2A 3PFWO 4GVLA 1GPJA 4NK4A 3SLKA 3NT4A 2QRKA 1HDOA 3F4LA 3NV9A 4UVIA 3U3XA 4UVGA 3B1JA 1IZ0A 1NHWA 1V8BA 2ZATA 3ENKA 3L6EA 1QYCA 3CTMA 1ZNQO 1ZMTA 1DAPA 4YACA 5I8WA 2PY6A 1NBOA 3B70A 5B37A 4CLRA 1XELA 5BNFA 3G79A 3ZU2A 5G4KB 1X7DA 5K6AA 4E5KA 3C7DB 1QG6A 3COSA 2X0JA 3TFQA 2QYSA 3AUTA 4BNTA 4WCFB 1RJWA 1FJHA 3JQAB 3E8XA 2Z1MA 3WDSA 3WQRA 4PLFA 2X0RA 5AYVA 4XJSA 1P3DA 1GR0A 5TIIA 3IUPA 4KUGA 3I9KA 3L4BC 2NTNA 4GMGA 1P33A 4CV1A 1PS0A 3RBZA 2FZEA 4OM8A 3F1LA 5T8KC 3INGA 1P45A 4PZDA 2CVZA 1BW9B 4WPGA 2WD8A 4B8ZA 2DAPA 5FF9A 1OOEA 4MVJI 2JJYA 4IJUA 1TEHA 5EPOA 4Z0PA 1X13A 4DRYA 3C1OA 4ZN6A 1I3LA 1TXGA 3EDMA 1ZSVA 3CZMA 1GCOA 4D44A 4RVUA 2W2LD 4BB6A 1ID1A 3ROQA 1BTOA 4BB5A 3K92A 1I24A 4AJJA 3NTOA 2UUPA 4ALLA 1VL8A 2EW2A 4KWHA 5JAIA 1PJQA 4LCJA 2D8AA 2P5YA 4BGEA 1AXEA 4DXHA 4QEDA 3GDGA 4G81A 5F3RA 4BQRA 5G0SA 4EUHA 2YQ5A 3IKTA 1JKFA 3DMYA 4II2A 1O6ZA 3HB5X 2YDXA 4XRGA 3Q11A 3S8MA 1N9GB 1DRUA 5ICSA 3LK7A 3OM9A 3ZWYA 4YAKA 4OXYA 3Q6IA 4M87A 3O03A 1GYQA 4XGKA 4TKLA 4OQZA 2HO5A 3EC7A 3JQ9A 5A3VA 5L7TA 3DBHA 1D1TA 2JAHA 1N7GA 4I5EA 1NR1A 1GL3A 3ZHZA 2HQ1A 4FOOA 3I4CA 5JLAA 4CV0A 1U2GA 4IQ8A 3LT0A 4BO7A 1LEHA 2C0CA 2QRJA 2JD1A 2VYVD 1Z7EA 5FYDA 5A03A 1T24A 2CNBA 2JFFA 1F0YA 1ENZA 4K26A 4PVDA 1X0XA 3GVHA 3IMFA 3WSVA 2OBYA 3SBOA 4OYRA 4N7RA 4BNVA 3KSZO 4UEJA 4QT0A 1IUKA 3I9NA 4CM8B 4NR0A 4RLHA 1B7GO 4FPXA 3I3OA 3TJRA 1XWFA 3OQ6A 4XQ9A 3WGOA 1E92A 1L7DA 3JQAD 4K6CA 1E3WB 4L75A 3NTRA 4WLUA 5ER6A 4RCVA 4FD3A 5ES3A 3BAZA 3O4RA 4FR5A 4E5PA 1E77A 2GRAA 4MKXA 4H3VA 3W8EA 3K30A 2VWGA 4EJ6A 3W6ZA 3OIFA 2HMVA 3WGYA 3R3JA 2O50A 2UAGA 3JQ7A 1DPGA 3BHJA 1P1JA 1Y9AA 1QV6A 3PQFA 4NFSA 1QP8A 1LBEA 3KB6A 2Q50A 1LRJA 1CETA 1YB1A 1ZK2A 3QW2A 4TWRA 2W90A 4N54A 5KTKA 3I9MA 4UVDA 1RM4A 3FI9A 1LU9A 4GX1A 2D5CA 3L4BA 3LT4A 1YL7A 5ITVA 5DN9A 5IN4A 1LC3A 4WOKA 5DOZA 3WGQA 2QRLA 1BDBA 1F8FA 5T8KA 3PWZA 1ZH8A 5LC1A 1FDUA 1P0CA 2B36A 4BGUA 3KYCB 2OOSA 4OGWA 4PGFA 1AHIA 4PG8A 1WZEA 3E18A 4ALKA 1RYDA 2C54A 5DCWA 5BSEA 2FPPA 3DFUA 1DRVA 4ITUA 4CM9A 2NWQA 3GVIA 2W2KB 1SB8A 4RPKA 1MA0A 1Z82A 4IZHA 5IFLA 5G4LA 4IIVA 5ENVA 4WNIA 2VT3A 4U7WA 1MUUA 5JAQA 3K8ZA 1DFGA 3CINA 1NVTA 3HQ4O 3B20A 2ZB4A 3AM5A 4D0RA 3AM3A 3U4HA 1BXGB 1EVJA 2SCUA 3HDQA 1EQUA 4FGWA 4XD2A 1XSEA 1A27A 4KOAA 2D0IA 4E31A 4FIZA 3K6JA 4AJKA 1EFLA 2OXIA 1JWAB 1DHTA 3ZNPA 3EY4A 1H5QA 4DA9A 1DIRA 1WNTA 1HDCA 4E3ZA 2I5PO 3AOGA 2JKVA 1NQ5A 3JYLA 4DMMA 1DOHA 1N2SA 2O3JA 1ZJZA 3W4JA 4JBIA 3B1KA 3FCOA 3NUGA 1CWUA 4GMFA 1DC4A 3INTA 2V6GA 2R2GA 1QYDA 4IDAA 4UEOA 3ZW8A 3VZQA 4Y67A 3DDNA 1KYQA 1EE2A 4E4YA 4TZKA 1DJNA 5KKCA 3KEOA 4NIMA 4K1LA 3ZZNA 3CE6A 5L4SA 3UKOA 3Q2IA 1KVUA 2WMDA 3BHMA 4K28A 2C2YA 3OJEA 3SLGA 3E5RA 5JYDA 1W6UA 1NVMB 3E1KA 2DT5A 2RH8A 3MJ4A 1UP7A 5T57A 1VE9A 3SJ7A 4ZJUA 3QE3A 1OBFO 4LW8A 2JHFA 4D41A 5A9RA 3TRIA 3F1KA 3C85A 4QTZA 4RQUA 2ZCVA 4F3YA 1BXKA 1VJ1A 2OORA 2ZQZA 1AXGA 4Z3KA 2B83A 4E5NA 2BGKA 1J0XO 4GKVA 2PLAA 4LVCA 3ABIA 4OXNA 4CQMA 4Y8VA 1PJSA 1LSUA 4YJHA 1KERA 4DC0A 2IEBA 3P7MA 3H9QA 3Q1LA 4U0KA 1R0LA 2HU2A 3BTOA 1PX0A 3ITDA 3JQCA 1XA0A 1UXGA 4JJIA 1Y5RA 3G0OA 3QWIA 4YJFB 1FK8A 2BHLA 3EZYA 3L9WA 3L6DA 4JN6B 3N74A 4XA8A 5GY7A 3PLRA 3KVOA 4AJ4A 4BO1A 5IXSA 3QHAA 5EERA 3GZNA 2GYYA 2GZ2A 3BXXA 1R4MB 3OIDA 1B3RA 1T26A 2BF7A 2Q99A 3ZV5A 4NBTA 1TB4A 1P74A 3K2BA 4YT8A 4RPGA 4B3JA 2W8ZA 1C0PA 1UP4A 3CKYA 2XXBA 5EINA 2HK7A 3WLFA 3WG9A 3WYEA 3JQDA 3D0OA 3R6DA 1O95A 2X7HA 2P5UA 4PRLA 5TSDA 5A4DA 3AJRA 1PJTA 1HYGA 3BZUA 4ZGWA 4BGVA 2YHIB 4BOYA 1NASA 2I99A 3EW7A 3TSCA 1DIBA 2C29D 4UAGA 3LC2O 4XRRA 2FSSA 3KXDA 3JQGB 4MIEA 4MP8A 1M67A 4Y6RA 2VHXA 1B0AA 4BHTA 1VL0A 5C3MA 2HMTA 4EI2A 4XIYA 5HA5A 4YT4A 4Z3DA 3JYNA 3OA2A 4ZQFA 4AICA 3F6YA 3QA9A 3E82A 3LYLA 3DBLB 1YJQA 3KETA 4KDFA 2WM3A 4Z0HO 5KKAA 1KS9A 4J0FA 3H3JA 3ZWMA 4B7CA 4HUJA 1AHHA 4DMLA 2PK3A 3PHLA 4CJXA 3G1UA 1LSSA 4R9RA 2OBNA 4IQ0A
chains in the Genus database with same CATH superfamily
1E7WA 4EYYQ 2BTOA 3S8EA 5EUCA 1OWLA 1N7IA 1QH1A 5AW3B 3VH2A 1V5GA 2MWMA 4I2NA 3OW2O 2O0HA 1KKUA 3CO0S 2IDZA 3RG2A 2H88C 1RBQA 2O1KA 4PZCA 1P1KA 4ENUA 1FZTA 3LNTA 2BFAA 3W9BA 1DTWB 1X2BA 1Z28A 1FZBA 3S9OA 4Y0AA 4L28A 4F4IA 4DZRA 1MAUA 3KPUA 421PA 3ZXUB 2HJRA 2WR8A 4RKFA 5JZMA 4EO9A 2H29A 1L7BA 2GBPA 2R8OA 3W5VA 1KMQA 4FGSA 4FFOA 5B3AA 3WL5A 2EP7A 1YHZA 2X15A 4KODA 4D9HA 4RULA 3FYUB 1VBMA 4HEQA 2JATA 3AEYA 3I6MA 1Y7TA 5CFOA 4WINA 3AJ9A 3U3OA 1PYOA 2O1EA 1WDLA 4OXKA 1KFJB 2PSHA 2OECA 2YZ2A 3LX5A 1Q22A 5KAFE 1X80A 4KFRA 1EPUA 3FDJA 2QAIA 2YIMA 2JJ2A 3P27A 4M3NA 1QO0D 4FUTA 5FHRA 2D3TA 1YDFA 1YSCA 2QVZX 4JOCA 4NJMA 1BU5A 1O8CA 1NP3A 4L6IA 2VL7A 4IKOA 2G9QA 1Y3FE 3K05A 5DBGA 1LVUA 4ZALA 2Q3LA 5AM0A 4HPWA 5JCZA 2O7QA 5T3UA 3TGUJ 4CCSA 1P77A 5FBHA 4H7EA 2D7JA 4PXSA 4UTOA 3VPHA 1WB6A 4WN3A 2YZKA 3K0FB 3RSFA 3GQBA 5B7GA 4EI8A 2RHCA 4HJXA 2CJWA 2XUGA 2HR1A 2QM0A 3CX5E 3JS5A 2ZSHA 1UJMA 3KT0A 4ZO7A 2FLVA 1V1RB 2HF7A 1FXUA 2XD9A 3RANA 2O01J 5JZBA 5AW2B 1PQYA 3MJDA 1NI4B 4YR9A 2ZT8A 4PD4D 4MROA 1B8UA 4YUXA 1QS0B 1Y1PA 4FJ1A 3D3JA 3QIVA 1QP4A 5J40A 1M1YB 1PHRA 4QLBA 3DEZA 3I0MA 2O3RA 3HFSA 1URQD 3JQFC 3AEFC 1PR0A 4X97A 4DIBA 2CCJA 1DQNA 2HNKA 2B30A 5JS7A 3OO0A 4CM5A 2HAEA 3EZ9A 3PNOA 3BD6A 4BMPB 5K0ZA 2OCDA 1VL6A 1QH8B 3F49S 1PTJC 4NV3A 1DEBA 3RE1A 2X1VA 1TJ5A 2ZJBA 2BLLA 3HY3A 2WY2D 1UQUA 1QLWA 4FDAA 2CVOA 4HNHA 1O96B 3NV7A 4L51A 2CUTA 4FKZA 2K9JB 1LXCA 4D9JA 1CHDA 3NTLA 1YA8A 1ZUHA 4F85A 2ZBRA 3JC22 3N53A 3L0BA 4TQUS 4PCVA 1GPMA 1OW3B 2W4MA 5KYKA 2E42A 1QRDA 4IVPA 1YRWA 5TT1A 4L57A 1I0IA 3D8NA 3Q0TA 2K2QB 3H1ID 4UBLA 4UM9B 4J2OA 1C9JA 3OPMA 3BIXA 2CLDX 4HFMA 4PAWA 3G9ZA 5BR8B 2NUAA 2VF7A 2V5VA 2V65A 2JWDA 1XEAA 4F8YA 3V55A 1E58A 4GZMA 2PUHA 5KNDA 2YV2A 5HGXA 2QGFA 4NE2A 4B3FX 3M0DC 4ARAA 4Q1CA 3SFVA 1H6CA 1JEKA 3I9FA 1ZWLA 3PFFA 1R0SA 4DY4A 1T4MA 2X86A 4PGMA 1ZA1A 1PFWA 4Y28J 1L8AA 5LZ2A 1NE2A 1FPQA 3EVTA 4CM3A 2MSEB 3H7AA 1HC7A 2WYOA 4UD2A 3OMLA 1DWQA 3TVDA 5KYTA 3I45A 3UQZA 4LY9A 3OT5A 1ISFA 2EL7A 1LW6E 2JW5A 3PEWA 1M6YA 2NW6A 1B4DA 3QFTA 1NFRA 1UDXA 4IG9A 4TTSA 4A03A 4FCTA 4MS4A 2UU9B 4XYMA 4MRAA 1O2DA 3TI7A 4TVSA 1AQYA 1YC2A 4R54A 5FTJA 1OR8A 1GG8A 3EZ2A 3BL6A 3AEQA 3FLBA 4R1QA 3MB5A 3L8FA 2FLKA 1U3UA 5ARBA 2QLJA 2PSJA 4A9AA 4DGSA 1K92A 4YRNA 2O1SA 3LTNC 1Z39A 1TYDE 3BRTB 2PKCA 4UPDA 1M7HA 2P41A 5CB6A 4L15A 5FDFA 1FZAA 2FUKA 4DKXA 1XDBA 5TGTA 1Z0KA 3OOJA 1KILE 3HKDA 1YC5A 3ITNA 3DGEC 1XRSB 5IF3A 3CXHD 4QSHA 3GIDA 3GN1A 3QOWA 1IK4A 2CXQA 4F72A 3QE4A 3THWB 1YFLA 1KBQA 1PV2A 1AU9A 2PCJA 2QR3A 3NDPA 3BX1A 4WXRA 1X74A 4QJ5A 3LOQA 1DIGA 2W2VA 3ELUA 1BNCA 2X8LA 5TMBA 5C7LO 4IX1A 4PGAA 4BB9A 5ICCA 4RSRA 1GK4A 1JHRA 5IVPA 1N3IA 2ZBEA 1ZO8A 4EG5A 3OE7D 2QX7A 1DT5A 2ZXXA 3NHYA 4ZO4A 4KR2A 5AJTA 2W98A 2B1RA 3CLTD 2GX6A 1CJVC 4IFIA 5EJIA 2IBZG 1ZG3A 3P9QA 4ZVVA 3VTPC 5CNMA 4D99A 4L3OA 5K8JB 5F51A 4D92A 4S1VA 2DWUA 1JYSA 1JAXA 2WT8A 1VIYA 3VKHA 1WRBA 4OQMA 3GCZA 1KQGB 3LPAA 1YDGA 3FF1A 1CY0A 2QRUA 3QNUA 1BYIA 1FVFA 2YWEA 5KVCA 2XZRA 1T36A 3LPLA 4CN8A 4TUYF 3ZX5A 3SQOA 1CRZA 1JQKA 3U16A 3I2KA 3T4EA 1G6Q1 3VKVA 1V11B 1BE6A 5C9ZA 4ROSA 2X1MA 1QCCA 1VHDA 1A02J 3WB1A 3JV7A 4Z9XA 3WMGA 3W77A 1V41E 5KOJB 3F8SA 3BBLA 4I7EA 5H2FE 1FRZA 1WP9A 2GHIA 1IYZA 4YRBA 5AVSB 3L74E 1KYOI 3F98A 4A0HA 2XNDD 1S9KE 3HKCB 1L5WA 3R20A 2X2EA 5CYGA 2RFLA 1PNTA 1KB9I 3UVEA 3H1JJ 3L0DA 3GHGA 2GEFA 4V3BA 2MYNA 4O29A 1CS4C 5I5EA 1P8AA 4EEKA 4JB2A 4CFSA 4K9LA 4A26A 2G6TA 3J7AC 3F46A 2VQSA 3QEKA 4P80A 3RSLA 3TRHA 2Q3JA 1LTHR 1T5HX 3E70C 3G8YA 4EA8A 4BMOB 3W67A 4EHFA 2CL7X 1JWLA 2VT2A 1A71A 4K81B 3W5SA 1FSSA 5CLHA 2XWQA 2XE7A 3NB0A 3W78A 2BCCG 3W6NA 2CXSA 4KN9S 4MVJG 1OVVA 4K03A 4P81A 1RTTA 2HSJA 3EWSA 1F0NA 4YHHB 3BMCB 4OKNA 4KN5A 5K0SA 2JPDA 4PX5A 1AUVA 1U8CB 2M6RA 1Z4LA 4KJZA 2A3RA 2X9VA 1YFZA 2O1WA 3MRVA 4W8HA 2A45H 3KQNA 1HM5A 3FSEA 1VB3A 3WYFA 1FAVA 1A9QA 3IUNA 1XEWX 4WBSA 1CV2A 2V3VA 1LLUA 3QBTA 4TLCA 1L0LE 2QJYB 3K6KA 3O3NB 1G3IA 1M34A 4XA4A 1H8AA 4OYLA 4GWLA 4KUHA 4C07A 3QU9A 3OHSX 4MWSA 3FIJA 4NESA 5LUBA 3A31A 3QH9A 2EDAA 2PHZA 1O5TA 3A5TA 1N92A 1UXKA 4E6PA 2CPSA 3GG9A 4WCFA 2ZVPX 4U8GA 2AKYA 4L4YA 1C9YA 2IPLA 4AJEA 4BMVA 1LT9B 3EZFA 4AXBA 5KMGB 1BZYA 1U2SA 4AF7A 1USEA 3DMDA 1L1QA 2Q3HA 3Q3DA 1V9CA 4GXRA 1WSBA 3D6VA 3O8ZA 4OFWA 1JQDA 4LDNA 3W5DA 5A06A 4ZA2A 1L8QA 5AKEA 2YYSA 1E2HA 3PSAA 2W7TA 3SIWA 3TNUA 3UUGA 3WBKA 2YJ5A 4CUJA 2AN3A 2XU6A 4XVCA 1PCXA 2CXPA 4CG0A 3JQBA 1EHYA 5B5EE 1N25A 2CYBA 5K09A 2XQIA 4UUAA 1UJ6A 2ZZKA 5A9SA 1E96A 4ZC8A 2C61A 4U2DA 5I9LA 3NIWA 3WA6A 3PCXA 8AT1A 4XRGA 5FTNA 3BGIA 4NU6A 2DFVA 3MYRA 4RV4A 5F7OA 1UPXA 3ZQ4A 4EKIA 1A72A 1KILD 2Y77A 3H2YA 4LAFA 3ENQA 1J8FA 3D1JA 1DBQA 1KYYA 3KDPA 4BX9A 3AR8A 1SQQD 4AWAA 3MXOA 5AJZA 1NQVA 4I6MC 4KE7A 2NNLD 1MO5A 2QAJA 3R24A 1T8WA 4OH1A 1RDFA 2B5OA 1L8LA 4O0LA 3IEUA 1A0OA 1T15A 2Z58A 2J6IA 2PZGA 3R3UA 2HIMA 5HBRA 821PA 5ED0A 2A5DA 3CR7A 1D0SA 4DM7A 4MWZA 1NM5A 1IATA 4DV3B 2PXAA 1QXSA 2OAEA 1EX6A 5ALYA 1MQSA 2O5EA 4G9GA 1E2EA 4G67A 2A14A 4HLNA 5DHQA 5LMCA 1TO2E 4MYRA 2JANA 2ETVA 2J0EA 2C9BA 4C88A 3MLBA 2ZKIA 4WBNA 2FP4B 5EI5A 2FF5A 3LG2A 2PA3A 3KLBA 2DC1A 4EBFA 3JWEA 3GJ3A 3IKLA 4X91A 3ANNA 3JSAA 1N7SB 1GYPA 1XZCA 1UKZA 3PXBA 2O48X 2IU6A 2VOJA 1XDDA 2WWVD 3WJ1A 5ER9A 3SQMA 4OB7A 2YQZA 2AG5A 1KZ4A 4M6WB 4MCIA 4WKCA 2B94A 2ZSDA 1ZR2A 4FW9A 4MS3A 1GTZA 3HD7D 3LWBA 3NHJA 1X1SA 1U7ZA 2WUWE 4YCDA 4EQ6B 4NQZA 3ANLA 1M2KA 3OLQA 3V6MA 3MT0A 1NNI1 3MF4A 2OHHA 3T3EA 1ILWA 4ZZ2A 4YPFA 4LYAA 5H3CA 1EGAA 2QYHA 2ONZA 2GYWA 1XI2A 4INZA 3KAKA 4XQ0A 4BQOA 3L74D 1IUNA 1S9KD 4XQGA 4X54A 1IPFA 1XF1A 4LX8A 4MI1A 1Q83A 1YJXA 4MCHA 2O2CA 3CRZA 4OJYA 3SSNA 1VJDA 2EG9A 2B78A 1O89A 1ZUD1 1YOVB 1LVHA 4DDMA 4LVNA 4HN2A 2ZR7A 4IFTA 1L5VA 5LN1A 1PN3A 1N6NA 1T3TA 2V6JA 3AM1A 1J1EB 3W7AA 1AS2A 4HRXA 5E7MA 4Q93A 5KZMB 2FUNB 5HHTA 1HWTC 2Y0BA 4GWGA 3L8YA 4BVHA 1VQMP 5EKXA 2O3UA 5DP1A 2D2XA 5BYAA 1L1FA 5FUYA 3K8YA 1XKLA 3EQZA 1KIFA 1SKYB 5LP6C 4I4TB 2Q8QA 1Z35A 1QVWA 4US1R 4JJ7A 3ZY6A 3L72J 5IS2A 4W63A 3ASYA 2CUZA 4C6TB 2GNOA 4U8HA 5J4KA 4MW0A 3GGOA 2IHVA 4L6CA 4CR7A 4X71A 3UXEA 2VO1A 3ZUPA 3BQ9A 1AVTA 3ETHA 3EIFA 3GLRA 3JVEA 4IXDA 2XMCA 2GF9A 1Z8FA 3I0NA 4JA0A 1C2TA 3CUTA 5TMPA 1JV2B 3R41A 2IWHA 4UFPA 2WTNA 1UMKA 5ELLA 2PM8A 2DVMA 3IQIX 2WTYA 1NSYA 3QG5A 4MMYB 2BGMA 4MR9A 3EEBA 1SUIA 4GZ5A 5BSUA 4GYKA 2XVZA 5TEWA 1GVHA 3SEFA 4OREX 1MC4A 3CUYA 2YIUC 3GRYA 1L4AB 5CCHC 1QWOA 2BR4A 3JQ9C 1KJIA 4GSYA 1R1DA 1K89A 3H13A 3FCSB 4IWYA 1DU4A 3MWDB 3D71A 1QV7A 2JIZD 2I6SA 3RV4A 3G2HA 4L0CA 5CJPA 4WZBE 1LPOA 3KJNA 5BW4A 4U2CA 4YJ2B 4XLZA 4CKXA 1GU0A 2Z3WA 1MTOA 1VG8A 1P4SA 4JSTA 2WQ6A 4URZR 4I99A 3CTMA 1UC8A 3B70A 3ZU2A 1X7DA 3MVEA 4AUEA 2X0JA 3B71A 4XJSA 1RHUA 1WKCA 1JY3N 5EIAA 2VP6A 4URHA 1R9MA 5A5DA 2HWXA 1ZD3A 1P45A 2WJ4A 3C6QA 2JJYA 1TEHA 1WLSA 3C1OA 1CZNA 4DLZA 1BN6A 3QPUA 4GECA 2OFXA 1SXQA 3G13A 1A4XA 3KHTA 5K8LA 3PQ8A 4DXHA 3GDGA 2W6PA 1JPUA 2KSEA 4U1RA 3ZEIA 5D1HA 4HAWA 3MAAC 5C4MA 1WSWA 3MUEA 2ORIA 5DYYA 3G2NA 4RKRA 3Q3HA 3KQKA 3KWLA 1EUCB 2YWDA 4O02B 1GVNB 3AI7A 2XNKA 2O5RA 3JX9A 2Q5LA 2OYRA 3OE4A 2NAFA 2TRSB 3L2OB 2JD1A 3A6KA 2VYVD 5KWVA 1VDMA 2F9LA 4MA5A 3HYCA 3SBXA 1QP0A 3IMFA 2IF0A 4MGKR 3IIMA 1DAIA 3TLKA 1A1VA 2GH1A 4ZEXA 4LHWA 2QRQA 1BA2A 3JASB 1YZYA 1L5YA 1I7DA 4FPXA 3TJRA 6PFKA 1Q20A 2ZJ6A 1ZIPA 3JQ7A 4U4AA 4I3FA 1HT2E 3PQFA 4NFSA 3L1HA 4W7YA 1CETA 2ZS8A 2W90A 1W36B 2HPZA 1JFFA 1YCDA 5ITVA 3K70B 2G6BA 1J1IA 1XNQB 3D6TB 1EE1A 3D0KA 2ONCA 3PFNA 3M9BA 2R1UA 4P4SB 2L91A 1JJIA 2LBPA 3O2SB 5LXTA 3LCJA 5KOHB 3W5UA 3ZJ5A 1IEVA 2XW6A 3PRHA 3T3PB 2ZUVA 5C8VA 4RGYA 2D0IA 4N47A 5JEEA 1DHTA 3EY4A 3QBEA 4OEHA 5EJ7A 3A8TA 4BTEA 2O8CB 2ECQA 1T4GA 2BKEA 2PBZA 4F2GA 1CW5A 2XNCA 3D5EA 3ZZNA 1WUTA 5JYDA 4L72A 1VIAA 3KB8A 3MJ4A 4AY5A 1VE9A 3ZY3A 2E4UA 5EZ5A 1HG0A 2A1UA 4LW8A 2JBAB 1DWUA 4G6ZA 1ZZGA 2RI0A 4WY4A 1XAGA 4FLMA 1OQAA 2JJMA 4AUWA 3FX2A 5KTPA 1U0BB 1M74A 1VE6A 2B6NA 2NYAA 4DQ0A 4YRJA 1OH8A 3C4QA 3KVRA 1NRXA 5IBPA 1FK8A 1XAJA 3EZYA 3L9WA 1X0TA 2X8JB 2AI1A 1KZUB 2FG5A 4NPDA 4BRYA 2WDPA 4HNUA 4OGGA 3HBAA 2HF2A 3ISVA 2JGIA 3O0DA 4TV8A 1YTUA 1UP4A 5J2UA 3QU4A 3R77A 2H59A 3Q2YA 1QZZA 1NASA 4HDRA 2FDXA 2NPSD 1DIBA 2ALJA 2X5NA 2JLCA 2PUVA 5LKAA 4TTRA 4FDTA 4G56A 2CDRA 1V2GA 3MFQA 3F6YA 4DLPA 3V9PA 3C87A 4PS1A 4V1CA 4CJXA 2GZDA 2BMDA 2IS2A 4LQLA 3E0XA 3QQ5A 4KQ2A 2PXHA 1M6NA 5A71A 1ZH4A 2GEBA 1GN8A 4HGRA 3EFOB 5FEUA 2W6JH 3P5SA 1AJEA 2OYIC 5JFTA 4XX0A 1F6DA 4G89A 2E6UX 1B1AA 3B53X 3CZ4A 2R7MA 4ZK6A 4DPLA 4HQNA 2R6AA 3BULA 1ST3A 3AZPA 5KOYA 5FQOA 4F3NA 1JN0A 2YJNA 4XR4A 1H5NA 1C14A 2OG1A 3UAXA 4C43A 2WTEA 2HSEA 4R1NA 4HKZH 1YBKA 4IFDK 4MYUA 2QT9A 4FN4A 4GUAA 1PO7A 1DRKA 1CQWA 4DL9A 1WQ3A 2IEGA 3NGLA 4H7IA 3V1NA 2VP2A 4UC0A 4BNDB 1EG2A 1S3SA 3CJRA 2BEZF 1AV1A 4ZV9A 4D43A 1TA9A 1L2PA 2GM4A 1NVFA 3LW8A 3ML1A 2NTVA 4EF6A 3VU1A 3MRTA 3T7JA 1TFRA 4UKDA 3DM5A 1LQTA 5EIWA 2P7JA 4CU5A 3BMQB 3QP9A 5GJWC 1DD3A 5CDUA 4JBGA 3F4BA 2HNAA 5DO9A 1IZZA 4GPEA 4D97A 1U28A 3K53A 4MQEB 3H6HA 3ESDA 4AKEA 3IIEA 1ND6A 3LT1A 4RO0A 3QHPA 1DC7A 3M2TA 4JQ0D 1FFBA 2G07A 4XVQA 1G98A 1YBAA 3V2HA 2NT3A 3CH6A 3IV9A 1GMJA 1UMDB 3ZV6A 1IXSB 2ZI5A 3BM5A 1ORHA 3X1XA 1Y34E 1C9EA 2XCLA 1EUQA 4C2UA 4B3BA 1KI3A 2BBSA 1CY2A 4KVAA 5BVGB 1MBZA 1OX3A 4MVJH 1KEKA 3HNPA 2DPHA 1L1EA 5KSPA 4F12A 1C7EA 2D2CC 5IP5A 2IP2A 2L2QA 4KTVE 3NCHA 2F55A 2XECA 2IJGX 4KFUA 1PPJG 1JY2O 3U49A 1FF9A 3KL2A 4LX0A 4HQKA 1DJLA 4IDOA 1LWNA 1RPTA 3MQ4A 4JI8B 4EENA 3UG7A 2WAMA 5LBIA 1PJAA 2QVYX 2Y66A 4X1IA 3EXHC 1PQPA 2ZJ4A 2PH5A 1C7ZA 5G0TA 4F4UA 4EITA 1HEIA 2B21A 3Q87B 4MP6A 1VCHA 1PSWA 3KHUA 4ZYXA 1ONPA 5T4FA 2UUAB 4UNRA 4RF4A 5F7ZA 4ZJPA 1HT3A 2ADMA 1QPGA 3STVA 4K9DA 5JAZA 1KILB 1O97C 1CUXA 1DTEA 3DGFC 4LRUA 3AR4A 3CH5A 2QSZA 2V3WA 3T3DA 2PV0A 4RTSA 4UHFA 3TSYA 3E27A 3HA2A 3IOBA 3PJRA 1VGRA 4LXIA 1Y3DE 1EYZA 1PWZA 4R8SA 1D04A 3ESQA 1VSVA 3WNVA 3CN7A 3A9VA 4LSGA 1WVIA 1NVXQ 2CWWA 1E62A 1X39A 2B69A 4JU8A 4W5OA 2GTPA 3BBPA 3G59A 3C3BA 1QFJA 1JDBC 2ZAEB 1TUEA 1ZD8A 3WKDA 2DCUA 4EGFA 3C98A 2ZUFA 4Q24A 5M5BA 3SSUA 4DSNA 1GTG1 1JA0A 2VI5A 4HXYA 4IUYA 1KJWA 2A9OA 4LRWA 4CL8A 2J08A 4IO0A 5DIZA 1GXSB 5CFMA 4RKQA 3BRWD 4QZVA 4U7HA 1B2LA 4PX9A 1O94A 3ZHBA 3Q2KA 4UM9D 4EG1A 3D8BA 1IQUA 3T3MB 3DOIA 4YJHB 2C3YA 5G2OA 3MBKA 4ZEVA 1ZN8A 3A10A 4IIDA 2YFHA 5JC1A 1NPDA 1MIOB 3JVIA 4I7ZB 1IUPA 1BRMA 3VZCA 2PRJA 2C4WA 4M1QA 3HLYA 3EPHA 3QSYA 1QRSA 2CEKA 2K3RA 4O4JF 1R0YA 2G40A 3EISA 1KEPA 1MHPA 3CR8A 3L79A 3INRA 3RSSA 1GSHA 1I1HA 4KH1A 5KDOA 1BHJA 4ZOLF 3ZCSA 3DHVA 3Q10A 1LSOA 5FOTA 4MVJM 5C1PA 4GOLD 3U3ZA 4LMPA 1A69A 3C1AA 5B6PA 4PJ0H 5CD1A 3KSUA 3GRFA 3MCAA 1EX9A 2YFKA 5K99A 2CKMA 2XEXA 3F5HA 1W52X 3IPYA 4EYSA 5CITA 1DKRA 4ZAYA 1M76A 2ACWA 1AK9A 1T8UA 1OC4A 4QBHA 3WX0A 3ZBPA 4ND3A 3WMXA 1SS1A 1CY1A 1PWYE 3ZHTA 4FYVA 2JJ8A 2PCLA 3N6XA 1ZR4A 1RU3A 1UBRS 2P58A 3FOEC 2Q4RA 4XD7D 2R00C 2EAUA 1V9LA 2G1UA 3C7TA 4G01B 1CERA 1L8XA 1MCZA 2LKCA 2HTFA 1MXFA 4KFTA 4C78A 1EXNA 5IN5A 3PTAA 2NADA 4W4TA 2FW1A 2IGTA 3AF0A 3MZWB 2QRVB 1THMA 5TVGA 5I7AA 2X13A 4HX9A 4YUVA 5EJMA 3AEDC 5KLIC 2ZITA 2EFYA 1UDBA 3R75A 3H18A 1HJ0A 4CMGA 1BHO1 4YXWD 4YT5A 4HAOA 2ZAIA 4F1WA 1XTPA 3DVLA 1BDJA 3TF5A 2Q62A 2QRMA 2A4MA 3W7BA 2HSDA 4PANA 1G21A 1YMUA 3AP1A 1Z7YA 1K6MA 3T06B 1CT9A 5IUJC 4HTFB 5JEDA 3A0BH 5EWLB 1IJBA 4ODIA 2WMNB 2D5IA 5JAOA 1XTIA 4OUDB 2WUEA 5EWMA 1V3TA 5J1TB 3E22A 2X40A 1FUEA 4QYTA 1GGVA 3OX2A 2JF0A 5ANRB 2B5VA 4PN3A 3V4QA 1KOFA 1F60A 3S2ZA 3QWAA 4JUCA 5JH7F 1DIOB 1MPTA 1YRHA 3KTFA 2RH4A 1OU4A 2QT0A 1T3SA 3QKSA 1NP7A 2R4UA 2QTNA 1NTZE 5EIEA 3R5XA 3OO1A 4MN4C 2X22A 1NHGA 2CMGA 5B58C 2FV8A 1FU1A 2PUFA 4H0LC 1OY1A 4HDKA 4BX8A 1X77A 4NCXA 5JRDS 4AZVA 2HNBA 3FHTA 5ALJA 2VKTA 2UKDA 5A5VA 3B2EA 1M1NB 3FRHA 4ZOLA 3TPCA 2WT7A 2O8VA 2FW9A 1ZJ5A 3CSDA 3G8DA 1BE0A 1XKQA 1JA1A 1LDMA 2VHTA 1VPWA 3OM0A 2R8EA 1VFNA 1TVEA 3ZWDA 5TGDA 1E66A 2Y6UA 4Q4LA 1I4EB 3PQEA 3VU8A 1RP1A 3D2BA 1GGJA 3OC6A 3UATA 4NULA 3HPRA 4L5YA 2Y9ZA 2N46A 3EFEA 3RR2A 1EVZA 2H3EA 4L78A 1PV3A 2P2YA 5J58A 4IJQA 2EJTA 3IUQA 3DTVA 5KREA 3AYXB 1BFUA 3TLAA 4EFKA 3A4NA 3UJDA 4Q7JB 4KO1S 2AI3A 4CMIA 1EZZA 5FUVA 4MV6A 1NDHA 1E5LA 1VC2A 3D3EA 3FLAA 1AIPA 3B6KA 4TT3D 1OWNA 2O2YA 3HP7A 4RTRA 1WDKA 4M88A 5E3HA 1DDOA 2ZSEA 1ZGHA 3T7TA 3VPBA 2GRJA 3O6QA 2AVNA 3D8UA 4X92A 4PYRA 1YHYA 4CLHA 5EJEA 2UZ1A 2JLUA 3LC1O 1YIDA 4YR7A 4LHSA 5JH7A 1A3CA 4O4HF 4D26A 2GNPA 3F3KA 4DIEA 3FPAA 4EEZA 2I1WA 3RWBA 4I5IA 2QTFA 5T5QA 3M4JA 3FNQA 1NJ6A 4I50B 4HAZA 4AG6A 1GLVA 2FA9A 3IXMA 1Y42X 4TQGA 5CLFA 2G1KA 4OJMX 1HE2A 2XVXA 3A6LA 2E37A 4YCBA 3OE1A 3PI6A 3S2EA 3ZK9A 4TVKA 2AD5A 4LF7B 2Z9CA 3NYIA 2H89C 2EKQA 3ASVA 3CS3A 1G8SA 3GVCA 4ZQEA 1TYEB 2BEVB 4EGSA 2B25A 3MJVA 1ORIA 3VYRB 3FKSA 1N9GA 4GPTA 1VPEA 1E1NA 4HVTA 4AS1A 3N5CA 2ZIAA 1PBNA 1J1ZA 2IXBA 3I3SR 5L4LA 1K4KA 4FWTA 2AOUB 4QRHA 1MMFB 1CP2A 3DCIA 2QXTA 4P7GA 1ZUWA 2H1IA 1BEUB 4R8RA 4BFZA 2XUJA 3LBFA 3QF4A 4QTXA 1T3LA 4JOQA 4L3WA 2XMDA 3IA2A 4ZXFA 4YPCA 1HLDA 4N49A 1SFCB 1YI8A 4N0EA 5CB8A 4AXXA 4G5SA 1RKUA 5EMHA 4LGCA 3THSA 3IDSA 3P9NA 1UIRA 3PUKA 1L4LA 2B35A 4NDNE 3KYCA 1U31A 4K2AA 1NULA 3EGXB 4JAVC 3V2RA 1G63A 1RZVA 3A0UA 2WVGA 2P9FA 3ILVA 4YRQA 3AP2A 2PGNA 2WAOA 5DASA 3BFJA 5I7EA 1WULS 3UOGA 1REQB 3FUCA 3BCCE 3K0HA 4LF9B 5D87A 3F8WA 3PIRA 3OEHA 2W4QA 5APTA 3BCSA 1EVQA 1E6CA 2ONYA 5CCDA 2OQQA 4RTNA 2QA4P 4EG0A 4OGKA 4B6SA 4RZ2A 1XZBA 1ARZA 3B3JA 5AVOA 2NUTA 3BRVB 4F92B 3K2QA 5F1KA 4AN0A 4WT7A 3FCCA 4CMJA 3ZQUA 4O4HA 1RHMA 3VAZA 4C7KA 5M2QA 1T3GA 5AK6A 2HFKA 2LIPA 3NBUA 1F20A 4JV5B 2BM0A 1BCSA 2H8GA 3SG0A 2Q5OA 4LF8B 3V2GA 4UE2A 1KTIA 2X0KA 2OXCA 1JU4A 3A4LA 2B4TO 4LNUA 3Q5RA 1SQQK 3L8MA 3MD9A 3M3PA 3GWZA 1N73B 3H84A 2BEWA 1YIOA 2VUSA 1YGYA 4E07A 1ZL2A 1D2GA 1MB9A 2UWJE 1KI2A 4Q12A 3RYCA 1FTNA 5SY6A 1TUGA 3CONA 4ASWA 2FK8A 3UM9A 3C9IA 4O2BB 4WZBB 4CG2A 3A1VA 2AOWA 1J24A 3ZW7A 5TMDA 1KAEA 4P1ZA 1JEQB 1ZQ9A 5U9CA 3SFZA 1N7SD 4PC2A 3AEUB 3IP1A 2PWYA 1WEKA 4XUGB 1E6MA 1V35A 2I1KA 1P9RA 2HT1A 3GBVA 3O26A 1C9KA 3IIKA 5A3QA 4B3IA 4RIGA 1FZCB 2RGBA 2IV3A 1FBNA 3DDSA 5G3ZA 2VF2A 1JG7A 2C0PA 1V3VA 4J3FA 3WQBA 4L4SA 3I6BA 3VC1A 1BCCG 3NYRA 3DMRA 1KI1A 2WG0A 3RVKA 5IXJA 4TSKA 3IQXA 1V3UA 4CBVA 3H65A 2MOKA 2QVXX 1QRRA 1CZHA 1DADA 2VQDA 3I34X 5KJ7D 1OMOA 5C7IO 1TM2A 4NYIR 3PE6A 2R1VA 5AW5A 1VG1A 3OUZA 3UHAA 4ZAWA 2ONJA 1AKQA 4I55B 3THOA 3UAWA 4E09A 1NUUA 3I01M 2AE2A 5IU6A 4H17A 3ZHUA 3NR2A 4HD8A 1WXQA 1X8KA 4HUTA 1OE0A 1MOZA 1P7ZA 4N5MA 5KJ6A 1QC5B 2LNDA 3GV0A 1Y1QA 2EKLA 4EARA 4IIJB 2WWIA 2IYYA 2JIQA 1U8ZA 3OFVA 2K4MA 3GRPA 5IYZB 3U4DA 4JUBA 4DMRA 3HUEA 3E35A 2EG5A 2ZZMA 3GUZA 2EIHA 1TU0A 4JJ4A 4UZSA 2NTEA 2QRNA 5D8DA 4JCOA 1SQXJ 4II3A 1OLUB 2P9EA 5IG2A 5IC6A 4XYBA 4ZO8A 3AVQA 3WGUA 3D8RA 1ZOYC 1H8HA 2YN2A 4LZPA 3TUZC 2AUNA 2JLQA 1OFCX 4OQFA 2PYIA 3ZGLA 3KKMA 3SE7A 3RYTC 1SUEA 5AM4A 2DBYA 1IBKB 3KPWA 4Y3UA 4FIDA 1XCOA 3F1LA 4KXLA 4RD6A 4PSUA 2DAPA 5EPOA 1AC5A 2QBYA 3L7NA 5BMVB 1VL8A 3ZJVA 1AKWA 1L0LK 2FMFA 4EGAA 2Z6AA 1L4AD 3JXEA 2P1JA 4BRSA 5J5AA 2YQ5A 3H4MA 5BORA 3Q11A 3S8MA 5LVAA 4V39A 3L71D 1AD2A 5IM4A 3VNAA 4QOJA 3FVRA 3HB0A 2OZLA 1N7GA 1KDOA 1GL3A 4UBIA 3KJEA 1U0GA 4F38A 1BJKA 4JKOA 1M7BA 4CV0A 1L8OA 2YMYA 2XNXA 4XIFA 1WCIA 1PVOA 1S3IA 5KNBA 4L2IA 3DHWC 2RG7A 3H1AA 1BGYG 2OTJP 3JSXA 3OQPA 4HJGH 3RVLA 3JZDA 5MGNA 1G7CA 3L8ZA 1ZRTE 5EXEA 5DYNA 1E92A 4JJEA 2F67A 4R2IA 4L8YA 5ER6A 5ES3A 4P36A 3V4ZA 4C0SA 2GEKA 3BCCD 1S72P 3HH8A 1FJXA 4ASVA 3L7YA 4G8CA 4TWRA 4AQRD 2AR7A 4ZREA 4KE9A 3A3PA 5CXQA 5KTMA 1HPLA 4F0JA 4MH0R 4MI6A 4K05A 5H16A 3AIMA 4QPNA 4P7BA 5KAPA 4F5DA 1BFDA 4IZHA 5IEJA 3AM5A 1QANA 3AM3A 5LR6A 4XGRA 3RGUA 2O8BA 3JAMA 2C95A 3JARA 4AJKA 3ZNPA 2BGGA 4QATA 2JKVA 4CEIB 3N0TA 2O3JA 3W3AA 3OUUA 3X0DA 4HSEA 3B1KA 2VP3A 2V6GA 1N75A 2W2NA 3ZYZA 1V8FA 1NIJA 2GA8A 3G0HA 2RH8A 1ZP0C 1NXWA 4J94A 1FUIA 2JHFA 3TRIA 3A3YA 4Z3KA 4EGCB 5LOVF 4WKNA 4L7VA 4LTNA 3TEJA 1U80A 3U3MA 2GPAA 5D3KA 1Q0TA 1W36D 2WW8A 2FZGA 2PS1A 4BO1A 2AF3C 3QHAA 3K70D 5GOZA 3OIDA 3I72A 2Q99A 1M33A 1U2DC 3UB2A 3T1NA 3F6BX 4A6XA 1TL7C 5TSDA 5A4DA 3B38A 3EGDB 4DXAA 3HBJA 3AB3A 1SC3A 3R44A 4K46A 2VAPA 3B9BA 4KV7A 2FWIA 3KT6A 2ANBA 4NCNA 1G4UR 4D9IA 1FFSA 4EI2A 5DNWA 4YT4A 3OA2A 3D6UA 2YNMD 1CB7A 1C0EA 4ZO9A 4HDAA 3AL2A 2JEEA 3LWNA 5JJCA 3H3JA 4B2PA 4DMLA 1COWD 3HB7A 1R8SA 4HWRA 2OBNA 3QEMA 3HSSA 3CE9A 3EASA 1LLQA 1OASA 5BW6B 3JD0A 1MR3F 5A4KA 1O0SA 1PYDA 1Y5IA 5TX7A 2RCYA 3WGIA 1NXSA 2O0JA 3K2IA 1H4QA 2WJJA 3HFRA 1WMDA 4LCEA 1XQVA 1PR9A 4I4CA 1OYVA 2XX3A 1ODJA 1JEYA 3G0DA 3QYFA 5D1NA 5IVIA 2PU5A 4MLDA 1QB7A 3ACCA 3GZTB 4HO1X 1L9XA 4LE2A 1KZ7B 3HI6A 3BE5A 5CVVA 3KXKA 4MUGA 2H4JA 2XIJA 2NO6A 3QTBA 2PU7A 3CX5D 2ASVA 4RA6B 4MDYA 1PJZA 2H63A 2WJPA 2VR1A 4KXVA 1E1RD 4LTMA 3B1WA 4NP6A 4B32A 4LKRA 4DDKA 5TC4A 5B4TA 3TL3A 3FMVA 3KV1A 4Q4CA 1DQZA 1ZOIA 4EFNA 3A11A 3AY7A 1JR3A 4MW4A 3VKUA 2FPGB 2P9YA 4DANA 3DOJA 2V7VA 5JMWA 2VTDA 5LOVA 1JA9A 3CC2P 3R0JA 4R01A 4JYPA 2OAP1 1OBHA 4NLLA 3WS7A 1QLHA 2ZFCA 1DKOA 4AIRA 4DCUA 3WV5A 3JRWA 2ZRJA 4OXQA 3WDMA 1NTMG 1E3JA 4KBFA 1K4YA 1K7SN 2R5FA 1U7XA 4Z1MA 5A4AA 4B4KA 4MV1A 4AY3A 1Z4OA 2PUAA 2K88A 1VCNA 2X8BA 1NQTA 3QVKA 3I32A 4EMUA 5DNAA 1NJSA 2QD5A 3ZDZB 1VJ0A 5JISA 4KQEA 2J8ZA 2YHUA 1P84I 3FNFA 4G4IA 3T5CA 1V5EA 3SJUA 4R8LA 3CWZA 2A86A 4GPBA 1TIBA 2BTQB 3RNOA 2XNJA 1M9NA 5KJ1A 3M7IA 3AR9A 1D5WA 4A16A 4J0JA 4FONA 4W6ZA 1V1MB 3MCTA 3LCVB 1ZMBA 1T2CA 1I13A 2FMTA 1E6WA 3CWCA 3CBQA 4R3WA 4ZCIA 5B1DA 4R68A 2V4ZA 2EW8A 2YWCA 2EKPA 5K3SA 4JI3B 3KOXA 2D2IA 5BWOA 4OQYA 3ET5A 2PVCA 1BE3G 5K0JA 1P17A 4MCJA 4MITA 2ZAOA 2IKQA 4R31A 2TMKA 2BI7A 4I9FA 2YWRA 3LH5A 1EJ2A 4OI0A 2CMFA 1W93A 4G5QA 4WBNF 5TQJA 2GK6A 4NE7A 1WV0A 2ZUWA 2G3YA 4P7KA 4GYWA 2PFXA 2ZDQA 4Z8YA 2RK4A 1B76A 1P39A 4J0KA 2JZCA 221PA 4D3XA 1GPWB 1ETHA 4JUAA 5ICGA 1XYYA 3T4XA 4RJ2A 4MPTA 5AW8A 2NQTA 2WTUA 4J3JA 3FYSA 3QVUA 1NYHA 3GOHA 2JJLA 2VHJA 1U8FO 3RUCA 1W96A 4REMA 3IGFA 4WJKB 2OD9A 1FCJA 4LJ4A 1E2FA 4X45A 1Q7TA 2NU9A 4YT2A 4DE5A 1GFZA 3CX8A 3V8MA 3LLMA 1UK8A 4Y2RA 3L4FA 4KE6A 5ITWA 1WZIA 3H5TA 1AQUA 4IHQA 3R6WA 5E4YA 5A0FA 3PH0A 3BXZA 3HADA 1JTVA 4RPJA 5DLYA 3JD1A 2WTXA 3GT7A 5HIAA 3N7UA 2ORWA 4UEKA 4F9GA 5FBLB 3EZLA 4HKTA 3OU2A 1VKZA 2QR2A 1PAUA 3LUGA 4BV9A 3ZHYA 2OHGA 4F86A 1G4HA 3GDWA 1RHJA 2ZS9A 3J80A 4J0EA 4B45A 1PNRA 1T2AA 3PNBA 2XTNA 4NVRA 2FLWA 1S4XA 4RSGA 4KXFB 1JDJA 1RXYA 4QAJA 3DYVA 3NJRA 4JC8A 3ZDFA 1A9RA 3W90A 1W88A 1H0TA 1DQPA 4N4AA 2VP5A 1I6KA 1PV4A 2BFCB 3GJ6A 3OSUA 4IF6A 2C2OA 5IKEA 2XMSA 1E4VA 1X19A 2I2FA 5FWYB 3OEEA 3CLRD 3C24A 5E6UB 1GFWA 2BJWA 1A02F 4H59A 1Q2XA 4I1OA 5JXWA 1RZ3A 3E7DA 4DHWA 2QTMA 1KO4A 3V97A 2ZJYA 3EZ7A 4LPKA 2H08A 4O33A 3L4SO 5EP3A 2V97A 2JFOA 4HFNA 5EHZA 1TOAA 3UWPA 5DXAA 1QIKA 5JC8A 3HR7A 3GLIE 1IHPA 1KYVA 1UDCA 1JHPA 3PJSK 1U7JA 4U9IS 1YVRA 4MW9A 3Q7PA 4JHXA 3VOAA 4OL9A 2ECFA 4RLQA 1U1GA 2F00A 1QX8A 1YBVA 3ESBA 5EL0A 4PD4I 2WHQA 1R5LA 3GPCA 1N6HA 1KBOA 4HMOA 1YBFA 3H2IA 4C7VA 4H2DA 2F9MA 3WQQA 3BVPA 3P0HA 2QE7D 1QP7A 3BFPA 5JMOA 3C6MA 1UM9B 3E8MA 2WT4A 4INAA 3TIFA 1ADFA 4YAOA 2E75C 1TM7E 3T1TA 3C1LA 1VQ4P 4CCAA 4QL3A 5KCMA 4BVJA 1XF9A 4B3DA 4CNBA 3WUTA 2FTKE 3FLMA 4WVZA 1MT0A 1N1GA 2PA0A 4LSMA 2FY8A 1ZOOA 2EERA 5AKIA 1JY3P 1UOOA 4TWIA 3F6SA 2ZRBA 2P65A 1P2DA