3SSUA

Crystal structure of vimentin coil1a/1b fragment
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
46
structure length
46
Chain Sequence
SRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Vimentin
publication title Atomic structure of the vimentin central alpha-helical domain and its implications for intermediate filament assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 46
sequence length 46
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1160 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Vasodilator-stimulated phosphoprotein 3ssuA00
1USEA 1USDA 3S4RA 4YPCA 3SSUA 3MUDC 3QH9A 3SWKA
chains in the Genus database with same CATH superfamily
3JC22 3Q5SA 2B89A 3R2PA 4GOFA 2WSSH 2OYHC 4KJMA 3RBZA 5AVXB 2WMMA 2KNCA 3VOPA 3H25A 2KI7B 3H1HG 1FE6A 5CCHD 1KYOD 4AQRD 2D2CD 2FFDB 1KILD 2FFDA 2ZXEB 3AE3C 4OGQC 1GU5A 2Q9IA 2HG5D 5AW1B 3F89A 1SQPG 2OTJP 2PGDA 2YKOA 2YO2A 1MV8A 1N7SD 1NAFA 3L37A 1EQ7A 2FYUJ 3R4YA 3L71D 2JO1A 1HBWA 1DEBA 1M1JB 4ZNCA 1FZCB 1M1JA 1KYOE 4N6JA 2R3CA 1KILE 1HVVA 3C1LA 1VQMP 1X22A 1GTWA 3VMYA 1SQVK 1W2EA 3IAOA 1ZR4A 1N2DC 2BEZF 3EFGA 3TGUG 3BRVB 1LJ2A 1DH3A 3TNUB 1FOSF 3HRNA 1MUUA 5KTBA 1WMKA 3TNUA 5APVA 3TYYA 1S72P 1PP9G 2E74C 3PHLA 2OYOA 2KXPB 1OVUA 3VP8A 2K1AA 1L0LD 1L4AD 5B5EH 2WZ7A 1M1KQ 4Z1MH 1FZGA 2O1JA 4EDFA 4JYCA 1JY3P 2IBZD 2OYIC 3AEGC 1LP1B 2KK7A 1HWTC 4IFFA 5B5EE 1FDOA 4AUWA 2R3SA 3L74J 1L0LE 1BGYG 3BCCD 2M8RA 1ZLLA 2J59M 2A45G 1NTMD 3M0DA 1BE3G 1PL5A 1NOHA 5KKZC 3TK1A 2IBZE 4BRYB 1LT9B 3AE9C 4YXDC 1VQ8P 1LT9A 4GIFA 2Z5HA 4UB6H 3L73J 2WSFJ 3L70J 4H0LD 4C46A 1NU1J 3LIEA 1FZAA 2NRGA 5APQA 1ZP0C 1KC8Q 2O1KA 3BCCE 2YIUC 2HYNA 3MIWA 3H1LJ 4JYBA 1VF5B 1NTME 2XU6A 5CCGD 1JM0A 3VYIA 2E5YA 4DOJA 3H6PA 1JY2P 1CSBA 2A06D 3EFFK 2G8YA 1S2EA 3GMAA 3PLNA 5TJHA 2QRXA 3HE5A 5KJ7D 3GW6A 3P8MC 2K3RA 2O01N 4PV1D 3RL0D 2W6AA 1GZLA 3W68A 2E75C 4W7ZA 3H1JG 5KLVJ 1EXJA 3P8CD 1LTJC 3CWBG 2HPCB 1SFCC 4I6MC 2KUBA 1BCCD 1M90Q 2E76C 2G3AA 4AYCA 1KQSO 3FXDA 2A06E 1KTMA 5TISE 2WSEH 3I56P 2O01J 3M06A 3H1KG 1HJ0A 2WPQA 3CCVP 2NZ2A 1IJDB 2M5AB 3MHVA 2HODB 2KB7P 1PV3A 2M5AA 2R44A 1Q2NA 1EZVI 2HODA 3A2AA 3B8EB 3P8CE 2R32A 5CCHA 2D2CB 3VN0A 1BCCE 1KILA 3CC4P 1J1DC 1YJ9P 2JR8A 3CCQP 5APWA 1NTKK 1SQPD 1YTZT 3CX5H 1LGHB 1RHZB 4WWIA 1N7SA 3HE4A 1SQBJ 1YQ4C 3RK2C 3PH0A 4K3AA 2P1JA 2KZIA 2QG4A 1RQUA 2YO3A 2BASA 2ZT9C 1VQPP 2QJYC 3OA7A 3A5TA 3TF5A 2ZYAA 2JWAA 3KZIH 3C8VA 2QE7H 3LW5H 2W8ZA 1SQPE 2LR2A 4GOEA 2Q6QA 3V4WA 2FXPA 3TGUD 1AVOA 3PTZA 4L75A 1RE3A 3MGNA 5KLIB 1YITP 1JCCA 1PP9D 3FX0A 1VPCA 4IFDK 1FDMA 3AEDC 3CCSP 3KZIE 1LTJA 3N7NA 4A7PA 1L4AB 1R5LA 1L4AA 1KQFB 4DZOA 1M57D 1PIXA 2GM4A 1L0NJ 1N8RQ 5GTHE 3L74G 1R8EA 3TGUE 3HD7D 3V5BA 2YXQB 1VQ4P 3EQ2A 1SQXK 1BSHA 3AE7C 1PP9E 3CMAP 4I1LA 3I55P 2AEMA 1SQPK 1EDKA 1OVRA 3AEAC 3L75D 1DD3A 1FZBA 3RK3D 4O9BA 2FFDC 3D71A 5CBNA 1Q7YQ 1IO4A 3A3YB 2A45H 3AE6C 4ZKPA 2PFXA 4U3FJ 1G1IA 3H1LG 1DIPA 1NTZJ 1SQQJ 2B87B 4H0LB 1LTAC 2N1TD 1OX3A 2B87A 1LTGC 1CI6B 5E79H 3S9OA 1CI6A 2LKMA 1NTKG 1GD2E 4I7ZB 3QWOC 3VMAA 3AECC 3P32A 4NPFX 3RK3E 1W2BO 1M1JC 1VF5D 3L75J 1KYOI 3AEBC 2OTLP 5KAFH 2KS1A 5CCGA 1OIPA 5KLVG 3USSA 1LWUB 4PJ0E 5E79E 1LWUA 1K05A 3A7OA 4BXLA 3T97B 3T97A 4W7YA 5KJ7A 4DJGA 1SQVD 2FY8A 1LTIC 1FAVA 1PPJG 1L2PA 3BRTB 3TSIA 5KAFE 3H1JD 2PP6A 1OMIA 3U1CA 1GL2B 1MFTA 4C7RA 1U57A 2I1KA 3CXHH 1NJIQ 3MTUE 3QH9A 2POHA 1QGKB 3BATA 3E7KA 3KHUA 1WRGA 1P84H 4LC1A 1BSNA 3ZDMA 2ZVNB 2M0BA 1FC2C 5AVRB 2QJKB 1SQVE 3H1KD 1Q81Q 3C9IA 1X8YA 2BCCG 1KQGB 2WSCJ 3H1JE 1GW3A 3CWBE 2Q3EA 1SQXG 3CL3D 5AVSB 1QEXA 1EXIA 1RE4A 1JY3O 3P7KA 2CK3H 4RKUJ 5KAIH 4GODA 1OW8A 1NGMB 3M0DC 4H44B 3N4XA 1PGJA 1IFIA 2Y0EA 2QM8A 1P84E 1YYCA 2N9YB 2H8PD 1RF0A 3SWFA 3M9QA 2IBZI 1RY3A 1LT9C 4TLFA 3MP7B 2SPZA 2JWDA 3L72G 3H1KE 1NKZB 1EDJA 3A0BH 3CMEP 1KMIZ 4W80A 4QMAA 1FZCA 4L73A 4JBZA 3H1ID 1Q86Q 4JQ0D 2QIWA 5DJUB 1Z56A 2H89C 3LIDA 3A0BE 1HH0A 4U7JA 4TT3H 3D6YA 1OWAA 2KIKA 1DD4A 1NYHA 1YQ3C 2E42A 1NO4A 3L71J 3GF7A 2XZRA 1N73B 1LTTC 5AW9B 3WUTA 2DW3A 1URQD 1JY2O 3H1IE 1ZW0A 4B86A 1RF1B 5H2FH 5K5GB 3IR9A 1DEEG 1SFCD 3HD7B 4EIJA 2E76D 3CCRP 1LP1A 2FYUK 1SS1A 2R5BA 2P58A 1HF9A 3AE1C 3G3ZA 1NTZG 4K35A 2JP3A 2WITA 1GMJA 3FXEA 3Q5RA 3RK3B 1T2KD 5H2FE 4KT0J 1VDFA 5AVVB 5CCHC 3G4SP 1L0LJ 2FKWB 3CCUP 1KILC 1QVGO 2QSIA 3WU2H 4PD4D 1HUCA 4YPCA 3Q3DA 1IFJA 1FU1A 1AA0A 3AEFC 4BRYA 4PD4H 2KP8A 1JNMA 1AV1A 5M1BA 2N1TB 2OQQA 1N7SC 2N1TA 1NTKD 1KFMA 3HUSB 3IFMA 3HUSA 4D6TD 2WPVB 2WPSA 4HKZH 1YIJP 2P2UA 1NH4A 3BCCJ 2W83C 3FWLA 3CCJP 5BVZA 3SWKA 1NTMJ 1JY2N 3M9BA 4PD4E 4UB6E 2KSJA 2YMKA 3CPWO 4ZMDA 1QVFO 3II6A 5APUA 1JO5A 1NTKE 3MUDA 2K37A 1RE3C 4H13D 3SSUA 5AW2B 4UB8H 4D6TE 4RESB 3B4SA 4OH8B 4WY4D 2AXTH 3BVHA 1GL2D 2HPCA 1Y9BA 4L76A 1L4AC 4GKGA 1KORA 2KOGA 2ZFCA 2WWWA 2Z4EA 1AQTA 5AW8B 3F5HA 1NU1K 4UB8E 4YXWH 1GK6A 2L5GB 1QL1A 3NXSA 2ZXXA 1PPJE 3RL0g 2Y0CA 2BCCD 3H1HD 1KB9D 2UWJE 3RBXA 4NPEA 1A02J 1D7MA 2NPSD 2W6BA 5GTIH 1IK7A 2FYUG 2IYPA 1KB9H 1ZR2A 1SQXD 2XKMA 4IOIH 2M3EA 3V2QA 1ZRTD 3E1IA 1BCCJ 4JPZB 3CX5D 4L74A 4H44D 3NMDA 3E1RA 1FZEA 2WSEJ 3FGAD 2C9NY 2W6JH 2V4HA 1PFIA 1QLED 3IF4A 3ABVC 2E5TA 2Z5IA 4H0LC 3PP5A 1YJWP 1JTHB 3WUUA 2BCCE 3H1HE 1KB9E 1OXZA 5KLVK 1YI2P 4I7ZC 1SQXE 4Y99B 3AE8C 1K73Q 1ZRTE 3CX5E 3L71G 1PZQA 2YMYA 2A45I 1K8AQ 5CCGC 3OJAB 1SQPJ 1HGZA 3KXDA 1AVYA 1LWUC 3L72E 3B5ND 3NTNA 5KJ7C 1K9MQ 3VMZA 1RQVA 2QJPC 3RL0C 4PV1C 1VQKP 2YKPA 2ZJSE 2QEXP 1JCDA 1Q90D 1JOCA 1URQB 1FBMA 1NVOA 3LW5J 1URQA 3OW2O 1LTBC 1UIIA 2LXBA 1OZHA 3I5CA 5AVZB 1SFCB 3CCMP 1R5SA 3V2PA 4RJTA 2E76B 4N3YB 3TGUJ 3L36A 1SQBK 2ZVOB 2H7HA 5CBOA 5BU5A 2KLUA 2ZAEB 1PP9J 2Y0DA 2FYZA 3L73G 3L70G 2J58A 1BGYD 1USDA 1NU1G 2YKQA 3Q1MA 1T3UA 4JF7A 3GF3A 1XTCC 5L8RJ 1BE3D 4HJGH 1FDIA 1RE4C 5C39A 5AVYB 1Y47A 1IC2A 3UIAA 4OGQD 1P84I 3S1KA 1RF0C 1NTMG 2HFED 5AW3B 1VQOP 2XDJA 1NTZE 1SP4A 2W90A 1BGYE 1CW5A 1FZCC 3RK2B 3K5BA 1BE3E 3CD6P 3WMM0 2W27A 2ZT9B 1M7LA 1SVFA 2QJYB 1L0NK 2C0XA 2IZ1A 2RN0A 2ITAA 1VQNP 4OWFA 2GUSA 3ITKA 3CI9A 1PGQA 3GHGB 2XV5A 5AW6B 3GHGA 4H13B 2V7QH 3CC2P 2CPBA 2A06G 1FZFA 1FS0E 2OGUA 1WT6A 4WY4B 1GW4A 3SFDC 4WY4A 1X9VA 1X79B 3CWBD 3CXHD 1TU3F 3L35A 4IFMA 1OVVA 1GL2A 2E74D 1PGPA 1VQ6P 1P84D 1NTZK 1SQQK 3AE4C 2ZYDA 2YNYA 3HD7C 3U59A 1N7LA 2QM7A 2JEEA 4C7NB 2L91A 3A0HH 1MZ9A 1SQVJ 3CCLP 2NPSB 1S3JA 1FJKA 2AXCA 2NPSA 3CXHE 2FYUD 1SQBG 3H1JJ 1IFDA 4YTPC 2KNCB 3CWBJ 4M3LA 3RK3C 1NHLA 1W5CE 4MN4C 1MKMA 4CPGA 1ZMEC 2FYNB 1KYOH 4ZKUA 3A0HE 1FOSE 1PGOA 1IFPA 5CJ0A 1T3JA 2N1TC 3H1KJ 1EDLA 3KQGA 2GUVA 2FYUE 3HUSC 5KAIE 5APYA 2J5UA 1S5LH 1VF5C 2QVAA 5AVWB 2WT7B 2WT7A 4PD4I 2IDBA 4WBAA 5AVTB 2N9BA 3B5NB 1J1EB 1AJYA 3B5NA 1L0NG 2R5DA 1GU4A 2IPPA 3MUDC 2IFMA 2RKLA 2PRRA 2RMZA 1S5LE 2XNXA 1N73A 1GDTA 4N78D 3IN6A 3L71E 1QL2A 1YBKA 1JY3N 1EZVG 2E75D 1NKNA 2RH0A 1RF1A 3L4FA 3H1IJ 3V2RA 1S1CX 2KSEA 3L74D 4R4LA 1ZXGA 2FBWC 3HD7A 2P10A 1J2JB 2FXOA 1VQ9P 3V2NA 3JCUH 3O6QB 4HH2A 4U3FG 2OTKE 3O6QA 4RO0A 1YJNP 1KFNA 1N86A 1SQQG 2OYHB 3L73D 3L70D 1Y8AA 2OYHA 4N78E 2B88A 3VMXA 1NU1D 2WSFH 2VRSA 2WPRA 1LTSC 2D2CC 2Y9YA 1VQ5P 1DX7A 4EYYQ 3L74E 1QX8A 5EFWB 1KN7A 3M0AA 3JCUE 3H1LD 2BEQD 4R4MA 3L75G 1G1JA 1BDCA 3CLQA 1U7JA 4OGQB 3CCEP 3JSVC 2IYOA 2I8DA 1GK4A 3PJSK 3KPEA 1VQLP 2WQYC 3L73E 2QA4P 3L70E 1JB0J 4OVNF 1H0TB 1H0TA 1NU1E 1KB9I 2XNDH 2KLVA 3AE2C 3WU2E 3RK2D 1JUNA 4Y99C 1ZOYC 2ZT9D 1XTGB 2PAJA 3G9RA 3S4RA 3H1LE 3CX5I 5KLVD 3KYQA 2MKVA 2H43A 3M9HA 2KYVA 4GDOA 4WVZA 5AVQB 5CMZA 1E5WA 1NAYA 1NTKJ 5KLIC 3RGUA 1SLQA 1PPJD 3CC7P 1EC5A 1HTLC 1G2CB 3OAKA 4D6TJ 4XE5B 2Y9ZA 3HE5B 1G2CA 3SWYA 1L0LK 1OFCX 5AVUB 1KZUB 2E74B 5TISH 5DJTB 2O01H 1E79H 1SQVG 1URQC 5CHXA 5KLVE 1KD1Q 4KHXA 2CPSA 3VTPC 5APSA 1FJPA 2MJZA 1HJBA 2Q7CA 1YHQP 1JMBA 3G6EP 4ASWA 2OYIB 1H88A 2OYIA 1IZNB 2AXTE 2O3JA 3V4QA 1JMMA 1IK9A 1OW6A 1SQBD 1VQ7P 1NTMK 1X0TA 3TDKA 1T2KC 4GT1A 5APTA 4XA4A 2HLOA 3NFQA 3V6IA 1USEA 4EI2A 4XFJA 2IX7C 1LT1A 5KKZB 1KILB 3PRJA 1YTZI 1UIXA 3L72D 2ZYGA 5APXA 2C9LY 3AE5C 5GTIE 4DT0A 1H89A 1JTHA 2LXCB 1N7SB 4EOTA 2BCCJ 3H1HJ 3HTKB 1SQBE 3B71A 2K88A 4BWNA 2WVRA 3HTKA 3HE4B 1ZV8A 1SQXJ 1A02F 2YIUB 2P67A 3AEEC 1NWQA 1BDDA 2JJLA 2C0WA 1IFMA 5B66H 3H1IG 1L0ND 2I1JA 3L72J 4IL6X 1Q82Q 3GHGC 1H8AA 5AW7B 4H13C 3H32B 5GTHH 4WY4C 3H32A 1CZQA 2E75B 1T6AA 3D6ZA 1EZVD 1GL2C 1EDIA 3O8ZA 3BASA 1LTJB 2P7JA 5B66E 1SFCA 4LGDE 2IZ0A 1L0LG 2Q3IA 1L0NE 4I2LC 4ASVA 3M91A 4HYTB 2JDIH 4U3FD 1JEKA 3GLMA 2QJKC 2IBZG 2M3BA 5AW5B 1NTZD 1SQQD 1K04A 4WB4A 2E43A 2JKVA 2NPSC 2Q1KA 3KDPB 1EZVE 3CXHI 4DCKA 1RH5B 3W67A 2B9BA 4H44C 3SFEC 3BCCG 3D70A 1J1DB 1KQLA 1KV4A 2KZJA 1AQ5A 4U3FE 2AEJA 2FYNC 1SQQE 3FWNA 4LLHA 2YXRB 2IFNA 5AW0B 1BGYJ 4PJ0H 1U7MA 2K9YA 1BE3J 1AFOA 1IFNA 2H88C 4Y28J 2WTYA 1OW7A 1MFZA 4D6TG 1LNQA 3L75E 2K9JB 1S5LX 3EWKA 3VP9A 2K9JA 2FXMA 4IL6H 2HR3A 1ZN5A 3WUVA 2KS1B 1M56D 1S9KD 3B5NC 1J1EC 4HB1A 2GA1A 1T8ZA 3U1AA 1M8OB 1S4XA 3GG2A 5CJ4A 1N73C 3G71P 3MD0A 3Q2YA 2QJPB 3RL0B 4PV1B 1HGVA 2AEFA 4IL6E 4NPDA 1RF1C 5AW4B 5BU8B 3MZWB 2WSCH 1VL2A 1BCCG 2OARA 1S9KE 3Q5PA 2V7QJ 4C7NA 2Q5UA
chains in the Genus database with same CATH topology
1USEA 1USDA 3S4RA 4YPCA 3SSUA 3MUDC 3QH9A 3SWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USE A;  1USD A;  3S4R A;  4YPC A;  3SSU A;  3MUD C;  3QH9 A;  3SWK A; 
#chains in the Genus database with same CATH topology
 3JC2 2;  3Q5S A;  2B89 A;  3R2P A;  4GOF A;  2WSS H;  2OYH C;  4KJM A;  3RBZ A;  5AVX B;  2WMM A;  2KNC A;  3VOP A;  3H25 A;  2KI7 B;  3H1H G;  1FE6 A;  5CCH D;  1KYO D;  4AQR D;  2D2C D;  2FFD B;  1KIL D;  2FFD A;  2ZXE B;  3AE3 C;  4OGQ C;  1GU5 A;  2Q9I A;  2HG5 D;  5AW1 B;  3F89 A;  1SQP G;  2OTJ P;  2PGD A;  2YKO A;  2YO2 A;  1MV8 A;  1N7S D;  1NAF A;  3L37 A;  1EQ7 A;  2FYU J;  3R4Y A;  3L71 D;  2JO1 A;  1HBW A;  1DEB A;  1M1J B;  4ZNC A;  1FZC B;  1M1J A;  1KYO E;  4N6J A;  2R3C A;  1KIL E;  1HVV A;  3C1L A;  1VQM P;  1X22 A;  1GTW A;  3VMY A;  1SQV K;  1W2E A;  3IAO A;  1ZR4 A;  1N2D C;  2BEZ F;  3EFG A;  3TGU G;  3BRV B;  1LJ2 A;  1DH3 A;  3TNU B;  1FOS F;  3HRN A;  1MUU A;  5KTB A;  1WMK A;  3TNU A;  5APV A;  3TYY A;  1S72 P;  1PP9 G;  2E74 C;  3PHL A;  2OYO A;  2KXP B;  1OVU A;  3VP8 A;  2K1A A;  1L0L D;  1L4A D;  5B5E H;  2WZ7 A;  1M1K Q;  4Z1M H;  1FZG A;  2O1J A;  4EDF A;  4JYC A;  1JY3 P;  2IBZ D;  2OYI C;  3AEG C;  1LP1 B;  2KK7 A;  1HWT C;  4IFF A;  5B5E E;  1FDO A;  4AUW A;  2R3S A;  3L74 J;  1L0L E;  1BGY G;  3BCC D;  2M8R A;  1ZLL A;  2J59 M;  2A45 G;  1NTM D;  3M0D A;  1BE3 G;  1PL5 A;  1NOH A;  5KKZ C;  3TK1 A;  2IBZ E;  4BRY B;  1LT9 B;  3AE9 C;  4YXD C;  1VQ8 P;  1LT9 A;  4GIF A;  2Z5H A;  4UB6 H;  3L73 J;  2WSF J;  3L70 J;  4H0L D;  4C46 A;  1NU1 J;  3LIE A;  1FZA A;  2NRG A;  5APQ A;  1ZP0 C;  1KC8 Q;  2O1K A;  3BCC E;  2YIU C;  2HYN A;  3MIW A;  3H1L J;  4JYB A;  1VF5 B;  1NTM E;  2XU6 A;  5CCG D;  1JM0 A;  3VYI A;  2E5Y A;  4DOJ A;  3H6P A;  1JY2 P;  1CSB A;  2A06 D;  3EFF K;  2G8Y A;  1S2E A;  3GMA A;  3PLN A;  5TJH A;  2QRX A;  3HE5 A;  5KJ7 D;  3GW6 A;  3P8M C;  2K3R A;  2O01 N;  4PV1 D;  3RL0 D;  2W6A A;  1GZL A;  3W68 A;  2E75 C;  4W7Z A;  3H1J G;  5KLV J;  1EXJ A;  3P8C D;  1LTJ C;  3CWB G;  2HPC B;  1SFC C;  4I6M C;  2KUB A;  1BCC D;  1M90 Q;  2E76 C;  2G3A A;  4AYC A;  1KQS O;  3FXD A;  2A06 E;  1KTM A;  5TIS E;  2WSE H;  3I56 P;  2O01 J;  3M06 A;  3H1K G;  1HJ0 A;  2WPQ A;  3CCV P;  2NZ2 A;  1IJD B;  2M5A B;  3MHV A;  2HOD B;  2KB7 P;  1PV3 A;  2M5A A;  2R44 A;  1Q2N A;  1EZV I;  2HOD A;  3A2A A;  3B8E B;  3P8C E;  2R32 A;  5CCH A;  2D2C B;  3VN0 A;  1BCC E;  1KIL A;  3CC4 P;  1J1D C;  1YJ9 P;  2JR8 A;  3CCQ P;  5APW A;  1NTK K;  1SQP D;  1YTZ T;  3CX5 H;  1LGH B;  1RHZ B;  4WWI A;  1N7S A;  3HE4 A;  1SQB J;  1YQ4 C;  3RK2 C;  3PH0 A;  4K3A A;  2P1J A;  2KZI A;  2QG4 A;  1RQU A;  2YO3 A;  2BAS A;  2ZT9 C;  1VQP P;  2QJY C;  3OA7 A;  3A5T A;  3TF5 A;  2ZYA A;  2JWA A;  3KZI H;  3C8V A;  2QE7 H;  3LW5 H;  2W8Z A;  1SQP E;  2LR2 A;  4GOE A;  2Q6Q A;  3V4W A;  2FXP A;  3TGU D;  1AVO A;  3PTZ A;  4L75 A;  1RE3 A;  3MGN A;  5KLI B;  1YIT P;  1JCC A;  1PP9 D;  3FX0 A;  1VPC A;  4IFD K;  1FDM A;  3AED C;  3CCS P;  3KZI E;  1LTJ A;  3N7N A;  4A7P A;  1L4A B;  1R5L A;  1L4A A;  1KQF B;  4DZO A;  1M57 D;  1PIX A;  2GM4 A;  1L0N J;  1N8R Q;  5GTH E;  3L74 G;  1R8E A;  3TGU E;  3HD7 D;  3V5B A;  2YXQ B;  1VQ4 P;  3EQ2 A;  1SQX K;  1BSH A;  3AE7 C;  1PP9 E;  3CMA P;  4I1L A;  3I55 P;  2AEM A;  1SQP K;  1EDK A;  1OVR A;  3AEA C;  3L75 D;  1DD3 A;  1FZB A;  3RK3 D;  4O9B A;  2FFD C;  3D71 A;  5CBN A;  1Q7Y Q;  1IO4 A;  3A3Y B;  2A45 H;  3AE6 C;  4ZKP A;  2PFX A;  4U3F J;  1G1I A;  3H1L G;  1DIP A;  1NTZ J;  1SQQ J;  2B87 B;  4H0L B;  1LTA C;  2N1T D;  1OX3 A;  2B87 A;  1LTG C;  1CI6 B;  5E79 H;  3S9O A;  1CI6 A;  2LKM A;  1NTK G;  1GD2 E;  4I7Z B;  3QWO C;  3VMA A;  3AEC C;  3P32 A;  4NPF X;  3RK3 E;  1W2B O;  1M1J C;  1VF5 D;  3L75 J;  1KYO I;  3AEB C;  2OTL P;  5KAF H;  2KS1 A;  5CCG A;  1OIP A;  5KLV G;  3USS A;  1LWU B;  4PJ0 E;  5E79 E;  1LWU A;  1K05 A;  3A7O A;  4BXL A;  3T97 B;  3T97 A;  4W7Y A;  5KJ7 A;  4DJG A;  1SQV D;  2FY8 A;  1LTI C;  1FAV A;  1PPJ G;  1L2P A;  3BRT B;  3TSI A;  5KAF E;  3H1J D;  2PP6 A;  1OMI A;  3U1C A;  1GL2 B;  1MFT A;  4C7R A;  1U57 A;  2I1K A;  3CXH H;  1NJI Q;  3MTU E;  3QH9 A;  2POH A;  1QGK B;  3BAT A;  3E7K A;  3KHU A;  1WRG A;  1P84 H;  4LC1 A;  1BSN A;  3ZDM A;  2ZVN B;  2M0B A;  1FC2 C;  5AVR B;  2QJK B;  1SQV E;  3H1K D;  1Q81 Q;  3C9I A;  1X8Y A;  2BCC G;  1KQG B;  2WSC J;  3H1J E;  1GW3 A;  3CWB E;  2Q3E A;  1SQX G;  3CL3 D;  5AVS B;  1QEX A;  1EXI A;  1RE4 A;  1JY3 O;  3P7K A;  2CK3 H;  4RKU J;  5KAI H;  4GOD A;  1OW8 A;  1NGM B;  3M0D C;  4H44 B;  3N4X A;  1PGJ A;  1IFI A;  2Y0E A;  2QM8 A;  1P84 E;  1YYC A;  2N9Y B;  2H8P D;  1RF0 A;  3SWF A;  3M9Q A;  2IBZ I;  1RY3 A;  1LT9 C;  4TLF A;  3MP7 B;  2SPZ A;  2JWD A;  3L72 G;  3H1K E;  1NKZ B;  1EDJ A;  3A0B H;  3CME P;  1KMI Z;  4W80 A;  4QMA A;  1FZC A;  4L73 A;  4JBZ A;  3H1I D;  1Q86 Q;  4JQ0 D;  2QIW A;  5DJU B;  1Z56 A;  2H89 C;  3LID A;  3A0B E;  1HH0 A;  4U7J A;  4TT3 H;  3D6Y A;  1OWA A;  2KIK A;  1DD4 A;  1NYH A;  1YQ3 C;  2E42 A;  1NO4 A;  3L71 J;  3GF7 A;  2XZR A;  1N73 B;  1LTT C;  5AW9 B;  3WUT A;  2DW3 A;  1URQ D;  1JY2 O;  3H1I E;  1ZW0 A;  4B86 A;  1RF1 B;  5H2F H;  5K5G B;  3IR9 A;  1DEE G;  1SFC D;  3HD7 B;  4EIJ A;  2E76 D;  3CCR P;  1LP1 A;  2FYU K;  1SS1 A;  2R5B A;  2P58 A;  1HF9 A;  3AE1 C;  3G3Z A;  1NTZ G;  4K35 A;  2JP3 A;  2WIT A;  1GMJ A;  3FXE A;  3Q5R A;  3RK3 B;  1T2K D;  5H2F E;  4KT0 J;  1VDF A;  5AVV B;  5CCH C;  3G4S P;  1L0L J;  2FKW B;  3CCU P;  1KIL C;  1QVG O;  2QSI A;  3WU2 H;  4PD4 D;  1HUC A;  4YPC A;  3Q3D A;  1IFJ A;  1FU1 A;  1AA0 A;  3AEF C;  4BRY A;  4PD4 H;  2KP8 A;  1JNM A;  1AV1 A;  5M1B A;  2N1T B;  2OQQ A;  1N7S C;  2N1T A;  1NTK D;  1KFM A;  3HUS B;  3IFM A;  3HUS A;  4D6T D;  2WPV B;  2WPS A;  4HKZ H;  1YIJ P;  2P2U A;  1NH4 A;  3BCC J;  2W83 C;  3FWL A;  3CCJ P;  5BVZ A;  3SWK A;  1NTM J;  1JY2 N;  3M9B A;  4PD4 E;  4UB6 E;  2KSJ A;  2YMK A;  3CPW O;  4ZMD A;  1QVF O;  3II6 A;  5APU A;  1JO5 A;  1NTK E;  3MUD A;  2K37 A;  1RE3 C;  4H13 D;  3SSU A;  5AW2 B;  4UB8 H;  4D6T E;  4RES B;  3B4S A;  4OH8 B;  4WY4 D;  2AXT H;  3BVH A;  1GL2 D;  2HPC A;  1Y9B A;  4L76 A;  1L4A C;  4GKG A;  1KOR A;  2KOG A;  2ZFC A;  2WWW A;  2Z4E A;  1AQT A;  5AW8 B;  3F5H A;  1NU1 K;  4UB8 E;  4YXW H;  1GK6 A;  2L5G B;  1QL1 A;  3NXS A;  2ZXX A;  1PPJ E;  3RL0 g;  2Y0C A;  2BCC D;  3H1H D;  1KB9 D;  2UWJ E;  3RBX A;  4NPE A;  1A02 J;  1D7M A;  2NPS D;  2W6B A;  5GTI H;  1IK7 A;  2FYU G;  2IYP A;  1KB9 H;  1ZR2 A;  1SQX D;  2XKM A;  4IOI H;  2M3E A;  3V2Q A;  1ZRT D;  3E1I A;  1BCC J;  4JPZ B;  3CX5 D;  4L74 A;  4H44 D;  3NMD A;  3E1R A;  1FZE A;  2WSE J;  3FGA D;  2C9N Y;  2W6J H;  2V4H A;  1PFI A;  1QLE D;  3IF4 A;  3ABV C;  2E5T A;  2Z5I A;  4H0L C;  3PP5 A;  1YJW P;  1JTH B;  3WUU A;  2BCC E;  3H1H E;  1KB9 E;  1OXZ A;  5KLV K;  1YI2 P;  4I7Z C;  1SQX E;  4Y99 B;  3AE8 C;  1K73 Q;  1ZRT E;  3CX5 E;  3L71 G;  1PZQ A;  2YMY A;  2A45 I;  1K8A Q;  5CCG C;  3OJA B;  1SQP J;  1HGZ A;  3KXD A;  1AVY A;  1LWU C;  3L72 E;  3B5N D;  3NTN A;  5KJ7 C;  1K9M Q;  3VMZ A;  1RQV A;  2QJP C;  3RL0 C;  4PV1 C;  1VQK P;  2YKP A;  2ZJS E;  2QEX P;  1JCD A;  1Q90 D;  1JOC A;  1URQ B;  1FBM A;  1NVO A;  3LW5 J;  1URQ A;  3OW2 O;  1LTB C;  1UII A;  2LXB A;  1OZH A;  3I5C A;  5AVZ B;  1SFC B;  3CCM P;  1R5S A;  3V2P A;  4RJT A;  2E76 B;  4N3Y B;  3TGU J;  3L36 A;  1SQB K;  2ZVO B;  2H7H A;  5CBO A;  5BU5 A;  2KLU A;  2ZAE B;  1PP9 J;  2Y0D A;  2FYZ A;  3L73 G;  3L70 G;  2J58 A;  1BGY D;  1USD A;  1NU1 G;  2YKQ A;  3Q1M A;  1T3U A;  4JF7 A;  3GF3 A;  1XTC C;  5L8R J;  1BE3 D;  4HJG H;  1FDI A;  1RE4 C;  5C39 A;  5AVY B;  1Y47 A;  1IC2 A;  3UIA A;  4OGQ D;  1P84 I;  3S1K A;  1RF0 C;  1NTM G;  2HFE D;  5AW3 B;  1VQO P;  2XDJ A;  1NTZ E;  1SP4 A;  2W90 A;  1BGY E;  1CW5 A;  1FZC C;  3RK2 B;  3K5B A;  1BE3 E;  3CD6 P;  3WMM 0;  2W27 A;  2ZT9 B;  1M7L A;  1SVF A;  2QJY B;  1L0N K;  2C0X A;  2IZ1 A;  2RN0 A;  2ITA A;  1VQN P;  4OWF A;  2GUS A;  3ITK A;  3CI9 A;  1PGQ A;  3GHG B;  2XV5 A;  5AW6 B;  3GHG A;  4H13 B;  2V7Q H;  3CC2 P;  2CPB A;  2A06 G;  1FZF A;  1FS0 E;  2OGU A;  1WT6 A;  4WY4 B;  1GW4 A;  3SFD C;  4WY4 A;  1X9V A;  1X79 B;  3CWB D;  3CXH D;  1TU3 F;  3L35 A;  4IFM A;  1OVV A;  1GL2 A;  2E74 D;  1PGP A;  1VQ6 P;  1P84 D;  1NTZ K;  1SQQ K;  3AE4 C;  2ZYD A;  2YNY A;  3HD7 C;  3U59 A;  1N7L A;  2QM7 A;  2JEE A;  4C7N B;  2L91 A;  3A0H H;  1MZ9 A;  1SQV J;  3CCL P;  2NPS B;  1S3J A;  1FJK A;  2AXC A;  2NPS A;  3CXH E;  2FYU D;  1SQB G;  3H1J J;  1IFD A;  4YTP C;  2KNC B;  3CWB J;  4M3L A;  3RK3 C;  1NHL A;  1W5C E;  4MN4 C;  1MKM A;  4CPG A;  1ZME C;  2FYN B;  1KYO H;  4ZKU A;  3A0H E;  1FOS E;  1PGO A;  1IFP A;  5CJ0 A;  1T3J A;  2N1T C;  3H1K J;  1EDL A;  3KQG A;  2GUV A;  2FYU E;  3HUS C;  5KAI E;  5APY A;  2J5U A;  1S5L H;  1VF5 C;  2QVA A;  5AVW B;  2WT7 B;  2WT7 A;  4PD4 I;  2IDB A;  4WBA A;  5AVT B;  2N9B A;  3B5N B;  1J1E B;  1AJY A;  3B5N A;  1L0N G;  2R5D A;  1GU4 A;  2IPP A;  3MUD C;  2IFM A;  2RKL A;  2PRR A;  2RMZ A;  1S5L E;  2XNX A;  1N73 A;  1GDT A;  4N78 D;  3IN6 A;  3L71 E;  1QL2 A;  1YBK A;  1JY3 N;  1EZV G;  2E75 D;  1NKN A;  2RH0 A;  1RF1 A;  3L4F A;  3H1I J;  3V2R A;  1S1C X;  2KSE A;  3L74 D;  4R4L A;  1ZXG A;  2FBW C;  3HD7 A;  2P10 A;  1J2J B;  2FXO A;  1VQ9 P;  3V2N A;  3JCU H;  3O6Q B;  4HH2 A;  4U3F G;  2OTK E;  3O6Q A;  4RO0 A;  1YJN P;  1KFN A;  1N86 A;  1SQQ G;  2OYH B;  3L73 D;  3L70 D;  1Y8A A;  2OYH A;  4N78 E;  2B88 A;  3VMX A;  1NU1 D;  2WSF H;  2VRS A;  2WPR A;  1LTS C;  2D2C C;  2Y9Y A;  1VQ5 P;  1DX7 A;  4EYY Q;  3L74 E;  1QX8 A;  5EFW B;  1KN7 A;  3M0A A;  3JCU E;  3H1L D;  2BEQ D;  4R4M A;  3L75 G;  1G1J A;  1BDC A;  3CLQ A;  1U7J A;  4OGQ B;  3CCE P;  3JSV C;  2IYO A;  2I8D A;  1GK4 A;  3PJS K;  3KPE A;  1VQL P;  2WQY C;  3L73 E;  2QA4 P;  3L70 E;  1JB0 J;  4OVN F;  1H0T B;  1H0T A;  1NU1 E;  1KB9 I;  2XND H;  2KLV A;  3AE2 C;  3WU2 E;  3RK2 D;  1JUN A;  4Y99 C;  1ZOY C;  2ZT9 D;  1XTG B;  2PAJ A;  3G9R A;  3S4R A;  3H1L E;  3CX5 I;  5KLV D;  3KYQ A;  2MKV A;  2H43 A;  3M9H A;  2KYV A;  4GDO A;  4WVZ A;  5AVQ B;  5CMZ A;  1E5W A;  1NAY A;  1NTK J;  5KLI C;  3RGU A;  1SLQ A;  1PPJ D;  3CC7 P;  1EC5 A;  1HTL C;  1G2C B;  3OAK A;  4D6T J;  4XE5 B;  2Y9Z A;  3HE5 B;  1G2C A;  3SWY A;  1L0L K;  1OFC X;  5AVU B;  1KZU B;  2E74 B;  5TIS H;  5DJT B;  2O01 H;  1E79 H;  1SQV G;  1URQ C;  5CHX A;  5KLV E;  1KD1 Q;  4KHX A;  2CPS A;  3VTP C;  5APS A;  1FJP A;  2MJZ A;  1HJB A;  2Q7C A;  1YHQ P;  1JMB A;  3G6E P;  4ASW A;  2OYI B;  1H88 A;  2OYI A;  1IZN B;  2AXT E;  2O3J A;  3V4Q A;  1JMM A;  1IK9 A;  1OW6 A;  1SQB D;  1VQ7 P;  1NTM K;  1X0T A;  3TDK A;  1T2K C;  4GT1 A;  5APT A;  4XA4 A;  2HLO A;  3NFQ A;  3V6I A;  1USE A;  4EI2 A;  4XFJ A;  2IX7 C;  1LT1 A;  5KKZ B;  1KIL B;  3PRJ A;  1YTZ I;  1UIX A;  3L72 D;  2ZYG A;  5APX A;  2C9L Y;  3AE5 C;  5GTI E;  4DT0 A;  1H89 A;  1JTH A;  2LXC B;  1N7S B;  4EOT A;  2BCC J;  3H1H J;  3HTK B;  1SQB E;  3B71 A;  2K88 A;  4BWN A;  2WVR A;  3HTK A;  3HE4 B;  1ZV8 A;  1SQX J;  1A02 F;  2YIU B;  2P67 A;  3AEE C;  1NWQ A;  1BDD A;  2JJL A;  2C0W A;  1IFM A;  5B66 H;  3H1I G;  1L0N D;  2I1J A;  3L72 J;  4IL6 X;  1Q82 Q;  3GHG C;  1H8A A;  5AW7 B;  4H13 C;  3H32 B;  5GTH H;  4WY4 C;  3H32 A;  1CZQ A;  2E75 B;  1T6A A;  3D6Z A;  1EZV D;  1GL2 C;  1EDI A;  3O8Z A;  3BAS A;  1LTJ B;  2P7J A;  5B66 E;  1SFC A;  4LGD E;  2IZ0 A;  1L0L G;  2Q3I A;  1L0N E;  4I2L C;  4ASV A;  3M91 A;  4HYT B;  2JDI H;  4U3F D;  1JEK A;  3GLM A;  2QJK C;  2IBZ G;  2M3B A;  5AW5 B;  1NTZ D;  1SQQ D;  1K04 A;  4WB4 A;  2E43 A;  2JKV A;  2NPS C;  2Q1K A;  3KDP B;  1EZV E;  3CXH I;  4DCK A;  1RH5 B;  3W67 A;  2B9B A;  4H44 C;  3SFE C;  3BCC G;  3D70 A;  1J1D B;  1KQL A;  1KV4 A;  2KZJ A;  1AQ5 A;  4U3F E;  2AEJ A;  2FYN C;  1SQQ E;  3FWN A;  4LLH A;  2YXR B;  2IFN A;  5AW0 B;  1BGY J;  4PJ0 H;  1U7M A;  2K9Y A;  1BE3 J;  1AFO A;  1IFN A;  2H88 C;  4Y28 J;  2WTY A;  1OW7 A;  1MFZ A;  4D6T G;  1LNQ A;  3L75 E;  2K9J B;  1S5L X;  3EWK A;  3VP9 A;  2K9J A;  2FXM A;  4IL6 H;  2HR3 A;  1ZN5 A;  3WUV A;  2KS1 B;  1M56 D;  1S9K D;  3B5N C;  1J1E C;  4HB1 A;  2GA1 A;  1T8Z A;  3U1A A;  1M8O B;  1S4X A;  3GG2 A;  5CJ4 A;  1N73 C;  3G71 P;  3MD0 A;  3Q2Y A;  2QJP B;  3RL0 B;  4PV1 B;  1HGV A;  2AEF A;  4IL6 E;  4NPD A;  1RF1 C;  5AW4 B;  5BU8 B;  3MZW B;  2WSC H;  1VL2 A;  1BCC G;  2OAR A;  1S9K E;  3Q5P A;  2V7Q J;  4C7N A;  2Q5U A; 
#chains in the Genus database with same CATH homology
 1USE A;  1USD A;  3S4R A;  4YPC A;  3SSU A;  3MUD C;  3QH9 A;  3SWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...