1SVFA

Paramyxovirus sv5 fusion protein core
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
64
structure length
64
Chain Sequence
TAAVALVKANENAAAILNLKNAIQKTNAAVADVVQATQSLGTAVQAVQDHINSVVSPAITAANY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (FUSION GLYCOPROTEIN)
publication title Structural basis for paramyxovirus-mediated membrane fusion.
pubmed doi rcsb
source organism Simian virus 5 (strain w3)
molecule tags Viral protein
total genus 30
structure length 64
sequence length 64
chains with identical sequence C
ec nomenclature
pdb deposition date 1999-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.300 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1svfA00
3SWYA 3EFGA 1SVFA 1G2CA 1ZV8A 4EIJA 3KPEA 4N6JA 2FYZA
chains in the Genus database with same CATH superfamily
2WPQA 1OIPA 4Z1MH 1ZXGA 1NAYA 1L0NG 3I56P 1OVUA 2O01H 3HUSA 1DD4A 1NTME 3RGUA 3NFQA 1KB9D 2YKQA 4C7NB 2JKVA 3BCCE 4TT3H 4WY4A 3H1JE 4A7PA 2NPSA 5AW8B 5M1BA 4JYBA 1KMIZ 4RKUJ 5AVXB 3C1LA 1VQPP 1EDKA 4GOEA 1M7LA 3PJSK 2JEEA 4WWIA 3L75J 3HE5B 1W2EA 1S9KD 3ZDMA 3L35A 1LTIC 1N7SD 1PV3A 1RE4C 4IOIH 1G1IA 2ZXXA 1FZGA 5AVZB 2WT7B 2E75D 3V2QA 3H1HG 2KOGA 2P2UA 1JCDA 2E76D 3VN0A 1Y47A 1NH4A 2L5GB 2ZT9D 5AW2B 4U3FJ 1UIXA 1LWUC 4GT1A 1VQ5P 1P84I 1URQB 3L70J 2QRXA 1PGJA 1H0TB 1KYOD 1HTLC 2KZJA 4H0LD 1NTMJ 2P67A 3C8VA 2WT7A 3BCCJ 1JY3N 2Z5IA 1LTGC 3SWYA 1FS0E 2Q7CA 1K8AQ 3P8MC 4GOFA 1R8EA 3HUSC 1BCCJ 1IK7A 5CJ4A 1SQBK 2ZXEB 4WY4C 2YIUC 2NPSC 1KFNA 2E43A 1H0TA 2BCCE 1H8AA 1BE3D 1Y8AA 5KLVE 2QVAA 3AEEC 1NKNA 1CI6A 3I55P 4PD4E 4YPCA 5GTHH 2C9NY 2FFDC 2POHA 3F89A 1EZVE 2FXOA 3CCUP 2JDIH 2OTLP 2Q9IA 3GF3A 3TGUD 3L71D 1URQD 3CCJP 3P32A 5TISE 1SQXE 3H32B 1SQBD 3AE9C 2JWAA 2VRSA 5CCGA 1QL1A 2H8PD 2LKMA 3V2RA 1UIIA 3H6PA 2V7QJ 2ZYDA 2ZYGA 3CCLP 3BATA 1L0LK 2WMMA 1BGYG 4IFFA 2OGUA 1IFJA 3H1LG 1IZNB 1G1JA 1N8RQ 3CCRP 1U57A 1BE3G 3RL0C 5B66H 1GZLA 5KAFE 2V7QH 4EI2A 3CCMP 2QG4A 2E5YA 1PGOA 1NAFA 2A45I 3VP8A 1ZP0C 2QE7H 3H32A 1FAVA 2BCCJ 1NTKE 2FXPA 4ASVA 5KLVJ 5APSA 1QVFO 2DW3A 1IFPA 1OWAA 3TGUG 1L0NE 1T3UA 1ZN5A 2C0WA 1SQBG 3O8ZA 4L76A 1L0LD 2R3SA 2Y0DA 2FYUJ 1HUCA 1XTGB 5APTA 5KKZB 2W8ZA 3NTNA 3LIEA 1FDIA 5KTBA 3KHUA 5BVZA 1N7LA 2P1JA 1CZQA 1KV4A 3RK3B 3H1KD 3B5NB 3QH9A 2V4HA 1JOCA 3P8CE 1HBWA 1NTZK 2XNDH 3RL0g 2QJPC 1GDTA 1SQQK 4UB8H 1WT6A 1OVVA 3CLQA 2PAJA 2KSJA 5CCGC 2HYNA 2BASA 4RESB 3KQGA 3L72D 2N1TB 3G4SP 3JC22 1L4AA 3PLNA 1GL2C 1KB9E 2I1JA 1GTWA 2G8YA 1PFIA 5H2FH 1L0LG 4UB6E 2O3JA 3G71P 2E74C 2P58A 2QIWA 1VF5B 3M9QA 2K88A 4PV1D 1SLQA 1L0NJ 2GM4A 2IBZE 2HPCA 4NPDA 1T6AA 4EYYQ 1NTZD 1ZR2A 2Y0CA 2H43A 1SQQD 3H1KG 1Y9BA 1GW4A 5KJ7A 3LW5H 4I7ZB 3M9BA 5AW5B 1S72P 1ZRTD 4N3YB 1M90Q 3GLMA 2KNCB 1M1JA 3B5ND 3E1IA 1EXIA 4ZKUA 1M56D 3V4QA 3L72G 4PJ0E 3OW2O 3L73G 1P84D 2Y9YA 3GW6A 1KQLA 2B89A 2XDJA 2K3RA 4IFMA 3H1HJ 2C0XA 1N73C 3RBZA 2N1TD 3W68A 3A0BH 2JR8A 1RF1A 3KZIH 3MHVA 3E7KA 2ZVNB 3PHLA 1IFDA 3TF5A 1K9MQ 3CXHI 3L74D 5CCHC 1NTZG 1RQVA 4L74A 2YXRB 1RF0A 2OARA 1FZCA 2J5UA 4W7YA 1SQQG 1VQMP 1E79H 3A0HH 2OYIA 4WVZA 1L4AC 2WZ7A 1HVVA 3FWNA 3RK2C 1X9VA 3V2PA 1EXJA 3RBXA 1BGYE 1ZW0A 4DT0A 4N78E 3H1LE 1IJDB 3B8EB 4HKZH 1BE3E 1SQVD 3E1RA 3IAOA 1SFCB 3S9OA 2OYHB 2I8DA 3V2NA 1KQGB 2ZAEB 1FOSF 3AE5C 3D6ZA 4EIJA 2KIKA 1EDJA 3Q2YA 1R5SA 2FXMA 1OW7A 3CX5I 1QL2A 3TGUE 2E76B 2WTYA 1LTJB 4U3FE 1NKZB 2ZT9B 3TYYA 1MFTA 1M1JC 2KS1A 3BRVB 1WRGA 1EDLA 2A06G 3D6YA 4D6TD 5B5EH 5AVWB 2IFNA 3MIWA 1BDCA 3CC7P 4OGQB 5APYA 2QM8A 1N7SA 4H0LB 4AYCA 5CBNA 2SPZA 3H1ID 1IK9A 1PZQA 1KYOH 2J59M 2PRRA 1JNMA 1RF1C 2YNYA 1RY3A 1VQOP 1OFCX 2HR3A 3BASA 1LT1A 1YJWP 1LTJA 3MGNA 1BCCE 1BGYJ 2QM7A 1RF0C 5AW6B 1FZCC 5GTHE 3A3YB 3H1LJ 2IZ1A 1BE3J 3AE8C 4IL6H 4H44C 2OYIC 3G9RA 3VTPC 5GTIH 2M5AB 2W6JH 1SFCD 5APUA 1YBKA 2NZ2A 1Q7YQ 1J2JB 1X0TA 2Q3EA 4WB4A 5CJ0A 4C7NA 2I1KA 3G6EP 4PD4I 3S4RA 4D6TG 5AVYB 1E5WA 1ZR4A 1ZOYC 3TGUJ 1EZVI 2J58A 2O1KA 3A7OA 1VQKP 1NU1K 5BU5A 1N86A 1LTBC 3H1IG 4M3LA 3LIDA 1YIJP 1J1DC 3SFDC 1XTCC 3H1KE 2C9LY 3HE5A 2OQQA 5AVUB 5B66E 2IPPA 2R3CA 2RKLA 1RH5B 3P7KA 2A45G 2W83C 4OGQD 4CPGA 2FYZA 1DEBA 2K9YA 3CC4P 3VP9A 2FKWB 2M3BA 2ZVOB 3L72E 2Y0EA 3QWOC 3EFFK 3L37A 3CMAP 3L73E 1N2DC 4Y99C 3L4FA 2QJKB 1FBMA 1N7SC 4W7ZA 2W6AA 1FZBA 4ZNCA 3EQ2A 4DZOA 1QGKB 3GHGB 1NU1D 1AVOA 1URQA 2E75C 3JSVC 4H13D 2AXTH 2Z4EA 1BSHA 4XE5B 1ZLLA 1K73Q 1PP9D 3H25A 3CD6P 1JTHB 3AE2C 2FYNC 1L0LJ 3M06A 4DOJA 1KORA 2RN0A 4BXLA 1SQQE 4NPFX 3RL0D 3NXSA 3M91A 3PRJA 2BEQD 3L75D 3CWBE 4YXDC 1KD1Q 2FYUE 1NTMK 1L2PA 4I6MC 3KPEA 3FX0A 3RK3E 2LXBA 3VMXA 4HB1A 1FDOA 3GHGA 3AEFC 3H1KJ 4UB8E 2K37A 5AW1B 1S5LE 1A02F 1QEXA 3B71A 5CBOA 1K04A 1YQ4C 3S1KA 1KILB 3M0AA 4GODA 1JTHA 1ZMEC 2QSIA 1H89A 1LT9B 3N4XA 1NU1G 4IL6X 2WPVB 5H2FE 2PGDA 2D2CD 3L72J 3V6IA 1GU5A 3L73J 3CXHD 2B88A 1S3JA 1PP9G 3AEDC 1RQUA 2K9JB 4U7JA 3TK1A 1NTMD 1YI2P 1KC8Q 3BCCD 3H1JD 2IYOA 2A06E 5AVTB 2YMKA 5AVRB 2WSEJ 3OAKA 1JB0J 3L71G 1TU3F 2AXCA 4PV1B 4B86A 1LT9A 2P10A 2WQYC 5AW4B 1SQQJ 1URQC 1KTMA 1USEA 2IBZI 3CWBJ 2LXCB 1GL2D 2E42A 2WSEH 2K9JA 3U59A 2JP3A 3VYIA 1LTAC 2E74D 5APVA 3AEAC 1RHZB 2M0BA 3CX5D 2AEFA 1T2KD 1KILD 3A5TA 2Y9ZA 3A0BE 1LJ2A 3KZIE 4N6JA 2HLOA 3AE7C 1VQLP 3N7NA 3H1JG 1S5LH 3AEGC 4D6TE 5KLVK 3H1HE 3SFEC 1P84H 2E5TA 3A0HE 5AW9B 2H7HA 2Z5HA 5L8RJ 1LNQA 3L36A 1FZEA 3WMM0 1AFOA 1SQPK 2PP6A 4HYTB 1AVYA 1OW8A 1MKMA 3WU2H 2B9BA 1X8YA 2QJYB 1FJPA 1JY2N 4NPEA 3B5NA 1AJYA 1USDA 2KSEA 3LW5J 1IFIA 2HODB 1SQXK 2H89C 3U1AA 1S4XA 3VMYA 1LTSC 2JWDA 1OXZA 2B87B 2OTKE 1FJKA 2BCCD 1KQFB 1S9KE 1S2EA 3IFMA 5KAIH 2N1TA 5KLVD 2W6BA 4L75A 5CCHD 2ZJSE 1LT9C 3HE4B 4PD4D 4JBZA 1Q82Q 3PP5A 4MN4C 1SQPD 3KXDA 3MD0A 1AQTA 1EZVD 4OWFA 2YMYA 1L4AD 2WVRA 3Q5RA 5B5EE 3TDKA 2HODA 3Q5PA 4ASWA 5AVVB 2KLUA 3ITKA 2M3EA 4C46A 4OVNF 1NTKK 4RO0A 5BU8B 1SQVK 1SQXD 2YKOA 4D6TJ 2B87A 1KYOE 3Q1MA 5EFWB 1JY2P 1NOHA 5E79H 4Y28J 4PV1C 3HE4A 3W67A 4R4MA 4OH8B 2W90A 3H1IJ 3C9IA 2IZ0A 2KB7P 2KNCA 1Q81Q 4K3AA 3SWFA 4IL6E 3R2PA 2PFXA 5KLVG 5KKZC 3CCSP 4R4LA 2G3AA 5GTIE 2L91A 1GD2E 1LWUB 1YHQP 4GKGA 2ITAA 1SQPG 1T3JA 3HD7D 3RK3C 1KFMA 2QA4P 5K5GB 1EZVG 4K35A 1H88A 1NTKD 5KLIB 3B5NC 2A45H 3SSUA 1RE4A 2YXQB 1S5LX 1AQ5A 2CPBA 3ABVC 1SQXG 4O9BA 3MUDA 1GMJA 3IF4A 1BSNA 1OZHA 2CPSA 2N1TC 5KJ7C 3AE1C 1X22A 2XZRA 3JCUE 3CCVP 2XV5A 3HUSB 3L74G 3L71E 2ZYAA 1KN7A 3CI9A 3V4WA 1HH0A 2QJYC 4WY4B 1SQBE 2NPSB 1VF5C 2CK3H 3USSA 2YO3A 1NVOA 3GG2A 1NYHA 1M1KQ 1YYCA 1SFCA 2OYHA 2O1JA 1HGVA 1NTKG 2FFDB 2FBWC 1SQVG 3CXHE 2YO2A 1BDDA 2AXTE 1EC5A 4I7ZC 3M9HA 4KHXA 4XA4A 3M0DA 2WPSA 1CSBA 4KT0J 1YJNP 4TLFA 3AE4C 4I1LA 1CW5A 1NU1J 4LC1A 1HWTC 3BVHA 3CCEP 1LTTC 3MZWB 3II6A 1NWQA 2XKMA 2W27A 1KQSO 2OTJP 1YITP 1PP9J 2RH0A 4H13B 3FWLA 2KP8A 1VQ4P 2IFMA 2IBZD 1JEKA 1AV1A 1L0LE 2FFDA 3RL0B 1EDIA 3L71J 2R44A 2O01N 2KI7B 4W80A 3HRNA 4WY4D 1FOSE 2IDBA 2NPSD 3MUDC 1NJIQ 1PGQA 1SQBJ 3CX5E 4ZKPA 2LR2A 1KILE 3WUTA 2M5AA 3IR9A 2WITA 1JMMA 1PL5A 2JO1A 3JCUH 2KUBA 3A2AA 1QVGO 2Q3IA 1MZ9A 1PGPA 5KLIC 1FDMA 4BWNA 1JY2O 2GUSA 1JM0A 5APWA 1NHLA 2D2CB 1SFCC 3VOPA 3T97B 2OYHC 2IBZG 1CI6B 1IC2A 3H1JJ 4I2LC 1X79B 5APQA 1VQNP 3UIAA 3D70A 3OA7A 1Q86Q 3CXHH 4HH2A 5AVQB 3M0DC 2E76C 2GUVA 1LTJC 1HF9A 2ZT9C 4C7RA 2XNXA 2WSFJ 1YTZT 2QJPB 2M8RA 1NTZE 1BGYD 3TSIA 1PIXA 3EWKA 4N78D 3VMAA 1JCCA 3H1LD 2WWWA 3AE6C 3AEBC 3K5BA 1DIPA 5CMZA 2AEJA 1PPJD 5DJUB 5AVSB 3T97A 1VQ7P 1ZRTE 1GW3A 4OGQC 1MUUA 4H0LC 1GL2B 2YKPA 2WSFH 2MKVA 1SQPE 1GU4A 3WUVA 5APXA 1FC2C 3B4SA 2E74B 4DCKA 4GDOA 1U7JA 1VQ8P 1U7MA 1IO4A 1OX3A 1SS1A 1P84E 4U3FD 1JUNA 3CX5H 1HJ0A 3KDPB 1JY3P 2N9BA 3SWKA 1YTZI 3WU2E 3L70D 3EFGA 4H13C 5AW7B 4AQRD 3MP7B 3L74E 1GL2A 2OYOA 4RJTA 4LLHA 5CHXA 2KZIA 1KB9I 1NGMB 3L75G 1PPJG 3CPWO 5KAIE 1GK6A 4AUWA 1KILA 4ZMDA 4WBAA 1BCCD 1NTZJ 3PTZA 2JJLA 1G2CB 5CCGD 2KXPB 2FY8A 3G3ZA 3R4YA 2IX7C 1N73B 3O6QB 1SQVE 4JYCA 1FE6A 4GIFA 4U3FG 1KZUB 1SQPJ 1QLED 1OMIA 2R5DA 1GK4A 3L70G 5AW3B 1M8OB 2D2CC 3PH0A 2QJKC 2XU6A 4PD4H 1L4AB 4JQ0D 1DX7A 5E79E 1LP1B 1NTMG 4JPZB 3CCQP 3RK2B 1G2CA 1QX8A 1SQXJ 3GF7A 3GHGC 1JMBA 3FGAD 3BCCG 2RMZA 1J1EB 1NO4A 1N73A 3O6QA 1DH3A 1W5CE 1FU1A 2P7JA 2MJZA 1KYOI 1RE3A 3L74J 2HPCB 1IFNA 2ZFCA 3WUUA 2KK7A 1BCCG 3KYQA 1VDFA 5DJTB 5CCHA 5TISH 3H1IE 1Q2NA 3AE3C 1S1CX 2FYUK 1D7MA 3L73D 1YJ9P 1LP1A 1AA0A 3I5CA 1Z56A 1NTKJ 2N9YB 1M1JB 1SQVJ 2WSSH 3VMZA 3IN6A 2UWJE 3HD7B 3MTUE 1SVFA 5KAFH 3GMAA 1T2KC 1KILC 3HTKB 1JO5A 1R5LA 1VQ9P 1FZAA 3Q3DA 2IYPA 4IFDK 1K05A 3TNUB 1FZFA 2K1AA 4L73A 2HFED 2AEMA 4XFJA 2BEZF 1RF1B 3CWBD 2KYVA 2FYUD 3RK2D 1A02J 3RK3D 1SP4A 1M57D 3FXDA 1FZCB 1Q90D 3HD7A 1MV8A 4H44B 2OYIB 2R5BA 1DD3A 2GA1A 4BRYB 3HTKA 1L0NK 3CL3D 5C39A 2H88C 2WPRA 3FXEA 1DEEG 1WMKA 1JY3O 3TNUA 1LGHB 1OW6A 1OVRA 1VL2A 2KLVA 5TJHA 5KJ7D 2BCCG 1W2BO 3Q5SA 3BRTB 3D71A 1RE3C 4EOTA 4EDFA 1EQ7A 3F5HA 1VF5D 3V5BA 3AECC 1NU1E 4DJGA 1J1DB 2A06D 3CWBG 2Q5UA 1HGZA 2FYUG 4BRYA 2Q1KA 2WSCJ 1VQ6P 4YXWH 1KB9H 1PP9E 1L0ND 3CMEP 4UB6H 1J1EC 2KS1B 1HJBA 1IFMA 1YQ3C 2Q6QA 3L75E 2HG5D 2NRGA 1PPJE 2WSCH 3U1CA 4Y99B 4KJMA 1LWUA 3NMDA 1VPCA 1N7SB 3OJAB 2QEXP 4H44D 2YIUB 5AW0B 2E75B 4LGDE 2R32A 4YTPC 3CC2P 4QMAA 1T8ZA 2O01J 3P8CD 4JF7A 1ZV8A 2FYNB 4HJGH 1MFZA 3HD7C 4PJ0H 3L70E 3H1HD
chains in the Genus database with same CATH topology
4ZKUA 3V4QA 2WPQA 5AVQB 3M0DC 1GL2D 2E42A 2WSEH 2GUVA 1LTJC 1KQLA 3HUSA 2O01H 2XDJA 2XNXA 3U59A 4C7RA 3VYIA 3NFQA 1LTAC 2YKQA 1YTZT 4C7NB 2M8RA 5APVA 3TSIA 4IFMA 4N78D 4WY4A 2C0XA 1N73C 1JCCA 2NPSA 5AW8B 2WWWA 2N1TD 1T2KD 1RF1A 1KILD 3A5TA 4JYBA 5CMZA 5AVXB 5AVSB 3T97A 1IFDA 4N6JA 1GW3A 1MUUA 5CCHC 1GL2B 2YKPA 2HLOA 2WSFH 1M7LA 1GU4A 5APXA 3N7NA 1RF0A 2OARA 1FZCA 4W7YA 2JEEA 3HE5B 5KLVK 1W2EA 1S9KD 2OYIA 1IO4A 5AW9B 1L4AC 2Z5HA 2H7HA 3L35A 3L36A 1LTIC 2WZ7A 1FZEA 1N7SD 1HVVA 1RE4C 3WMM0 1AFOA 1SQPK 3RK2C 1X9VA 2PP6A 1G1IA 4HYTB 1FZGA 5AVZB 1JUNA 3V2PA 2WT7B 4N78E 3V2QA 3KDPB 1JY3P 1IJDB 1X8YA 2N9BA 3B8EB 2KOGA 1FJPA 1YTZI 2P2UA 1JY2N 3EFGA 1JCDA 3VN0A 3B5NA 5AW7B 4AQRD 1NH4A 2L5GB 5AW2B 1IFIA 2HODB 1LWUC 4GT1A 1SFCB 2OYHB 1GL2A 1SQXK 3V2NA 3U1AA 3VMYA 1LTSC 4LLHA 5CHXA 1URQB 1FOSF 1OXZA 4EIJA 1FJKA 1S9KE 1HTLC 3IFMA 2FXMA 2N1TA 2W6BA 1GK6A 4AUWA 1QL2A 5CCHD 1KILA 2WTYA 2P67A 4WBAA 1LTJB 1LT9C 3HE4B 1NKZB 3TYYA 2JJLA 2WT7A 1G2CB 3PP5A 1JY3N 5CCGD 1M1JC 2Z5IA 1LTGC 3SWYA 3MD0A 3G3ZA 3BRVB 2Q7CA 1WRGA 2IX7C 1N73B 3P8MC 2YMYA 1L4AD 4JYCA 5AVWB 4GIFA 2HODA 3HUSC 5AVVB 2IFNA 3MIWA 5CJ4A 4C46A 1KZUB 1SQBK 2ZXEB 5APYA 2QM8A 1N7SA 1NTKK 4AYCA 4WY4C 2R5DA 5BU8B 2NPSC 1KFNA 2E43A 1IK9A 1GK4A 1SQVK 2YKOA 2J59M 5AW3B 1JNMA 1RF1C 2YNYA 1RY3A 1H8AA 1JY2P 1NOHA 3BASA 2XU6A 1L4AB 1NKNA 1DX7A 1LTJA 3MGNA 1CI6A 3HE4A 2QM7A 4OH8B 3C9IA 3RK2B 1G2CA 1RF0C 5AW6B 1FZCC 2C9NY 3A3YB 3GHGC 2FFDC 2KB7P 2POHA 1J1EB 1NO4A 3SWFA 1N73A 2OYIC 1DH3A 3VTPC 3R2PA 1SFCD 5APUA 1FU1A 2P7JA 2MJZA 1RE3A 2HPCB 1IFNA 2ZFCA 2Q9IA 1GD2E 1LWUB 1J2JB 4GKGA 3KYQA 1VDFA 4WB4A 1URQD 5CJ0A 5CCHA 1T3JA 3HD7D 3P32A 4C7NA 2I1KA 3RK3C 1KFMA 3H32B 1H88A 5AVYB 2VRSA 2FYUK 3B5NC 5CCGA 1QL1A 2H8PD 1E5WA 2LKMA 1ZR4A 3V2RA 2A45H 3H6PA 2J58A 2O1KA 3BATA 1RE4A 3A7OA 1NU1K 5BU5A 1N86A 1L0LK 3I5CA 1Z56A 1AQ5A 2CPBA 1LTBC 4IFFA 4M3LA 4O9BA 3LIDA 3MUDA 1IFJA 1M1JB 1J1DC 3VMZA 1G1JA 1XTCC 2C9LY 3HD7B 3HE5A 3RL0C 2CPSA 1SVFA 1GZLA 2N1TC 3MTUE 5AVUB 5KJ7C 1T2KC 2IPPA 1KILC 3HTKB 2R3CA 3P7KA 2XZRA 1JO5A 2A45G 1FZAA 2XV5A 3HUSB 4IFDK 2FYZA 3CI9A 3V4WA 1NAFA 1DEBA 1HH0A 3TNUB 2A45I 4WY4B 3VP8A 3VP9A 1FZFA 2FKWB 3H32A 2NPSB 2HFED 1FAVA 2M3BA 1RF1B 2YO3A 5APSA 3L37A 1YYCA 2KYVA 1N2DC 1OWAA 4Y99C 3RK2D 3L4FA 1SFCA 2OYHA 1FBMA 1HGVA 2O1JA 1N7SC 4W7ZA 2W6AA 1FZBA 1A02J 3RK3D 1SP4A 1T3UA 3EQ2A 4DZOA 1ZN5A 2C0WA 1FZCB 3O8ZA 3GHGB 1URQA 2FFDB 3HD7A 1MV8A 2OYIB 2R5BA 2YO2A 1HUCA 1XTGB 2Z4EA 3HTKA 3M9HA 4KHXA 1L0NK 5APTA 4XE5B 3CL3D 4XA4A 1ZLLA 3M0DA 2WPSA 2WPRA 3LIEA 3NTNA 1CSBA 5KTBA 5BVZA 1N7LA 4I1LA 1CW5A 1JTHB 1JY3O 4LC1A 3M06A 3TNUA 1LGHB 4DOJA 1HWTC 3BVHA 2P1JA 1CZQA 2KLVA 1LTTC 3RK3B 3RL0D 3II6A 3NXSA 1NWQA 2XKMA 2W27A 5KJ7D 3M91A 3B5NB 3BRTB 1RE3C 4EOTA 1NTMK 1JOCA 2KP8A 3P8CE 1HBWA 2IFMA 4I6MC 1NTZK 3KPEA 3VMXA 1EQ7A 1GDTA 1SQQK 1WT6A 3V5BA 3GHGA 3CLQA 2PAJA 2KSJA 2FFDA 5AW1B 5CCGC 2HYNA 1J1DB 2BASA 1A02F 2Q5UA 1HGZA 4RESB 3KQGA 3RL0B 2N1TB 1KILB 1L4AA 3M0AA 1GL2C 4W80A 2I1JA 3HRNA 1GTWA 4WY4D 1JTHA 1FOSE 2NPSD 1H89A 1LT9B 1J1EC 3N4XA 1PFIA 1HJBA 1IFMA 4ZKPA 1GU5A 3M9QA 2HG5D 3IR9A 2WITA 1JMMA 1SLQA 2WSCH 3U1CA 2GM4A 2HPCA 4Y99B 3TK1A 1LWUA 3NMDA 1VPCA 3A2AA 1N7SB 2Q3IA 3OJAB 1MZ9A 1ZR2A 5AW0B 1FDMA 2H43A 1JY2O 4LGDE 2GUSA 5AVTB 5APWA 1NHLA 2R32A 5AVRB 1GW4A 5KJ7A 3LW5H 1SFCC 3VOPA 3M9BA 2OYHC 5AW5B 1T8ZA 1CI6B 3OAKA 3P8CD 1IC2A 4JF7A 4B86A 4N3YB 1ZV8A 1LT9A 5AW4B 4I2LC 1URQC 1X79B 5APQA 1MFZA 3HD7C 3UIAA 1M1JA 3B5ND 3OA7A 3E1IA 4HH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWY A;  3EFG A;  1SVF A;  1G2C A;  1ZV8 A;  4EIJ A;  3KPE A;  4N6J A;  2FYZ A; 
#chains in the Genus database with same CATH topology
 2WPQ A;  1OIP A;  4Z1M H;  1ZXG A;  1NAY A;  1L0N G;  3I56 P;  1OVU A;  2O01 H;  3HUS A;  1DD4 A;  1NTM E;  3RGU A;  3NFQ A;  1KB9 D;  2YKQ A;  4C7N B;  2JKV A;  3BCC E;  4TT3 H;  4WY4 A;  3H1J E;  4A7P A;  2NPS A;  5AW8 B;  5M1B A;  4JYB A;  1KMI Z;  4RKU J;  5AVX B;  3C1L A;  1VQP P;  1EDK A;  4GOE A;  1M7L A;  3PJS K;  2JEE A;  4WWI A;  3L75 J;  3HE5 B;  1W2E A;  1S9K D;  3ZDM A;  3L35 A;  1LTI C;  1N7S D;  1PV3 A;  1RE4 C;  4IOI H;  1G1I A;  2ZXX A;  1FZG A;  5AVZ B;  2WT7 B;  2E75 D;  3V2Q A;  3H1H G;  2KOG A;  2P2U A;  1JCD A;  2E76 D;  3VN0 A;  1Y47 A;  1NH4 A;  2L5G B;  2ZT9 D;  5AW2 B;  4U3F J;  1UIX A;  1LWU C;  4GT1 A;  1VQ5 P;  1P84 I;  1URQ B;  3L70 J;  2QRX A;  1PGJ A;  1H0T B;  1KYO D;  1HTL C;  2KZJ A;  4H0L D;  1NTM J;  2P67 A;  3C8V A;  2WT7 A;  3BCC J;  1JY3 N;  2Z5I A;  1LTG C;  3SWY A;  1FS0 E;  2Q7C A;  1K8A Q;  3P8M C;  4GOF A;  1R8E A;  3HUS C;  1BCC J;  1IK7 A;  5CJ4 A;  1SQB K;  2ZXE B;  4WY4 C;  2YIU C;  2NPS C;  1KFN A;  2E43 A;  1H0T A;  2BCC E;  1H8A A;  1BE3 D;  1Y8A A;  5KLV E;  2QVA A;  3AEE C;  1NKN A;  1CI6 A;  3I55 P;  4PD4 E;  4YPC A;  5GTH H;  2C9N Y;  2FFD C;  2POH A;  3F89 A;  1EZV E;  2FXO A;  3CCU P;  2JDI H;  2OTL P;  2Q9I A;  3GF3 A;  3TGU D;  3L71 D;  1URQ D;  3CCJ P;  3P32 A;  5TIS E;  1SQX E;  3H32 B;  1SQB D;  3AE9 C;  2JWA A;  2VRS A;  5CCG A;  1QL1 A;  2H8P D;  2LKM A;  3V2R A;  1UII A;  3H6P A;  2V7Q J;  2ZYD A;  2ZYG A;  3CCL P;  3BAT A;  1L0L K;  2WMM A;  1BGY G;  4IFF A;  2OGU A;  1IFJ A;  3H1L G;  1IZN B;  1G1J A;  1N8R Q;  3CCR P;  1U57 A;  1BE3 G;  3RL0 C;  5B66 H;  1GZL A;  5KAF E;  2V7Q H;  4EI2 A;  3CCM P;  2QG4 A;  2E5Y A;  1PGO A;  1NAF A;  2A45 I;  3VP8 A;  1ZP0 C;  2QE7 H;  3H32 A;  1FAV A;  2BCC J;  1NTK E;  2FXP A;  4ASV A;  5KLV J;  5APS A;  1QVF O;  2DW3 A;  1IFP A;  1OWA A;  3TGU G;  1L0N E;  1T3U A;  1ZN5 A;  2C0W A;  1SQB G;  3O8Z A;  4L76 A;  1L0L D;  2R3S A;  2Y0D A;  2FYU J;  1HUC A;  1XTG B;  5APT A;  5KKZ B;  2W8Z A;  3NTN A;  3LIE A;  1FDI A;  5KTB A;  3KHU A;  5BVZ A;  1N7L A;  2P1J A;  1CZQ A;  1KV4 A;  3RK3 B;  3H1K D;  3B5N B;  3QH9 A;  2V4H A;  1JOC A;  3P8C E;  1HBW A;  1NTZ K;  2XND H;  3RL0 g;  2QJP C;  1GDT A;  1SQQ K;  4UB8 H;  1WT6 A;  1OVV A;  3CLQ A;  2PAJ A;  2KSJ A;  5CCG C;  2HYN A;  2BAS A;  4RES B;  3KQG A;  3L72 D;  2N1T B;  3G4S P;  3JC2 2;  1L4A A;  3PLN A;  1GL2 C;  1KB9 E;  2I1J A;  1GTW A;  2G8Y A;  1PFI A;  5H2F H;  1L0L G;  4UB6 E;  2O3J A;  3G71 P;  2E74 C;  2P58 A;  2QIW A;  1VF5 B;  3M9Q A;  2K88 A;  4PV1 D;  1SLQ A;  1L0N J;  2GM4 A;  2IBZ E;  2HPC A;  4NPD A;  1T6A A;  4EYY Q;  1NTZ D;  1ZR2 A;  2Y0C A;  2H43 A;  1SQQ D;  3H1K G;  1Y9B A;  1GW4 A;  5KJ7 A;  3LW5 H;  4I7Z B;  3M9B A;  5AW5 B;  1S72 P;  1ZRT D;  4N3Y B;  1M90 Q;  3GLM A;  2KNC B;  1M1J A;  3B5N D;  3E1I A;  1EXI A;  4ZKU A;  1M56 D;  3V4Q A;  3L72 G;  4PJ0 E;  3OW2 O;  3L73 G;  1P84 D;  2Y9Y A;  3GW6 A;  1KQL A;  2B89 A;  2XDJ A;  2K3R A;  4IFM A;  3H1H J;  2C0X A;  1N73 C;  3RBZ A;  2N1T D;  3W68 A;  3A0B H;  2JR8 A;  1RF1 A;  3KZI H;  3MHV A;  3E7K A;  2ZVN B;  3PHL A;  1IFD A;  3TF5 A;  1K9M Q;  3CXH I;  3L74 D;  5CCH C;  1NTZ G;  1RQV A;  4L74 A;  2YXR B;  1RF0 A;  2OAR A;  1FZC A;  2J5U A;  4W7Y A;  1SQQ G;  1VQM P;  1E79 H;  3A0H H;  2OYI A;  4WVZ A;  1L4A C;  2WZ7 A;  1HVV A;  3FWN A;  3RK2 C;  1X9V A;  3V2P A;  1EXJ A;  3RBX A;  1BGY E;  1ZW0 A;  4DT0 A;  4N78 E;  3H1L E;  1IJD B;  3B8E B;  4HKZ H;  1BE3 E;  1SQV D;  3E1R A;  3IAO A;  1SFC B;  3S9O A;  2OYH B;  2I8D A;  3V2N A;  1KQG B;  2ZAE B;  1FOS F;  3AE5 C;  3D6Z A;  4EIJ A;  2KIK A;  1EDJ A;  3Q2Y A;  1R5S A;  2FXM A;  1OW7 A;  3CX5 I;  1QL2 A;  3TGU E;  2E76 B;  2WTY A;  1LTJ B;  4U3F E;  1NKZ B;  2ZT9 B;  3TYY A;  1MFT A;  1M1J C;  2KS1 A;  3BRV B;  1WRG A;  1EDL A;  2A06 G;  3D6Y A;  4D6T D;  5B5E H;  5AVW B;  2IFN A;  3MIW A;  1BDC A;  3CC7 P;  4OGQ B;  5APY A;  2QM8 A;  1N7S A;  4H0L B;  4AYC A;  5CBN A;  2SPZ A;  3H1I D;  1IK9 A;  1PZQ A;  1KYO H;  2J59 M;  2PRR A;  1JNM A;  1RF1 C;  2YNY A;  1RY3 A;  1VQO P;  1OFC X;  2HR3 A;  3BAS A;  1LT1 A;  1YJW P;  1LTJ A;  3MGN A;  1BCC E;  1BGY J;  2QM7 A;  1RF0 C;  5AW6 B;  1FZC C;  5GTH E;  3A3Y B;  3H1L J;  2IZ1 A;  1BE3 J;  3AE8 C;  4IL6 H;  4H44 C;  2OYI C;  3G9R A;  3VTP C;  5GTI H;  2M5A B;  2W6J H;  1SFC D;  5APU A;  1YBK A;  2NZ2 A;  1Q7Y Q;  1J2J B;  1X0T A;  2Q3E A;  4WB4 A;  5CJ0 A;  4C7N A;  2I1K A;  3G6E P;  4PD4 I;  3S4R A;  4D6T G;  5AVY B;  1E5W A;  1ZR4 A;  1ZOY C;  3TGU J;  1EZV I;  2J58 A;  2O1K A;  3A7O A;  1VQK P;  1NU1 K;  5BU5 A;  1N86 A;  1LTB C;  3H1I G;  4M3L A;  3LID A;  1YIJ P;  1J1D C;  3SFD C;  1XTC C;  3H1K E;  2C9L Y;  3HE5 A;  2OQQ A;  5AVU B;  5B66 E;  2IPP A;  2R3C A;  2RKL A;  1RH5 B;  3P7K A;  2A45 G;  2W83 C;  4OGQ D;  4CPG A;  2FYZ A;  1DEB A;  2K9Y A;  3CC4 P;  3VP9 A;  2FKW B;  2M3B A;  2ZVO B;  3L72 E;  2Y0E A;  3QWO C;  3EFF K;  3L37 A;  3CMA P;  3L73 E;  1N2D C;  4Y99 C;  3L4F A;  2QJK B;  1FBM A;  1N7S C;  4W7Z A;  2W6A A;  1FZB A;  4ZNC A;  3EQ2 A;  4DZO A;  1QGK B;  3GHG B;  1NU1 D;  1AVO A;  1URQ A;  2E75 C;  3JSV C;  4H13 D;  2AXT H;  2Z4E A;  1BSH A;  4XE5 B;  1ZLL A;  1K73 Q;  1PP9 D;  3H25 A;  3CD6 P;  1JTH B;  3AE2 C;  2FYN C;  1L0L J;  3M06 A;  4DOJ A;  1KOR A;  2RN0 A;  4BXL A;  1SQQ E;  4NPF X;  3RL0 D;  3NXS A;  3M91 A;  3PRJ A;  2BEQ D;  3L75 D;  3CWB E;  4YXD C;  1KD1 Q;  2FYU E;  1NTM K;  1L2P A;  4I6M C;  3KPE A;  3FX0 A;  3RK3 E;  2LXB A;  3VMX A;  4HB1 A;  1FDO A;  3GHG A;  3AEF C;  3H1K J;  4UB8 E;  2K37 A;  5AW1 B;  1S5L E;  1A02 F;  1QEX A;  3B71 A;  5CBO A;  1K04 A;  1YQ4 C;  3S1K A;  1KIL B;  3M0A A;  4GOD A;  1JTH A;  1ZME C;  2QSI A;  1H89 A;  1LT9 B;  3N4X A;  1NU1 G;  4IL6 X;  2WPV B;  5H2F E;  2PGD A;  2D2C D;  3L72 J;  3V6I A;  1GU5 A;  3L73 J;  3CXH D;  2B88 A;  1S3J A;  1PP9 G;  3AED C;  1RQU A;  2K9J B;  4U7J A;  3TK1 A;  1NTM D;  1YI2 P;  1KC8 Q;  3BCC D;  3H1J D;  2IYO A;  2A06 E;  5AVT B;  2YMK A;  5AVR B;  2WSE J;  3OAK A;  1JB0 J;  3L71 G;  1TU3 F;  2AXC A;  4PV1 B;  4B86 A;  1LT9 A;  2P10 A;  2WQY C;  5AW4 B;  1SQQ J;  1URQ C;  1KTM A;  1USE A;  2IBZ I;  3CWB J;  2LXC B;  1GL2 D;  2E42 A;  2WSE H;  2K9J A;  3U59 A;  2JP3 A;  3VYI A;  1LTA C;  2E74 D;  5APV A;  3AEA C;  1RHZ B;  2M0B A;  3CX5 D;  2AEF A;  1T2K D;  1KIL D;  3A5T A;  2Y9Z A;  3A0B E;  1LJ2 A;  3KZI E;  4N6J A;  2HLO A;  3AE7 C;  1VQL P;  3N7N A;  3H1J G;  1S5L H;  3AEG C;  4D6T E;  5KLV K;  3H1H E;  3SFE C;  1P84 H;  2E5T A;  3A0H E;  5AW9 B;  2H7H A;  2Z5H A;  5L8R J;  1LNQ A;  3L36 A;  1FZE A;  3WMM 0;  1AFO A;  1SQP K;  2PP6 A;  4HYT B;  1AVY A;  1OW8 A;  1MKM A;  3WU2 H;  2B9B A;  1X8Y A;  2QJY B;  1FJP A;  1JY2 N;  4NPE A;  3B5N A;  1AJY A;  1USD A;  2KSE A;  3LW5 J;  1IFI A;  2HOD B;  1SQX K;  2H89 C;  3U1A A;  1S4X A;  3VMY A;  1LTS C;  2JWD A;  1OXZ A;  2B87 B;  2OTK E;  1FJK A;  2BCC D;  1KQF B;  1S9K E;  1S2E A;  3IFM A;  5KAI H;  2N1T A;  5KLV D;  2W6B A;  4L75 A;  5CCH D;  2ZJS E;  1LT9 C;  3HE4 B;  4PD4 D;  4JBZ A;  1Q82 Q;  3PP5 A;  4MN4 C;  1SQP D;  3KXD A;  3MD0 A;  1AQT A;  1EZV D;  4OWF A;  2YMY A;  1L4A D;  2WVR A;  3Q5R A;  5B5E E;  3TDK A;  2HOD A;  3Q5P A;  4ASW A;  5AVV B;  2KLU A;  3ITK A;  2M3E A;  4C46 A;  4OVN F;  1NTK K;  4RO0 A;  5BU8 B;  1SQV K;  1SQX D;  2YKO A;  4D6T J;  2B87 A;  1KYO E;  3Q1M A;  5EFW B;  1JY2 P;  1NOH A;  5E79 H;  4Y28 J;  4PV1 C;  3HE4 A;  3W67 A;  4R4M A;  4OH8 B;  2W90 A;  3H1I J;  3C9I A;  2IZ0 A;  2KB7 P;  2KNC A;  1Q81 Q;  4K3A A;  3SWF A;  4IL6 E;  3R2P A;  2PFX A;  5KLV G;  5KKZ C;  3CCS P;  4R4L A;  2G3A A;  5GTI E;  2L91 A;  1GD2 E;  1LWU B;  1YHQ P;  4GKG A;  2ITA A;  1SQP G;  1T3J A;  3HD7 D;  3RK3 C;  1KFM A;  2QA4 P;  5K5G B;  1EZV G;  4K35 A;  1H88 A;  1NTK D;  5KLI B;  3B5N C;  2A45 H;  3SSU A;  1RE4 A;  2YXQ B;  1S5L X;  1AQ5 A;  2CPB A;  3ABV C;  1SQX G;  4O9B A;  3MUD A;  1GMJ A;  3IF4 A;  1BSN A;  1OZH A;  2CPS A;  2N1T C;  5KJ7 C;  3AE1 C;  1X22 A;  2XZR A;  3JCU E;  3CCV P;  2XV5 A;  3HUS B;  3L74 G;  3L71 E;  2ZYA A;  1KN7 A;  3CI9 A;  3V4W A;  1HH0 A;  2QJY C;  4WY4 B;  1SQB E;  2NPS B;  1VF5 C;  2CK3 H;  3USS A;  2YO3 A;  1NVO A;  3GG2 A;  1NYH A;  1M1K Q;  1YYC A;  1SFC A;  2OYH A;  2O1J A;  1HGV A;  1NTK G;  2FFD B;  2FBW C;  1SQV G;  3CXH E;  2YO2 A;  1BDD A;  2AXT E;  1EC5 A;  4I7Z C;  3M9H A;  4KHX A;  4XA4 A;  3M0D A;  2WPS A;  1CSB A;  4KT0 J;  1YJN P;  4TLF A;  3AE4 C;  4I1L A;  1CW5 A;  1NU1 J;  4LC1 A;  1HWT C;  3BVH A;  3CCE P;  1LTT C;  3MZW B;  3II6 A;  1NWQ A;  2XKM A;  2W27 A;  1KQS O;  2OTJ P;  1YIT P;  1PP9 J;  2RH0 A;  4H13 B;  3FWL A;  2KP8 A;  1VQ4 P;  2IFM A;  2IBZ D;  1JEK A;  1AV1 A;  1L0L E;  2FFD A;  3RL0 B;  1EDI A;  3L71 J;  2R44 A;  2O01 N;  2KI7 B;  4W80 A;  3HRN A;  4WY4 D;  1FOS E;  2IDB A;  2NPS D;  3MUD C;  1NJI Q;  1PGQ A;  1SQB J;  3CX5 E;  4ZKP A;  2LR2 A;  1KIL E;  3WUT A;  2M5A A;  3IR9 A;  2WIT A;  1JMM A;  1PL5 A;  2JO1 A;  3JCU H;  2KUB A;  3A2A A;  1QVG O;  2Q3I A;  1MZ9 A;  1PGP A;  5KLI C;  1FDM A;  4BWN A;  1JY2 O;  2GUS A;  1JM0 A;  5APW A;  1NHL A;  2D2C B;  1SFC C;  3VOP A;  3T97 B;  2OYH C;  2IBZ G;  1CI6 B;  1IC2 A;  3H1J J;  4I2L C;  1X79 B;  5APQ A;  1VQN P;  3UIA A;  3D70 A;  3OA7 A;  1Q86 Q;  3CXH H;  4HH2 A;  5AVQ B;  3M0D C;  2E76 C;  2GUV A;  1LTJ C;  1HF9 A;  2ZT9 C;  4C7R A;  2XNX A;  2WSF J;  1YTZ T;  2QJP B;  2M8R A;  1NTZ E;  1BGY D;  3TSI A;  1PIX A;  3EWK A;  4N78 D;  3VMA A;  1JCC A;  3H1L D;  2WWW A;  3AE6 C;  3AEB C;  3K5B A;  1DIP A;  5CMZ A;  2AEJ A;  1PPJ D;  5DJU B;  5AVS B;  3T97 A;  1VQ7 P;  1ZRT E;  1GW3 A;  4OGQ C;  1MUU A;  4H0L C;  1GL2 B;  2YKP A;  2WSF H;  2MKV A;  1SQP E;  1GU4 A;  3WUV A;  5APX A;  1FC2 C;  3B4S A;  2E74 B;  4DCK A;  4GDO A;  1U7J A;  1VQ8 P;  1U7M A;  1IO4 A;  1OX3 A;  1SS1 A;  1P84 E;  4U3F D;  1JUN A;  3CX5 H;  1HJ0 A;  3KDP B;  1JY3 P;  2N9B A;  3SWK A;  1YTZ I;  3WU2 E;  3L70 D;  3EFG A;  4H13 C;  5AW7 B;  4AQR D;  3MP7 B;  3L74 E;  1GL2 A;  2OYO A;  4RJT A;  4LLH A;  5CHX A;  2KZI A;  1KB9 I;  1NGM B;  3L75 G;  1PPJ G;  3CPW O;  5KAI E;  1GK6 A;  4AUW A;  1KIL A;  4ZMD A;  4WBA A;  1BCC D;  1NTZ J;  3PTZ A;  2JJL A;  1G2C B;  5CCG D;  2KXP B;  2FY8 A;  3G3Z A;  3R4Y A;  2IX7 C;  1N73 B;  3O6Q B;  1SQV E;  4JYC A;  1FE6 A;  4GIF A;  4U3F G;  1KZU B;  1SQP J;  1QLE D;  1OMI A;  2R5D A;  1GK4 A;  3L70 G;  5AW3 B;  1M8O B;  2D2C C;  3PH0 A;  2QJK C;  2XU6 A;  4PD4 H;  1L4A B;  4JQ0 D;  1DX7 A;  5E79 E;  1LP1 B;  1NTM G;  4JPZ B;  3CCQ P;  3RK2 B;  1G2C A;  1QX8 A;  1SQX J;  3GF7 A;  3GHG C;  1JMB A;  3FGA D;  3BCC G;  2RMZ A;  1J1E B;  1NO4 A;  1N73 A;  3O6Q A;  1DH3 A;  1W5C E;  1FU1 A;  2P7J A;  2MJZ A;  1KYO I;  1RE3 A;  3L74 J;  2HPC B;  1IFN A;  2ZFC A;  3WUU A;  2KK7 A;  1BCC G;  3KYQ A;  1VDF A;  5DJT B;  5CCH A;  5TIS H;  3H1I E;  1Q2N A;  3AE3 C;  1S1C X;  2FYU K;  1D7M A;  3L73 D;  1YJ9 P;  1LP1 A;  1AA0 A;  3I5C A;  1Z56 A;  1NTK J;  2N9Y B;  1M1J B;  1SQV J;  2WSS H;  3VMZ A;  3IN6 A;  2UWJ E;  3HD7 B;  3MTU E;  1SVF A;  5KAF H;  3GMA A;  1T2K C;  1KIL C;  3HTK B;  1JO5 A;  1R5L A;  1VQ9 P;  1FZA A;  3Q3D A;  2IYP A;  4IFD K;  1K05 A;  3TNU B;  1FZF A;  2K1A A;  4L73 A;  2HFE D;  2AEM A;  4XFJ A;  2BEZ F;  1RF1 B;  3CWB D;  2KYV A;  2FYU D;  3RK2 D;  1A02 J;  3RK3 D;  1SP4 A;  1M57 D;  3FXD A;  1FZC B;  1Q90 D;  3HD7 A;  1MV8 A;  4H44 B;  2OYI B;  2R5B A;  1DD3 A;  2GA1 A;  4BRY B;  3HTK A;  1L0N K;  3CL3 D;  5C39 A;  2H88 C;  2WPR A;  3FXE A;  1DEE G;  1WMK A;  1JY3 O;  3TNU A;  1LGH B;  1OW6 A;  1OVR A;  1VL2 A;  2KLV A;  5TJH A;  5KJ7 D;  2BCC G;  1W2B O;  3Q5S A;  3BRT B;  3D71 A;  1RE3 C;  4EOT A;  4EDF A;  1EQ7 A;  3F5H A;  1VF5 D;  3V5B A;  3AEC C;  1NU1 E;  4DJG A;  1J1D B;  2A06 D;  3CWB G;  2Q5U A;  1HGZ A;  2FYU G;  4BRY A;  2Q1K A;  2WSC J;  1VQ6 P;  4YXW H;  1KB9 H;  1PP9 E;  1L0N D;  3CME P;  4UB6 H;  1J1E C;  2KS1 B;  1HJB A;  1IFM A;  1YQ3 C;  2Q6Q A;  3L75 E;  2HG5 D;  2NRG A;  1PPJ E;  2WSC H;  3U1C A;  4Y99 B;  4KJM A;  1LWU A;  3NMD A;  1VPC A;  1N7S B;  3OJA B;  2QEX P;  4H44 D;  2YIU B;  5AW0 B;  2E75 B;  4LGD E;  2R32 A;  4YTP C;  3CC2 P;  4QMA A;  1T8Z A;  2O01 J;  3P8C D;  4JF7 A;  1ZV8 A;  2FYN B;  4HJG H;  1MFZ A;  3HD7 C;  4PJ0 H;  3L70 E;  3H1H D; 
#chains in the Genus database with same CATH homology
 4ZKU A;  3V4Q A;  2WPQ A;  5AVQ B;  3M0D C;  1GL2 D;  2E42 A;  2WSE H;  2GUV A;  1LTJ C;  1KQL A;  3HUS A;  2O01 H;  2XDJ A;  2XNX A;  3U59 A;  4C7R A;  3VYI A;  3NFQ A;  1LTA C;  2YKQ A;  1YTZ T;  4C7N B;  2M8R A;  5APV A;  3TSI A;  4IFM A;  4N78 D;  4WY4 A;  2C0X A;  1N73 C;  1JCC A;  2NPS A;  5AW8 B;  2WWW A;  2N1T D;  1T2K D;  1RF1 A;  1KIL D;  3A5T A;  4JYB A;  5CMZ A;  5AVX B;  5AVS B;  3T97 A;  1IFD A;  4N6J A;  1GW3 A;  1MUU A;  5CCH C;  1GL2 B;  2YKP A;  2HLO A;  2WSF H;  1M7L A;  1GU4 A;  5APX A;  3N7N A;  1RF0 A;  2OAR A;  1FZC A;  4W7Y A;  2JEE A;  3HE5 B;  5KLV K;  1W2E A;  1S9K D;  2OYI A;  1IO4 A;  5AW9 B;  1L4A C;  2Z5H A;  2H7H A;  3L35 A;  3L36 A;  1LTI C;  2WZ7 A;  1FZE A;  1N7S D;  1HVV A;  1RE4 C;  3WMM 0;  1AFO A;  1SQP K;  3RK2 C;  1X9V A;  2PP6 A;  1G1I A;  4HYT B;  1FZG A;  5AVZ B;  1JUN A;  3V2P A;  2WT7 B;  4N78 E;  3V2Q A;  3KDP B;  1JY3 P;  1IJD B;  1X8Y A;  2N9B A;  3B8E B;  2KOG A;  1FJP A;  1YTZ I;  2P2U A;  1JY2 N;  3EFG A;  1JCD A;  3VN0 A;  3B5N A;  5AW7 B;  4AQR D;  1NH4 A;  2L5G B;  5AW2 B;  1IFI A;  2HOD B;  1LWU C;  4GT1 A;  1SFC B;  2OYH B;  1GL2 A;  1SQX K;  3V2N A;  3U1A A;  3VMY A;  1LTS C;  4LLH A;  5CHX A;  1URQ B;  1FOS F;  1OXZ A;  4EIJ A;  1FJK A;  1S9K E;  1HTL C;  3IFM A;  2FXM A;  2N1T A;  2W6B A;  1GK6 A;  4AUW A;  1QL2 A;  5CCH D;  1KIL A;  2WTY A;  2P67 A;  4WBA A;  1LTJ B;  1LT9 C;  3HE4 B;  1NKZ B;  3TYY A;  2JJL A;  2WT7 A;  1G2C B;  3PP5 A;  1JY3 N;  5CCG D;  1M1J C;  2Z5I A;  1LTG C;  3SWY A;  3MD0 A;  3G3Z A;  3BRV B;  2Q7C A;  1WRG A;  2IX7 C;  1N73 B;  3P8M C;  2YMY A;  1L4A D;  4JYC A;  5AVW B;  4GIF A;  2HOD A;  3HUS C;  5AVV B;  2IFN A;  3MIW A;  5CJ4 A;  4C46 A;  1KZU B;  1SQB K;  2ZXE B;  5APY A;  2QM8 A;  1N7S A;  1NTK K;  4AYC A;  4WY4 C;  2R5D A;  5BU8 B;  2NPS C;  1KFN A;  2E43 A;  1IK9 A;  1GK4 A;  1SQV K;  2YKO A;  2J59 M;  5AW3 B;  1JNM A;  1RF1 C;  2YNY A;  1RY3 A;  1H8A A;  1JY2 P;  1NOH A;  3BAS A;  2XU6 A;  1L4A B;  1NKN A;  1DX7 A;  1LTJ A;  3MGN A;  1CI6 A;  3HE4 A;  2QM7 A;  4OH8 B;  3C9I A;  3RK2 B;  1G2C A;  1RF0 C;  5AW6 B;  1FZC C;  2C9N Y;  3A3Y B;  3GHG C;  2FFD C;  2KB7 P;  2POH A;  1J1E B;  1NO4 A;  3SWF A;  1N73 A;  2OYI C;  1DH3 A;  3VTP C;  3R2P A;  1SFC D;  5APU A;  1FU1 A;  2P7J A;  2MJZ A;  1RE3 A;  2HPC B;  1IFN A;  2ZFC A;  2Q9I A;  1GD2 E;  1LWU B;  1J2J B;  4GKG A;  3KYQ A;  1VDF A;  4WB4 A;  1URQ D;  5CJ0 A;  5CCH A;  1T3J A;  3HD7 D;  3P32 A;  4C7N A;  2I1K A;  3RK3 C;  1KFM A;  3H32 B;  1H88 A;  5AVY B;  2VRS A;  2FYU K;  3B5N C;  5CCG A;  1QL1 A;  2H8P D;  1E5W A;  2LKM A;  1ZR4 A;  3V2R A;  2A45 H;  3H6P A;  2J58 A;  2O1K A;  3BAT A;  1RE4 A;  3A7O A;  1NU1 K;  5BU5 A;  1N86 A;  1L0L K;  3I5C A;  1Z56 A;  1AQ5 A;  2CPB A;  1LTB C;  4IFF A;  4M3L A;  4O9B A;  3LID A;  3MUD A;  1IFJ A;  1M1J B;  1J1D C;  3VMZ A;  1G1J A;  1XTC C;  2C9L Y;  3HD7 B;  3HE5 A;  3RL0 C;  2CPS A;  1SVF A;  1GZL A;  2N1T C;  3MTU E;  5AVU B;  5KJ7 C;  1T2K C;  2IPP A;  1KIL C;  3HTK B;  2R3C A;  3P7K A;  2XZR A;  1JO5 A;  2A45 G;  1FZA A;  2XV5 A;  3HUS B;  4IFD K;  2FYZ A;  3CI9 A;  3V4W A;  1NAF A;  1DEB A;  1HH0 A;  3TNU B;  2A45 I;  4WY4 B;  3VP8 A;  3VP9 A;  1FZF A;  2FKW B;  3H32 A;  2NPS B;  2HFE D;  1FAV A;  2M3B A;  1RF1 B;  2YO3 A;  5APS A;  3L37 A;  1YYC A;  2KYV A;  1N2D C;  1OWA A;  4Y99 C;  3RK2 D;  3L4F A;  1SFC A;  2OYH A;  1FBM A;  1HGV A;  2O1J A;  1N7S C;  4W7Z A;  2W6A A;  1FZB A;  1A02 J;  3RK3 D;  1SP4 A;  1T3U A;  3EQ2 A;  4DZO A;  1ZN5 A;  2C0W A;  1FZC B;  3O8Z A;  3GHG B;  1URQ A;  2FFD B;  3HD7 A;  1MV8 A;  2OYI B;  2R5B A;  2YO2 A;  1HUC A;  1XTG B;  2Z4E A;  3HTK A;  3M9H A;  4KHX A;  1L0N K;  5APT A;  4XE5 B;  3CL3 D;  4XA4 A;  1ZLL A;  3M0D A;  2WPS A;  2WPR A;  3LIE A;  3NTN A;  1CSB A;  5KTB A;  5BVZ A;  1N7L A;  4I1L A;  1CW5 A;  1JTH B;  1JY3 O;  4LC1 A;  3M06 A;  3TNU A;  1LGH B;  4DOJ A;  1HWT C;  3BVH A;  2P1J A;  1CZQ A;  2KLV A;  1LTT C;  3RK3 B;  3RL0 D;  3II6 A;  3NXS A;  1NWQ A;  2XKM A;  2W27 A;  5KJ7 D;  3M91 A;  3B5N B;  3BRT B;  1RE3 C;  4EOT A;  1NTM K;  1JOC A;  2KP8 A;  3P8C E;  1HBW A;  2IFM A;  4I6M C;  1NTZ K;  3KPE A;  3VMX A;  1EQ7 A;  1GDT A;  1SQQ K;  1WT6 A;  3V5B A;  3GHG A;  3CLQ A;  2PAJ A;  2KSJ A;  2FFD A;  5AW1 B;  5CCG C;  2HYN A;  1J1D B;  2BAS A;  1A02 F;  2Q5U A;  1HGZ A;  4RES B;  3KQG A;  3RL0 B;  2N1T B;  1KIL B;  1L4A A;  3M0A A;  1GL2 C;  4W80 A;  2I1J A;  3HRN A;  1GTW A;  4WY4 D;  1JTH A;  1FOS E;  2NPS D;  1H89 A;  1LT9 B;  1J1E C;  3N4X A;  1PFI A;  1HJB A;  1IFM A;  4ZKP A;  1GU5 A;  3M9Q A;  2HG5 D;  3IR9 A;  2WIT A;  1JMM A;  1SLQ A;  2WSC H;  3U1C A;  2GM4 A;  2HPC A;  4Y99 B;  3TK1 A;  1LWU A;  3NMD A;  1VPC A;  3A2A A;  1N7S B;  2Q3I A;  3OJA B;  1MZ9 A;  1ZR2 A;  5AW0 B;  1FDM A;  2H43 A;  1JY2 O;  4LGD E;  2GUS A;  5AVT B;  5APW A;  1NHL A;  2R32 A;  5AVR B;  1GW4 A;  5KJ7 A;  3LW5 H;  1SFC C;  3VOP A;  3M9B A;  2OYH C;  5AW5 B;  1T8Z A;  1CI6 B;  3OAK A;  3P8C D;  1IC2 A;  4JF7 A;  4B86 A;  4N3Y B;  1ZV8 A;  1LT9 A;  5AW4 B;  4I2L C;  1URQ C;  1X79 B;  5APQ A;  1MFZ A;  3HD7 C;  3UIA A;  1M1J A;  3B5N D;  3OA7 A;  3E1I A;  4HH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...