1SVFA

Paramyxovirus sv5 fusion protein core
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
64
structure length
64
Chain Sequence
TAAVALVKANENAAAILNLKNAIQKTNAAVADVVQATQSLGTAVQAVQDHINSVVSPAITAANY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords PROTEIN (FUSION GLYCOPROTEIN)
publication title Structural basis for paramyxovirus-mediated membrane fusion.
pubmed doi rcsb
source organism Simian virus 5 (strain w3)
total genus 30
structure length 64
sequence length 64
chains with identical sequence C
ec nomenclature
pdb deposition date 1999-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.300 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1svfA00
4EIJA 1G2CA 1SVFA 4N6JA 2FYZA 1ZV8A 3EFGA 3SWYA 3KPEA
chains in the Genus database with same CATH superfamily
3O6QA 1SFCB 3N7NA 2R5BA 2WWWA 1KQGB 4N6JA 3BCCJ 5AW3B 1OWAA 1N7SD 3B5NA 2NPSA 3L73E 4IL6X 2DW3A 1ZRTD 1BSNA 3TDKA 1FAVA 1PGOA 3RL0C 2FYUE 2IZ1A 1BE3G 5B66E 2ITAA 3HUSA 5KLIC 1J1EB 5AVTB 2BCCJ 1L0NE 2QE7H 1FZCC 2FXMA 3AE2C 4NPFX 3VP8A 4EDFA 1BDCA 4AYCA 4IFDK 3P32A 2LR2A 1AJYA 1PP9J 1NHLA 2PP6A 5GTHH 3D6YA 1EDJA 1EZVD 1NYHA 1RE4A 1OVVA 3L74J 3KZIH 2KUBA 1LTSC 2QRXA 2ZT9B 1RH5B 2QJPB 2FXOA 4PJ0H 1JMBA 1URQA 2E76C 3L72D 3CWBG 3NXSA 3TGUD 2HYNA 1JMMA 2HR3A 2JO1A 2YMYA 2RKLA 2OYHA 2JKVA 1K73Q 1VQOP 1T3JA 5AW6B 3L75J 4WY4D 3GHGA 1OMIA 3I56P 1LT9A 1AQTA 1GW4A 5KLVD 1FDMA 2G8YA 2KK7A 1N2DC 1N73A 1P84H 4I2LC 3TGUE 2YKQA 5H2FH 5CCHD 1G2CB 1BGYD 2KLUA 4TLFA 2A06D 2H8PD 2Q9IA 1PPJD 2Q1KA 4DT0A 3CMEP 1Q81Q 2IZ0A 1EDIA 3H1JD 1KILC 1W2BO 1RHZB 1SQQD 4DJGA 5KLVE 1NTMD 4L76A 3CCVP 1USDA 2AXCA 1NU1D 1AQ5A 3VTPC 3L71E 5GTHE 3HE4A 1BGYE 1NTKJ 1PPJE 3KZIE 5KAIH 1Y9BA 2ZVNB 1HGVA 2XZRA 1KD1Q 4PJ0E 3H1JE 1YQ4C 1T8ZA 1SFCD 1EZVG 1P84D 3KPEA 4EYYQ 1NU1E 2W8ZA 3AE7C 2CK3H 3H1HD 3L72G 1W5CE 2AEJA 1T3UA 4OH8B 2SPZA 1JEKA 4AUWA 4LC1A 3TGUG 2HPCA 3L4FA 2O1KA 3O8ZA 2V7QJ 1K05A 1LTJB 2LKMA 1M8OB 3CPWO 5AW0B 3HUSC 1HJ0A 2WQYC 2KZIA 1FU1A 3H1HE 2Y9ZA 3M0DC 4ZKUA 5KLVG 3D6ZA 3USSA 1IFMA 3Q5PA 3CCRP 1BGYG 2A06G 4HH2A 3AEGC 1PPJG 3A3YB 3L36A 2K88A 1RQUA 1GU4A 1SQQK 2QM8A 4H44D 1JOCA 1NTMK 4OVNF 1JY2P 3SFDC 2E75B 1HUCA 2JP3A 3E1IA 5KAIE 1NU1K 1SQQG 1HBWA 1NTMG 3AE4C 1URQD 1GK6A 1GU5A 1NU1G 1S5LE 1YJNP 2YMKA 3G6EP 2KI7B 2BEZF 3Q3DA 3VMYA 4GODA 4M3LA 3ABVC 2I1KA 1BCCE 1PIXA 2WTYA 1NTZK 2A45G 1FS0E 4NPDA 3V5BA 3BRVB 3VMXA 3QWOC 3H1IJ 4UB6E 2OARA 3L70E 2RMZA 3PRJA 4U3FD 3H1HG 3WU2H 4GOEA 5APTA 2N1TA 3LIEA 3G9RA 2FYNB 2YO2A 3MUDC 1SQVE 1DIPA 1E5WA 4KT0J 1RF1C 1VF5D 1RE3C 2FXPA 3K5BA 2E5TA 2M5AA 5AW4B 1GL2A 1YBKA 5KKZB 2YKOA 4RO0A 1OIPA 2P2UA 3A2AA 1MFTA 2YIUB 1PFIA 1KYOE 3AEBC 1LWUA 1JTHA 2M0BA 1HWTC 1JY3N 2KNCA 3M9BA 1U7JA 1S72P 3E1RA 1ZW0A 1KFNA 2YO3A 4C7RA 4Y28J 3HTKB 1Q2NA 4N78E 4A7PA 4IL6H 4AQRD 2ZXXA 4LGDE 2FFDC 2OQQA 3JCUH 1VQ4P 1SQXE 5CCGC 1KZUB 3H1LD 3RK3C 3H6PA 1T6AA 1PGQA 4D6TJ 3KQGA 4DOJA 2K1AA 1K04A 2D2CC 4U3FG 5KJ7C 4TT3H 1FZCA 2QIWA 1RY3A 3H1KD 2G3AA 2HLOA 2Q3EA 2WPVB 3H1LE 3CX5E 5APXA 3QH9A 2BCCD 1WRGA 4I7ZB 2C0WA 1X8YA 4K3AA 1NKZB 2AEMA 1LGHB 3LW5J 1PP9D 3H1KE 2FKWB 1HTLC 1VQPP 3CCLP 1L4AC 1JUNA 4ASVA 3G4SP 3B4SA 1X22A 2LXBA 1JB0J 5AW9B 4EOTA 1AA0A 2BCCE 1KQFB 4IL6E 3C9IA 1CSBA 2PGDA 2N9YB 2XDJA 1MKMA 3JCUE 3RBXA 1PP9E 2JDIH 2WITA 1J1DC 4W80A 3F89A 5B5EE 2Q6QA 1L0LJ 2Y0CA 1KC8Q 4Z1MH 1FOSF 2B87B 1OX3A 1IFIA 5AW8B 3HD7B 1GMJA 2WZ7A 4ASWA 4IFMA 3VMZA 3H1LG 5APSA 3PH0A 2O01J 3F5HA 1VQ8P 1KILA 1NWQA 1VQ7P 1M1JC 1P84I 4OGQB 2YXQB 3LIDA 5TJHA 2HG5D 1QVGO 2K9JB 1VQNP 3H1KG 1FZGA 3BASA 1KB9E 3L73D 2CPBA 1Q7YQ 1IZNB 4R4MA 2FYUD 1KQSO 4IOIH 2NRGA 1DD3A 2P10A 4L73A 1DEEG 3SSUA 1HF9A 4R4LA 1L0ND 5APWA 1PP9G 1R5SA 5K5GB 2E74C 3O6QB 3V2RA 3RK2B 1SQPJ 2RN0A 1GDTA 1M57D 4O9BA 2Y0DA 1SQBJ 1UIXA 2UWJE 2IDBA 3B5NB 2NPSB 1N7SC 1M7LA 1LJ2A 3VOPA 2I1JA 1H88A 5AVSB 2QA4P 4GKGA 3M0DA 2GUVA 3HUSB 1OW8A 2WT7A 1J2JB 2QG4A 2W83C 4W7ZA 2WSEJ 4PV1B 1XTCC 2W27A 3M9HA 1E79H 3Q5SA 3E7KA 3HE5A 2QJKC 3Q1MA 3MGNA 4Y99B 3FXDA 5CJ4A 1IFNA 1NO4A 1Y47A 4MN4C 1KORA 4H44B 2BASA 5APQA 4H13B 4C7NA 1QLED 2WPSA 1URQB 2KSEA 2GA1A 3AE8C 1QEXA 1H0TA 3CL3D 1VQ5P 1JY2O 1NKNA 3A5TA 1BE3J 4BWNA 3S1KA 2FYUK 3L73G 1JY3P 2IX7C 5AVWB 1N8RQ 2M8RA 2OYHB 3V2QA 2Z5HA 2KS1A 1M1KQ 2FYUG 1KYOI 3WMM0 1L0NK 1QGKB 2J58A 1FZBA 1X0TA 3GHGB 3HD7D 2B89A 4WY4C 1LT9B 2KS1B 3L71D 3V2PA 1GD2E 1L0NG 3KHUA 3EWKA 1N73B 3VYIA 3U1CA 5CCHC 3MUDA 4OGQD 1M90Q 4GOFA 1RF1A 3OA7A 4K35A 2OYIC 4HKZH 3CWBJ 1RE3A 1PZQA 2Y9YA 3VN0A 1VF5B 3WUVA 2HODA 1G1JA 1K8AQ 3IF4A 4KHXA 1MV8A 3HE4B 1FZEA 3H1IE 4JF7A 1NOHA 3P7KA 1N7LA 2AXTH 1OW7A 2AEFA 1GZLA 4EIJA 1G1IA 1S5LH 3I5CA 1ZR4A 1KILE 3B8EB 2ZXEB 5GTIH 3RK2D 1SFCC 2Z4EA 5KAFE 2R44A 4UB6H 3B5ND 2NPSD 1IO4A 3IAOA 2JR8A 3MTUE 2WVRA 2HPCB 2FFDA 4H0LB 5KLVK 3H32A 3OAKA 5CCGA 1PV3A 2QEXP 5AVUB 3SFEC 2JWAA 2P1JA 1JCDA 4PV1D 1YJ9P 5APVA 1J1EC 2RH0A 1YI2P 2E43A 1LT1A 3LW5H 1NAYA 3L71G 5KJ7A 1VQKP 5BU5A 1BCCD 4WB4A 1EC5A 3H1JG 1LNQA 1IFPA 5AW7B 4H13D 3SWYA 2M3EA 2ZT9C 1D7MA 3L72J 2K37A 3TK1A 1KYOH 3A7OA 2QJPC 3L70D 2AXTE 1OXZA 2XNDH 1U57A 1L2PA 2J59M 1S9KD 2Q5UA 5APYA 1VPCA 1S4XA 4XFJA 4D6TE 5GTIE 1L4AA 4YPCA 3PLNA 1SQVD 5KLVJ 1EXJA 2WSFH 4ZKPA 3CC7P 2O01H 3MP7B 1VQMP 1DX7A 1KB9I 3PP5A 1S9KE 3G71P 3II6A 1NVOA 3AE1C 1BGYJ 2H89C 1JM0A 3CI9A 1KTMA 1U7MA 3AEAC 1LTTC 1IFDA 2V4HA 2O3JA 1FZAA 3L35A 1KYOD 1SQQJ 2N1TB 5BVZA 3D70A 1YQ3C 1NTMJ 2QVAA 3MD0A 1NU1J 5KTBA 3KYQA 2B88A 4JYCA 2KOGA 3CX5H 2PRRA 1JO5A 1M1JA 3S4RA 1IK9A 2M5AB 1XTGB 4N78D 2YKPA 1HVVA 1GL2B 1Q86Q 2ZAEB 2OTKE 2R5DA 2OTJP 1NTZJ 2C0XA 1SQXD 2Q3IA 3U1AA 1BCCG 4RJTA 1EXIA 1LWUB 3H1HJ 1L0LE 1JTHB 2JWDA 3AE9C 2KNCB 1KFMA 3L70G 2QJYB 2YXRB 1VQLP 1FE6A 4H0LD 4JBZA 2N9BA 3BVHA 1JNMA 1SQVK 2E42A 1EDLA 1LTJC 1K9MQ 3CCJP 1NH4A 1ZOYC 2PAJA 5B5EH 1SQVG 2ZFCA 2BEQD 3CX5D 3RK3D 3CCUP 3BCCD 3JSVC 1N7SA 1T2KD 1SQPD 3FGAD 3W67A 1Y8AA 2P7JA 3RL0B 3TNUA 1VQ9P 2VRSA 1VDFA 5AW1B 1FBMA 5KLIB 1FZCB 3RK3E 2E75C 5DJUB 4PD4H 3BCCE 2WPQA 3SWFA 1SQPE 2Y0EA 5CJ0A 1KB9H 2QJKB 1OW6A 1SQBE 3PJSK 1FJKA 1RQVA 2HFED 1SS1A 3MZWB 3AE6C 2J5UA 3L74D 1SQXK 2E76B 1M56D 1IJDB 3AE3C 2WSSH 1N86A 1SQXG 1YTZI 3AECC 4U3FJ 2QSIA 2OGUA 3L74E 2N1TD 1BE3D 4WY4A 3L75D 4PD4D 3W68A 4BRYA 2FYNC 1X79B 2ZYDA 1JY3O 5CBOA 5E79H 1KB9D 4I6MC 1A02F 4BRYB 5CCHA 1ZMEC 2KIKA 1VQ6P 3BCCG 4HJGH 1GL2D 2OYIA 3KXDA 1BE3E 5KKZC 2IFMA 3HRNA 5APUA 1KILB 1RF0C 3L75E 3CCMP 4PD4E 2YIUC 3R2PA 2IYOA 3CD6P 2V7QH 4W7YA 4RESB 3CCQP 2CPSA 2W6AA 3IR9A 1NTKD 2BCCG 1IC2A 3CC4P 1FDOA 2WSCJ 3Q2YA 3Q5RA 4WBAA 3FXEA 1KN7A 1SFCA 2MKVA 3C8VA 2FYZA 3EQ2A 3L74G 3H1LJ 2QM7A 3CWBE 3ITKA 2GM4A 2IBZD 1NTKE 2PFXA 3RL0D 3IN6A 3V4WA 3D71A 3FX0A 3B71A 2I8DA 5E79E 3M0AA 1QL1A 3NFQA 3H1KJ 1FOSE 3JC22 3L75G 2KB7P 2YNYA 2WT7B 1ZN5A 1PGPA 2IBZE 3GF7A 3P8CD 3HE5B 3M91A 1FDIA 4ZMDA 4C46A 3T97A 4I7ZC 2R32A 1ZRTE 2NZ2A 5CBNA 2E76D 1YIJP 2H43A 3T97B 1OVUA 2IFNA 2L5GB 3ZDMA 3CXHH 1AVYA 4ZNCA 2ZYAA 4C7NB 1LTGC 3P8CE 1R5LA 1NTKK 1S2EA 5M1BA 3CC2P 4XE5B 5KAFH 4WWIA 3PTZA 1H0TB 4XA4A 2ZJSE 1NTKG 2C9LY 5AVVB 1EQ7A 1WMKA 5AW5B 1EZVE 2XNXA 1TU3F 3NTNA 1DEBA 2WPRA 4NPEA 2WMMA 3L72E 1G2CA 2A45H 4DZOA 1NAFA 3H1ID 3HD7C 2IBZG 2FY8A 3I55P 1S1CX 1KILD 2XU6A 3U59A 3CXHD 3MHVA 1GK4A 1LTIC 4OGQC 3RBZA 1RF1B 3PHLA 2JEEA 3S9OA 1SVFA 3L73J 2M3BA 2P58A 2HODB 3KDPB 4JQ0D 2FYUJ 2A06E 1OZHA 1MZ9A 4UB8H 1WT6A 3CCEP 1ZLLA 3CXHE 2POHA 1L0NJ 2H88C 1A02J 3CX5I 1SQQE 1NTME 4CPGA 3N4XA 1NTZD 3RK2C 2W6BA 4OWFA 2O01N 5AVZB 3GW6A 3B5NC 1LTJA 3WUUA 3V6IA 2NPSC 1IK7A 1FJPA 1FC2C 1NGMB 2FFDB 3H32B 2KSJA 2O1JA 3A0BH 1P84E 1YTZT 3RK3B 3M9QA 5H2FE 1NTZE 1JCCA 1HJBA 1QVFO 4PV1C 2MJZA 2D2CB 4D6TD 3H1IG 5AVXB 4Y99C 2K9YA 4EI2A 1OVRA 4BXLA 2Q7CA 3P8MC 2GUSA 2ZT9D 4H44C 1RE4C 3EFFK 2XV5A 3TGUJ 3RL0g 2ZYGA 4H13C 4UB8E 3TYYA 1URQC 3FWLA 1GTWA 4HYTB 1LP1A 2OTLP 3MIWA 4GIFA 4QMAA 5L8RJ 4PD4I 4YTPC 4WVZA 2OYHC 1LP1B 1L4AB 4HB1A 1W2EA 3L71J 4IFFA 4GDOA 3GHGC 1KMIZ 1HH0A 5AVQB 1LT9C 1ZXGA 4L74A 1NTZG 1N73C 3AE5C 3H1JJ 3VP9A 4KJMA 3A0BE 1J1DB 1YITP 4L75A 4JYBA 3V4QA 1L0LD 1OFCX 1KV4A 2WSCH 2KYVA 1VF5C 2KLVA 3G3ZA 1CI6A 4B86A 1EDKA 2W90A 1RF0A 4LLHA 2ZVOB 4U3FE 1Q90D 1M1JB 2R3CA 4D6TG 1CI6B 2IYPA 1PGJA 3BRTB 2FBWC 4DCKA 3GLMA 3VMAA 2JJLA 2IBZI 5CMZA 2L91A 2KP8A 5AVRB 4JPZB 5C39A 1CZQA 1MFZA 1NJIQ 1Z56A 3HTKA 1S5LX 1YYCA 3CMAP 2WSEH 1VL2A 3CCSP 2KZJA 3M06A 5CCGD 4H0LC 2B9BA 2E74B 1FZFA 1R8EA 3GMAA 1H89A 1DD4A 1ZP0C 1KQLA 3OJAB 3GF3A 1UIIA 3RGUA 1QX8A 1AFOA 3IFMA 1BSHA 2D2CD 1QL2A 3WU2E 3NMDA 1SQBD 3A0HH 5KJ7D 1N7SB 2OYOA 1Q82Q 3UIAA 1T2KC 4I1LA 1BCCJ 1EZVI 3TNUB 5CHXA 2KXPB 3R4YA 3SWKA 1L0LK 3L70J 2E75D 1BDDA 1SLQA 5TISH 1L0LG 3AEEC 3WUTA 1H8AA 3AEDC 4GT1A 1L4AD 1MUUA 1SQVJ 2LXCB 5AVYB 2E5YA 3OW2O 1ZV8A 1LTAC 1ZR2A 5AW2B 3TF5A 2P67A 1AV1A 3AEFC 1HGZA 3FWNA 1LTBC 1SP4A 3CXHI 1USEA 2B87A 3H25A 4WY4B 2N1TC 3HD7A 2Z5IA 3A0HE 5B66H 1SQPK 1AVOA 3V2NA 2R3SA 3L37A 1PL5A 1SQBK 2K3RA 1CW5A 1JY2N 1SQPG 1S3JA 4N3YB 1GW3A 1SQBG 2WSFJ 2IPPA 2OYIB 3EFGA 5EFWB 2A45I 2C9NY 1GL2C 3C1LA 1SQXJ 5TISE 2XKMA 2K9JA 3CWBD 3CLQA 3BATA 2W6JH 1LWUC 3TSIA 4YXDC 5BU8B 1DH3A 2QJYC 4RKUJ 1X9VA 5DJTB 3GG2A 1YHQP 2H7HA 4YXWH 2E74D 1YJWP 4U7JA 1IFJA
chains in the Genus database with same CATH topology
2HLOA 1RF1B 1SFCB 2WSFH 3N7NA 2R5BA 4ZKPA 2JEEA 2O01H 2WWWA 1SVFA 1DX7A 4N6JA 3PP5A 2M3BA 1S9KE 3II6A 5AW3B 5APXA 3CI9A 1OWAA 1N7SD 2HODB 3B5NA 2NPSA 3KDPB 1WRGA 2C0WA 1X8YA 1LTTC 1MZ9A 1IFDA 1FAVA 1NKZB 1WT6A 3RL0C 1LGHB 1FZAA 1ZLLA 3L35A 3HUSA 2FKWB 2N1TB 2POHA 5BVZA 1HTLC 1A02J 1L4AC 1JUNA 3MD0A 1J1EB 5AVTB 1FZCC 2FXMA 5KTBA 5AW9B 3KYQA 3N4XA 4EOTA 3RK2C 4JYCA 3VP8A 2KOGA 2W6BA 4AYCA 4IFDK 3P32A 1JO5A 1M1JA 3C9IA 1NHLA 1CSBA 2PP6A 5AVZB 1IK9A 2XDJA 1XTGB 4N78D 2YKPA 1HVVA 1LTJA 3B5NC 1GL2B 1RE4A 2NPSC 1FJPA 1LTSC 2R5DA 2WITA 1J1DC 2FFDB 4W80A 3H32B 2KSJA 2C0XA 2Q3IA 3U1AA 1FOSF 2O1JA 1URQA 1IFIA 1YTZT 3RK3B 3M9QA 1LWUB 5AW8B 1JTHB 1JCCA 3HD7B 1HJBA 2WZ7A 4IFMA 1KFMA 3NXSA 3VMZA 2HYNA 5APSA 1JMMA 2MJZA 2YMYA 5AVXB 2OYHA 4Y99C 1KILA 1T3JA 2N9BA 1NWQA 5AW6B 3BVHA 1JNMA 1M1JC 1SQVK 2E42A 2Q7CA 4WY4D 1IFJA 3P8MC 3LIDA 2GUSA 3GHGA 1LTJC 1RE4C 1LT9A 1NH4A 1GW4A 2XV5A 2PAJA 2HG5D 1FDMA 2ZFCA 3RK3D 1FZGA 1N2DC 1N73A 4I2LC 2YKQA 3BASA 3TYYA 2CPBA 1URQC 5CCHD 1N7SA 1G2CB 1T2KD 1GTWA 2H8PD 4HYTB 2Q9IA 2P7JA 3MIWA 4GIFA 3RL0B 3TNUA 2VRSA 1VDFA 2OYHC 5AW1B 1L4AB 1FBMA 1KILC 1W2EA 1FZCB 5APWA 4IFFA 3V2RA 3RK2B 3GHGC 1AQ5A 2WPQA 1HH0A 5AVQB 1LT9C 3VTPC 3SWFA 1GDTA 3HE4A 4O9BA 5CJ0A 1HGVA 1N73C 3B5NB 2XZRA 2NPSB 1N7SC 3VP9A 1M7LA 1J1DB 1FJKA 2HFED 3VOPA 2I1JA 1H88A 5AVSB 4JYBA 3V4QA 1T8ZA 1SFCD 1SQXK 4GKGA 3M0DA 2GUVA 3KPEA 1IJDB 3HUSB 2WT7A 1J2JB 1N86A 2WSCH 4W7ZA 1YTZI 2KYVA 1XTCC 2W27A 3M9HA 2KLVA 3HE5A 3G3ZA 1CI6A 1T3UA 4OH8B 4B86A 3MGNA 4AUWA 4Y99B 1RF0A 4LLHA 4LC1A 5CJ4A 2HPCA 3L4FA 2O1KA 3O8ZA 1M1JB 1IFNA 1NO4A 2R3CA 1CI6B 2N1TD 4WY4A 1LTJB 2LKMA 3BRTB 5AW0B 3HUSC 2BASA 1X79B 5APQA 1JY3O 2JJLA 5CMZA 4C7NA 2KP8A 2WPSA 1FU1A 5AVRB 3M0DC 4I6MC 1URQB 1A02F 1CZQA 4ZKUA 1MFZA 1Z56A 5CCHA 3HTKA 3CL3D 1JY2O 1NKNA 3A5TA 1IFMA 1YYCA 2WSEH 2FYUK 1GL2D 1JY3P 2IX7C 5AVWB 2OYIA 2M8RA 4HH2A 2OYHB 2IFMA 3HRNA 5APUA 3A3YB 1KILB 3L36A 3V2QA 2Z5HA 1RF0C 3M06A 1GU4A 1SQQK 5CCGD 2QM8A 3WMM0 1L0NK 1JOCA 1NTMK 1FZFA 1JY2P 3R2PA 2J58A 1HUCA 1H89A 1FZBA 3GHGB 3HD7D 4WY4C 1KQLA 3E1IA 4W7YA 1NU1K 1LT9B 4RESB 1HBWA 3OJAB 3V2PA 1GD2E 2CPSA 1AFOA 2W6AA 1URQD 3IR9A 3IFMA 1N73B 1GK6A 1QL2A 1GU5A 3NMDA 5KJ7D 1IC2A 1N7SB 3VYIA 3U1CA 5CCHC 3UIAA 1T2KC 3MUDA 4I1LA 4WBAA 3TNUB 3VMYA 5CHXA 4M3LA 1RF1A 3OA7A 1SFCA 2I1KA 2OYIC 2FYZA 1L0LK 2WTYA 1NTZK 3EQ2A 1RE3A 2A45G 3VN0A 1SLQA 3V5BA 3BRVB 2QM7A 3VMXA 2GM4A 2OARA 2HODA 1G1JA 4KHXA 1MV8A 3HE4B 1FZEA 4JF7A 3RL0D 1NOHA 1H8AA 3P7KA 1N7LA 3V4WA 5APTA 1GZLA 4EIJA 1G1IA 3I5CA 4GT1A 2N1TA 1ZR4A 1L4AD 3LIEA 1MUUA 3M0AA 1QL1A 3NFQA 3B8EB 2YO2A 2ZXEB 5AVYB 1FOSE 3RK2D 1ZV8A 1E5WA 1LTAC 1ZR2A 5AW2B 1RF1C 1SFCC 2KB7P 2YNYA 2Z4EA 2WT7B 1ZN5A 2P67A 1RE3C 3P8CD 3B5ND 3HE5B 2NPSD 3M91A 1HGZA 1IO4A 3MTUE 1LTBC 5AW4B 1GL2A 4C46A 1SP4A 2YKOA 3T97A 2R32A 2P2UA 2HPCB 2FFDA 5KLVK 3H32A 3A2AA 3OAKA 5CCGA 1PFIA 5AVUB 2H43A 4WY4B 2N1TC 2P1JA 1LWUA 1JTHA 2IFNA 2L5GB 1HWTC 3HD7A 1JCDA 1JY3N 3M9BA 2Z5IA 5APVA 1SQPK 1J1EC 3V2NA 2E43A 4C7NB 1KFNA 1LTGC 2YO3A 3P8CE 4C7RA 3L37A 1NTKK 3LW5H 4XE5B 1SQBK 1CW5A 1JY2N 5KJ7A 3HTKB 4XA4A 4N3YB 2C9LY 1GW3A 5AVVB 5BU5A 1EQ7A 2IPPA 2OYIB 3EFGA 4N78E 5AW5B 2A45I 4WB4A 1GL2C 2C9NY 2XNXA 2XKMA 4AQRD 5AW7B 3SWYA 3NTNA 4LGDE 2FFDC 1DEBA 3TK1A 2WPRA 3A7OA 3CLQA 5CCGC 1KZUB 3BATA 1OXZA 2J59M 1G2CA 3RK3C 3H6PA 2A45H 4DZOA 1LWUC 1NAFA 3TSIA 1S9KD 3HD7C 2Q5UA 5APYA 1VPCA 5BU8B 3KQGA 4DOJA 1DH3A 1X9VA 1KILD 2XU6A 3U59A 2H7HA 1L4AA 5KJ7C 1FZCA 1GK4A 1RY3A 1LTIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EIJ A;  1G2C A;  1SVF A;  4N6J A;  2FYZ A;  1ZV8 A;  3EFG A;  3SWY A;  3KPE A; 
#chains in the Genus database with same CATH topology
 3O6Q A;  1SFC B;  3N7N A;  2R5B A;  2WWW A;  1KQG B;  4N6J A;  3BCC J;  5AW3 B;  1OWA A;  1N7S D;  3B5N A;  2NPS A;  3L73 E;  4IL6 X;  2DW3 A;  1ZRT D;  1BSN A;  3TDK A;  1FAV A;  1PGO A;  3RL0 C;  2FYU E;  2IZ1 A;  1BE3 G;  5B66 E;  2ITA A;  3HUS A;  5KLI C;  1J1E B;  5AVT B;  2BCC J;  1L0N E;  2QE7 H;  1FZC C;  2FXM A;  3AE2 C;  4NPF X;  3VP8 A;  4EDF A;  1BDC A;  4AYC A;  4IFD K;  3P32 A;  2LR2 A;  1AJY A;  1PP9 J;  1NHL A;  2PP6 A;  5GTH H;  3D6Y A;  1EDJ A;  1EZV D;  1NYH A;  1RE4 A;  1OVV A;  3L74 J;  3KZI H;  2KUB A;  1LTS C;  2QRX A;  2ZT9 B;  1RH5 B;  2QJP B;  2FXO A;  4PJ0 H;  1JMB A;  1URQ A;  2E76 C;  3L72 D;  3CWB G;  3NXS A;  3TGU D;  2HYN A;  1JMM A;  2HR3 A;  2JO1 A;  2YMY A;  2RKL A;  2OYH A;  2JKV A;  1K73 Q;  1VQO P;  1T3J A;  5AW6 B;  3L75 J;  4WY4 D;  3GHG A;  1OMI A;  3I56 P;  1LT9 A;  1AQT A;  1GW4 A;  5KLV D;  1FDM A;  2G8Y A;  2KK7 A;  1N2D C;  1N73 A;  1P84 H;  4I2L C;  3TGU E;  2YKQ A;  5H2F H;  5CCH D;  1G2C B;  1BGY D;  2KLU A;  4TLF A;  2A06 D;  2H8P D;  2Q9I A;  1PPJ D;  2Q1K A;  4DT0 A;  3CME P;  1Q81 Q;  2IZ0 A;  1EDI A;  3H1J D;  1KIL C;  1W2B O;  1RHZ B;  1SQQ D;  4DJG A;  5KLV E;  1NTM D;  4L76 A;  3CCV P;  1USD A;  2AXC A;  1NU1 D;  1AQ5 A;  3VTP C;  3L71 E;  5GTH E;  3HE4 A;  1BGY E;  1NTK J;  1PPJ E;  3KZI E;  5KAI H;  1Y9B A;  2ZVN B;  1HGV A;  2XZR A;  1KD1 Q;  4PJ0 E;  3H1J E;  1YQ4 C;  1T8Z A;  1SFC D;  1EZV G;  1P84 D;  3KPE A;  4EYY Q;  1NU1 E;  2W8Z A;  3AE7 C;  2CK3 H;  3H1H D;  3L72 G;  1W5C E;  2AEJ A;  1T3U A;  4OH8 B;  2SPZ A;  1JEK A;  4AUW A;  4LC1 A;  3TGU G;  2HPC A;  3L4F A;  2O1K A;  3O8Z A;  2V7Q J;  1K05 A;  1LTJ B;  2LKM A;  1M8O B;  3CPW O;  5AW0 B;  3HUS C;  1HJ0 A;  2WQY C;  2KZI A;  1FU1 A;  3H1H E;  2Y9Z A;  3M0D C;  4ZKU A;  5KLV G;  3D6Z A;  3USS A;  1IFM A;  3Q5P A;  3CCR P;  1BGY G;  2A06 G;  4HH2 A;  3AEG C;  1PPJ G;  3A3Y B;  3L36 A;  2K88 A;  1RQU A;  1GU4 A;  1SQQ K;  2QM8 A;  4H44 D;  1JOC A;  1NTM K;  4OVN F;  1JY2 P;  3SFD C;  2E75 B;  1HUC A;  2JP3 A;  3E1I A;  5KAI E;  1NU1 K;  1SQQ G;  1HBW A;  1NTM G;  3AE4 C;  1URQ D;  1GK6 A;  1GU5 A;  1NU1 G;  1S5L E;  1YJN P;  2YMK A;  3G6E P;  2KI7 B;  2BEZ F;  3Q3D A;  3VMY A;  4GOD A;  4M3L A;  3ABV C;  2I1K A;  1BCC E;  1PIX A;  2WTY A;  1NTZ K;  2A45 G;  1FS0 E;  4NPD A;  3V5B A;  3BRV B;  3VMX A;  3QWO C;  3H1I J;  4UB6 E;  2OAR A;  3L70 E;  2RMZ A;  3PRJ A;  4U3F D;  3H1H G;  3WU2 H;  4GOE A;  5APT A;  2N1T A;  3LIE A;  3G9R A;  2FYN B;  2YO2 A;  3MUD C;  1SQV E;  1DIP A;  1E5W A;  4KT0 J;  1RF1 C;  1VF5 D;  1RE3 C;  2FXP A;  3K5B A;  2E5T A;  2M5A A;  5AW4 B;  1GL2 A;  1YBK A;  5KKZ B;  2YKO A;  4RO0 A;  1OIP A;  2P2U A;  3A2A A;  1MFT A;  2YIU B;  1PFI A;  1KYO E;  3AEB C;  1LWU A;  1JTH A;  2M0B A;  1HWT C;  1JY3 N;  2KNC A;  3M9B A;  1U7J A;  1S72 P;  3E1R A;  1ZW0 A;  1KFN A;  2YO3 A;  4C7R A;  4Y28 J;  3HTK B;  1Q2N A;  4N78 E;  4A7P A;  4IL6 H;  4AQR D;  2ZXX A;  4LGD E;  2FFD C;  2OQQ A;  3JCU H;  1VQ4 P;  1SQX E;  5CCG C;  1KZU B;  3H1L D;  3RK3 C;  3H6P A;  1T6A A;  1PGQ A;  4D6T J;  3KQG A;  4DOJ A;  2K1A A;  1K04 A;  2D2C C;  4U3F G;  5KJ7 C;  4TT3 H;  1FZC A;  2QIW A;  1RY3 A;  3H1K D;  2G3A A;  2HLO A;  2Q3E A;  2WPV B;  3H1L E;  3CX5 E;  5APX A;  3QH9 A;  2BCC D;  1WRG A;  4I7Z B;  2C0W A;  1X8Y A;  4K3A A;  1NKZ B;  2AEM A;  1LGH B;  3LW5 J;  1PP9 D;  3H1K E;  2FKW B;  1HTL C;  1VQP P;  3CCL P;  1L4A C;  1JUN A;  4ASV A;  3G4S P;  3B4S A;  1X22 A;  2LXB A;  1JB0 J;  5AW9 B;  4EOT A;  1AA0 A;  2BCC E;  1KQF B;  4IL6 E;  3C9I A;  1CSB A;  2PGD A;  2N9Y B;  2XDJ A;  1MKM A;  3JCU E;  3RBX A;  1PP9 E;  2JDI H;  2WIT A;  1J1D C;  4W80 A;  3F89 A;  5B5E E;  2Q6Q A;  1L0L J;  2Y0C A;  1KC8 Q;  4Z1M H;  1FOS F;  2B87 B;  1OX3 A;  1IFI A;  5AW8 B;  3HD7 B;  1GMJ A;  2WZ7 A;  4ASW A;  4IFM A;  3VMZ A;  3H1L G;  5APS A;  3PH0 A;  2O01 J;  3F5H A;  1VQ8 P;  1KIL A;  1NWQ A;  1VQ7 P;  1M1J C;  1P84 I;  4OGQ B;  2YXQ B;  3LID A;  5TJH A;  2HG5 D;  1QVG O;  2K9J B;  1VQN P;  3H1K G;  1FZG A;  3BAS A;  1KB9 E;  3L73 D;  2CPB A;  1Q7Y Q;  1IZN B;  4R4M A;  2FYU D;  1KQS O;  4IOI H;  2NRG A;  1DD3 A;  2P10 A;  4L73 A;  1DEE G;  3SSU A;  1HF9 A;  4R4L A;  1L0N D;  5APW A;  1PP9 G;  1R5S A;  5K5G B;  2E74 C;  3O6Q B;  3V2R A;  3RK2 B;  1SQP J;  2RN0 A;  1GDT A;  1M57 D;  4O9B A;  2Y0D A;  1SQB J;  1UIX A;  2UWJ E;  2IDB A;  3B5N B;  2NPS B;  1N7S C;  1M7L A;  1LJ2 A;  3VOP A;  2I1J A;  1H88 A;  5AVS B;  2QA4 P;  4GKG A;  3M0D A;  2GUV A;  3HUS B;  1OW8 A;  2WT7 A;  1J2J B;  2QG4 A;  2W83 C;  4W7Z A;  2WSE J;  4PV1 B;  1XTC C;  2W27 A;  3M9H A;  1E79 H;  3Q5S A;  3E7K A;  3HE5 A;  2QJK C;  3Q1M A;  3MGN A;  4Y99 B;  3FXD A;  5CJ4 A;  1IFN A;  1NO4 A;  1Y47 A;  4MN4 C;  1KOR A;  4H44 B;  2BAS A;  5APQ A;  4H13 B;  4C7N A;  1QLE D;  2WPS A;  1URQ B;  2KSE A;  2GA1 A;  3AE8 C;  1QEX A;  1H0T A;  3CL3 D;  1VQ5 P;  1JY2 O;  1NKN A;  3A5T A;  1BE3 J;  4BWN A;  3S1K A;  2FYU K;  3L73 G;  1JY3 P;  2IX7 C;  5AVW B;  1N8R Q;  2M8R A;  2OYH B;  3V2Q A;  2Z5H A;  2KS1 A;  1M1K Q;  2FYU G;  1KYO I;  3WMM 0;  1L0N K;  1QGK B;  2J58 A;  1FZB A;  1X0T A;  3GHG B;  3HD7 D;  2B89 A;  4WY4 C;  1LT9 B;  2KS1 B;  3L71 D;  3V2P A;  1GD2 E;  1L0N G;  3KHU A;  3EWK A;  1N73 B;  3VYI A;  3U1C A;  5CCH C;  3MUD A;  4OGQ D;  1M90 Q;  4GOF A;  1RF1 A;  3OA7 A;  4K35 A;  2OYI C;  4HKZ H;  3CWB J;  1RE3 A;  1PZQ A;  2Y9Y A;  3VN0 A;  1VF5 B;  3WUV A;  2HOD A;  1G1J A;  1K8A Q;  3IF4 A;  4KHX A;  1MV8 A;  3HE4 B;  1FZE A;  3H1I E;  4JF7 A;  1NOH A;  3P7K A;  1N7L A;  2AXT H;  1OW7 A;  2AEF A;  1GZL A;  4EIJ A;  1G1I A;  1S5L H;  3I5C A;  1ZR4 A;  1KIL E;  3B8E B;  2ZXE B;  5GTI H;  3RK2 D;  1SFC C;  2Z4E A;  5KAF E;  2R44 A;  4UB6 H;  3B5N D;  2NPS D;  1IO4 A;  3IAO A;  2JR8 A;  3MTU E;  2WVR A;  2HPC B;  2FFD A;  4H0L B;  5KLV K;  3H32 A;  3OAK A;  5CCG A;  1PV3 A;  2QEX P;  5AVU B;  3SFE C;  2JWA A;  2P1J A;  1JCD A;  4PV1 D;  1YJ9 P;  5APV A;  1J1E C;  2RH0 A;  1YI2 P;  2E43 A;  1LT1 A;  3LW5 H;  1NAY A;  3L71 G;  5KJ7 A;  1VQK P;  5BU5 A;  1BCC D;  4WB4 A;  1EC5 A;  3H1J G;  1LNQ A;  1IFP A;  5AW7 B;  4H13 D;  3SWY A;  2M3E A;  2ZT9 C;  1D7M A;  3L72 J;  2K37 A;  3TK1 A;  1KYO H;  3A7O A;  2QJP C;  3L70 D;  2AXT E;  1OXZ A;  2XND H;  1U57 A;  1L2P A;  2J59 M;  1S9K D;  2Q5U A;  5APY A;  1VPC A;  1S4X A;  4XFJ A;  4D6T E;  5GTI E;  1L4A A;  4YPC A;  3PLN A;  1SQV D;  5KLV J;  1EXJ A;  2WSF H;  4ZKP A;  3CC7 P;  2O01 H;  3MP7 B;  1VQM P;  1DX7 A;  1KB9 I;  3PP5 A;  1S9K E;  3G71 P;  3II6 A;  1NVO A;  3AE1 C;  1BGY J;  2H89 C;  1JM0 A;  3CI9 A;  1KTM A;  1U7M A;  3AEA C;  1LTT C;  1IFD A;  2V4H A;  2O3J A;  1FZA A;  3L35 A;  1KYO D;  1SQQ J;  2N1T B;  5BVZ A;  3D70 A;  1YQ3 C;  1NTM J;  2QVA A;  3MD0 A;  1NU1 J;  5KTB A;  3KYQ A;  2B88 A;  4JYC A;  2KOG A;  3CX5 H;  2PRR A;  1JO5 A;  1M1J A;  3S4R A;  1IK9 A;  2M5A B;  1XTG B;  4N78 D;  2YKP A;  1HVV A;  1GL2 B;  1Q86 Q;  2ZAE B;  2OTK E;  2R5D A;  2OTJ P;  1NTZ J;  2C0X A;  1SQX D;  2Q3I A;  3U1A A;  1BCC G;  4RJT A;  1EXI A;  1LWU B;  3H1H J;  1L0L E;  1JTH B;  2JWD A;  3AE9 C;  2KNC B;  1KFM A;  3L70 G;  2QJY B;  2YXR B;  1VQL P;  1FE6 A;  4H0L D;  4JBZ A;  2N9B A;  3BVH A;  1JNM A;  1SQV K;  2E42 A;  1EDL A;  1LTJ C;  1K9M Q;  3CCJ P;  1NH4 A;  1ZOY C;  2PAJ A;  5B5E H;  1SQV G;  2ZFC A;  2BEQ D;  3CX5 D;  3RK3 D;  3CCU P;  3BCC D;  3JSV C;  1N7S A;  1T2K D;  1SQP D;  3FGA D;  3W67 A;  1Y8A A;  2P7J A;  3RL0 B;  3TNU A;  1VQ9 P;  2VRS A;  1VDF A;  5AW1 B;  1FBM A;  5KLI B;  1FZC B;  3RK3 E;  2E75 C;  5DJU B;  4PD4 H;  3BCC E;  2WPQ A;  3SWF A;  1SQP E;  2Y0E A;  5CJ0 A;  1KB9 H;  2QJK B;  1OW6 A;  1SQB E;  3PJS K;  1FJK A;  1RQV A;  2HFE D;  1SS1 A;  3MZW B;  3AE6 C;  2J5U A;  3L74 D;  1SQX K;  2E76 B;  1M56 D;  1IJD B;  3AE3 C;  2WSS H;  1N86 A;  1SQX G;  1YTZ I;  3AEC C;  4U3F J;  2QSI A;  2OGU A;  3L74 E;  2N1T D;  1BE3 D;  4WY4 A;  3L75 D;  4PD4 D;  3W68 A;  4BRY A;  2FYN C;  1X79 B;  2ZYD A;  1JY3 O;  5CBO A;  5E79 H;  1KB9 D;  4I6M C;  1A02 F;  4BRY B;  5CCH A;  1ZME C;  2KIK A;  1VQ6 P;  3BCC G;  4HJG H;  1GL2 D;  2OYI A;  3KXD A;  1BE3 E;  5KKZ C;  2IFM A;  3HRN A;  5APU A;  1KIL B;  1RF0 C;  3L75 E;  3CCM P;  4PD4 E;  2YIU C;  3R2P A;  2IYO A;  3CD6 P;  2V7Q H;  4W7Y A;  4RES B;  3CCQ P;  2CPS A;  2W6A A;  3IR9 A;  1NTK D;  2BCC G;  1IC2 A;  3CC4 P;  1FDO A;  2WSC J;  3Q2Y A;  3Q5R A;  4WBA A;  3FXE A;  1KN7 A;  1SFC A;  2MKV A;  3C8V A;  2FYZ A;  3EQ2 A;  3L74 G;  3H1L J;  2QM7 A;  3CWB E;  3ITK A;  2GM4 A;  2IBZ D;  1NTK E;  2PFX A;  3RL0 D;  3IN6 A;  3V4W A;  3D71 A;  3FX0 A;  3B71 A;  2I8D A;  5E79 E;  3M0A A;  1QL1 A;  3NFQ A;  3H1K J;  1FOS E;  3JC2 2;  3L75 G;  2KB7 P;  2YNY A;  2WT7 B;  1ZN5 A;  1PGP A;  2IBZ E;  3GF7 A;  3P8C D;  3HE5 B;  3M91 A;  1FDI A;  4ZMD A;  4C46 A;  3T97 A;  4I7Z C;  2R32 A;  1ZRT E;  2NZ2 A;  5CBN A;  2E76 D;  1YIJ P;  2H43 A;  3T97 B;  1OVU A;  2IFN A;  2L5G B;  3ZDM A;  3CXH H;  1AVY A;  4ZNC A;  2ZYA A;  4C7N B;  1LTG C;  3P8C E;  1R5L A;  1NTK K;  1S2E A;  5M1B A;  3CC2 P;  4XE5 B;  5KAF H;  4WWI A;  3PTZ A;  1H0T B;  4XA4 A;  2ZJS E;  1NTK G;  2C9L Y;  5AVV B;  1EQ7 A;  1WMK A;  5AW5 B;  1EZV E;  2XNX A;  1TU3 F;  3NTN A;  1DEB A;  2WPR A;  4NPE A;  2WMM A;  3L72 E;  1G2C A;  2A45 H;  4DZO A;  1NAF A;  3H1I D;  3HD7 C;  2IBZ G;  2FY8 A;  3I55 P;  1S1C X;  1KIL D;  2XU6 A;  3U59 A;  3CXH D;  3MHV A;  1GK4 A;  1LTI C;  4OGQ C;  3RBZ A;  1RF1 B;  3PHL A;  2JEE A;  3S9O A;  1SVF A;  3L73 J;  2M3B A;  2P58 A;  2HOD B;  3KDP B;  4JQ0 D;  2FYU J;  2A06 E;  1OZH A;  1MZ9 A;  4UB8 H;  1WT6 A;  3CCE P;  1ZLL A;  3CXH E;  2POH A;  1L0N J;  2H88 C;  1A02 J;  3CX5 I;  1SQQ E;  1NTM E;  4CPG A;  3N4X A;  1NTZ D;  3RK2 C;  2W6B A;  4OWF A;  2O01 N;  5AVZ B;  3GW6 A;  3B5N C;  1LTJ A;  3WUU A;  3V6I A;  2NPS C;  1IK7 A;  1FJP A;  1FC2 C;  1NGM B;  2FFD B;  3H32 B;  2KSJ A;  2O1J A;  3A0B H;  1P84 E;  1YTZ T;  3RK3 B;  3M9Q A;  5H2F E;  1NTZ E;  1JCC A;  1HJB A;  1QVF O;  4PV1 C;  2MJZ A;  2D2C B;  4D6T D;  3H1I G;  5AVX B;  4Y99 C;  2K9Y A;  4EI2 A;  1OVR A;  4BXL A;  2Q7C A;  3P8M C;  2GUS A;  2ZT9 D;  4H44 C;  1RE4 C;  3EFF K;  2XV5 A;  3TGU J;  3RL0 g;  2ZYG A;  4H13 C;  4UB8 E;  3TYY A;  1URQ C;  3FWL A;  1GTW A;  4HYT B;  1LP1 A;  2OTL P;  3MIW A;  4GIF A;  4QMA A;  5L8R J;  4PD4 I;  4YTP C;  4WVZ A;  2OYH C;  1LP1 B;  1L4A B;  4HB1 A;  1W2E A;  3L71 J;  4IFF A;  4GDO A;  3GHG C;  1KMI Z;  1HH0 A;  5AVQ B;  1LT9 C;  1ZXG A;  4L74 A;  1NTZ G;  1N73 C;  3AE5 C;  3H1J J;  3VP9 A;  4KJM A;  3A0B E;  1J1D B;  1YIT P;  4L75 A;  4JYB A;  3V4Q A;  1L0L D;  1OFC X;  1KV4 A;  2WSC H;  2KYV A;  1VF5 C;  2KLV A;  3G3Z A;  1CI6 A;  4B86 A;  1EDK A;  2W90 A;  1RF0 A;  4LLH A;  2ZVO B;  4U3F E;  1Q90 D;  1M1J B;  2R3C A;  4D6T G;  1CI6 B;  2IYP A;  1PGJ A;  3BRT B;  2FBW C;  4DCK A;  3GLM A;  3VMA A;  2JJL A;  2IBZ I;  5CMZ A;  2L91 A;  2KP8 A;  5AVR B;  4JPZ B;  5C39 A;  1CZQ A;  1MFZ A;  1NJI Q;  1Z56 A;  3HTK A;  1S5L X;  1YYC A;  3CMA P;  2WSE H;  1VL2 A;  3CCS P;  2KZJ A;  3M06 A;  5CCG D;  4H0L C;  2B9B A;  2E74 B;  1FZF A;  1R8E A;  3GMA A;  1H89 A;  1DD4 A;  1ZP0 C;  1KQL A;  3OJA B;  3GF3 A;  1UII A;  3RGU A;  1QX8 A;  1AFO A;  3IFM A;  1BSH A;  2D2C D;  1QL2 A;  3WU2 E;  3NMD A;  1SQB D;  3A0H H;  5KJ7 D;  1N7S B;  2OYO A;  1Q82 Q;  3UIA A;  1T2K C;  4I1L A;  1BCC J;  1EZV I;  3TNU B;  5CHX A;  2KXP B;  3R4Y A;  3SWK A;  1L0L K;  3L70 J;  2E75 D;  1BDD A;  1SLQ A;  5TIS H;  1L0L G;  3AEE C;  3WUT A;  1H8A A;  3AED C;  4GT1 A;  1L4A D;  1MUU A;  1SQV J;  2LXC B;  5AVY B;  2E5Y A;  3OW2 O;  1ZV8 A;  1LTA C;  1ZR2 A;  5AW2 B;  3TF5 A;  2P67 A;  1AV1 A;  3AEF C;  1HGZ A;  3FWN A;  1LTB C;  1SP4 A;  3CXH I;  1USE A;  2B87 A;  3H25 A;  4WY4 B;  2N1T C;  3HD7 A;  2Z5I A;  3A0H E;  5B66 H;  1SQP K;  1AVO A;  3V2N A;  2R3S A;  3L37 A;  1PL5 A;  1SQB K;  2K3R A;  1CW5 A;  1JY2 N;  1SQP G;  1S3J A;  4N3Y B;  1GW3 A;  1SQB G;  2WSF J;  2IPP A;  2OYI B;  3EFG A;  5EFW B;  2A45 I;  2C9N Y;  1GL2 C;  3C1L A;  1SQX J;  5TIS E;  2XKM A;  2K9J A;  3CWB D;  3CLQ A;  3BAT A;  2W6J H;  1LWU C;  3TSI A;  4YXD C;  5BU8 B;  1DH3 A;  2QJY C;  4RKU J;  1X9V A;  5DJT B;  3GG2 A;  1YHQ P;  2H7H A;  4YXW H;  2E74 D;  1YJW P;  4U7J A;  1IFJ A; 
#chains in the Genus database with same CATH homology
 2HLO A;  1RF1 B;  1SFC B;  2WSF H;  3N7N A;  2R5B A;  4ZKP A;  2JEE A;  2O01 H;  2WWW A;  1SVF A;  1DX7 A;  4N6J A;  3PP5 A;  2M3B A;  1S9K E;  3II6 A;  5AW3 B;  5APX A;  3CI9 A;  1OWA A;  1N7S D;  2HOD B;  3B5N A;  2NPS A;  3KDP B;  1WRG A;  2C0W A;  1X8Y A;  1LTT C;  1MZ9 A;  1IFD A;  1FAV A;  1NKZ B;  1WT6 A;  3RL0 C;  1LGH B;  1FZA A;  1ZLL A;  3L35 A;  3HUS A;  2FKW B;  2N1T B;  2POH A;  5BVZ A;  1HTL C;  1A02 J;  1L4A C;  1JUN A;  3MD0 A;  1J1E B;  5AVT B;  1FZC C;  2FXM A;  5KTB A;  5AW9 B;  3KYQ A;  3N4X A;  4EOT A;  3RK2 C;  4JYC A;  3VP8 A;  2KOG A;  2W6B A;  4AYC A;  4IFD K;  3P32 A;  1JO5 A;  1M1J A;  3C9I A;  1NHL A;  1CSB A;  2PP6 A;  5AVZ B;  1IK9 A;  2XDJ A;  1XTG B;  4N78 D;  2YKP A;  1HVV A;  1LTJ A;  3B5N C;  1GL2 B;  1RE4 A;  2NPS C;  1FJP A;  1LTS C;  2R5D A;  2WIT A;  1J1D C;  2FFD B;  4W80 A;  3H32 B;  2KSJ A;  2C0X A;  2Q3I A;  3U1A A;  1FOS F;  2O1J A;  1URQ A;  1IFI A;  1YTZ T;  3RK3 B;  3M9Q A;  1LWU B;  5AW8 B;  1JTH B;  1JCC A;  3HD7 B;  1HJB A;  2WZ7 A;  4IFM A;  1KFM A;  3NXS A;  3VMZ A;  2HYN A;  5APS A;  1JMM A;  2MJZ A;  2YMY A;  5AVX B;  2OYH A;  4Y99 C;  1KIL A;  1T3J A;  2N9B A;  1NWQ A;  5AW6 B;  3BVH A;  1JNM A;  1M1J C;  1SQV K;  2E42 A;  2Q7C A;  4WY4 D;  1IFJ A;  3P8M C;  3LID A;  2GUS A;  3GHG A;  1LTJ C;  1RE4 C;  1LT9 A;  1NH4 A;  1GW4 A;  2XV5 A;  2PAJ A;  2HG5 D;  1FDM A;  2ZFC A;  3RK3 D;  1FZG A;  1N2D C;  1N73 A;  4I2L C;  2YKQ A;  3BAS A;  3TYY A;  2CPB A;  1URQ C;  5CCH D;  1N7S A;  1G2C B;  1T2K D;  1GTW A;  2H8P D;  4HYT B;  2Q9I A;  2P7J A;  3MIW A;  4GIF A;  3RL0 B;  3TNU A;  2VRS A;  1VDF A;  2OYH C;  5AW1 B;  1L4A B;  1FBM A;  1KIL C;  1W2E A;  1FZC B;  5APW A;  4IFF A;  3V2R A;  3RK2 B;  3GHG C;  1AQ5 A;  2WPQ A;  1HH0 A;  5AVQ B;  1LT9 C;  3VTP C;  3SWF A;  1GDT A;  3HE4 A;  4O9B A;  5CJ0 A;  1HGV A;  1N73 C;  3B5N B;  2XZR A;  2NPS B;  1N7S C;  3VP9 A;  1M7L A;  1J1D B;  1FJK A;  2HFE D;  3VOP A;  2I1J A;  1H88 A;  5AVS B;  4JYB A;  3V4Q A;  1T8Z A;  1SFC D;  1SQX K;  4GKG A;  3M0D A;  2GUV A;  3KPE A;  1IJD B;  3HUS B;  2WT7 A;  1J2J B;  1N86 A;  2WSC H;  4W7Z A;  1YTZ I;  2KYV A;  1XTC C;  2W27 A;  3M9H A;  2KLV A;  3HE5 A;  3G3Z A;  1CI6 A;  1T3U A;  4OH8 B;  4B86 A;  3MGN A;  4AUW A;  4Y99 B;  1RF0 A;  4LLH A;  4LC1 A;  5CJ4 A;  2HPC A;  3L4F A;  2O1K A;  3O8Z A;  1M1J B;  1IFN A;  1NO4 A;  2R3C A;  1CI6 B;  2N1T D;  4WY4 A;  1LTJ B;  2LKM A;  3BRT B;  5AW0 B;  3HUS C;  2BAS A;  1X79 B;  5APQ A;  1JY3 O;  2JJL A;  5CMZ A;  4C7N A;  2KP8 A;  2WPS A;  1FU1 A;  5AVR B;  3M0D C;  4I6M C;  1URQ B;  1A02 F;  1CZQ A;  4ZKU A;  1MFZ A;  1Z56 A;  5CCH A;  3HTK A;  3CL3 D;  1JY2 O;  1NKN A;  3A5T A;  1IFM A;  1YYC A;  2WSE H;  2FYU K;  1GL2 D;  1JY3 P;  2IX7 C;  5AVW B;  2OYI A;  2M8R A;  4HH2 A;  2OYH B;  2IFM A;  3HRN A;  5APU A;  3A3Y B;  1KIL B;  3L36 A;  3V2Q A;  2Z5H A;  1RF0 C;  3M06 A;  1GU4 A;  1SQQ K;  5CCG D;  2QM8 A;  3WMM 0;  1L0N K;  1JOC A;  1NTM K;  1FZF A;  1JY2 P;  3R2P A;  2J58 A;  1HUC A;  1H89 A;  1FZB A;  3GHG B;  3HD7 D;  4WY4 C;  1KQL A;  3E1I A;  4W7Y A;  1NU1 K;  1LT9 B;  4RES B;  1HBW A;  3OJA B;  3V2P A;  1GD2 E;  2CPS A;  1AFO A;  2W6A A;  1URQ D;  3IR9 A;  3IFM A;  1N73 B;  1GK6 A;  1QL2 A;  1GU5 A;  3NMD A;  5KJ7 D;  1IC2 A;  1N7S B;  3VYI A;  3U1C A;  5CCH C;  3UIA A;  1T2K C;  3MUD A;  4I1L A;  4WBA A;  3TNU B;  3VMY A;  5CHX A;  4M3L A;  1RF1 A;  3OA7 A;  1SFC A;  2I1K A;  2OYI C;  2FYZ A;  1L0L K;  2WTY A;  1NTZ K;  3EQ2 A;  1RE3 A;  2A45 G;  3VN0 A;  1SLQ A;  3V5B A;  3BRV B;  2QM7 A;  3VMX A;  2GM4 A;  2OAR A;  2HOD A;  1G1J A;  4KHX A;  1MV8 A;  3HE4 B;  1FZE A;  4JF7 A;  3RL0 D;  1NOH A;  1H8A A;  3P7K A;  1N7L A;  3V4W A;  5APT A;  1GZL A;  4EIJ A;  1G1I A;  3I5C A;  4GT1 A;  2N1T A;  1ZR4 A;  1L4A D;  3LIE A;  1MUU A;  3M0A A;  1QL1 A;  3NFQ A;  3B8E B;  2YO2 A;  2ZXE B;  5AVY B;  1FOS E;  3RK2 D;  1ZV8 A;  1E5W A;  1LTA C;  1ZR2 A;  5AW2 B;  1RF1 C;  1SFC C;  2KB7 P;  2YNY A;  2Z4E A;  2WT7 B;  1ZN5 A;  2P67 A;  1RE3 C;  3P8C D;  3B5N D;  3HE5 B;  2NPS D;  3M91 A;  1HGZ A;  1IO4 A;  3MTU E;  1LTB C;  5AW4 B;  1GL2 A;  4C46 A;  1SP4 A;  2YKO A;  3T97 A;  2R32 A;  2P2U A;  2HPC B;  2FFD A;  5KLV K;  3H32 A;  3A2A A;  3OAK A;  5CCG A;  1PFI A;  5AVU B;  2H43 A;  4WY4 B;  2N1T C;  2P1J A;  1LWU A;  1JTH A;  2IFN A;  2L5G B;  1HWT C;  3HD7 A;  1JCD A;  1JY3 N;  3M9B A;  2Z5I A;  5APV A;  1SQP K;  1J1E C;  3V2N A;  2E43 A;  4C7N B;  1KFN A;  1LTG C;  2YO3 A;  3P8C E;  4C7R A;  3L37 A;  1NTK K;  3LW5 H;  4XE5 B;  1SQB K;  1CW5 A;  1JY2 N;  5KJ7 A;  3HTK B;  4XA4 A;  4N3Y B;  2C9L Y;  1GW3 A;  5AVV B;  5BU5 A;  1EQ7 A;  2IPP A;  2OYI B;  3EFG A;  4N78 E;  5AW5 B;  2A45 I;  4WB4 A;  1GL2 C;  2C9N Y;  2XNX A;  2XKM A;  4AQR D;  5AW7 B;  3SWY A;  3NTN A;  4LGD E;  2FFD C;  1DEB A;  3TK1 A;  2WPR A;  3A7O A;  3CLQ A;  5CCG C;  1KZU B;  3BAT A;  1OXZ A;  2J59 M;  1G2C A;  3RK3 C;  3H6P A;  2A45 H;  4DZO A;  1LWU C;  1NAF A;  3TSI A;  1S9K D;  3HD7 C;  2Q5U A;  5APY A;  1VPC A;  5BU8 B;  3KQG A;  4DOJ A;  1DH3 A;  1X9V A;  1KIL D;  2XU6 A;  3U59 A;  2H7H A;  1L4A A;  5KJ7 C;  1FZC A;  1GK4 A;  1RY3 A;  1LTI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...