1KILE

Three-dimensional structure of the complexin/snare complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
41
structure length
41
Chain Sequence
KKEEERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the complexin/SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Synaptobrevin SNARE motif
total genus 19
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2001-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.580 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 1kilE00
3RL0g 3RK3E 4GDOA 1KILE
chains in the Genus database with same CATH superfamily
3L74G 1FDOA 1GL2B 1IFMA 1SQBG 1WT6A 1N73A 1JMMA 1JCCA 1QL1A 5AVYB 1FDMA 1K04A 5B66E 1NTZD 4PV1D 1L0LD 1VQNP 1KD1Q 1L0NK 2E76D 3L72G 4U3FE 3C1LA 3CI9A 3M91A 4PJ0H 2HPCA 2NZ2A 3OAKA 1USDA 1OVRA 2K88A 2PFXA 3MUDC 2HPCB 5B5EE 1AQTA 1FE6A 1S3JA 1S4XA 5B5EH 3CC2P 2KSEA 1HGVA 2QVAA 4HYTB 4EDFA 3II6A 3WUVA 3G6EP 2YMYA 3BCCD 3H25A 1NYHA 1NJIQ 3GHGB 1SQQE 3BCCJ 3MP7B 1FZCA 4MN4C 2O1KA 1RE4C 3CXHI 3GHGC 2JP3A 2K37A 3I5CA 2NPSA 2WVRA 3VMYA 3B4SA 1G2CB 2ZVNB 3JSVC 3L72D 2QIWA 5APSA 5AVSB 4LC1A 1H8AA 4IL6H 2SPZA 4RKUJ 3RK3C 3A0HH 3H1IE 1VQPP 2IBZE 1FDIA 1BGYJ 2G8YA 1OW7A 2GUSA 2KXPB 3LW5J 3SWYA 1ZN5A 3CX5E 3GMAA 1JY2O 1NTKK 1SQXE 3BRTB 4YXDC 2I1JA 4C46A 1GL2C 1JOCA 1NU1E 1RF1B 2IDBA 3KQGA 5H2FE 4W7YA 2WPVB 1KQFB 4C7NB 3D6ZA 2KUBA 1HJBA 2H89C 4N78D 3MHVA 5AW3B 5KLIC 4DZOA 2HG5D 1QVGO 1VQ6P 3AE8C 4NPFX 2FXMA 4L75A 4Y99C 3H6PA 3M0DA 1VQLP 1DD3A 1N7LA 1PGPA 3FXEA 5GTHE 1CZQA 1CI6B 1LGHB 2Y0EA 3H1HE 3NTNA 1KYOH 1BGYE 3G3ZA 1BGYG 1FZEA 3IN6A 3CCVP 1YJ9P 1T2KC 1UIIA 2ITAA 3RK3D 1DD4A 5B66H 2E43A 2QJPB 2FYUJ 3MUDA 4IL6E 1NTZK 1DH3A 1FZBA 3O6QA 1SQPD 1EZVE 1OMIA 1H0TA 3SWFA 1SQVG 2WPQA 2OTJP 1FOSF 3QWOC 4CPGA 1LTTC 1NO4A 3L73D 1AA0A 1IK9A 2JEEA 2LXBA 2Q3IA 2MKVA 4KT0J 3ZDMA 4C7NA 1KB9E 1E79H 1LTSC 3L70E 4WWIA 3USSA 2OYIC 1PP9G 5BU5A 2B89A 4ASWA 2LR2A 1IZNB 5AW5B 2QEXP 3FWNA 3L70G 3CX5I 1L4AC 1L0LE 2PAJA 4U3FD 3CCQP 1CI6A 3JCUH 2Q7CA 4DOJA 1SQXD 3TK1A 2E42A 3M9HA 1L0NG 1T6AA 1RE4A 3AE7C 2OGUA 1Y47A 1K9MQ 1NTMK 1SQQJ 3BCCE 3P8CE 3AEEC 3O6QB 1N2DC 1FZGA 2H88C 1BSNA 2IZ0A 2M8RA 4GODA 3B5NA 2E74D 4L74A 3B5NC 2XNXA 2H7HA 1QLED 1J2JB 3RL0C 1RF0A 2FXOA 3H1HD 1S9KD 2HFED 2XDJA 1OVVA 1OW8A 3L36A 1PPJE 1VQ4P 2Z5IA 1LT1A 4W80A 1SP4A 1YQ4C 1VQKP 4TLFA 1HH0A 3PJSK 4PD4D 1Z56A 1EZVD 2WQYC 3NFQA 3CCJP 4Y99B 2BCCD 5CBNA 3RBXA 3CX5H 1R5SA 4O9BA 5KLIB 3M9BA 3QH9A 2O01J 1JO5A 1NKNA 1OVUA 3AE1C 3KDPB 3V6IA 4ASVA 4PD4I 1KB9D 3H1IG 2Q5UA 3F89A 2G3AA 3WUUA 1RF1C 1SQPK 3LIEA 3HD7A 1J1DC 1PIXA 1IO4A 4GOFA 3RL0D 4I2LC 1BE3E 2A06D 3TF5A 2WTYA 1LP1B 2WWWA 4ZKUA 3ABVC 2FYUE 3CWBG 1H88A 4IL6X 2ZXXA 4H0LB 1L2PA 1GL2D 1PL5A 3EQ2A 1GW4A 3L35A 2WSEH 5KTBA 3OW2O 5KJ7A 3L73J 1JM0A 5AW2B 3AEFC 2C9LY 4GDOA 3TGUG 1PFIA 2FBWC 1FJPA 1NTKD 2IBZG 1N7SB 2M3EA 5E79H 3P7KA 1KQLA 5AW6B 2RH0A 1RQUA 3RK2B 1U57A 3VP8A 3H1IJ 5KAIE 5KLVE 3CL3D 2QJKC 3L70D 4OWFA 4W7ZA 1BE3J 1JCDA 3H1LG 2NPSD 4I1LA 4K35A 1S9KE 1ZR2A 4YTPC 1QVFO 1Q90D 4WY4C 2J58A 1URQA 1NU1G 3CMEP 3I56P 2ZYGA 2KNCB 2PP6A 3L73G 4RO0A 3IAOA 4PD4E 1LP1A 1X22A 2ZAEB 3TDKA 2MJZA 3V2PA 2KP8A 2W6JH 2ZYDA 3SSUA 2BASA 3IFMA 4H13B 1AV1A 3TNUB 1M1JB 4WB4A 1NGMB 2NRGA 1Y8AA 1NTMG 1L0LK 1N7SC 1OXZA 3KPEA 5KKZB 3H1LJ 2GA1A 2O3JA 1AFOA 5K5GB 2QJYC 5APTA 4H13D 3B8EB 4YXWH 1S2EA 2A45I 2Y9YA 4BWNA 3CC4P 3K5BA 1PPJD 4AUWA 1RE3C 5KAIH 3SFEC 1Q86Q 2VRSA 3VP9A 3CD6P 1M56D 1LWUB 4H44D 1SQPG 1P84I 1K73Q 1VF5B 3HE4B 2YO3A 1URQB 3H1KG 1BSHA 2IPPA 1CSBA 1OIPA 1QL2A 3FXDA 3A7OA 3KHUA 3RL0B 1JUNA 2HODA 2FY8A 1KQGB 2L91A 2BCCE 1SQBJ 3L74J 2Z5HA 4AYCA 3HD7C 1VQOP 2R44A 2Y0DA 1RHZB 1T8ZA 1USEA 2KS1B 2OARA 1YTZT 3H1LE 3P8MC 1KFMA 1FZCB 1L0LJ 2N1TA 3VMAA 2LXCB 2BEQD 1N7SD 3CWBD 2K9JA 2AEJA 1G1IA 2YMKA 1GMJA 1L4AA 1PP9E 2YO2A 5DJUB 4ZNCA 1ZRTE 1JTHA 2A06E 5AVQB 3HTKB 5AW9B 1NAYA 3HUSA 2WSCH 3B5ND 3G4SP 1S72P 1FBMA 2C0XA 2B9BA 4OGQC 3R2PA 3T97B 2JO1A 5CJ0A 3I55P 5TJHA 2L5GB 1ZR4A 2Q9IA 2OYIB 3HE4A 3WU2E 1NTKE 3U59A 1SQBK 3JCUE 5AVVB 1DIPA 2O01H 5APUA 3AE3C 3GW6A 1KYOI 2P67A 3NMDA 3L75G 2AEFA 1SFCC 1Q7YQ 5E79E 1HBWA 1MFZA 2QE7H 2ZYAA 3G9RA 4UB8E 1GU5A 1J1EB 2N1TB 3AE9C 1AJYA 4PJ0E 1IK7A 2FYZA 2K9JB 1JNMA 2P58A 1L4AB 3CXHH 1SQQK 2N9BA 1SS1A 3H32B 3V4WA 3MTUE 2Z4EA 2DW3A 4NPEA 1QEXA 2QJYB 1NU1D 2HYNA 1HJ0A 2XU6A 3HUSB 1IC2A 5APXA 3W68A 2RKLA 1PZQA 1RH5B 1NTZG 2IX7C 1M1JC 1YTZI 1SQQD 1BDDA 2ZJSE 1GL2A 2K3RA 3H1LD 3RBZA 3T97A 2OYIA 1EDLA 3AE5C 2FYUG 3CWBE 3L72E 4U3FG 1Q2NA 3A0HE 3D71A 2KK7A 2A45H 1SFCD 1YBKA 5AVZB 1VF5C 3U1CA 1NHLA 2FYNC 3N4XA 3CCUP 4GKGA 2W8ZA 2BCCJ 1SQBE 3VYIA 1M57D 1N8RQ 1S5LX 1SLQA 2K1AA 3S1KA 2YIUC 5CCGD 1EDJA 2PGDA 2NPSC 3H1KE 2ZT9C 3L71D 3GHGA 5H2FH 3N7NA 1M1KQ 2QJKB 1SQPE 3L37A 1P84D 4WY4D 1NTZJ 2KYVA 2WMMA 2YXRB 3E1RA 5CHXA 5TISE 1PP9J 5CCHC 2C0WA 4I7ZC 4PV1B 2ZXEB 2Y0CA 2W90A 3A0BE 3L73E 2WSCJ 1JY3P 4H13C 2I1KA 3EFFK 1PGQA 3L75D 3U1AA 2IBZI 1EZVI 4JBZA 4OGQB 1FU1A 2BCCG 2KZIA 3CCSP 2IFMA 4UB8H 3Q2YA 1DEEG 1HUCA 2Q6QA 4D6TD 1RF1A 3BVHA 3D70A 3AE4C 3V5BA 3RK3B 3VN0A 1GK6A 3P32A 3HRNA 4IFMA 4WY4A 3SWKA 3A5TA 4HH2A 1OW6A 2E5TA 3P8CD 3R4YA 4H44C 1ZLLA 4NPDA 5CCHD 1KB9H 1HF9A 3RK2C 4H44B 3VTPC 1A02F 2E75B 3EWKA 4D6TG 2YKOA 4JF7A 1SQXK 2ZT9B 3CCMP 4R4LA 4IFDK 4AQRD 4H0LC 1SQXJ 2WT7B 1FC2C 1N73B 4L73A 1NTMD 2CK3H 1DEBA 2FYNB 2W83C 3Q5SA 2FFDC 3FGAD 4HB1A 3H1KD 2C9NY 1J1DB 2KLUA 3O8ZA 3V2NA 3CXHE 1ZW0A 1VQ9P 5GTIE 2XZRA 3RL0g 2YKPA 2CPSA 5EFWB 4PV1C 1KFNA 1EXJA 1MZ9A 3IR9A 2KI7B 2E76C 1T3UA 3CWBJ 1H89A 2FKWB 3GLMA 3HUSC 1KN7A 2FXPA 5KLVK 1N86A 1RQVA 1ZP0C 3AEBC 2NPSB 1NTZE 2OTKE 1SQBD 1M7LA 2FYUD 2M5AA 2WSFJ 2W6AA 1YJNP 1NTKJ 3OA7A 1J1EC 2N1TC 4WVZA 1KILB 2P7JA 4A7PA 4DT0A 2Y9ZA 2WT7A 2JWAA 4JQ0D 1YHQP 1BE3G 1VL2A 3B5NB 3PHLA 5AVWB 2FYUK 1LTJB 1M90Q 1KQSO 1KILE 1RF0C 4UB6H 2Q3EA 1FZCC 3C8VA 1JY3O 2M3BA 3L71J 2FFDA 2W6BA 2HLOA 2JKVA 4RJTA 4DJGA 3L75E 4HJGH 3KZIE 2V7QH 3UIAA 2QM7A 1NU1K 1ZXGA 5C39A 5AVRB 1IFJA 3B71A 5CCHA 1BE3D 3H1ID 3W67A 1LT9A 1E5WA 1NTKG 2IBZD 4XE5B 1JY2N 3Q3DA 2QA4P 4D6TE 2AXTH 1MUUA 2ZT9D 3M0DC 1IFPA 2IFNA 3BASA 4KJMA 5AW7B 4N3YB 4TT3H 3TGUD 5CJ4A 1FS0E 1NTMJ 1SQVE 2JDIH 2N1TD 1VF5D 4U7JA 2M5AB 5L8RJ 1EDIA 3GG2A 1SFCB 1EZVG 3A2AA 3AE2C 3S9OA 3L72J 1PGJA 1KILA 1GTWA 4JPZB 1KB9I 1W2EA 2D2CC 3HD7B 2PRRA 3KXDA 1LTJC 2R3SA 1JY3N 3H1JG 1JEKA 3NXSA 3PTZA 2R5DA 5APVA 1FZAA 1LTJA 3H1HJ 5KLVD 1OZHA 1GD2E 2QM8A 4ZMDA 1URQC 1Q82Q 4JYCA 2YNYA 3H1KJ 2CPBA 3BCCG 3MGNA 1KORA 1LJ2A 2OQQA 2FFDB 2QJPC 5GTHH 2UWJE 4M3LA 4N6JA 1CW5A 1FAVA 5BU8B 1NTME 1JY2P 3AECC 1NWQA 1LT9B 3AEAC 3WU2H 2GUVA 1NOHA 1L0LG 4IOIH 4BRYB 2AXTE 1K05A 1X79B 2BEZF 3C9IA 3GF3A 3CXHD 1L0ND 2QSIA 1KILD 1XTGB 2RN0A 3H1JJ 4N78E 3CC7P 1AQ5A 1IFNA 2P1JA 3L74D 5KJ7C 1SFCA 2IYPA 3H1HG 1VQMP 1VQ8P 5AW8B 1IFIA 2B87B 3S4RA 4QMAA 2GM4A 1TU3F 1NAFA 1S5LH 1YITP 2WITA 2KNCA 5BVZA 1PP9D 3TSIA 3M06A 5GTIH 3M9QA 2WPRA 1URQD 2KIKA 2R3CA 3KYQA 3RK2D 2O01N 3V2RA 3FX0A 3VMZA 5AW4B 5KLVG 5AVUB 3H1JD 2P10A 4YPCA 1GDTA 4ZKPA 1SQVD 2KB7P 2JR8A 1M1JA 2YKQA 3FWLA 2V7QJ 3L75J 4H0LD 3PH0A 1LTAC 2WPSA 2E75C 3Q5PA 2XNDH 1MV8A 1G1JA 2KOGA 2M0BA 1QGKB 1X9VA 3PRJA 4I7ZB 2P2UA 4WBAA 3VOPA 4BRYA 1DX7A 1KC8Q 2K9YA 1YIJP 1VPCA 1VDFA 1SQVJ 2JWDA 3HD7D 4BXLA 5KLVJ 3CPWO 1ZRTD 2B87A 2YIUB 4JYBA 1XTCC 4EOTA 1GZLA 2H43A 1MFTA 2QRXA 4GIFA 2HR3A 3KZIH 3TGUE 5TISH 4RESB 1GK4A 3CCLP 1WMKA 1RY3A 3L70J 1NVOA 1RE3A 3RGUA 4U3FJ 3HE5B 3PP5A 3SFDC 1QX8A 3CCEP 1OX3A 4XA4A 1EC5A 1L0NJ 2LKMA 5APWA 3F5HA 3BATA 1N7SA 1NH4A 1U7MA 1KMIZ 1LTGC 2OYHB 1SQQG 2E74B 2A06G 1M8OB 1PV3A 4K3AA 1BCCE 1MKMA 2R32A 2WZ7A 3AEDC 3H1JE 4B86A 5APYA 4EIJA 1A02J 4LLHA 3L71E 1YI2P 3PLNA 4Y28J 1JB0J 2IZ1A 3ITKA 3TYYA 3OJAB 1OFCX 1IFDA 2D2CD 1L0NE 2KSJA 5CCGC 3CCRP 1KYOD 1VQ5P 3EFGA 4IFFA 4C7RA 3L74E 3Q1MA 1HTLC 1W2BO 2N9YB 4I6MC 3HE5A 2YXQB 1FZFA 3TNUA 3VMXA 3WUTA 1LT9C 3AE6C 2OYOA 1ZV8A 2J59M 4UB6E 3LW5H 3V4QA 2OYHA 3D6YA 1JMBA 2KZJA 1Q81Q 1S5LE 2KLVA 2QG4A 1VQ7P 1KZUB 1OWAA 4R4MA 1R5LA 1H0TB 1EQ7A 1LTBC 1LWUA 1P84E 4D6TJ 3Q5RA 1P84H 1S1CX 3A0BH 3G71P 5KJ7D 1YJWP 4GOEA 3V2QA 2AEMA 3CLQA 5AVTB 2D2CB 1AVYA 1UIXA 3L4FA 5CBOA 2HODB 1SQXG 3TGUJ 1PGOA 2OTLP 1YQ3C 1HVVA 1FJKA 2KS1A 1YYCA 1D7MA 4KHXA 1SVFA 1ZOYC 1KILC 2XV5A 2JJLA 3MD0A 2XKMA 4HKZH 3CMAP 1T3JA 1LWUC 5APQA 4EYYQ 1BCCD 1KV4A 1NKZB 2ZFCA 3AEGC 3MIWA 5CCGA 3BRVB 1K8AQ 1JTHB 2A45G 3HTKA 1FOSE 1WRGA 1GU4A 5KAFE 2OYHC 4Z1MH 1EDKA 1NU1J 1T2KD 1PPJG 5KKZC 4LGDE 1KYOE 2WSFH 3GF7A 5AW0B 1GW3A 1LTIC 1BCCJ 4GT1A 1L4AD 5AVXB 2AXCA 2E5YA 3E7KA 1Y9BA 2W27A 3IF4A 4OVNF 1SQVK 2B88A 2RMZA 2ZVOB 3LIDA 2E75D 2R5BA 2H8PD 4DCKA 2WSSH 1EXIA 1KTMA 1AVOA 1BGYD 4OGQD 5DJTB 4EI2A 1IJDB 1R8EA 3RK3E 1W5CE 2POHA 2V4HA 5AW1B 1N73C 1HWTC 1BDCA 4WY4B 1X8YA 4OH8B 3CX5D 2Q1KA 3A3YB 4XFJA 5M1BA 3L71G 1ZMEC 3M0AA 2I8DA 2E74C 2WSEJ 3E1IA 4L76A 5CMZA 1LNQA 2E76B 3H32A 4PD4H 1BCCG 2IYOA 3MZWB 1X0TA 1SQPJ 1G2CA 2O1JA 3WMM0 5KAFH 1HGZA 1U7JA 2J5UA 3JC22
chains in the Genus database with same CATH topology
3AEFC 1FDOA 2V7QJ 4GDOA 4H0LD 2FBWC 3Q5PA 2E75C 1K04A 3Q2YA 4PV1D 1RQUA 2E76D 4I7ZB 1U57A 3D70A 2NZ2A 3AE4C 2QJKC 2K9YA 3H25A 4YTPC 1Q90D 1NYHA 1OW6A 3R4YA 4H44C 1HF9A 4H44B 2JP3A 2E75B 3EWKA 3IAOA 1WMKA 2QIWA 2ZT9B 4R4LA 4RKUJ 4H13B 3SFDC 4H0LC 1FDIA 2G8YA 3LW5J 1OW7A 1NGMB 3GMAA 3Q5SA 3FGAD 4YXDC 2QJYC 1KMIZ 4H13D 2E74B 2IDBA 3D6ZA 1KQFB 2WPVB 1PV3A 2H89C 3SFEC 3AEDC 1MKMA 3RL0g 4IL6X 5KLIC 3AE8C 4H44D 4PV1C 1EXJA 1VF5B 2E76C 3GLMA 1DD3A 2FXPA 4Y28J 1JB0J 1RQVA 1ZP0C 3AEBC 1KQGB 3IN6A 2D2CD 1DD4A 2WSFJ 3Q1MA 2BEQD 2YMKA 3O6QA 1GMJA 1OMIA 3AE6C 1VL2A 1ZRTE 1KILE 3C8VA 4H13C 3D6YA 4KT0J 2MKVA 4R4MA 4OGQC 3T97B 2JO1A 3Q5RA 3B71A 1S1CX 2D2CB 1UIXA 3Q3DA 1DIPA 2ZT9D 3AE3C 4TT3H 1YQ3C 3AE7C 1VF5D 4U7JA 4OGQB 5L8RJ 1ZOYC 3AE2C 3G9RA 3S9OA 3AE9C 1AJYA 3AEEC 1IK7A 3AEGC 2D2CC 2E74D 1HJ0A 4Z1MH 1OW8A 1KORA 5KKZC 2OQQA 2QJPC 3GF7A 1YQ4C 3AE5C 3AECC 1Y9BA 3AEAC 3D71A 2E75D 2WQYC 3GF3A 1K05A 1EXIA 2BEZF 1KTMA 1VF5C 4OGQD 1R8EA 2FYNC 2QSIA 3RK3E 1S5LX 2O01J 2YIUC 3AE1C 2P10A 4XFJA 5M1BA 1ZMEC 2ZT9C 1TU3F 2E74C 2G3AA 2WSEJ 1PIXA 2E76B 4PV1B 4I7ZC 3ABVC 2WSCJ 4H0LB 2H88C 2J5UA 1PL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RL0 g;  3RK3 E;  4GDO A;  1KIL E; 
#chains in the Genus database with same CATH topology
 3L74 G;  1FDO A;  1GL2 B;  1IFM A;  1SQB G;  1WT6 A;  1N73 A;  1JMM A;  1JCC A;  1QL1 A;  5AVY B;  1FDM A;  1K04 A;  5B66 E;  1NTZ D;  4PV1 D;  1L0L D;  1VQN P;  1KD1 Q;  1L0N K;  2E76 D;  3L72 G;  4U3F E;  3C1L A;  3CI9 A;  3M91 A;  4PJ0 H;  2HPC A;  2NZ2 A;  3OAK A;  1USD A;  1OVR A;  2K88 A;  2PFX A;  3MUD C;  2HPC B;  5B5E E;  1AQT A;  1FE6 A;  1S3J A;  1S4X A;  5B5E H;  3CC2 P;  2KSE A;  1HGV A;  2QVA A;  4HYT B;  4EDF A;  3II6 A;  3WUV A;  3G6E P;  2YMY A;  3BCC D;  3H25 A;  1NYH A;  1NJI Q;  3GHG B;  1SQQ E;  3BCC J;  3MP7 B;  1FZC A;  4MN4 C;  2O1K A;  1RE4 C;  3CXH I;  3GHG C;  2JP3 A;  2K37 A;  3I5C A;  2NPS A;  2WVR A;  3VMY A;  3B4S A;  1G2C B;  2ZVN B;  3JSV C;  3L72 D;  2QIW A;  5APS A;  5AVS B;  4LC1 A;  1H8A A;  4IL6 H;  2SPZ A;  4RKU J;  3RK3 C;  3A0H H;  3H1I E;  1VQP P;  2IBZ E;  1FDI A;  1BGY J;  2G8Y A;  1OW7 A;  2GUS A;  2KXP B;  3LW5 J;  3SWY A;  1ZN5 A;  3CX5 E;  3GMA A;  1JY2 O;  1NTK K;  1SQX E;  3BRT B;  4YXD C;  2I1J A;  4C46 A;  1GL2 C;  1JOC A;  1NU1 E;  1RF1 B;  2IDB A;  3KQG A;  5H2F E;  4W7Y A;  2WPV B;  1KQF B;  4C7N B;  3D6Z A;  2KUB A;  1HJB A;  2H89 C;  4N78 D;  3MHV A;  5AW3 B;  5KLI C;  4DZO A;  2HG5 D;  1QVG O;  1VQ6 P;  3AE8 C;  4NPF X;  2FXM A;  4L75 A;  4Y99 C;  3H6P A;  3M0D A;  1VQL P;  1DD3 A;  1N7L A;  1PGP A;  3FXE A;  5GTH E;  1CZQ A;  1CI6 B;  1LGH B;  2Y0E A;  3H1H E;  3NTN A;  1KYO H;  1BGY E;  3G3Z A;  1BGY G;  1FZE A;  3IN6 A;  3CCV P;  1YJ9 P;  1T2K C;  1UII A;  2ITA A;  3RK3 D;  1DD4 A;  5B66 H;  2E43 A;  2QJP B;  2FYU J;  3MUD A;  4IL6 E;  1NTZ K;  1DH3 A;  1FZB A;  3O6Q A;  1SQP D;  1EZV E;  1OMI A;  1H0T A;  3SWF A;  1SQV G;  2WPQ A;  2OTJ P;  1FOS F;  3QWO C;  4CPG A;  1LTT C;  1NO4 A;  3L73 D;  1AA0 A;  1IK9 A;  2JEE A;  2LXB A;  2Q3I A;  2MKV A;  4KT0 J;  3ZDM A;  4C7N A;  1KB9 E;  1E79 H;  1LTS C;  3L70 E;  4WWI A;  3USS A;  2OYI C;  1PP9 G;  5BU5 A;  2B89 A;  4ASW A;  2LR2 A;  1IZN B;  5AW5 B;  2QEX P;  3FWN A;  3L70 G;  3CX5 I;  1L4A C;  1L0L E;  2PAJ A;  4U3F D;  3CCQ P;  1CI6 A;  3JCU H;  2Q7C A;  4DOJ A;  1SQX D;  3TK1 A;  2E42 A;  3M9H A;  1L0N G;  1T6A A;  1RE4 A;  3AE7 C;  2OGU A;  1Y47 A;  1K9M Q;  1NTM K;  1SQQ J;  3BCC E;  3P8C E;  3AEE C;  3O6Q B;  1N2D C;  1FZG A;  2H88 C;  1BSN A;  2IZ0 A;  2M8R A;  4GOD A;  3B5N A;  2E74 D;  4L74 A;  3B5N C;  2XNX A;  2H7H A;  1QLE D;  1J2J B;  3RL0 C;  1RF0 A;  2FXO A;  3H1H D;  1S9K D;  2HFE D;  2XDJ A;  1OVV A;  1OW8 A;  3L36 A;  1PPJ E;  1VQ4 P;  2Z5I A;  1LT1 A;  4W80 A;  1SP4 A;  1YQ4 C;  1VQK P;  4TLF A;  1HH0 A;  3PJS K;  4PD4 D;  1Z56 A;  1EZV D;  2WQY C;  3NFQ A;  3CCJ P;  4Y99 B;  2BCC D;  5CBN A;  3RBX A;  3CX5 H;  1R5S A;  4O9B A;  5KLI B;  3M9B A;  3QH9 A;  2O01 J;  1JO5 A;  1NKN A;  1OVU A;  3AE1 C;  3KDP B;  3V6I A;  4ASV A;  4PD4 I;  1KB9 D;  3H1I G;  2Q5U A;  3F89 A;  2G3A A;  3WUU A;  1RF1 C;  1SQP K;  3LIE A;  3HD7 A;  1J1D C;  1PIX A;  1IO4 A;  4GOF A;  3RL0 D;  4I2L C;  1BE3 E;  2A06 D;  3TF5 A;  2WTY A;  1LP1 B;  2WWW A;  4ZKU A;  3ABV C;  2FYU E;  3CWB G;  1H88 A;  4IL6 X;  2ZXX A;  4H0L B;  1L2P A;  1GL2 D;  1PL5 A;  3EQ2 A;  1GW4 A;  3L35 A;  2WSE H;  5KTB A;  3OW2 O;  5KJ7 A;  3L73 J;  1JM0 A;  5AW2 B;  3AEF C;  2C9L Y;  4GDO A;  3TGU G;  1PFI A;  2FBW C;  1FJP A;  1NTK D;  2IBZ G;  1N7S B;  2M3E A;  5E79 H;  3P7K A;  1KQL A;  5AW6 B;  2RH0 A;  1RQU A;  3RK2 B;  1U57 A;  3VP8 A;  3H1I J;  5KAI E;  5KLV E;  3CL3 D;  2QJK C;  3L70 D;  4OWF A;  4W7Z A;  1BE3 J;  1JCD A;  3H1L G;  2NPS D;  4I1L A;  4K35 A;  1S9K E;  1ZR2 A;  4YTP C;  1QVF O;  1Q90 D;  4WY4 C;  2J58 A;  1URQ A;  1NU1 G;  3CME P;  3I56 P;  2ZYG A;  2KNC B;  2PP6 A;  3L73 G;  4RO0 A;  3IAO A;  4PD4 E;  1LP1 A;  1X22 A;  2ZAE B;  3TDK A;  2MJZ A;  3V2P A;  2KP8 A;  2W6J H;  2ZYD A;  3SSU A;  2BAS A;  3IFM A;  4H13 B;  1AV1 A;  3TNU B;  1M1J B;  4WB4 A;  1NGM B;  2NRG A;  1Y8A A;  1NTM G;  1L0L K;  1N7S C;  1OXZ A;  3KPE A;  5KKZ B;  3H1L J;  2GA1 A;  2O3J A;  1AFO A;  5K5G B;  2QJY C;  5APT A;  4H13 D;  3B8E B;  4YXW H;  1S2E A;  2A45 I;  2Y9Y A;  4BWN A;  3CC4 P;  3K5B A;  1PPJ D;  4AUW A;  1RE3 C;  5KAI H;  3SFE C;  1Q86 Q;  2VRS A;  3VP9 A;  3CD6 P;  1M56 D;  1LWU B;  4H44 D;  1SQP G;  1P84 I;  1K73 Q;  1VF5 B;  3HE4 B;  2YO3 A;  1URQ B;  3H1K G;  1BSH A;  2IPP A;  1CSB A;  1OIP A;  1QL2 A;  3FXD A;  3A7O A;  3KHU A;  3RL0 B;  1JUN A;  2HOD A;  2FY8 A;  1KQG B;  2L91 A;  2BCC E;  1SQB J;  3L74 J;  2Z5H A;  4AYC A;  3HD7 C;  1VQO P;  2R44 A;  2Y0D A;  1RHZ B;  1T8Z A;  1USE A;  2KS1 B;  2OAR A;  1YTZ T;  3H1L E;  3P8M C;  1KFM A;  1FZC B;  1L0L J;  2N1T A;  3VMA A;  2LXC B;  2BEQ D;  1N7S D;  3CWB D;  2K9J A;  2AEJ A;  1G1I A;  2YMK A;  1GMJ A;  1L4A A;  1PP9 E;  2YO2 A;  5DJU B;  4ZNC A;  1ZRT E;  1JTH A;  2A06 E;  5AVQ B;  3HTK B;  5AW9 B;  1NAY A;  3HUS A;  2WSC H;  3B5N D;  3G4S P;  1S72 P;  1FBM A;  2C0X A;  2B9B A;  4OGQ C;  3R2P A;  3T97 B;  2JO1 A;  5CJ0 A;  3I55 P;  5TJH A;  2L5G B;  1ZR4 A;  2Q9I A;  2OYI B;  3HE4 A;  3WU2 E;  1NTK E;  3U59 A;  1SQB K;  3JCU E;  5AVV B;  1DIP A;  2O01 H;  5APU A;  3AE3 C;  3GW6 A;  1KYO I;  2P67 A;  3NMD A;  3L75 G;  2AEF A;  1SFC C;  1Q7Y Q;  5E79 E;  1HBW A;  1MFZ A;  2QE7 H;  2ZYA A;  3G9R A;  4UB8 E;  1GU5 A;  1J1E B;  2N1T B;  3AE9 C;  1AJY A;  4PJ0 E;  1IK7 A;  2FYZ A;  2K9J B;  1JNM A;  2P58 A;  1L4A B;  3CXH H;  1SQQ K;  2N9B A;  1SS1 A;  3H32 B;  3V4W A;  3MTU E;  2Z4E A;  2DW3 A;  4NPE A;  1QEX A;  2QJY B;  1NU1 D;  2HYN A;  1HJ0 A;  2XU6 A;  3HUS B;  1IC2 A;  5APX A;  3W68 A;  2RKL A;  1PZQ A;  1RH5 B;  1NTZ G;  2IX7 C;  1M1J C;  1YTZ I;  1SQQ D;  1BDD A;  2ZJS E;  1GL2 A;  2K3R A;  3H1L D;  3RBZ A;  3T97 A;  2OYI A;  1EDL A;  3AE5 C;  2FYU G;  3CWB E;  3L72 E;  4U3F G;  1Q2N A;  3A0H E;  3D71 A;  2KK7 A;  2A45 H;  1SFC D;  1YBK A;  5AVZ B;  1VF5 C;  3U1C A;  1NHL A;  2FYN C;  3N4X A;  3CCU P;  4GKG A;  2W8Z A;  2BCC J;  1SQB E;  3VYI A;  1M57 D;  1N8R Q;  1S5L X;  1SLQ A;  2K1A A;  3S1K A;  2YIU C;  5CCG D;  1EDJ A;  2PGD A;  2NPS C;  3H1K E;  2ZT9 C;  3L71 D;  3GHG A;  5H2F H;  3N7N A;  1M1K Q;  2QJK B;  1SQP E;  3L37 A;  1P84 D;  4WY4 D;  1NTZ J;  2KYV A;  2WMM A;  2YXR B;  3E1R A;  5CHX A;  5TIS E;  1PP9 J;  5CCH C;  2C0W A;  4I7Z C;  4PV1 B;  2ZXE B;  2Y0C A;  2W90 A;  3A0B E;  3L73 E;  2WSC J;  1JY3 P;  4H13 C;  2I1K A;  3EFF K;  1PGQ A;  3L75 D;  3U1A A;  2IBZ I;  1EZV I;  4JBZ A;  4OGQ B;  1FU1 A;  2BCC G;  2KZI A;  3CCS P;  2IFM A;  4UB8 H;  3Q2Y A;  1DEE G;  1HUC A;  2Q6Q A;  4D6T D;  1RF1 A;  3BVH A;  3D70 A;  3AE4 C;  3V5B A;  3RK3 B;  3VN0 A;  1GK6 A;  3P32 A;  3HRN A;  4IFM A;  4WY4 A;  3SWK A;  3A5T A;  4HH2 A;  1OW6 A;  2E5T A;  3P8C D;  3R4Y A;  4H44 C;  1ZLL A;  4NPD A;  5CCH D;  1KB9 H;  1HF9 A;  3RK2 C;  4H44 B;  3VTP C;  1A02 F;  2E75 B;  3EWK A;  4D6T G;  2YKO A;  4JF7 A;  1SQX K;  2ZT9 B;  3CCM P;  4R4L A;  4IFD K;  4AQR D;  4H0L C;  1SQX J;  2WT7 B;  1FC2 C;  1N73 B;  4L73 A;  1NTM D;  2CK3 H;  1DEB A;  2FYN B;  2W83 C;  3Q5S A;  2FFD C;  3FGA D;  4HB1 A;  3H1K D;  2C9N Y;  1J1D B;  2KLU A;  3O8Z A;  3V2N A;  3CXH E;  1ZW0 A;  1VQ9 P;  5GTI E;  2XZR A;  3RL0 g;  2YKP A;  2CPS A;  5EFW B;  4PV1 C;  1KFN A;  1EXJ A;  1MZ9 A;  3IR9 A;  2KI7 B;  2E76 C;  1T3U A;  3CWB J;  1H89 A;  2FKW B;  3GLM A;  3HUS C;  1KN7 A;  2FXP A;  5KLV K;  1N86 A;  1RQV A;  1ZP0 C;  3AEB C;  2NPS B;  1NTZ E;  2OTK E;  1SQB D;  1M7L A;  2FYU D;  2M5A A;  2WSF J;  2W6A A;  1YJN P;  1NTK J;  3OA7 A;  1J1E C;  2N1T C;  4WVZ A;  1KIL B;  2P7J A;  4A7P A;  4DT0 A;  2Y9Z A;  2WT7 A;  2JWA A;  4JQ0 D;  1YHQ P;  1BE3 G;  1VL2 A;  3B5N B;  3PHL A;  5AVW B;  2FYU K;  1LTJ B;  1M90 Q;  1KQS O;  1KIL E;  1RF0 C;  4UB6 H;  2Q3E A;  1FZC C;  3C8V A;  1JY3 O;  2M3B A;  3L71 J;  2FFD A;  2W6B A;  2HLO A;  2JKV A;  4RJT A;  4DJG A;  3L75 E;  4HJG H;  3KZI E;  2V7Q H;  3UIA A;  2QM7 A;  1NU1 K;  1ZXG A;  5C39 A;  5AVR B;  1IFJ A;  3B71 A;  5CCH A;  1BE3 D;  3H1I D;  3W67 A;  1LT9 A;  1E5W A;  1NTK G;  2IBZ D;  4XE5 B;  1JY2 N;  3Q3D A;  2QA4 P;  4D6T E;  2AXT H;  1MUU A;  2ZT9 D;  3M0D C;  1IFP A;  2IFN A;  3BAS A;  4KJM A;  5AW7 B;  4N3Y B;  4TT3 H;  3TGU D;  5CJ4 A;  1FS0 E;  1NTM J;  1SQV E;  2JDI H;  2N1T D;  1VF5 D;  4U7J A;  2M5A B;  5L8R J;  1EDI A;  3GG2 A;  1SFC B;  1EZV G;  3A2A A;  3AE2 C;  3S9O A;  3L72 J;  1PGJ A;  1KIL A;  1GTW A;  4JPZ B;  1KB9 I;  1W2E A;  2D2C C;  3HD7 B;  2PRR A;  3KXD A;  1LTJ C;  2R3S A;  1JY3 N;  3H1J G;  1JEK A;  3NXS A;  3PTZ A;  2R5D A;  5APV A;  1FZA A;  1LTJ A;  3H1H J;  5KLV D;  1OZH A;  1GD2 E;  2QM8 A;  4ZMD A;  1URQ C;  1Q82 Q;  4JYC A;  2YNY A;  3H1K J;  2CPB A;  3BCC G;  3MGN A;  1KOR A;  1LJ2 A;  2OQQ A;  2FFD B;  2QJP C;  5GTH H;  2UWJ E;  4M3L A;  4N6J A;  1CW5 A;  1FAV A;  5BU8 B;  1NTM E;  1JY2 P;  3AEC C;  1NWQ A;  1LT9 B;  3AEA C;  3WU2 H;  2GUV A;  1NOH A;  1L0L G;  4IOI H;  4BRY B;  2AXT E;  1K05 A;  1X79 B;  2BEZ F;  3C9I A;  3GF3 A;  3CXH D;  1L0N D;  2QSI A;  1KIL D;  1XTG B;  2RN0 A;  3H1J J;  4N78 E;  3CC7 P;  1AQ5 A;  1IFN A;  2P1J A;  3L74 D;  5KJ7 C;  1SFC A;  2IYP A;  3H1H G;  1VQM P;  1VQ8 P;  5AW8 B;  1IFI A;  2B87 B;  3S4R A;  4QMA A;  2GM4 A;  1TU3 F;  1NAF A;  1S5L H;  1YIT P;  2WIT A;  2KNC A;  5BVZ A;  1PP9 D;  3TSI A;  3M06 A;  5GTI H;  3M9Q A;  2WPR A;  1URQ D;  2KIK A;  2R3C A;  3KYQ A;  3RK2 D;  2O01 N;  3V2R A;  3FX0 A;  3VMZ A;  5AW4 B;  5KLV G;  5AVU B;  3H1J D;  2P10 A;  4YPC A;  1GDT A;  4ZKP A;  1SQV D;  2KB7 P;  2JR8 A;  1M1J A;  2YKQ A;  3FWL A;  2V7Q J;  3L75 J;  4H0L D;  3PH0 A;  1LTA C;  2WPS A;  2E75 C;  3Q5P A;  2XND H;  1MV8 A;  1G1J A;  2KOG A;  2M0B A;  1QGK B;  1X9V A;  3PRJ A;  4I7Z B;  2P2U A;  4WBA A;  3VOP A;  4BRY A;  1DX7 A;  1KC8 Q;  2K9Y A;  1YIJ P;  1VPC A;  1VDF A;  1SQV J;  2JWD A;  3HD7 D;  4BXL A;  5KLV J;  3CPW O;  1ZRT D;  2B87 A;  2YIU B;  4JYB A;  1XTC C;  4EOT A;  1GZL A;  2H43 A;  1MFT A;  2QRX A;  4GIF A;  2HR3 A;  3KZI H;  3TGU E;  5TIS H;  4RES B;  1GK4 A;  3CCL P;  1WMK A;  1RY3 A;  3L70 J;  1NVO A;  1RE3 A;  3RGU A;  4U3F J;  3HE5 B;  3PP5 A;  3SFD C;  1QX8 A;  3CCE P;  1OX3 A;  4XA4 A;  1EC5 A;  1L0N J;  2LKM A;  5APW A;  3F5H A;  3BAT A;  1N7S A;  1NH4 A;  1U7M A;  1KMI Z;  1LTG C;  2OYH B;  1SQQ G;  2E74 B;  2A06 G;  1M8O B;  1PV3 A;  4K3A A;  1BCC E;  1MKM A;  2R32 A;  2WZ7 A;  3AED C;  3H1J E;  4B86 A;  5APY A;  4EIJ A;  1A02 J;  4LLH A;  3L71 E;  1YI2 P;  3PLN A;  4Y28 J;  1JB0 J;  2IZ1 A;  3ITK A;  3TYY A;  3OJA B;  1OFC X;  1IFD A;  2D2C D;  1L0N E;  2KSJ A;  5CCG C;  3CCR P;  1KYO D;  1VQ5 P;  3EFG A;  4IFF A;  4C7R A;  3L74 E;  3Q1M A;  1HTL C;  1W2B O;  2N9Y B;  4I6M C;  3HE5 A;  2YXQ B;  1FZF A;  3TNU A;  3VMX A;  3WUT A;  1LT9 C;  3AE6 C;  2OYO A;  1ZV8 A;  2J59 M;  4UB6 E;  3LW5 H;  3V4Q A;  2OYH A;  3D6Y A;  1JMB A;  2KZJ A;  1Q81 Q;  1S5L E;  2KLV A;  2QG4 A;  1VQ7 P;  1KZU B;  1OWA A;  4R4M A;  1R5L A;  1H0T B;  1EQ7 A;  1LTB C;  1LWU A;  1P84 E;  4D6T J;  3Q5R A;  1P84 H;  1S1C X;  3A0B H;  3G71 P;  5KJ7 D;  1YJW P;  4GOE A;  3V2Q A;  2AEM A;  3CLQ A;  5AVT B;  2D2C B;  1AVY A;  1UIX A;  3L4F A;  5CBO A;  2HOD B;  1SQX G;  3TGU J;  1PGO A;  2OTL P;  1YQ3 C;  1HVV A;  1FJK A;  2KS1 A;  1YYC A;  1D7M A;  4KHX A;  1SVF A;  1ZOY C;  1KIL C;  2XV5 A;  2JJL A;  3MD0 A;  2XKM A;  4HKZ H;  3CMA P;  1T3J A;  1LWU C;  5APQ A;  4EYY Q;  1BCC D;  1KV4 A;  1NKZ B;  2ZFC A;  3AEG C;  3MIW A;  5CCG A;  3BRV B;  1K8A Q;  1JTH B;  2A45 G;  3HTK A;  1FOS E;  1WRG A;  1GU4 A;  5KAF E;  2OYH C;  4Z1M H;  1EDK A;  1NU1 J;  1T2K D;  1PPJ G;  5KKZ C;  4LGD E;  1KYO E;  2WSF H;  3GF7 A;  5AW0 B;  1GW3 A;  1LTI C;  1BCC J;  4GT1 A;  1L4A D;  5AVX B;  2AXC A;  2E5Y A;  3E7K A;  1Y9B A;  2W27 A;  3IF4 A;  4OVN F;  1SQV K;  2B88 A;  2RMZ A;  2ZVO B;  3LID A;  2E75 D;  2R5B A;  2H8P D;  4DCK A;  2WSS H;  1EXI A;  1KTM A;  1AVO A;  1BGY D;  4OGQ D;  5DJT B;  4EI2 A;  1IJD B;  1R8E A;  3RK3 E;  1W5C E;  2POH A;  2V4H A;  5AW1 B;  1N73 C;  1HWT C;  1BDC A;  4WY4 B;  1X8Y A;  4OH8 B;  3CX5 D;  2Q1K A;  3A3Y B;  4XFJ A;  5M1B A;  3L71 G;  1ZME C;  3M0A A;  2I8D A;  2E74 C;  2WSE J;  3E1I A;  4L76 A;  5CMZ A;  1LNQ A;  2E76 B;  3H32 A;  4PD4 H;  1BCC G;  2IYO A;  3MZW B;  1X0T A;  1SQP J;  1G2C A;  2O1J A;  3WMM 0;  5KAF H;  1HGZ A;  1U7J A;  2J5U A;  3JC2 2; 
#chains in the Genus database with same CATH homology
 3AEF C;  1FDO A;  2V7Q J;  4GDO A;  4H0L D;  2FBW C;  3Q5P A;  2E75 C;  1K04 A;  3Q2Y A;  4PV1 D;  1RQU A;  2E76 D;  4I7Z B;  1U57 A;  3D70 A;  2NZ2 A;  3AE4 C;  2QJK C;  2K9Y A;  3H25 A;  4YTP C;  1Q90 D;  1NYH A;  1OW6 A;  3R4Y A;  4H44 C;  1HF9 A;  4H44 B;  2JP3 A;  2E75 B;  3EWK A;  3IAO A;  1WMK A;  2QIW A;  2ZT9 B;  4R4L A;  4RKU J;  4H13 B;  3SFD C;  4H0L C;  1FDI A;  2G8Y A;  3LW5 J;  1OW7 A;  1NGM B;  3GMA A;  3Q5S A;  3FGA D;  4YXD C;  2QJY C;  1KMI Z;  4H13 D;  2E74 B;  2IDB A;  3D6Z A;  1KQF B;  2WPV B;  1PV3 A;  2H89 C;  3SFE C;  3AED C;  1MKM A;  3RL0 g;  4IL6 X;  5KLI C;  3AE8 C;  4H44 D;  4PV1 C;  1EXJ A;  1VF5 B;  2E76 C;  3GLM A;  1DD3 A;  2FXP A;  4Y28 J;  1JB0 J;  1RQV A;  1ZP0 C;  3AEB C;  1KQG B;  3IN6 A;  2D2C D;  1DD4 A;  2WSF J;  3Q1M A;  2BEQ D;  2YMK A;  3O6Q A;  1GMJ A;  1OMI A;  3AE6 C;  1VL2 A;  1ZRT E;  1KIL E;  3C8V A;  4H13 C;  3D6Y A;  4KT0 J;  2MKV A;  4R4M A;  4OGQ C;  3T97 B;  2JO1 A;  3Q5R A;  3B71 A;  1S1C X;  2D2C B;  1UIX A;  3Q3D A;  1DIP A;  2ZT9 D;  3AE3 C;  4TT3 H;  1YQ3 C;  3AE7 C;  1VF5 D;  4U7J A;  4OGQ B;  5L8R J;  1ZOY C;  3AE2 C;  3G9R A;  3S9O A;  3AE9 C;  1AJY A;  3AEE C;  1IK7 A;  3AEG C;  2D2C C;  2E74 D;  1HJ0 A;  4Z1M H;  1OW8 A;  1KOR A;  5KKZ C;  2OQQ A;  2QJP C;  3GF7 A;  1YQ4 C;  3AE5 C;  3AEC C;  1Y9B A;  3AEA C;  3D71 A;  2E75 D;  2WQY C;  3GF3 A;  1K05 A;  1EXI A;  2BEZ F;  1KTM A;  1VF5 C;  4OGQ D;  1R8E A;  2FYN C;  2QSI A;  3RK3 E;  1S5L X;  2O01 J;  2YIU C;  3AE1 C;  2P10 A;  4XFJ A;  5M1B A;  1ZME C;  2ZT9 C;  1TU3 F;  2E74 C;  2G3A A;  2WSE J;  1PIX A;  2E76 B;  4PV1 B;  4I7Z C;  3ABV C;  2WSC J;  4H0L B;  2H88 C;  2J5U A;  1PL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...