1KILE

Three-dimensional structure of the complexin/snare complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
41
structure length
41
Chain Sequence
KKEEERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Synaptobrevin SNARE motif
publication title Three-dimensional structure of the complexin/SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 19
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2001-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.580 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 1kilE00
3RK3E 1KILE 3RL0g 4GDOA
chains in the Genus database with same CATH superfamily
3S1KA 1NJIQ 2IYPA 3MUDC 1SQXD 1N73B 5CCGC 1ZRTE 2IZ0A 4H13D 1JY3N 1YHQP 1KB9H 1S3JA 2QJKB 5KAIH 3E1IA 3RK2D 1VQ5P 1USDA 2M3BA 2YO3A 2XU6A 1MKMA 1NU1D 3H1JJ 1KYOH 1QVGO 3L70E 4EIJA 3L74D 1SQPD 2G3AA 3L71D 1J1EB 2W90A 5AVUB 1AQ5A 3L75E 2V7QH 1VF5D 2FYUJ 2OYIC 4WY4C 1RY3A 4MN4C 1FZEA 2KS1B 3B5NC 1DIPA 3MTUE 3NXSA 3M9QA 1Y9BA 5EFWB 1L0LE 3WUUA 1JY3P 5KAFE 5TISH 1PZQA 2WITA 2YMKA 1ZP0C 1QL2A 1NTZJ 3HUSC 1CZQA 1LTJC 1SQVK 1RE3A 3CWBJ 3Q2YA 1PP9G 3B4SA 3V4WA 1S9KD 1YQ3C 2QEXP 2YIUB 2ZYGA 1KD1Q 1KMIZ 1L0NK 3A7OA 2QVAA 4GT1A 4I7ZC 1M90Q 3M91A 5AW5B 3WUVA 2O3JA 1BGYE 2P58A 1LTTC 1JY2P 3U59A 3VTPC 3H1LE 5AW3B 4GODA 4EYYQ 2FYUK 2C9LY 1EXIA 1RF0A 2YNYA 4CPGA 2BEZF 1URQC 1HJBA 1KZUB 1BE3D 1SQVE 2WPSA 3A3YB 1YITP 5M1BA 3H1ID 1L4AA 3CMAP 3M9BA 1YBKA 4PJ0E 1IFJA 4DJGA 1PPJG 2K37A 1L0NE 4DT0A 3CCJP 1GMJA 5AW1B 3B71A 1NTZK 1NTME 1SQBD 5AW7B 1N73A 2Q5UA 1KTMA 3M9HA 2QJPB 3PP5A 3BCCJ 1HBWA 1NAFA 2KZJA 5TJHA 3MHVA 3N4XA 4PD4D 1FZCB 2IBZG 3KPEA 5AW0B 2E5TA 3P8CE 4R4MA 1E5WA 5AVRB 3H1HG 3AE7C 3G6EP 3CXHH 3VP9A 2YMYA 3FWNA 1JTHB 2H88C 3U1CA 4H13C 3PTZA 2FXMA 3C8VA 3L73E 3RK2C 2LXBA 3CCQP 4W7YA 3AEDC 3H1JD 1N7SB 1LTAC 2OYHB 1IFMA 1OVRA 3AE6C 2IX7C 2WSFJ 3RL0g 2Y0CA 2MKVA 2QSIA 5B66H 1GW3A 3LW5H 2ZXXA 4Z1MH 1JCDA 1RE3C 1NYHA 5K5GB 3TF5A 5CJ0A 1OXZA 1FOSE 4AYCA 3AE5C 2ZYDA 2I1KA 3H1HE 4XA4A 1YYCA 5B5EH 5CBOA 2KNCB 3CWBD 4A7PA 1EZVE 1ZR2A 3MIWA 2WWWA 3O6QA 1RF0C 1VQNP 2N9YB 1M56D 3MD0A 1H0TB 3H1KG 1KB9I 1FJPA 2IZ1A 2FXOA 2Y9ZA 2IDBA 5KLVJ 3II6A 1HGVA 1NTKJ 3CX5H 1LTIC 5KTBA 1PV3A 1N73C 4HYTB 1KYOI 4U3FG 1YI2P 1BCCE 2R44A 3CLQA 2XNDH 2WMMA 2QJKC 2ITAA 1FU1A 1T3JA 2MJZA 2A06E 3CD6P 5APVA 1FZCA 2N1TB 1N7SD 3C9IA 1IC2A 4K35A 4BXLA 3H25A 3PLNA 4N78E 1QVFO 3TGUD 2O1KA 1J1EC 5BU5A 2V7QJ 5KLVK 2QG4A 1PFIA 1JOCA 1VPCA 1N7SA 1HVVA 1QL1A 5AVQB 1Q82Q 2HODB 3V5BA 2OYHA 1SQQK 3AE4C 1M1JB 5C39A 1ZW0A 3G4SP 3SWYA 3GW6A 1NU1J 1QGKB 1GTWA 2JWAA 3L74J 3L72J 1SQPJ 1G2CB 3USSA 4N3YB 3RK3B 3EWKA 1HF9A 3M06A 4Y99B 1K8AQ 5APSA 1X79B 2IYOA 3H6PA 3JSVC 1CW5A 1RH5B 2SPZA 3A0BE 1SQXK 1WRGA 3IN6A 3F5HA 5GTIE 1IFPA 1SQQE 2BCCG 2E75B 1WMKA 2H89C 5H2FE 3FX0A 4K3AA 4ASVA 1JB0J 2AEMA 1FJKA 3EQ2A 3RL0B 3V4QA 1HUCA 1FBMA 3IR9A 4WY4A 3VYIA 2UWJE 1H0TA 3LIEA 2XKMA 1R8EA 4D6TE 3L4FA 1MZ9A 4UB8H 1NU1K 2G8YA 4QMAA 1NWQA 2E42A 2AEJA 4IOIH 2N1TD 1SQXE 1MUUA 1SQPK 2AXTE 2YKQA 2KLVA 3CXHI 4LGDE 3GF3A 1KORA 1KC8Q 2JJLA 1LTJA 5KKZB 1JY3O 4ASWA 2QJPC 2VRSA 1JNMA 3AEBC 1QEXA 1K9MQ 1NTKD 4U3FD 3R4YA 3D70A 3CC7P 2QJYB 5KJ7A 3FXEA 1BE3J 1GL2B 1Q2NA 1HGZA 1FZCC 5DJUB 1EDJA 2JP3A 1RQVA 2N1TA 2BCCE 1FS0E 1OW8A 3L70G 4EDFA 5AW6B 3ZDMA 2W6AA 1KB9D 5BVZA 1RHZB 2B87B 1RF1B 2N9BA 1JY2O 1SQBJ 3L71E 1OFCX 1LT9B 3L75G 2E43A 3RBZA 3Q5RA 1RQUA 1MV8A 3E1RA 3TYYA 2ZYAA 3RK3D 2FXPA 4N6JA 4L76A 1KYOD 1N7SC 3SWFA 2FBWC 4OGQB 2PRRA 1OIPA 3P7KA 2OYHC 2Y0EA 1AVYA 2Z5IA 3CCRP 1M1JA 1L0LG 4B86A 2OTLP 1P84H 2ZXEB 1VQKP 3TSIA 1HJ0A 2E75D 5APTA 1LP1B 1ZR4A 1W2EA 1WT6A 1RE4C 3CMEP 2H7HA 1ZXGA 3RL0D 3LW5J 1G2CA 4NPFX 2M0BA 1J1DC 3VMYA 3TK1A 1KQSO 3OW2O 4WB4A 5AW2B 1SQBK 4RKUJ 4H0LB 1BGYG 2O01H 3V2NA 3L72D 1S5LE 4M3LA 1JY2N 3H1LG 2OTJP 3FWLA 3AEFC 4RESB 3CX5I 1Q81Q 4IL6H 4JBZA 4L74A 2XNXA 3S9OA 3G71P 1SQVG 3H1IE 3FGAD 3FXDA 2AXTH 4LLHA 1L0NG 1KQLA 3HD7B 3CCLP 2WSSH 1GL2D 2IFMA 1FDMA 2L91A 3P8MC 2E76B 1NTMG 1VQ7P 1T3UA 1PP9J 1YJNP 1IK7A 3D6ZA 2FYUG 2ZT9D 5APWA 2WPQA 1IJDB 1JEKA 3LIDA 1E79H 1NH4A 3KZIH 4PD4E 3AE9C 2OGUA 3HRNA 5KJ7C 3CCSP 1GL2A 3BRTB 4I1LA 2N1TC 4YXWH 1LGHB 2POHA 4OGQD 5APXA 1X22A 4HKZH 4L75A 2B87A 3HE4B 1RF1A 3WMM0 2W6JH 1LT9A 2KSEA 2IBZI 3WU2E 3L73G 3CI9A 1U7JA 4XE5B 3RBXA 3H1JE 3L75D 4Y28J 3CXHD 2GUSA 3K5BA 5CBNA 2Z4EA 1EZVI 2OYOA 2WTYA 3G3ZA 4H0LD 1M1JC 2FYUE 1JMBA 1X9VA 1LP1A 2RMZA 4C7NB 1L0LD 2Z5HA 4KT0J 3MGNA 1OX3A 3TGUJ 1N8RQ 3RK3C 1DD3A 3AECC 1S5LH 4Y99C 1HTLC 5APUA 1LNQA 1AQTA 4OWFA 1Y47A 4HH2A 1NTZE 3I56P 3OAKA 3HD7D 3R2PA 3BCCG 1R5SA 2E76D 3CWBE 4GIFA 1EQ7A 2E75C 1QLED 1AFOA 1EZVG 4OVNF 3T97B 3RL0C 3P32A 3BVHA 3V6IA 3QWOC 5KAFH 2P7JA 1Z56A 2KS1A 5APYA 2Q7CA 2FY8A 1OVVA 5E79E 2FKWB 3HD7A 1KFMA 1KV4A 3MP7B 1VQLP 2M3EA 3I55P 1KILB 1OVUA 1BCCG 1VF5C 1FAVA 3L36A 1NTMD 5KKZC 3EFGA 4ZKUA 4JF7A 1T2KD 1UIIA 2A06G 2K9JB 1K73Q 3HTKB 1PP9D 2QJYC 1GL2C 3CX5D 2JWDA 1PGPA 2RH0A 3BCCE 4YPCA 3H1KJ 4C46A 2KIKA 4PJ0H 1RF1C 1P84I 1VQ9P 3HE4A 3CL3D 3GHGB 2A45G 3Q1MA 2O01N 1FZAA 1M8OB 4DZOA 1LT9C 3W67A 2C0XA 2KXPB 4XFJA 3TDKA 3CC4P 1PL5A 1VQ8P 1VL2A 2E74B 2LR2A 3BATA 1IZNB 4U3FJ 1SLQA 4OGQC 1IK9A 1Q7YQ 1PPJD 2R32A 2RN0A 2OARA 2Y0DA 2J59M 1J2JB 4BWNA 3SFDC 2W8ZA 2KLUA 5GTHE 5KLVG 1W5CE 2WT7B 1VQ6P 1X0TA 1K05A 3PH0A 1BSHA 3GG2A 5CJ4A 4NPEA 3N7NA 1ZV8A 3NTNA 4IL6X 2IBZD 1SQQG 4H0LC 1CSBA 1TU3F 1JTHA 2O01J 1X8YA 1LWUB 3H1HD 2IPPA 1KILD 1BDCA 2M8RA 1OWAA 3T97A 3H32B 1NTKK 1GDTA 4YXDC 1EZVD 4I2LC 2C0WA 1Y8AA 2KB7P 4EI2A 2JKVA 4PV1B 4GKGA 2CPSA 1MFZA 4D6TG 2WVRA 3V2QA 2E5YA 4DOJA 3HD7C 1SQXG 2E76C 2K88A 1KILA 1SFCB 1GK6A 1LTBC 1RE4A 3WUTA 4GOFA 1YTZI 2CPBA 1SP4A 5CCHD 5KLVE 1DH3A 3MZWB 1HH0A 1NTKE 1MFTA 2YIUC 2ZAEB 1BCCD 3KYQA 1YIJP 1SVFA 2K9JA 3KQGA 1H88A 3HTKA 2E74D 2JEEA 2XDJA 4WBAA 2B88A 2KNCA 2WSEH 2HYNA 3AE1C 3L74G 1SQPG 3B5ND 1XTGB 3L71G 2P67A 4RJTA 1XTCC 5CCHA 3GHGA 3GLMA 1T2KC 4JYCA 2Q3IA 3BRVB 2YO2A 3RK3E 5AVXB 2NPSB 4UB6E 2HG5D 3UIAA 1KYOE 3OA7A 3H1KD 2RKLA 1FDIA 2JR8A 4WWIA 3S4RA 3V2PA 4L73A 1NOHA 1OW6A 4U7JA 1FOSF 2BEQD 1S72P 2WSFH 1S5LX 4R4LA 3AEEC 3GMAA 3Q5SA 4H44B 1L2PA 1PGOA 3L70J 5AVSB 2WT7A 3SFEC 1YJWP 2A45H 1NU1E 4PV1D 1P84D 3L75J 1CI6B 3L72E 3L74E 1SQPE 2ZT9B 3Q5PA 3VMZA 3VMAA 1LWUA 2Q9IA 2GA1A 1SFCD 2NZ2A 3NMDA 3H1IG 3E7KA 2P10A 4JQ0D 2KOGA 1L0LJ 4KHXA 5KLIB 1L4AB 2HODA 1SQBG 4IFFA 1ZLLA 1HWTC 1R5LA 1KILC 4IFDK 1IFIA 2KSJA 3M0DA 1SFCA 1LTSC 2YKPA 1U7MA 3A0BH 3U1AA 3ABVC 3VP8A 5GTIH 1S9KE 3CCEP 1BGYJ 3NFQA 2H8PD 5H2FH 3H1LJ 2FFDB 2NPSD 1DEEG 2B89A 5BU8B 1SQVJ 3CPWO 1N86A 4UB6H 2BCCD 1Q90D 1L0LK 1BE3E 1L0NJ 5CCHC 3GHGC 3IAOA 2PGDA 1NTMJ 4ZNCA 1PGJA 3H1JG 3IF4A 2HPCB 4H44D 2NPSA 3CXHE 1QX8A 3A5TA 3BASA 1G1IA 2FYNB 2QE7H 2E74C 1SQBE 1IFNA 1GD2E 1UIXA 1IFDA 1T8ZA 2Y9YA 1GZLA 1ZRTD 1VQMP 2PP6A 5AVTB 1VQPP 1DD4A 2ZFCA 1IO4A 1N2DC 2J5UA 2Q6QA 1NTZG 3I5CA 3D71A 3A2AA 1L4AD 2FYZA 2C9NY 3L37A 5DJTB 1CI6A 3L73J 3CWBG 5B66E 1FC2C 1NTMK 1LWUC 3L70D 1FE6A 2HR3A 2I8DA 1NO4A 3O6QB 4DCKA 3F89A 1SS1A 5B5EE 3G9RA 2JDIH 3A0HE 5CMZA 4PV1C 1G1JA 3CC2P 1D7MA 3SWKA 1ZMEC 4C7RA 1OMIA 4NPDA 3M0DC 1SFCC 2WSCH 1NKZB 2IFNA 3H1HJ 4HB1A 4RO0A 1NHLA 1PP9E 3CX5E 2FFDA 2WPRA 1KQFB 1GU4A 1S4XA 1S2EA 2Q3EA 2WSEJ 2WZ7A 1EC5A 2OTKE 1BGYD 1FZBA 1NAYA 3AEGC 3TGUG 2PAJA 4YTPC 5AVWB 2R3SA 2XZRA 3H1LD 2KP8A 3JCUE 3B8EB 1VDFA 1OZHA 2H43A 3O8ZA 1ZOYC 4GDOA 3VOPA 2KYVA 1U57A 4AQRD 2ZVOB 2NPSC 2HPCA 1SQVD 1YJ9P 1NVOA 2PFXA 3AE2C 2QM7A 1NGMB 1BCCJ 2BASA 2D2CB 3TNUB 3VN0A 2YXRB 5AW8B 2OQQA 1PPJE 2A45I 1L0ND 2AEFA 4PD4H 1AJYA 1NKNA 2HFED 2GUVA 3SSUA 2L5GB 2FYUD 1EDIA 1H8AA 4H44C 1J1DB 2NRGA 2KZIA 3WU2H 2QM8A 4BRYB 2IBZE 3HE5B 3ITKA 3GF7A 3P8CD 2ZJSE 1GK4A 2B9BA 4W80A 4WVZA 2ZT9C 3TGUE 1KILE 3QH9A 1M1KQ 1AV1A 3A0HH 1NTZD 1N7LA 1EDLA 1FZGA 2OYIB 3CCUP 5CHXA 2P2UA 2V4HA 2J58A 4WY4B 3L73D 5AVVB 5KLIC 4I6MC 3B5NB 1L4AC 1A02F 1JO5A 2I1JA 4ZKPA 3EFFK 2ZVNB 1JUNA 2QRXA 3PRJA 1LTGC 2R5BA 1W2BO 1PGQA 4C7NA 1YTZT 2KI7B 3C1LA 3HUSB 3CCVP 1NTKG 1LTJB 1GU5A 4UB8E 3RGUA 1SQQJ 2JO1A 1JCCA 4KJMA 2K9YA 2WPVB 1JMMA 2LKMA 2KUBA 2FFDC 4I7ZB 1BSNA 3JCUH 2D2CD 2XV5A 1AA0A 3V2RA 1VQOP 2M5AB 1OW7A 1EXJA 1LJ2A 5CCGD 3BCCD 2W6BA 5E79H 2YKOA 1Q86Q 4D6TJ 4EOTA 3KXDA 5L8RJ 1URQB 5APQA 1SQXJ 2W27A 3KHUA 5AVYB 4HJGH 1FZFA 2K1AA 3H1KE 2FYNC 3TNUA 3W68A 3PHLA 3MUDA 1DEBA 3L35A 5CCGA 1GW4A 2LXCB 5AW4B 3JC22 4U3FE 2QIWA 4AUWA 2BCCJ 4LC1A 2K3RA 1JM0A 3KDPB 1NU1G 3L71J 1P84E 4WY4D 2A06D 2W83C 1K04A 1KB9E 3L72G 4BRYA 3HE5A 3OJAB 5KAIE 1M7LA 2CK3H 4H13B 4TT3H 4N78D 2R3CA 5AW9B 3VMXA 4IFMA 3CCMP 3RK2B 3D6YA 2OYIA 5AVZB 3PJSK 3B5NA 5GTHH 4TLFA 4IL6E 5KJ7D 1S1CX 4JPZB 1LT1A 1YQ4C 1BDDA 4JYBA 2WSCJ 1KQGB 2R5DA 2P1JA 3HUSA 4OH8B 1VF5B 2WQYC 1PIXA 1URQD 1FDOA 5KLVD 5TISE 3Q3DA 3AE8C 4ZMDA 3M0AA 3AEAC 4W7ZA 3H1IJ 2QA4P 2O1JA 4O9BA 2M5AA 1AVOA 1SQQD 4PD4I 2KK7A 3KZIE 1BE3G 1KN7A 3IFMA 3H32A 2Q1KA 1M57D 1EDKA 1DX7A 1KFNA 3AE3C 1USEA 1URQA 2GM4A 1ZN5A 1VQ4P 1T6AA 2YXQB 2AXCA 1H89A 2HLOA 2D2CC 4GOEA 2DW3A 1A02J 4D6TD
chains in the Genus database with same CATH topology
2H88C 1S5LX 4H13C 4I7ZB 3AEEC 1YQ3C 4PV1B 4R4LA 3EWKA 3G9RA 1HF9A 4KT0J 1KMIZ 2D2CD 1ZRTE 2E76B 1DD3A 3GMAA 3AECC 4I7ZC 4PV1C 3C8VA 3D6YA 3Q5SA 4H44B 1PV3A 3Q1MA 4H13D 3Q5RA 1OW7A 1RQUA 3SFEC 1EXJA 1Q90D 2E76C 3AEDC 3IN6A 4H44C 1IK7A 1ZMEC 4XFJA 2FXPA 3D6ZA 4PV1D 3IAOA 2H89C 2E75B 1OMIA 1WMKA 1PL5A 2ZT9D 1S1CX 1VL2A 5L8RJ 1JB0J 2E76D 2E74B 2QJKC 1EXIA 2FBWC 4OGQB 2E75C 4H44D 2ZT9B 3AE6C 3Q5PA 1YQ4C 3GF7A 2WSFJ 2BEZF 2WSCJ 3RL0g 2E74C 3AE9C 1KQGB 4OGQC 2YIUC 2ZT9C 3T97B 1KILE 5M1BA 2NZ2A 2FYNC 2MKVA 1VF5B 2QSIA 1HJ0A 1MKMA 2WQYC 2E75D 3H25A 1UIXA 1PIXA 2E74D 4OGQD 4Z1MH 2P10A 2G3AA 1FDOA 1R8EA 1NYHA 1KQFB 1GMJA 3Q3DA 3LW5J 3SFDC 2G8YA 3B71A 3AE8C 3AE1C 3AEAC 3AE5C 1VF5D 1DD4A 2WSEJ 2V7QJ 2QIWA 5KLIC 1KTMA 1K05A 2J5UA 3AEGC 3GLMA 3GF3A 1KORA 4YTPC 4RKUJ 4H0LB 2QJPC 1DIPA 3RK3E 1VF5C 4IL6X 1Y9BA 3AEBC 4H0LC 4Y28J 5KKZC 1TU3F 1ZOYC 3AE3C 3D71A 4GDOA 2O01J 3O6QA 1K04A 3ABVC 3AE4C 1FDIA 1U57A 3AEFC 3R4YA 3D70A 3AE2C 4R4MA 1NGMB 2D2CB 4H0LD 2JP3A 1RQVA 2YMKA 1ZP0C 3S9OA 2OQQA 2JO1A 2QJYC 3AE7C 3FGAD 4H13B 1OW6A 2D2CC 4TT3H 2IDBA 4U7JA 4YXDC 2K9YA 2WPVB 2BEQD 3Q2YA 1AJYA 1OW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RK3 E;  1KIL E;  3RL0 g;  4GDO A; 
#chains in the Genus database with same CATH topology
 3S1K A;  1NJI Q;  2IYP A;  3MUD C;  1SQX D;  1N73 B;  5CCG C;  1ZRT E;  2IZ0 A;  4H13 D;  1JY3 N;  1YHQ P;  1KB9 H;  1S3J A;  2QJK B;  5KAI H;  3E1I A;  3RK2 D;  1VQ5 P;  1USD A;  2M3B A;  2YO3 A;  2XU6 A;  1MKM A;  1NU1 D;  3H1J J;  1KYO H;  1QVG O;  3L70 E;  4EIJ A;  3L74 D;  1SQP D;  2G3A A;  3L71 D;  1J1E B;  2W90 A;  5AVU B;  1AQ5 A;  3L75 E;  2V7Q H;  1VF5 D;  2FYU J;  2OYI C;  4WY4 C;  1RY3 A;  4MN4 C;  1FZE A;  2KS1 B;  3B5N C;  1DIP A;  3MTU E;  3NXS A;  3M9Q A;  1Y9B A;  5EFW B;  1L0L E;  3WUU A;  1JY3 P;  5KAF E;  5TIS H;  1PZQ A;  2WIT A;  2YMK A;  1ZP0 C;  1QL2 A;  1NTZ J;  3HUS C;  1CZQ A;  1LTJ C;  1SQV K;  1RE3 A;  3CWB J;  3Q2Y A;  1PP9 G;  3B4S A;  3V4W A;  1S9K D;  1YQ3 C;  2QEX P;  2YIU B;  2ZYG A;  1KD1 Q;  1KMI Z;  1L0N K;  3A7O A;  2QVA A;  4GT1 A;  4I7Z C;  1M90 Q;  3M91 A;  5AW5 B;  3WUV A;  2O3J A;  1BGY E;  2P58 A;  1LTT C;  1JY2 P;  3U59 A;  3VTP C;  3H1L E;  5AW3 B;  4GOD A;  4EYY Q;  2FYU K;  2C9L Y;  1EXI A;  1RF0 A;  2YNY A;  4CPG A;  2BEZ F;  1URQ C;  1HJB A;  1KZU B;  1BE3 D;  1SQV E;  2WPS A;  3A3Y B;  1YIT P;  5M1B A;  3H1I D;  1L4A A;  3CMA P;  3M9B A;  1YBK A;  4PJ0 E;  1IFJ A;  4DJG A;  1PPJ G;  2K37 A;  1L0N E;  4DT0 A;  3CCJ P;  1GMJ A;  5AW1 B;  3B71 A;  1NTZ K;  1NTM E;  1SQB D;  5AW7 B;  1N73 A;  2Q5U A;  1KTM A;  3M9H A;  2QJP B;  3PP5 A;  3BCC J;  1HBW A;  1NAF A;  2KZJ A;  5TJH A;  3MHV A;  3N4X A;  4PD4 D;  1FZC B;  2IBZ G;  3KPE A;  5AW0 B;  2E5T A;  3P8C E;  4R4M A;  1E5W A;  5AVR B;  3H1H G;  3AE7 C;  3G6E P;  3CXH H;  3VP9 A;  2YMY A;  3FWN A;  1JTH B;  2H88 C;  3U1C A;  4H13 C;  3PTZ A;  2FXM A;  3C8V A;  3L73 E;  3RK2 C;  2LXB A;  3CCQ P;  4W7Y A;  3AED C;  3H1J D;  1N7S B;  1LTA C;  2OYH B;  1IFM A;  1OVR A;  3AE6 C;  2IX7 C;  2WSF J;  3RL0 g;  2Y0C A;  2MKV A;  2QSI A;  5B66 H;  1GW3 A;  3LW5 H;  2ZXX A;  4Z1M H;  1JCD A;  1RE3 C;  1NYH A;  5K5G B;  3TF5 A;  5CJ0 A;  1OXZ A;  1FOS E;  4AYC A;  3AE5 C;  2ZYD A;  2I1K A;  3H1H E;  4XA4 A;  1YYC A;  5B5E H;  5CBO A;  2KNC B;  3CWB D;  4A7P A;  1EZV E;  1ZR2 A;  3MIW A;  2WWW A;  3O6Q A;  1RF0 C;  1VQN P;  2N9Y B;  1M56 D;  3MD0 A;  1H0T B;  3H1K G;  1KB9 I;  1FJP A;  2IZ1 A;  2FXO A;  2Y9Z A;  2IDB A;  5KLV J;  3II6 A;  1HGV A;  1NTK J;  3CX5 H;  1LTI C;  5KTB A;  1PV3 A;  1N73 C;  4HYT B;  1KYO I;  4U3F G;  1YI2 P;  1BCC E;  2R44 A;  3CLQ A;  2XND H;  2WMM A;  2QJK C;  2ITA A;  1FU1 A;  1T3J A;  2MJZ A;  2A06 E;  3CD6 P;  5APV A;  1FZC A;  2N1T B;  1N7S D;  3C9I A;  1IC2 A;  4K35 A;  4BXL A;  3H25 A;  3PLN A;  4N78 E;  1QVF O;  3TGU D;  2O1K A;  1J1E C;  5BU5 A;  2V7Q J;  5KLV K;  2QG4 A;  1PFI A;  1JOC A;  1VPC A;  1N7S A;  1HVV A;  1QL1 A;  5AVQ B;  1Q82 Q;  2HOD B;  3V5B A;  2OYH A;  1SQQ K;  3AE4 C;  1M1J B;  5C39 A;  1ZW0 A;  3G4S P;  3SWY A;  3GW6 A;  1NU1 J;  1QGK B;  1GTW A;  2JWA A;  3L74 J;  3L72 J;  1SQP J;  1G2C B;  3USS A;  4N3Y B;  3RK3 B;  3EWK A;  1HF9 A;  3M06 A;  4Y99 B;  1K8A Q;  5APS A;  1X79 B;  2IYO A;  3H6P A;  3JSV C;  1CW5 A;  1RH5 B;  2SPZ A;  3A0B E;  1SQX K;  1WRG A;  3IN6 A;  3F5H A;  5GTI E;  1IFP A;  1SQQ E;  2BCC G;  2E75 B;  1WMK A;  2H89 C;  5H2F E;  3FX0 A;  4K3A A;  4ASV A;  1JB0 J;  2AEM A;  1FJK A;  3EQ2 A;  3RL0 B;  3V4Q A;  1HUC A;  1FBM A;  3IR9 A;  4WY4 A;  3VYI A;  2UWJ E;  1H0T A;  3LIE A;  2XKM A;  1R8E A;  4D6T E;  3L4F A;  1MZ9 A;  4UB8 H;  1NU1 K;  2G8Y A;  4QMA A;  1NWQ A;  2E42 A;  2AEJ A;  4IOI H;  2N1T D;  1SQX E;  1MUU A;  1SQP K;  2AXT E;  2YKQ A;  2KLV A;  3CXH I;  4LGD E;  3GF3 A;  1KOR A;  1KC8 Q;  2JJL A;  1LTJ A;  5KKZ B;  1JY3 O;  4ASW A;  2QJP C;  2VRS A;  1JNM A;  3AEB C;  1QEX A;  1K9M Q;  1NTK D;  4U3F D;  3R4Y A;  3D70 A;  3CC7 P;  2QJY B;  5KJ7 A;  3FXE A;  1BE3 J;  1GL2 B;  1Q2N A;  1HGZ A;  1FZC C;  5DJU B;  1EDJ A;  2JP3 A;  1RQV A;  2N1T A;  2BCC E;  1FS0 E;  1OW8 A;  3L70 G;  4EDF A;  5AW6 B;  3ZDM A;  2W6A A;  1KB9 D;  5BVZ A;  1RHZ B;  2B87 B;  1RF1 B;  2N9B A;  1JY2 O;  1SQB J;  3L71 E;  1OFC X;  1LT9 B;  3L75 G;  2E43 A;  3RBZ A;  3Q5R A;  1RQU A;  1MV8 A;  3E1R A;  3TYY A;  2ZYA A;  3RK3 D;  2FXP A;  4N6J A;  4L76 A;  1KYO D;  1N7S C;  3SWF A;  2FBW C;  4OGQ B;  2PRR A;  1OIP A;  3P7K A;  2OYH C;  2Y0E A;  1AVY A;  2Z5I A;  3CCR P;  1M1J A;  1L0L G;  4B86 A;  2OTL P;  1P84 H;  2ZXE B;  1VQK P;  3TSI A;  1HJ0 A;  2E75 D;  5APT A;  1LP1 B;  1ZR4 A;  1W2E A;  1WT6 A;  1RE4 C;  3CME P;  2H7H A;  1ZXG A;  3RL0 D;  3LW5 J;  1G2C A;  4NPF X;  2M0B A;  1J1D C;  3VMY A;  3TK1 A;  1KQS O;  3OW2 O;  4WB4 A;  5AW2 B;  1SQB K;  4RKU J;  4H0L B;  1BGY G;  2O01 H;  3V2N A;  3L72 D;  1S5L E;  4M3L A;  1JY2 N;  3H1L G;  2OTJ P;  3FWL A;  3AEF C;  4RES B;  3CX5 I;  1Q81 Q;  4IL6 H;  4JBZ A;  4L74 A;  2XNX A;  3S9O A;  3G71 P;  1SQV G;  3H1I E;  3FGA D;  3FXD A;  2AXT H;  4LLH A;  1L0N G;  1KQL A;  3HD7 B;  3CCL P;  2WSS H;  1GL2 D;  2IFM A;  1FDM A;  2L91 A;  3P8M C;  2E76 B;  1NTM G;  1VQ7 P;  1T3U A;  1PP9 J;  1YJN P;  1IK7 A;  3D6Z A;  2FYU G;  2ZT9 D;  5APW A;  2WPQ A;  1IJD B;  1JEK A;  3LID A;  1E79 H;  1NH4 A;  3KZI H;  4PD4 E;  3AE9 C;  2OGU A;  3HRN A;  5KJ7 C;  3CCS P;  1GL2 A;  3BRT B;  4I1L A;  2N1T C;  4YXW H;  1LGH B;  2POH A;  4OGQ D;  5APX A;  1X22 A;  4HKZ H;  4L75 A;  2B87 A;  3HE4 B;  1RF1 A;  3WMM 0;  2W6J H;  1LT9 A;  2KSE A;  2IBZ I;  3WU2 E;  3L73 G;  3CI9 A;  1U7J A;  4XE5 B;  3RBX A;  3H1J E;  3L75 D;  4Y28 J;  3CXH D;  2GUS A;  3K5B A;  5CBN A;  2Z4E A;  1EZV I;  2OYO A;  2WTY A;  3G3Z A;  4H0L D;  1M1J C;  2FYU E;  1JMB A;  1X9V A;  1LP1 A;  2RMZ A;  4C7N B;  1L0L D;  2Z5H A;  4KT0 J;  3MGN A;  1OX3 A;  3TGU J;  1N8R Q;  3RK3 C;  1DD3 A;  3AEC C;  1S5L H;  4Y99 C;  1HTL C;  5APU A;  1LNQ A;  1AQT A;  4OWF A;  1Y47 A;  4HH2 A;  1NTZ E;  3I56 P;  3OAK A;  3HD7 D;  3R2P A;  3BCC G;  1R5S A;  2E76 D;  3CWB E;  4GIF A;  1EQ7 A;  2E75 C;  1QLE D;  1AFO A;  1EZV G;  4OVN F;  3T97 B;  3RL0 C;  3P32 A;  3BVH A;  3V6I A;  3QWO C;  5KAF H;  2P7J A;  1Z56 A;  2KS1 A;  5APY A;  2Q7C A;  2FY8 A;  1OVV A;  5E79 E;  2FKW B;  3HD7 A;  1KFM A;  1KV4 A;  3MP7 B;  1VQL P;  2M3E A;  3I55 P;  1KIL B;  1OVU A;  1BCC G;  1VF5 C;  1FAV A;  3L36 A;  1NTM D;  5KKZ C;  3EFG A;  4ZKU A;  4JF7 A;  1T2K D;  1UII A;  2A06 G;  2K9J B;  1K73 Q;  3HTK B;  1PP9 D;  2QJY C;  1GL2 C;  3CX5 D;  2JWD A;  1PGP A;  2RH0 A;  3BCC E;  4YPC A;  3H1K J;  4C46 A;  2KIK A;  4PJ0 H;  1RF1 C;  1P84 I;  1VQ9 P;  3HE4 A;  3CL3 D;  3GHG B;  2A45 G;  3Q1M A;  2O01 N;  1FZA A;  1M8O B;  4DZO A;  1LT9 C;  3W67 A;  2C0X A;  2KXP B;  4XFJ A;  3TDK A;  3CC4 P;  1PL5 A;  1VQ8 P;  1VL2 A;  2E74 B;  2LR2 A;  3BAT A;  1IZN B;  4U3F J;  1SLQ A;  4OGQ C;  1IK9 A;  1Q7Y Q;  1PPJ D;  2R32 A;  2RN0 A;  2OAR A;  2Y0D A;  2J59 M;  1J2J B;  4BWN A;  3SFD C;  2W8Z A;  2KLU A;  5GTH E;  5KLV G;  1W5C E;  2WT7 B;  1VQ6 P;  1X0T A;  1K05 A;  3PH0 A;  1BSH A;  3GG2 A;  5CJ4 A;  4NPE A;  3N7N A;  1ZV8 A;  3NTN A;  4IL6 X;  2IBZ D;  1SQQ G;  4H0L C;  1CSB A;  1TU3 F;  1JTH A;  2O01 J;  1X8Y A;  1LWU B;  3H1H D;  2IPP A;  1KIL D;  1BDC A;  2M8R A;  1OWA A;  3T97 A;  3H32 B;  1NTK K;  1GDT A;  4YXD C;  1EZV D;  4I2L C;  2C0W A;  1Y8A A;  2KB7 P;  4EI2 A;  2JKV A;  4PV1 B;  4GKG A;  2CPS A;  1MFZ A;  4D6T G;  2WVR A;  3V2Q A;  2E5Y A;  4DOJ A;  3HD7 C;  1SQX G;  2E76 C;  2K88 A;  1KIL A;  1SFC B;  1GK6 A;  1LTB C;  1RE4 A;  3WUT A;  4GOF A;  1YTZ I;  2CPB A;  1SP4 A;  5CCH D;  5KLV E;  1DH3 A;  3MZW B;  1HH0 A;  1NTK E;  1MFT A;  2YIU C;  2ZAE B;  1BCC D;  3KYQ A;  1YIJ P;  1SVF A;  2K9J A;  3KQG A;  1H88 A;  3HTK A;  2E74 D;  2JEE A;  2XDJ A;  4WBA A;  2B88 A;  2KNC A;  2WSE H;  2HYN A;  3AE1 C;  3L74 G;  1SQP G;  3B5N D;  1XTG B;  3L71 G;  2P67 A;  4RJT A;  1XTC C;  5CCH A;  3GHG A;  3GLM A;  1T2K C;  4JYC A;  2Q3I A;  3BRV B;  2YO2 A;  3RK3 E;  5AVX B;  2NPS B;  4UB6 E;  2HG5 D;  3UIA A;  1KYO E;  3OA7 A;  3H1K D;  2RKL A;  1FDI A;  2JR8 A;  4WWI A;  3S4R A;  3V2P A;  4L73 A;  1NOH A;  1OW6 A;  4U7J A;  1FOS F;  2BEQ D;  1S72 P;  2WSF H;  1S5L X;  4R4L A;  3AEE C;  3GMA A;  3Q5S A;  4H44 B;  1L2P A;  1PGO A;  3L70 J;  5AVS B;  2WT7 A;  3SFE C;  1YJW P;  2A45 H;  1NU1 E;  4PV1 D;  1P84 D;  3L75 J;  1CI6 B;  3L72 E;  3L74 E;  1SQP E;  2ZT9 B;  3Q5P A;  3VMZ A;  3VMA A;  1LWU A;  2Q9I A;  2GA1 A;  1SFC D;  2NZ2 A;  3NMD A;  3H1I G;  3E7K A;  2P10 A;  4JQ0 D;  2KOG A;  1L0L J;  4KHX A;  5KLI B;  1L4A B;  2HOD A;  1SQB G;  4IFF A;  1ZLL A;  1HWT C;  1R5L A;  1KIL C;  4IFD K;  1IFI A;  2KSJ A;  3M0D A;  1SFC A;  1LTS C;  2YKP A;  1U7M A;  3A0B H;  3U1A A;  3ABV C;  3VP8 A;  5GTI H;  1S9K E;  3CCE P;  1BGY J;  3NFQ A;  2H8P D;  5H2F H;  3H1L J;  2FFD B;  2NPS D;  1DEE G;  2B89 A;  5BU8 B;  1SQV J;  3CPW O;  1N86 A;  4UB6 H;  2BCC D;  1Q90 D;  1L0L K;  1BE3 E;  1L0N J;  5CCH C;  3GHG C;  3IAO A;  2PGD A;  1NTM J;  4ZNC A;  1PGJ A;  3H1J G;  3IF4 A;  2HPC B;  4H44 D;  2NPS A;  3CXH E;  1QX8 A;  3A5T A;  3BAS A;  1G1I A;  2FYN B;  2QE7 H;  2E74 C;  1SQB E;  1IFN A;  1GD2 E;  1UIX A;  1IFD A;  1T8Z A;  2Y9Y A;  1GZL A;  1ZRT D;  1VQM P;  2PP6 A;  5AVT B;  1VQP P;  1DD4 A;  2ZFC A;  1IO4 A;  1N2D C;  2J5U A;  2Q6Q A;  1NTZ G;  3I5C A;  3D71 A;  3A2A A;  1L4A D;  2FYZ A;  2C9N Y;  3L37 A;  5DJT B;  1CI6 A;  3L73 J;  3CWB G;  5B66 E;  1FC2 C;  1NTM K;  1LWU C;  3L70 D;  1FE6 A;  2HR3 A;  2I8D A;  1NO4 A;  3O6Q B;  4DCK A;  3F89 A;  1SS1 A;  5B5E E;  3G9R A;  2JDI H;  3A0H E;  5CMZ A;  4PV1 C;  1G1J A;  3CC2 P;  1D7M A;  3SWK A;  1ZME C;  4C7R A;  1OMI A;  4NPD A;  3M0D C;  1SFC C;  2WSC H;  1NKZ B;  2IFN A;  3H1H J;  4HB1 A;  4RO0 A;  1NHL A;  1PP9 E;  3CX5 E;  2FFD A;  2WPR A;  1KQF B;  1GU4 A;  1S4X A;  1S2E A;  2Q3E A;  2WSE J;  2WZ7 A;  1EC5 A;  2OTK E;  1BGY D;  1FZB A;  1NAY A;  3AEG C;  3TGU G;  2PAJ A;  4YTP C;  5AVW B;  2R3S A;  2XZR A;  3H1L D;  2KP8 A;  3JCU E;  3B8E B;  1VDF A;  1OZH A;  2H43 A;  3O8Z A;  1ZOY C;  4GDO A;  3VOP A;  2KYV A;  1U57 A;  4AQR D;  2ZVO B;  2NPS C;  2HPC A;  1SQV D;  1YJ9 P;  1NVO A;  2PFX A;  3AE2 C;  2QM7 A;  1NGM B;  1BCC J;  2BAS A;  2D2C B;  3TNU B;  3VN0 A;  2YXR B;  5AW8 B;  2OQQ A;  1PPJ E;  2A45 I;  1L0N D;  2AEF A;  4PD4 H;  1AJY A;  1NKN A;  2HFE D;  2GUV A;  3SSU A;  2L5G B;  2FYU D;  1EDI A;  1H8A A;  4H44 C;  1J1D B;  2NRG A;  2KZI A;  3WU2 H;  2QM8 A;  4BRY B;  2IBZ E;  3HE5 B;  3ITK A;  3GF7 A;  3P8C D;  2ZJS E;  1GK4 A;  2B9B A;  4W80 A;  4WVZ A;  2ZT9 C;  3TGU E;  1KIL E;  3QH9 A;  1M1K Q;  1AV1 A;  3A0H H;  1NTZ D;  1N7L A;  1EDL A;  1FZG A;  2OYI B;  3CCU P;  5CHX A;  2P2U A;  2V4H A;  2J58 A;  4WY4 B;  3L73 D;  5AVV B;  5KLI C;  4I6M C;  3B5N B;  1L4A C;  1A02 F;  1JO5 A;  2I1J A;  4ZKP A;  3EFF K;  2ZVN B;  1JUN A;  2QRX A;  3PRJ A;  1LTG C;  2R5B A;  1W2B O;  1PGQ A;  4C7N A;  1YTZ T;  2KI7 B;  3C1L A;  3HUS B;  3CCV P;  1NTK G;  1LTJ B;  1GU5 A;  4UB8 E;  3RGU A;  1SQQ J;  2JO1 A;  1JCC A;  4KJM A;  2K9Y A;  2WPV B;  1JMM A;  2LKM A;  2KUB A;  2FFD C;  4I7Z B;  1BSN A;  3JCU H;  2D2C D;  2XV5 A;  1AA0 A;  3V2R A;  1VQO P;  2M5A B;  1OW7 A;  1EXJ A;  1LJ2 A;  5CCG D;  3BCC D;  2W6B A;  5E79 H;  2YKO A;  1Q86 Q;  4D6T J;  4EOT A;  3KXD A;  5L8R J;  1URQ B;  5APQ A;  1SQX J;  2W27 A;  3KHU A;  5AVY B;  4HJG H;  1FZF A;  2K1A A;  3H1K E;  2FYN C;  3TNU A;  3W68 A;  3PHL A;  3MUD A;  1DEB A;  3L35 A;  5CCG A;  1GW4 A;  2LXC B;  5AW4 B;  3JC2 2;  4U3F E;  2QIW A;  4AUW A;  2BCC J;  4LC1 A;  2K3R A;  1JM0 A;  3KDP B;  1NU1 G;  3L71 J;  1P84 E;  4WY4 D;  2A06 D;  2W83 C;  1K04 A;  1KB9 E;  3L72 G;  4BRY A;  3HE5 A;  3OJA B;  5KAI E;  1M7L A;  2CK3 H;  4H13 B;  4TT3 H;  4N78 D;  2R3C A;  5AW9 B;  3VMX A;  4IFM A;  3CCM P;  3RK2 B;  3D6Y A;  2OYI A;  5AVZ B;  3PJS K;  3B5N A;  5GTH H;  4TLF A;  4IL6 E;  5KJ7 D;  1S1C X;  4JPZ B;  1LT1 A;  1YQ4 C;  1BDD A;  4JYB A;  2WSC J;  1KQG B;  2R5D A;  2P1J A;  3HUS A;  4OH8 B;  1VF5 B;  2WQY C;  1PIX A;  1URQ D;  1FDO A;  5KLV D;  5TIS E;  3Q3D A;  3AE8 C;  4ZMD A;  3M0A A;  3AEA C;  4W7Z A;  3H1I J;  2QA4 P;  2O1J A;  4O9B A;  2M5A A;  1AVO A;  1SQQ D;  4PD4 I;  2KK7 A;  3KZI E;  1BE3 G;  1KN7 A;  3IFM A;  3H32 A;  2Q1K A;  1M57 D;  1EDK A;  1DX7 A;  1KFN A;  3AE3 C;  1USE A;  1URQ A;  2GM4 A;  1ZN5 A;  1VQ4 P;  1T6A A;  2YXQ B;  2AXC A;  1H89 A;  2HLO A;  2D2C C;  4GOE A;  2DW3 A;  1A02 J;  4D6T D; 
#chains in the Genus database with same CATH homology
 2H88 C;  1S5L X;  4H13 C;  4I7Z B;  3AEE C;  1YQ3 C;  4PV1 B;  4R4L A;  3EWK A;  3G9R A;  1HF9 A;  4KT0 J;  1KMI Z;  2D2C D;  1ZRT E;  2E76 B;  1DD3 A;  3GMA A;  3AEC C;  4I7Z C;  4PV1 C;  3C8V A;  3D6Y A;  3Q5S A;  4H44 B;  1PV3 A;  3Q1M A;  4H13 D;  3Q5R A;  1OW7 A;  1RQU A;  3SFE C;  1EXJ A;  1Q90 D;  2E76 C;  3AED C;  3IN6 A;  4H44 C;  1IK7 A;  1ZME C;  4XFJ A;  2FXP A;  3D6Z A;  4PV1 D;  3IAO A;  2H89 C;  2E75 B;  1OMI A;  1WMK A;  1PL5 A;  2ZT9 D;  1S1C X;  1VL2 A;  5L8R J;  1JB0 J;  2E76 D;  2E74 B;  2QJK C;  1EXI A;  2FBW C;  4OGQ B;  2E75 C;  4H44 D;  2ZT9 B;  3AE6 C;  3Q5P A;  1YQ4 C;  3GF7 A;  2WSF J;  2BEZ F;  2WSC J;  3RL0 g;  2E74 C;  3AE9 C;  1KQG B;  4OGQ C;  2YIU C;  2ZT9 C;  3T97 B;  1KIL E;  5M1B A;  2NZ2 A;  2FYN C;  2MKV A;  1VF5 B;  2QSI A;  1HJ0 A;  1MKM A;  2WQY C;  2E75 D;  3H25 A;  1UIX A;  1PIX A;  2E74 D;  4OGQ D;  4Z1M H;  2P10 A;  2G3A A;  1FDO A;  1R8E A;  1NYH A;  1KQF B;  1GMJ A;  3Q3D A;  3LW5 J;  3SFD C;  2G8Y A;  3B71 A;  3AE8 C;  3AE1 C;  3AEA C;  3AE5 C;  1VF5 D;  1DD4 A;  2WSE J;  2V7Q J;  2QIW A;  5KLI C;  1KTM A;  1K05 A;  2J5U A;  3AEG C;  3GLM A;  3GF3 A;  1KOR A;  4YTP C;  4RKU J;  4H0L B;  2QJP C;  1DIP A;  3RK3 E;  1VF5 C;  4IL6 X;  1Y9B A;  3AEB C;  4H0L C;  4Y28 J;  5KKZ C;  1TU3 F;  1ZOY C;  3AE3 C;  3D71 A;  4GDO A;  2O01 J;  3O6Q A;  1K04 A;  3ABV C;  3AE4 C;  1FDI A;  1U57 A;  3AEF C;  3R4Y A;  3D70 A;  3AE2 C;  4R4M A;  1NGM B;  2D2C B;  4H0L D;  2JP3 A;  1RQV A;  2YMK A;  1ZP0 C;  3S9O A;  2OQQ A;  2JO1 A;  2QJY C;  3AE7 C;  3FGA D;  4H13 B;  1OW6 A;  2D2C C;  4TT3 H;  2IDB A;  4U7J A;  4YXD C;  2K9Y A;  2WPV B;  2BEQ D;  3Q2Y A;  1AJY A;  1OW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...