1KILE

Three-dimensional structure of the complexin/snare complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
41
structure length
41
Chain Sequence
KKEEERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptobrevin SNARE motif
publication title Three-dimensional structure of the complexin/SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 19
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2001-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.580 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 1kilE00
3RK3E 1KILE 3RL0g 4GDOA
chains in the Genus database with same CATH superfamily
2Y9YA 4ASWA 2WSEH 1FOSE 1HF9A 1WMKA 3GW6A 3SFEC 3RL0C 1SQBK 4KHXA 2P10A 4JF7A 2KP8A 3AE3C 4Z1MH 3OAKA 3OA7A 2BASA 2JWDA 3B5NA 3L70G 3O6QA 4I7ZB 1CZQA 5KAFH 1YQ4C 1H0TA 1Y9BA 1VQ4P 2JJLA 1NWQA 3L73J 1NTKG 2ZT9D 1YTZT 3CXHH 3JSVC 2KS1A 4L75A 5KAFE 2LKMA 1LWUA 3AEEC 2QJYB 1NTZJ 1R8EA 1YQ3C 3M9QA 2I1KA 3CXHE 4B86A 4HYTB 3RL0g 3L74E 3L75E 1IK7A 4R4MA 2HYNA 1FZCA 1VF5C 1SQXE 1JB0J 1MV8A 1S1CX 1IFJA 1LP1A 1SQXD 1S3JA 3L4FA 4DZOA 1KQLA 3LIEA 3RK3C 1G1IA 1KV4A 1VQNP 1HVVA 2ZAEB 3AE1C 4HKZH 3B71A 1OVUA 2O01H 4JQ0D 2C9LY 1CI6B 3AEDC 3S1KA 1FU1A 2FFDB 1JCCA 1URQD 3WUVA 2N9BA 1H89A 5AVTB 1ZRTE 3R2PA 4OVNF 3AE6C 4JYBA 5M1BA 5APVA 2WQYC 1A02F 1P84I 3H1LD 3IN6A 5KJ7D 1IFDA 3HE4B 2E74C 1KILA 3MUDA 2K9JB 1L0LK 5KKZB 2LR2A 3EFGA 3FWLA 3F5HA 1JEKA 5AW0B 3IAOA 1GL2D 4H44D 3L70E 1GL2B 3SSUA 2RMZA 2E76C 4WBAA 4ZMDA 2E42A 3L70D 1FZFA 2WVRA 1NTKE 1QLED 2B87B 4H13B 1CSBA 1SS1A 1NTKD 5APWA 2PAJA 2FYNB 4AUWA 2PGDA 1IFPA 3RK2B 1BGYJ 3CCMP 2BEZF 4W80A 2DW3A 1HH0A 5AVXB 3I5CA 3BCCE 1WRGA 2P2UA 1HWTC 4KT0J 1KD1Q 1W2EA 2FYUG 3BCCD 3H1HG 1SQVJ 1X9VA 3L72G 3VOPA 1JUNA 3CWBE 4IL6H 3H1JE 4PV1C 4Y28J 3AEBC 1YYCA 1PGOA 2MJZA 3H1JD 4K3AA 1IO4A 2BEQD 3A0HH 3MP7B 1J1DB 1MUUA 2JEEA 3VMZA 3GG2A 2LXCB 3TF5A 1L0NE 1G2CB 4AYCA 2HODB 1SQBJ 2WPVB 1L0ND 2H89C 3HE5B 3TGUG 3W68A 4XE5B 2W27A 3VP9A 1L4AC 5APTA 3JCUH 3LIDA 1OVVA 2XNXA 1HJ0A 2RH0A 1MFZA 4XFJA 1LTJC 3CMAP 3JCUE 1U57A 1OZHA 2ZJSE 2OYHB 1FS0E 2KZIA 2ZYGA 1OW7A 1RE4A 2FKWB 2FFDA 2C9NY 3GHGB 5AW4B 1BE3G 3RBZA 3M91A 3HUSA 2KXPB 2V7QJ 3WUUA 4M3LA 2WMMA 1PGJA 1SLQA 2NPSA 1LT9A 1N7SB 3G9RA 1SFCC 5KLIC 1VQOP 1Q2NA 3FXDA 3HTKB 2B9BA 3G6EP 1IFNA 2N9YB 3H1KE 3RL0B 2AEJA 1M90Q 2K9JA 3CI9A 3WU2H 1RQUA 1GK4A 1K05A 2FYUE 1K04A 4RO0A 1KC8Q 1M1KQ 3WU2E 1AVYA 1P84E 3OW2O 2FYUD 1P84D 1PP9E 2B87A 1VQKP 3CC2P 3TYYA 2Z5IA 3V6IA 2Q9IA 3UIAA 1PP9D 1FAVA 1NHLA 3AE2C 1GW3A 1NVOA 1FDMA 1LNQA 1YJ9P 2WWWA 1USDA 4U3FJ 4I2LC 1DH3A 3ZDMA 3BATA 3F89A 3A0BH 3MD0A 1LT9C 3TGUE 3K5BA 1KQGB 2BCCJ 3L73G 1FZEA 3TGUD 2QSIA 2YO2A 3A0BE 2Y0EA 1X8YA 1QL2A 2FXOA 2R32A 3B5ND 1WT6A 3VN0A 5APUA 3H1HJ 2CPSA 3L72J 2Z4EA 1N73C 1KZUB 4UB6E 3CL3D 5DJTB 5AVQB 1S72P 2WSSH 3U1CA 3KHUA 1L2PA 1LWUB 1NTMK 2ZXXA 2E74B 3KZIH 5GTHH 2WPSA 1RF0A 5KLVK 3V4QA 3PRJA 3KZIE 3D70A 5GTHE 2OYHA 3A3YB 2A06G 1LP1B 3GHGA 5AVYB 1Q86Q 1FOSF 1ZP0C 3PHLA 3HD7C 4D6TE 4LLHA 1SQQK 3II6A 3SWKA 1NU1K 3M0DA 1W5CE 2O1JA 1JY2P 3HTKA 2Y9ZA 2Q3EA 1AA0A 2IFNA 1BE3J 2YO3A 1SQQG 1OWAA 1NU1G 2ZVNB 4LC1A 3CCEP 3Q3DA 2GUSA 1VQ5P 4EOTA 1RE3C 2Q1KA 4PV1B 1Y47A 5AVUB 1ZR2A 1KILB 3L73E 3V2PA 3L36A 1NKZB 1VL2A 1FE6A 2KLVA 3L73D 1BCCJ 3AEGC 3KXDA 3CCVP 5BU5A 3AE9C 2XU6A 1NTZE 1YI2P 1M8OB 1OW8A 1GD2E 2N1TD 1PIXA 1EZVG 1L4AB 3E1RA 1RQVA 3LW5J 2CPBA 2KB7P 2IBZG 1SQVG 1JY2O 3E7KA 1AQ5A 3SFDC 1MFTA 2R3CA 3GF7A 3U1AA 4RJTA 2ZVOB 3AEAC 1HGVA 4A7PA 1NYHA 3H1IJ 1NJIQ 1IFIA 3PTZA 1GU4A 2R3SA 2I8DA 5GTIH 5CCGD 1SQPK 2KZJA 1QX8A 1QL1A 1JTHA 1SQBG 2IYOA 3H32B 5CCHD 5GTIE 2JP3A 1OVRA 2MKVA 1OXZA 1BDCA 5AVVB 1GMJA 4C46A 2IZ0A 1SQPG 3MTUE 1HUCA 3BVHA 3PH0A 1HTLC 4Y99B 3Q2YA 2P58A 3VMAA 3SWFA 1ZXGA 5CMZA 4OGQD 4OGQB 3A2AA 2QRXA 2QE7H 1LTIC 3E1IA 2KI7B 2POHA 1Q90D 2W90A 3G71P 2AXTH 1RF1C 4OWFA 4EDFA 3MIWA 1NAYA 2AXTE 3N7NA 5CJ4A 2RN0A 3VP8A 3VTPC 3C8VA 1NOHA 1NTMJ 4IFMA 3Q5SA 5B66E 4EYYQ 1L0NK 3QWOC 1J1EC 3Q5PA 3W67A 1OX3A 3M9BA 3WUTA 3HUSB 2WSEJ 5KLVJ 2QM8A 1BGYE 2NPSD 1M57D 2YMKA 2K3RA 2NPSB 2OTKE 3H1LE 1LT9B 1BGYD 2KYVA 1XTCC 3V2NA 4GKGA 2D2CC 1Z56A 4WVZA 1GK6A 1SQVE 3AE5C 2WSCH 1SQQJ 2FY8A 1ZN5A 1NU1J 1JNMA 1D7MA 1SQVD 2JDIH 3USSA 4L73A 2M8RA 3EFFK 4WY4C 5EFWB 1FZBA 2YIUC 4R4LA 5AVWB 1EDJA 4H13D 2B89A 1L0LG 1T2KC 1L4AA 4U3FG 1UIXA 3V2RA 1SQBE 2E75C 2QJPC 3RK2D 1SQBD 1LTJA 2KIKA 2BCCG 1JOCA 3TNUA 1M1JC 3I55P 4HJGH 4N6JA 4DJGA 3HD7B 2O01J 3P8CE 3CX5I 3P8CD 2ZYDA 1SFCA 1KFNA 3H32A 2K88A 4BXLA 2Y0CA 3P32A 3CCSP 2ZXEB 1T6AA 2VRSA 3L71G 3NXSA 2Q7CA 1EDLA 3KPEA 4H0LC 4O9BA 4BWNA 3V2QA 2R5BA 1SVFA 2E5TA 2W6JH 5AW9B 2A45G 1SQPJ 4W7ZA 4C7NA 1FZAA 1KN7A 4ZKPA 1GW4A 3FXEA 2N1TC 2O3JA 2WTYA 2JWAA 4GOFA 1PGPA 1H8AA 2WPRA 1RH5B 2QEXP 2C0XA 1R5LA 4I6MC 4GDOA 1N7SD 3KQGA 2GM4A 3GF3A 3CWBJ 2KSEA 4U3FE 4WB4A 1NO4A 3RL0D 2XV5A 4I7ZC 2J58A 4U3FD 2OGUA 3VYIA 5CCGC 2GA1A 2HG5D 2BCCE 1A02J 1NKNA 2ZT9C 1P84H 4AQRD 2AXCA 1N73A 4HB1A 2BCCD 1U7JA 1BCCG 3VMXA 1T3JA 5CBNA 5CCHC 2HPCB 2QJYC 1QGKB 5AW8B 3H1HE 1AJYA 4YXDC 3MHVA 3L72E 3H1HD 4NPFX 3L72D 1EXIA 3CMEP 1QVFO 1KB9E 1VF5B 4U7JA 2KK7A 1L0LJ 2KNCA 3CD6P 1KB9D 3H1IG 1JY3N 1PPJG 3RK3B 3PLNA 3HD7A 4K35A 3RGUA 4UB6H 1URQC 4ZNCA 1USEA 1J1EB 3CX5H 1NTZK 2SPZA 2IFMA 4OH8B 1S9KE 4I1LA 1KQSO 1S9KD 1PL5A 1IFMA 2P67A 1PGQA 1JTHB 3A5TA 5KJ7C 4ZKUA 1PFIA 2IDBA 2Y0DA 3CX5E 1BE3E 1HGZA 2AEMA 1RE3A 2QIWA 3CX5D 1BE3D 2D2CB 3L37A 2E74D 5CJ0A 3CCQP 3AE8C 3NTNA 1CW5A 3L71J 1S4XA 1GL2C 1LT1A 2JO1A 2W6BA 4H44C 4L76A 4WY4B 5AW3B 2WSFH 2E5YA 2G3AA 2E76D 4JBZA 1NTMG 4H13C 2E76B 3WMM0 4JPZB 1BCCE 2FYNC 2YKPA 2QA4P 1U7MA 1BCCD 4DT0A 2YNYA 5KLVG 2KUBA 2Q5UA 1EZVI 2E75B 1LTGC 4QMAA 3PP5A 2QJPB 1LJ2A 1VQ7P 2IBZI 2L5GB 3AE4C 5APSA 2M5AA 3EQ2A 1IK9A 4C7RA 1X0TA 5H2FH 1S2EA 1SQXK 5DJUB 1ZW0A 4TT3H 4PD4D 2WITA 2J59M 3L74G 1LTBC 5H2FE 5AW5B 3C1LA 1VQPP 4PV1D 2HPCA 1KILE 3L75G 5AVSB 1N2DC 3H1ID 1J1DC 1KILD 3AEFC 1FBMA 1AVOA 2PRRA 1SQXG 1DEEG 4ASVA 5KAIH 4W7YA 5KTBA 2OYOA 1UIIA 1DD3A 2QVAA 2OYIC 2YXQB 5KAIE 1QVGO 2P1JA 2OQQA 2OARA 3T97B 2R44A 1RF1A 1L4AD 2ITAA 2O1KA 2NRGA 4PJ0H 2IZ1A 1BSNA 1VQMP 1FJKA 4BRYA 3KDPB 3V5BA 2XZRA 1LTJB 2JKVA 1KQFB 1KORA 3TNUB 4PJ0E 1LTTC 4L74A 3C9IA 1VQ6P 5CBOA 3MZWB 4NPEA 1N7SC 3B4SA 1HJBA 1NTME 1NTKK 2A06E 1Q81Q 1SFCD 1NTMD 1SFCB 2J5UA 5KLIB 2H8PD 2A06D 2FBWC 5KLVE 4GT1A 4TLFA 1TU3F 5KLVD 2O01N 2OTJP 2ZT9B 5AVRB 2W83C 2WPQA 4WY4A 2UWJE 3CLQA 5K5GB 2P7JA 1SQQE 1JMBA 1NU1E 3ITKA 3P8MC 1GTWA 2PP6A 2FXMA 1SQQD 2Q6QA 1NU1D 1PZQA 1JO5A 4C7NB 5AVZB 1KFMA 3CXHD 3BCCG 5B66H 3L74D 3NFQA 4RESB 1PV3A 3L75D 2K9YA 2RKLA 1Q82Q 3CWBG 4YTPC 3TK1A 3H1JG 2E43A 2AEFA 1M1JA 3QH9A 1ZMEC 2IYPA 1FDIA 1JCDA 5BVZA 1QEXA 2QJKC 1NH4A 1DIPA 2C0WA 1EZVE 3BRVB 1K8AQ 1L0NG 2NZ2A 3B5NC 1FZGA 1EQ7A 3BASA 1EZVD 2IBZE 1EC5A 1URQB 4MN4C 1AFOA 5L8RJ 2IBZD 4NPDA 1HBWA 2FXPA 3N4XA 1ZRTD 1N73B 3L74J 1BDDA 2Z5HA 4GODA 1LWUC 3L75J 2KSJA 1KB9I 4CPGA 3G4SP 1W2BO 1SQXJ 3U59A 4UB8H 2G8YA 3T97A 4RKUJ 1YIJP 1X22A 1OW6A 1Y8AA 2H7HA 1KTMA 2WT7A 1FZCC 2A45I 4H44B 4UB8E 1GDTA 5AW7B 1SQPE 2N1TA 2W8ZA 2KNCB 1S5LH 1VDFA 1SQPD 1XTGB 3H1KG 1FDOA 2FYUK 3HD7D 3ABVC 1EXJA 2V7QH 4EIJA 1S5LE 3D6YA 1K73Q 3H1LJ 1YITP 2IX7C 2M0BA 4JYCA 1R5SA 1K9MQ 4HH2A 5AW2B 2L91A 1M7LA 1T3UA 3P7KA 1MZ9A 3TDKA 5CCGA 4EI2A 3GLMA 1GU5A 3D71A 1PP9G 2YMYA 3D6ZA 3CCRP 3CWBD 4DCKA 2WSCJ 1ZR4A 3L70J 1KILC 3MUDC 2ZYAA 5CCHA 4IL6E 1IC2A 1VQLP 3M0AA 5BU8B 3L35A 2OTLP 1NTKJ 3M9HA 4WWIA 1S5LX 2IPPA 3JC22 3A0HE 1GZLA 2K1AA 3CCLP 2OYIB 3PJSK 4PD4I 3BCCJ 1N7LA 3EWKA 2HLOA 1T8ZA 1IJDB 4IL6X 1L0LE 2Q3IA 1CI6A 3FX0A 1KYOI 4N78E 3H25A 2I1JA 3H1JJ 3S9OA 4YXWH 5AW6B 1L0LD 2M5AB 1OMIA 5TJHA 4N78D 1URQA 2XKMA 1NAFA 2KOGA 3TSIA 1MKMA 1YHQP 3G3ZA 1ZLLA 3Q5RA 2V4HA 2QM7A 1L0NJ 1AV1A 5KJ7A 1NGMB 1LTAC 3HE4A 1VQ9P 1Q7YQ 3H1KD 1IZNB 4Y99C 3SWYA 2GUVA 1EDKA 2XDJA 1KB9H 4OGQC 4D6TG 1GL2A 2LXBA 1J2JB 5CHXA 4GOEA 1RHZB 1AQTA 1VF5D 3L71E 4IFDK 1VPCA 2QG4A 3RK3E 1RF1B 5B5EH 2A45H 3L71D 1LTSC 1ZOYC 2PFXA 2B88A 3RK3D 2HR3A 4BRYB 1RE4C 2KLUA 5B5EE 3Q1MA 2FFDC 1DD4A 1OIPA 3KYQA 3HUSC 2HFED 3H1KJ 4LGDE 1JY2N 1YJNP 1ZV8A 2NPSC 2FYZA 3H6PA 3OJAB 3S4RA 1YJWP 3B8EB 2K37A 4DOJA 2QJKB 2XNDH 1KMIZ 2W6AA 3CXHI 2D2CD 1OFCX 3AE7C 3B5NB 3O6QB 2FYUJ 3IF4A 5KKZC 1NTZG 5C39A 1X79B 1H0TB 3GMAA 5E79H 3FGAD 1PP9J 2M3BA 1G2CA 4WY4D 2HODA 1N86A 2KS1B 4IFFA 1N8RQ 2YIUB 1SP4A 5E79E 3HE5A 2OYIA 5APQA 1T2KD 2R5DA 1EDIA 3RK2C 3LW5H 2E75D 3IFMA 3R4YA 2H88C 1FJPA 1FZCB 2H43A 3TGUJ 4PD4H 1LGHB 1FC2C 3CCUP 1JY3P 3BRTB 1E5WA 3AECC 3CC4P 1M1JB 4YPCA 4PD4E 4XA4A 3I56P 4D6TD 3O8ZA 5APYA 1KYOH 1N7SA 2YKOA 3CCJP 3RBXA 1DX7A 3H1IE 2YXRB 1PPJE 1RY3A 5APXA 1KYOE 3NMDA 2JR8A 1DEBA 1PPJD 1KYOD 1BSHA 3MGNA 4KJMA 2ZFCA 4H0LD 3VMYA 1VQ8P 4H0LB 4IOIH 1JM0A 5AW1B 5TISH 1H88A 3A7OA 3HRNA 1G1JA 3IR9A 4N3YB 1RF0C 1YTZI 1JMMA 3V4WA 1E79H 2WT7B 2WSFJ 5TISE 1SQVK 4D6TJ 2OYHC 1JY3O 1BGYG 1YBKA 2M3EA 4GIFA 3M06A 2WZ7A 3H1LG 1NTZD 3GHGC 2N1TB 1M56D 2YKQA 2CK3H 3CC7P 3CPWO 3M0DC 3FWNA
chains in the Genus database with same CATH topology
3RK3E 1TU3F 4PV1C 4Y28J 4PV1D 3AE9C 3AEBC 4GDOA 1HF9A 1WMKA 1ZOYC 1KILE 2E74B 1RQUA 2ZT9B 3GF3A 2G8YA 3AECC 1ZRTE 3SFEC 4RKUJ 1OW8A 3AE6C 1OW6A 1K05A 1PIXA 3AEFC 2BEQD 1K04A 1KTMA 3C8VA 1PL5A 2P10A 4I7ZC 5M1BA 3AE3C 4Z1MH 2WQYC 3Q1MA 3Q5SA 1DD4A 2IDBA 2O01J 1RQVA 3IN6A 3O6QA 3LW5J 4H44B 4I7ZB 1YQ4C 3D70A 3Q5PA 2QIWA 3EWKA 1Y9BA 2D2CB 2E74C 2ZT9C 2WPVB 1DD3A 2E74D 2WSEJ 2ZT9D 3SFDC 2H89C 3AE8C 4IL6X 3GF7A 1ZP0C 1PV3A 3H25A 1FDOA 3AE2C 2YMKA 3AEAC 2QJYC 2OQQA 2K9YA 3ABVC 3S9OA 2JO1A 1EXJA 1NYHA 4H44C 3T97B 3AEEC 3IAOA 1AJYA 4YXDC 1OMIA 4H44D 1KMIZ 1R8EA 4YTPC 2D2CC 1YQ3C 2E76C 1HJ0A 3D6YA 2D2CD 2G3AA 2E76D 4XFJA 3AE7C 3RL0g 3AE5C 4H0LC 1ZMEC 4H13C 2E76B 5KKZC 1MKMA 1FDIA 4H0LD 1U57A 1EXIA 4H0LB 4H13B 2FYNC 1KQFB 3Q5RA 1KORA 1IK7A 1OW7A 4R4MA 3GMAA 1KQGB 3FGAD 2QJKC 1NGMB 1VF5C 2JP3A 1JB0J 2MKVA 1DIPA 2QSIA 2YIUC 4R4LA 2E75B 2V7QJ 3Q3DA 1GMJA 1VF5B 3GLMA 1S1CX 2NZ2A 4U7JA 3D71A 2BEZF 3D6ZA 2WSFJ 4PV1B 3AE4C 2WSCJ 3Q2YA 3G9RA 4H13D 4OGQC 5KLIC 5L8RJ 4OGQD 3AE1C 1UIXA 4KT0J 2FXPA 4OGQB 3B71A 2J5UA 2FBWC 2E75C 2QJPC 1Q90D 2E75D 1VF5D 1VL2A 3AEDC 3R4YA 2H88C 4TT3H 1S5LX 3AEGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RK3 E;  1KIL E;  3RL0 g;  4GDO A; 
#chains in the Genus database with same CATH topology
 2Y9Y A;  4ASW A;  2WSE H;  1FOS E;  1HF9 A;  1WMK A;  3GW6 A;  3SFE C;  3RL0 C;  1SQB K;  4KHX A;  2P10 A;  4JF7 A;  2KP8 A;  3AE3 C;  4Z1M H;  3OAK A;  3OA7 A;  2BAS A;  2JWD A;  3B5N A;  3L70 G;  3O6Q A;  4I7Z B;  1CZQ A;  5KAF H;  1YQ4 C;  1H0T A;  1Y9B A;  1VQ4 P;  2JJL A;  1NWQ A;  3L73 J;  1NTK G;  2ZT9 D;  1YTZ T;  3CXH H;  3JSV C;  2KS1 A;  4L75 A;  5KAF E;  2LKM A;  1LWU A;  3AEE C;  2QJY B;  1NTZ J;  1R8E A;  1YQ3 C;  3M9Q A;  2I1K A;  3CXH E;  4B86 A;  4HYT B;  3RL0 g;  3L74 E;  3L75 E;  1IK7 A;  4R4M A;  2HYN A;  1FZC A;  1VF5 C;  1SQX E;  1JB0 J;  1MV8 A;  1S1C X;  1IFJ A;  1LP1 A;  1SQX D;  1S3J A;  3L4F A;  4DZO A;  1KQL A;  3LIE A;  3RK3 C;  1G1I A;  1KV4 A;  1VQN P;  1HVV A;  2ZAE B;  3AE1 C;  4HKZ H;  3B71 A;  1OVU A;  2O01 H;  4JQ0 D;  2C9L Y;  1CI6 B;  3AED C;  3S1K A;  1FU1 A;  2FFD B;  1JCC A;  1URQ D;  3WUV A;  2N9B A;  1H89 A;  5AVT B;  1ZRT E;  3R2P A;  4OVN F;  3AE6 C;  4JYB A;  5M1B A;  5APV A;  2WQY C;  1A02 F;  1P84 I;  3H1L D;  3IN6 A;  5KJ7 D;  1IFD A;  3HE4 B;  2E74 C;  1KIL A;  3MUD A;  2K9J B;  1L0L K;  5KKZ B;  2LR2 A;  3EFG A;  3FWL A;  3F5H A;  1JEK A;  5AW0 B;  3IAO A;  1GL2 D;  4H44 D;  3L70 E;  1GL2 B;  3SSU A;  2RMZ A;  2E76 C;  4WBA A;  4ZMD A;  2E42 A;  3L70 D;  1FZF A;  2WVR A;  1NTK E;  1QLE D;  2B87 B;  4H13 B;  1CSB A;  1SS1 A;  1NTK D;  5APW A;  2PAJ A;  2FYN B;  4AUW A;  2PGD A;  1IFP A;  3RK2 B;  1BGY J;  3CCM P;  2BEZ F;  4W80 A;  2DW3 A;  1HH0 A;  5AVX B;  3I5C A;  3BCC E;  1WRG A;  2P2U A;  1HWT C;  4KT0 J;  1KD1 Q;  1W2E A;  2FYU G;  3BCC D;  3H1H G;  1SQV J;  1X9V A;  3L72 G;  3VOP A;  1JUN A;  3CWB E;  4IL6 H;  3H1J E;  4PV1 C;  4Y28 J;  3AEB C;  1YYC A;  1PGO A;  2MJZ A;  3H1J D;  4K3A A;  1IO4 A;  2BEQ D;  3A0H H;  3MP7 B;  1J1D B;  1MUU A;  2JEE A;  3VMZ A;  3GG2 A;  2LXC B;  3TF5 A;  1L0N E;  1G2C B;  4AYC A;  2HOD B;  1SQB J;  2WPV B;  1L0N D;  2H89 C;  3HE5 B;  3TGU G;  3W68 A;  4XE5 B;  2W27 A;  3VP9 A;  1L4A C;  5APT A;  3JCU H;  3LID A;  1OVV A;  2XNX A;  1HJ0 A;  2RH0 A;  1MFZ A;  4XFJ A;  1LTJ C;  3CMA P;  3JCU E;  1U57 A;  1OZH A;  2ZJS E;  2OYH B;  1FS0 E;  2KZI A;  2ZYG A;  1OW7 A;  1RE4 A;  2FKW B;  2FFD A;  2C9N Y;  3GHG B;  5AW4 B;  1BE3 G;  3RBZ A;  3M91 A;  3HUS A;  2KXP B;  2V7Q J;  3WUU A;  4M3L A;  2WMM A;  1PGJ A;  1SLQ A;  2NPS A;  1LT9 A;  1N7S B;  3G9R A;  1SFC C;  5KLI C;  1VQO P;  1Q2N A;  3FXD A;  3HTK B;  2B9B A;  3G6E P;  1IFN A;  2N9Y B;  3H1K E;  3RL0 B;  2AEJ A;  1M90 Q;  2K9J A;  3CI9 A;  3WU2 H;  1RQU A;  1GK4 A;  1K05 A;  2FYU E;  1K04 A;  4RO0 A;  1KC8 Q;  1M1K Q;  3WU2 E;  1AVY A;  1P84 E;  3OW2 O;  2FYU D;  1P84 D;  1PP9 E;  2B87 A;  1VQK P;  3CC2 P;  3TYY A;  2Z5I A;  3V6I A;  2Q9I A;  3UIA A;  1PP9 D;  1FAV A;  1NHL A;  3AE2 C;  1GW3 A;  1NVO A;  1FDM A;  1LNQ A;  1YJ9 P;  2WWW A;  1USD A;  4U3F J;  4I2L C;  1DH3 A;  3ZDM A;  3BAT A;  3F89 A;  3A0B H;  3MD0 A;  1LT9 C;  3TGU E;  3K5B A;  1KQG B;  2BCC J;  3L73 G;  1FZE A;  3TGU D;  2QSI A;  2YO2 A;  3A0B E;  2Y0E A;  1X8Y A;  1QL2 A;  2FXO A;  2R32 A;  3B5N D;  1WT6 A;  3VN0 A;  5APU A;  3H1H J;  2CPS A;  3L72 J;  2Z4E A;  1N73 C;  1KZU B;  4UB6 E;  3CL3 D;  5DJT B;  5AVQ B;  1S72 P;  2WSS H;  3U1C A;  3KHU A;  1L2P A;  1LWU B;  1NTM K;  2ZXX A;  2E74 B;  3KZI H;  5GTH H;  2WPS A;  1RF0 A;  5KLV K;  3V4Q A;  3PRJ A;  3KZI E;  3D70 A;  5GTH E;  2OYH A;  3A3Y B;  2A06 G;  1LP1 B;  3GHG A;  5AVY B;  1Q86 Q;  1FOS F;  1ZP0 C;  3PHL A;  3HD7 C;  4D6T E;  4LLH A;  1SQQ K;  3II6 A;  3SWK A;  1NU1 K;  3M0D A;  1W5C E;  2O1J A;  1JY2 P;  3HTK A;  2Y9Z A;  2Q3E A;  1AA0 A;  2IFN A;  1BE3 J;  2YO3 A;  1SQQ G;  1OWA A;  1NU1 G;  2ZVN B;  4LC1 A;  3CCE P;  3Q3D A;  2GUS A;  1VQ5 P;  4EOT A;  1RE3 C;  2Q1K A;  4PV1 B;  1Y47 A;  5AVU B;  1ZR2 A;  1KIL B;  3L73 E;  3V2P A;  3L36 A;  1NKZ B;  1VL2 A;  1FE6 A;  2KLV A;  3L73 D;  1BCC J;  3AEG C;  3KXD A;  3CCV P;  5BU5 A;  3AE9 C;  2XU6 A;  1NTZ E;  1YI2 P;  1M8O B;  1OW8 A;  1GD2 E;  2N1T D;  1PIX A;  1EZV G;  1L4A B;  3E1R A;  1RQV A;  3LW5 J;  2CPB A;  2KB7 P;  2IBZ G;  1SQV G;  1JY2 O;  3E7K A;  1AQ5 A;  3SFD C;  1MFT A;  2R3C A;  3GF7 A;  3U1A A;  4RJT A;  2ZVO B;  3AEA C;  1HGV A;  4A7P A;  1NYH A;  3H1I J;  1NJI Q;  1IFI A;  3PTZ A;  1GU4 A;  2R3S A;  2I8D A;  5GTI H;  5CCG D;  1SQP K;  2KZJ A;  1QX8 A;  1QL1 A;  1JTH A;  1SQB G;  2IYO A;  3H32 B;  5CCH D;  5GTI E;  2JP3 A;  1OVR A;  2MKV A;  1OXZ A;  1BDC A;  5AVV B;  1GMJ A;  4C46 A;  2IZ0 A;  1SQP G;  3MTU E;  1HUC A;  3BVH A;  3PH0 A;  1HTL C;  4Y99 B;  3Q2Y A;  2P58 A;  3VMA A;  3SWF A;  1ZXG A;  5CMZ A;  4OGQ D;  4OGQ B;  3A2A A;  2QRX A;  2QE7 H;  1LTI C;  3E1I A;  2KI7 B;  2POH A;  1Q90 D;  2W90 A;  3G71 P;  2AXT H;  1RF1 C;  4OWF A;  4EDF A;  3MIW A;  1NAY A;  2AXT E;  3N7N A;  5CJ4 A;  2RN0 A;  3VP8 A;  3VTP C;  3C8V A;  1NOH A;  1NTM J;  4IFM A;  3Q5S A;  5B66 E;  4EYY Q;  1L0N K;  3QWO C;  1J1E C;  3Q5P A;  3W67 A;  1OX3 A;  3M9B A;  3WUT A;  3HUS B;  2WSE J;  5KLV J;  2QM8 A;  1BGY E;  2NPS D;  1M57 D;  2YMK A;  2K3R A;  2NPS B;  2OTK E;  3H1L E;  1LT9 B;  1BGY D;  2KYV A;  1XTC C;  3V2N A;  4GKG A;  2D2C C;  1Z56 A;  4WVZ A;  1GK6 A;  1SQV E;  3AE5 C;  2WSC H;  1SQQ J;  2FY8 A;  1ZN5 A;  1NU1 J;  1JNM A;  1D7M A;  1SQV D;  2JDI H;  3USS A;  4L73 A;  2M8R A;  3EFF K;  4WY4 C;  5EFW B;  1FZB A;  2YIU C;  4R4L A;  5AVW B;  1EDJ A;  4H13 D;  2B89 A;  1L0L G;  1T2K C;  1L4A A;  4U3F G;  1UIX A;  3V2R A;  1SQB E;  2E75 C;  2QJP C;  3RK2 D;  1SQB D;  1LTJ A;  2KIK A;  2BCC G;  1JOC A;  3TNU A;  1M1J C;  3I55 P;  4HJG H;  4N6J A;  4DJG A;  3HD7 B;  2O01 J;  3P8C E;  3CX5 I;  3P8C D;  2ZYD A;  1SFC A;  1KFN A;  3H32 A;  2K88 A;  4BXL A;  2Y0C A;  3P32 A;  3CCS P;  2ZXE B;  1T6A A;  2VRS A;  3L71 G;  3NXS A;  2Q7C A;  1EDL A;  3KPE A;  4H0L C;  4O9B A;  4BWN A;  3V2Q A;  2R5B A;  1SVF A;  2E5T A;  2W6J H;  5AW9 B;  2A45 G;  1SQP J;  4W7Z A;  4C7N A;  1FZA A;  1KN7 A;  4ZKP A;  1GW4 A;  3FXE A;  2N1T C;  2O3J A;  2WTY A;  2JWA A;  4GOF A;  1PGP A;  1H8A A;  2WPR A;  1RH5 B;  2QEX P;  2C0X A;  1R5L A;  4I6M C;  4GDO A;  1N7S D;  3KQG A;  2GM4 A;  3GF3 A;  3CWB J;  2KSE A;  4U3F E;  4WB4 A;  1NO4 A;  3RL0 D;  2XV5 A;  4I7Z C;  2J58 A;  4U3F D;  2OGU A;  3VYI A;  5CCG C;  2GA1 A;  2HG5 D;  2BCC E;  1A02 J;  1NKN A;  2ZT9 C;  1P84 H;  4AQR D;  2AXC A;  1N73 A;  4HB1 A;  2BCC D;  1U7J A;  1BCC G;  3VMX A;  1T3J A;  5CBN A;  5CCH C;  2HPC B;  2QJY C;  1QGK B;  5AW8 B;  3H1H E;  1AJY A;  4YXD C;  3MHV A;  3L72 E;  3H1H D;  4NPF X;  3L72 D;  1EXI A;  3CME P;  1QVF O;  1KB9 E;  1VF5 B;  4U7J A;  2KK7 A;  1L0L J;  2KNC A;  3CD6 P;  1KB9 D;  3H1I G;  1JY3 N;  1PPJ G;  3RK3 B;  3PLN A;  3HD7 A;  4K35 A;  3RGU A;  4UB6 H;  1URQ C;  4ZNC A;  1USE A;  1J1E B;  3CX5 H;  1NTZ K;  2SPZ A;  2IFM A;  4OH8 B;  1S9K E;  4I1L A;  1KQS O;  1S9K D;  1PL5 A;  1IFM A;  2P67 A;  1PGQ A;  1JTH B;  3A5T A;  5KJ7 C;  4ZKU A;  1PFI A;  2IDB A;  2Y0D A;  3CX5 E;  1BE3 E;  1HGZ A;  2AEM A;  1RE3 A;  2QIW A;  3CX5 D;  1BE3 D;  2D2C B;  3L37 A;  2E74 D;  5CJ0 A;  3CCQ P;  3AE8 C;  3NTN A;  1CW5 A;  3L71 J;  1S4X A;  1GL2 C;  1LT1 A;  2JO1 A;  2W6B A;  4H44 C;  4L76 A;  4WY4 B;  5AW3 B;  2WSF H;  2E5Y A;  2G3A A;  2E76 D;  4JBZ A;  1NTM G;  4H13 C;  2E76 B;  3WMM 0;  4JPZ B;  1BCC E;  2FYN C;  2YKP A;  2QA4 P;  1U7M A;  1BCC D;  4DT0 A;  2YNY A;  5KLV G;  2KUB A;  2Q5U A;  1EZV I;  2E75 B;  1LTG C;  4QMA A;  3PP5 A;  2QJP B;  1LJ2 A;  1VQ7 P;  2IBZ I;  2L5G B;  3AE4 C;  5APS A;  2M5A A;  3EQ2 A;  1IK9 A;  4C7R A;  1X0T A;  5H2F H;  1S2E A;  1SQX K;  5DJU B;  1ZW0 A;  4TT3 H;  4PD4 D;  2WIT A;  2J59 M;  3L74 G;  1LTB C;  5H2F E;  5AW5 B;  3C1L A;  1VQP P;  4PV1 D;  2HPC A;  1KIL E;  3L75 G;  5AVS B;  1N2D C;  3H1I D;  1J1D C;  1KIL D;  3AEF C;  1FBM A;  1AVO A;  2PRR A;  1SQX G;  1DEE G;  4ASV A;  5KAI H;  4W7Y A;  5KTB A;  2OYO A;  1UII A;  1DD3 A;  2QVA A;  2OYI C;  2YXQ B;  5KAI E;  1QVG O;  2P1J A;  2OQQ A;  2OAR A;  3T97 B;  2R44 A;  1RF1 A;  1L4A D;  2ITA A;  2O1K A;  2NRG A;  4PJ0 H;  2IZ1 A;  1BSN A;  1VQM P;  1FJK A;  4BRY A;  3KDP B;  3V5B A;  2XZR A;  1LTJ B;  2JKV A;  1KQF B;  1KOR A;  3TNU B;  4PJ0 E;  1LTT C;  4L74 A;  3C9I A;  1VQ6 P;  5CBO A;  3MZW B;  4NPE A;  1N7S C;  3B4S A;  1HJB A;  1NTM E;  1NTK K;  2A06 E;  1Q81 Q;  1SFC D;  1NTM D;  1SFC B;  2J5U A;  5KLI B;  2H8P D;  2A06 D;  2FBW C;  5KLV E;  4GT1 A;  4TLF A;  1TU3 F;  5KLV D;  2O01 N;  2OTJ P;  2ZT9 B;  5AVR B;  2W83 C;  2WPQ A;  4WY4 A;  2UWJ E;  3CLQ A;  5K5G B;  2P7J A;  1SQQ E;  1JMB A;  1NU1 E;  3ITK A;  3P8M C;  1GTW A;  2PP6 A;  2FXM A;  1SQQ D;  2Q6Q A;  1NU1 D;  1PZQ A;  1JO5 A;  4C7N B;  5AVZ B;  1KFM A;  3CXH D;  3BCC G;  5B66 H;  3L74 D;  3NFQ A;  4RES B;  1PV3 A;  3L75 D;  2K9Y A;  2RKL A;  1Q82 Q;  3CWB G;  4YTP C;  3TK1 A;  3H1J G;  2E43 A;  2AEF A;  1M1J A;  3QH9 A;  1ZME C;  2IYP A;  1FDI A;  1JCD A;  5BVZ A;  1QEX A;  2QJK C;  1NH4 A;  1DIP A;  2C0W A;  1EZV E;  3BRV B;  1K8A Q;  1L0N G;  2NZ2 A;  3B5N C;  1FZG A;  1EQ7 A;  3BAS A;  1EZV D;  2IBZ E;  1EC5 A;  1URQ B;  4MN4 C;  1AFO A;  5L8R J;  2IBZ D;  4NPD A;  1HBW A;  2FXP A;  3N4X A;  1ZRT D;  1N73 B;  3L74 J;  1BDD A;  2Z5H A;  4GOD A;  1LWU C;  3L75 J;  2KSJ A;  1KB9 I;  4CPG A;  3G4S P;  1W2B O;  1SQX J;  3U59 A;  4UB8 H;  2G8Y A;  3T97 A;  4RKU J;  1YIJ P;  1X22 A;  1OW6 A;  1Y8A A;  2H7H A;  1KTM A;  2WT7 A;  1FZC C;  2A45 I;  4H44 B;  4UB8 E;  1GDT A;  5AW7 B;  1SQP E;  2N1T A;  2W8Z A;  2KNC B;  1S5L H;  1VDF A;  1SQP D;  1XTG B;  3H1K G;  1FDO A;  2FYU K;  3HD7 D;  3ABV C;  1EXJ A;  2V7Q H;  4EIJ A;  1S5L E;  3D6Y A;  1K73 Q;  3H1L J;  1YIT P;  2IX7 C;  2M0B A;  4JYC A;  1R5S A;  1K9M Q;  4HH2 A;  5AW2 B;  2L91 A;  1M7L A;  1T3U A;  3P7K A;  1MZ9 A;  3TDK A;  5CCG A;  4EI2 A;  3GLM A;  1GU5 A;  3D71 A;  1PP9 G;  2YMY A;  3D6Z A;  3CCR P;  3CWB D;  4DCK A;  2WSC J;  1ZR4 A;  3L70 J;  1KIL C;  3MUD C;  2ZYA A;  5CCH A;  4IL6 E;  1IC2 A;  1VQL P;  3M0A A;  5BU8 B;  3L35 A;  2OTL P;  1NTK J;  3M9H A;  4WWI A;  1S5L X;  2IPP A;  3JC2 2;  3A0H E;  1GZL A;  2K1A A;  3CCL P;  2OYI B;  3PJS K;  4PD4 I;  3BCC J;  1N7L A;  3EWK A;  2HLO A;  1T8Z A;  1IJD B;  4IL6 X;  1L0L E;  2Q3I A;  1CI6 A;  3FX0 A;  1KYO I;  4N78 E;  3H25 A;  2I1J A;  3H1J J;  3S9O A;  4YXW H;  5AW6 B;  1L0L D;  2M5A B;  1OMI A;  5TJH A;  4N78 D;  1URQ A;  2XKM A;  1NAF A;  2KOG A;  3TSI A;  1MKM A;  1YHQ P;  3G3Z A;  1ZLL A;  3Q5R A;  2V4H A;  2QM7 A;  1L0N J;  1AV1 A;  5KJ7 A;  1NGM B;  1LTA C;  3HE4 A;  1VQ9 P;  1Q7Y Q;  3H1K D;  1IZN B;  4Y99 C;  3SWY A;  2GUV A;  1EDK A;  2XDJ A;  1KB9 H;  4OGQ C;  4D6T G;  1GL2 A;  2LXB A;  1J2J B;  5CHX A;  4GOE A;  1RHZ B;  1AQT A;  1VF5 D;  3L71 E;  4IFD K;  1VPC A;  2QG4 A;  3RK3 E;  1RF1 B;  5B5E H;  2A45 H;  3L71 D;  1LTS C;  1ZOY C;  2PFX A;  2B88 A;  3RK3 D;  2HR3 A;  4BRY B;  1RE4 C;  2KLU A;  5B5E E;  3Q1M A;  2FFD C;  1DD4 A;  1OIP A;  3KYQ A;  3HUS C;  2HFE D;  3H1K J;  4LGD E;  1JY2 N;  1YJN P;  1ZV8 A;  2NPS C;  2FYZ A;  3H6P A;  3OJA B;  3S4R A;  1YJW P;  3B8E B;  2K37 A;  4DOJ A;  2QJK B;  2XND H;  1KMI Z;  2W6A A;  3CXH I;  2D2C D;  1OFC X;  3AE7 C;  3B5N B;  3O6Q B;  2FYU J;  3IF4 A;  5KKZ C;  1NTZ G;  5C39 A;  1X79 B;  1H0T B;  3GMA A;  5E79 H;  3FGA D;  1PP9 J;  2M3B A;  1G2C A;  4WY4 D;  2HOD A;  1N86 A;  2KS1 B;  4IFF A;  1N8R Q;  2YIU B;  1SP4 A;  5E79 E;  3HE5 A;  2OYI A;  5APQ A;  1T2K D;  2R5D A;  1EDI A;  3RK2 C;  3LW5 H;  2E75 D;  3IFM A;  3R4Y A;  2H88 C;  1FJP A;  1FZC B;  2H43 A;  3TGU J;  4PD4 H;  1LGH B;  1FC2 C;  3CCU P;  1JY3 P;  3BRT B;  1E5W A;  3AEC C;  3CC4 P;  1M1J B;  4YPC A;  4PD4 E;  4XA4 A;  3I56 P;  4D6T D;  3O8Z A;  5APY A;  1KYO H;  1N7S A;  2YKO A;  3CCJ P;  3RBX A;  1DX7 A;  3H1I E;  2YXR B;  1PPJ E;  1RY3 A;  5APX A;  1KYO E;  3NMD A;  2JR8 A;  1DEB A;  1PPJ D;  1KYO D;  1BSH A;  3MGN A;  4KJM A;  2ZFC A;  4H0L D;  3VMY A;  1VQ8 P;  4H0L B;  4IOI H;  1JM0 A;  5AW1 B;  5TIS H;  1H88 A;  3A7O A;  3HRN A;  1G1J A;  3IR9 A;  4N3Y B;  1RF0 C;  1YTZ I;  1JMM A;  3V4W A;  1E79 H;  2WT7 B;  2WSF J;  5TIS E;  1SQV K;  4D6T J;  2OYH C;  1JY3 O;  1BGY G;  1YBK A;  2M3E A;  4GIF A;  3M06 A;  2WZ7 A;  3H1L G;  1NTZ D;  3GHG C;  2N1T B;  1M56 D;  2YKQ A;  2CK3 H;  3CC7 P;  3CPW O;  3M0D C;  3FWN A; 
#chains in the Genus database with same CATH homology
 3RK3 E;  1TU3 F;  4PV1 C;  4Y28 J;  4PV1 D;  3AE9 C;  3AEB C;  4GDO A;  1HF9 A;  1WMK A;  1ZOY C;  1KIL E;  2E74 B;  1RQU A;  2ZT9 B;  3GF3 A;  2G8Y A;  3AEC C;  1ZRT E;  3SFE C;  4RKU J;  1OW8 A;  3AE6 C;  1OW6 A;  1K05 A;  1PIX A;  3AEF C;  2BEQ D;  1K04 A;  1KTM A;  3C8V A;  1PL5 A;  2P10 A;  4I7Z C;  5M1B A;  3AE3 C;  4Z1M H;  2WQY C;  3Q1M A;  3Q5S A;  1DD4 A;  2IDB A;  2O01 J;  1RQV A;  3IN6 A;  3O6Q A;  3LW5 J;  4H44 B;  4I7Z B;  1YQ4 C;  3D70 A;  3Q5P A;  2QIW A;  3EWK A;  1Y9B A;  2D2C B;  2E74 C;  2ZT9 C;  2WPV B;  1DD3 A;  2E74 D;  2WSE J;  2ZT9 D;  3SFD C;  2H89 C;  3AE8 C;  4IL6 X;  3GF7 A;  1ZP0 C;  1PV3 A;  3H25 A;  1FDO A;  3AE2 C;  2YMK A;  3AEA C;  2QJY C;  2OQQ A;  2K9Y A;  3ABV C;  3S9O A;  2JO1 A;  1EXJ A;  1NYH A;  4H44 C;  3T97 B;  3AEE C;  3IAO A;  1AJY A;  4YXD C;  1OMI A;  4H44 D;  1KMI Z;  1R8E A;  4YTP C;  2D2C C;  1YQ3 C;  2E76 C;  1HJ0 A;  3D6Y A;  2D2C D;  2G3A A;  2E76 D;  4XFJ A;  3AE7 C;  3RL0 g;  3AE5 C;  4H0L C;  1ZME C;  4H13 C;  2E76 B;  5KKZ C;  1MKM A;  1FDI A;  4H0L D;  1U57 A;  1EXI A;  4H0L B;  4H13 B;  2FYN C;  1KQF B;  3Q5R A;  1KOR A;  1IK7 A;  1OW7 A;  4R4M A;  3GMA A;  1KQG B;  3FGA D;  2QJK C;  1NGM B;  1VF5 C;  2JP3 A;  1JB0 J;  2MKV A;  1DIP A;  2QSI A;  2YIU C;  4R4L A;  2E75 B;  2V7Q J;  3Q3D A;  1GMJ A;  1VF5 B;  3GLM A;  1S1C X;  2NZ2 A;  4U7J A;  3D71 A;  2BEZ F;  3D6Z A;  2WSF J;  4PV1 B;  3AE4 C;  2WSC J;  3Q2Y A;  3G9R A;  4H13 D;  4OGQ C;  5KLI C;  5L8R J;  4OGQ D;  3AE1 C;  1UIX A;  4KT0 J;  2FXP A;  4OGQ B;  3B71 A;  2J5U A;  2FBW C;  2E75 C;  2QJP C;  1Q90 D;  2E75 D;  1VF5 D;  1VL2 A;  3AED C;  3R4Y A;  2H88 C;  4TT3 H;  1S5L X;  3AEG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...