2WSCH

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
DLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords AT3G54890
publication title Structure Determination and Improved Model of Plant Photosystem I.
pubmed doi rcsb
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03244 PSI_PsaH Photosystem I reaction centre subunit VI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wscH01
1SQPK 5KLVK 2O01H 3M9QA 1SQXK 1SQBK 2WSFH 2FYUK 2WSEH 1L0LK 1SQQK 1L0NK 3G3ZA 1NTMK 1NTZK 4IFDK 2WSCH 1NTKK 1NU1K 1SQVK 2LKMA 3LW5H 2J59M 3CLQA 2OARA
chains in the Genus database with same CATH superfamily
1L0NG 2FYNB 3RL0B 5AVWB 2AXCA 3HE4B 3ITKA 1GDTA 5CCGD 3C1LA 5CBOA 3H1ID 1LTSC 4GOEA 1LTJB 3L70D 2CPBA 2J5UA 1DEBA 2ZYGA 2ZT9B 2Q6QA 1SQVJ 2QJYB 4ASVA 2Y9ZA 3H1LD 5KJ7C 3AE8C 4HKZH 3L75D 1BGYE 1JEKA 1MV8A 2QJPB 1L0LG 1X9VA 1OVRA 3H1JG 5AVTB 4EI2A 2WSEH 4GOFA 3B5NC 3A0BE 5KLVG 2Y0DA 2AEJA 3CLQA 1YJ9P 2O01H 2Z5HA 1H0TB 1T3JA 2IZ0A 1SQBE 3L72E 2Y9YA 2ZFCA 3IF4A 4KHXA 1Q86Q 2H43A 4A7PA 2Q9IA 3AE3C 2PP6A 1NTKE 1RE4C 2K3RA 3BCCJ 2NZ2A 1NWQA 3WMM0 1SQXE 1GK6A 5KTBA 3RL0D 1SP4A 1L0NK 2YIUB 4N78D 3CWBJ 2QIWA 2A06E 3A0BH 3FXEA 1FOSE 4D6TD 2K9JB 1VQMP 1HH0A 3NTNA 1PP9G 1VQ5P 4RO0A 3H1HG 1NTMK 1M1JA 3CMEP 3Q5SA 1Q81Q 1EDLA 3A5TA 2HR3A 1OFCX 4GIFA 2Y0EA 2KZJA 3TGUE 1A02F 1WMKA 2WVRA 3A2AA 2AEMA 1LT1A 1MKMA 1L0LK 3L37A 3JCUH 2O1JA 2GM4A 3FGAD 5APSA 3RK2B 2FFDC 1HF9A 3PTZA 2I1KA 1FZEA 1YYCA 2H89C 3TDKA 3SWFA 2E75D 1HVVA 1N7SC 1FBMA 1YJWP 1KFNA 1GMJA 4IL6H 1FZBA 1H0TA 2C0WA 1YTZT 1FZCA 3L73J 2N9YB 3U59A 4PV1C 1G1JA 1JY2N 1AVOA 3D71A 1AQ5A 3HTKA 3L71J 3L74J 1S2EA 1KILA 3QH9A 4I1LA 5AW7B 1E5WA 1NAFA 1SQVG 3TGUG 2HFED 1DD3A 2LXCB 2R44A 1U7MA 3HD7D 2B87A 5DJTB 1RY3A 3A3YB 3H1KD 1GZLA 3SWYA 3OW2O 3VMXA 4U3FE 1BDDA 3JSVC 2MJZA 2FYUE 2C9NY 2K9JA 3H1IE 5EFWB 3B5NB 1KQGB 1H89A 1NYHA 2H88C 2XU6A 1KORA 3RK3E 1W2EA 5CHXA 1NU1E 5TISE 2Y0CA 3RBXA 4KJMA 5AW3B 3NXSA 2B9BA 4RKUJ 3H1LE 2FY8A 1ZR2A 2PGDA 5CCGC 3V4QA 4YPCA 5AW0B 3GHGB 2H8PD 3T97B 3LW5H 1GK4A 3GW6A 2O1KA 5APYA 2Q3IA 3BCCG 2I1JA 3TF5A 2KLUA 1URQA 1S1CX 4U3FG 1S4XA 1BE3J 4OWFA 3CD6P 3HE5A 2YMKA 4M3LA 3CWBG 5DJUB 1LT9B 3MIWA 2NPSA 1LTAC 2QJKC 2O01N 1SFCA 1NU1G 1S3JA 1W5CE 5TISH 5CCHA 2C0XA 3CX5D 3CL3D 1GW3A 1YJNP 4R4MA 1HJ0A 2FYZA 1QEXA 2W83C 5KJ7D 1BCCE 5APVA 2GUVA 2ZYDA 2WPVB 2IBZG 1T3UA 5APWA 1VQ9P 5KLVD 1FS0E 2CPSA 3CCEP 1HUCA 4N78E 2BCCD 2YKOA 3B5ND 1IK9A 1PV3A 2XV5A 1LJ2A 4DT0A 1ZXGA 4IFMA 2FFDB 3F5HA 1OWAA 3BATA 1NTZD 2G3AA 1L0NJ 5K5GB 1NAYA 4U7JA 1VL2A 2OYHC 1EZVG 3MHVA 3P8CD 1JCDA 4PV1B 2Q1KA 3L73G 2RH0A 4IL6X 1G2CA 1NTMJ 3GHGA 2QVAA 4TLFA 2ITAA 1MZ9A 3L74G 1PGOA 1BCCG 3G71P 4WY4A 3WUTA 5AW2B 2R5BA 1T6AA 1NH4A 1OMIA 3UIAA 2R3SA 4BWNA 2K37A 3VP9A 3H1JJ 2KNCB 1RE3A 3AE5C 1L4AD 2FYUK 1IFPA 5GTIH 2XZRA 1VDFA 1LT9A 4LGDE 1K9MQ 4HB1A 1NU1K 3H32A 2KP8A 2P2UA 5C39A 2QA4P 2O01J 5APUA 1YITP 3FWLA 3VMYA 2E75C 4NPDA 4DCKA 4I7ZC 1CZQA 3MGNA 1FE6A 4HH2A 1HGVA 3PJSK 2SPZA 3NMDA 2LKMA 3V2PA 3LIDA 4K3AA 2FXMA 1BGYJ 2KUBA 1N7LA 1RQUA 1IFNA 2WSFH 3F89A 1N7SD 3M0DA 5AVQB 3JC22 2W6JH 1HJBA 1DD4A 3KZIE 1ZR4A 3MP7B 1VQKP 1BE3G 2IFNA 3AE2C 2A45G 1SQVD 1VQNP 2QJKB 1PGQA 3V2RA 2IDBA 5GTHE 2YO3A 3H1HJ 1EQ7A 1S9KD 1GL2A 1LNQA 2OYIC 4WWIA 2KNCA 1LWUC 3TSIA 5KKZB 2KZIA 2JO1A 4OGQD 2JWDA 2N1TA 2KK7A 1U7JA 2I8DA 2WSCH 3AE9C 3IFMA 3HUSC 1SQQE 3P32A 1WT6A 1J2JB 1M57D 4NPEA 1KQSO 4AQRD 4XFJA 3CX5I 1FAVA 3R4YA 4O9BA 5KAIE 4AUWA 3NFQA 5L8RJ 5GTHH 3BCCD 2OYOA 1NTMG 1IO4A 3TGUJ 3WU2E 5AW8B 2BCCE 3GF3A 3ABVC 4DZOA 2PFXA 1NJIQ 2KYVA 3CWBD 2Q7CA 1BSNA 1NTZE 2HODB 1IFDA 1SQQG 1PGPA 3CXHD 4YXDC 1H8AA 1DIPA 4HYTB 2PRRA 3CCVP 3FXDA 3RBZA 4JQ0D 3CCSP 1BDCA 4GDOA 1RF0C 3CX5H 2YO2A 1N73A 5KAIH 3MD0A 2IBZD 1AFOA 1ZN5A 2E75B 4I7ZB 1XTCC 1JY3N 2IX7C 5AW9B 1KD1Q 2E74C 1PZQA 1SS1A 1Q7YQ 3M9HA 1NOHA 1JB0J 3AEFC 3V6IA 1QLED 1JY2P 3WU2H 1XTGB 2K1AA 1LP1B 1YQ4C 3JCUE 1J1EC 4L75A 1BGYG 2HPCB 1SQPE 2QSIA 2ZVOB 2LR2A 3R2PA 2HLOA 4U3FJ 2BASA 5BVZA 1FC2C 2FYUJ 3HD7B 3W68A 3H1IJ 3HE4A 5CMZA 2J58A 1ZW0A 3L71D 3L74D 3K5BA 1OIPA 2JP3A 4IL6E 1L4AC 1NU1J 1NKNA 1PPJD 1LTJA 3KXDA 5AVRB 3L35A 3D70A 1SQBG 3L72G 4R4LA 2OTJP 1VF5D 4ZKPA 4EIJA 5AVUB 1ZRTE 2HODA 5B5EH 3AEDC 1NTKG 1U57A 3BRTB 4YTPC 1RHZB 1LWUB 1QVGO 1SQQK 4B86A 1QL1A 3MUDC 1IFIA 2W6AA 2R3CA 2C9LY 1SQXG 1M90Q 3HUSB 3BRVB 4I2LC 1R8EA 1RF1C 2G8YA 1X79B 4Z1MH 2M5AB 3OA7A 2QEXP 1FU1A 2A06G 1EXIA 1JY2O 3BVHA 5APXA 1NHLA 4IOIH 3SFEC 3EWKA 2YXQB 1OW7A 3P7KA 4H0LD 2HG5D 3CC2P 1FZGA 1BCCJ 3II6A 1R5SA 4ZNCA 1X22A 3E7KA 2W6BA 2HPCA 4YXWH 1FDOA 4EOTA 3HD7A 2Z5IA 4CPGA 1IFMA 2IYPA 4OGQC 1W2BO 4L73A 1J1DC 2Q5UA 3N4XA 1QVFO 2NRGA 3D6YA 1MUUA 2UWJE 3AE1C 3L70E 4LC1A 4OH8B 1SQBK 3I5CA 1KB9D 3L75E 1NTKK 1OZHA 2Z4EA 1X0TA 2ZVNB 1FZAA 1USEA 1CI6B 4Y99C 2WSFJ 1L0ND 1YI2P 3CCMP 1SQPK 2KIKA 1SQXK 3HRNA 1K8AQ 1J1EB 1M1KQ 2R5DA 4IFFA 3CCUP 2P58A 3EFGA 3U1CA 2FYUG 4ZKUA 1NTMD 3H1IG 2QG4A 5BU5A 4RESB 1URQD 3E1RA 1L4AB 2E5TA 1FJKA 3S4RA 4BRYB 4I6MC 1M56D 4C46A 1E79H 2NPSD 1L0LD 3G9RA 2J59M 3H1JD 3H1LG 4WB4A 1OX3A 4C7NB 5KJ7A 3OAKA 2XNDH 2ZYAA 1PL5A 2WSCJ 1QL2A 1JM0A 2D2CC 2RMZA 3L71E 3CPWO 1HTLC 5GTIE 1QGKB 3B5NA 2KSEA 1RF1B 4ASWA 1AQTA 1PPJE 1FJPA 1KQLA 4D6TE 1SVFA 3SFDC 1N7SB 2AEFA 3MTUE 1Q82Q 4NPFX 1OW8A 1KN7A 4K35A 2E74D 2QM7A 3N7NA 1Z56A 1X8YA 3M9BA 1BGYD 2M0BA 3LIEA 2FYNC 3T97A 1IJDB 3AEAC 1RE4A 3WUVA 1YTZI 1KV4A 5APQA 2OGUA 3H6PA 2E76C 5B66H 1ZP0C 1SQQJ 1T2KD 4ZMDA 1N8RQ 1VF5C 1PP9D 1NGMB 2WSEJ 1M1JC 3H1HD 3KPEA 1MFTA 3RL0g 4OGQB 2KOGA 4D6TG 1J1DB 2DW3A 3TNUB 3TYYA 5H2FH 1ZMEC 4MN4C 3D6ZA 4Y28J 3M91A 5AVXB 3C9IA 2WSSH 3AECC 3CCJP 1HBWA 3Q3DA 3B71A 1KQFB 3VYIA 3AEGC 2K88A 2A45I 2IPPA 3RGUA 3H1KE 4H0LC 1FOSF 2OARA 2JWAA 3V2QA 2E43A 1NTZJ 2A06D 1CSBA 1FZCC 1OXZA 2W90A 2FFDA 1YBKA 3A0HE 2RKLA 1N7SA 1KILC 4JPZB 4QMAA 1R5LA 1VQPP 3TGUD 1KB9E 1KB9I 2QE7H 3BASA 4JBZA 1K73Q 1SQBJ 3L72J 4TT3H 1VQ6P 1EXJA 2O3JA 2JEEA 3V4WA 4UB6E 1FZFA 1NTKJ 1JY3P 3VTPC 3H1KG 1JMBA 1T8ZA 1SQPJ 1TU3F 1SQXJ 3G6EP 1GL2D 2D2CB 1VQ7P 3A0HH 4JYCA 4DOJA 4RJTA 2YKQA 4H44C 1AV1A 2WT7B 2N1TD 1VQ8P 1QX8A 3CX5E 2OYHB 2OTLP 1Y47A 1L0LE 1L2PA 3RK2C 2E5YA 1KB9H 3H1JE 3W67A 3Q2YA 4JF7A 2R32A 2P7JA 2L5GB 2Q3EA 5CCGA 1URQC 1OVVA 2MKVA 4XE5B 1GU5A 5KLVE 3USSA 3PRJA 4U3FD 1KC8Q 4UB6H 3PP5A 2FYUD 2W27A 1LTTC 2NPSC 2M8RA 2FBWC 1SFCC 2E76B 5CCHC 3RK3D 1VF5B 1NU1D 3PHLA 2LXBA 1M1JB 1ZOYC 3IR9A 3P8CE 2PAJA 1VQLP 1GW4A 4IFDK 1KFMA 1YQ3C 3CCRP 2P1JA 1JY3O 4H13D 1HWTC 4PD4D 1DX7A 4OVNF 3CMAP 2WWWA 3M06A 3IAOA 1OVUA 3O8ZA 1LTBC 3LW5J 2D2CD 1JTHB 1YIJP 2BCCG 1S72P 5B5EE 4H0LB 1PP9E 1BSHA 1DEEG 3H1HE 1P84D 1NTZG 1FZCB 2WT7A 1EZVD 3ZDMA 1S5LE 2WITA 3MZWB 1K05A 1PFIA 3GHGC 3L73D 1GD2E 3HTKB 2KXPB 2OYHA 1KILB 2V7QH 1T2KC 4WY4C 5CJ4A 5AW5B 3H25A 1Q90D 1BCCD 3L70J 1MFZA 1SLQA 4UB8E 1LTIC 5CJ0A 2B87B 4N6JA 1WRGA 1RE3C 3H1LJ 1OW6A 3L75J 1LT9C 2E76D 2HYNA 2JKVA 2ZT9D 3FWNA 5AVSB 2OYIB 1N86A 3TK1A 5APTA 1SQPG 3Q5PA 1S5LH 2BEZF 3EQ2A 3CC4P 3L4FA 1USDA 2FXPA 4H44B 1KYOD 1SQVE 4XA4A 2XKMA 1NVOA 4UB8H 1S9KE 2JR8A 3M0DC 1Q2NA 4W7YA 5KLVK 2FXOA 4W7ZA 1EC5A 1JTHA 1URQB 1AJYA 1VQOP 4WBAA 1JO5A 1LP1A 3HE5B 1NTZK 1BE3D 3KQGA 1JOCA 2NPSB 3V5BA 2OTKE 1KILD 1SFCB 2CK3H 2IYOA 2YMYA 4D6TJ 5AW4B 5KLIC 2M3BA 1GL2C 3SWKA 1FDIA 4BXLA 3BCCE 2B88A 2KS1B 2N1TC 3AE7C 1JCCA 2V4HA 2JDIH 5AW1B 1A02J 3CWBE 2OYIA 5E79E 1NO4A 2E74B 1LTGC 1LWUA 3U1AA 3O6QB 3I55P 1JMMA 3B8EB 3CXHE 3CXHI 4H44D 3QWOC 3KHUA 3HUSA 1VPCA 3OJAB 5TJHA 4PJ0E 2ZAEB 3GF7A 3AEBC 1CW5A 2M5AA 1ZLLA 4GODA 1G2CB 4PD4E 4PD4I 1EDKA 2IBZE 1IZNB 2IBZI 3RK2D 2FKWB 3RK3C 3I56P 4WY4B 4GT1A 2P67A 3S1KA 3L70G 5CBNA 2WQYC 4H13C 1SQQD 3G4SP 1SFCD 1AA0A 5E79H 1P84E 1P84I 2YNYA 3M9QA 3L75G 3H1KJ 5CCHD 1EZVE 3KDPB 1EZVI 4DJGA 1RQVA 3H32B 3CXHH 1N73C 4GKGA 3L73E 5B66E 3AE6C 2WZ7A 1H88A 1KZUB 3KYQA 4PJ0H 1GU4A 1SQVK 3L74E 2YKPA 2P10A 1K04A 2WPQA 4PD4H 3AE4C 1RF0A 3VMAA 5KKZC 3PLNA 1S5LX 4JYBA 2KS1A 3A7OA 3CCQP 3CI9A 5H2FE 2KLVA 2BEQD 3VN0A 3E1IA 3GG2A 1KTMA 1G1IA 1M8OB 1ZV8A 3PH0A 3O6QA 1EDIA 3RL0C 1EDJA 1CI6A 1P84H 4LLHA 2ZJSE 2WMMA 4HJGH 1YHQP 5AVVB 2IFMA 1LTJC 1KYOE 1KYOI 4AYCA 1M7LA 4L74A 2ZT9C 4WY4D 3EFFK 3FX0A 2WPSA 1AVYA 3L71G 5BU8B 2IZ1A 3M0AA 2QJYC 2KSJA 2WTYA 5KLIB 1SQBD 3L72D 1PPJG 2ZXEB 1IFJA 1L4AA 2W8ZA 1GL2B 4BRYA 2KB7P 3GMAA 1L0LJ 1LGHB 4EYYQ 2K9YA 2QJPC 1HGZA 1NTKD 1Y9BA 2AXTE 2KI7B 1D7MA 2XDJA 3CCLP 3VP8A 2N9BA 2N1TB 1Y8AA 1SQPD 2B89A 1SQXD 1BE3E 5KLVJ 4C7NA 2RN0A 3P8MC 2BCCJ 1KILE 3AEEC 3GLMA 2JJLA 3MUDA 4Y99B 3V2NA 1KYOH 5AVZB 1RF1A 4W80A 2V7QJ 1DH3A 3RK3B 2QRXA 4EDFA 2QM8A 1ZRTD 1RH5B 4L76A 3Q1MA 5KAFE 3C8VA 3VOPA 2AXTH 5AVYB 1JUNA 3HD7C 1UIIA 3G3ZA 2YIUC 2ZXXA 3CC7P 1NKZB 1GTWA 5AW6B 1L0NE 2POHA 1UIXA 4H13B 2YXRB 4PV1D 1PIXA 4WVZA 3IN6A 2A45H 3S9OA 1PP9J 2GA1A 3Q5RA 1N73B 2E42A 4C7RA 2GUSA 5M1BA 2WPRA 1VQ4P 1IK7A 2L91A 1NTME 1FDMA 4KT0J 2M3EA 3WUUA 4N3YB 3VMZA 3B4SA 3TNUA 3SSUA 2OQQA 2XNXA 1N2DC 2VRSA 1PGJA 3L36A 5KAFH 1KMIZ 1IC2A 2H7HA 1JNMA 3KZIH
chains in the Genus database with same CATH topology
1SQPK 1SQXK 3HRNA 1RE3A 5AVSB 1L4AD 2FYUK 1J1EB 2OYIB 2XZRA 1VDFA 3RL0B 1N86A 1LT9A 5AVWB 2R5DA 4IFFA 3HE4B 3TK1A 5APTA 4LGDE 1GDTA 5CCGD 1NU1K 3H32A 2KP8A 3EFGA 2P2UA 3U1CA 3EQ2A 1LTSC 3L4FA 5APUA 4ZKUA 1LTJB 3VMYA 2CPBA 5BU5A 1DEBA 4XA4A 4RESB 1URQD 1CZQA 3MGNA 2XKMA 1L4AB 1FJKA 4HH2A 1HGVA 4I6MC 4C46A 2NPSD 5KJ7C 1S9KE 3NMDA 2LKMA 3M0DC 3V2PA 3LIDA 2J59M 4W7YA 1MV8A 4WB4A 2FXMA 5KLVK 1X9VA 1N7LA 1IFNA 4W7ZA 1URQB 1JTHA 2WSFH 4C7NB 5KJ7A 1N7SD 3OAKA 5AVTB 3M0DA 2WSEH 5AVQB 4WBAA 1JO5A 3HE5B 1HJBA 3B5NC 1QL2A 1NTZK 3KQGA 1ZR4A 1JOCA 2NPSB 3V5BA 1KILD 1HTLC 1SFCB 3CLQA 3B5NA 2IFNA 1RF1B 2O01H 2A45G 2Z5HA 1FJPA 1KQLA 1SVFA 1T3JA 1N7SB 2YMYA 3V2RA 3MTUE 5AW4B 2YO3A 2M3BA 2ZFCA 4KHXA 2H43A 1GL2C 2Q9IA 2QM7A 3N7NA 2PP6A 1EQ7A 1Z56A 1S9KD 1X8YA 3M9BA 1GL2A 3LIEA 1RE4C 2N1TC 1NWQA 2OYIC 3T97A 3WMM0 1GK6A 5KTBA 3RL0D 1LWUC 1IJDB 1JCCA 3TSIA 1RE4A 1A02J 1SP4A 5AW1B 1YTZI 2N1TA 1L0NK 5APQA 2OYIA 1NO4A 2WSCH 3H6PA 3IFMA 3HUSC 4N78D 1LTGC 3P32A 1LWUA 3U1AA 1JMMA 1WT6A 3B8EB 1T2KD 1J2JB 1FOSE 3HUSA 4AQRD 1VPCA 1M1JC 3OJAB 1FAVA 1HH0A 3NTNA 3KPEA 4O9BA 2KOGA 1CW5A 1J1DB 1ZLLA 1NTMK 4AUWA 3NFQA 1G2CB 1M1JA 3TNUB 3TYYA 3RK2D 2FKWB 3A5TA 3RK3C 4WY4B 4GT1A 4GIFA 2P67A 1A02F 3M91A 5AVXB 3C9IA 3A2AA 1IO4A 1L0LK 5AW8B 3L37A 2O1JA 1HBWA 2GM4A 4DZOA 3VYIA 2A45I 2KYVA 2IPPA 5APSA 2Q7CA 3RK2B 2FFDC 2HODB 1SFCD 2I1KA 1FOSF 1FZEA 1YYCA 2OARA 1IFDA 3V2QA 2E43A 3SWFA 2YNYA 3M9QA 5CCHD 1HVVA 1N7SC 1CSBA 1H8AA 3KDPB 1FZCC 1OXZA 1FBMA 4HYTB 2FFDA 1KFNA 3H32B 1N73C 4GKGA 1FZBA 2C0WA 1N7SA 1YTZT 2WZ7A 1H88A 1KZUB 3KYQA 1FZCA 1RF0C 1GU4A 1KILC 3U59A 1SQVK 2YO2A 1G1JA 1N73A 1JY2N 2YKPA 3MD0A 1AFOA 1AQ5A 2WPQA 1ZN5A 3HTKA 1RF0A 1XTCC 1KILA 1JY3N 2IX7C 5AW9B 5AW7B 4I1LA 4JYBA 3A7OA 1E5WA 1NAFA 3BASA 3CI9A 3VN0A 2KLVA 2HFED 3E1IA 3HD7D 1NOHA 3M9HA 1G1IA 1JY2P 1XTGB 1RY3A 3A3YB 1GZLA 2JEEA 1ZV8A 3SWYA 3V4WA 1FZFA 3VMXA 1J1EC 1JY3P 3VTPC 3RL0C 2HPCB 1CI6A 3R2PA 1T8ZA 2MJZA 4LLHA 2HLOA 2C9NY 2BASA 5BVZA 1GL2D 3B5NB 3HD7B 4JYCA 1H89A 5AVVB 4DOJA 2IFMA 1LTJC 2XU6A 3HE4A 5CMZA 2YKQA 2J58A 4AYCA 1M7LA 1W2EA 5CHXA 2WT7B 4WY4D 2WPSA 1L4AC 2N1TD 5AW3B 1NKNA 1LTJA 5BU8B 5AVRB 3M0AA 2KSJA 2WTYA 2OYHB 3NXSA 3L35A 2ZXEB 1IFJA 1L4AA 1ZR2A 5CCGC 1GL2B 3RK2C 3V4QA 5AW0B 2KB7P 3GHGB 2H8PD 4JF7A 1LGHB 2R32A 3LW5H 1GK4A 2O1KA 2P7JA 2L5GB 1HGZA 1URQC 5APYA 2XDJA 4ZKPA 5CCGA 4EIJA 2Q3IA 3VP8A 5AVUB 2N9BA 2N1TB 4XE5B 2HODA 1GU5A 2I1JA 3BRTB 1LWUB 1SQQK 4B86A 1QL1A 1URQA 4C7NA 1IFIA 3PP5A 2W6AA 2R3CA 2W27A 2C9LY 3P8MC 1LTTC 2NPSC 2M8RA 3HUSB 1SFCC 2JJLA 3BRVB 4I2LC 3HE5A 1RF1C 4M3LA 3MUDA 5CCHC 3RK3D 1LT9B 4Y99B 3MIWA 3V2NA 1X79B 2NPSA 1LTAC 3OA7A 1SFCA 1FU1A 1M1JB 5AVZB 1RF1A 5CCHA 1JY2O 3BVHA 5APXA 1NHLA 2C0XA 3IR9A 3P8CE 2PAJA 3CL3D 1GW3A 1GW4A 4W80A 1KFMA 4IFDK 2FYZA 2P1JA 1JY3O 5KJ7D 1HWTC 3P7KA 1DX7A 2HG5D 1DH3A 5APVA 3RK3B 1FZGA 2GUVA 2WWWA 3M06A 3II6A 2QM8A 1T3UA 5APWA 2CPSA 3VOPA 5AVYB 1HUCA 3O8ZA 1LTBC 4N78E 1JUNA 2W6BA 2HPCA 3HD7C 3G3ZA 2YKOA 3B5ND 1NKZB 1IK9A 2XV5A 1GTWA 5AW6B 1JTHB 2POHA 4IFMA 4EOTA 2FFDB 1OWAA 3BATA 3HD7A 2Z5IA 2A45H 1IFMA 2OYHC 1FZCB 2WT7A 2WITA 1N73B 1J1DC 2E42A 2Q5UA 4C7RA 2GUSA 2WPRA 1PFIA 3N4XA 3P8CD 3GHGC 1GD2E 3HTKB 2OYHA 1MUUA 1JCDA 1KILB 1FDMA 1T2KC 4WY4C 5CJ4A 5AW5B 4LC1A 4OH8B 1G2CA 4N3YB 3VMZA 3GHGA 1SQBK 1MFZA 3TNUA 1MZ9A 1SLQA 2XNXA 1N2DC 3I5CA 4WY4A 2VRSA 1LTIC 5CJ0A 4N6JA 1WRGA 5AW2B 2R5BA 1RE3C 1NTKK 1NH4A 3L36A 2Z4EA 3UIAA 1IC2A 1FZAA 1LT9C 1CI6B 4Y99C 2H7HA 1JNMA 2HYNA 3VP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP K;  5KLV K;  2O01 H;  3M9Q A;  1SQX K;  1SQB K;  2WSF H;  2FYU K;  2WSE H;  1L0L K;  1SQQ K;  1L0N K;  3G3Z A;  1NTM K;  1NTZ K;  4IFD K;  2WSC H;  1NTK K;  1NU1 K;  1SQV K;  2LKM A;  3LW5 H;  2J59 M;  3CLQ A;  2OAR A; 
#chains in the Genus database with same CATH topology
 1L0N G;  2FYN B;  3RL0 B;  5AVW B;  2AXC A;  3HE4 B;  3ITK A;  1GDT A;  5CCG D;  3C1L A;  5CBO A;  3H1I D;  1LTS C;  4GOE A;  1LTJ B;  3L70 D;  2CPB A;  2J5U A;  1DEB A;  2ZYG A;  2ZT9 B;  2Q6Q A;  1SQV J;  2QJY B;  4ASV A;  2Y9Z A;  3H1L D;  5KJ7 C;  3AE8 C;  4HKZ H;  3L75 D;  1BGY E;  1JEK A;  1MV8 A;  2QJP B;  1L0L G;  1X9V A;  1OVR A;  3H1J G;  5AVT B;  4EI2 A;  2WSE H;  4GOF A;  3B5N C;  3A0B E;  5KLV G;  2Y0D A;  2AEJ A;  3CLQ A;  1YJ9 P;  2O01 H;  2Z5H A;  1H0T B;  1T3J A;  2IZ0 A;  1SQB E;  3L72 E;  2Y9Y A;  2ZFC A;  3IF4 A;  4KHX A;  1Q86 Q;  2H43 A;  4A7P A;  2Q9I A;  3AE3 C;  2PP6 A;  1NTK E;  1RE4 C;  2K3R A;  3BCC J;  2NZ2 A;  1NWQ A;  3WMM 0;  1SQX E;  1GK6 A;  5KTB A;  3RL0 D;  1SP4 A;  1L0N K;  2YIU B;  4N78 D;  3CWB J;  2QIW A;  2A06 E;  3A0B H;  3FXE A;  1FOS E;  4D6T D;  2K9J B;  1VQM P;  1HH0 A;  3NTN A;  1PP9 G;  1VQ5 P;  4RO0 A;  3H1H G;  1NTM K;  1M1J A;  3CME P;  3Q5S A;  1Q81 Q;  1EDL A;  3A5T A;  2HR3 A;  1OFC X;  4GIF A;  2Y0E A;  2KZJ A;  3TGU E;  1A02 F;  1WMK A;  2WVR A;  3A2A A;  2AEM A;  1LT1 A;  1MKM A;  1L0L K;  3L37 A;  3JCU H;  2O1J A;  2GM4 A;  3FGA D;  5APS A;  3RK2 B;  2FFD C;  1HF9 A;  3PTZ A;  2I1K A;  1FZE A;  1YYC A;  2H89 C;  3TDK A;  3SWF A;  2E75 D;  1HVV A;  1N7S C;  1FBM A;  1YJW P;  1KFN A;  1GMJ A;  4IL6 H;  1FZB A;  1H0T A;  2C0W A;  1YTZ T;  1FZC A;  3L73 J;  2N9Y B;  3U59 A;  4PV1 C;  1G1J A;  1JY2 N;  1AVO A;  3D71 A;  1AQ5 A;  3HTK A;  3L71 J;  3L74 J;  1S2E A;  1KIL A;  3QH9 A;  4I1L A;  5AW7 B;  1E5W A;  1NAF A;  1SQV G;  3TGU G;  2HFE D;  1DD3 A;  2LXC B;  2R44 A;  1U7M A;  3HD7 D;  2B87 A;  5DJT B;  1RY3 A;  3A3Y B;  3H1K D;  1GZL A;  3SWY A;  3OW2 O;  3VMX A;  4U3F E;  1BDD A;  3JSV C;  2MJZ A;  2FYU E;  2C9N Y;  2K9J A;  3H1I E;  5EFW B;  3B5N B;  1KQG B;  1H89 A;  1NYH A;  2H88 C;  2XU6 A;  1KOR A;  3RK3 E;  1W2E A;  5CHX A;  1NU1 E;  5TIS E;  2Y0C A;  3RBX A;  4KJM A;  5AW3 B;  3NXS A;  2B9B A;  4RKU J;  3H1L E;  2FY8 A;  1ZR2 A;  2PGD A;  5CCG C;  3V4Q A;  4YPC A;  5AW0 B;  3GHG B;  2H8P D;  3T97 B;  3LW5 H;  1GK4 A;  3GW6 A;  2O1K A;  5APY A;  2Q3I A;  3BCC G;  2I1J A;  3TF5 A;  2KLU A;  1URQ A;  1S1C X;  4U3F G;  1S4X A;  1BE3 J;  4OWF A;  3CD6 P;  3HE5 A;  2YMK A;  4M3L A;  3CWB G;  5DJU B;  1LT9 B;  3MIW A;  2NPS A;  1LTA C;  2QJK C;  2O01 N;  1SFC A;  1NU1 G;  1S3J A;  1W5C E;  5TIS H;  5CCH A;  2C0X A;  3CX5 D;  3CL3 D;  1GW3 A;  1YJN P;  4R4M A;  1HJ0 A;  2FYZ A;  1QEX A;  2W83 C;  5KJ7 D;  1BCC E;  5APV A;  2GUV A;  2ZYD A;  2WPV B;  2IBZ G;  1T3U A;  5APW A;  1VQ9 P;  5KLV D;  1FS0 E;  2CPS A;  3CCE P;  1HUC A;  4N78 E;  2BCC D;  2YKO A;  3B5N D;  1IK9 A;  1PV3 A;  2XV5 A;  1LJ2 A;  4DT0 A;  1ZXG A;  4IFM A;  2FFD B;  3F5H A;  1OWA A;  3BAT A;  1NTZ D;  2G3A A;  1L0N J;  5K5G B;  1NAY A;  4U7J A;  1VL2 A;  2OYH C;  1EZV G;  3MHV A;  3P8C D;  1JCD A;  4PV1 B;  2Q1K A;  3L73 G;  2RH0 A;  4IL6 X;  1G2C A;  1NTM J;  3GHG A;  2QVA A;  4TLF A;  2ITA A;  1MZ9 A;  3L74 G;  1PGO A;  1BCC G;  3G71 P;  4WY4 A;  3WUT A;  5AW2 B;  2R5B A;  1T6A A;  1NH4 A;  1OMI A;  3UIA A;  2R3S A;  4BWN A;  2K37 A;  3VP9 A;  3H1J J;  2KNC B;  1RE3 A;  3AE5 C;  1L4A D;  2FYU K;  1IFP A;  5GTI H;  2XZR A;  1VDF A;  1LT9 A;  4LGD E;  1K9M Q;  4HB1 A;  1NU1 K;  3H32 A;  2KP8 A;  2P2U A;  5C39 A;  2QA4 P;  2O01 J;  5APU A;  1YIT P;  3FWL A;  3VMY A;  2E75 C;  4NPD A;  4DCK A;  4I7Z C;  1CZQ A;  3MGN A;  1FE6 A;  4HH2 A;  1HGV A;  3PJS K;  2SPZ A;  3NMD A;  2LKM A;  3V2P A;  3LID A;  4K3A A;  2FXM A;  1BGY J;  2KUB A;  1N7L A;  1RQU A;  1IFN A;  2WSF H;  3F89 A;  1N7S D;  3M0D A;  5AVQ B;  3JC2 2;  2W6J H;  1HJB A;  1DD4 A;  3KZI E;  1ZR4 A;  3MP7 B;  1VQK P;  1BE3 G;  2IFN A;  3AE2 C;  2A45 G;  1SQV D;  1VQN P;  2QJK B;  1PGQ A;  3V2R A;  2IDB A;  5GTH E;  2YO3 A;  3H1H J;  1EQ7 A;  1S9K D;  1GL2 A;  1LNQ A;  2OYI C;  4WWI A;  2KNC A;  1LWU C;  3TSI A;  5KKZ B;  2KZI A;  2JO1 A;  4OGQ D;  2JWD A;  2N1T A;  2KK7 A;  1U7J A;  2I8D A;  2WSC H;  3AE9 C;  3IFM A;  3HUS C;  1SQQ E;  3P32 A;  1WT6 A;  1J2J B;  1M57 D;  4NPE A;  1KQS O;  4AQR D;  4XFJ A;  3CX5 I;  1FAV A;  3R4Y A;  4O9B A;  5KAI E;  4AUW A;  3NFQ A;  5L8R J;  5GTH H;  3BCC D;  2OYO A;  1NTM G;  1IO4 A;  3TGU J;  3WU2 E;  5AW8 B;  2BCC E;  3GF3 A;  3ABV C;  4DZO A;  2PFX A;  1NJI Q;  2KYV A;  3CWB D;  2Q7C A;  1BSN A;  1NTZ E;  2HOD B;  1IFD A;  1SQQ G;  1PGP A;  3CXH D;  4YXD C;  1H8A A;  1DIP A;  4HYT B;  2PRR A;  3CCV P;  3FXD A;  3RBZ A;  4JQ0 D;  3CCS P;  1BDC A;  4GDO A;  1RF0 C;  3CX5 H;  2YO2 A;  1N73 A;  5KAI H;  3MD0 A;  2IBZ D;  1AFO A;  1ZN5 A;  2E75 B;  4I7Z B;  1XTC C;  1JY3 N;  2IX7 C;  5AW9 B;  1KD1 Q;  2E74 C;  1PZQ A;  1SS1 A;  1Q7Y Q;  3M9H A;  1NOH A;  1JB0 J;  3AEF C;  3V6I A;  1QLE D;  1JY2 P;  3WU2 H;  1XTG B;  2K1A A;  1LP1 B;  1YQ4 C;  3JCU E;  1J1E C;  4L75 A;  1BGY G;  2HPC B;  1SQP E;  2QSI A;  2ZVO B;  2LR2 A;  3R2P A;  2HLO A;  4U3F J;  2BAS A;  5BVZ A;  1FC2 C;  2FYU J;  3HD7 B;  3W68 A;  3H1I J;  3HE4 A;  5CMZ A;  2J58 A;  1ZW0 A;  3L71 D;  3L74 D;  3K5B A;  1OIP A;  2JP3 A;  4IL6 E;  1L4A C;  1NU1 J;  1NKN A;  1PPJ D;  1LTJ A;  3KXD A;  5AVR B;  3L35 A;  3D70 A;  1SQB G;  3L72 G;  4R4L A;  2OTJ P;  1VF5 D;  4ZKP A;  4EIJ A;  5AVU B;  1ZRT E;  2HOD A;  5B5E H;  3AED C;  1NTK G;  1U57 A;  3BRT B;  4YTP C;  1RHZ B;  1LWU B;  1QVG O;  1SQQ K;  4B86 A;  1QL1 A;  3MUD C;  1IFI A;  2W6A A;  2R3C A;  2C9L Y;  1SQX G;  1M90 Q;  3HUS B;  3BRV B;  4I2L C;  1R8E A;  1RF1 C;  2G8Y A;  1X79 B;  4Z1M H;  2M5A B;  3OA7 A;  2QEX P;  1FU1 A;  2A06 G;  1EXI A;  1JY2 O;  3BVH A;  5APX A;  1NHL A;  4IOI H;  3SFE C;  3EWK A;  2YXQ B;  1OW7 A;  3P7K A;  4H0L D;  2HG5 D;  3CC2 P;  1FZG A;  1BCC J;  3II6 A;  1R5S A;  4ZNC A;  1X22 A;  3E7K A;  2W6B A;  2HPC A;  4YXW H;  1FDO A;  4EOT A;  3HD7 A;  2Z5I A;  4CPG A;  1IFM A;  2IYP A;  4OGQ C;  1W2B O;  4L73 A;  1J1D C;  2Q5U A;  3N4X A;  1QVF O;  2NRG A;  3D6Y A;  1MUU A;  2UWJ E;  3AE1 C;  3L70 E;  4LC1 A;  4OH8 B;  1SQB K;  3I5C A;  1KB9 D;  3L75 E;  1NTK K;  1OZH A;  2Z4E A;  1X0T A;  2ZVN B;  1FZA A;  1USE A;  1CI6 B;  4Y99 C;  2WSF J;  1L0N D;  1YI2 P;  3CCM P;  1SQP K;  2KIK A;  1SQX K;  3HRN A;  1K8A Q;  1J1E B;  1M1K Q;  2R5D A;  4IFF A;  3CCU P;  2P58 A;  3EFG A;  3U1C A;  2FYU G;  4ZKU A;  1NTM D;  3H1I G;  2QG4 A;  5BU5 A;  4RES B;  1URQ D;  3E1R A;  1L4A B;  2E5T A;  1FJK A;  3S4R A;  4BRY B;  4I6M C;  1M56 D;  4C46 A;  1E79 H;  2NPS D;  1L0L D;  3G9R A;  2J59 M;  3H1J D;  3H1L G;  4WB4 A;  1OX3 A;  4C7N B;  5KJ7 A;  3OAK A;  2XND H;  2ZYA A;  1PL5 A;  2WSC J;  1QL2 A;  1JM0 A;  2D2C C;  2RMZ A;  3L71 E;  3CPW O;  1HTL C;  5GTI E;  1QGK B;  3B5N A;  2KSE A;  1RF1 B;  4ASW A;  1AQT A;  1PPJ E;  1FJP A;  1KQL A;  4D6T E;  1SVF A;  3SFD C;  1N7S B;  2AEF A;  3MTU E;  1Q82 Q;  4NPF X;  1OW8 A;  1KN7 A;  4K35 A;  2E74 D;  2QM7 A;  3N7N A;  1Z56 A;  1X8Y A;  3M9B A;  1BGY D;  2M0B A;  3LIE A;  2FYN C;  3T97 A;  1IJD B;  3AEA C;  1RE4 A;  3WUV A;  1YTZ I;  1KV4 A;  5APQ A;  2OGU A;  3H6P A;  2E76 C;  5B66 H;  1ZP0 C;  1SQQ J;  1T2K D;  4ZMD A;  1N8R Q;  1VF5 C;  1PP9 D;  1NGM B;  2WSE J;  1M1J C;  3H1H D;  3KPE A;  1MFT A;  3RL0 g;  4OGQ B;  2KOG A;  4D6T G;  1J1D B;  2DW3 A;  3TNU B;  3TYY A;  5H2F H;  1ZME C;  4MN4 C;  3D6Z A;  4Y28 J;  3M91 A;  5AVX B;  3C9I A;  2WSS H;  3AEC C;  3CCJ P;  1HBW A;  3Q3D A;  3B71 A;  1KQF B;  3VYI A;  3AEG C;  2K88 A;  2A45 I;  2IPP A;  3RGU A;  3H1K E;  4H0L C;  1FOS F;  2OAR A;  2JWA A;  3V2Q A;  2E43 A;  1NTZ J;  2A06 D;  1CSB A;  1FZC C;  1OXZ A;  2W90 A;  2FFD A;  1YBK A;  3A0H E;  2RKL A;  1N7S A;  1KIL C;  4JPZ B;  4QMA A;  1R5L A;  1VQP P;  3TGU D;  1KB9 E;  1KB9 I;  2QE7 H;  3BAS A;  4JBZ A;  1K73 Q;  1SQB J;  3L72 J;  4TT3 H;  1VQ6 P;  1EXJ A;  2O3J A;  2JEE A;  3V4W A;  4UB6 E;  1FZF A;  1NTK J;  1JY3 P;  3VTP C;  3H1K G;  1JMB A;  1T8Z A;  1SQP J;  1TU3 F;  1SQX J;  3G6E P;  1GL2 D;  2D2C B;  1VQ7 P;  3A0H H;  4JYC A;  4DOJ A;  4RJT A;  2YKQ A;  4H44 C;  1AV1 A;  2WT7 B;  2N1T D;  1VQ8 P;  1QX8 A;  3CX5 E;  2OYH B;  2OTL P;  1Y47 A;  1L0L E;  1L2P A;  3RK2 C;  2E5Y A;  1KB9 H;  3H1J E;  3W67 A;  3Q2Y A;  4JF7 A;  2R32 A;  2P7J A;  2L5G B;  2Q3E A;  5CCG A;  1URQ C;  1OVV A;  2MKV A;  4XE5 B;  1GU5 A;  5KLV E;  3USS A;  3PRJ A;  4U3F D;  1KC8 Q;  4UB6 H;  3PP5 A;  2FYU D;  2W27 A;  1LTT C;  2NPS C;  2M8R A;  2FBW C;  1SFC C;  2E76 B;  5CCH C;  3RK3 D;  1VF5 B;  1NU1 D;  3PHL A;  2LXB A;  1M1J B;  1ZOY C;  3IR9 A;  3P8C E;  2PAJ A;  1VQL P;  1GW4 A;  4IFD K;  1KFM A;  1YQ3 C;  3CCR P;  2P1J A;  1JY3 O;  4H13 D;  1HWT C;  4PD4 D;  1DX7 A;  4OVN F;  3CMA P;  2WWW A;  3M06 A;  3IAO A;  1OVU A;  3O8Z A;  1LTB C;  3LW5 J;  2D2C D;  1JTH B;  1YIJ P;  2BCC G;  1S72 P;  5B5E E;  4H0L B;  1PP9 E;  1BSH A;  1DEE G;  3H1H E;  1P84 D;  1NTZ G;  1FZC B;  2WT7 A;  1EZV D;  3ZDM A;  1S5L E;  2WIT A;  3MZW B;  1K05 A;  1PFI A;  3GHG C;  3L73 D;  1GD2 E;  3HTK B;  2KXP B;  2OYH A;  1KIL B;  2V7Q H;  1T2K C;  4WY4 C;  5CJ4 A;  5AW5 B;  3H25 A;  1Q90 D;  1BCC D;  3L70 J;  1MFZ A;  1SLQ A;  4UB8 E;  1LTI C;  5CJ0 A;  2B87 B;  4N6J A;  1WRG A;  1RE3 C;  3H1L J;  1OW6 A;  3L75 J;  1LT9 C;  2E76 D;  2HYN A;  2JKV A;  2ZT9 D;  3FWN A;  5AVS B;  2OYI B;  1N86 A;  3TK1 A;  5APT A;  1SQP G;  3Q5P A;  1S5L H;  2BEZ F;  3EQ2 A;  3CC4 P;  3L4F A;  1USD A;  2FXP A;  4H44 B;  1KYO D;  1SQV E;  4XA4 A;  2XKM A;  1NVO A;  4UB8 H;  1S9K E;  2JR8 A;  3M0D C;  1Q2N A;  4W7Y A;  5KLV K;  2FXO A;  4W7Z A;  1EC5 A;  1JTH A;  1URQ B;  1AJY A;  1VQO P;  4WBA A;  1JO5 A;  1LP1 A;  3HE5 B;  1NTZ K;  1BE3 D;  3KQG A;  1JOC A;  2NPS B;  3V5B A;  2OTK E;  1KIL D;  1SFC B;  2CK3 H;  2IYO A;  2YMY A;  4D6T J;  5AW4 B;  5KLI C;  2M3B A;  1GL2 C;  3SWK A;  1FDI A;  4BXL A;  3BCC E;  2B88 A;  2KS1 B;  2N1T C;  3AE7 C;  1JCC A;  2V4H A;  2JDI H;  5AW1 B;  1A02 J;  3CWB E;  2OYI A;  5E79 E;  1NO4 A;  2E74 B;  1LTG C;  1LWU A;  3U1A A;  3O6Q B;  3I55 P;  1JMM A;  3B8E B;  3CXH E;  3CXH I;  4H44 D;  3QWO C;  3KHU A;  3HUS A;  1VPC A;  3OJA B;  5TJH A;  4PJ0 E;  2ZAE B;  3GF7 A;  3AEB C;  1CW5 A;  2M5A A;  1ZLL A;  4GOD A;  1G2C B;  4PD4 E;  4PD4 I;  1EDK A;  2IBZ E;  1IZN B;  2IBZ I;  3RK2 D;  2FKW B;  3RK3 C;  3I56 P;  4WY4 B;  4GT1 A;  2P67 A;  3S1K A;  3L70 G;  5CBN A;  2WQY C;  4H13 C;  1SQQ D;  3G4S P;  1SFC D;  1AA0 A;  5E79 H;  1P84 E;  1P84 I;  2YNY A;  3M9Q A;  3L75 G;  3H1K J;  5CCH D;  1EZV E;  3KDP B;  1EZV I;  4DJG A;  1RQV A;  3H32 B;  3CXH H;  1N73 C;  4GKG A;  3L73 E;  5B66 E;  3AE6 C;  2WZ7 A;  1H88 A;  1KZU B;  3KYQ A;  4PJ0 H;  1GU4 A;  1SQV K;  3L74 E;  2YKP A;  2P10 A;  1K04 A;  2WPQ A;  4PD4 H;  3AE4 C;  1RF0 A;  3VMA A;  5KKZ C;  3PLN A;  1S5L X;  4JYB A;  2KS1 A;  3A7O A;  3CCQ P;  3CI9 A;  5H2F E;  2KLV A;  2BEQ D;  3VN0 A;  3E1I A;  3GG2 A;  1KTM A;  1G1I A;  1M8O B;  1ZV8 A;  3PH0 A;  3O6Q A;  1EDI A;  3RL0 C;  1EDJ A;  1CI6 A;  1P84 H;  4LLH A;  2ZJS E;  2WMM A;  4HJG H;  1YHQ P;  5AVV B;  2IFM A;  1LTJ C;  1KYO E;  1KYO I;  4AYC A;  1M7L A;  4L74 A;  2ZT9 C;  4WY4 D;  3EFF K;  3FX0 A;  2WPS A;  1AVY A;  3L71 G;  5BU8 B;  2IZ1 A;  3M0A A;  2QJY C;  2KSJ A;  2WTY A;  5KLI B;  1SQB D;  3L72 D;  1PPJ G;  2ZXE B;  1IFJ A;  1L4A A;  2W8Z A;  1GL2 B;  4BRY A;  2KB7 P;  3GMA A;  1L0L J;  1LGH B;  4EYY Q;  2K9Y A;  2QJP C;  1HGZ A;  1NTK D;  1Y9B A;  2AXT E;  2KI7 B;  1D7M A;  2XDJ A;  3CCL P;  3VP8 A;  2N9B A;  2N1T B;  1Y8A A;  1SQP D;  2B89 A;  1SQX D;  1BE3 E;  5KLV J;  4C7N A;  2RN0 A;  3P8M C;  2BCC J;  1KIL E;  3AEE C;  3GLM A;  2JJL A;  3MUD A;  4Y99 B;  3V2N A;  1KYO H;  5AVZ B;  1RF1 A;  4W80 A;  2V7Q J;  1DH3 A;  3RK3 B;  2QRX A;  4EDF A;  2QM8 A;  1ZRT D;  1RH5 B;  4L76 A;  3Q1M A;  5KAF E;  3C8V A;  3VOP A;  2AXT H;  5AVY B;  1JUN A;  3HD7 C;  1UII A;  3G3Z A;  2YIU C;  2ZXX A;  3CC7 P;  1NKZ B;  1GTW A;  5AW6 B;  1L0N E;  2POH A;  1UIX A;  4H13 B;  2YXR B;  4PV1 D;  1PIX A;  4WVZ A;  3IN6 A;  2A45 H;  3S9O A;  1PP9 J;  2GA1 A;  3Q5R A;  1N73 B;  2E42 A;  4C7R A;  2GUS A;  5M1B A;  2WPR A;  1VQ4 P;  1IK7 A;  2L91 A;  1NTM E;  1FDM A;  4KT0 J;  2M3E A;  3WUU A;  4N3Y B;  3VMZ A;  3B4S A;  3TNU A;  3SSU A;  2OQQ A;  2XNX A;  1N2D C;  2VRS A;  1PGJ A;  3L36 A;  5KAF H;  1KMI Z;  1IC2 A;  2H7H A;  1JNM A;  3KZI H; 
#chains in the Genus database with same CATH homology
 1SQP K;  1SQX K;  3HRN A;  1RE3 A;  5AVS B;  1L4A D;  2FYU K;  1J1E B;  2OYI B;  2XZR A;  1VDF A;  3RL0 B;  1N86 A;  1LT9 A;  5AVW B;  2R5D A;  4IFF A;  3HE4 B;  3TK1 A;  5APT A;  4LGD E;  1GDT A;  5CCG D;  1NU1 K;  3H32 A;  2KP8 A;  3EFG A;  2P2U A;  3U1C A;  3EQ2 A;  1LTS C;  3L4F A;  5APU A;  4ZKU A;  1LTJ B;  3VMY A;  2CPB A;  5BU5 A;  1DEB A;  4XA4 A;  4RES B;  1URQ D;  1CZQ A;  3MGN A;  2XKM A;  1L4A B;  1FJK A;  4HH2 A;  1HGV A;  4I6M C;  4C46 A;  2NPS D;  5KJ7 C;  1S9K E;  3NMD A;  2LKM A;  3M0D C;  3V2P A;  3LID A;  2J59 M;  4W7Y A;  1MV8 A;  4WB4 A;  2FXM A;  5KLV K;  1X9V A;  1N7L A;  1IFN A;  4W7Z A;  1URQ B;  1JTH A;  2WSF H;  4C7N B;  5KJ7 A;  1N7S D;  3OAK A;  5AVT B;  3M0D A;  2WSE H;  5AVQ B;  4WBA A;  1JO5 A;  3HE5 B;  1HJB A;  3B5N C;  1QL2 A;  1NTZ K;  3KQG A;  1ZR4 A;  1JOC A;  2NPS B;  3V5B A;  1KIL D;  1HTL C;  1SFC B;  3CLQ A;  3B5N A;  2IFN A;  1RF1 B;  2O01 H;  2A45 G;  2Z5H A;  1FJP A;  1KQL A;  1SVF A;  1T3J A;  1N7S B;  2YMY A;  3V2R A;  3MTU E;  5AW4 B;  2YO3 A;  2M3B A;  2ZFC A;  4KHX A;  2H43 A;  1GL2 C;  2Q9I A;  2QM7 A;  3N7N A;  2PP6 A;  1EQ7 A;  1Z56 A;  1S9K D;  1X8Y A;  3M9B A;  1GL2 A;  3LIE A;  1RE4 C;  2N1T C;  1NWQ A;  2OYI C;  3T97 A;  3WMM 0;  1GK6 A;  5KTB A;  3RL0 D;  1LWU C;  1IJD B;  1JCC A;  3TSI A;  1RE4 A;  1A02 J;  1SP4 A;  5AW1 B;  1YTZ I;  2N1T A;  1L0N K;  5APQ A;  2OYI A;  1NO4 A;  2WSC H;  3H6P A;  3IFM A;  3HUS C;  4N78 D;  1LTG C;  3P32 A;  1LWU A;  3U1A A;  1JMM A;  1WT6 A;  3B8E B;  1T2K D;  1J2J B;  1FOS E;  3HUS A;  4AQR D;  1VPC A;  1M1J C;  3OJA B;  1FAV A;  1HH0 A;  3NTN A;  3KPE A;  4O9B A;  2KOG A;  1CW5 A;  1J1D B;  1ZLL A;  1NTM K;  4AUW A;  3NFQ A;  1G2C B;  1M1J A;  3TNU B;  3TYY A;  3RK2 D;  2FKW B;  3A5T A;  3RK3 C;  4WY4 B;  4GT1 A;  4GIF A;  2P67 A;  1A02 F;  3M91 A;  5AVX B;  3C9I A;  3A2A A;  1IO4 A;  1L0L K;  5AW8 B;  3L37 A;  2O1J A;  1HBW A;  2GM4 A;  4DZO A;  3VYI A;  2A45 I;  2KYV A;  2IPP A;  5APS A;  2Q7C A;  3RK2 B;  2FFD C;  2HOD B;  1SFC D;  2I1K A;  1FOS F;  1FZE A;  1YYC A;  2OAR A;  1IFD A;  3V2Q A;  2E43 A;  3SWF A;  2YNY A;  3M9Q A;  5CCH D;  1HVV A;  1N7S C;  1CSB A;  1H8A A;  3KDP B;  1FZC C;  1OXZ A;  1FBM A;  4HYT B;  2FFD A;  1KFN A;  3H32 B;  1N73 C;  4GKG A;  1FZB A;  2C0W A;  1N7S A;  1YTZ T;  2WZ7 A;  1H88 A;  1KZU B;  3KYQ A;  1FZC A;  1RF0 C;  1GU4 A;  1KIL C;  3U59 A;  1SQV K;  2YO2 A;  1G1J A;  1N73 A;  1JY2 N;  2YKP A;  3MD0 A;  1AFO A;  1AQ5 A;  2WPQ A;  1ZN5 A;  3HTK A;  1RF0 A;  1XTC C;  1KIL A;  1JY3 N;  2IX7 C;  5AW9 B;  5AW7 B;  4I1L A;  4JYB A;  3A7O A;  1E5W A;  1NAF A;  3BAS A;  3CI9 A;  3VN0 A;  2KLV A;  2HFE D;  3E1I A;  3HD7 D;  1NOH A;  3M9H A;  1G1I A;  1JY2 P;  1XTG B;  1RY3 A;  3A3Y B;  1GZL A;  2JEE A;  1ZV8 A;  3SWY A;  3V4W A;  1FZF A;  3VMX A;  1J1E C;  1JY3 P;  3VTP C;  3RL0 C;  2HPC B;  1CI6 A;  3R2P A;  1T8Z A;  2MJZ A;  4LLH A;  2HLO A;  2C9N Y;  2BAS A;  5BVZ A;  1GL2 D;  3B5N B;  3HD7 B;  4JYC A;  1H89 A;  5AVV B;  4DOJ A;  2IFM A;  1LTJ C;  2XU6 A;  3HE4 A;  5CMZ A;  2YKQ A;  2J58 A;  4AYC A;  1M7L A;  1W2E A;  5CHX A;  2WT7 B;  4WY4 D;  2WPS A;  1L4A C;  2N1T D;  5AW3 B;  1NKN A;  1LTJ A;  5BU8 B;  5AVR B;  3M0A A;  2KSJ A;  2WTY A;  2OYH B;  3NXS A;  3L35 A;  2ZXE B;  1IFJ A;  1L4A A;  1ZR2 A;  5CCG C;  1GL2 B;  3RK2 C;  3V4Q A;  5AW0 B;  2KB7 P;  3GHG B;  2H8P D;  4JF7 A;  1LGH B;  2R32 A;  3LW5 H;  1GK4 A;  2O1K A;  2P7J A;  2L5G B;  1HGZ A;  1URQ C;  5APY A;  2XDJ A;  4ZKP A;  5CCG A;  4EIJ A;  2Q3I A;  3VP8 A;  5AVU B;  2N9B A;  2N1T B;  4XE5 B;  2HOD A;  1GU5 A;  2I1J A;  3BRT B;  1LWU B;  1SQQ K;  4B86 A;  1QL1 A;  1URQ A;  4C7N A;  1IFI A;  3PP5 A;  2W6A A;  2R3C A;  2W27 A;  2C9L Y;  3P8M C;  1LTT C;  2NPS C;  2M8R A;  3HUS B;  1SFC C;  2JJL A;  3BRV B;  4I2L C;  3HE5 A;  1RF1 C;  4M3L A;  3MUD A;  5CCH C;  3RK3 D;  1LT9 B;  4Y99 B;  3MIW A;  3V2N A;  1X79 B;  2NPS A;  1LTA C;  3OA7 A;  1SFC A;  1FU1 A;  1M1J B;  5AVZ B;  1RF1 A;  5CCH A;  1JY2 O;  3BVH A;  5APX A;  1NHL A;  2C0X A;  3IR9 A;  3P8C E;  2PAJ A;  3CL3 D;  1GW3 A;  1GW4 A;  4W80 A;  1KFM A;  4IFD K;  2FYZ A;  2P1J A;  1JY3 O;  5KJ7 D;  1HWT C;  3P7K A;  1DX7 A;  2HG5 D;  1DH3 A;  5APV A;  3RK3 B;  1FZG A;  2GUV A;  2WWW A;  3M06 A;  3II6 A;  2QM8 A;  1T3U A;  5APW A;  2CPS A;  3VOP A;  5AVY B;  1HUC A;  3O8Z A;  1LTB C;  4N78 E;  1JUN A;  2W6B A;  2HPC A;  3HD7 C;  3G3Z A;  2YKO A;  3B5N D;  1NKZ B;  1IK9 A;  2XV5 A;  1GTW A;  5AW6 B;  1JTH B;  2POH A;  4IFM A;  4EOT A;  2FFD B;  1OWA A;  3BAT A;  3HD7 A;  2Z5I A;  2A45 H;  1IFM A;  2OYH C;  1FZC B;  2WT7 A;  2WIT A;  1N73 B;  1J1D C;  2E42 A;  2Q5U A;  4C7R A;  2GUS A;  2WPR A;  1PFI A;  3N4X A;  3P8C D;  3GHG C;  1GD2 E;  3HTK B;  2OYH A;  1MUU A;  1JCD A;  1KIL B;  1FDM A;  1T2K C;  4WY4 C;  5CJ4 A;  5AW5 B;  4LC1 A;  4OH8 B;  1G2C A;  4N3Y B;  3VMZ A;  3GHG A;  1SQB K;  1MFZ A;  3TNU A;  1MZ9 A;  1SLQ A;  2XNX A;  1N2D C;  3I5C A;  4WY4 A;  2VRS A;  1LTI C;  5CJ0 A;  4N6J A;  1WRG A;  5AW2 B;  2R5B A;  1RE3 C;  1NTK K;  1NH4 A;  3L36 A;  2Z4E A;  3UIA A;  1IC2 A;  1FZA A;  1LT9 C;  1CI6 B;  4Y99 C;  2H7H A;  1JNM A;  2HYN A;  3VP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...