2WSCH

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
DLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
publication title Structure Determination and Improved Model of Plant Photosystem I.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03244 PSI_PsaH Photosystem I reaction centre subunit VI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wscH01
2LKMA 1SQPK 2WSFH 2OARA 1L0NK 1SQXK 3M9QA 1SQVK 2O01H 2J59M 1SQBK 1L0LK 3CLQA 4IFDK 1NTZK 2WSCH 2WSEH 3G3ZA 3LW5H 1NU1K 5KLVK 1NTMK 1NTKK 2FYUK 1SQQK
chains in the Genus database with same CATH superfamily
2WSFH 1HTLC 3AEFC 1PGPA 1LWUA 4XFJA 1URQA 3C1LA 3IFMA 1LT9C 3M9HA 4R4LA 2W8ZA 1KMIZ 5TISE 2FFDC 3CCMP 4U7JA 3CPWO 2YO3A 3V2RA 5H2FE 2R5DA 1QEXA 1RQVA 3GHGC 2ZVNB 1EXJA 2PRRA 1NAYA 2P2UA 4OVNF 1LT9A 2CK3H 2Y0CA 3CCSP 3CX5H 5B5EE 2ZYGA 2FFDA 1NTZJ 5AW5B 3E7KA 3CWBE 1FZAA 3CCRP 1SQQK 2D2CC 3VMXA 3CWBG 4OWFA 5EFWB 1LTSC 2KK7A 3CC2P 1EZVD 4GKGA 5KLVD 1SQBK 2M3BA 2N9YB 5KAFE 1IJDB 2WQYC 2R44A 4I2LC 3RL0g 3L70J 4HKZH 3L75D 5CCHC 1M56D 1CW5A 2AEJA 1FDMA 3H1JD 1KZUB 2V7QH 2IPPA 3Q5SA 3L73J 5AW3B 5AVZB 4XA4A 2RKLA 2WTYA 5B66H 3HD7D 3GMAA 2A06E 1ZP0C 1SQPJ 1H0TA 5L8RJ 1H8AA 2YNYA 1S5LX 2PP6A 2O01H 3U59A 2A06G 3QWOC 1NU1E 3D6ZA 1N7LA 3H1HJ 1KB9I 2WMMA 2WPSA 1H89A 4PV1C 3NTNA 2IBZE 1NU1G 1BDDA 1NTKD 2QJPC 2HFED 3CCQP 2KZJA 1YIJP 3G3ZA 2HYNA 2W27A 2AXTH 1PPJE 3AEGC 2IBZG 1K8AQ 3H1LE 1JM0A 4W7YA 1JB0J 2H89C 3L74J 4DZOA 4OGQB 3K5BA 1OVRA 1PPJG 4Y99C 4HB1A 1VL2A 1T6AA 1M1JB 3CXHH 5AVXB 5GTHE 1VQ8P 5KLIC 1FZCB 1FE6A 4N78D 3VP8A 1BSNA 1IFPA 5APVA 2BCCJ 2FYUD 1EC5A 3RK3D 1N7SB 3W67A 3TDKA 4DJGA 2E5YA 1U57A 1UIXA 2NPSB 4U3FJ 3RK2B 2OYOA 1S72P 4IFDK 4RESB 1S1CX 1NOHA 3BCCE 2KXPB 2P10A 2E5TA 5KJ7D 3PH0A 1KD1Q 2OTJP 3BCCG 1LWUB 3RL0C 1URQB 1VQNP 1P84H 3CI9A 1ZOYC 1WRGA 1N2DC 2YKQA 2M0BA 1M90Q 5APUA 3GF7A 1SFCB 3A0HE 2K9YA 4YXWH 1WT6A 1NTZD 2W6JH 2NZ2A 2HPCA 5BVZA 1VQPP 1LT9B 4PD4I 4YTPC 1SQXE 1KORA 3TGUG 1FJPA 1L4AC 1OW7A 2FFDB 3NFQA 5CBOA 5AVYB 4LLHA 5KKZC 5GTIE 5KLVK 2O3JA 1HGVA 1KFMA 1OW8A 1SQXG 3FX0A 4H44B 3B71A 5M1BA 3OA7A 1GD2E 1FZGA 3KPEA 5CCGC 4H0LC 1L4AA 3CL3D 2YMYA 1L0LE 4CPGA 3L70D 1JNMA 2JP3A 3F89A 1DEEG 2E42A 1KILC 1L0LG 3L73D 1Y47A 1KTMA 3HE5B 1EXIA 5CCGA 3JSVC 2P7JA 1JY2N 2HLOA 2KSEA 3AE1C 2KS1B 1SQPD 2Z5HA 1KILA 2E76C 1FDOA 4W80A 1H0TB 2NRGA 4BRYA 1QL1A 3M9QA 1QVGO 2H7HA 3H1KJ 4GT1A 3R2PA 5KAIE 1EQ7A 2R3SA 3H1IE 2E74D 3H1HD 2W90A 1NTKK 3ZDMA 2Y0EA 1OWAA 1D7MA 2FYZA 1ZMEC 2FXPA 1KILE 2P1JA 1N8RQ 3CWBJ 2KYVA 3SWKA 5E79H 3E1IA 1SQQD 3L72E 4NPDA 4NPFX 1VQ5P 1SP4A 1YTZT 2UWJE 3CCVP 1SQBD 1L2PA 2LKMA 3L72G 3AEDC 3A3YB 4PV1B 2QJPB 2ZT9C 3CLQA 3AE9C 3LIDA 1JOCA 3WUUA 1USEA 2Z4EA 2Q7CA 2FYUK 5APTA 2YXRB 1MZ9A 2BCCD 2IBZI 2QJKC 1FBMA 2ITAA 4Y99B 1HJ0A 4D6TJ 2JWDA 2IYOA 3HRNA 3IAOA 4RJTA 2QSIA 3RBZA 3FWNA 4U3FD 5KLIB 3WU2H 4IL6H 2KB7P 2A45G 2QG4A 3KZIH 3CMEP 2FXOA 4OGQC 1L0NE 2KUBA 2N1TD 2WSCH 1M1JC 1ZRTE 2R3CA 1NU1J 1L0NG 1LP1A 1PGOA 4AYCA 2ZXXA 1FZCC 2N9BA 1NTZK 1S5LH 1NGMB 1IC2A 1N7SC 1GW3A 3H1LJ 4WY4B 3S1KA 1VQKP 5AVSB 1EDJA 2B88A 3Q3DA 2O1JA 2Q5UA 1FZCA 3RL0B 2NPSC 2HPCB 3CCJP 1GZLA 1PZQA 1Z56A 2KLVA 1N7SA 1KYOE 1BCCE 1EDLA 4L73A 2QJYB 2RH0A 1BGYE 2RMZA 2NPSA 5APQA 1VQ4P 3L36A 1L4AB 3VP9A 4IFFA 2JEEA 3I56P 4PJ0E 1BGYG 1X0TA 4PD4E 2IX7C 2XNDH 1T8ZA 1ZXGA 1SFCC 1SQPK 2I1KA 2GM4A 2E75C 2JO1A 1IFDA 4H0LB 1AFOA 2J59M 4O9BA 1MFZA 1A02F 1LGHB 4ASVA 1S4XA 1KILB 3CX5D 2OYIC 4N6JA 1SFCA 1E79H 3H1KD 4H44C 1BE3E 3EQ2A 4BRYB 5AW7B 1U7JA 3HE4A 1M7LA 4MN4C 3RGUA 4C46A 1JUNA 3Q2YA 5TISH 3T97A 1CI6A 3V4WA 1NKNA 1BE3G 2FBWC 1CZQA 1YITP 3USSA 2OYIA 2E76B 3MP7B 1T2KD 3HD7C 3SWFA 3EFFK 4ASWA 3BATA 5B5EH 1OIPA 1AVYA 4M3LA 2C9NY 4IL6X 2I8DA 3B4SA 3MZWB 3HD7A 2G3AA 5CJ0A 2LR2A 3HE5A 1JY3N 3AEAC 5DJUB 1MKMA 5KLVG 1R5LA 3L75E 5KAFH 1LJ2A 3CC4P 1BDCA 2HG5D 1X8YA 2KS1A 2WPRA 2FKWB 3L75G 3H32A 4D6TD 4K3AA 2OGUA 3H1JG 4EI2A 4JQ0D 5CBNA 4TT3H 2ZT9B 3HTKA 4EOTA 2A06D 1SQVE 2Y9YA 1UIIA 2Q6QA 2D2CD 1YI2P 3GG2A 1IK7A 1Q90D 1YJWP 1SQVG 1J2JB 3A2AA 2L5GB 3P8MC 4I7ZB 2QJKB 1GW4A 5K5GB 1SVFA 3H1IJ 1IFJA 4GOFA 2ZAEB 2L91A 1LTGC 2Q1KA 5CCHD 1NTMJ 3JCUE 4KJMA 1LP1B 1RE3C 1GL2D 3CXHD 2WPVB 3TSIA 1VF5D 3M06A 2A45I 1MUUA 3H1LD 2K1AA 3L72J 3M9BA 3H25A 4HYTB 3G4SP 3E1RA 1Q82Q 1K04A 1M57D 1RE3A 2YKPA 1U7MA 4JBZA 2CPBA 2QEXP 3P8CE 1QLED 3KDPB 1N86A 3HUSB 3AE5C 4N78E 3SFEC 3I5CA 1KFNA 2XDJA 2ZJSE 1PFIA 5KTBA 3B5ND 2FYUE 5GTHH 3RK3E 4ZNCA 3P7KA 5AVTB 2WSCJ 2FYUG 3LW5J 1W5CE 2AEFA 3PP5A 1YYCA 3M0DC 3ITKA 4DOJA 3WUTA 1YJ9P 5TJHA 4WY4C 1P84D 5CHXA 3OAKA 1S9KD 1L0NJ 2OYHB 1GU5A 3OW2O 2YXQB 5AVVB 2FYNB 1GK4A 1KYOI 3M0DA 2IDBA 2KP8A 1NJIQ 4WY4A 3GF3A 2ZFCA 3TGUE 2QJYC 3RBXA 1IFIA 2E75B 2WWWA 3HE4B 1AJYA 4JPZB 5CJ4A 3T97B 5C39A 1CI6B 2AXCA 2OYIB 3TNUA 1NTZG 2GUSA 4NPEA 1PP9E 3NXSA 1BCCJ 1NO4A 2IFMA 5GTIH 4GODA 3L71J 2E74C 2P58A 3RL0D 1PP9G 3HD7B 3L70E 5BU5A 4K35A 1G1IA 3SSUA 4YXDC 3AE3C 1JCDA 1LTIC 4KT0J 3L73E 3L70G 1VDFA 2KZIA 1JY2P 1YBKA 2Y0DA 1ZV8A 5AW1B 1OFCX 1QVFO 3H32B 3MGNA 3L73G 3A7OA 3GLMA 1YJNP 1R8EA 1XTCC 1AV1A 3HTKB 2WSEJ 4W7ZA 1NYHA 1PGQA 1GMJA 1NU1K 3WUVA 1BE3J 1X79B 1HF9A 5CCGD 3H1ID 3QH9A 3JC22 4GDOA 1USDA 1NTMD 3A0BE 5E79E 5KAIH 1K9MQ 1KN7A 3H1HG 2AEMA 2M5AA 3L74D 4ZKUA 4GIFA 1VQLP 1SQQE 3MHVA 3SFDC 1AA0A 3AE8C 3KHUA 3C8VA 3VYIA 1SQBE 1YQ3C 1SQQG 2IZ0A 3RK3B 2E76D 2MJZA 1M8OB 1KB9D 1NH4A 5AW2B 2OTKE 3VN0A 1ZW0A 1SQBG 3G71P 4I7ZC 1Q86Q 3L75J 1KV4A 2Q3IA 1KB9H 3KYQA 2BCCE 5AVQB 3AE4C 4H13C 2E43A 3FWLA 1LTTC 1DD4A 1R5SA 1GK6A 2KIKA 3AECC 1LTJC 2BCCG 1PV3A 1GDTA 1SQVJ 3Q5RA 4U3FE 1VQ6P 3U1CA 2C0WA 3LW5H 1N73A 2WPQA 1L0ND 3ABVC 4U3FG 1YQ4C 1LTJA 4WVZA 2G8YA 4UB8E 4JYCA 4IOIH 1S5LE 4C7NA 1OXZA 3HUSC 3S4RA 5AW6B 1AVOA 3TYYA 2PGDA 1LTBC 5APXA 1A02J 4L75A 1FAVA 2R5BA 2M8RA 2KOGA 2JJLA 3FXDA 2WT7B 4HJGH 1SQXK 2HR3A 3V2NA 4UB6E 3CCUP 3CMAP 4B86A 3HUSA 3VMAA 3KXDA 1AQTA 4BWNA 2J58A 3IF4A 1JTHB 5AVUB 2GUVA 1WMKA 4OGQD 3TNUB 2K3RA 1BCCD 4A7PA 2OYHC 1L0LK 2FYNC 3VTPC 1AQ5A 3L71D 1H88A 4JYBA 2B87A 3M91A 1W2EA 4PD4D 2QM8A 2QA4P 1HGZA 2OYHA 2RN0A 1IFMA 3TK1A 4ZKPA 2JDIH 1N7SD 3BCCJ 4PD4H 1VQ9P 1RF0C 2QRXA 1DD3A 2E74B 3EFGA 1EDIA 2NPSD 3L4FA 3V2PA 3SWYA 1FS0E 3RK2D 2YKOA 3II6A 3CX5E 2O01N 5AVRB 3H1KE 4EDFA 2WSSH 1BE3D 2Q3EA 2WSEH 3O6QA 1JMBA 1RF0A 2BEZF 1LT1A 3L35A 3TGUJ 1NTMK 1QL2A 5H2FH 2ZVOB 1NAFA 2ZYDA 3H1KG 3CWBD 1URQD 3A5TA 1SQXJ 3I55P 3BRTB 3EWKA 2M5AB 1SFCD 1OMIA 2IZ1A 3GHGA 1NWQA 1EZVE 1RE4C 1M1KQ 5KLVE 2E75D 1FZFA 3V2QA 2XZRA 1PP9J 1EZVG 1L0LJ 1LTAC 2M3EA 1JY3P 1G2CB 1NVOA 2YO2A 1ZN5A 3TF5A 2Z5IA 3D71A 3H1JE 1FZEA 1JMMA 4H44D 1RE4A 2XU6A 5B66E 1Q7YQ 3BASA 1GL2C 3VMYA 2XV5A 1VF5C 5AW4B 4D6TE 2N1TB 3GW6A 2HODA 1W2BO 2R32A 5CCHA 1CSBA 1SQVD 4D6TG 1J1EC 4HH2A 4L74A 1L0NK 1GL2A 3OJAB 1JO5A 2WVRA 1VQMP 4RO0A 1J1DB 3O8ZA 3W68A 1NU1D 3AEBC 1FC2C 1T3JA 5APSA 3FGAD 1N73B 2AXTE 4H13B 3RK3C 2IBZD 1QGKB 1NTKE 3V4QA 3CD6P 2O1KA 1HVVA 1KQLA 1LTJB 1FDIA 2K88A 3B5NC 4BXLA 2POHA 2H43A 1PPJD 1LNQA 1NTKG 3CXHE 3P32A 4C7NB 2KNCA 3IR9A 2DW3A 4OH8B 3JCUH 4DCKA 1SQQJ 3B5NA 5KJ7C 3CC7P 1HH0A 1DEBA 3MUDC 1Q81Q 1SQBJ 3H1LG 1ZR2A 4C7RA 1PIXA 1MFTA 3L37A 4AUWA 3P8CD 1FJKA 1DX7A 2B9BA 3FXEA 1JY2O 1X22A 1HWTC 5KJ7A 4PV1D 2FY8A 3MUDA 2JWAA 1GU4A 2QE7H 1RF1B 2W6BA 2B87B 4TLFA 3V6IA 1DH3A 3BCCD 2YIUC 4EYYQ 1K73Q 1P84E 1OVUA 1S9KE 2JKVA 1PGJA 1OVVA 4IFMA 5AW0B 1Y9BA 4EIJA 5AW9B 3BRVB 2WT7A 1Y8AA 3TGUD 1OW6A 1NTZE 3O6QB 1KC8Q 1JTHA 1SQXD 2QVAA 3A0HH 3VOPA 4Y28J 3AE7C 4WBAA 3VMZA 3CCEP 3CCLP 4WY4D 4DT0A 2FXMA 2W83C 3GHGB 1BGYJ 2MKVA 1PP9D 2K9JA 1L0LD 3PLNA 3CX5I 2IFNA 3V5BA 1G1JA 2V4HA 3PHLA 2BASA 4RKUJ 2D2CB 2WSFJ 4JF7A 2OQQA 1NHLA 2QM7A 4GOEA 1GTWA 3U1AA 1VPCA 1PL5A 1SQPE 1L4AD 2LXCB 1YHQP 1SQVK 3Q5PA 1EZVI 1SQPG 1ZLLA 2HODB 2GA1A 1Q2NA 3S9OA 5DJTB 3Q1MA 1GL2B 4H0LD 2PFXA 3H1HE 1VF5B 1IK9A 1SS1A 3D70A 2JR8A 2Q9IA 2P67A 3AEEC 1KILD 1KQFB 1NTME 1J1EB 3MD0A 2OARA 3IN6A 3H1IG 3L72D 3NMDA 1SLQA 3L74E 3MTUE 1XTGB 2I1JA 4I6MC 1NTMG 2XNXA 1FZBA 3A0BH 4QMAA 1G2CA 2KNCB 5AW8B 2BEQD 4WWIA 1FOSF 3WMM0 2N1TC 3N4XA 5KLVJ 3L74G 1ZR4A 1K05A 1X9VA 5AVWB 3B5NB 2V7QJ 1RY3A 1E5WA 2OTLP 4ZMDA 1DIPA 1J1DC 1KB9E 2H8PD 4R4MA 3H1JJ 5APYA 2N1TA 1N73C 1HUCA 3WU2E 2LXBA 4IL6E 2WZ7A 1TU3F 1KQGB 3AE2C 3KZIE 1NKZB 2O01J 3AE6C 3H6PA 3CXHI 2CPSA 1IZNB 2Y9ZA 2A45H 3KQGA 1FU1A 3N7NA 2YMKA 2QIWA 2KSJA 1ZRTD 4WB4A 1IO4A 2ZT9D 3R4YA 1YTZI 3PTZA 3D6YA 3PJSK 4L76A 1HJBA 3G6EP 1NTKJ 3BVHA 2KLUA 1OX3A 2PAJA 1EDKA 1JEKA 2ZYAA 4YPCA 2J5UA 1RH5B 2YIUB 3PRJA 4LGDE 2SPZA 1VQOP 3B8EB 4UB8H 4KHXA 2K37A 2WITA 1M1JA 4H13D 2KI7B 1RQUA 1IFNA 3MIWA 1JY3O 1RF1C 3G9RA 4XE5B 1KQSO 1P84I 1S3JA 1KYOD 3F5HA 2IYPA 3RK2C 4Z1MH 4UB6H 2C9LY 1QX8A 4AQRD 3C9IA 2H88C 2B89A 2ZXEB 1BGYD 5APWA 2XKMA 1RF1A 1KYOH 2FYUJ 4LC1A 3UIAA 3LIEA 4I1LA 3L71E 2K9JB 1FOSE 1OZHA 1LWUC 1T3UA 2W6AA 1BCCG 5BU8B 2VRSA 1URQC 1T2KC 1MV8A 3L71G 1RHZB 3M0AA 4PJ0H 2C0XA 1BSHA 5KKZB 1HBWA 1JCCA 1VQ7P 5CMZA 1S2EA 4N3YB
chains in the Genus database with same CATH topology
1LTJB 3TNUA 1MZ9A 2WSFH 2GUSA 3B5NC 1HTLC 1LWUA 1FBMA 1URQA 2POHA 2H43A 4Y99B 3IFMA 1LT9C 3M9HA 3HRNA 2FFDC 3NXSA 3P32A 4C7NB 3IR9A 1NO4A 2YO3A 2IFMA 3V2RA 4OH8B 2R5DA 3GHGC 2KB7P 3RL0D 2A45G 3B5NA 3HD7B 5KJ7C 5BU5A 1G1IA 1HH0A 2P2UA 1LT9A 1DEBA 1JCDA 1LTIC 1ZR2A 2FFDA 4C7RA 2N1TD 5AW5B 2WSCH 1M1JC 1VDFA 3L37A 4AUWA 1JY2P 1FZAA 2R3CA 3P8CD 1ZV8A 1FJKA 5AW1B 1DX7A 4AYCA 1SQQK 1JY2O 3H32B 3MGNA 3VMXA 1HWTC 5KJ7A 1LTSC 1FZCC 3A7OA 3MUDA 1GU4A 4GKGA 1XTCC 2N9BA 1SQBK 3HTKB 2M3BA 1IJDB 4W7ZA 1NTZK 1IC2A 4I2LC 1N7SC 1NU1K 1RF1B 1GW3A 2W6BA 4WY4B 5AVSB 1X79B 5CCHC 1DH3A 2O1JA 5CCGD 2Q5UA 1FZCA 1CW5A 3RL0B 1FDMA 2NPSC 2HPCB 1KZUB 2IPPA 1GZLA 1S9KE 5AW3B 1Z56A 2KLVA 1N7SA 5AVZB 4XA4A 4ZKUA 2WTYA 4GIFA 4IFMA 3HD7D 5AW0B 4EIJA 1H8AA 2YNYA 2NPSA 5AW9B 3BRVB 2PP6A 2WT7A 5APQA 3VYIA 2O01H 3L36A 1L4AB 3VP9A 4IFFA 3U59A 2JEEA 2IX7C 3RK3B 2MJZA 1T8ZA 1JTHA 1NH4A 1N7LA 5AW2B 3VN0A 1SFCC 1SQPK 2I1KA 3VOPA 2GM4A 4WBAA 2WPSA 1H89A 1IFDA 3VMZA 1AFOA 2J59M 3NTNA 2Q3IA 2HFED 3KYQA 4O9BA 1MFZA 3G3ZA 4WY4D 2HYNA 2W27A 5AVQB 1A02F 1LGHB 2FXMA 2E43A 3GHGB 1LTTC 1KILB 2OYIC 4N6JA 1SFCA 4W7YA 1GK6A 1LTJC 3EQ2A 4DZOA 5AW7B 2IFNA 3V5BA 1GDTA 1G1JA 3HE4A 4Y99C 1M7LA 4C46A 1JUNA 1M1JB 3T97A 1CI6A 3V4WA 1NKNA 2BASA 2C0WA 3U1CA 3LW5H 1N73A 1CZQA 2WPQA 5AVXB 2OYIA 4JF7A 1NHLA 2QM7A 1LTJA 1FZCB 1GTWA 4N78D 3U1AA 1VPCA 3VP8A 1T2KD 3HD7C 3SWFA 1L4AD 5APVA 4JYCA 1SQVK 3BATA 3RK3D 4C7NA 1OXZA 3HUSC 4M3LA 2C9NY 1N7SB 5AW6B 3TYYA 1LTBC 1ZLLA 2HODB 5APXA 1A02J 1FAVA 2R5BA 2M8RA 3HD7A 2KOGA 2NPSB 2JJLA 1GL2B 5CJ0A 2WT7B 3HE5A 1SQXK 1JY3N 3RK2B 3V2NA 1IK9A 4IFDK 4RESB 4B86A 3HUSA 2HG5D 1NOHA 1X8YA 2WPRA 2J58A 2Q9IA 2P67A 1KILD 1JTHB 5KJ7D 2FKWB 5AVUB 2GUVA 1J1EB 3H32A 3MD0A 3TNUB 2OARA 1LWUB 3NMDA 3RL0C 1SLQA 1URQB 3MTUE 1XTGB 2I1JA 4I6MC 2OYHC 3HTKA 1L0LK 2XNXA 3CI9A 1FZBA 4EOTA 1G2CA 1AQ5A 3VTPC 1H88A 1WRGA 5AW8B 1FOSF 1N2DC 4JYBA 2N1TC 2YKQA 3N4XA 3WMM0 1ZR4A 5APUA 1SFCB 3M91A 1J2JB 1WT6A 1W2EA 1X9VA 3A2AA 2L5GB 3B5NB 1RY3A 3P8MC 2QM8A 5AVWB 1HGZA 2HPCA 1E5WA 1GW4A 5BVZA 2OYHA 1LT9B 1SVFA 1IFMA 3TK1A 1J1DC 4ZKPA 1FJPA 1L4AC 2FFDB 2H8PD 1N7SD 3NFQA 1IFJA 5AVYB 4LLHA 5APYA 2N1TA 1RF0C 1LTGC 1N73C 5CCHD 5KLVK 1HGVA 1HUCA 1KFMA 3EFGA 1RE3C 2NPSD 3L4FA 2WZ7A 3V2PA 1GL2D 3SWYA 1NKZB 3RK2D 3OA7A 1GD2E 2YKOA 3TSIA 1FZGA 3H6PA 3M06A 3KPEA 2A45I 5CCGC 2CPSA 3II6A 1L4AA 1MUUA 3CL3D 5AVRB 2YMYA 3M9BA 2A45H 2WSEH 1JNMA 1RF0A 3L35A 3KQGA 1FU1A 4HYTB 1NTMK 3N7NA 1QL2A 2E42A 1RE3A 1KILC 1NAFA 2YKPA 2CPBA 2KSJA 1URQD 3A5TA 4WB4A 1IO4A 3HE5B 3P8CE 5CCGA 3KDPB 1N86A 1YTZI 3BRTB 2P7JA 3HUSB 1JY2N 2HLOA 4N78E 3I5CA 1KFNA 2Z5HA 1HJBA 1SFCD 2XDJA 3GHGA 1NWQA 1PFIA 3BVHA 1RE4C 1KILA 5KTBA 3B5ND 2PAJA 4W80A 1FZFA 1QL1A 3P7KA 4LGDE 3V2QA 2XZRA 3B8EB 3M9QA 4KHXA 5AVTB 2H7HA 1LTAC 2WITA 1JY3P 1G2CB 1M1JA 4GT1A 2YO2A 3R2PA 1EQ7A 1ZN5A 3PP5A 1YYCA 3M0DC 1IFNA 2Z5IA 3MIWA 1FZEA 1JY3O 1JMMA 4DOJA 1NTKK 1RE4A 2XU6A 1RF1C 4WY4C 5CHXA 1OWAA 3OAKA 3BASA 1S9KD 2FYZA 4XE5B 1GL2C 2OYHB 1GU5A 3RK2C 2P1JA 2C9LY 3VMYA 2XV5A 5AVVB 1GK4A 5AW4B 4AQRD 2KYVA 3C9IA 2ZXEB 3E1IA 3M0DA 5APWA 2N1TB 2XKMA 2KP8A 1RF1A 2HODA 4WY4A 2R32A 1SP4A 1YTZT 4LC1A 3UIAA 5CCHA 1CSBA 2ZFCA 3LIEA 4I1LA 1J1EC 2LKMA 4HH2A 1IFIA 1FOSE 1L0NK 1GL2A 3OJAB 1JO5A 1LWUC 1T3UA 2W6AA 5BU8B 3A3YB 1J1DB 1URQC 2VRSA 2WWWA 3HE4B 1T2KC 5CJ4A 3O8ZA 1MV8A 3CLQA 1HVVA 3LIDA 1JOCA 1CI6B 3M0AA 1T3JA 2C0XA 5APSA 1HBWA 1N73B 2Z4EA 3RK3C 1JCCA 5CMZA 2Q7CA 2OYIB 2FYUK 5APTA 3V4QA 2O1KA 4N3YB 1KQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKM A;  1SQP K;  2WSF H;  2OAR A;  1L0N K;  1SQX K;  3M9Q A;  1SQV K;  2O01 H;  2J59 M;  1SQB K;  1L0L K;  3CLQ A;  4IFD K;  1NTZ K;  2WSC H;  2WSE H;  3G3Z A;  3LW5 H;  1NU1 K;  5KLV K;  1NTM K;  1NTK K;  2FYU K;  1SQQ K; 
#chains in the Genus database with same CATH topology
 2WSF H;  1HTL C;  3AEF C;  1PGP A;  1LWU A;  4XFJ A;  1URQ A;  3C1L A;  3IFM A;  1LT9 C;  3M9H A;  4R4L A;  2W8Z A;  1KMI Z;  5TIS E;  2FFD C;  3CCM P;  4U7J A;  3CPW O;  2YO3 A;  3V2R A;  5H2F E;  2R5D A;  1QEX A;  1RQV A;  3GHG C;  2ZVN B;  1EXJ A;  2PRR A;  1NAY A;  2P2U A;  4OVN F;  1LT9 A;  2CK3 H;  2Y0C A;  3CCS P;  3CX5 H;  5B5E E;  2ZYG A;  2FFD A;  1NTZ J;  5AW5 B;  3E7K A;  3CWB E;  1FZA A;  3CCR P;  1SQQ K;  2D2C C;  3VMX A;  3CWB G;  4OWF A;  5EFW B;  1LTS C;  2KK7 A;  3CC2 P;  1EZV D;  4GKG A;  5KLV D;  1SQB K;  2M3B A;  2N9Y B;  5KAF E;  1IJD B;  2WQY C;  2R44 A;  4I2L C;  3RL0 g;  3L70 J;  4HKZ H;  3L75 D;  5CCH C;  1M56 D;  1CW5 A;  2AEJ A;  1FDM A;  3H1J D;  1KZU B;  2V7Q H;  2IPP A;  3Q5S A;  3L73 J;  5AW3 B;  5AVZ B;  4XA4 A;  2RKL A;  2WTY A;  5B66 H;  3HD7 D;  3GMA A;  2A06 E;  1ZP0 C;  1SQP J;  1H0T A;  5L8R J;  1H8A A;  2YNY A;  1S5L X;  2PP6 A;  2O01 H;  3U59 A;  2A06 G;  3QWO C;  1NU1 E;  3D6Z A;  1N7L A;  3H1H J;  1KB9 I;  2WMM A;  2WPS A;  1H89 A;  4PV1 C;  3NTN A;  2IBZ E;  1NU1 G;  1BDD A;  1NTK D;  2QJP C;  2HFE D;  3CCQ P;  2KZJ A;  1YIJ P;  3G3Z A;  2HYN A;  2W27 A;  2AXT H;  1PPJ E;  3AEG C;  2IBZ G;  1K8A Q;  3H1L E;  1JM0 A;  4W7Y A;  1JB0 J;  2H89 C;  3L74 J;  4DZO A;  4OGQ B;  3K5B A;  1OVR A;  1PPJ G;  4Y99 C;  4HB1 A;  1VL2 A;  1T6A A;  1M1J B;  3CXH H;  5AVX B;  5GTH E;  1VQ8 P;  5KLI C;  1FZC B;  1FE6 A;  4N78 D;  3VP8 A;  1BSN A;  1IFP A;  5APV A;  2BCC J;  2FYU D;  1EC5 A;  3RK3 D;  1N7S B;  3W67 A;  3TDK A;  4DJG A;  2E5Y A;  1U57 A;  1UIX A;  2NPS B;  4U3F J;  3RK2 B;  2OYO A;  1S72 P;  4IFD K;  4RES B;  1S1C X;  1NOH A;  3BCC E;  2KXP B;  2P10 A;  2E5T A;  5KJ7 D;  3PH0 A;  1KD1 Q;  2OTJ P;  3BCC G;  1LWU B;  3RL0 C;  1URQ B;  1VQN P;  1P84 H;  3CI9 A;  1ZOY C;  1WRG A;  1N2D C;  2YKQ A;  2M0B A;  1M90 Q;  5APU A;  3GF7 A;  1SFC B;  3A0H E;  2K9Y A;  4YXW H;  1WT6 A;  1NTZ D;  2W6J H;  2NZ2 A;  2HPC A;  5BVZ A;  1VQP P;  1LT9 B;  4PD4 I;  4YTP C;  1SQX E;  1KOR A;  3TGU G;  1FJP A;  1L4A C;  1OW7 A;  2FFD B;  3NFQ A;  5CBO A;  5AVY B;  4LLH A;  5KKZ C;  5GTI E;  5KLV K;  2O3J A;  1HGV A;  1KFM A;  1OW8 A;  1SQX G;  3FX0 A;  4H44 B;  3B71 A;  5M1B A;  3OA7 A;  1GD2 E;  1FZG A;  3KPE A;  5CCG C;  4H0L C;  1L4A A;  3CL3 D;  2YMY A;  1L0L E;  4CPG A;  3L70 D;  1JNM A;  2JP3 A;  3F89 A;  1DEE G;  2E42 A;  1KIL C;  1L0L G;  3L73 D;  1Y47 A;  1KTM A;  3HE5 B;  1EXI A;  5CCG A;  3JSV C;  2P7J A;  1JY2 N;  2HLO A;  2KSE A;  3AE1 C;  2KS1 B;  1SQP D;  2Z5H A;  1KIL A;  2E76 C;  1FDO A;  4W80 A;  1H0T B;  2NRG A;  4BRY A;  1QL1 A;  3M9Q A;  1QVG O;  2H7H A;  3H1K J;  4GT1 A;  3R2P A;  5KAI E;  1EQ7 A;  2R3S A;  3H1I E;  2E74 D;  3H1H D;  2W90 A;  1NTK K;  3ZDM A;  2Y0E A;  1OWA A;  1D7M A;  2FYZ A;  1ZME C;  2FXP A;  1KIL E;  2P1J A;  1N8R Q;  3CWB J;  2KYV A;  3SWK A;  5E79 H;  3E1I A;  1SQQ D;  3L72 E;  4NPD A;  4NPF X;  1VQ5 P;  1SP4 A;  1YTZ T;  2UWJ E;  3CCV P;  1SQB D;  1L2P A;  2LKM A;  3L72 G;  3AED C;  3A3Y B;  4PV1 B;  2QJP B;  2ZT9 C;  3CLQ A;  3AE9 C;  3LID A;  1JOC A;  3WUU A;  1USE A;  2Z4E A;  2Q7C A;  2FYU K;  5APT A;  2YXR B;  1MZ9 A;  2BCC D;  2IBZ I;  2QJK C;  1FBM A;  2ITA A;  4Y99 B;  1HJ0 A;  4D6T J;  2JWD A;  2IYO A;  3HRN A;  3IAO A;  4RJT A;  2QSI A;  3RBZ A;  3FWN A;  4U3F D;  5KLI B;  3WU2 H;  4IL6 H;  2KB7 P;  2A45 G;  2QG4 A;  3KZI H;  3CME P;  2FXO A;  4OGQ C;  1L0N E;  2KUB A;  2N1T D;  2WSC H;  1M1J C;  1ZRT E;  2R3C A;  1NU1 J;  1L0N G;  1LP1 A;  1PGO A;  4AYC A;  2ZXX A;  1FZC C;  2N9B A;  1NTZ K;  1S5L H;  1NGM B;  1IC2 A;  1N7S C;  1GW3 A;  3H1L J;  4WY4 B;  3S1K A;  1VQK P;  5AVS B;  1EDJ A;  2B88 A;  3Q3D A;  2O1J A;  2Q5U A;  1FZC A;  3RL0 B;  2NPS C;  2HPC B;  3CCJ P;  1GZL A;  1PZQ A;  1Z56 A;  2KLV A;  1N7S A;  1KYO E;  1BCC E;  1EDL A;  4L73 A;  2QJY B;  2RH0 A;  1BGY E;  2RMZ A;  2NPS A;  5APQ A;  1VQ4 P;  3L36 A;  1L4A B;  3VP9 A;  4IFF A;  2JEE A;  3I56 P;  4PJ0 E;  1BGY G;  1X0T A;  4PD4 E;  2IX7 C;  2XND H;  1T8Z A;  1ZXG A;  1SFC C;  1SQP K;  2I1K A;  2GM4 A;  2E75 C;  2JO1 A;  1IFD A;  4H0L B;  1AFO A;  2J59 M;  4O9B A;  1MFZ A;  1A02 F;  1LGH B;  4ASV A;  1S4X A;  1KIL B;  3CX5 D;  2OYI C;  4N6J A;  1SFC A;  1E79 H;  3H1K D;  4H44 C;  1BE3 E;  3EQ2 A;  4BRY B;  5AW7 B;  1U7J A;  3HE4 A;  1M7L A;  4MN4 C;  3RGU A;  4C46 A;  1JUN A;  3Q2Y A;  5TIS H;  3T97 A;  1CI6 A;  3V4W A;  1NKN A;  1BE3 G;  2FBW C;  1CZQ A;  1YIT P;  3USS A;  2OYI A;  2E76 B;  3MP7 B;  1T2K D;  3HD7 C;  3SWF A;  3EFF K;  4ASW A;  3BAT A;  5B5E H;  1OIP A;  1AVY A;  4M3L A;  2C9N Y;  4IL6 X;  2I8D A;  3B4S A;  3MZW B;  3HD7 A;  2G3A A;  5CJ0 A;  2LR2 A;  3HE5 A;  1JY3 N;  3AEA C;  5DJU B;  1MKM A;  5KLV G;  1R5L A;  3L75 E;  5KAF H;  1LJ2 A;  3CC4 P;  1BDC A;  2HG5 D;  1X8Y A;  2KS1 A;  2WPR A;  2FKW B;  3L75 G;  3H32 A;  4D6T D;  4K3A A;  2OGU A;  3H1J G;  4EI2 A;  4JQ0 D;  5CBN A;  4TT3 H;  2ZT9 B;  3HTK A;  4EOT A;  2A06 D;  1SQV E;  2Y9Y A;  1UII A;  2Q6Q A;  2D2C D;  1YI2 P;  3GG2 A;  1IK7 A;  1Q90 D;  1YJW P;  1SQV G;  1J2J B;  3A2A A;  2L5G B;  3P8M C;  4I7Z B;  2QJK B;  1GW4 A;  5K5G B;  1SVF A;  3H1I J;  1IFJ A;  4GOF A;  2ZAE B;  2L91 A;  1LTG C;  2Q1K A;  5CCH D;  1NTM J;  3JCU E;  4KJM A;  1LP1 B;  1RE3 C;  1GL2 D;  3CXH D;  2WPV B;  3TSI A;  1VF5 D;  3M06 A;  2A45 I;  1MUU A;  3H1L D;  2K1A A;  3L72 J;  3M9B A;  3H25 A;  4HYT B;  3G4S P;  3E1R A;  1Q82 Q;  1K04 A;  1M57 D;  1RE3 A;  2YKP A;  1U7M A;  4JBZ A;  2CPB A;  2QEX P;  3P8C E;  1QLE D;  3KDP B;  1N86 A;  3HUS B;  3AE5 C;  4N78 E;  3SFE C;  3I5C A;  1KFN A;  2XDJ A;  2ZJS E;  1PFI A;  5KTB A;  3B5N D;  2FYU E;  5GTH H;  3RK3 E;  4ZNC A;  3P7K A;  5AVT B;  2WSC J;  2FYU G;  3LW5 J;  1W5C E;  2AEF A;  3PP5 A;  1YYC A;  3M0D C;  3ITK A;  4DOJ A;  3WUT A;  1YJ9 P;  5TJH A;  4WY4 C;  1P84 D;  5CHX A;  3OAK A;  1S9K D;  1L0N J;  2OYH B;  1GU5 A;  3OW2 O;  2YXQ B;  5AVV B;  2FYN B;  1GK4 A;  1KYO I;  3M0D A;  2IDB A;  2KP8 A;  1NJI Q;  4WY4 A;  3GF3 A;  2ZFC A;  3TGU E;  2QJY C;  3RBX A;  1IFI A;  2E75 B;  2WWW A;  3HE4 B;  1AJY A;  4JPZ B;  5CJ4 A;  3T97 B;  5C39 A;  1CI6 B;  2AXC A;  2OYI B;  3TNU A;  1NTZ G;  2GUS A;  4NPE A;  1PP9 E;  3NXS A;  1BCC J;  1NO4 A;  2IFM A;  5GTI H;  4GOD A;  3L71 J;  2E74 C;  2P58 A;  3RL0 D;  1PP9 G;  3HD7 B;  3L70 E;  5BU5 A;  4K35 A;  1G1I A;  3SSU A;  4YXD C;  3AE3 C;  1JCD A;  1LTI C;  4KT0 J;  3L73 E;  3L70 G;  1VDF A;  2KZI A;  1JY2 P;  1YBK A;  2Y0D A;  1ZV8 A;  5AW1 B;  1OFC X;  1QVF O;  3H32 B;  3MGN A;  3L73 G;  3A7O A;  3GLM A;  1YJN P;  1R8E A;  1XTC C;  1AV1 A;  3HTK B;  2WSE J;  4W7Z A;  1NYH A;  1PGQ A;  1GMJ A;  1NU1 K;  3WUV A;  1BE3 J;  1X79 B;  1HF9 A;  5CCG D;  3H1I D;  3QH9 A;  3JC2 2;  4GDO A;  1USD A;  1NTM D;  3A0B E;  5E79 E;  5KAI H;  1K9M Q;  1KN7 A;  3H1H G;  2AEM A;  2M5A A;  3L74 D;  4ZKU A;  4GIF A;  1VQL P;  1SQQ E;  3MHV A;  3SFD C;  1AA0 A;  3AE8 C;  3KHU A;  3C8V A;  3VYI A;  1SQB E;  1YQ3 C;  1SQQ G;  2IZ0 A;  3RK3 B;  2E76 D;  2MJZ A;  1M8O B;  1KB9 D;  1NH4 A;  5AW2 B;  2OTK E;  3VN0 A;  1ZW0 A;  1SQB G;  3G71 P;  4I7Z C;  1Q86 Q;  3L75 J;  1KV4 A;  2Q3I A;  1KB9 H;  3KYQ A;  2BCC E;  5AVQ B;  3AE4 C;  4H13 C;  2E43 A;  3FWL A;  1LTT C;  1DD4 A;  1R5S A;  1GK6 A;  2KIK A;  3AEC C;  1LTJ C;  2BCC G;  1PV3 A;  1GDT A;  1SQV J;  3Q5R A;  4U3F E;  1VQ6 P;  3U1C A;  2C0W A;  3LW5 H;  1N73 A;  2WPQ A;  1L0N D;  3ABV C;  4U3F G;  1YQ4 C;  1LTJ A;  4WVZ A;  2G8Y A;  4UB8 E;  4JYC A;  4IOI H;  1S5L E;  4C7N A;  1OXZ A;  3HUS C;  3S4R A;  5AW6 B;  1AVO A;  3TYY A;  2PGD A;  1LTB C;  5APX A;  1A02 J;  4L75 A;  1FAV A;  2R5B A;  2M8R A;  2KOG A;  2JJL A;  3FXD A;  2WT7 B;  4HJG H;  1SQX K;  2HR3 A;  3V2N A;  4UB6 E;  3CCU P;  3CMA P;  4B86 A;  3HUS A;  3VMA A;  3KXD A;  1AQT A;  4BWN A;  2J58 A;  3IF4 A;  1JTH B;  5AVU B;  2GUV A;  1WMK A;  4OGQ D;  3TNU B;  2K3R A;  1BCC D;  4A7P A;  2OYH C;  1L0L K;  2FYN C;  3VTP C;  1AQ5 A;  3L71 D;  1H88 A;  4JYB A;  2B87 A;  3M91 A;  1W2E A;  4PD4 D;  2QM8 A;  2QA4 P;  1HGZ A;  2OYH A;  2RN0 A;  1IFM A;  3TK1 A;  4ZKP A;  2JDI H;  1N7S D;  3BCC J;  4PD4 H;  1VQ9 P;  1RF0 C;  2QRX A;  1DD3 A;  2E74 B;  3EFG A;  1EDI A;  2NPS D;  3L4F A;  3V2P A;  3SWY A;  1FS0 E;  3RK2 D;  2YKO A;  3II6 A;  3CX5 E;  2O01 N;  5AVR B;  3H1K E;  4EDF A;  2WSS H;  1BE3 D;  2Q3E A;  2WSE H;  3O6Q A;  1JMB A;  1RF0 A;  2BEZ F;  1LT1 A;  3L35 A;  3TGU J;  1NTM K;  1QL2 A;  5H2F H;  2ZVO B;  1NAF A;  2ZYD A;  3H1K G;  3CWB D;  1URQ D;  3A5T A;  1SQX J;  3I55 P;  3BRT B;  3EWK A;  2M5A B;  1SFC D;  1OMI A;  2IZ1 A;  3GHG A;  1NWQ A;  1EZV E;  1RE4 C;  1M1K Q;  5KLV E;  2E75 D;  1FZF A;  3V2Q A;  2XZR A;  1PP9 J;  1EZV G;  1L0L J;  1LTA C;  2M3E A;  1JY3 P;  1G2C B;  1NVO A;  2YO2 A;  1ZN5 A;  3TF5 A;  2Z5I A;  3D71 A;  3H1J E;  1FZE A;  1JMM A;  4H44 D;  1RE4 A;  2XU6 A;  5B66 E;  1Q7Y Q;  3BAS A;  1GL2 C;  3VMY A;  2XV5 A;  1VF5 C;  5AW4 B;  4D6T E;  2N1T B;  3GW6 A;  2HOD A;  1W2B O;  2R32 A;  5CCH A;  1CSB A;  1SQV D;  4D6T G;  1J1E C;  4HH2 A;  4L74 A;  1L0N K;  1GL2 A;  3OJA B;  1JO5 A;  2WVR A;  1VQM P;  4RO0 A;  1J1D B;  3O8Z A;  3W68 A;  1NU1 D;  3AEB C;  1FC2 C;  1T3J A;  5APS A;  3FGA D;  1N73 B;  2AXT E;  4H13 B;  3RK3 C;  2IBZ D;  1QGK B;  1NTK E;  3V4Q A;  3CD6 P;  2O1K A;  1HVV A;  1KQL A;  1LTJ B;  1FDI A;  2K88 A;  3B5N C;  4BXL A;  2POH A;  2H43 A;  1PPJ D;  1LNQ A;  1NTK G;  3CXH E;  3P32 A;  4C7N B;  2KNC A;  3IR9 A;  2DW3 A;  4OH8 B;  3JCU H;  4DCK A;  1SQQ J;  3B5N A;  5KJ7 C;  3CC7 P;  1HH0 A;  1DEB A;  3MUD C;  1Q81 Q;  1SQB J;  3H1L G;  1ZR2 A;  4C7R A;  1PIX A;  1MFT A;  3L37 A;  4AUW A;  3P8C D;  1FJK A;  1DX7 A;  2B9B A;  3FXE A;  1JY2 O;  1X22 A;  1HWT C;  5KJ7 A;  4PV1 D;  2FY8 A;  3MUD A;  2JWA A;  1GU4 A;  2QE7 H;  1RF1 B;  2W6B A;  2B87 B;  4TLF A;  3V6I A;  1DH3 A;  3BCC D;  2YIU C;  4EYY Q;  1K73 Q;  1P84 E;  1OVU A;  1S9K E;  2JKV A;  1PGJ A;  1OVV A;  4IFM A;  5AW0 B;  1Y9B A;  4EIJ A;  5AW9 B;  3BRV B;  2WT7 A;  1Y8A A;  3TGU D;  1OW6 A;  1NTZ E;  3O6Q B;  1KC8 Q;  1JTH A;  1SQX D;  2QVA A;  3A0H H;  3VOP A;  4Y28 J;  3AE7 C;  4WBA A;  3VMZ A;  3CCE P;  3CCL P;  4WY4 D;  4DT0 A;  2FXM A;  2W83 C;  3GHG B;  1BGY J;  2MKV A;  1PP9 D;  2K9J A;  1L0L D;  3PLN A;  3CX5 I;  2IFN A;  3V5B A;  1G1J A;  2V4H A;  3PHL A;  2BAS A;  4RKU J;  2D2C B;  2WSF J;  4JF7 A;  2OQQ A;  1NHL A;  2QM7 A;  4GOE A;  1GTW A;  3U1A A;  1VPC A;  1PL5 A;  1SQP E;  1L4A D;  2LXC B;  1YHQ P;  1SQV K;  3Q5P A;  1EZV I;  1SQP G;  1ZLL A;  2HOD B;  2GA1 A;  1Q2N A;  3S9O A;  5DJT B;  3Q1M A;  1GL2 B;  4H0L D;  2PFX A;  3H1H E;  1VF5 B;  1IK9 A;  1SS1 A;  3D70 A;  2JR8 A;  2Q9I A;  2P67 A;  3AEE C;  1KIL D;  1KQF B;  1NTM E;  1J1E B;  3MD0 A;  2OAR A;  3IN6 A;  3H1I G;  3L72 D;  3NMD A;  1SLQ A;  3L74 E;  3MTU E;  1XTG B;  2I1J A;  4I6M C;  1NTM G;  2XNX A;  1FZB A;  3A0B H;  4QMA A;  1G2C A;  2KNC B;  5AW8 B;  2BEQ D;  4WWI A;  1FOS F;  3WMM 0;  2N1T C;  3N4X A;  5KLV J;  3L74 G;  1ZR4 A;  1K05 A;  1X9V A;  5AVW B;  3B5N B;  2V7Q J;  1RY3 A;  1E5W A;  2OTL P;  4ZMD A;  1DIP A;  1J1D C;  1KB9 E;  2H8P D;  4R4M A;  3H1J J;  5APY A;  2N1T A;  1N73 C;  1HUC A;  3WU2 E;  2LXB A;  4IL6 E;  2WZ7 A;  1TU3 F;  1KQG B;  3AE2 C;  3KZI E;  1NKZ B;  2O01 J;  3AE6 C;  3H6P A;  3CXH I;  2CPS A;  1IZN B;  2Y9Z A;  2A45 H;  3KQG A;  1FU1 A;  3N7N A;  2YMK A;  2QIW A;  2KSJ A;  1ZRT D;  4WB4 A;  1IO4 A;  2ZT9 D;  3R4Y A;  1YTZ I;  3PTZ A;  3D6Y A;  3PJS K;  4L76 A;  1HJB A;  3G6E P;  1NTK J;  3BVH A;  2KLU A;  1OX3 A;  2PAJ A;  1EDK A;  1JEK A;  2ZYA A;  4YPC A;  2J5U A;  1RH5 B;  2YIU B;  3PRJ A;  4LGD E;  2SPZ A;  1VQO P;  3B8E B;  4UB8 H;  4KHX A;  2K37 A;  2WIT A;  1M1J A;  4H13 D;  2KI7 B;  1RQU A;  1IFN A;  3MIW A;  1JY3 O;  1RF1 C;  3G9R A;  4XE5 B;  1KQS O;  1P84 I;  1S3J A;  1KYO D;  3F5H A;  2IYP A;  3RK2 C;  4Z1M H;  4UB6 H;  2C9L Y;  1QX8 A;  4AQR D;  3C9I A;  2H88 C;  2B89 A;  2ZXE B;  1BGY D;  5APW A;  2XKM A;  1RF1 A;  1KYO H;  2FYU J;  4LC1 A;  3UIA A;  3LIE A;  4I1L A;  3L71 E;  2K9J B;  1FOS E;  1OZH A;  1LWU C;  1T3U A;  2W6A A;  1BCC G;  5BU8 B;  2VRS A;  1URQ C;  1T2K C;  1MV8 A;  3L71 G;  1RHZ B;  3M0A A;  4PJ0 H;  2C0X A;  1BSH A;  5KKZ B;  1HBW A;  1JCC A;  1VQ7 P;  5CMZ A;  1S2E A;  4N3Y B; 
#chains in the Genus database with same CATH homology
 1LTJ B;  3TNU A;  1MZ9 A;  2WSF H;  2GUS A;  3B5N C;  1HTL C;  1LWU A;  1FBM A;  1URQ A;  2POH A;  2H43 A;  4Y99 B;  3IFM A;  1LT9 C;  3M9H A;  3HRN A;  2FFD C;  3NXS A;  3P32 A;  4C7N B;  3IR9 A;  1NO4 A;  2YO3 A;  2IFM A;  3V2R A;  4OH8 B;  2R5D A;  3GHG C;  2KB7 P;  3RL0 D;  2A45 G;  3B5N A;  3HD7 B;  5KJ7 C;  5BU5 A;  1G1I A;  1HH0 A;  2P2U A;  1LT9 A;  1DEB A;  1JCD A;  1LTI C;  1ZR2 A;  2FFD A;  4C7R A;  2N1T D;  5AW5 B;  2WSC H;  1M1J C;  1VDF A;  3L37 A;  4AUW A;  1JY2 P;  1FZA A;  2R3C A;  3P8C D;  1ZV8 A;  1FJK A;  5AW1 B;  1DX7 A;  4AYC A;  1SQQ K;  1JY2 O;  3H32 B;  3MGN A;  3VMX A;  1HWT C;  5KJ7 A;  1LTS C;  1FZC C;  3A7O A;  3MUD A;  1GU4 A;  4GKG A;  1XTC C;  2N9B A;  1SQB K;  3HTK B;  2M3B A;  1IJD B;  4W7Z A;  1NTZ K;  1IC2 A;  4I2L C;  1N7S C;  1NU1 K;  1RF1 B;  1GW3 A;  2W6B A;  4WY4 B;  5AVS B;  1X79 B;  5CCH C;  1DH3 A;  2O1J A;  5CCG D;  2Q5U A;  1FZC A;  1CW5 A;  3RL0 B;  1FDM A;  2NPS C;  2HPC B;  1KZU B;  2IPP A;  1GZL A;  1S9K E;  5AW3 B;  1Z56 A;  2KLV A;  1N7S A;  5AVZ B;  4XA4 A;  4ZKU A;  2WTY A;  4GIF A;  4IFM A;  3HD7 D;  5AW0 B;  4EIJ A;  1H8A A;  2YNY A;  2NPS A;  5AW9 B;  3BRV B;  2PP6 A;  2WT7 A;  5APQ A;  3VYI A;  2O01 H;  3L36 A;  1L4A B;  3VP9 A;  4IFF A;  3U59 A;  2JEE A;  2IX7 C;  3RK3 B;  2MJZ A;  1T8Z A;  1JTH A;  1NH4 A;  1N7L A;  5AW2 B;  3VN0 A;  1SFC C;  1SQP K;  2I1K A;  3VOP A;  2GM4 A;  4WBA A;  2WPS A;  1H89 A;  1IFD A;  3VMZ A;  1AFO A;  2J59 M;  3NTN A;  2Q3I A;  2HFE D;  3KYQ A;  4O9B A;  1MFZ A;  3G3Z A;  4WY4 D;  2HYN A;  2W27 A;  5AVQ B;  1A02 F;  1LGH B;  2FXM A;  2E43 A;  3GHG B;  1LTT C;  1KIL B;  2OYI C;  4N6J A;  1SFC A;  4W7Y A;  1GK6 A;  1LTJ C;  3EQ2 A;  4DZO A;  5AW7 B;  2IFN A;  3V5B A;  1GDT A;  1G1J A;  3HE4 A;  4Y99 C;  1M7L A;  4C46 A;  1JUN A;  1M1J B;  3T97 A;  1CI6 A;  3V4W A;  1NKN A;  2BAS A;  2C0W A;  3U1C A;  3LW5 H;  1N73 A;  1CZQ A;  2WPQ A;  5AVX B;  2OYI A;  4JF7 A;  1NHL A;  2QM7 A;  1LTJ A;  1FZC B;  1GTW A;  4N78 D;  3U1A A;  1VPC A;  3VP8 A;  1T2K D;  3HD7 C;  3SWF A;  1L4A D;  5APV A;  4JYC A;  1SQV K;  3BAT A;  3RK3 D;  4C7N A;  1OXZ A;  3HUS C;  4M3L A;  2C9N Y;  1N7S B;  5AW6 B;  3TYY A;  1LTB C;  1ZLL A;  2HOD B;  5APX A;  1A02 J;  1FAV A;  2R5B A;  2M8R A;  3HD7 A;  2KOG A;  2NPS B;  2JJL A;  1GL2 B;  5CJ0 A;  2WT7 B;  3HE5 A;  1SQX K;  1JY3 N;  3RK2 B;  3V2N A;  1IK9 A;  4IFD K;  4RES B;  4B86 A;  3HUS A;  2HG5 D;  1NOH A;  1X8Y A;  2WPR A;  2J58 A;  2Q9I A;  2P67 A;  1KIL D;  1JTH B;  5KJ7 D;  2FKW B;  5AVU B;  2GUV A;  1J1E B;  3H32 A;  3MD0 A;  3TNU B;  2OAR A;  1LWU B;  3NMD A;  3RL0 C;  1SLQ A;  1URQ B;  3MTU E;  1XTG B;  2I1J A;  4I6M C;  2OYH C;  3HTK A;  1L0L K;  2XNX A;  3CI9 A;  1FZB A;  4EOT A;  1G2C A;  1AQ5 A;  3VTP C;  1H88 A;  1WRG A;  5AW8 B;  1FOS F;  1N2D C;  4JYB A;  2N1T C;  2YKQ A;  3N4X A;  3WMM 0;  1ZR4 A;  5APU A;  1SFC B;  3M91 A;  1J2J B;  1WT6 A;  1W2E A;  1X9V A;  3A2A A;  2L5G B;  3B5N B;  1RY3 A;  3P8M C;  2QM8 A;  5AVW B;  1HGZ A;  2HPC A;  1E5W A;  1GW4 A;  5BVZ A;  2OYH A;  1LT9 B;  1SVF A;  1IFM A;  3TK1 A;  1J1D C;  4ZKP A;  1FJP A;  1L4A C;  2FFD B;  2H8P D;  1N7S D;  3NFQ A;  1IFJ A;  5AVY B;  4LLH A;  5APY A;  2N1T A;  1RF0 C;  1LTG C;  1N73 C;  5CCH D;  5KLV K;  1HGV A;  1HUC A;  1KFM A;  3EFG A;  1RE3 C;  2NPS D;  3L4F A;  2WZ7 A;  3V2P A;  1GL2 D;  3SWY A;  1NKZ B;  3RK2 D;  3OA7 A;  1GD2 E;  2YKO A;  3TSI A;  1FZG A;  3H6P A;  3M06 A;  3KPE A;  2A45 I;  5CCG C;  2CPS A;  3II6 A;  1L4A A;  1MUU A;  3CL3 D;  5AVR B;  2YMY A;  3M9B A;  2A45 H;  2WSE H;  1JNM A;  1RF0 A;  3L35 A;  3KQG A;  1FU1 A;  4HYT B;  1NTM K;  3N7N A;  1QL2 A;  2E42 A;  1RE3 A;  1KIL C;  1NAF A;  2YKP A;  2CPB A;  2KSJ A;  1URQ D;  3A5T A;  4WB4 A;  1IO4 A;  3HE5 B;  3P8C E;  5CCG A;  3KDP B;  1N86 A;  1YTZ I;  3BRT B;  2P7J A;  3HUS B;  1JY2 N;  2HLO A;  4N78 E;  3I5C A;  1KFN A;  2Z5H A;  1HJB A;  1SFC D;  2XDJ A;  3GHG A;  1NWQ A;  1PFI A;  3BVH A;  1RE4 C;  1KIL A;  5KTB A;  3B5N D;  2PAJ A;  4W80 A;  1FZF A;  1QL1 A;  3P7K A;  4LGD E;  3V2Q A;  2XZR A;  3B8E B;  3M9Q A;  4KHX A;  5AVT B;  2H7H A;  1LTA C;  2WIT A;  1JY3 P;  1G2C B;  1M1J A;  4GT1 A;  2YO2 A;  3R2P A;  1EQ7 A;  1ZN5 A;  3PP5 A;  1YYC A;  3M0D C;  1IFN A;  2Z5I A;  3MIW A;  1FZE A;  1JY3 O;  1JMM A;  4DOJ A;  1NTK K;  1RE4 A;  2XU6 A;  1RF1 C;  4WY4 C;  5CHX A;  1OWA A;  3OAK A;  3BAS A;  1S9K D;  2FYZ A;  4XE5 B;  1GL2 C;  2OYH B;  1GU5 A;  3RK2 C;  2P1J A;  2C9L Y;  3VMY A;  2XV5 A;  5AVV B;  1GK4 A;  5AW4 B;  4AQR D;  2KYV A;  3C9I A;  2ZXE B;  3E1I A;  3M0D A;  5APW A;  2N1T B;  2XKM A;  2KP8 A;  1RF1 A;  2HOD A;  4WY4 A;  2R32 A;  1SP4 A;  1YTZ T;  4LC1 A;  3UIA A;  5CCH A;  1CSB A;  2ZFC A;  3LIE A;  4I1L A;  1J1E C;  2LKM A;  4HH2 A;  1IFI A;  1FOS E;  1L0N K;  1GL2 A;  3OJA B;  1JO5 A;  1LWU C;  1T3U A;  2W6A A;  5BU8 B;  3A3Y B;  1J1D B;  1URQ C;  2VRS A;  2WWW A;  3HE4 B;  1T2K C;  5CJ4 A;  3O8Z A;  1MV8 A;  3CLQ A;  1HVV A;  3LID A;  1JOC A;  1CI6 B;  3M0A A;  1T3J A;  2C0X A;  5APS A;  1HBW A;  1N73 B;  2Z4E A;  3RK3 C;  1JCC A;  5CMZ A;  2Q7C A;  2OYI B;  2FYU K;  5APT A;  3V4Q A;  2O1K A;  4N3Y B;  1KQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...