1L0LK

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
53
structure length
53
Chain Sequence
MLTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDWRLILDWVPYINGKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 15
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1l0lK00
3G3ZA 3LW5H 1L0NK 2OARA 2J59M 4IFDK 1L0LK 1SQXK 1SQQK 5KLVK 1NTZK 1NTMK 1NU1K 1NTKK 3M9QA 2WSEH 3CLQA 2LKMA 1SQVK 2FYUK 1SQBK 2WSCH 2O01H 2WSFH 1SQPK
chains in the Genus database with same CATH superfamily
3FXEA 2OYHA 4MN4C 4WY4D 4HKZH 1P84D 3L75G 2W6BA 1S4XA 4LLHA 2OYHC 2QJPC 3TF5A 2ZT9D 2WZ7A 2OYIB 1PP9G 3L74D 1X22A 3R2PA 2IPPA 1VQ4P 4EYYQ 4H13D 3CC2P 4JYBA 3FGAD 1KC8Q 1KB9I 5TISE 3VP9A 2W27A 1YIJP 2QSIA 1SQVG 1GL2D 2ITAA 2W83C 2E75D 1K04A 2JR8A 1T3JA 2AEMA 1PGQA 2OYHB 2QJPB 3L35A 4OGQD 2QG4A 3LW5H 5BU5A 3HTKA 3H1HJ 1OIPA 3GG2A 1VQKP 3QH9A 2W6JH 3VP8A 3I56P 1QVGO 1DD4A 2ZVOB 2M3BA 2NRGA 1KFNA 3VMZA 3K5BA 3P8CE 4RKUJ 4LGDE 5APTA 2OARA 3L71G 1YITP 4I7ZC 1Q7YQ 3TGUE 4JF7A 5AVVB 2MJZA 4H0LC 2BASA 1SQPG 5KLIC 2POHA 1G1IA 1OW8A 3H1JE 4YXWH 3AEEC 2K9YA 2FYUJ 2RH0A 1Y47A 3HTKB 3MGNA 4PJ0H 4M3LA 1VQ8P 1H8AA 3SWFA 3GMAA 2FXPA 4I7ZB 2OYOA 1NKNA 4H0LB 4N6JA 3H6PA 2JWDA 5KLIB 3RK3C 5GTIE 1SLQA 1EZVG 2Y0DA 1L0LG 5APQA 4K35A 3N4XA 1L0NJ 2O1JA 2NZ2A 2XZRA 1KB9D 3E1RA 2K1AA 2XV5A 2OTJP 5AVTB 1GW4A 3O6QA 2CPSA 4PD4H 3CD6P 5GTHE 3L70E 4O9BA 1NJIQ 2ZT9C 1UIXA 2K3RA 1RH5B 1EDLA 1L0ND 2O01N 5H2FH 2E74C 3RK3B 2HPCA 3TYYA 3PJSK 3GLMA 1SQBK 1CSBA 2WSFH 3U1CA 2B87A 2GA1A 3IR9A 5AVWB 5AW4B 2E75C 3NFQA 1HWTC 1QVFO 1KV4A 2KSJA 2XKMA 1NTZK 2ZT9B 3O6QB 1SVFA 2E74B 1FZGA 3MP7B 3MHVA 1FOSF 3E1IA 1Z56A 1LT9A 2ZYGA 1VF5D 1SQXG 2GUVA 2HPCB 3M91A 3RK2D 2E75B 3VYIA 1LT9C 5CCHD 3BRVB 2WSEH 3HE4A 5E79E 3U1AA 5AVSB 1JEKA 1S5LH 2ZXEB 2B87B 3Q2YA 2IYOA 3CX5E 3TNUA 2A06G 2ZXXA 4IFDK 1QX8A 1FZEA 3L37A 5KLVK 1VQ5P 1ZOYC 3H1JJ 3WU2E 3GW6A 3P8CD 3VMAA 3UIAA 4GKGA 2G8YA 1K8AQ 1RF1A 1LT9B 3C1LA 3A0BE 2WSCJ 1A02J 1IO4A 1LTSC 1FS0E 2KK7A 2KZJA 2KXPB 3KDPB 1RF1C 2YKPA 4UB6E 3H1JD 3HE4B 3NXSA 1PPJE 2PP6A 3H32A 1HGVA 2YXRB 1IC2A 2BEQD 1IFDA 3TNUB 1JM0A 5AW2B 5AW6B 4U3FG 4Z1MH 3CX5I 1RF1B 1SQVK 2IDBA 1PIXA 1MFTA 2HODA 2R5DA 2HR3A 3L75E 3N7NA 1FZCA 5AVQB 1FOSE 1BDCA 3CC4P 1QL2A 2OTLP 3H32B 3HRNA 3P8MC 1PP9E 1FZCC 3C8VA 1W2EA 2FXMA 4D6TG 2WMMA 1CW5A 3Q3DA 1P84H 3RL0C 1SQVE 2JWAA 4N3YB 3PHLA 2W8ZA 1ZW0A 1NAFA 2HG5D 5KJ7D 1AJYA 1KZUB 2HODB 1BE3G 2AEFA 2KOGA 1FZCB 1IZNB 2FYNC 2J59M 4IOIH 4ASVA 2QIWA 3AE6C 1FZAA 2QEXP 3V4WA 3CWBE 1BGYG 3RL0B 3L72J 5B5EH 2KP8A 1ZV8A 5CCGD 1AVOA 3PLNA 5K5GB 4W7ZA 3ABVC 1SQPE 2L91A 2FYNB 3L72D 2C9LY 3CX5D 4EDFA 1NYHA 2H88C 5AW5B 3V2QA 4ZNCA 3B4SA 3FWNA 2M5AA 1L2PA 5CJ0A 3P32A 2YIUC 3L4FA 3H1IJ 3NMDA 5AW9B 3M9QA 3JCUE 2FBWC 4IL6E 1FC2C 2MKVA 2YMYA 1EZVE 3JC22 2V4HA 1L0LE 2KIKA 1N8RQ 1EDKA 5DJUB 3H1ID 1SP4A 3B5NA 1SQBG 2IBZG 1OX3A 2YIUB 1PGPA 4C7NA 1ZP0C 2M5AB 1IFNA 1LTJA 3AE1C 4WBAA 1GK4A 1USEA 1YI2P 1KB9H 2W6AA 1KQSO 1LTJC 3VN0A 1TU3F 4H0LD 3G3ZA 1SQVJ 4RJTA 1YQ3C 2QVAA 3PH0A 1CI6A 2QA4P 3B5NB 3M9HA 1EDIA 1PGOA 4KT0J 4L76A 1EZVI 1HUCA 4JYCA 5C39A 2Z4EA 3L73G 4C7NB 1FJPA 3B71A 1LTJB 1LTIC 1E5WA 1N73A 2WT7A 2FY8A 4ASWA 4OVNF 1K9MQ 1QGKB 2XDJA 4GT1A 1KTMA 1SQXE 3R4YA 3CWBJ 5KLVG 1YJ9P 1N73C 3RK3D 2WITA 2XU6A 2YNYA 3TK1A 1SQQD 1NTMJ 2IZ0A 2R44A 1WRGA 4NPDA 5AW0B 3CC7P 2A06E 1CI6B 1SQPJ 1BSHA 1SS1A 1HF9A 4BWNA 3CWBD 2IFMA 4C7RA 1NTKG 1ZMEC 3CXHD 2H89C 2WPQA 3G6EP 1AVYA 2V7QJ 1YQ4C 1AQ5A 2ZYDA 1N73B 2Z5IA 2WT7B 5KAIE 2E74D 1IK9A 2QJKC 1OVRA 1U7MA 2AXTE 1URQA 1NTMD 2P58A 1MZ9A 4UB8H 1MUUA 1BCCG 1RQVA 2ZFCA 1SQPD 2PFXA 3MUDA 2R32A 3CCVP 1URQC 3MTUE 3IF4A 3CCEP 1VQNP 1L0LJ 3MUDC 4YPCA 1IFIA 2IFNA 2JDIH 3LIEA 1Q82Q 5KKZC 2QJKB 1JTHA 4U3FE 1NU1G 2K88A 1EZVD 4N78D 1KQGB 1URQB 1L0LD 2WTYA 5AVZB 1MKMA 2KUBA 1N2DC 4DCKA 5APYA 3H1HD 4B86A 2P10A 5KKZB 1DIPA 1ZR2A 1Q86Q 3Q5SA 1FDIA 1ZRTE 2CK3H 2R3CA 4ZMDA 4D6TE 1MV8A 1JTHB 3H1LJ 3L74G 3HE5A 5GTHH 3AE9C 4AUWA 3EWKA 4DOJA 2M3EA 2E43A 3L36A 1FZFA 3AE2C 3PP5A 1SQXJ 1N7LA 1BE3E 5KAFE 2LR2A 1DD3A 2FYUD 3H1LD 3BCCE 5APVA 2WVRA 3OAKA 3D6YA 1KILE 1BGYE 3CMEP 3W68A 4DJGA 2D2CC 1SQXD 3LIDA 4U7JA 1JCCA 1KFMA 3HE5B 2ZYAA 1T6AA 3I5CA 1VPCA 1VQ7P 4AQRD 1NHLA 4PJ0E 2P67A 2A45H 2KSEA 4K3AA 2D2CB 1BDDA 3SWKA 2P7JA 5E79H 5AW7B 2E5TA 4Y28J 1PFIA 3CX5H 5CBNA 3RL0D 5L8RJ 1RY3A 2YO2A 4I2LC 3ITKA 3V2NA 2O01J 1OVUA 4XA4A 2KZIA 4PD4E 4XFJA 2FFDA 1SQBE 5CMZA 3BVHA 1KORA 2FFDC 5H2FE 3CI9A 1G2CA 3TGUJ 3KYQA 2RN0A 1NH4A 1NTZE 1LT1A 2Q7CA 5CJ4A 1PV3A 2B9BA 2BCCG 2FXOA 3F5HA 1L0NG 2JO1A 3EFGA 1DH3A 3TGUD 3G4SP 1NGMB 2FFDB 4L73A 3H1KG 4Y99C 3L73E 3V2RA 4WVZA 1NTKK 3P7KA 2P2UA 3BCCJ 1KN7A 2KB7P 1G2CB 3KZIH 4EI2A 2E5YA 1NOHA 3FXDA 2B89A 5KLVE 1BGYJ 2N9BA 1KYOH 2KNCA 5AW3B 1Q81Q 1S5LE 1S9KE 2WWWA 3V2PA 4GOFA 1NO4A 3L70J 3D71A 3BCCD 4Y99B 5EFWB 1IFMA 1QEXA 4DT0A 3CCUP 1AQTA 1KILD 1JNMA 1BGYD 2B88A 1NTKE 1H88A 1L4AD 1LTTC 3B5ND 1UIIA 1NU1K 3L70D 1EQ7A 2J58A 5B66E 3A2AA 4PV1C 3W67A 4AYCA 1BCCE 2Y0CA 2KNCB 3CXHH 2WSSH 1QL1A 1S5LX 1KD1Q 2Y9ZA 1J1DC 5AW8B 3CCRP 1U57A 3A0HH 1OMIA 1RE4A 1SQBJ 1PGJA 4PV1B 1NU1E 2Z5HA 4JPZB 1RE4C 2PRRA 2O1KA 1J1EC 3AEBC 2DW3A 1NTZJ 1J1DB 3VTPC 1SQBD 1GTWA 3JCUH 2WSFJ 3L71E 3QWOC 2G3AA 1ZN5A 1RF0A 1JMMA 1NAYA 3CPWO 3WUVA 2N1TA 2K37A 2K9JA 3G9RA 1DEBA 1NTZD 1YBKA 2LXBA 1EXIA 1RF0C 1VQOP 2GUSA 3L74E 2IZ1A 2M0BA 1J1EB 2N1TC 3L73J 1FE6A 2Q5UA 1N7SA 3AEFC 4IFMA 3S4RA 2E76D 2Q3IA 1HGZA 1FU1A 2IYPA 1N7SC 5KLVJ 1URQD 2XNXA 3SFEC 1KILA 2QRXA 5B5EE 3KXDA 1PPJD 2PAJA 1L4AA 4GDOA 2N1TB 1S3JA 2K9JB 3IFMA 3VOPA 1KILC 4TLFA 3GF3A 1YYCA 1D7MA 1H0TA 5KLVD 2LKMA 1NTKJ 1L4AC 3AEDC 4GIFA 3L75J 3B5NC 1S9KD 1N7SB 1OWAA 2WPRA 1VDFA 1FZBA 1X8YA 1PP9J 2R3SA 3CCMP 2A45G 4JQ0D 1BCCJ 3NTNA 3L75D 1GMJA 1LTBC 1KILB 3L72G 4I1LA 3E7KA 4GOEA 1JB0J 1L4AB 2QJYC 4YXDC 1N86A 1YJWP 1PP9D 2I1JA 4RESB 4DZOA 1JMBA 4JBZA 3PRJA 2L5GB 1NU1J 2KI7B 1T2KC 1SQVD 1NKZB 1L0NK 4GODA 1JUNA 5KAIH 3HD7A 1HBWA 5M1BA 3AE3C 1K05A 2E42A 3HUSA 2Q9IA 2QJYB 1VQLP 4QMAA 2KYVA 3H1IG 3HD7C 1PZQA 3Q1MA 5TISH 3L71J 1NU1D 1HVVA 1FBMA 3HUSC 4C46A 2JKVA 3AECC 1YTZI 2D2CD 4KHXA 4RO0A 3TSIA 3M0DA 2H7HA 3AE4C 2CPBA 1HJBA 2BCCE 1EDJA 1L0NE 2ZVNB 1JY3O 2SPZA 3L71D 3M0DC 3D70A 2YKOA 1A02F 2E76C 3HD7B 1ZXGA 1KQFB 3H1KE 3HUSB 2PGDA 5KTBA 3CCLP 4WB4A 1JY3P 1S1CX 2C0XA 4HYTB 2E76B 3A3YB 2KLVA 1FDMA 1VQ9P 2YMKA 1X79B 3M06A 2WSCH 4I6MC 5APXA 1G1JA 1M56D 2WPVB 1NVOA 3V6IA 3TDKA 1VQMP 1SQQG 3AE7C 5KAFH 5GTIH 4UB8E 3CWBG 3WUUA 2ZAEB 1JO5A 2J5UA 4ZKUA 2I1KA 2YXQB 3FX0A 3II6A 2RMZA 1LGHB 1HH0A 1NTMG 4TT3H 1M1KQ 2NPSD 3RGUA 1R8EA 1GK6A 3A5TA 1Y9BA 2OTKE 4L74A 1JY3N 3ZDMA 1VL2A 4W80A 1OVVA 1OFCX 1OXZA 1W2BO 3M0AA 1HTLC 2BCCJ 1S2EA 4A7PA 4WY4A 5DJTB 3WUTA 1LNQA 2IX7C 3H25A 3H1HG 4WY4C 2A06D 3CMAP 1H89A 3H1KJ 1FDOA 1XTCC 1GU4A 1GU5A 2BCCD 4PV1D 4WWIA 3CCJP 1GL2A 4H13C 3KPEA 1IK7A 3O8ZA 1WMKA 1YTZT 3H1KD 4U3FJ 5BU8B 1GL2C 3WU2H 4WY4B 1BSNA 3IAOA 2BEZF 1Q90D 1LWUA 1IFPA 2FYUG 3A0BH 3H1LG 3EFFK 2IBZE 4OGQC 2AXCA 3V4QA 3SWYA 1LWUC 3A7OA 3CCSP 3G71P 1M7LA 4H13B 4U3FD 3GF7A 4UB6H 2Q3EA 2R5BA 1HJ0A 1QLED 1DEEG 1GL2B 5AVXB 1SFCD 1EC5A 1RHZB 2NPSA 4D6TJ 1XTGB 2Q1KA 4R4LA 3OW2O 1EXJA 4OGQB 3L72E 1USDA 3IN6A 3RL0g 2NPSC 1LWUB 3LW5J 2W90A 3AEAC 1ZRTD 4LC1A 2N1TD 1BE3J 4D6TD 2FKWB 4KJMA 1K73Q 4PD4I 2IBZI 5B66H 1AA0A 1X9VA 3RBXA 1YJNP 1GD2E 1RE3A 1N7SD 2AEJA 3BASA 2NPSB 2YO3A 4BXLA 1BE3D 3H1IE 3JSVC 1RE3C 3Q5RA 4BRYA 3EQ2A 1JY2O 3SFDC 1OW7A 2M8RA 2FYZA 2A45I 1T3UA 1MFZA 2RKLA 1FJKA 5AVUB 1E79H 2WPSA 1LTAC 2ZJSE 1M1JA 1GDTA 2KS1A 2N9YB 4YTPC 3U59A 1VQPP 1GW3A 4HJGH 1M1JC 1JY2P 2GM4A 5AVRB 4W7YA 3CL3D 2HYNA 4HH2A 1VQ6P 2P1JA 3TGUG 1J2JB 3KZIE 1LTGC 1SQQK 4BRYB 4H44D 4XE5B 1IJDB 4NPFX 1NWQA 1KYOE 1CZQA 5APUA 1YHQP 1LJ2A 5CHXA 3T97A 3H1JG 1M1JB 3I55P 1U7JA 2KS1B 2C9NY 2V7QH 1T8ZA 1T2KD 3MIWA 2VRSA 1NTMK 1SFCA 5CCHA 1VF5C 3RK3E 3F89A 1SQPK 2QE7H 1SQQE 4PD4D 3RK2C 3HD7D 1SFCC 2IBZD 4IL6H 3BCCG 5CCHC 1OW6A 2Y9YA 4L75A 5AVYB 4HB1A 3M9BA 4R4MA 2H43A 3B8EB 3WMM0 2UWJE 4ZKPA 3CXHE 1JCDA 1P84E 2Y0EA 3T97B 3AEGC 3C9IA 2JJLA 2QM8A 3MZWB 3L70G 1VF5B 2I8DA 1NTME 1FAVA 1GZLA 3KHUA 1OZHA 1KYOI 2XNDH 3AE8C 3RK2B 1L0LK 1SFCB 1JY2N 3A0HE 4NPEA 4OH8B 3CLQA 4IFFA 1S72P 2WSEJ 2C0WA 3RBZA 1KQLA 1KMIZ 3Q5PA 2KLUA 1ZR4A 3L73D 2OQQA 3USSA 5CBOA 1AFOA 1R5LA 1LP1A 3S1KA 4N78E 5APWA 3OA7A 3GHGA 3CXHI 1P84I 3VMXA 3CCQP 1M8OB 1M57D 4CPGA 1RQUA 3H1HE 3BATA 3GHGC 4EIJA 1PL5A 2HFED 1WT6A 3S9OA 2FYUK 5TJHA 3V5BA 1NTKD 1R5SA 1DX7A 2QM7A 1Q2NA 2HLOA 1NTZG 4H44C 2O3JA 1AV1A 1ZLLA 3KQGA 3VMYA 1SQXK 1M90Q 2JP3A 1LP1B 1BCCD 1H0TB 4IL6X 5KJ7A 1JOCA 2OGUA 3GHGB 2Q6QA 2LXCB 2AXTH 2FYUE 2WQYC 3H1LE 5KJ7C 1X0TA 3D6ZA 5BVZA 1KYOD 1W5CE 3AE5C 4H44B 3BRTB 1SQQJ 1PPJG 2OYIA 3OJAB 1KB9E 5AW1B 1IFJA 1Y8AA 5CCGA 5APSA 2YKQA 2OYIC 3MD0A 4OWFA 3FWLA 2JEEA 2H8PD 4EOTA 3PTZA 5CCGC 3L74J 3SSUA 2O01H
chains in the Genus database with same CATH topology
3V2QA 2OYHA 1NOHA 3M0AA 1HTLC 5CJ0A 3P32A 2N9BA 4WY4D 4WY4A 3L4FA 5AW3B 3NMDA 5AW9B 1S9KE 2W6BA 2WWWA 4LLHA 2OYHC 3V2PA 2WZ7A 2IX7C 1NO4A 2OYIB 3M9QA 4WY4C 4Y99B 2YMYA 3R2PA 2IPPA 1H89A 1IFMA 1XTCC 1GU4A 1KILD 1JNMA 1GU5A 1H88A 4JYBA 1L4AD 1LTTC 1SP4A 3VP9A 3B5ND 2W27A 3B5NA 1GL2D 1GL2A 1NU1K 1EQ7A 2J58A 3KPEA 1T3JA 3O8ZA 3A2AA 4C7NA 2OYHB 4AYCA 3L35A 1YTZT 1IFNA 1LTJA 5BU8B 3LW5H 5BU5A 1GL2C 4WBAA 4WY4B 1GK4A 3HTKA 1QL1A 1LWUA 2W6AA 1LTJC 1J1DC 3VP8A 3VN0A 5AW8B 3V4QA 2M3BA 3SWYA 1KFNA 1LWUC 3A7OA 3VMZA 3G3ZA 3P8CE 1M7LA 1RE4A 4LGDE 5APTA 2OARA 2R5BA 1CI6A 2Z5HA 3B5NB 3M9HA 1GL2B 4JF7A 1HUCA 5AVVB 2MJZA 5AVXB 4JYCA 1SFCD 1RE4C 2Z4EA 2BASA 2NPSA 1XTGB 2POHA 4C7NB 1FJPA 2O1KA 1J1EC 1G1IA 1LTJB 1J1DB 1LTIC 1E5WA 1N73A 2WT7A 3VTPC 4GT1A 2XDJA 3HTKB 3MGNA 1GTWA 2NPSC 4M3LA 1LWUB 1N73C 1ZN5A 1RF0A 1H8AA 3SWFA 1JMMA 3RK3D 4LC1A 2N1TD 2WITA 2XU6A 2N1TA 2YNYA 1DEBA 2FKWB 3TK1A 1NKNA 1RF0C 1WRGA 3H6PA 4N6JA 5AW0B 2GUSA 3RK3C 1SLQA 1CI6B 1J1EB 1X9VA 1GD2E 2N1TC 1RE3A 1N7SD 5APQA 2IFMA 1N7SA 2Q5UA 4C7RA 3N4XA 3BASA 2O1JA 4IFMA 2NPSB 2XZRA 2YO3A 2WPQA 2Q3IA 1HGZA 2XV5A 5AVTB 1RE3C 1GW4A 1AQ5A 1FU1A 1N73B 2Z5IA 1N7SC 2WT7B 1URQD 2CPSA 3EQ2A 1IK9A 1JY2O 2XNXA 1URQA 2M8RA 2FYZA 4O9BA 2A45I 1T3UA 1MFZA 1MZ9A 1MUUA 1FJKA 5AVUB 2ZFCA 2WPSA 1KILA 1LTAC 3MUDA 2R32A 1M1JA 1GDTA 2PAJA 1URQC 1L4AA 3MTUE 3RK3B 2N1TB 2HPCA 3IFMA 3TYYA 3VOPA 3U59A 1KILC 1YYCA 1GW3A 1M1JC 2LKMA 1JY2P 1SQBK 2GM4A 1IFIA 2IFNA 5AVRB 1L4AC 4W7YA 1CSBA 2WSFH 4GIFA 3LIEA 3U1CA 3B5NC 1S9KD 5AW4B 3IR9A 5AVWB 1N7SB 3CL3D 1OWAA 2WPRA 1JTHA 2HYNA 3NFQA 1VDFA 1FZBA 4HH2A 1HWTC 1X8YA 2P1JA 2KSJA 1J2JB 1LTGC 1SQQK 2XKMA 1NTZK 2A45G 1SVFA 4XE5B 4N78D 1IJDB 3NTNA 1URQB 1NWQA 2WTYA 1FZGA 5AVZB 1CZQA 5APUA 1N2DC 5CHXA 3T97A 1FOSF 3E1IA 1LTBC 1Z56A 1KILB 1LT9A 4I1LA 1M1JB 1L4AB 2GUVA 2C9NY 5APYA 1N86A 2I1JA 2HPCB 4B86A 1T8ZA 4RESB 3M91A 4DZOA 1T2KD 3MIWA 3RK2D 3VYIA 1LT9C 2VRSA 1NTMK 5CCHD 2L5GB 1SFCA 3BRVB 2WSEH 5CCHA 3HE4A 1ZR2A 3U1AA 5AVSB 2R3CA 2ZXEB 1MV8A 1SQPK 1T2KC 1JTHB 1NKZB 1L0NK 1JUNA 3RK2C 3TNUA 3HD7D 1SFCC 3HD7A 5CCHC 1HBWA 3HE5A 4IFDK 4AUWA 4DOJA 2E42A 5AVYB 3M9BA 1FZEA 3HUSA 3B8EB 3L37A 5KLVK 2H43A 2Q9IA 2E43A 3WMM0 3L36A 1FZFA 3PP5A 3P8CD 4ZKPA 1JCDA 2KYVA 3HD7C 3UIAA 4GKGA 1N7LA 3C9IA 2JJLA 1HVVA 1RF1A 1FBMA 1LT9B 2QM8A 3HUSC 4C46A 1A02J 1IO4A 1YTZI 4KHXA 5APVA 1FAVA 1GZLA 1LTSC 3OAKA 3TSIA 3M0DA 2H7HA 1RF1C 3KDPB 2CPBA 3RK2B 1HJBA 1L0LK 1SFCB 2YKPA 1JY2N 3HE4B 3NXSA 2PP6A 3H32A 4OH8B 3LIDA 3CLQA 1JY3O 1HGVA 3M0DC 4IFFA 1IC2A 1IFDA 2YKOA 3TNUB 1JCCA 1A02F 2C0WA 1KQLA 3HD7B 1KFMA 3HE5B 1ZR4A 3I5CA 1VPCA 5AW2B 3HUSB 4AQRD 1NHLA 5AW6B 5KTBA 1AFOA 2P67A 4WB4A 1JY3P 1RF1B 1SQVK 2C0XA 2A45H 4N78E 4HYTB 2P7JA 2HODA 2R5DA 5APWA 5AW7B 3OA7A 3GHGA 3VMXA 3N7NA 1FZCA 5AVQB 1FOSE 1PFIA 3A3YB 2KLVA 1FDMA 1QL2A 3H32B 1X79B 3HRNA 3P8MC 3M06A 3BATA 3GHGC 4EIJA 3RL0D 2HFED 1WT6A 1FZCC 2FYUK 2WSCH 4I6MC 1RY3A 5APXA 3V5BA 1W2EA 2FXMA 2YO2A 1G1JA 4I2LC 3V2NA 1DX7A 1CW5A 2QM7A 2HLOA 3RL0C 1ZLLA 4XA4A 2FFDA 4N3YB 5CMZA 3KQGA 3VMYA 1SQXK 1NAFA 2HG5D 3BVHA 5KJ7D 1JO5A 5KJ7A 2FFDC 1KZUB 1JOCA 2HODB 3CI9A 3GHGB 4ZKUA 1G2CA 2I1KA 2KOGA 3KYQA 1NH4A 1FZCB 3II6A 1LGHB 1HH0A 2J59M 2Q7CA 5CJ4A 5KJ7C 1FZAA 5BVZA 2NPSD 1GK6A 3V4WA 3RL0B 3BRTB 2KP8A 2OYIA 3OJAB 3EFGA 5AW1B 1DH3A 1ZV8A 1IFJA 3A5TA 5CCGD 5CCGA 5APSA 2YKQA 2FFDB 2OYIC 3MD0A 4W7ZA 4Y99C 1JY3N 3V2RA 4W80A 2JEEA 2H8PD 4EOTA 1OXZA 5CCGC 1NTKK 3P7KA 2P2UA 2C9LY 2O01H 2KB7P 5AW5B 1G2CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3Z A;  3LW5 H;  1L0N K;  2OAR A;  2J59 M;  4IFD K;  1L0L K;  1SQX K;  1SQQ K;  5KLV K;  1NTZ K;  1NTM K;  1NU1 K;  1NTK K;  3M9Q A;  2WSE H;  3CLQ A;  2LKM A;  1SQV K;  2FYU K;  1SQB K;  2WSC H;  2O01 H;  2WSF H;  1SQP K; 
#chains in the Genus database with same CATH topology
 3FXE A;  2OYH A;  4MN4 C;  4WY4 D;  4HKZ H;  1P84 D;  3L75 G;  2W6B A;  1S4X A;  4LLH A;  2OYH C;  2QJP C;  3TF5 A;  2ZT9 D;  2WZ7 A;  2OYI B;  1PP9 G;  3L74 D;  1X22 A;  3R2P A;  2IPP A;  1VQ4 P;  4EYY Q;  4H13 D;  3CC2 P;  4JYB A;  3FGA D;  1KC8 Q;  1KB9 I;  5TIS E;  3VP9 A;  2W27 A;  1YIJ P;  2QSI A;  1SQV G;  1GL2 D;  2ITA A;  2W83 C;  2E75 D;  1K04 A;  2JR8 A;  1T3J A;  2AEM A;  1PGQ A;  2OYH B;  2QJP B;  3L35 A;  4OGQ D;  2QG4 A;  3LW5 H;  5BU5 A;  3HTK A;  3H1H J;  1OIP A;  3GG2 A;  1VQK P;  3QH9 A;  2W6J H;  3VP8 A;  3I56 P;  1QVG O;  1DD4 A;  2ZVO B;  2M3B A;  2NRG A;  1KFN A;  3VMZ A;  3K5B A;  3P8C E;  4RKU J;  4LGD E;  5APT A;  2OAR A;  3L71 G;  1YIT P;  4I7Z C;  1Q7Y Q;  3TGU E;  4JF7 A;  5AVV B;  2MJZ A;  4H0L C;  2BAS A;  1SQP G;  5KLI C;  2POH A;  1G1I A;  1OW8 A;  3H1J E;  4YXW H;  3AEE C;  2K9Y A;  2FYU J;  2RH0 A;  1Y47 A;  3HTK B;  3MGN A;  4PJ0 H;  4M3L A;  1VQ8 P;  1H8A A;  3SWF A;  3GMA A;  2FXP A;  4I7Z B;  2OYO A;  1NKN A;  4H0L B;  4N6J A;  3H6P A;  2JWD A;  5KLI B;  3RK3 C;  5GTI E;  1SLQ A;  1EZV G;  2Y0D A;  1L0L G;  5APQ A;  4K35 A;  3N4X A;  1L0N J;  2O1J A;  2NZ2 A;  2XZR A;  1KB9 D;  3E1R A;  2K1A A;  2XV5 A;  2OTJ P;  5AVT B;  1GW4 A;  3O6Q A;  2CPS A;  4PD4 H;  3CD6 P;  5GTH E;  3L70 E;  4O9B A;  1NJI Q;  2ZT9 C;  1UIX A;  2K3R A;  1RH5 B;  1EDL A;  1L0N D;  2O01 N;  5H2F H;  2E74 C;  3RK3 B;  2HPC A;  3TYY A;  3PJS K;  3GLM A;  1SQB K;  1CSB A;  2WSF H;  3U1C A;  2B87 A;  2GA1 A;  3IR9 A;  5AVW B;  5AW4 B;  2E75 C;  3NFQ A;  1HWT C;  1QVF O;  1KV4 A;  2KSJ A;  2XKM A;  1NTZ K;  2ZT9 B;  3O6Q B;  1SVF A;  2E74 B;  1FZG A;  3MP7 B;  3MHV A;  1FOS F;  3E1I A;  1Z56 A;  1LT9 A;  2ZYG A;  1VF5 D;  1SQX G;  2GUV A;  2HPC B;  3M91 A;  3RK2 D;  2E75 B;  3VYI A;  1LT9 C;  5CCH D;  3BRV B;  2WSE H;  3HE4 A;  5E79 E;  3U1A A;  5AVS B;  1JEK A;  1S5L H;  2ZXE B;  2B87 B;  3Q2Y A;  2IYO A;  3CX5 E;  3TNU A;  2A06 G;  2ZXX A;  4IFD K;  1QX8 A;  1FZE A;  3L37 A;  5KLV K;  1VQ5 P;  1ZOY C;  3H1J J;  3WU2 E;  3GW6 A;  3P8C D;  3VMA A;  3UIA A;  4GKG A;  2G8Y A;  1K8A Q;  1RF1 A;  1LT9 B;  3C1L A;  3A0B E;  2WSC J;  1A02 J;  1IO4 A;  1LTS C;  1FS0 E;  2KK7 A;  2KZJ A;  2KXP B;  3KDP B;  1RF1 C;  2YKP A;  4UB6 E;  3H1J D;  3HE4 B;  3NXS A;  1PPJ E;  2PP6 A;  3H32 A;  1HGV A;  2YXR B;  1IC2 A;  2BEQ D;  1IFD A;  3TNU B;  1JM0 A;  5AW2 B;  5AW6 B;  4U3F G;  4Z1M H;  3CX5 I;  1RF1 B;  1SQV K;  2IDB A;  1PIX A;  1MFT A;  2HOD A;  2R5D A;  2HR3 A;  3L75 E;  3N7N A;  1FZC A;  5AVQ B;  1FOS E;  1BDC A;  3CC4 P;  1QL2 A;  2OTL P;  3H32 B;  3HRN A;  3P8M C;  1PP9 E;  1FZC C;  3C8V A;  1W2E A;  2FXM A;  4D6T G;  2WMM A;  1CW5 A;  3Q3D A;  1P84 H;  3RL0 C;  1SQV E;  2JWA A;  4N3Y B;  3PHL A;  2W8Z A;  1ZW0 A;  1NAF A;  2HG5 D;  5KJ7 D;  1AJY A;  1KZU B;  2HOD B;  1BE3 G;  2AEF A;  2KOG A;  1FZC B;  1IZN B;  2FYN C;  2J59 M;  4IOI H;  4ASV A;  2QIW A;  3AE6 C;  1FZA A;  2QEX P;  3V4W A;  3CWB E;  1BGY G;  3RL0 B;  3L72 J;  5B5E H;  2KP8 A;  1ZV8 A;  5CCG D;  1AVO A;  3PLN A;  5K5G B;  4W7Z A;  3ABV C;  1SQP E;  2L91 A;  2FYN B;  3L72 D;  2C9L Y;  3CX5 D;  4EDF A;  1NYH A;  2H88 C;  5AW5 B;  3V2Q A;  4ZNC A;  3B4S A;  3FWN A;  2M5A A;  1L2P A;  5CJ0 A;  3P32 A;  2YIU C;  3L4F A;  3H1I J;  3NMD A;  5AW9 B;  3M9Q A;  3JCU E;  2FBW C;  4IL6 E;  1FC2 C;  2MKV A;  2YMY A;  1EZV E;  3JC2 2;  2V4H A;  1L0L E;  2KIK A;  1N8R Q;  1EDK A;  5DJU B;  3H1I D;  1SP4 A;  3B5N A;  1SQB G;  2IBZ G;  1OX3 A;  2YIU B;  1PGP A;  4C7N A;  1ZP0 C;  2M5A B;  1IFN A;  1LTJ A;  3AE1 C;  4WBA A;  1GK4 A;  1USE A;  1YI2 P;  1KB9 H;  2W6A A;  1KQS O;  1LTJ C;  3VN0 A;  1TU3 F;  4H0L D;  3G3Z A;  1SQV J;  4RJT A;  1YQ3 C;  2QVA A;  3PH0 A;  1CI6 A;  2QA4 P;  3B5N B;  3M9H A;  1EDI A;  1PGO A;  4KT0 J;  4L76 A;  1EZV I;  1HUC A;  4JYC A;  5C39 A;  2Z4E A;  3L73 G;  4C7N B;  1FJP A;  3B71 A;  1LTJ B;  1LTI C;  1E5W A;  1N73 A;  2WT7 A;  2FY8 A;  4ASW A;  4OVN F;  1K9M Q;  1QGK B;  2XDJ A;  4GT1 A;  1KTM A;  1SQX E;  3R4Y A;  3CWB J;  5KLV G;  1YJ9 P;  1N73 C;  3RK3 D;  2WIT A;  2XU6 A;  2YNY A;  3TK1 A;  1SQQ D;  1NTM J;  2IZ0 A;  2R44 A;  1WRG A;  4NPD A;  5AW0 B;  3CC7 P;  2A06 E;  1CI6 B;  1SQP J;  1BSH A;  1SS1 A;  1HF9 A;  4BWN A;  3CWB D;  2IFM A;  4C7R A;  1NTK G;  1ZME C;  3CXH D;  2H89 C;  2WPQ A;  3G6E P;  1AVY A;  2V7Q J;  1YQ4 C;  1AQ5 A;  2ZYD A;  1N73 B;  2Z5I A;  2WT7 B;  5KAI E;  2E74 D;  1IK9 A;  2QJK C;  1OVR A;  1U7M A;  2AXT E;  1URQ A;  1NTM D;  2P58 A;  1MZ9 A;  4UB8 H;  1MUU A;  1BCC G;  1RQV A;  2ZFC A;  1SQP D;  2PFX A;  3MUD A;  2R32 A;  3CCV P;  1URQ C;  3MTU E;  3IF4 A;  3CCE P;  1VQN P;  1L0L J;  3MUD C;  4YPC A;  1IFI A;  2IFN A;  2JDI H;  3LIE A;  1Q82 Q;  5KKZ C;  2QJK B;  1JTH A;  4U3F E;  1NU1 G;  2K88 A;  1EZV D;  4N78 D;  1KQG B;  1URQ B;  1L0L D;  2WTY A;  5AVZ B;  1MKM A;  2KUB A;  1N2D C;  4DCK A;  5APY A;  3H1H D;  4B86 A;  2P10 A;  5KKZ B;  1DIP A;  1ZR2 A;  1Q86 Q;  3Q5S A;  1FDI A;  1ZRT E;  2CK3 H;  2R3C A;  4ZMD A;  4D6T E;  1MV8 A;  1JTH B;  3H1L J;  3L74 G;  3HE5 A;  5GTH H;  3AE9 C;  4AUW A;  3EWK A;  4DOJ A;  2M3E A;  2E43 A;  3L36 A;  1FZF A;  3AE2 C;  3PP5 A;  1SQX J;  1N7L A;  1BE3 E;  5KAF E;  2LR2 A;  1DD3 A;  2FYU D;  3H1L D;  3BCC E;  5APV A;  2WVR A;  3OAK A;  3D6Y A;  1KIL E;  1BGY E;  3CME P;  3W68 A;  4DJG A;  2D2C C;  1SQX D;  3LID A;  4U7J A;  1JCC A;  1KFM A;  3HE5 B;  2ZYA A;  1T6A A;  3I5C A;  1VPC A;  1VQ7 P;  4AQR D;  1NHL A;  4PJ0 E;  2P67 A;  2A45 H;  2KSE A;  4K3A A;  2D2C B;  1BDD A;  3SWK A;  2P7J A;  5E79 H;  5AW7 B;  2E5T A;  4Y28 J;  1PFI A;  3CX5 H;  5CBN A;  3RL0 D;  5L8R J;  1RY3 A;  2YO2 A;  4I2L C;  3ITK A;  3V2N A;  2O01 J;  1OVU A;  4XA4 A;  2KZI A;  4PD4 E;  4XFJ A;  2FFD A;  1SQB E;  5CMZ A;  3BVH A;  1KOR A;  2FFD C;  5H2F E;  3CI9 A;  1G2C A;  3TGU J;  3KYQ A;  2RN0 A;  1NH4 A;  1NTZ E;  1LT1 A;  2Q7C A;  5CJ4 A;  1PV3 A;  2B9B A;  2BCC G;  2FXO A;  3F5H A;  1L0N G;  2JO1 A;  3EFG A;  1DH3 A;  3TGU D;  3G4S P;  1NGM B;  2FFD B;  4L73 A;  3H1K G;  4Y99 C;  3L73 E;  3V2R A;  4WVZ A;  1NTK K;  3P7K A;  2P2U A;  3BCC J;  1KN7 A;  2KB7 P;  1G2C B;  3KZI H;  4EI2 A;  2E5Y A;  1NOH A;  3FXD A;  2B89 A;  5KLV E;  1BGY J;  2N9B A;  1KYO H;  2KNC A;  5AW3 B;  1Q81 Q;  1S5L E;  1S9K E;  2WWW A;  3V2P A;  4GOF A;  1NO4 A;  3L70 J;  3D71 A;  3BCC D;  4Y99 B;  5EFW B;  1IFM A;  1QEX A;  4DT0 A;  3CCU P;  1AQT A;  1KIL D;  1JNM A;  1BGY D;  2B88 A;  1NTK E;  1H88 A;  1L4A D;  1LTT C;  3B5N D;  1UII A;  1NU1 K;  3L70 D;  1EQ7 A;  2J58 A;  5B66 E;  3A2A A;  4PV1 C;  3W67 A;  4AYC A;  1BCC E;  2Y0C A;  2KNC B;  3CXH H;  2WSS H;  1QL1 A;  1S5L X;  1KD1 Q;  2Y9Z A;  1J1D C;  5AW8 B;  3CCR P;  1U57 A;  3A0H H;  1OMI A;  1RE4 A;  1SQB J;  1PGJ A;  4PV1 B;  1NU1 E;  2Z5H A;  4JPZ B;  1RE4 C;  2PRR A;  2O1K A;  1J1E C;  3AEB C;  2DW3 A;  1NTZ J;  1J1D B;  3VTP C;  1SQB D;  1GTW A;  3JCU H;  2WSF J;  3L71 E;  3QWO C;  2G3A A;  1ZN5 A;  1RF0 A;  1JMM A;  1NAY A;  3CPW O;  3WUV A;  2N1T A;  2K37 A;  2K9J A;  3G9R A;  1DEB A;  1NTZ D;  1YBK A;  2LXB A;  1EXI A;  1RF0 C;  1VQO P;  2GUS A;  3L74 E;  2IZ1 A;  2M0B A;  1J1E B;  2N1T C;  3L73 J;  1FE6 A;  2Q5U A;  1N7S A;  3AEF C;  4IFM A;  3S4R A;  2E76 D;  2Q3I A;  1HGZ A;  1FU1 A;  2IYP A;  1N7S C;  5KLV J;  1URQ D;  2XNX A;  3SFE C;  1KIL A;  2QRX A;  5B5E E;  3KXD A;  1PPJ D;  2PAJ A;  1L4A A;  4GDO A;  2N1T B;  1S3J A;  2K9J B;  3IFM A;  3VOP A;  1KIL C;  4TLF A;  3GF3 A;  1YYC A;  1D7M A;  1H0T A;  5KLV D;  2LKM A;  1NTK J;  1L4A C;  3AED C;  4GIF A;  3L75 J;  3B5N C;  1S9K D;  1N7S B;  1OWA A;  2WPR A;  1VDF A;  1FZB A;  1X8Y A;  1PP9 J;  2R3S A;  3CCM P;  2A45 G;  4JQ0 D;  1BCC J;  3NTN A;  3L75 D;  1GMJ A;  1LTB C;  1KIL B;  3L72 G;  4I1L A;  3E7K A;  4GOE A;  1JB0 J;  1L4A B;  2QJY C;  4YXD C;  1N86 A;  1YJW P;  1PP9 D;  2I1J A;  4RES B;  4DZO A;  1JMB A;  4JBZ A;  3PRJ A;  2L5G B;  1NU1 J;  2KI7 B;  1T2K C;  1SQV D;  1NKZ B;  1L0N K;  4GOD A;  1JUN A;  5KAI H;  3HD7 A;  1HBW A;  5M1B A;  3AE3 C;  1K05 A;  2E42 A;  3HUS A;  2Q9I A;  2QJY B;  1VQL P;  4QMA A;  2KYV A;  3H1I G;  3HD7 C;  1PZQ A;  3Q1M A;  5TIS H;  3L71 J;  1NU1 D;  1HVV A;  1FBM A;  3HUS C;  4C46 A;  2JKV A;  3AEC C;  1YTZ I;  2D2C D;  4KHX A;  4RO0 A;  3TSI A;  3M0D A;  2H7H A;  3AE4 C;  2CPB A;  1HJB A;  2BCC E;  1EDJ A;  1L0N E;  2ZVN B;  1JY3 O;  2SPZ A;  3L71 D;  3M0D C;  3D70 A;  2YKO A;  1A02 F;  2E76 C;  3HD7 B;  1ZXG A;  1KQF B;  3H1K E;  3HUS B;  2PGD A;  5KTB A;  3CCL P;  4WB4 A;  1JY3 P;  1S1C X;  2C0X A;  4HYT B;  2E76 B;  3A3Y B;  2KLV A;  1FDM A;  1VQ9 P;  2YMK A;  1X79 B;  3M06 A;  2WSC H;  4I6M C;  5APX A;  1G1J A;  1M56 D;  2WPV B;  1NVO A;  3V6I A;  3TDK A;  1VQM P;  1SQQ G;  3AE7 C;  5KAF H;  5GTI H;  4UB8 E;  3CWB G;  3WUU A;  2ZAE B;  1JO5 A;  2J5U A;  4ZKU A;  2I1K A;  2YXQ B;  3FX0 A;  3II6 A;  2RMZ A;  1LGH B;  1HH0 A;  1NTM G;  4TT3 H;  1M1K Q;  2NPS D;  3RGU A;  1R8E A;  1GK6 A;  3A5T A;  1Y9B A;  2OTK E;  4L74 A;  1JY3 N;  3ZDM A;  1VL2 A;  4W80 A;  1OVV A;  1OFC X;  1OXZ A;  1W2B O;  3M0A A;  1HTL C;  2BCC J;  1S2E A;  4A7P A;  4WY4 A;  5DJT B;  3WUT A;  1LNQ A;  2IX7 C;  3H25 A;  3H1H G;  4WY4 C;  2A06 D;  3CMA P;  1H89 A;  3H1K J;  1FDO A;  1XTC C;  1GU4 A;  1GU5 A;  2BCC D;  4PV1 D;  4WWI A;  3CCJ P;  1GL2 A;  4H13 C;  3KPE A;  1IK7 A;  3O8Z A;  1WMK A;  1YTZ T;  3H1K D;  4U3F J;  5BU8 B;  1GL2 C;  3WU2 H;  4WY4 B;  1BSN A;  3IAO A;  2BEZ F;  1Q90 D;  1LWU A;  1IFP A;  2FYU G;  3A0B H;  3H1L G;  3EFF K;  2IBZ E;  4OGQ C;  2AXC A;  3V4Q A;  3SWY A;  1LWU C;  3A7O A;  3CCS P;  3G71 P;  1M7L A;  4H13 B;  4U3F D;  3GF7 A;  4UB6 H;  2Q3E A;  2R5B A;  1HJ0 A;  1QLE D;  1DEE G;  1GL2 B;  5AVX B;  1SFC D;  1EC5 A;  1RHZ B;  2NPS A;  4D6T J;  1XTG B;  2Q1K A;  4R4L A;  3OW2 O;  1EXJ A;  4OGQ B;  3L72 E;  1USD A;  3IN6 A;  3RL0 g;  2NPS C;  1LWU B;  3LW5 J;  2W90 A;  3AEA C;  1ZRT D;  4LC1 A;  2N1T D;  1BE3 J;  4D6T D;  2FKW B;  4KJM A;  1K73 Q;  4PD4 I;  2IBZ I;  5B66 H;  1AA0 A;  1X9V A;  3RBX A;  1YJN P;  1GD2 E;  1RE3 A;  1N7S D;  2AEJ A;  3BAS A;  2NPS B;  2YO3 A;  4BXL A;  1BE3 D;  3H1I E;  3JSV C;  1RE3 C;  3Q5R A;  4BRY A;  3EQ2 A;  1JY2 O;  3SFD C;  1OW7 A;  2M8R A;  2FYZ A;  2A45 I;  1T3U A;  1MFZ A;  2RKL A;  1FJK A;  5AVU B;  1E79 H;  2WPS A;  1LTA C;  2ZJS E;  1M1J A;  1GDT A;  2KS1 A;  2N9Y B;  4YTP C;  3U59 A;  1VQP P;  1GW3 A;  4HJG H;  1M1J C;  1JY2 P;  2GM4 A;  5AVR B;  4W7Y A;  3CL3 D;  2HYN A;  4HH2 A;  1VQ6 P;  2P1J A;  3TGU G;  1J2J B;  3KZI E;  1LTG C;  1SQQ K;  4BRY B;  4H44 D;  4XE5 B;  1IJD B;  4NPF X;  1NWQ A;  1KYO E;  1CZQ A;  5APU A;  1YHQ P;  1LJ2 A;  5CHX A;  3T97 A;  3H1J G;  1M1J B;  3I55 P;  1U7J A;  2KS1 B;  2C9N Y;  2V7Q H;  1T8Z A;  1T2K D;  3MIW A;  2VRS A;  1NTM K;  1SFC A;  5CCH A;  1VF5 C;  3RK3 E;  3F89 A;  1SQP K;  2QE7 H;  1SQQ E;  4PD4 D;  3RK2 C;  3HD7 D;  1SFC C;  2IBZ D;  4IL6 H;  3BCC G;  5CCH C;  1OW6 A;  2Y9Y A;  4L75 A;  5AVY B;  4HB1 A;  3M9B A;  4R4M A;  2H43 A;  3B8E B;  3WMM 0;  2UWJ E;  4ZKP A;  3CXH E;  1JCD A;  1P84 E;  2Y0E A;  3T97 B;  3AEG C;  3C9I A;  2JJL A;  2QM8 A;  3MZW B;  3L70 G;  1VF5 B;  2I8D A;  1NTM E;  1FAV A;  1GZL A;  3KHU A;  1OZH A;  1KYO I;  2XND H;  3AE8 C;  3RK2 B;  1L0L K;  1SFC B;  1JY2 N;  3A0H E;  4NPE A;  4OH8 B;  3CLQ A;  4IFF A;  1S72 P;  2WSE J;  2C0W A;  3RBZ A;  1KQL A;  1KMI Z;  3Q5P A;  2KLU A;  1ZR4 A;  3L73 D;  2OQQ A;  3USS A;  5CBO A;  1AFO A;  1R5L A;  1LP1 A;  3S1K A;  4N78 E;  5APW A;  3OA7 A;  3GHG A;  3CXH I;  1P84 I;  3VMX A;  3CCQ P;  1M8O B;  1M57 D;  4CPG A;  1RQU A;  3H1H E;  3BAT A;  3GHG C;  4EIJ A;  1PL5 A;  2HFE D;  1WT6 A;  3S9O A;  2FYU K;  5TJH A;  3V5B A;  1NTK D;  1R5S A;  1DX7 A;  2QM7 A;  1Q2N A;  2HLO A;  1NTZ G;  4H44 C;  2O3J A;  1AV1 A;  1ZLL A;  3KQG A;  3VMY A;  1SQX K;  1M90 Q;  2JP3 A;  1LP1 B;  1BCC D;  1H0T B;  4IL6 X;  5KJ7 A;  1JOC A;  2OGU A;  3GHG B;  2Q6Q A;  2LXC B;  2AXT H;  2FYU E;  2WQY C;  3H1L E;  5KJ7 C;  1X0T A;  3D6Z A;  5BVZ A;  1KYO D;  1W5C E;  3AE5 C;  4H44 B;  3BRT B;  1SQQ J;  1PPJ G;  2OYI A;  3OJA B;  1KB9 E;  5AW1 B;  1IFJ A;  1Y8A A;  5CCG A;  5APS A;  2YKQ A;  2OYI C;  3MD0 A;  4OWF A;  3FWL A;  2JEE A;  2H8P D;  4EOT A;  3PTZ A;  5CCG C;  3L74 J;  3SSU A;  2O01 H; 
#chains in the Genus database with same CATH homology
 3V2Q A;  2OYH A;  1NOH A;  3M0A A;  1HTL C;  5CJ0 A;  3P32 A;  2N9B A;  4WY4 D;  4WY4 A;  3L4F A;  5AW3 B;  3NMD A;  5AW9 B;  1S9K E;  2W6B A;  2WWW A;  4LLH A;  2OYH C;  3V2P A;  2WZ7 A;  2IX7 C;  1NO4 A;  2OYI B;  3M9Q A;  4WY4 C;  4Y99 B;  2YMY A;  3R2P A;  2IPP A;  1H89 A;  1IFM A;  1XTC C;  1GU4 A;  1KIL D;  1JNM A;  1GU5 A;  1H88 A;  4JYB A;  1L4A D;  1LTT C;  1SP4 A;  3VP9 A;  3B5N D;  2W27 A;  3B5N A;  1GL2 D;  1GL2 A;  1NU1 K;  1EQ7 A;  2J58 A;  3KPE A;  1T3J A;  3O8Z A;  3A2A A;  4C7N A;  2OYH B;  4AYC A;  3L35 A;  1YTZ T;  1IFN A;  1LTJ A;  5BU8 B;  3LW5 H;  5BU5 A;  1GL2 C;  4WBA A;  4WY4 B;  1GK4 A;  3HTK A;  1QL1 A;  1LWU A;  2W6A A;  1LTJ C;  1J1D C;  3VP8 A;  3VN0 A;  5AW8 B;  3V4Q A;  2M3B A;  3SWY A;  1KFN A;  1LWU C;  3A7O A;  3VMZ A;  3G3Z A;  3P8C E;  1M7L A;  1RE4 A;  4LGD E;  5APT A;  2OAR A;  2R5B A;  1CI6 A;  2Z5H A;  3B5N B;  3M9H A;  1GL2 B;  4JF7 A;  1HUC A;  5AVV B;  2MJZ A;  5AVX B;  4JYC A;  1SFC D;  1RE4 C;  2Z4E A;  2BAS A;  2NPS A;  1XTG B;  2POH A;  4C7N B;  1FJP A;  2O1K A;  1J1E C;  1G1I A;  1LTJ B;  1J1D B;  1LTI C;  1E5W A;  1N73 A;  2WT7 A;  3VTP C;  4GT1 A;  2XDJ A;  3HTK B;  3MGN A;  1GTW A;  2NPS C;  4M3L A;  1LWU B;  1N73 C;  1ZN5 A;  1RF0 A;  1H8A A;  3SWF A;  1JMM A;  3RK3 D;  4LC1 A;  2N1T D;  2WIT A;  2XU6 A;  2N1T A;  2YNY A;  1DEB A;  2FKW B;  3TK1 A;  1NKN A;  1RF0 C;  1WRG A;  3H6P A;  4N6J A;  5AW0 B;  2GUS A;  3RK3 C;  1SLQ A;  1CI6 B;  1J1E B;  1X9V A;  1GD2 E;  2N1T C;  1RE3 A;  1N7S D;  5APQ A;  2IFM A;  1N7S A;  2Q5U A;  4C7R A;  3N4X A;  3BAS A;  2O1J A;  4IFM A;  2NPS B;  2XZR A;  2YO3 A;  2WPQ A;  2Q3I A;  1HGZ A;  2XV5 A;  5AVT B;  1RE3 C;  1GW4 A;  1AQ5 A;  1FU1 A;  1N73 B;  2Z5I A;  1N7S C;  2WT7 B;  1URQ D;  2CPS A;  3EQ2 A;  1IK9 A;  1JY2 O;  2XNX A;  1URQ A;  2M8R A;  2FYZ A;  4O9B A;  2A45 I;  1T3U A;  1MFZ A;  1MZ9 A;  1MUU A;  1FJK A;  5AVU B;  2ZFC A;  2WPS A;  1KIL A;  1LTA C;  3MUD A;  2R32 A;  1M1J A;  1GDT A;  2PAJ A;  1URQ C;  1L4A A;  3MTU E;  3RK3 B;  2N1T B;  2HPC A;  3IFM A;  3TYY A;  3VOP A;  3U59 A;  1KIL C;  1YYC A;  1GW3 A;  1M1J C;  2LKM A;  1JY2 P;  1SQB K;  2GM4 A;  1IFI A;  2IFN A;  5AVR B;  1L4A C;  4W7Y A;  1CSB A;  2WSF H;  4GIF A;  3LIE A;  3U1C A;  3B5N C;  1S9K D;  5AW4 B;  3IR9 A;  5AVW B;  1N7S B;  3CL3 D;  1OWA A;  2WPR A;  1JTH A;  2HYN A;  3NFQ A;  1VDF A;  1FZB A;  4HH2 A;  1HWT C;  1X8Y A;  2P1J A;  2KSJ A;  1J2J B;  1LTG C;  1SQQ K;  2XKM A;  1NTZ K;  2A45 G;  1SVF A;  4XE5 B;  4N78 D;  1IJD B;  3NTN A;  1URQ B;  1NWQ A;  2WTY A;  1FZG A;  5AVZ B;  1CZQ A;  5APU A;  1N2D C;  5CHX A;  3T97 A;  1FOS F;  3E1I A;  1LTB C;  1Z56 A;  1KIL B;  1LT9 A;  4I1L A;  1M1J B;  1L4A B;  2GUV A;  2C9N Y;  5APY A;  1N86 A;  2I1J A;  2HPC B;  4B86 A;  1T8Z A;  4RES B;  3M91 A;  4DZO A;  1T2K D;  3MIW A;  3RK2 D;  3VYI A;  1LT9 C;  2VRS A;  1NTM K;  5CCH D;  2L5G B;  1SFC A;  3BRV B;  2WSE H;  5CCH A;  3HE4 A;  1ZR2 A;  3U1A A;  5AVS B;  2R3C A;  2ZXE B;  1MV8 A;  1SQP K;  1T2K C;  1JTH B;  1NKZ B;  1L0N K;  1JUN A;  3RK2 C;  3TNU A;  3HD7 D;  1SFC C;  3HD7 A;  5CCH C;  1HBW A;  3HE5 A;  4IFD K;  4AUW A;  4DOJ A;  2E42 A;  5AVY B;  3M9B A;  1FZE A;  3HUS A;  3B8E B;  3L37 A;  5KLV K;  2H43 A;  2Q9I A;  2E43 A;  3WMM 0;  3L36 A;  1FZF A;  3PP5 A;  3P8C D;  4ZKP A;  1JCD A;  2KYV A;  3HD7 C;  3UIA A;  4GKG A;  1N7L A;  3C9I A;  2JJL A;  1HVV A;  1RF1 A;  1FBM A;  1LT9 B;  2QM8 A;  3HUS C;  4C46 A;  1A02 J;  1IO4 A;  1YTZ I;  4KHX A;  5APV A;  1FAV A;  1GZL A;  1LTS C;  3OAK A;  3TSI A;  3M0D A;  2H7H A;  1RF1 C;  3KDP B;  2CPB A;  3RK2 B;  1HJB A;  1L0L K;  1SFC B;  2YKP A;  1JY2 N;  3HE4 B;  3NXS A;  2PP6 A;  3H32 A;  4OH8 B;  3LID A;  3CLQ A;  1JY3 O;  1HGV A;  3M0D C;  4IFF A;  1IC2 A;  1IFD A;  2YKO A;  3TNU B;  1JCC A;  1A02 F;  2C0W A;  1KQL A;  3HD7 B;  1KFM A;  3HE5 B;  1ZR4 A;  3I5C A;  1VPC A;  5AW2 B;  3HUS B;  4AQR D;  1NHL A;  5AW6 B;  5KTB A;  1AFO A;  2P67 A;  4WB4 A;  1JY3 P;  1RF1 B;  1SQV K;  2C0X A;  2A45 H;  4N78 E;  4HYT B;  2P7J A;  2HOD A;  2R5D A;  5APW A;  5AW7 B;  3OA7 A;  3GHG A;  3VMX A;  3N7N A;  1FZC A;  5AVQ B;  1FOS E;  1PFI A;  3A3Y B;  2KLV A;  1FDM A;  1QL2 A;  3H32 B;  1X79 B;  3HRN A;  3P8M C;  3M06 A;  3BAT A;  3GHG C;  4EIJ A;  3RL0 D;  2HFE D;  1WT6 A;  1FZC C;  2FYU K;  2WSC H;  4I6M C;  1RY3 A;  5APX A;  3V5B A;  1W2E A;  2FXM A;  2YO2 A;  1G1J A;  4I2L C;  3V2N A;  1DX7 A;  1CW5 A;  2QM7 A;  2HLO A;  3RL0 C;  1ZLL A;  4XA4 A;  2FFD A;  4N3Y B;  5CMZ A;  3KQG A;  3VMY A;  1SQX K;  1NAF A;  2HG5 D;  3BVH A;  5KJ7 D;  1JO5 A;  5KJ7 A;  2FFD C;  1KZU B;  1JOC A;  2HOD B;  3CI9 A;  3GHG B;  4ZKU A;  1G2C A;  2I1K A;  2KOG A;  3KYQ A;  1NH4 A;  1FZC B;  3II6 A;  1LGH B;  1HH0 A;  2J59 M;  2Q7C A;  5CJ4 A;  5KJ7 C;  1FZA A;  5BVZ A;  2NPS D;  1GK6 A;  3V4W A;  3RL0 B;  3BRT B;  2KP8 A;  2OYI A;  3OJA B;  3EFG A;  5AW1 B;  1DH3 A;  1ZV8 A;  1IFJ A;  3A5T A;  5CCG D;  5CCG A;  5APS A;  2YKQ A;  2FFD B;  2OYI C;  3MD0 A;  4W7Z A;  4Y99 C;  1JY3 N;  3V2R A;  4W80 A;  2JEE A;  2H8P D;  4EOT A;  1OXZ A;  5CCG C;  1NTK K;  3P7K A;  2P2U A;  2C9L Y;  2O01 H;  2KB7 P;  5AW5 B;  1G2C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...