3CXHH

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
b'GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 16
structure length 93
sequence length 93
chains with identical sequence S
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3cxhH00
1BCCG 1KYOH 2BCCG 1PP9G 1SQXG 4D6TG 1KB9H 3H1HG 2IBZG 3H1LG 3L72G 3H1IG 1SQPG 3L73G 1PPJG 3TGUG 4U3FG 2FYUG 3H1KG 1NU1G 3CX5H 4PD4H 1NTZG 3L71G 3CXHH 3BCCG 3L74G 3H1JG 1L0LG 1NTMG 1EZVG 1P84H 1BGYG 1NTKG 3L70G 1BE3G 1SQQG 5KLVG 3L75G 1L0NG 1SQBG 3CWBG 1SQVG 2A06G
chains in the Genus database with same CATH superfamily
1L4AB 5AVXB 1AV1A 1NTMK 2IBZI 2FYUD 3L72J 3L74E 5K5GB 3B4SA 5AW8B 1EZVE 3S1KA 1NTKE 1IFDA 1SQBE 3L75D 3CPWO 2XDJA 5B5EE 1HJBA 5DJUB 3MD0A 2D2CB 2FFDA 1BCCJ 3A3YB 2LXBA 1PP9J 2IZ0A 1SS1A 3HRNA 5C39A 3G6EP 3TDKA 2E75D 1OFCX 3LIEA 1FDOA 3CWBG 3A7OA 1IK9A 4H0LD 3RL0g 1JY3N 3HUSA 3RL0D 3EFGA 1KQSO 3HE4B 1KTMA 1X22A 5KLVE 3M0AA 5GTIE 4WVZA 2WTYA 2ZT9B 2O01H 2UWJE 3JSVC 1KB9H 3T97A 4NPDA 2XU6A 1G1IA 4PV1B 1CW5A 3L71G 1M1JA 5KTBA 2E76D 2KIKA 1L0LJ 2HFED 2Q5UA 4NPFX 1X0TA 3MUDA 3L72E 1FZCB 5APWA 3U1CA 3CX5H 1SQQK 3Q1MA 2V7QH 2GA1A 3P8MC 1FC2C 2KB7P 1NKNA 2XKMA 2ZJSE 1BCCE 2PFXA 1PP9E 2QJYC 2KYVA 3KYQA 3BVHA 2L91A 4OWFA 4N78E 2WSEH 3N7NA 1S5LH 3MP7B 2XZRA 2W6AA 3TGUJ 3AEBC 1LTAC 1S9KD 2C0XA 5M1BA 4OGQC 1SQPK 2K9JA 3WMM0 1J1DC 2IX7C 3OW2O 2IPPA 2W6BA 4D6TJ 1URQC 5APQA 1PZQA 3Q5RA 3L74G 1NTZJ 4IFMA 1N73B 5BU8B 1BGYE 1NTMD 1EZVG 3W68A 4R4LA 2Q1KA 1NTKG 1VDFA 1EXIA 1SQBG 5APVA 4GKGA 2YXRB 1SQXE 1LP1B 4WY4B 2B87B 1NKZB 3H1LJ 3H1KJ 5APTA 3L37A 1GZLA 1LT9B 1JY2O 3B8EB 1KILE 2LKMA 2IBZE 1RE4A 2QM8A 2CPSA 1M7LA 1VQKP 4PD4E 2N1TA 3CI9A 5CJ4A 2H88C 1LWUB 3H1JJ 1BE3D 3SWKA 2N1TD 3GMAA 5KLVG 1GL2B 1M1KQ 2NPSC 1AVYA 1PGOA 3TGUE 4HKZH 1RY3A 2WPQA 4U3FD 5APUA 2K88A 4JYBA 1XTGB 1CSBA 2RN0A 2QJPC 3P8CD 3WUUA 2ZYGA 5CHXA 1SFCB 1R8EA 2QJKC 3B5NA 4D6TE 1L0NJ 3L72G 3FX0A 1NTZE 3GF7A 5CBOA 4UB8E 3VP9A 2H89C 1YHQP 4KJMA 1ZV8A 1JCCA 1EQ7A 3AE1C 1IC2A 2YKQA 1SQQD 1BCCG 1OW7A 3O8ZA 3H1LE 2I1JA 3M0DC 1PP9G 1N2DC 1NVOA 2N9BA 1NU1E 3H1KE 1Q82Q 3GLMA 1K8AQ 2M5AB 4JPZB 4R4MA 1HVVA 4GOFA 1YBKA 3P7KA 2E74C 1LTJB 1AQTA 2FYNB 2QVAA 3GHGC 2JO1A 1RE3C 1J1DB 1SQPD 2K9YA 3AE3C 3CCMP 1S72P 1BDCA 2CK3H 2WT7A 5CCGC 1BGYG 2XNXA 1VF5C 3RK3E 2O3JA 1HF9A 1P84D 1JMMA 4WB4A 3K5BA 1SQXG 3H32B 1OIPA 2QE7H 2O1KA 4O9BA 2OYHC 3TNUB 2OTJP 1H88A 3KPEA 3HD7C 1U7JA 2QEXP 3GW6A 1NTKD 1ZOYC 1MFTA 2A06E 1L0NE 2JR8A 3GG2A 2K3RA 1HGZA 4Y28J 1L0LK 2C0WA 2H7HA 2IBZG 1VQOP 3L71J 4OVNF 1M90Q 1LTIC 1L4AC 4C7NB 3I5CA 2FYUK 5AVZB 1Q90D 3W67A 5KKZB 2Y9YA 5AW4B 3U1AA 3TGUG 3H1IJ 3JCUE 2A45I 2PGDA 5CJ0A 4PJ0E 2D2CC 2BCCE 1K9MQ 1Q2NA 4D6TG 3A0HH 2QJKB 3L73G 4OGQD 1NTZG 1XTCC 3CMAP 1W2EA 1URQA 1KILB 3L4FA 2M0BA 1URQD 2PP6A 1OWAA 1KQLA 3EFFK 3H1LG 1UIXA 2Q7CA 1NU1G 3AE9C 1H0TB 2MJZA 2Y0CA 3L74J 4IL6X 2ZT9C 1NAFA 2KOGA 3KHUA 1SQBJ 4W7ZA 5L8RJ 4UB6H 4PV1C 2J5UA 2PRRA 3C1LA 1JY2N 4HYTB 1DD4A 1RF1B 1J1EB 2KK7A 1Q81Q 1FZCC 3H1IE 1VQ9P 1VQLP 1PFIA 1GDTA 1GU5A 2NPSA 1T8ZA 4L76A 1JOCA 2NPSD 1RF0A 3HD7B 1R5LA 5KAIE 1WT6A 2E43A 3CL3D 1K73Q 2RKLA 4RKUJ 2A06G 2ZXXA 5KLVJ 3CCRP 4UB8H 3LIDA 4IL6E 4ZMDA 2AEFA 2POHA 2GM4A 3CLQA 1FZAA 2WPRA 1L0LD 1ZR4A 2JWAA 1VQMP 2W90A 2AXTE 4XA4A 3AE2C 1LTBC 1Z56A 3NMDA 3RK3B 1N73C 2OARA 2R32A 3M0DA 3FGAD 5TJHA 2M3EA 4HH2A 4PD4I 2HLOA 1E79H 4JYCA 1J2JB 2BCCG 2KLUA 4WY4C 3V6IA 3H1HE 1CI6A 2J58A 4BWNA 3R4YA 1HWTC 3E7KA 2E74D 3GHGA 4TT3H 2OYIB 1FDMA 1RE3A 4LGDE 4TLFA 2W6JH 2WQYC 1KD1Q 5TISH 2R44A 1FOSE 2VRSA 4DOJA 1LT9C 1ZMEC 1RHZB 1WRGA 4W7YA 1S2EA 3TYYA 5CCGA 2RH0A 5CCGD 3CC7P 1S4XA 1VF5D 2KNCB 3WUTA 1LWUC 3GF3A 4AQRD 4DJGA 1GL2C 1JO5A 1USEA 2OYHA 1BGYJ 1ZP0C 1N7SB 3CCSP 1JTHB 1DEEG 1U7MA 3HTKA 1SQXJ 3H1KD 4L73A 4L75A 2NRGA 3ITKA 1SFCC 5AW0B 1USDA 1FAVA 2HR3A 4OH8B 2BASA 4QMAA 1KN7A 4AYCA 3CMEP 3H1IG 1MZ9A 1L4AA 3VMAA 2KP8A 3SWFA 3AEGC 1L4AD 1UIIA 3RBXA 3H1JD 3Q5PA 4EIJA 1NH4A 1EDIA 5KLIB 3HE5A 2Z5IA 3AE6C 2RMZA 1IFNA 1IFIA 4GT1A 1W2BO 1RH5B 3KXDA 1Y8AA 2D2CD 1DX7A 1LTJC 1ZN5A 4LC1A 2FYNC 3RK2B 3V4QA 1SQVE 1L0ND 2PAJA 5APYA 5KJ7C 3L75J 2KZJA 3U59A 2FKWB 1BSHA 3A2AA 1HBWA 1KQFB 1VQ7P 2P10A 5E79E 3L73J 3D71A 1KB9D 3M9BA 3HE4A 1S3JA 1AVOA 3QH9A 2HODB 3N4XA 3H1HG 1GD2E 2KUBA 2ZT9D 1NTKK 3BCCE 1IO4A 1PGQA 1WMKA 1SQBK 1DEBA 1NU1J 3D6YA 1BSNA 3D6ZA 5CCHC 1AJYA 3CX5D 4PV1D 1ZLLA 1FDIA 1ZRTE 2E5TA 5B66E 3NFQA 2R5DA 1KC8Q 1U57A 3G4SP 5DJTB 2A45G 5KAIH 1FZCA 2I8DA 1JB0J 1QVFO 3I56P 3CWBD 1W5CE 2G3AA 3MTUE 5KKZC 2G8YA 1RQVA 1X9VA 3QWOC 2WT7B 3G9RA 1G2CA 4B86A 5KLVK 2BEZF 2IZ1A 5AVYB 1FZBA 1FU1A 2XNDH 2O1JA 3L75E 4C7RA 4DZOA 1Q7YQ 3L70J 4M3LA 1KQGB 4JF7A 3D70A 3PH0A 1BDDA 1JM0A 1CZQA 3L73E 2AXCA 3Q2YA 1PPJG 4W80A 1N86A 3H6PA 1MV8A 1QL1A 1A02J 3L71D 2P67A 1T6AA 3LW5J 1KILC 4H44B 3IR9A 5B5EH 1SLQA 1YITP 1N73A 2B88A 3CXHI 2C9LY 2Z5HA 2OTKE 1TU3F 1LT1A 3MIWA 1LP1A 1IFPA 4WY4A 3SFEC 2B87A 4WY4D 3FXEA 4ZKPA 3O6QB 1SQVG 2GUSA 2QRXA 2CPBA 1YI2P 1AA0A 1QL2A 5H2FE 2BCCJ 4BRYB 1GMJA 1IZNB 2YO3A 2WMMA 2Q3IA 2XV5A 5AVTB 5GTIH 1YQ3C 3BRVB 2M3BA 1RF1C 1J1EC 1OX3A 1LWUA 1DD3A 3CCJP 3M91A 5CMZA 1GL2A 1EDLA 1K04A 4MN4C 1YJWP 3IN6A 1GL2D 1S1CX 2Y0DA 2ITAA 4CPGA 3L74D 1OXZA 3BCCG 4RJTA 1EZVD 1IFJA 4XE5B 3L70E 1JNMA 1SQXK 1EDKA 1FZGA 1QEXA 1SQBD 4IFDK 4WBAA 4I6MC 3A0BE 3CD6P 1P84I 1T3JA 1SFCA 1VQ5P 1SFCD 1FJKA 3IF4A 4H13B 4U3FJ 2HPCB 1S9KE 3V2QA 3FWLA 3AE5C 4JBZA 3KZIE 1Y47A 5APSA 5KAFE 1AFOA 4ASVA 1S5LX 2YNYA 2IFNA 5APXA 3E1RA 3RK3C 2ZVOB 1DIPA 2FYUG 3VYIA 1NTME 2QSIA 4ZKUA 2JJLA 1VQPP 5KLVD 2ZYAA 2M5AA 3L75G 4Y99B 5AW9B 1OVRA 2ZXEB 1OMIA 1LTJA 1JUNA 2OYIC 4BXLA 5KJ7A 1IFMA 5KJ7D 2P58A 5AVWB 3IFMA 1NHLA 3F89A 1LNQA 1NTZK 2IYOA 1FBMA 3L72D 1SP4A 1SQPJ 1G1JA 2P2UA 3V4WA 2E42A 1KORA 3H32A 2QA4P 2JP3A 4I7ZB 3EWKA 5AVVB 1BE3E 3TNUA 1N7SC 2JEEA 1HTLC 1LTTC 3G71P 3S9OA 2JDIH 1BCCD 1NU1K 1LTGC 1ZR2A 5CCHA 1M8OB 1H89A 1PP9D 1GK6A 5CCHD 4U3FE 2E5YA 1ZW0A 4N78D 3H1HJ 4PD4H 1KV4A 3P8CE 2QM7A 1T2KC 3CXHE 2FFDB 1KMIZ 5AVRB 3P32A 4EDFA 4C7NA 3M9HA 2J59M 2E75B 3V2RA 3TSIA 2MKVA 4H0LB 5KLIC 1BGYD 1YIJP 1SQQE 4IFFA 4U7JA 3L70G 4KHXA 1HUCA 3RBZA 3RL0B 3M9QA 2OGUA 3HUSB 1SQXD 4IOIH 2N1TC 3AE4C 1EDJA 2WZ7A 4K3AA 1KYOI 2LR2A 4A7PA 2IYPA 1L0NK 3RK2C 1MUUA 3F5HA 5AW6B 4AUWA 1NYHA 2WSCJ 3T97B 1KILA 2E76B 1SQPE 1KILD 1M1JB 2IBZD 2ZYDA 1VQ4P 5CBNA 3OA7A 2V4HA 3B5NC 1LTSC 1NTMG 4PD4D 3L36A 2KS1A 1H0TA 3B71A 5H2FH 1OVVA 2Y9ZA 1P84E 1NGMB 1FJPA 1X79B 1QX8A 3TGUD 3ZDMA 1GTWA 4L74A 4LLHA 3HE5B 1JY3P 1MKMA 3S4RA 3AECC 2L5GB 1Y9BA 3PRJA 1SQVJ 3H25A 4D6TD 3RGUA 1RF1A 3L73D 1T3UA 3AEAC 2P1JA 2BEQD 1NTZD 1IK7A 1RQUA 2K9JB 3TF5A 3A0BH 1BE3G 4GIFA 4I2LC 3PTZA 3HD7A 3LW5H 2WSFJ 2WITA 3HD7D 3H1LD 4U3FG 1NU1D 2FY8A 3AEDC 3KZIH 5KAFH 2FXOA 4KT0J 3BCCJ 1PGPA 4YXWH 4HJGH 4C46A 3JCUH 1PPJE 1JCDA 2QG4A 4H44C 2HYNA 3MHVA 4PJ0H 2P7JA 2ZVNB 3SSUA 1SQQG 3RK3D 2Q3EA 1N7LA 3AE7C 2N1TB 3EQ2A 2FYUJ 4GODA 4GDOA 3L70D 2OYIA 5EFWB 3PHLA 2A06D 1G2CB 2C9NY 3TK1A 1YJNP 1SQPG 3IAOA 3CCLP 2W27A 1PL5A 3CCQP 1D7MA 2KNCA 4ASWA 1YQ4C 3B5NB 1R5SA 3E1IA 3CC4P 2YIUC 3CC2P 5BVZA 2JKVA 1MFZA 1N7SA 1OW6A 1QVGO 1KYOE 4JQ0D 1YJ9P 2OYOA 3PLNA 1N7SD 3A0HE 1JTHA 3CXHH 2I1KA 2HG5D 3BRTB 3JC22 2AEMA 1KB9I 3KDPB 2IDBA 3Q5SA 4GOEA 2BCCD 3MGNA 3R2PA 1ZXGA 1T2KD 4H13C 2H8PD 4RESB 4Z1MH 1L0LE 5AW5B 2OQQA 1NJIQ 2YKPA 1VL2A 2YXQB 3CX5I 3G3ZA 3WU2E 2Q9IA 4IL6H 2H43A 3A5TA 2O01N 5AVSB 3SWYA 2FYUE 2KLVA 1FOSF 1NWQA 4UB6E 2KSEA 2AXTH 4Y99C 2B89A 1GU4A 5GTHE 1QGKB 1NAYA 2WSSH 3II6A 4HB1A 3RK2D 1RF0C 3VN0A 1M57D 1H8AA 4N3YB 2YMKA 2WPSA 1P84H 3CXHD 1LJ2A 1SVFA 1DH3A 2M8RA 3B5ND 4XFJA 2ZAEB 3H1ID 3C9IA 2HODA 3NTNA 4I7ZC 2O01J 3OAKA 1IJDB 1K05A 1NTMJ 4I1LA 2A45H 2FYZA 2QJYB 1LT9A 1QLED 4EYYQ 2KZIA 2YMYA 4WWIA 1FZFA 2NZ2A 1SQVK 2DW3A 2FFDC 1YTZI 1GW3A 5AW3B 2IFMA 4N6JA 4OGQB 2V7QJ 5AW2B 2E75C 2KXPB 2YIUB 2KSJA 3PJSK 2WSCH 1URQB 3H1JE 4H0LC 1M56D 1OVUA 3VMZA 1YYCA 3VP8A 1JY3O 2WSEJ 4YTPC 3RL0C 5BU5A 3OJAB 5TISE 3HUSC 1BE3J 3CWBJ 3H1HD 2SPZA 3WUVA 1EC5A 2WVRA 1KFMA 1L0LG 1EZVI 1EXJA 1LGHB 2E76C 1KZUB 1M1JC 2YKOA 4H44D 3FXDA 2FXMA 2JWDA 3M06A 3CCUP 2W8ZA 1KB9E 3AE8C 1FS0E 3MUDC 2Q6QA 3VTPC 1SQQJ 2NPSB 3CCEP 3O6QA 1AQ5A 5E79H 5AVUB 2K1AA 3UIAA 1VQNP 1VQ8P 2R5BA 2WSFH 4BRYA 3BATA 4YPCA 1FZEA 3MZWB 3CX5E 2QJPB 2WPVB 5AW1B 1KYOH 1HH0A 1HGVA 1X8YA 3FWNA 1PPJD 3NXSA 3VOPA 4NPEA 3KQGA 2W83C 2QIWA 3VMYA 1S5LE 3C8VA 2ZFCA 1JY2P 1N8RQ 5B66H 3CWBE 2GUVA 4K35A 1YTZT 1OZHA 1PV3A 1E5WA 2B9BA 3SFDC 3BASA 3PP5A 3H1KG 2KS1B 2WWWA 1GW4A 4DT0A 3Q3DA 3WU2H 1VPCA 3V2PA 2HPCA 1CI6B 4H13D 1JMBA 5AVQB 2E74B 1NOHA 1NTKJ 1SQVD 1L2PA 1OW8A 1PGJA 3GHGB 2Z4EA 3L71E 2FXPA 2AEJA 5AW7B 3H1JG 5GTHH 1RE4C 2R3SA 1KFNA 4DCKA 2K37A 4RO0A 3AEFC 1VF5B 1JEKA 2OTLP 2N9YB 3CCVP 1NO4A 1KYOD 3L35A 2Y0EA 2KI7B 2YO2A 3BCCD 4EI2A 2OYHB 2FBWC 3VMXA 1FE6A 3AEEC 1L0NG 2LXCB 1ZRTD 3HTKB 1PIXA 4YXDC 2R3CA 4EOTA 1VQ6P 3ABVC 4ZNCA 3I55P 3V2NA 3USSA 1Q86Q 1HJ0A 1A02F 1GK4A 3V5BA
chains in the Genus database with same CATH topology
1BCCG 1KYOH 2BCCG 1PP9G 1SQXG 4D6TG 1KB9H 3H1HG 2IBZG 3H1LG 3L72G 3H1IG 1SQPG 3L73G 1PPJG 3TGUG 4U3FG 2FYUG 3H1KG 1NU1G 3CX5H 4PD4H 1NTZG 3L71G 3CXHH 3BCCG 3L74G 3H1JG 1L0LG 1NTMG 1EZVG 1P84H 1BGYG 1NTKG 3L70G 1BE3G 1SQQG 5KLVG 3L75G 1L0NG 1SQBG 3CWBG 1SQVG 2A06G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC G;  1KYO H;  2BCC G;  1PP9 G;  1SQX G;  4D6T G;  1KB9 H;  3H1H G;  2IBZ G;  3H1L G;  3L72 G;  3H1I G;  1SQP G;  3L73 G;  1PPJ G;  3TGU G;  4U3F G;  2FYU G;  3H1K G;  1NU1 G;  3CX5 H;  4PD4 H;  1NTZ G;  3L71 G;  3CXH H;  3BCC G;  3L74 G;  3H1J G;  1L0L G;  1NTM G;  1EZV G;  1P84 H;  1BGY G;  1NTK G;  3L70 G;  1BE3 G;  1SQQ G;  5KLV G;  3L75 G;  1L0N G;  1SQB G;  3CWB G;  1SQV G;  2A06 G; 
#chains in the Genus database with same CATH topology
 1L4A B;  5AVX B;  1AV1 A;  1NTM K;  2IBZ I;  2FYU D;  3L72 J;  3L74 E;  5K5G B;  3B4S A;  5AW8 B;  1EZV E;  3S1K A;  1NTK E;  1IFD A;  1SQB E;  3L75 D;  3CPW O;  2XDJ A;  5B5E E;  1HJB A;  5DJU B;  3MD0 A;  2D2C B;  2FFD A;  1BCC J;  3A3Y B;  2LXB A;  1PP9 J;  2IZ0 A;  1SS1 A;  3HRN A;  5C39 A;  3G6E P;  3TDK A;  2E75 D;  1OFC X;  3LIE A;  1FDO A;  3CWB G;  3A7O A;  1IK9 A;  4H0L D;  3RL0 g;  1JY3 N;  3HUS A;  3RL0 D;  3EFG A;  1KQS O;  3HE4 B;  1KTM A;  1X22 A;  5KLV E;  3M0A A;  5GTI E;  4WVZ A;  2WTY A;  2ZT9 B;  2O01 H;  2UWJ E;  3JSV C;  1KB9 H;  3T97 A;  4NPD A;  2XU6 A;  1G1I A;  4PV1 B;  1CW5 A;  3L71 G;  1M1J A;  5KTB A;  2E76 D;  2KIK A;  1L0L J;  2HFE D;  2Q5U A;  4NPF X;  1X0T A;  3MUD A;  3L72 E;  1FZC B;  5APW A;  3U1C A;  3CX5 H;  1SQQ K;  3Q1M A;  2V7Q H;  2GA1 A;  3P8M C;  1FC2 C;  2KB7 P;  1NKN A;  2XKM A;  2ZJS E;  1BCC E;  2PFX A;  1PP9 E;  2QJY C;  2KYV A;  3KYQ A;  3BVH A;  2L91 A;  4OWF A;  4N78 E;  2WSE H;  3N7N A;  1S5L H;  3MP7 B;  2XZR A;  2W6A A;  3TGU J;  3AEB C;  1LTA C;  1S9K D;  2C0X A;  5M1B A;  4OGQ C;  1SQP K;  2K9J A;  3WMM 0;  1J1D C;  2IX7 C;  3OW2 O;  2IPP A;  2W6B A;  4D6T J;  1URQ C;  5APQ A;  1PZQ A;  3Q5R A;  3L74 G;  1NTZ J;  4IFM A;  1N73 B;  5BU8 B;  1BGY E;  1NTM D;  1EZV G;  3W68 A;  4R4L A;  2Q1K A;  1NTK G;  1VDF A;  1EXI A;  1SQB G;  5APV A;  4GKG A;  2YXR B;  1SQX E;  1LP1 B;  4WY4 B;  2B87 B;  1NKZ B;  3H1L J;  3H1K J;  5APT A;  3L37 A;  1GZL A;  1LT9 B;  1JY2 O;  3B8E B;  1KIL E;  2LKM A;  2IBZ E;  1RE4 A;  2QM8 A;  2CPS A;  1M7L A;  1VQK P;  4PD4 E;  2N1T A;  3CI9 A;  5CJ4 A;  2H88 C;  1LWU B;  3H1J J;  1BE3 D;  3SWK A;  2N1T D;  3GMA A;  5KLV G;  1GL2 B;  1M1K Q;  2NPS C;  1AVY A;  1PGO A;  3TGU E;  4HKZ H;  1RY3 A;  2WPQ A;  4U3F D;  5APU A;  2K88 A;  4JYB A;  1XTG B;  1CSB A;  2RN0 A;  2QJP C;  3P8C D;  3WUU A;  2ZYG A;  5CHX A;  1SFC B;  1R8E A;  2QJK C;  3B5N A;  4D6T E;  1L0N J;  3L72 G;  3FX0 A;  1NTZ E;  3GF7 A;  5CBO A;  4UB8 E;  3VP9 A;  2H89 C;  1YHQ P;  4KJM A;  1ZV8 A;  1JCC A;  1EQ7 A;  3AE1 C;  1IC2 A;  2YKQ A;  1SQQ D;  1BCC G;  1OW7 A;  3O8Z A;  3H1L E;  2I1J A;  3M0D C;  1PP9 G;  1N2D C;  1NVO A;  2N9B A;  1NU1 E;  3H1K E;  1Q82 Q;  3GLM A;  1K8A Q;  2M5A B;  4JPZ B;  4R4M A;  1HVV A;  4GOF A;  1YBK A;  3P7K A;  2E74 C;  1LTJ B;  1AQT A;  2FYN B;  2QVA A;  3GHG C;  2JO1 A;  1RE3 C;  1J1D B;  1SQP D;  2K9Y A;  3AE3 C;  3CCM P;  1S72 P;  1BDC A;  2CK3 H;  2WT7 A;  5CCG C;  1BGY G;  2XNX A;  1VF5 C;  3RK3 E;  2O3J A;  1HF9 A;  1P84 D;  1JMM A;  4WB4 A;  3K5B A;  1SQX G;  3H32 B;  1OIP A;  2QE7 H;  2O1K A;  4O9B A;  2OYH C;  3TNU B;  2OTJ P;  1H88 A;  3KPE A;  3HD7 C;  1U7J A;  2QEX P;  3GW6 A;  1NTK D;  1ZOY C;  1MFT A;  2A06 E;  1L0N E;  2JR8 A;  3GG2 A;  2K3R A;  1HGZ A;  4Y28 J;  1L0L K;  2C0W A;  2H7H A;  2IBZ G;  1VQO P;  3L71 J;  4OVN F;  1M90 Q;  1LTI C;  1L4A C;  4C7N B;  3I5C A;  2FYU K;  5AVZ B;  1Q90 D;  3W67 A;  5KKZ B;  2Y9Y A;  5AW4 B;  3U1A A;  3TGU G;  3H1I J;  3JCU E;  2A45 I;  2PGD A;  5CJ0 A;  4PJ0 E;  2D2C C;  2BCC E;  1K9M Q;  1Q2N A;  4D6T G;  3A0H H;  2QJK B;  3L73 G;  4OGQ D;  1NTZ G;  1XTC C;  3CMA P;  1W2E A;  1URQ A;  1KIL B;  3L4F A;  2M0B A;  1URQ D;  2PP6 A;  1OWA A;  1KQL A;  3EFF K;  3H1L G;  1UIX A;  2Q7C A;  1NU1 G;  3AE9 C;  1H0T B;  2MJZ A;  2Y0C A;  3L74 J;  4IL6 X;  2ZT9 C;  1NAF A;  2KOG A;  3KHU A;  1SQB J;  4W7Z A;  5L8R J;  4UB6 H;  4PV1 C;  2J5U A;  2PRR A;  3C1L A;  1JY2 N;  4HYT B;  1DD4 A;  1RF1 B;  1J1E B;  2KK7 A;  1Q81 Q;  1FZC C;  3H1I E;  1VQ9 P;  1VQL P;  1PFI A;  1GDT A;  1GU5 A;  2NPS A;  1T8Z A;  4L76 A;  1JOC A;  2NPS D;  1RF0 A;  3HD7 B;  1R5L A;  5KAI E;  1WT6 A;  2E43 A;  3CL3 D;  1K73 Q;  2RKL A;  4RKU J;  2A06 G;  2ZXX A;  5KLV J;  3CCR P;  4UB8 H;  3LID A;  4IL6 E;  4ZMD A;  2AEF A;  2POH A;  2GM4 A;  3CLQ A;  1FZA A;  2WPR A;  1L0L D;  1ZR4 A;  2JWA A;  1VQM P;  2W90 A;  2AXT E;  4XA4 A;  3AE2 C;  1LTB C;  1Z56 A;  3NMD A;  3RK3 B;  1N73 C;  2OAR A;  2R32 A;  3M0D A;  3FGA D;  5TJH A;  2M3E A;  4HH2 A;  4PD4 I;  2HLO A;  1E79 H;  4JYC A;  1J2J B;  2BCC G;  2KLU A;  4WY4 C;  3V6I A;  3H1H E;  1CI6 A;  2J58 A;  4BWN A;  3R4Y A;  1HWT C;  3E7K A;  2E74 D;  3GHG A;  4TT3 H;  2OYI B;  1FDM A;  1RE3 A;  4LGD E;  4TLF A;  2W6J H;  2WQY C;  1KD1 Q;  5TIS H;  2R44 A;  1FOS E;  2VRS A;  4DOJ A;  1LT9 C;  1ZME C;  1RHZ B;  1WRG A;  4W7Y A;  1S2E A;  3TYY A;  5CCG A;  2RH0 A;  5CCG D;  3CC7 P;  1S4X A;  1VF5 D;  2KNC B;  3WUT A;  1LWU C;  3GF3 A;  4AQR D;  4DJG A;  1GL2 C;  1JO5 A;  1USE A;  2OYH A;  1BGY J;  1ZP0 C;  1N7S B;  3CCS P;  1JTH B;  1DEE G;  1U7M A;  3HTK A;  1SQX J;  3H1K D;  4L73 A;  4L75 A;  2NRG A;  3ITK A;  1SFC C;  5AW0 B;  1USD A;  1FAV A;  2HR3 A;  4OH8 B;  2BAS A;  4QMA A;  1KN7 A;  4AYC A;  3CME P;  3H1I G;  1MZ9 A;  1L4A A;  3VMA A;  2KP8 A;  3SWF A;  3AEG C;  1L4A D;  1UII A;  3RBX A;  3H1J D;  3Q5P A;  4EIJ A;  1NH4 A;  1EDI A;  5KLI B;  3HE5 A;  2Z5I A;  3AE6 C;  2RMZ A;  1IFN A;  1IFI A;  4GT1 A;  1W2B O;  1RH5 B;  3KXD A;  1Y8A A;  2D2C D;  1DX7 A;  1LTJ C;  1ZN5 A;  4LC1 A;  2FYN C;  3RK2 B;  3V4Q A;  1SQV E;  1L0N D;  2PAJ A;  5APY A;  5KJ7 C;  3L75 J;  2KZJ A;  3U59 A;  2FKW B;  1BSH A;  3A2A A;  1HBW A;  1KQF B;  1VQ7 P;  2P10 A;  5E79 E;  3L73 J;  3D71 A;  1KB9 D;  3M9B A;  3HE4 A;  1S3J A;  1AVO A;  3QH9 A;  2HOD B;  3N4X A;  3H1H G;  1GD2 E;  2KUB A;  2ZT9 D;  1NTK K;  3BCC E;  1IO4 A;  1PGQ A;  1WMK A;  1SQB K;  1DEB A;  1NU1 J;  3D6Y A;  1BSN A;  3D6Z A;  5CCH C;  1AJY A;  3CX5 D;  4PV1 D;  1ZLL A;  1FDI A;  1ZRT E;  2E5T A;  5B66 E;  3NFQ A;  2R5D A;  1KC8 Q;  1U57 A;  3G4S P;  5DJT B;  2A45 G;  5KAI H;  1FZC A;  2I8D A;  1JB0 J;  1QVF O;  3I56 P;  3CWB D;  1W5C E;  2G3A A;  3MTU E;  5KKZ C;  2G8Y A;  1RQV A;  1X9V A;  3QWO C;  2WT7 B;  3G9R A;  1G2C A;  4B86 A;  5KLV K;  2BEZ F;  2IZ1 A;  5AVY B;  1FZB A;  1FU1 A;  2XND H;  2O1J A;  3L75 E;  4C7R A;  4DZO A;  1Q7Y Q;  3L70 J;  4M3L A;  1KQG B;  4JF7 A;  3D70 A;  3PH0 A;  1BDD A;  1JM0 A;  1CZQ A;  3L73 E;  2AXC A;  3Q2Y A;  1PPJ G;  4W80 A;  1N86 A;  3H6P A;  1MV8 A;  1QL1 A;  1A02 J;  3L71 D;  2P67 A;  1T6A A;  3LW5 J;  1KIL C;  4H44 B;  3IR9 A;  5B5E H;  1SLQ A;  1YIT P;  1N73 A;  2B88 A;  3CXH I;  2C9L Y;  2Z5H A;  2OTK E;  1TU3 F;  1LT1 A;  3MIW A;  1LP1 A;  1IFP A;  4WY4 A;  3SFE C;  2B87 A;  4WY4 D;  3FXE A;  4ZKP A;  3O6Q B;  1SQV G;  2GUS A;  2QRX A;  2CPB A;  1YI2 P;  1AA0 A;  1QL2 A;  5H2F E;  2BCC J;  4BRY B;  1GMJ A;  1IZN B;  2YO3 A;  2WMM A;  2Q3I A;  2XV5 A;  5AVT B;  5GTI H;  1YQ3 C;  3BRV B;  2M3B A;  1RF1 C;  1J1E C;  1OX3 A;  1LWU A;  1DD3 A;  3CCJ P;  3M91 A;  5CMZ A;  1GL2 A;  1EDL A;  1K04 A;  4MN4 C;  1YJW P;  3IN6 A;  1GL2 D;  1S1C X;  2Y0D A;  2ITA A;  4CPG A;  3L74 D;  1OXZ A;  3BCC G;  4RJT A;  1EZV D;  1IFJ A;  4XE5 B;  3L70 E;  1JNM A;  1SQX K;  1EDK A;  1FZG A;  1QEX A;  1SQB D;  4IFD K;  4WBA A;  4I6M C;  3A0B E;  3CD6 P;  1P84 I;  1T3J A;  1SFC A;  1VQ5 P;  1SFC D;  1FJK A;  3IF4 A;  4H13 B;  4U3F J;  2HPC B;  1S9K E;  3V2Q A;  3FWL A;  3AE5 C;  4JBZ A;  3KZI E;  1Y47 A;  5APS A;  5KAF E;  1AFO A;  4ASV A;  1S5L X;  2YNY A;  2IFN A;  5APX A;  3E1R A;  3RK3 C;  2ZVO B;  1DIP A;  2FYU G;  3VYI A;  1NTM E;  2QSI A;  4ZKU A;  2JJL A;  1VQP P;  5KLV D;  2ZYA A;  2M5A A;  3L75 G;  4Y99 B;  5AW9 B;  1OVR A;  2ZXE B;  1OMI A;  1LTJ A;  1JUN A;  2OYI C;  4BXL A;  5KJ7 A;  1IFM A;  5KJ7 D;  2P58 A;  5AVW B;  3IFM A;  1NHL A;  3F89 A;  1LNQ A;  1NTZ K;  2IYO A;  1FBM A;  3L72 D;  1SP4 A;  1SQP J;  1G1J A;  2P2U A;  3V4W A;  2E42 A;  1KOR A;  3H32 A;  2QA4 P;  2JP3 A;  4I7Z B;  3EWK A;  5AVV B;  1BE3 E;  3TNU A;  1N7S C;  2JEE A;  1HTL C;  1LTT C;  3G71 P;  3S9O A;  2JDI H;  1BCC D;  1NU1 K;  1LTG C;  1ZR2 A;  5CCH A;  1M8O B;  1H89 A;  1PP9 D;  1GK6 A;  5CCH D;  4U3F E;  2E5Y A;  1ZW0 A;  4N78 D;  3H1H J;  4PD4 H;  1KV4 A;  3P8C E;  2QM7 A;  1T2K C;  3CXH E;  2FFD B;  1KMI Z;  5AVR B;  3P32 A;  4EDF A;  4C7N A;  3M9H A;  2J59 M;  2E75 B;  3V2R A;  3TSI A;  2MKV A;  4H0L B;  5KLI C;  1BGY D;  1YIJ P;  1SQQ E;  4IFF A;  4U7J A;  3L70 G;  4KHX A;  1HUC A;  3RBZ A;  3RL0 B;  3M9Q A;  2OGU A;  3HUS B;  1SQX D;  4IOI H;  2N1T C;  3AE4 C;  1EDJ A;  2WZ7 A;  4K3A A;  1KYO I;  2LR2 A;  4A7P A;  2IYP A;  1L0N K;  3RK2 C;  1MUU A;  3F5H A;  5AW6 B;  4AUW A;  1NYH A;  2WSC J;  3T97 B;  1KIL A;  2E76 B;  1SQP E;  1KIL D;  1M1J B;  2IBZ D;  2ZYD A;  1VQ4 P;  5CBN A;  3OA7 A;  2V4H A;  3B5N C;  1LTS C;  1NTM G;  4PD4 D;  3L36 A;  2KS1 A;  1H0T A;  3B71 A;  5H2F H;  1OVV A;  2Y9Z A;  1P84 E;  1NGM B;  1FJP A;  1X79 B;  1QX8 A;  3TGU D;  3ZDM A;  1GTW A;  4L74 A;  4LLH A;  3HE5 B;  1JY3 P;  1MKM A;  3S4R A;  3AEC C;  2L5G B;  1Y9B A;  3PRJ A;  1SQV J;  3H25 A;  4D6T D;  3RGU A;  1RF1 A;  3L73 D;  1T3U A;  3AEA C;  2P1J A;  2BEQ D;  1NTZ D;  1IK7 A;  1RQU A;  2K9J B;  3TF5 A;  3A0B H;  1BE3 G;  4GIF A;  4I2L C;  3PTZ A;  3HD7 A;  3LW5 H;  2WSF J;  2WIT A;  3HD7 D;  3H1L D;  4U3F G;  1NU1 D;  2FY8 A;  3AED C;  3KZI H;  5KAF H;  2FXO A;  4KT0 J;  3BCC J;  1PGP A;  4YXW H;  4HJG H;  4C46 A;  3JCU H;  1PPJ E;  1JCD A;  2QG4 A;  4H44 C;  2HYN A;  3MHV A;  4PJ0 H;  2P7J A;  2ZVN B;  3SSU A;  1SQQ G;  3RK3 D;  2Q3E A;  1N7L A;  3AE7 C;  2N1T B;  3EQ2 A;  2FYU J;  4GOD A;  4GDO A;  3L70 D;  2OYI A;  5EFW B;  3PHL A;  2A06 D;  1G2C B;  2C9N Y;  3TK1 A;  1YJN P;  1SQP G;  3IAO A;  3CCL P;  2W27 A;  1PL5 A;  3CCQ P;  1D7M A;  2KNC A;  4ASW A;  1YQ4 C;  3B5N B;  1R5S A;  3E1I A;  3CC4 P;  2YIU C;  3CC2 P;  5BVZ A;  2JKV A;  1MFZ A;  1N7S A;  1OW6 A;  1QVG O;  1KYO E;  4JQ0 D;  1YJ9 P;  2OYO A;  3PLN A;  1N7S D;  3A0H E;  1JTH A;  3CXH H;  2I1K A;  2HG5 D;  3BRT B;  3JC2 2;  2AEM A;  1KB9 I;  3KDP B;  2IDB A;  3Q5S A;  4GOE A;  2BCC D;  3MGN A;  3R2P A;  1ZXG A;  1T2K D;  4H13 C;  2H8P D;  4RES B;  4Z1M H;  1L0L E;  5AW5 B;  2OQQ A;  1NJI Q;  2YKP A;  1VL2 A;  2YXQ B;  3CX5 I;  3G3Z A;  3WU2 E;  2Q9I A;  4IL6 H;  2H43 A;  3A5T A;  2O01 N;  5AVS B;  3SWY A;  2FYU E;  2KLV A;  1FOS F;  1NWQ A;  4UB6 E;  2KSE A;  2AXT H;  4Y99 C;  2B89 A;  1GU4 A;  5GTH E;  1QGK B;  1NAY A;  2WSS H;  3II6 A;  4HB1 A;  3RK2 D;  1RF0 C;  3VN0 A;  1M57 D;  1H8A A;  4N3Y B;  2YMK A;  2WPS A;  1P84 H;  3CXH D;  1LJ2 A;  1SVF A;  1DH3 A;  2M8R A;  3B5N D;  4XFJ A;  2ZAE B;  3H1I D;  3C9I A;  2HOD A;  3NTN A;  4I7Z C;  2O01 J;  3OAK A;  1IJD B;  1K05 A;  1NTM J;  4I1L A;  2A45 H;  2FYZ A;  2QJY B;  1LT9 A;  1QLE D;  4EYY Q;  2KZI A;  2YMY A;  4WWI A;  1FZF A;  2NZ2 A;  1SQV K;  2DW3 A;  2FFD C;  1YTZ I;  1GW3 A;  5AW3 B;  2IFM A;  4N6J A;  4OGQ B;  2V7Q J;  5AW2 B;  2E75 C;  2KXP B;  2YIU B;  2KSJ A;  3PJS K;  2WSC H;  1URQ B;  3H1J E;  4H0L C;  1M56 D;  1OVU A;  3VMZ A;  1YYC A;  3VP8 A;  1JY3 O;  2WSE J;  4YTP C;  3RL0 C;  5BU5 A;  3OJA B;  5TIS E;  3HUS C;  1BE3 J;  3CWB J;  3H1H D;  2SPZ A;  3WUV A;  1EC5 A;  2WVR A;  1KFM A;  1L0L G;  1EZV I;  1EXJ A;  1LGH B;  2E76 C;  1KZU B;  1M1J C;  2YKO A;  4H44 D;  3FXD A;  2FXM A;  2JWD A;  3M06 A;  3CCU P;  2W8Z A;  1KB9 E;  3AE8 C;  1FS0 E;  3MUD C;  2Q6Q A;  3VTP C;  1SQQ J;  2NPS B;  3CCE P;  3O6Q A;  1AQ5 A;  5E79 H;  5AVU B;  2K1A A;  3UIA A;  1VQN P;  1VQ8 P;  2R5B A;  2WSF H;  4BRY A;  3BAT A;  4YPC A;  1FZE A;  3MZW B;  3CX5 E;  2QJP B;  2WPV B;  5AW1 B;  1KYO H;  1HH0 A;  1HGV A;  1X8Y A;  3FWN A;  1PPJ D;  3NXS A;  3VOP A;  4NPE A;  3KQG A;  2W83 C;  2QIW A;  3VMY A;  1S5L E;  3C8V A;  2ZFC A;  1JY2 P;  1N8R Q;  5B66 H;  3CWB E;  2GUV A;  4K35 A;  1YTZ T;  1OZH A;  1PV3 A;  1E5W A;  2B9B A;  3SFD C;  3BAS A;  3PP5 A;  3H1K G;  2KS1 B;  2WWW A;  1GW4 A;  4DT0 A;  3Q3D A;  3WU2 H;  1VPC A;  3V2P A;  2HPC A;  1CI6 B;  4H13 D;  1JMB A;  5AVQ B;  2E74 B;  1NOH A;  1NTK J;  1SQV D;  1L2P A;  1OW8 A;  1PGJ A;  3GHG B;  2Z4E A;  3L71 E;  2FXP A;  2AEJ A;  5AW7 B;  3H1J G;  5GTH H;  1RE4 C;  2R3S A;  1KFN A;  4DCK A;  2K37 A;  4RO0 A;  3AEF C;  1VF5 B;  1JEK A;  2OTL P;  2N9Y B;  3CCV P;  1NO4 A;  1KYO D;  3L35 A;  2Y0E A;  2KI7 B;  2YO2 A;  3BCC D;  4EI2 A;  2OYH B;  2FBW C;  3VMX A;  1FE6 A;  3AEE C;  1L0N G;  2LXC B;  1ZRT D;  3HTK B;  1PIX A;  4YXD C;  2R3C A;  4EOT A;  1VQ6 P;  3ABV C;  4ZNC A;  3I55 P;  3V2N A;  3USS A;  1Q86 Q;  1HJ0 A;  1A02 F;  1GK4 A;  3V5B A; 
#chains in the Genus database with same CATH homology
 1BCC G;  1KYO H;  2BCC G;  1PP9 G;  1SQX G;  4D6T G;  1KB9 H;  3H1H G;  2IBZ G;  3H1L G;  3L72 G;  3H1I G;  1SQP G;  3L73 G;  1PPJ G;  3TGU G;  4U3F G;  2FYU G;  3H1K G;  1NU1 G;  3CX5 H;  4PD4 H;  1NTZ G;  3L71 G;  3CXH H;  3BCC G;  3L74 G;  3H1J G;  1L0L G;  1NTM G;  1EZV G;  1P84 H;  1BGY G;  1NTK G;  3L70 G;  1BE3 G;  1SQQ G;  5KLV G;  3L75 G;  1L0N G;  1SQB G;  3CWB G;  1SQV G;  2A06 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...