3CXHH

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 93
sequence length 93
chains with identical sequence S
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3cxhH00
1BE3G 3H1IG 3TGUG 1SQQG 3H1LG 1SQPG 3L72G 1SQVG 2IBZG 1BGYG 2BCCG 1P84H 1BCCG 3L74G 1NTMG 3L73G 1L0NG 3CWBG 2A06G 1NTKG 4D6TG 3L71G 3L70G 1SQXG 1L0LG 1PPJG 1SQBG 4PD4H 1PP9G 1NTZG 2FYUG 3BCCG 3H1KG 1KYOH 1KB9H 1EZVG 4U3FG 3CX5H 3L75G 3CXHH 3H1JG 3H1HG 1NU1G 5KLVG
chains in the Genus database with same CATH superfamily
2W90A 3SWFA 1YBKA 3H32B 3H1KJ 5DJTB 2FYNC 2Q6QA 5AW7B 1CW5A 1L4AA 5AW3B 1NU1J 4GOFA 3MZWB 3NFQA 1PGOA 3BRVB 3FX0A 2NZ2A 2QIWA 5AVRB 1G2CB 3CCRP 1ZLLA 3P7KA 3V4WA 1Q81Q 1AQ5A 3AE8C 2B87B 1W2EA 2GUSA 2Z5IA 1FE6A 3D71A 2FYNB 3P8MC 3H1JG 1DD4A 3B5NB 4UB8H 2W6AA 3H1LD 2L91A 3M0DA 2P67A 2WSEH 3CL3D 1ZRTE 1ZR4A 5CJ4A 2YO2A 2E5YA 1GZLA 2JWDA 3MUDA 3HD7D 2OYOA 2JR8A 1EZVG 2Q1KA 1WT6A 2R5BA 4H13C 3II6A 1N86A 2C0WA 2BCCD 4D6TE 3L37A 1ZN5A 2PAJA 1VQNP 2R5DA 3RK3D 1YYCA 5KAFE 3MHVA 3RL0B 1Y8AA 2WZ7A 1M1JC 2K1AA 2ZT9C 4D6TJ 1BGYE 1VQMP 3L72G 2H88C 1FAVA 2B88A 2KIKA 1VF5D 2A06D 1L0NG 2A45H 1IFNA 3GG2A 4H13B 1QL2A 1PZQA 3LIEA 3Q5RA 3M0AA 2OYIA 2FXOA 4YTPC 1JY2O 4EI2A 3TGUE 5APVA 3H1HG 3QWOC 1JO5A 1S2EA 3CI9A 4JYBA 1DEEG 2A45I 3TK1A 1S5LH 1AV1A 1NTMG 1M1JB 4AYCA 1NTKG 2ZT9B 1SFCC 1JB0J 2KLVA 1SP4A 3V5BA 5AW5B 2FFDA 1KFNA 3MP7B 3TGUJ 3RK2C 3HRNA 5KJ7C 3EWKA 1FOSF 2ZYGA 2NPSD 1NWQA 3AE3C 4AUWA 1RF1A 1R5SA 5AW9B 3OAKA 2WSFH 1HJBA 2V7QJ 4I6MC 2OARA 2E5TA 3CWBD 1LTBC 2QJYC 3SSUA 1LTGC 5E79E 3N4XA 3RBZA 2WMMA 3C9IA 3PLNA 4H0LD 1GU5A 3H1LE 5KLIC 1X8YA 2PRRA 1BE3G 2I1KA 2ZFCA 3FWNA 3EFGA 4NPFX 4UB6E 2O3JA 3L70G 1L0LG 5APWA 2E42A 4IOIH 3AECC 1U7MA 3H1LJ 2KOGA 3S1KA 1HH0A 2JKVA 1USEA 2BCCE 1QX8A 3NXSA 3M06A 4L76A 1EC5A 5KLIB 1ZW0A 1Q7YQ 1ZMEC 3AEGC 2B89A 1VF5C 3U1CA 2M0BA 2BCCJ 3L75G 2HPCB 1RQUA 2PGDA 4M3LA 2KSEA 4WY4D 1FBMA 2A06E 1LTJC 4EDFA 3ABVC 3WUVA 5APQA 1K73Q 4UB8E 1OVVA 3KYQA 1FDMA 2JDIH 1LWUB 1LT9C 1VF5B 5GTHH 2GUVA 1HUCA 3IF4A 5AVTB 3W67A 4RESB 3CCSP 1T2KC 3TF5A 4ASWA 1LTJB 1PV3A 3CX5H 3OW2O 2IX7C 4OWFA 4IFMA 1LP1A 5APSA 2IPPA 1OIPA 3CWBE 2YKPA 1PPJD 3KDPB 1LT9B 3BCCD 2XDJA 1YTZI 2Q3EA 2IZ1A 1JMMA 2R3CA 2KYVA 2IBZI 1QVGO 2OYHA 4JF7A 3L71G 4EYYQ 1YTZT 1N8RQ 3H1JE 4H0LB 4YPCA 1DX7A 3JC22 3D6YA 1S5LE 4PV1C 1PGJA 3K5BA 2K9JB 3TNUA 3H1JJ 1EDKA 2P7JA 1YIJP 4ZKPA 3CX5D 4L74A 1QL1A 4OH8B 4MN4C 5CMZA 2D2CD 3VMAA 1CI6B 4L73A 2ZVOB 2IBZD 1OX3A 2W83C 3P32A 3RL0g 2W6BA 3WMM0 4PV1B 5CCHD 2FYUD 1NTZG 4JYCA 2WSFJ 3F5HA 1OW8A 1KFMA 2Q9IA 3JCUH 1RE4C 3HE5B 1P84H 2KS1B 1NGMB 2HLOA 2AXTH 4IFDK 3PRJA 3CD6P 3H1KD 3L72J 4YXWH 2KZJA 1OMIA 1OZHA 1NU1D 1L0NJ 3AEBC 1HWTC 1SQPD 1NKNA 3PH0A 1P84I 4WY4A 1UIXA 2FYZA 1PPJE 1JMBA 3H1HJ 3BCCE 2RN0A 3AEDC 1S3JA 3V6IA 2LXBA 3G9RA 1YQ4C 2YXRB 1NTKJ 1H0TA 2O01J 3G6EP 1N7SC 1GL2A 2J59M 1MV8A 3KQGA 1SQXG 1JOCA 1K05A 1SQBG 2Y0CA 2Q7CA 3BVHA 2KLUA 4HYTB 1BE3E 5APXA 5AW8B 1FZFA 2QA4P 5GTHE 3CCVP 5BU8B 1P84D 4C7NA 3V2NA 1L0LE 2R32A 2HODA 2D2CC 2QSIA 3CX5E 1LTAC 1BE3J 5AW2B 1OVUA 2V7QH 1X22A 1S4XA 1N7SB 3TSIA 2FYUK 2IBZE 1L0LJ 3HE4A 1HF9A 5EFWB 1MKMA 4D6TD 3PJSK 2XNDH 1KQLA 1L2PA 3N7NA 2FYUE 3OA7A 1QEXA 1PGPA 4C46A 1NJIQ 1N73A 4XA4A 2D2CB 5E79H 4BRYA 1FJKA 3Q1MA 4LC1A 1NU1K 2JJLA 1FZCB 2FYUJ 1VQLP 1QGKB 1SQPK 4QMAA 3L75J 1A02J 3H1KE 4L75A 1PP9D 1KV4A 4UB6H 1NU1E 4WB4A 1OWAA 4OVNF 1SQPE 5AVYB 2RMZA 4JPZB 2BASA 2LKMA 2M5AA 1VQ8P 1S9KE 1YJWP 1OVRA 3AE7C 1SQPJ 2FBWC 4BWNA 1GMJA 3VMXA 3GHGB 3O6QB 3H1IG 3RBXA 1SFCD 1LJ2A 3L73G 3RK2D 2ZXEB 5KJ7D 1EXIA 3H32A 1SVFA 2XNXA 1FC2C 1IFJA 1N2DC 3JCUE 2KNCB 4N3YB 2G3AA 1P84E 3KZIE 2AXTE 2E74C 2QVAA 3L74G 2YO3A 1G2CA 2H8PD 3SFDC 5AW1B 2QJPC 1X0TA 3Q2YA 3VOPA 1NAYA 2KP8A 2B87A 1JY3P 5KLVG 1SQQD 2IFMA 2CPSA 2Q5UA 1YQ3C 2Y0EA 3B5NA 4H44C 1HVVA 3A7OA 1PGQA 1HBWA 3P8CD 2E74B 5AVQB 3AE4C 1OW6A 3CXHH 1RF0C 2WT7B 1K8AQ 1AA0A 1FS0E 2QJPB 1YJNP 1E5WA 3FWLA 3VTPC 5AW6B 1PP9E 3G71P 3VN0A 4YXDC 1T6AA 2ZXXA 1FDIA 1HGVA 1SQVE 2FKWB 2W27A 5AVUB 3IN6A 1NTZJ 1PP9J 2N9YB 3I5CA 5DJUB 2YKOA 3R2PA 4I1LA 3A5TA 4N78D 3W68A 2YXQB 1SQVJ 1K04A 2V4HA 2RH0A 1ZV8A 4Z1MH 2WVRA 1FZEA 4KJMA 5TISH 1T2KD 5BVZA 2YMYA 1M1JA 3CXHD 2C9LY 5APYA 3B71A 2C0XA 1SFCB 3RK2B 2I1JA 2ITAA 2J58A 1KZUB 3H1JD 1SQQE 2QJYB 1E79H 4PJ0E 2YNYA 1SQXJ 1SQBJ 3A3YB 4DOJA 3L35A 3LW5J 4RKUJ 2WITA 5AW0B 1MZ9A 2WWWA 3WUTA 3V4QA 3P8CE 5KJ7A 4PV1D 1EZVD 1SQQJ 2O01H 1RE3C 3M9HA 3JSVC 1J1EC 2IYOA 1A02F 1AQTA 1GTWA 2BEQD 3CCEP 2Z5HA 1U57A 4GODA 5L8RJ 1M7LA 2W6JH 1KQFB 4XE5B 1JTHA 4U3FG 3HD7A 2XKMA 2IFNA 1GK6A 3HTKB 1U7JA 2PP6A 3L72D 5AVWB 3IFMA 1AVOA 3U1AA 1BCCG 2HPCA 1L0ND 3AEFC 2P2UA 4WVZA 1JCCA 1W5CE 4N78E 2VRSA 1KN7A 1AVYA 3H1HD 3NTNA 5B5EE 2N1TD 3GW6A 1NTMD 1Z56A 4R4MA 1NTKD 1LWUA 1GU4A 4N6JA 2UWJE 2ZVNB 3PP5A 3CXHE 2JEEA 3CX5I 3HUSC 1IZNB 1LTJA 3L73E 2OGUA 3MGNA 2YMKA 2G8YA 2WTYA 5CBNA 3M91A 3L73J 1GK4A 1LT9A 1BE3D 1N7SD 3G3ZA 2NPSA 3G4SP 2WPVB 4LLHA 3L70D 1L0LD 3HUSB 3IAOA 1KILD 2SPZA 1EZVE 1Q90D 1VL2A 5KLVE 2OQQA 3L74J 1JEKA 4HB1A 5TISE 1URQC 4HJGH 3T97B 3GF7A 3Q5SA 3I56P 2HFED 1IK7A 5KLVJ 1L0NK 1FU1A 2K9JA 1KB9H 5CJ0A 3L75D 3L72E 3MIWA 1WMKA 1G1IA 3I55P 1ZOYC 1M1KQ 2OTLP 1AJYA 1DIPA 1L0NE 1T3UA 2W8ZA 1BGYG 1L4AD 2FXMA 1JNMA 2XU6A 3B4SA 3KZIH 4ZMDA 1CI6A 2N1TC 1NTMK 1URQB 1KB9I 1G1JA 2ZJSE 1NTKK 3H6PA 5AVZB 3H1HE 3S9OA 2N9BA 3SFEC 3TGUG 5CHXA 1NTME 3Q5PA 1NTKE 1EXJA 1GW4A 3HE5A 3AE9C 1S9KD 3GLMA 3D6ZA 2KS1A 1T8ZA 4JBZA 5KAIH 1NOHA 3A0HH 2L5GB 1NTMJ 2N1TB 1WRGA 2K88A 2J5UA 5K5GB 2PFXA 2OTKE 3VYIA 1NAFA 4K35A 1KB9D 5CCGC 1IK9A 1RHZB 1L0LK 5M1BA 1KILC 1XTCC 2B9BA 2AXCA 1RE4A 3CC4P 3H1LG 4IL6X 2QEXP 3L70E 1RY3A 5TJHA 1KILE 3L71D 3VMZA 2K3RA 2M8RA 4KT0J 1VDFA 2E74D 3AE6C 5GTIH 1HTLC 4CPGA 4I7ZC 3L70J 2BCCG 2QJKC 1KILB 2JWAA 1UIIA 2YIUC 4C7RA 1L4AC 1YHQP 3L75E 5APUA 1VQOP 2NRGA 1JY2P 4H44D 4TLFA 1BSNA 1N7SA 4BXLA 2A06G 4ASVA 4U3FE 2IDBA 2GM4A 1NTZD 3TDKA 3LW5H 2WPQA 2WQYC 2RKLA 1Q86Q 2YIUB 2QE7H 3KHUA 1L4AB 2IYPA 1SQVD 3M9QA 4U3FJ 4PJ0H 3M0DC 1LGHB 1GW3A 1RQVA 1FZCA 4O9BA 3MUDC 5AVXB 5CCHA 1RH5B 2ZYAA 1FZGA 1M57D 1LNQA 1SS1A 2QM7A 5KKZC 2GA1A 1IFPA 3CWBG 3B5NC 5CBOA 1KB9E 2KB7P 5H2FH 2KK7A 3M9BA 1D7MA 1BDCA 3C1LA 2XV5A 1H89A 1VQ5P 2A45G 3MD0A 3L71E 3GHGA 2WPRA 3O6QA 1LTTC 1SQXD 1SQBD 1IFIA 5KKZB 1HJ0A 4DJGA 3WU2H 2OYIC 1FDOA 2QM8A 3L71J 2KNCA 3TYYA 3RL0C 1NVOA 1PFIA 2P1JA 3Q3DA 5B5EH 5C39A 5KAIE 3CCUP 4IL6H 3FXDA 3A0HE 4RJTA 1VQ6P 2FFDC 5B66E 4GOEA 1NTZK 3OJAB 1NO4A 2H43A 1BDDA 2Z4EA 1RF1C 3B8EB 2K9YA 3AEEC 3BRTB 2OYIB 2QG4A 5AW4B 1OW7A 1NHLA 1NTZE 1LTSC 1SQVK 3CPWO 2CPBA 1MUUA 3CXHI 4H44B 4GDOA 4OGQD 2KSJA 1IO4A 4KHXA 2FFDB 3CC7P 2WT7A 4PD4E 1CSBA 2JO1A 4LGDE 2LR2A 4A7PA 3WUUA 1T3JA 2HG5D 1JY2N 5GTIE 3CMAP 1RF1B 1BGYJ 3CCQP 2AEMA 2HYNA 3CMEP 2WSSH 4K3AA 5AVSB 5APTA 1VQ9P 1PPJG 4HH2A 1K9MQ 3C8VA 3BCCG 3SWYA 1RF0A 2MJZA 1EZVI 1SQXK 1SQBK 3KXDA 1S72P 2O01N 3H1ID 3A2AA 3GMAA 4DT0A 3PTZA 3VP9A 1M90Q 3E1RA 3L73D 1J1DC 1SQXE 1SQQK 1H8AA 1SQBE 4GT1A 1AFOA 2XZRA 1MFZA 3V2PA 4DCKA 1NYHA 2R3SA 1IJDB 3HD7C 1Q2NA 4HKZH 3CCMP 1H88A 1NH4A 2E43A 2H89C 3L74D 2H7HA 2M3BA 1SFCA 1EQ7A 1KTMA 3CLQA 4GIFA 3RK3C 3E7KA 1J1DB 1PL5A 4W7YA 2MKVA 5KLVD 1DD3A 2HR3A 2IBZG 1Q82Q 3RK3E 1JTHB 4OGQC 3HD7B 5H2FE 3AE1C 1LWUC 4EIJA 1JY3N 1X79B 2FYUG 2C9NY 1URQD 1JY3O 2OTJP 2O1JA 2WSCH 3RK3B 1ZXGA 1Y9BA 2OYHC 1J1EB 4RO0A 3WU2E 5AVVB 3CC2P 1LP1B 1VQ4P 3V2QA 1M56D 3H1KG 1KYOH 4OGQB 3BASA 1NU1G 3USSA 3A0BH 3PHLA 1SQPG 1FZBA 3AEAC 2E75D 4WBAA 2NPSC 1GL2D 1IFMA 4IL6E 3HTKA 1M8OB 2IZ0A 1KQGB 1KYOI 1RE3A 3BATA 1FJPA 4ZKUA 2WSEJ 1BSHA 1R8EA 1HGZA 3H1IE 2OYHB 4Y28J 4TT3H 2E76D 1ZR2A 4H0LC 4WWIA 1VQPP 1EDLA 2Y9ZA 2KI7B 3MTUE 1EDJA 3ITKA 2NPSB 3H1IJ 1ZP0C 2WPSA 2KZIA 3CWBJ 2Y9YA 3L74E 3TNUB 4B86A 5KLVK 5CCGD 3EQ2A 5BU5A 1VQKP 1KYOD 1VQ7P 1PIXA 4JQ0D 1SLQA 1LTIC 2FXPA 2DW3A 1GDTA 1XTGB 4XFJA 2KUBA 1JM0A 1YITP 4D6TG 4WY4C 1FZAA 1DEBA 2KXPB 3HUSA 3FGAD 4EOTA 4NPEA 1LT1A 1MFTA 1VPCA 1EDIA 2LXCB 3CCLP 1JUNA 2E75C 2P10A 2BEZF 3T97A 1GL2C 1N7LA 2QRXA 2Y0DA 1PP9G 4U3FD 3FXEA 2AEJA 3EFFK 1USDA 4WY4B 1DH3A 2I8DA 1Y47A 1SQVG 1BCCD 1OXZA 3AE2C 1NKZB 4Y99C 2E76C 1GD2E 3V2RA 2AEFA 3AE5C 3H25A 1X9VA 1H0TB 3E1IA 3UIAA 4NPDA 1JCDA 1KC8Q 1URQA 2E75B 1GL2B 2O1KA 5B66H 3KPEA 1QLED 5KTBA 2K37A 1J2JB 1FOSE 1KQSO 3QH9A 2YKQA 1IC2A 3L36A 4C7NB 1TU3F 4Y99B 5KAFH 2E76B 2ZYDA 1N73C 2HODB 3B5ND 3VP8A 3BCCJ 3U59A 2N1TA 3LIDA 1CZQA 1KYOE 3R4YA 1KMIZ 1R5LA 3F89A 3CCJP 4PD4H 3ZDMA 2WSCJ 3A0BE 3HE4B 2P58A 3D70A 3IR9A 1YJ9P 1SQQG 4R4LA 1KD1Q 1ZRTD 1W2BO 4PD4I 1N73B 2ZAEB 2M3EA 2Q3IA 4BRYB 2POHA 1YI2P 4DZOA 1FZCC 2R44A 4W7ZA 5CCHC 3RL0D 3L4FA 4U7JA 3VMYA 3S4RA 1KORA 4IFFA 1IFDA 3SWKA 2CK3H 4W80A 3NMDA 4I2LC 5CCGA 4H13D 4I7ZB 2JP3A 4ZNCA 1KILA 3O8ZA 1S5LX 3GF3A 2QJKB 2M5AB 1S1CX 1BCCE 1BGYD 1OFCX 3GHGC 3RGUA 4PD4D 1QVFO 4GKGA 4AQRD 2ZT9D 1BCCJ 2FY8A 3TGUD
chains in the Genus database with same CATH topology
1BE3G 3H1IG 3TGUG 1SQQG 3H1LG 1SQPG 3L72G 1SQVG 2IBZG 1BGYG 2BCCG 1P84H 1BCCG 3L74G 1NTMG 3L73G 1L0NG 3CWBG 2A06G 1NTKG 4D6TG 3L71G 3L70G 1SQXG 1L0LG 1PPJG 1SQBG 4PD4H 1PP9G 1NTZG 2FYUG 3BCCG 3H1KG 1KYOH 1KB9H 1EZVG 4U3FG 3CX5H 3L75G 3CXHH 3H1JG 3H1HG 1NU1G 5KLVG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 G;  3H1I G;  3TGU G;  1SQQ G;  3H1L G;  1SQP G;  3L72 G;  1SQV G;  2IBZ G;  1BGY G;  2BCC G;  1P84 H;  1BCC G;  3L74 G;  1NTM G;  3L73 G;  1L0N G;  3CWB G;  2A06 G;  1NTK G;  4D6T G;  3L71 G;  3L70 G;  1SQX G;  1L0L G;  1PPJ G;  1SQB G;  4PD4 H;  1PP9 G;  1NTZ G;  2FYU G;  3BCC G;  3H1K G;  1KYO H;  1KB9 H;  1EZV G;  4U3F G;  3CX5 H;  3L75 G;  3CXH H;  3H1J G;  3H1H G;  1NU1 G;  5KLV G; 
#chains in the Genus database with same CATH topology
 2W90 A;  3SWF A;  1YBK A;  3H32 B;  3H1K J;  5DJT B;  2FYN C;  2Q6Q A;  5AW7 B;  1CW5 A;  1L4A A;  5AW3 B;  1NU1 J;  4GOF A;  3MZW B;  3NFQ A;  1PGO A;  3BRV B;  3FX0 A;  2NZ2 A;  2QIW A;  5AVR B;  1G2C B;  3CCR P;  1ZLL A;  3P7K A;  3V4W A;  1Q81 Q;  1AQ5 A;  3AE8 C;  2B87 B;  1W2E A;  2GUS A;  2Z5I A;  1FE6 A;  3D71 A;  2FYN B;  3P8M C;  3H1J G;  1DD4 A;  3B5N B;  4UB8 H;  2W6A A;  3H1L D;  2L91 A;  3M0D A;  2P67 A;  2WSE H;  3CL3 D;  1ZRT E;  1ZR4 A;  5CJ4 A;  2YO2 A;  2E5Y A;  1GZL A;  2JWD A;  3MUD A;  3HD7 D;  2OYO A;  2JR8 A;  1EZV G;  2Q1K A;  1WT6 A;  2R5B A;  4H13 C;  3II6 A;  1N86 A;  2C0W A;  2BCC D;  4D6T E;  3L37 A;  1ZN5 A;  2PAJ A;  1VQN P;  2R5D A;  3RK3 D;  1YYC A;  5KAF E;  3MHV A;  3RL0 B;  1Y8A A;  2WZ7 A;  1M1J C;  2K1A A;  2ZT9 C;  4D6T J;  1BGY E;  1VQM P;  3L72 G;  2H88 C;  1FAV A;  2B88 A;  2KIK A;  1VF5 D;  2A06 D;  1L0N G;  2A45 H;  1IFN A;  3GG2 A;  4H13 B;  1QL2 A;  1PZQ A;  3LIE A;  3Q5R A;  3M0A A;  2OYI A;  2FXO A;  4YTP C;  1JY2 O;  4EI2 A;  3TGU E;  5APV A;  3H1H G;  3QWO C;  1JO5 A;  1S2E A;  3CI9 A;  4JYB A;  1DEE G;  2A45 I;  3TK1 A;  1S5L H;  1AV1 A;  1NTM G;  1M1J B;  4AYC A;  1NTK G;  2ZT9 B;  1SFC C;  1JB0 J;  2KLV A;  1SP4 A;  3V5B A;  5AW5 B;  2FFD A;  1KFN A;  3MP7 B;  3TGU J;  3RK2 C;  3HRN A;  5KJ7 C;  3EWK A;  1FOS F;  2ZYG A;  2NPS D;  1NWQ A;  3AE3 C;  4AUW A;  1RF1 A;  1R5S A;  5AW9 B;  3OAK A;  2WSF H;  1HJB A;  2V7Q J;  4I6M C;  2OAR A;  2E5T A;  3CWB D;  1LTB C;  2QJY C;  3SSU A;  1LTG C;  5E79 E;  3N4X A;  3RBZ A;  2WMM A;  3C9I A;  3PLN A;  4H0L D;  1GU5 A;  3H1L E;  5KLI C;  1X8Y A;  2PRR A;  1BE3 G;  2I1K A;  2ZFC A;  3FWN A;  3EFG A;  4NPF X;  4UB6 E;  2O3J A;  3L70 G;  1L0L G;  5APW A;  2E42 A;  4IOI H;  3AEC C;  1U7M A;  3H1L J;  2KOG A;  3S1K A;  1HH0 A;  2JKV A;  1USE A;  2BCC E;  1QX8 A;  3NXS A;  3M06 A;  4L76 A;  1EC5 A;  5KLI B;  1ZW0 A;  1Q7Y Q;  1ZME C;  3AEG C;  2B89 A;  1VF5 C;  3U1C A;  2M0B A;  2BCC J;  3L75 G;  2HPC B;  1RQU A;  2PGD A;  4M3L A;  2KSE A;  4WY4 D;  1FBM A;  2A06 E;  1LTJ C;  4EDF A;  3ABV C;  3WUV A;  5APQ A;  1K73 Q;  4UB8 E;  1OVV A;  3KYQ A;  1FDM A;  2JDI H;  1LWU B;  1LT9 C;  1VF5 B;  5GTH H;  2GUV A;  1HUC A;  3IF4 A;  5AVT B;  3W67 A;  4RES B;  3CCS P;  1T2K C;  3TF5 A;  4ASW A;  1LTJ B;  1PV3 A;  3CX5 H;  3OW2 O;  2IX7 C;  4OWF A;  4IFM A;  1LP1 A;  5APS A;  2IPP A;  1OIP A;  3CWB E;  2YKP A;  1PPJ D;  3KDP B;  1LT9 B;  3BCC D;  2XDJ A;  1YTZ I;  2Q3E A;  2IZ1 A;  1JMM A;  2R3C A;  2KYV A;  2IBZ I;  1QVG O;  2OYH A;  4JF7 A;  3L71 G;  4EYY Q;  1YTZ T;  1N8R Q;  3H1J E;  4H0L B;  4YPC A;  1DX7 A;  3JC2 2;  3D6Y A;  1S5L E;  4PV1 C;  1PGJ A;  3K5B A;  2K9J B;  3TNU A;  3H1J J;  1EDK A;  2P7J A;  1YIJ P;  4ZKP A;  3CX5 D;  4L74 A;  1QL1 A;  4OH8 B;  4MN4 C;  5CMZ A;  2D2C D;  3VMA A;  1CI6 B;  4L73 A;  2ZVO B;  2IBZ D;  1OX3 A;  2W83 C;  3P32 A;  3RL0 g;  2W6B A;  3WMM 0;  4PV1 B;  5CCH D;  2FYU D;  1NTZ G;  4JYC A;  2WSF J;  3F5H A;  1OW8 A;  1KFM A;  2Q9I A;  3JCU H;  1RE4 C;  3HE5 B;  1P84 H;  2KS1 B;  1NGM B;  2HLO A;  2AXT H;  4IFD K;  3PRJ A;  3CD6 P;  3H1K D;  3L72 J;  4YXW H;  2KZJ A;  1OMI A;  1OZH A;  1NU1 D;  1L0N J;  3AEB C;  1HWT C;  1SQP D;  1NKN A;  3PH0 A;  1P84 I;  4WY4 A;  1UIX A;  2FYZ A;  1PPJ E;  1JMB A;  3H1H J;  3BCC E;  2RN0 A;  3AED C;  1S3J A;  3V6I A;  2LXB A;  3G9R A;  1YQ4 C;  2YXR B;  1NTK J;  1H0T A;  2O01 J;  3G6E P;  1N7S C;  1GL2 A;  2J59 M;  1MV8 A;  3KQG A;  1SQX G;  1JOC A;  1K05 A;  1SQB G;  2Y0C A;  2Q7C A;  3BVH A;  2KLU A;  4HYT B;  1BE3 E;  5APX A;  5AW8 B;  1FZF A;  2QA4 P;  5GTH E;  3CCV P;  5BU8 B;  1P84 D;  4C7N A;  3V2N A;  1L0L E;  2R32 A;  2HOD A;  2D2C C;  2QSI A;  3CX5 E;  1LTA C;  1BE3 J;  5AW2 B;  1OVU A;  2V7Q H;  1X22 A;  1S4X A;  1N7S B;  3TSI A;  2FYU K;  2IBZ E;  1L0L J;  3HE4 A;  1HF9 A;  5EFW B;  1MKM A;  4D6T D;  3PJS K;  2XND H;  1KQL A;  1L2P A;  3N7N A;  2FYU E;  3OA7 A;  1QEX A;  1PGP A;  4C46 A;  1NJI Q;  1N73 A;  4XA4 A;  2D2C B;  5E79 H;  4BRY A;  1FJK A;  3Q1M A;  4LC1 A;  1NU1 K;  2JJL A;  1FZC B;  2FYU J;  1VQL P;  1QGK B;  1SQP K;  4QMA A;  3L75 J;  1A02 J;  3H1K E;  4L75 A;  1PP9 D;  1KV4 A;  4UB6 H;  1NU1 E;  4WB4 A;  1OWA A;  4OVN F;  1SQP E;  5AVY B;  2RMZ A;  4JPZ B;  2BAS A;  2LKM A;  2M5A A;  1VQ8 P;  1S9K E;  1YJW P;  1OVR A;  3AE7 C;  1SQP J;  2FBW C;  4BWN A;  1GMJ A;  3VMX A;  3GHG B;  3O6Q B;  3H1I G;  3RBX A;  1SFC D;  1LJ2 A;  3L73 G;  3RK2 D;  2ZXE B;  5KJ7 D;  1EXI A;  3H32 A;  1SVF A;  2XNX A;  1FC2 C;  1IFJ A;  1N2D C;  3JCU E;  2KNC B;  4N3Y B;  2G3A A;  1P84 E;  3KZI E;  2AXT E;  2E74 C;  2QVA A;  3L74 G;  2YO3 A;  1G2C A;  2H8P D;  3SFD C;  5AW1 B;  2QJP C;  1X0T A;  3Q2Y A;  3VOP A;  1NAY A;  2KP8 A;  2B87 A;  1JY3 P;  5KLV G;  1SQQ D;  2IFM A;  2CPS A;  2Q5U A;  1YQ3 C;  2Y0E A;  3B5N A;  4H44 C;  1HVV A;  3A7O A;  1PGQ A;  1HBW A;  3P8C D;  2E74 B;  5AVQ B;  3AE4 C;  1OW6 A;  3CXH H;  1RF0 C;  2WT7 B;  1K8A Q;  1AA0 A;  1FS0 E;  2QJP B;  1YJN P;  1E5W A;  3FWL A;  3VTP C;  5AW6 B;  1PP9 E;  3G71 P;  3VN0 A;  4YXD C;  1T6A A;  2ZXX A;  1FDI A;  1HGV A;  1SQV E;  2FKW B;  2W27 A;  5AVU B;  3IN6 A;  1NTZ J;  1PP9 J;  2N9Y B;  3I5C A;  5DJU B;  2YKO A;  3R2P A;  4I1L A;  3A5T A;  4N78 D;  3W68 A;  2YXQ B;  1SQV J;  1K04 A;  2V4H A;  2RH0 A;  1ZV8 A;  4Z1M H;  2WVR A;  1FZE A;  4KJM A;  5TIS H;  1T2K D;  5BVZ A;  2YMY A;  1M1J A;  3CXH D;  2C9L Y;  5APY A;  3B71 A;  2C0X A;  1SFC B;  3RK2 B;  2I1J A;  2ITA A;  2J58 A;  1KZU B;  3H1J D;  1SQQ E;  2QJY B;  1E79 H;  4PJ0 E;  2YNY A;  1SQX J;  1SQB J;  3A3Y B;  4DOJ A;  3L35 A;  3LW5 J;  4RKU J;  2WIT A;  5AW0 B;  1MZ9 A;  2WWW A;  3WUT A;  3V4Q A;  3P8C E;  5KJ7 A;  4PV1 D;  1EZV D;  1SQQ J;  2O01 H;  1RE3 C;  3M9H A;  3JSV C;  1J1E C;  2IYO A;  1A02 F;  1AQT A;  1GTW A;  2BEQ D;  3CCE P;  2Z5H A;  1U57 A;  4GOD A;  5L8R J;  1M7L A;  2W6J H;  1KQF B;  4XE5 B;  1JTH A;  4U3F G;  3HD7 A;  2XKM A;  2IFN A;  1GK6 A;  3HTK B;  1U7J A;  2PP6 A;  3L72 D;  5AVW B;  3IFM A;  1AVO A;  3U1A A;  1BCC G;  2HPC A;  1L0N D;  3AEF C;  2P2U A;  4WVZ A;  1JCC A;  1W5C E;  4N78 E;  2VRS A;  1KN7 A;  1AVY A;  3H1H D;  3NTN A;  5B5E E;  2N1T D;  3GW6 A;  1NTM D;  1Z56 A;  4R4M A;  1NTK D;  1LWU A;  1GU4 A;  4N6J A;  2UWJ E;  2ZVN B;  3PP5 A;  3CXH E;  2JEE A;  3CX5 I;  3HUS C;  1IZN B;  1LTJ A;  3L73 E;  2OGU A;  3MGN A;  2YMK A;  2G8Y A;  2WTY A;  5CBN A;  3M91 A;  3L73 J;  1GK4 A;  1LT9 A;  1BE3 D;  1N7S D;  3G3Z A;  2NPS A;  3G4S P;  2WPV B;  4LLH A;  3L70 D;  1L0L D;  3HUS B;  3IAO A;  1KIL D;  2SPZ A;  1EZV E;  1Q90 D;  1VL2 A;  5KLV E;  2OQQ A;  3L74 J;  1JEK A;  4HB1 A;  5TIS E;  1URQ C;  4HJG H;  3T97 B;  3GF7 A;  3Q5S A;  3I56 P;  2HFE D;  1IK7 A;  5KLV J;  1L0N K;  1FU1 A;  2K9J A;  1KB9 H;  5CJ0 A;  3L75 D;  3L72 E;  3MIW A;  1WMK A;  1G1I A;  3I55 P;  1ZOY C;  1M1K Q;  2OTL P;  1AJY A;  1DIP A;  1L0N E;  1T3U A;  2W8Z A;  1BGY G;  1L4A D;  2FXM A;  1JNM A;  2XU6 A;  3B4S A;  3KZI H;  4ZMD A;  1CI6 A;  2N1T C;  1NTM K;  1URQ B;  1KB9 I;  1G1J A;  2ZJS E;  1NTK K;  3H6P A;  5AVZ B;  3H1H E;  3S9O A;  2N9B A;  3SFE C;  3TGU G;  5CHX A;  1NTM E;  3Q5P A;  1NTK E;  1EXJ A;  1GW4 A;  3HE5 A;  3AE9 C;  1S9K D;  3GLM A;  3D6Z A;  2KS1 A;  1T8Z A;  4JBZ A;  5KAI H;  1NOH A;  3A0H H;  2L5G B;  1NTM J;  2N1T B;  1WRG A;  2K88 A;  2J5U A;  5K5G B;  2PFX A;  2OTK E;  3VYI A;  1NAF A;  4K35 A;  1KB9 D;  5CCG C;  1IK9 A;  1RHZ B;  1L0L K;  5M1B A;  1KIL C;  1XTC C;  2B9B A;  2AXC A;  1RE4 A;  3CC4 P;  3H1L G;  4IL6 X;  2QEX P;  3L70 E;  1RY3 A;  5TJH A;  1KIL E;  3L71 D;  3VMZ A;  2K3R A;  2M8R A;  4KT0 J;  1VDF A;  2E74 D;  3AE6 C;  5GTI H;  1HTL C;  4CPG A;  4I7Z C;  3L70 J;  2BCC G;  2QJK C;  1KIL B;  2JWA A;  1UII A;  2YIU C;  4C7R A;  1L4A C;  1YHQ P;  3L75 E;  5APU A;  1VQO P;  2NRG A;  1JY2 P;  4H44 D;  4TLF A;  1BSN A;  1N7S A;  4BXL A;  2A06 G;  4ASV A;  4U3F E;  2IDB A;  2GM4 A;  1NTZ D;  3TDK A;  3LW5 H;  2WPQ A;  2WQY C;  2RKL A;  1Q86 Q;  2YIU B;  2QE7 H;  3KHU A;  1L4A B;  2IYP A;  1SQV D;  3M9Q A;  4U3F J;  4PJ0 H;  3M0D C;  1LGH B;  1GW3 A;  1RQV A;  1FZC A;  4O9B A;  3MUD C;  5AVX B;  5CCH A;  1RH5 B;  2ZYA A;  1FZG A;  1M57 D;  1LNQ A;  1SS1 A;  2QM7 A;  5KKZ C;  2GA1 A;  1IFP A;  3CWB G;  3B5N C;  5CBO A;  1KB9 E;  2KB7 P;  5H2F H;  2KK7 A;  3M9B A;  1D7M A;  1BDC A;  3C1L A;  2XV5 A;  1H89 A;  1VQ5 P;  2A45 G;  3MD0 A;  3L71 E;  3GHG A;  2WPR A;  3O6Q A;  1LTT C;  1SQX D;  1SQB D;  1IFI A;  5KKZ B;  1HJ0 A;  4DJG A;  3WU2 H;  2OYI C;  1FDO A;  2QM8 A;  3L71 J;  2KNC A;  3TYY A;  3RL0 C;  1NVO A;  1PFI A;  2P1J A;  3Q3D A;  5B5E H;  5C39 A;  5KAI E;  3CCU P;  4IL6 H;  3FXD A;  3A0H E;  4RJT A;  1VQ6 P;  2FFD C;  5B66 E;  4GOE A;  1NTZ K;  3OJA B;  1NO4 A;  2H43 A;  1BDD A;  2Z4E A;  1RF1 C;  3B8E B;  2K9Y A;  3AEE C;  3BRT B;  2OYI B;  2QG4 A;  5AW4 B;  1OW7 A;  1NHL A;  1NTZ E;  1LTS C;  1SQV K;  3CPW O;  2CPB A;  1MUU A;  3CXH I;  4H44 B;  4GDO A;  4OGQ D;  2KSJ A;  1IO4 A;  4KHX A;  2FFD B;  3CC7 P;  2WT7 A;  4PD4 E;  1CSB A;  2JO1 A;  4LGD E;  2LR2 A;  4A7P A;  3WUU A;  1T3J A;  2HG5 D;  1JY2 N;  5GTI E;  3CMA P;  1RF1 B;  1BGY J;  3CCQ P;  2AEM A;  2HYN A;  3CME P;  2WSS H;  4K3A A;  5AVS B;  5APT A;  1VQ9 P;  1PPJ G;  4HH2 A;  1K9M Q;  3C8V A;  3BCC G;  3SWY A;  1RF0 A;  2MJZ A;  1EZV I;  1SQX K;  1SQB K;  3KXD A;  1S72 P;  2O01 N;  3H1I D;  3A2A A;  3GMA A;  4DT0 A;  3PTZ A;  3VP9 A;  1M90 Q;  3E1R A;  3L73 D;  1J1D C;  1SQX E;  1SQQ K;  1H8A A;  1SQB E;  4GT1 A;  1AFO A;  2XZR A;  1MFZ A;  3V2P A;  4DCK A;  1NYH A;  2R3S A;  1IJD B;  3HD7 C;  1Q2N A;  4HKZ H;  3CCM P;  1H88 A;  1NH4 A;  2E43 A;  2H89 C;  3L74 D;  2H7H A;  2M3B A;  1SFC A;  1EQ7 A;  1KTM A;  3CLQ A;  4GIF A;  3RK3 C;  3E7K A;  1J1D B;  1PL5 A;  4W7Y A;  2MKV A;  5KLV D;  1DD3 A;  2HR3 A;  2IBZ G;  1Q82 Q;  3RK3 E;  1JTH B;  4OGQ C;  3HD7 B;  5H2F E;  3AE1 C;  1LWU C;  4EIJ A;  1JY3 N;  1X79 B;  2FYU G;  2C9N Y;  1URQ D;  1JY3 O;  2OTJ P;  2O1J A;  2WSC H;  3RK3 B;  1ZXG A;  1Y9B A;  2OYH C;  1J1E B;  4RO0 A;  3WU2 E;  5AVV B;  3CC2 P;  1LP1 B;  1VQ4 P;  3V2Q A;  1M56 D;  3H1K G;  1KYO H;  4OGQ B;  3BAS A;  1NU1 G;  3USS A;  3A0B H;  3PHL A;  1SQP G;  1FZB A;  3AEA C;  2E75 D;  4WBA A;  2NPS C;  1GL2 D;  1IFM A;  4IL6 E;  3HTK A;  1M8O B;  2IZ0 A;  1KQG B;  1KYO I;  1RE3 A;  3BAT A;  1FJP A;  4ZKU A;  2WSE J;  1BSH A;  1R8E A;  1HGZ A;  3H1I E;  2OYH B;  4Y28 J;  4TT3 H;  2E76 D;  1ZR2 A;  4H0L C;  4WWI A;  1VQP P;  1EDL A;  2Y9Z A;  2KI7 B;  3MTU E;  1EDJ A;  3ITK A;  2NPS B;  3H1I J;  1ZP0 C;  2WPS A;  2KZI A;  3CWB J;  2Y9Y A;  3L74 E;  3TNU B;  4B86 A;  5KLV K;  5CCG D;  3EQ2 A;  5BU5 A;  1VQK P;  1KYO D;  1VQ7 P;  1PIX A;  4JQ0 D;  1SLQ A;  1LTI C;  2FXP A;  2DW3 A;  1GDT A;  1XTG B;  4XFJ A;  2KUB A;  1JM0 A;  1YIT P;  4D6T G;  4WY4 C;  1FZA A;  1DEB A;  2KXP B;  3HUS A;  3FGA D;  4EOT A;  4NPE A;  1LT1 A;  1MFT A;  1VPC A;  1EDI A;  2LXC B;  3CCL P;  1JUN A;  2E75 C;  2P10 A;  2BEZ F;  3T97 A;  1GL2 C;  1N7L A;  2QRX A;  2Y0D A;  1PP9 G;  4U3F D;  3FXE A;  2AEJ A;  3EFF K;  1USD A;  4WY4 B;  1DH3 A;  2I8D A;  1Y47 A;  1SQV G;  1BCC D;  1OXZ A;  3AE2 C;  1NKZ B;  4Y99 C;  2E76 C;  1GD2 E;  3V2R A;  2AEF A;  3AE5 C;  3H25 A;  1X9V A;  1H0T B;  3E1I A;  3UIA A;  4NPD A;  1JCD A;  1KC8 Q;  1URQ A;  2E75 B;  1GL2 B;  2O1K A;  5B66 H;  3KPE A;  1QLE D;  5KTB A;  2K37 A;  1J2J B;  1FOS E;  1KQS O;  3QH9 A;  2YKQ A;  1IC2 A;  3L36 A;  4C7N B;  1TU3 F;  4Y99 B;  5KAF H;  2E76 B;  2ZYD A;  1N73 C;  2HOD B;  3B5N D;  3VP8 A;  3BCC J;  3U59 A;  2N1T A;  3LID A;  1CZQ A;  1KYO E;  3R4Y A;  1KMI Z;  1R5L A;  3F89 A;  3CCJ P;  4PD4 H;  3ZDM A;  2WSC J;  3A0B E;  3HE4 B;  2P58 A;  3D70 A;  3IR9 A;  1YJ9 P;  1SQQ G;  4R4L A;  1KD1 Q;  1ZRT D;  1W2B O;  4PD4 I;  1N73 B;  2ZAE B;  2M3E A;  2Q3I A;  4BRY B;  2POH A;  1YI2 P;  4DZO A;  1FZC C;  2R44 A;  4W7Z A;  5CCH C;  3RL0 D;  3L4F A;  4U7J A;  3VMY A;  3S4R A;  1KOR A;  4IFF A;  1IFD A;  3SWK A;  2CK3 H;  4W80 A;  3NMD A;  4I2L C;  5CCG A;  4H13 D;  4I7Z B;  2JP3 A;  4ZNC A;  1KIL A;  3O8Z A;  1S5L X;  3GF3 A;  2QJK B;  2M5A B;  1S1C X;  1BCC E;  1BGY D;  1OFC X;  3GHG C;  3RGU A;  4PD4 D;  1QVF O;  4GKG A;  4AQR D;  2ZT9 D;  1BCC J;  2FY8 A;  3TGU D; 
#chains in the Genus database with same CATH homology
 1BE3 G;  3H1I G;  3TGU G;  1SQQ G;  3H1L G;  1SQP G;  3L72 G;  1SQV G;  2IBZ G;  1BGY G;  2BCC G;  1P84 H;  1BCC G;  3L74 G;  1NTM G;  3L73 G;  1L0N G;  3CWB G;  2A06 G;  1NTK G;  4D6T G;  3L71 G;  3L70 G;  1SQX G;  1L0L G;  1PPJ G;  1SQB G;  4PD4 H;  1PP9 G;  1NTZ G;  2FYU G;  3BCC G;  3H1K G;  1KYO H;  1KB9 H;  1EZV G;  4U3F G;  3CX5 H;  3L75 G;  3CXH H;  3H1J G;  3H1H G;  1NU1 G;  5KLV G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...