3CXHH

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 16
structure length 93
sequence length 93
chains with identical sequence S
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3cxhH00
1SQVG 3L71G 1BGYG 3H1LG 3TGUG 1KB9H 4D6TG 4PD4H 1SQXG 3H1JG 1SQPG 3BCCG 1NTKG 1NU1G 2BCCG 1NTZG 5KLVG 3CXHH 2FYUG 3L75G 2IBZG 3CWBG 3CX5H 3L70G 3L74G 1SQBG 3L72G 1L0NG 1BCCG 3H1IG 3L73G 1EZVG 3H1HG 1SQQG 1PPJG 1PP9G 2A06G 3H1KG 1NTMG 1BE3G 1KYOH 1P84H 4U3FG 1L0LG
chains in the Genus database with same CATH superfamily
3IF4A 5CJ4A 2J58A 2QIWA 2QJYB 3L73E 4H0LC 1RE3C 5KLIB 1JY2N 2Q3IA 1KORA 2M5AA 3HD7B 1JY2P 1KQFB 1QL2A 2M3BA 3E1IA 2OYIA 3M9HA 2YIUC 1NAYA 4N3YB 2KIKA 2NPSD 1T6AA 1QX8A 1VQ4P 1HGVA 5CJ0A 3L75G 3FXEA 4O9BA 2KSEA 1SQVE 1BGYE 2QM7A 1QVFO 1LTJB 2V7QJ 5AVTB 1HUCA 1S1CX 1K05A 3LW5H 3JCUE 2WSSH 2QJKB 1NHLA 2OYHB 4KHXA 3RL0g 1LTBC 2M0BA 1SFCD 1OZHA 1EQ7A 3TGUG 1S9KE 1NGMB 4OGQB 5APXA 1HGZA 5AVXB 3ZDMA 1VF5B 1ZN5A 1Q82Q 5KLVG 1AVOA 5APUA 2A45I 5KJ7D 2QA4P 3T97A 3SFEC 2PGDA 1N73C 2BEQD 2GM4A 1USEA 1MFZA 3C9IA 2R3SA 2FFDB 5GTIE 3AE6C 2HPCB 1KFNA 4H44D 2R5DA 3L72G 2KNCA 3V4QA 3PLNA 5EFWB 4JBZA 1VQ7P 2IPPA 1HJ0A 1VQKP 1M1JC 3AE8C 1VQNP 3HUSC 2V4HA 1S2EA 1L4AB 1FZCC 2YXQB 1NTKK 1JY3O 2OARA 1Y47A 3B5NB 3H1KG 1PZQA 2WT7B 1KV4A 5APYA 1QGKB 4AQRD 3CCEP 2B87B 1L0LK 1M90Q 1VQ6P 1NU1G 3GHGB 1SQXK 3AEEC 4WY4D 2K37A 4JYBA 3IN6A 3PRJA 1RF1C 1RE3A 2L91A 4GIFA 2J5UA 3A0HH 3V6IA 2WSCH 2O3JA 3F5HA 3H1IE 3Q1MA 1NOHA 2ZVNB 1GL2C 2FYNB 3R4YA 5AW5B 3TGUD 2NPSB 1KQGB 1MUUA 3AE4C 3RBXA 5AW9B 4LC1A 3BASA 1CI6B 5KLVD 1R8EA 3EFFK 1YBKA 3IAOA 2IYOA 2FYUK 3H1IJ 1A02J 3Q5RA 1NTMK 1NVOA 1ZXGA 3D71A 3BVHA 4PD4H 3SWKA 2ZXEB 4IL6H 3VMYA 2P2UA 2WTYA 2MJZA 3C8VA 3L72D 1SFCB 1LWUA 3H1LE 1Q90D 1SQBK 1KYOH 1GW4A 1P84H 3BRVB 2IBZI 1T2KC 2E74D 1WMKA 1FE6A 3L70G 1YI2P 1D7MA 1SQQD 3VN0A 1SQXE 3B8EB 4JYCA 4YXWH 5AVUB 1J1EB 1S5LX 5CHXA 2Q7CA 1T3JA 3TGUJ 3RL0C 4D6TG 4H44B 1X79B 4UB6H 2RH0A 2R3CA 2SPZA 5KLVJ 1QL1A 3AEFC 4ZKPA 4ZKUA 1FOSE 3H25A 1MFTA 2QVAA 2PP6A 1RE4C 1FZCA 3TYYA 1YHQP 4Y99C 3HE4B 3BCCG 1SQQE 3U1AA 2BASA 3AE2C 2KYVA 2I1JA 2N1TC 2KS1A 3L72J 5AW4B 2H43A 1JCDA 5AVRB 2W27A 1A02F 5E79H 1LP1A 1ZRTD 1RF1A 1KB9D 4WY4B 2WPRA 2LKMA 2WPQA 3RK3C 3M06A 1OIPA 1NTME 2ZJSE 4U3FE 5CCGC 1X22A 1BCCG 3O8ZA 1N7SC 1PPJD 2K88A 2W6BA 1SQQJ 1X0TA 3VOPA 2WWWA 1BDCA 1VQ8P 1GL2A 1SQBE 2ZVOB 4C46A 1QLED 2H89C 2FXOA 1IFPA 3PHLA 1VQOP 4I6MC 4PD4E 1LTGC 4IL6E 5AVZB 3CPWO 3CX5I 4OH8B 2OYOA 2ZYGA 1PPJE 1YTZT 1KYOE 2QRXA 3L70D 5AVYB 1P84E 3U59A 1DX7A 1Q2NA 4OWFA 2V7QH 4D6TD 1Z56A 1M1KQ 2VRSA 1SQPG 3MHVA 2E75C 2NRGA 4R4MA 1XTGB 2ZAEB 3Q3DA 3FWLA 2M3EA 1AA0A 2K9JA 3W68A 2AEFA 1FZFA 2E74B 4PV1C 4UB6E 2A45G 3MIWA 5KTBA 3S1KA 1FOSF 1KFMA 3BCCD 1G2CA 3VYIA 3CXHD 3LIDA 4H0LD 1OW6A 3HRNA 1SS1A 1UIIA 4BWNA 2MKVA 3K5BA 4W7YA 2BCCE 1CSBA 4GT1A 2M5AB 3SWYA 2HODA 2OYIB 1BCCD 1KILC 5E79E 1QVGO 1JOCA 3E7KA 3KQGA 2N1TA 3CC2P 4D6TJ 3D6ZA 1IFMA 3H1JG 3H1HE 3MD0A 1SLQA 2Q6QA 3CWBG 4DOJA 2CPBA 3CCVP 3EWKA 2QJPB 4DJGA 5CCGA 3P7KA 3W67A 1N7SA 3C1LA 1BCCE 4U7JA 2DW3A 2O01J 1QEXA 1WRGA 1NKZB 3BCCJ 4ASVA 4BXLA 1PGJA 2YKPA 1T8ZA 3CCSP 3KDPB 2FYZA 2HG5D 2I8DA 4YTPC 1SQPD 4HKZH 1NO4A 2WPSA 1BCCJ 1MKMA 3CCMP 1M8OB 3GF3A 1K73Q 1ZR2A 2ZYAA 4Z1MH 4N78E 1X8YA 4GOEA 2QEXP 1R5SA 1IZNB 3RK2C 1L0ND 1S4XA 1VQ9P 3CC4P 2IYPA 2XU6A 2O1KA 1Y9BA 2LXCB 3D6YA 1FZAA 2N9YB 2E76C 2JDIH 2R5BA 2IBZG 1E79H 3L74D 1EZVG 4IOIH 2B89A 2ZXXA 1U7MA 3WUUA 1DEBA 1JTHA 3B71A 2KP8A 3M0AA 4IFFA 1L0NE 1LWUC 3H1JD 4H0LB 1SQPJ 2Q1KA 3CWBD 4JQ0D 3WMM0 3AEDC 2YIUB 1GL2D 1N2DC 1KILA 3OAKA 4C7NA 3L74E 1ZOYC 2ZT9C 1NTKG 5BVZA 3AEAC 1JO5A 3GMAA 1OXZA 2A06D 1L0NJ 3A3YB 1L0LG 3HD7A 1N86A 3M9QA 5AW1B 1EDJA 4ZMDA 1NKNA 3L4FA 4EOTA 4JF7A 2IX7C 2FXPA 5KLVK 3L74J 4N6JA 1LT9C 2W83C 2WZ7A 1EXIA 1T2KD 2A06E 2OGUA 2P67A 3H1JJ 1SVFA 3L75D 3CWBJ 2H8PD 3TSIA 1VPCA 3NXSA 1N73B 1S5LH 5TISH 1URQC 2FKWB 5KAIH 1JM0A 1KMIZ 1ZP0C 3V2NA 2OYHA 3A5TA 3P8MC 2UWJE 3A0BH 1HWTC 3RL0D 2IBZD 1Y8AA 2FYUG 5AW7B 1DH3A 1OX3A 1OVUA 1PGPA 1SQQK 3Q5SA 2AEMA 3L75E 5KKZC 1M1JB 1JNMA 2Y0CA 3CL3D 3AECC 5GTHH 3HUSB 1FZCB 5CCHA 3RBZA 1OW8A 3WU2H 2FFDA 4L76A 4RESB 1LT1A 2N1TD 3KZIH 1OVVA 2C0WA 2YKQA 1KB9H 2KS1B 5B5EH 1NTKD 1YQ3C 1ZR4A 1J1DC 4H13C 3G3ZA 3BATA 5L8RJ 3RK3D 3CCJP 1LP1B 3L75J 3TGUE 1RF1B 2AEJA 4W7ZA 5CCGD 1JMMA 1L4AA 4HYTB 1N7SD 1EXJA 1U57A 1YTZI 5KLVE 1VQMP 3B5NA 2WT7A 1EZVI 3MUDC 2Z4EA 2LR2A 4R4LA 3TDKA 2R44A 3MGNA 4PJ0H 1FBMA 3R2PA 1GL2B 3V2RA 3H1KD 4RJTA 3GHGA 1OWAA 3TK1A 1ZW0A 2KOGA 1NH4A 2W90A 3L72E 1NU1D 1NTZG 1YIJP 2P1JA 3F89A 4XA4A 3MZWB 3H32A 2B88A 2WVRA 2D2CC 1JB0J 2FBWC 1LT9A 2K1AA 2LXBA 2Q5UA 3H1KE 2FYUD 3AE3C 1NTKJ 1S5LE 5APQA 5TISE 1IFNA 3CX5D 4HH2A 3PH0A 5KAIE 3P8CD 2E75D 4JPZB 1JEKA 4I7ZC 1CI6A 5AW8B 3A0BE 1NU1E 1FS0E 3G4SP 4PV1D 2O01H 1T3UA 2K9JB 1URQA 1YQ4C 3AEBC 1E5WA 3CXHH 2C9LY 2QE7H 3G71P 3M9BA 5B66H 3B4SA 1FDMA 1G2CB 3H1KJ 2YMYA 1SFCA 5GTHE 4ZNCA 3I56P 3RL0B 4YPCA 2K9YA 1VQ5P 1XTCC 5TJHA 3WU2E 1HJBA 3FX0A 1NU1J 4GDOA 3KZIE 2P58A 3I55P 5BU8B 1ZRTE 1KILD 1KB9E 1N7LA 5KAFH 5B5EE 4Y99B 3L71G 1LNQA 1G1IA 4WVZA 1UIXA 3LIEA 3PJSK 5APWA 3RGUA 4TT3H 2N1TB 1AJYA 1HF9A 3L73G 3V5BA 4RKUJ 2B9BA 2AXTH 1HVVA 3P32A 4PJ0E 1MV8A 2O1JA 2G8YA 3RK3B 1NTZD 1USDA 1HBWA 2PRRA 2WSEH 3GF7A 3HE4A 1N7SB 3MUDA 4PD4I 1FJKA 2KLVA 4TLFA 2JJLA 4QMAA 1AQTA 1SQVG 1BGYG 2R32A 2BEZF 3L70E 3A2AA 1MZ9A 4CPGA 1KYOI 3D70A 1P84I 3IR9A 4WY4A 1JUNA 1NAFA 3VMXA 4D6TE 1IFJA 2A45H 4DCKA 3OA7A 1H89A 1PGQA 2Z5HA 3GG2A 2RKLA 3L70J 1H88A 3HTKA 2JKVA 3NFQA 3BCCE 3CXHE 4K3AA 2KB7P 5APSA 2QJYC 3M0DC 2E75B 5B66E 5KLIC 4YXDC 1NTZJ 2E43A 2E76D 3JSVC 3HD7C 2POHA 1L0NK 3CLQA 4PV1B 1K9MQ 3L71D 3S4RA 3CD6P 3AE5C 1SP4A 3ITKA 4M3LA 1X9VA 5C39A 1DIPA 4RO0A 1IJDB 5KAFE 1JTHB 3L73D 1AV1A 2Y0DA 2FY8A 1RHZB 3AE9C 2HLOA 1CZQA 2WPVB 5DJUB 5DJTB 3L35A 1LTJC 2CK3H 3FWNA 2I1KA 1VQPP 1VL2A 3NTNA 4XFJA 3T97B 2IFNA 2XDJA 1GMJA 3H6PA 1GU5A 1KILB 2QJKC 2ZT9D 1LJ2A 3I5CA 4BRYA 3WUTA 2AXTE 4C7NB 2OYHC 1HTLC 3Q5PA 1M7LA 1FZGA 1SQVD 4W80A 3U1CA 1BGYD 2QM8A 4OGQC 1FC2C 3S9OA 1RQVA 2KNCB 3GW6A 4GKGA 1VF5C 1RF0C 2Y9YA 4EYYQ 2K3RA 2GA1A 1GW3A 1GDTA 3H1IG 2ZYDA 1IO4A 2IZ1A 1LTTC 2HR3A 2JP3A 2JWDA 1SQPE 4EDFA 1LTIC 1H0TA 3GLMA 5CCHC 3L71J 2FFDC 2IZ0A 1S9KD 4OVNF 4NPEA 1GU4A 2N9BA 5K5GB 3AE7C 2WSEJ 3SWFA 3CCLP 3L73J 3QWOC 1KD1Q 3NMDA 1N8RQ 1EC5A 1URQD 4AYCA 5M1BA 3HE5A 2Y0EA 5AW2B 5AVVB 1L4AC 3B5NC 5AW6B 3TNUA 2OTLP 1AFOA 1BSNA 1IK7A 3H1LG 1SQVJ 3AE1C 3O6QA 1BGYJ 4WWIA 1FZEA 2W6JH 1KN7A 2HFED 3GHGC 2L5GB 3RK2B 4IFDK 3M0DA 5AVSB 2YNYA 1AQ5A 3H1JE 2XNDH 3KYQA 1W2BO 2KXPB 2JR8A 2C0XA 3CWBE 3PTZA 2Y9ZA 1SQXG 1PV3A 2E76B 1LTSC 1KC8Q 1L2PA 2ZFCA 3USSA 2J59M 4H13D 1IFDA 2NZ2A 2FYNC 2JEEA 2QSIA 2NPSC 4L74A 2RMZA 1LWUB 2G3AA 1ZV8A 4LGDE 5APTA 1LTJA 2OTKE 1LTAC 2WQYC 3H1ID 4ASWA 4XE5B 1SQQG 1BE3G 2Q9IA 2WSFJ 5CMZA 4HB1A 1JMBA 3A7OA 1RH5B 3MP7B 2ZT9B 1HH0A 3FXDA 3M91A 1FU1A 1SFCC 1EZVD 1EDIA 2KZIA 1NTMG 1VDFA 1TU3F 4LLHA 1RF0A 3FGAD 4U3FG 2D2CD 3CI9A 3H32B 3WUVA 2W8ZA 5KJ7C 3CX5H 4KJMA 1NU1K 1SQBG 2RN0A 1YYCA 1LT9B 4KT0J 1LGHB 1KQLA 2HPCA 4B86A 1IC2A 1J1EC 3H1LD 2PFXA 1G1JA 2IBZE 2YXRB 2GUVA 1EZVE 4H44C 5BU5A 2YO3A 1EDKA 1U7JA 1M57D 2KZJA 2GUSA 1PPJG 1URQB 1PL5A 1GTWA 1YITP 1L0LD 3G6EP 1FZBA 5H2FH 1Q81Q 1AVYA 1SQXD 3L36A 2M8RA 1K04A 4MN4C 1NJIQ 4K35A 3LW5J 4WBAA 2IDBA 2B87A 3N7NA 1PP9G 5AW3B 3OJAB 2Q3EA 1NTKE 3II6A 3PP5A 4AUWA 3VP8A 5KKZB 1N73A 3RK3E 4WY4C 3OW2O 4DT0A 2ITAA 2E42A 2XZRA 3CMAP 1OVRA 3L37A 2AXCA 3V2PA 1L0LE 1YJWP 1BE3D 3CCQP 3QH9A 4WB4A 2E5TA 3H1LJ 1GK4A 3VMAA 3KXDA 1J1DB 4A7PA 4H13B 1DD3A 1FDIA 2BCCG 1M56D 1S72P 2NPSA 1M1JA 3G9RA 1NTMD 3CMEP 3HUSA 4NPDA 4U3FD 1DD4A 3KPEA 1L0LJ 1IK9A 3JC22 5CBNA 1SQXJ 1BE3E 1JY3N 4Y28J 1SQBD 3A0HE 1NTZK 1JY3P 3H1HG 1H8AA 2KI7B 1DEEG 2FYUE 4PD4D 3CX5E 4L73A 1RY3A 1GK6A 3P8CE 1CW5A 4I2LC 1KZUB 4IL6X 2YMKA 2E5YA 5AVQB 1NWQA 1OFCX 1KYOD 2D2CB 2HODB 2OQQA 5KJ7A 4NPFX 1BE3J 1P84D 5CBOA 2E74C 3BRTB 5AVWB 2YKOA 4UB8H 2P10A 3UIAA 1OMIA 2WSCJ 3HTKB 3VTPC 3EFGA 3EQ2A 4I1LA 2HYNA 2FYUJ 1JY2O 2KUBA 5H2FE 1PP9D 4I7ZB 3KHUA 1NTMJ 3HD7D 1PFIA 5APVA 4U3FJ 1FAVA 3CCRP 1KQSO 3Q2YA 1IFIA 1WT6A 2JO1A 4EIJA 1ZLLA 2OYIC 1KTMA 1KILE 1Q86Q 2C9NY 3V2QA 1SQBJ 1OW7A 1KB9I 3AEGC 1YJ9P 2KSJA 1BDDA 1W5CE 1PP9E 2BCCD 1GZLA 1K8AQ 1R5LA 2WITA 1EDLA 2QG4A 3VP9A 2CPSA 1NTZE 2QJPC 4EI2A 1JCCA 4BRYB 1VQLP 4OGQD 2H88C 2O01N 1SQPK 1VF5D 1L0NG 3H1HD 3V4WA 3JCUH 3RK2D 1PP9J 4L75A 2XV5A 1GD2E 1W2EA 3N4XA 2FXMA 1SQVK 2PAJA 2YO2A 1RE4A 4HJGH 5CCHD 3ABVC 3CCUP 3L74G 1S3JA 2JWAA 1H0TB 4GOFA 1J2JB 1FDOA 2KLUA 2H7HA 1BSHA 3SFDC 2W6AA 1ZMEC 2XKMA 2XNXA 1PGOA 2BCCJ 2P7JA 3TF5A 1RQUA 4DZOA 5GTIH 1PIXA 4UB8E 3HE5B 1L4AD 2WSFH 2IFMA 2OTJP 3B5ND 3CXHI 1FJPA 2Z5IA 2WMMA 5AW0B 3TNUB 3VMZA 2KK7A 4N78D 4GODA 3MTUE 3O6QB 3L71E 3SSUA 3IFMA 4C7RA 4IFMA 2A06G 3H1HJ 3CC7P 3E1RA 1Q7YQ 1YJNP 1NYHA
chains in the Genus database with same CATH topology
1SQVG 3L71G 1BGYG 3H1LG 3TGUG 1KB9H 4D6TG 4PD4H 1SQXG 3H1JG 1SQPG 3BCCG 1NTKG 1NU1G 2BCCG 1NTZG 5KLVG 3CXHH 2FYUG 3L75G 2IBZG 3CWBG 3CX5H 3L70G 3L74G 1SQBG 3L72G 1L0NG 1BCCG 3H1IG 3L73G 1EZVG 3H1HG 1SQQG 1PPJG 1PP9G 2A06G 3H1KG 1NTMG 1BE3G 1KYOH 1P84H 4U3FG 1L0LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV G;  3L71 G;  1BGY G;  3H1L G;  3TGU G;  1KB9 H;  4D6T G;  4PD4 H;  1SQX G;  3H1J G;  1SQP G;  3BCC G;  1NTK G;  1NU1 G;  2BCC G;  1NTZ G;  5KLV G;  3CXH H;  2FYU G;  3L75 G;  2IBZ G;  3CWB G;  3CX5 H;  3L70 G;  3L74 G;  1SQB G;  3L72 G;  1L0N G;  1BCC G;  3H1I G;  3L73 G;  1EZV G;  3H1H G;  1SQQ G;  1PPJ G;  1PP9 G;  2A06 G;  3H1K G;  1NTM G;  1BE3 G;  1KYO H;  1P84 H;  4U3F G;  1L0L G; 
#chains in the Genus database with same CATH topology
 3IF4 A;  5CJ4 A;  2J58 A;  2QIW A;  2QJY B;  3L73 E;  4H0L C;  1RE3 C;  5KLI B;  1JY2 N;  2Q3I A;  1KOR A;  2M5A A;  3HD7 B;  1JY2 P;  1KQF B;  1QL2 A;  2M3B A;  3E1I A;  2OYI A;  3M9H A;  2YIU C;  1NAY A;  4N3Y B;  2KIK A;  2NPS D;  1T6A A;  1QX8 A;  1VQ4 P;  1HGV A;  5CJ0 A;  3L75 G;  3FXE A;  4O9B A;  2KSE A;  1SQV E;  1BGY E;  2QM7 A;  1QVF O;  1LTJ B;  2V7Q J;  5AVT B;  1HUC A;  1S1C X;  1K05 A;  3LW5 H;  3JCU E;  2WSS H;  2QJK B;  1NHL A;  2OYH B;  4KHX A;  3RL0 g;  1LTB C;  2M0B A;  1SFC D;  1OZH A;  1EQ7 A;  3TGU G;  1S9K E;  1NGM B;  4OGQ B;  5APX A;  1HGZ A;  5AVX B;  3ZDM A;  1VF5 B;  1ZN5 A;  1Q82 Q;  5KLV G;  1AVO A;  5APU A;  2A45 I;  5KJ7 D;  2QA4 P;  3T97 A;  3SFE C;  2PGD A;  1N73 C;  2BEQ D;  2GM4 A;  1USE A;  1MFZ A;  3C9I A;  2R3S A;  2FFD B;  5GTI E;  3AE6 C;  2HPC B;  1KFN A;  4H44 D;  2R5D A;  3L72 G;  2KNC A;  3V4Q A;  3PLN A;  5EFW B;  4JBZ A;  1VQ7 P;  2IPP A;  1HJ0 A;  1VQK P;  1M1J C;  3AE8 C;  1VQN P;  3HUS C;  2V4H A;  1S2E A;  1L4A B;  1FZC C;  2YXQ B;  1NTK K;  1JY3 O;  2OAR A;  1Y47 A;  3B5N B;  3H1K G;  1PZQ A;  2WT7 B;  1KV4 A;  5APY A;  1QGK B;  4AQR D;  3CCE P;  2B87 B;  1L0L K;  1M90 Q;  1VQ6 P;  1NU1 G;  3GHG B;  1SQX K;  3AEE C;  4WY4 D;  2K37 A;  4JYB A;  3IN6 A;  3PRJ A;  1RF1 C;  1RE3 A;  2L91 A;  4GIF A;  2J5U A;  3A0H H;  3V6I A;  2WSC H;  2O3J A;  3F5H A;  3H1I E;  3Q1M A;  1NOH A;  2ZVN B;  1GL2 C;  2FYN B;  3R4Y A;  5AW5 B;  3TGU D;  2NPS B;  1KQG B;  1MUU A;  3AE4 C;  3RBX A;  5AW9 B;  4LC1 A;  3BAS A;  1CI6 B;  5KLV D;  1R8E A;  3EFF K;  1YBK A;  3IAO A;  2IYO A;  2FYU K;  3H1I J;  1A02 J;  3Q5R A;  1NTM K;  1NVO A;  1ZXG A;  3D71 A;  3BVH A;  4PD4 H;  3SWK A;  2ZXE B;  4IL6 H;  3VMY A;  2P2U A;  2WTY A;  2MJZ A;  3C8V A;  3L72 D;  1SFC B;  1LWU A;  3H1L E;  1Q90 D;  1SQB K;  1KYO H;  1GW4 A;  1P84 H;  3BRV B;  2IBZ I;  1T2K C;  2E74 D;  1WMK A;  1FE6 A;  3L70 G;  1YI2 P;  1D7M A;  1SQQ D;  3VN0 A;  1SQX E;  3B8E B;  4JYC A;  4YXW H;  5AVU B;  1J1E B;  1S5L X;  5CHX A;  2Q7C A;  1T3J A;  3TGU J;  3RL0 C;  4D6T G;  4H44 B;  1X79 B;  4UB6 H;  2RH0 A;  2R3C A;  2SPZ A;  5KLV J;  1QL1 A;  3AEF C;  4ZKP A;  4ZKU A;  1FOS E;  3H25 A;  1MFT A;  2QVA A;  2PP6 A;  1RE4 C;  1FZC A;  3TYY A;  1YHQ P;  4Y99 C;  3HE4 B;  3BCC G;  1SQQ E;  3U1A A;  2BAS A;  3AE2 C;  2KYV A;  2I1J A;  2N1T C;  2KS1 A;  3L72 J;  5AW4 B;  2H43 A;  1JCD A;  5AVR B;  2W27 A;  1A02 F;  5E79 H;  1LP1 A;  1ZRT D;  1RF1 A;  1KB9 D;  4WY4 B;  2WPR A;  2LKM A;  2WPQ A;  3RK3 C;  3M06 A;  1OIP A;  1NTM E;  2ZJS E;  4U3F E;  5CCG C;  1X22 A;  1BCC G;  3O8Z A;  1N7S C;  1PPJ D;  2K88 A;  2W6B A;  1SQQ J;  1X0T A;  3VOP A;  2WWW A;  1BDC A;  1VQ8 P;  1GL2 A;  1SQB E;  2ZVO B;  4C46 A;  1QLE D;  2H89 C;  2FXO A;  1IFP A;  3PHL A;  1VQO P;  4I6M C;  4PD4 E;  1LTG C;  4IL6 E;  5AVZ B;  3CPW O;  3CX5 I;  4OH8 B;  2OYO A;  2ZYG A;  1PPJ E;  1YTZ T;  1KYO E;  2QRX A;  3L70 D;  5AVY B;  1P84 E;  3U59 A;  1DX7 A;  1Q2N A;  4OWF A;  2V7Q H;  4D6T D;  1Z56 A;  1M1K Q;  2VRS A;  1SQP G;  3MHV A;  2E75 C;  2NRG A;  4R4M A;  1XTG B;  2ZAE B;  3Q3D A;  3FWL A;  2M3E A;  1AA0 A;  2K9J A;  3W68 A;  2AEF A;  1FZF A;  2E74 B;  4PV1 C;  4UB6 E;  2A45 G;  3MIW A;  5KTB A;  3S1K A;  1FOS F;  1KFM A;  3BCC D;  1G2C A;  3VYI A;  3CXH D;  3LID A;  4H0L D;  1OW6 A;  3HRN A;  1SS1 A;  1UII A;  4BWN A;  2MKV A;  3K5B A;  4W7Y A;  2BCC E;  1CSB A;  4GT1 A;  2M5A B;  3SWY A;  2HOD A;  2OYI B;  1BCC D;  1KIL C;  5E79 E;  1QVG O;  1JOC A;  3E7K A;  3KQG A;  2N1T A;  3CC2 P;  4D6T J;  3D6Z A;  1IFM A;  3H1J G;  3H1H E;  3MD0 A;  1SLQ A;  2Q6Q A;  3CWB G;  4DOJ A;  2CPB A;  3CCV P;  3EWK A;  2QJP B;  4DJG A;  5CCG A;  3P7K A;  3W67 A;  1N7S A;  3C1L A;  1BCC E;  4U7J A;  2DW3 A;  2O01 J;  1QEX A;  1WRG A;  1NKZ B;  3BCC J;  4ASV A;  4BXL A;  1PGJ A;  2YKP A;  1T8Z A;  3CCS P;  3KDP B;  2FYZ A;  2HG5 D;  2I8D A;  4YTP C;  1SQP D;  4HKZ H;  1NO4 A;  2WPS A;  1BCC J;  1MKM A;  3CCM P;  1M8O B;  3GF3 A;  1K73 Q;  1ZR2 A;  2ZYA A;  4Z1M H;  4N78 E;  1X8Y A;  4GOE A;  2QEX P;  1R5S A;  1IZN B;  3RK2 C;  1L0N D;  1S4X A;  1VQ9 P;  3CC4 P;  2IYP A;  2XU6 A;  2O1K A;  1Y9B A;  2LXC B;  3D6Y A;  1FZA A;  2N9Y B;  2E76 C;  2JDI H;  2R5B A;  2IBZ G;  1E79 H;  3L74 D;  1EZV G;  4IOI H;  2B89 A;  2ZXX A;  1U7M A;  3WUU A;  1DEB A;  1JTH A;  3B71 A;  2KP8 A;  3M0A A;  4IFF A;  1L0N E;  1LWU C;  3H1J D;  4H0L B;  1SQP J;  2Q1K A;  3CWB D;  4JQ0 D;  3WMM 0;  3AED C;  2YIU B;  1GL2 D;  1N2D C;  1KIL A;  3OAK A;  4C7N A;  3L74 E;  1ZOY C;  2ZT9 C;  1NTK G;  5BVZ A;  3AEA C;  1JO5 A;  3GMA A;  1OXZ A;  2A06 D;  1L0N J;  3A3Y B;  1L0L G;  3HD7 A;  1N86 A;  3M9Q A;  5AW1 B;  1EDJ A;  4ZMD A;  1NKN A;  3L4F A;  4EOT A;  4JF7 A;  2IX7 C;  2FXP A;  5KLV K;  3L74 J;  4N6J A;  1LT9 C;  2W83 C;  2WZ7 A;  1EXI A;  1T2K D;  2A06 E;  2OGU A;  2P67 A;  3H1J J;  1SVF A;  3L75 D;  3CWB J;  2H8P D;  3TSI A;  1VPC A;  3NXS A;  1N73 B;  1S5L H;  5TIS H;  1URQ C;  2FKW B;  5KAI H;  1JM0 A;  1KMI Z;  1ZP0 C;  3V2N A;  2OYH A;  3A5T A;  3P8M C;  2UWJ E;  3A0B H;  1HWT C;  3RL0 D;  2IBZ D;  1Y8A A;  2FYU G;  5AW7 B;  1DH3 A;  1OX3 A;  1OVU A;  1PGP A;  1SQQ K;  3Q5S A;  2AEM A;  3L75 E;  5KKZ C;  1M1J B;  1JNM A;  2Y0C A;  3CL3 D;  3AEC C;  5GTH H;  3HUS B;  1FZC B;  5CCH A;  3RBZ A;  1OW8 A;  3WU2 H;  2FFD A;  4L76 A;  4RES B;  1LT1 A;  2N1T D;  3KZI H;  1OVV A;  2C0W A;  2YKQ A;  1KB9 H;  2KS1 B;  5B5E H;  1NTK D;  1YQ3 C;  1ZR4 A;  1J1D C;  4H13 C;  3G3Z A;  3BAT A;  5L8R J;  3RK3 D;  3CCJ P;  1LP1 B;  3L75 J;  3TGU E;  1RF1 B;  2AEJ A;  4W7Z A;  5CCG D;  1JMM A;  1L4A A;  4HYT B;  1N7S D;  1EXJ A;  1U57 A;  1YTZ I;  5KLV E;  1VQM P;  3B5N A;  2WT7 A;  1EZV I;  3MUD C;  2Z4E A;  2LR2 A;  4R4L A;  3TDK A;  2R44 A;  3MGN A;  4PJ0 H;  1FBM A;  3R2P A;  1GL2 B;  3V2R A;  3H1K D;  4RJT A;  3GHG A;  1OWA A;  3TK1 A;  1ZW0 A;  2KOG A;  1NH4 A;  2W90 A;  3L72 E;  1NU1 D;  1NTZ G;  1YIJ P;  2P1J A;  3F89 A;  4XA4 A;  3MZW B;  3H32 A;  2B88 A;  2WVR A;  2D2C C;  1JB0 J;  2FBW C;  1LT9 A;  2K1A A;  2LXB A;  2Q5U A;  3H1K E;  2FYU D;  3AE3 C;  1NTK J;  1S5L E;  5APQ A;  5TIS E;  1IFN A;  3CX5 D;  4HH2 A;  3PH0 A;  5KAI E;  3P8C D;  2E75 D;  4JPZ B;  1JEK A;  4I7Z C;  1CI6 A;  5AW8 B;  3A0B E;  1NU1 E;  1FS0 E;  3G4S P;  4PV1 D;  2O01 H;  1T3U A;  2K9J B;  1URQ A;  1YQ4 C;  3AEB C;  1E5W A;  3CXH H;  2C9L Y;  2QE7 H;  3G71 P;  3M9B A;  5B66 H;  3B4S A;  1FDM A;  1G2C B;  3H1K J;  2YMY A;  1SFC A;  5GTH E;  4ZNC A;  3I56 P;  3RL0 B;  4YPC A;  2K9Y A;  1VQ5 P;  1XTC C;  5TJH A;  3WU2 E;  1HJB A;  3FX0 A;  1NU1 J;  4GDO A;  3KZI E;  2P58 A;  3I55 P;  5BU8 B;  1ZRT E;  1KIL D;  1KB9 E;  1N7L A;  5KAF H;  5B5E E;  4Y99 B;  3L71 G;  1LNQ A;  1G1I A;  4WVZ A;  1UIX A;  3LIE A;  3PJS K;  5APW A;  3RGU A;  4TT3 H;  2N1T B;  1AJY A;  1HF9 A;  3L73 G;  3V5B A;  4RKU J;  2B9B A;  2AXT H;  1HVV A;  3P32 A;  4PJ0 E;  1MV8 A;  2O1J A;  2G8Y A;  3RK3 B;  1NTZ D;  1USD A;  1HBW A;  2PRR A;  2WSE H;  3GF7 A;  3HE4 A;  1N7S B;  3MUD A;  4PD4 I;  1FJK A;  2KLV A;  4TLF A;  2JJL A;  4QMA A;  1AQT A;  1SQV G;  1BGY G;  2R32 A;  2BEZ F;  3L70 E;  3A2A A;  1MZ9 A;  4CPG A;  1KYO I;  3D70 A;  1P84 I;  3IR9 A;  4WY4 A;  1JUN A;  1NAF A;  3VMX A;  4D6T E;  1IFJ A;  2A45 H;  4DCK A;  3OA7 A;  1H89 A;  1PGQ A;  2Z5H A;  3GG2 A;  2RKL A;  3L70 J;  1H88 A;  3HTK A;  2JKV A;  3NFQ A;  3BCC E;  3CXH E;  4K3A A;  2KB7 P;  5APS A;  2QJY C;  3M0D C;  2E75 B;  5B66 E;  5KLI C;  4YXD C;  1NTZ J;  2E43 A;  2E76 D;  3JSV C;  3HD7 C;  2POH A;  1L0N K;  3CLQ A;  4PV1 B;  1K9M Q;  3L71 D;  3S4R A;  3CD6 P;  3AE5 C;  1SP4 A;  3ITK A;  4M3L A;  1X9V A;  5C39 A;  1DIP A;  4RO0 A;  1IJD B;  5KAF E;  1JTH B;  3L73 D;  1AV1 A;  2Y0D A;  2FY8 A;  1RHZ B;  3AE9 C;  2HLO A;  1CZQ A;  2WPV B;  5DJU B;  5DJT B;  3L35 A;  1LTJ C;  2CK3 H;  3FWN A;  2I1K A;  1VQP P;  1VL2 A;  3NTN A;  4XFJ A;  3T97 B;  2IFN A;  2XDJ A;  1GMJ A;  3H6P A;  1GU5 A;  1KIL B;  2QJK C;  2ZT9 D;  1LJ2 A;  3I5C A;  4BRY A;  3WUT A;  2AXT E;  4C7N B;  2OYH C;  1HTL C;  3Q5P A;  1M7L A;  1FZG A;  1SQV D;  4W80 A;  3U1C A;  1BGY D;  2QM8 A;  4OGQ C;  1FC2 C;  3S9O A;  1RQV A;  2KNC B;  3GW6 A;  4GKG A;  1VF5 C;  1RF0 C;  2Y9Y A;  4EYY Q;  2K3R A;  2GA1 A;  1GW3 A;  1GDT A;  3H1I G;  2ZYD A;  1IO4 A;  2IZ1 A;  1LTT C;  2HR3 A;  2JP3 A;  2JWD A;  1SQP E;  4EDF A;  1LTI C;  1H0T A;  3GLM A;  5CCH C;  3L71 J;  2FFD C;  2IZ0 A;  1S9K D;  4OVN F;  4NPE A;  1GU4 A;  2N9B A;  5K5G B;  3AE7 C;  2WSE J;  3SWF A;  3CCL P;  3L73 J;  3QWO C;  1KD1 Q;  3NMD A;  1N8R Q;  1EC5 A;  1URQ D;  4AYC A;  5M1B A;  3HE5 A;  2Y0E A;  5AW2 B;  5AVV B;  1L4A C;  3B5N C;  5AW6 B;  3TNU A;  2OTL P;  1AFO A;  1BSN A;  1IK7 A;  3H1L G;  1SQV J;  3AE1 C;  3O6Q A;  1BGY J;  4WWI A;  1FZE A;  2W6J H;  1KN7 A;  2HFE D;  3GHG C;  2L5G B;  3RK2 B;  4IFD K;  3M0D A;  5AVS B;  2YNY A;  1AQ5 A;  3H1J E;  2XND H;  3KYQ A;  1W2B O;  2KXP B;  2JR8 A;  2C0X A;  3CWB E;  3PTZ A;  2Y9Z A;  1SQX G;  1PV3 A;  2E76 B;  1LTS C;  1KC8 Q;  1L2P A;  2ZFC A;  3USS A;  2J59 M;  4H13 D;  1IFD A;  2NZ2 A;  2FYN C;  2JEE A;  2QSI A;  2NPS C;  4L74 A;  2RMZ A;  1LWU B;  2G3A A;  1ZV8 A;  4LGD E;  5APT A;  1LTJ A;  2OTK E;  1LTA C;  2WQY C;  3H1I D;  4ASW A;  4XE5 B;  1SQQ G;  1BE3 G;  2Q9I A;  2WSF J;  5CMZ A;  4HB1 A;  1JMB A;  3A7O A;  1RH5 B;  3MP7 B;  2ZT9 B;  1HH0 A;  3FXD A;  3M91 A;  1FU1 A;  1SFC C;  1EZV D;  1EDI A;  2KZI A;  1NTM G;  1VDF A;  1TU3 F;  4LLH A;  1RF0 A;  3FGA D;  4U3F G;  2D2C D;  3CI9 A;  3H32 B;  3WUV A;  2W8Z A;  5KJ7 C;  3CX5 H;  4KJM A;  1NU1 K;  1SQB G;  2RN0 A;  1YYC A;  1LT9 B;  4KT0 J;  1LGH B;  1KQL A;  2HPC A;  4B86 A;  1IC2 A;  1J1E C;  3H1L D;  2PFX A;  1G1J A;  2IBZ E;  2YXR B;  2GUV A;  1EZV E;  4H44 C;  5BU5 A;  2YO3 A;  1EDK A;  1U7J A;  1M57 D;  2KZJ A;  2GUS A;  1PPJ G;  1URQ B;  1PL5 A;  1GTW A;  1YIT P;  1L0L D;  3G6E P;  1FZB A;  5H2F H;  1Q81 Q;  1AVY A;  1SQX D;  3L36 A;  2M8R A;  1K04 A;  4MN4 C;  1NJI Q;  4K35 A;  3LW5 J;  4WBA A;  2IDB A;  2B87 A;  3N7N A;  1PP9 G;  5AW3 B;  3OJA B;  2Q3E A;  1NTK E;  3II6 A;  3PP5 A;  4AUW A;  3VP8 A;  5KKZ B;  1N73 A;  3RK3 E;  4WY4 C;  3OW2 O;  4DT0 A;  2ITA A;  2E42 A;  2XZR A;  3CMA P;  1OVR A;  3L37 A;  2AXC A;  3V2P A;  1L0L E;  1YJW P;  1BE3 D;  3CCQ P;  3QH9 A;  4WB4 A;  2E5T A;  3H1L J;  1GK4 A;  3VMA A;  3KXD A;  1J1D B;  4A7P A;  4H13 B;  1DD3 A;  1FDI A;  2BCC G;  1M56 D;  1S72 P;  2NPS A;  1M1J A;  3G9R A;  1NTM D;  3CME P;  3HUS A;  4NPD A;  4U3F D;  1DD4 A;  3KPE A;  1L0L J;  1IK9 A;  3JC2 2;  5CBN A;  1SQX J;  1BE3 E;  1JY3 N;  4Y28 J;  1SQB D;  3A0H E;  1NTZ K;  1JY3 P;  3H1H G;  1H8A A;  2KI7 B;  1DEE G;  2FYU E;  4PD4 D;  3CX5 E;  4L73 A;  1RY3 A;  1GK6 A;  3P8C E;  1CW5 A;  4I2L C;  1KZU B;  4IL6 X;  2YMK A;  2E5Y A;  5AVQ B;  1NWQ A;  1OFC X;  1KYO D;  2D2C B;  2HOD B;  2OQQ A;  5KJ7 A;  4NPF X;  1BE3 J;  1P84 D;  5CBO A;  2E74 C;  3BRT B;  5AVW B;  2YKO A;  4UB8 H;  2P10 A;  3UIA A;  1OMI A;  2WSC J;  3HTK B;  3VTP C;  3EFG A;  3EQ2 A;  4I1L A;  2HYN A;  2FYU J;  1JY2 O;  2KUB A;  5H2F E;  1PP9 D;  4I7Z B;  3KHU A;  1NTM J;  3HD7 D;  1PFI A;  5APV A;  4U3F J;  1FAV A;  3CCR P;  1KQS O;  3Q2Y A;  1IFI A;  1WT6 A;  2JO1 A;  4EIJ A;  1ZLL A;  2OYI C;  1KTM A;  1KIL E;  1Q86 Q;  2C9N Y;  3V2Q A;  1SQB J;  1OW7 A;  1KB9 I;  3AEG C;  1YJ9 P;  2KSJ A;  1BDD A;  1W5C E;  1PP9 E;  2BCC D;  1GZL A;  1K8A Q;  1R5L A;  2WIT A;  1EDL A;  2QG4 A;  3VP9 A;  2CPS A;  1NTZ E;  2QJP C;  4EI2 A;  1JCC A;  4BRY B;  1VQL P;  4OGQ D;  2H88 C;  2O01 N;  1SQP K;  1VF5 D;  1L0N G;  3H1H D;  3V4W A;  3JCU H;  3RK2 D;  1PP9 J;  4L75 A;  2XV5 A;  1GD2 E;  1W2E A;  3N4X A;  2FXM A;  1SQV K;  2PAJ A;  2YO2 A;  1RE4 A;  4HJG H;  5CCH D;  3ABV C;  3CCU P;  3L74 G;  1S3J A;  2JWA A;  1H0T B;  4GOF A;  1J2J B;  1FDO A;  2KLU A;  2H7H A;  1BSH A;  3SFD C;  2W6A A;  1ZME C;  2XKM A;  2XNX A;  1PGO A;  2BCC J;  2P7J A;  3TF5 A;  1RQU A;  4DZO A;  5GTI H;  1PIX A;  4UB8 E;  3HE5 B;  1L4A D;  2WSF H;  2IFM A;  2OTJ P;  3B5N D;  3CXH I;  1FJP A;  2Z5I A;  2WMM A;  5AW0 B;  3TNU B;  3VMZ A;  2KK7 A;  4N78 D;  4GOD A;  3MTU E;  3O6Q B;  3L71 E;  3SSU A;  3IFM A;  4C7R A;  4IFM A;  2A06 G;  3H1H J;  3CC7 P;  3E1R A;  1Q7Y Q;  1YJN P;  1NYH A; 
#chains in the Genus database with same CATH homology
 1SQV G;  3L71 G;  1BGY G;  3H1L G;  3TGU G;  1KB9 H;  4D6T G;  4PD4 H;  1SQX G;  3H1J G;  1SQP G;  3BCC G;  1NTK G;  1NU1 G;  2BCC G;  1NTZ G;  5KLV G;  3CXH H;  2FYU G;  3L75 G;  2IBZ G;  3CWB G;  3CX5 H;  3L70 G;  3L74 G;  1SQB G;  3L72 G;  1L0N G;  1BCC G;  3H1I G;  3L73 G;  1EZV G;  3H1H G;  1SQQ G;  1PPJ G;  1PP9 G;  2A06 G;  3H1K G;  1NTM G;  1BE3 G;  1KYO H;  1P84 H;  4U3F G;  1L0L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...