5B5EE

Crystal structure analysis of photosystem ii complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 20
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5b5eE00
3KZIE 5B5EE 5B66E 5E79E 1W5CE 3A0HE 3JCUE 1S5LE 3WU2E 3A0BE 5H2FE 5TISE 4UB6E 4IL6E 4PJ0E 5KAFE 5GTHE 4UB8E 5KAIE 5GTIE 2AXTE
chains in the Genus database with same CATH superfamily
5APUA 4EOTA 4H0LB 1RE4A 1GW3A 5E79E 3GLMA 1T8ZA 5CJ4A 4N78D 5AW6B 3V6IA 1VQ4P 1M57D 1ZLLA 3H1IE 1PGJA 4PJ0E 1S5LX 4YXWH 1EC5A 1QL1A 4H13D 1VQMP 1X8YA 3TF5A 5CCHC 5APYA 2I1KA 2PRRA 4EYYQ 1KV4A 3TK1A 2HODB 5AVZB 4EIJA 2ZYGA 1N2DC 5GTHH 1G1JA 2UWJE 4YPCA 1NU1E 5AVTB 2IFMA 1LTJC 4H44D 4GT1A 2BCCJ 3CCLP 2FYUK 2W90A 1GL2C 3E7KA 1G2CB 4L74A 2M5AB 2R5DA 2OGUA 1SQQE 1M1JB 3CWBD 5TISH 4EI2A 3A3YB 2OTKE 3W67A 3TNUA 2GM4A 1DD4A 1YJNP 1NH4A 1AVYA 1L0LK 1N73C 1IO4A 1EDIA 3QWOC 1SP4A 3CXHI 5AW8B 2C0XA 1ZR2A 2QSIA 1KN7A 1ZP0C 3H1LD 3L70J 2H7HA 1SQVJ 2P58A 1OW7A 4HKZH 1A02F 3FXEA 1SQXD 2YNYA 3TYYA 3I56P 1BE3G 4DCKA 3RK3E 3UIAA 1JB0J 1KMIZ 2O3JA 1U57A 1GZLA 1FZCA 3V2NA 2JP3A 3V2PA 2HG5D 1U7JA 1SLQA 1JUNA 1KYOE 4DZOA 3L74G 4JBZA 1LTSC 1LT9B 4BWNA 3Q1MA 4QMAA 4N3YB 5CCHD 3EFGA 3P32A 3TGUE 3U1CA 2O01N 5TJHA 3L4FA 3CD6P 1VQNP 3C9IA 3BCCJ 2IDBA 2HFED 2J59M 2N9YB 1URQB 3L73D 3EQ2A 4IFMA 3CXHD 1S9KD 1EZVE 1CI6B 3H1JE 3C8VA 2OYOA 2B87A 1H88A 1HJBA 1GL2D 3G71P 2QRXA 1DH3A 3V4QA 1KB9I 5AW4B 1NTZE 3MD0A 2N9BA 2P1JA 2FYUD 4HYTB 3VMYA 3BATA 1BDCA 1BGYE 1NTMD 2FFDC 3CI9A 3RK2C 3AE3C 2P7JA 1SFCA 1AV1A 5KLVE 2HLOA 1KFNA 3CWBJ 2JKVA 3VP9A 2V7QJ 3CLQA 1IJDB 2HPCA 1YI2P 3MUDA 1AA0A 4PV1D 2KLVA 4WWIA 3VTPC 4JYCA 5CCGC 1JY3O 3VP8A 1PPJG 3SWYA 1L0LD 1NAYA 2E74C 2RN0A 2E5TA 5AW7B 1SQBJ 4N6JA 2KXPB 1BCCD 2R3SA 3H1LJ 1VF5C 2M0BA 4B86A 2YKPA 2KYVA 1VQ5P 4WVZA 4KJMA 1QL2A 3CC7P 1SQXJ 4DJGA 5KAIE 4D6TD 1PP9D 2WSCJ 4GIFA 3AE9C 1RF1A 3H1HG 2AEFA 1X0TA 1KB9D 1W2EA 4U3FE 4I7ZB 5AW3B 1J2JB 3M0DA 5BU5A 1NGMB 1EQ7A 5AVYB 3TNUB 3SSUA 2Y9YA 1FZFA 2H88C 3Q5PA 5KKZC 3CPWO 2Z4EA 2IX7C 4RJTA 2ZAEB 2OARA 3H1IG 1NHLA 4YTPC 2QJYC 1FU1A 3MP7B 5L8RJ 3D6YA 2WPQA 2H89C 1NOHA 3HRNA 1FZCB 1ZW0A 3RK2D 2K9JA 4PD4I 1NTMJ 1EDKA 1HGVA 1NU1G 1Q7YQ 1OMIA 2W6AA 1CZQA 3HUSA 1JY2O 3L35A 1NJIQ 3LIEA 5CCGD 2IFNA 4ZKPA 2M3BA 1HTLC 1DIPA 1VQ7P 1HWTC 2E5YA 2B88A 1BE3E 2E74D 1VQ9P 1L0LJ 1OXZA 3B8EB 5CCHA 1AVOA 1KFMA 1LWUB 1VF5D 3VMZA 1BCCJ 1RY3A 1PL5A 4XE5B 5EFWB 5APXA 2B87B 3Q5SA 3L74E 3I55P 4D6TJ 1PP9J 1GD2E 1PGOA 1VQ8P 1L0ND 1G1IA 2IBZI 2IYPA 1J1EC 2FBWC 1GL2A 1K04A 1SFCB 3RBZA 5C39A 2YMYA 4UB6H 1YITP 2YO3A 1YQ3C 3CX5H 3A7OA 4PD4D 1OIPA 1KILC 2HPCB 3P8CD 4OVNF 2ZYDA 1X9VA 1M90Q 2Z5IA 4L76A 3U1AA 2O1JA 4AUWA 3PJSK 1YJ9P 1JEKA 1MKMA 3M9QA 1FOSF 2KZIA 3OA7A 3F5HA 5E79H 2KUBA 3TGUG 1EDJA 1J1DB 4W7ZA 2OYIB 4JF7A 1LP1A 4H44B 3FWLA 2HR3A 1IFMA 1RF1B 4PJ0H 2K88A 2KOGA 1ZRTE 2W83C 4C7RA 5KAFH 3H32A 5KTBA 2YKOA 1YHQP 4IFFA 3SFDC 2IBZD 3MZWB 3H1JG 3OW2O 2V4HA 3D6ZA 1NTZG 2KNCA 2WMMA 1QX8A 2GUSA 1PZQA 3CCEP 1KQGB 1VQLP 2WSEJ 1SQBK 1JCDA 2P10A 2IYOA 5KLVG 1SVFA 3HE4A 5APVA 1T2KD 1GW4A 3H1HE 1K9MQ 3H1KG 2W8ZA 1SQXK 4GODA 1SQPG 1K8AQ 3B71A 2P67A 1OVRA 4IL6E 2ZVNB 3GMAA 3HTKA 1L0NJ 3IF4A 3B5ND 3L72D 2XKMA 1R5LA 2A06G 2K9JB 5BVZA 3VOPA 3CMAP 2LKMA 3HUSB 2POHA 5AW9B 1GMJA 3P7KA 1JMMA 1FBMA 3GHGC 1KZUB 1IC2A 2BASA 2KB7P 4Z1MH 2NZ2A 2Y0DA 2XU6A 5CCGA 3SFEC 3Q2YA 4U3FG 5AVWB 2KK7A 1FZAA 1JCCA 3BCCD 1KTMA 1L4AC 2Q9IA 2BCCG 2SPZA 4XFJA 2FYNC 3WUVA 1CW5A 1N7SA 1U7MA 3QH9A 2K3RA 5B5EE 1KYOH 3VMXA 2NRGA 1LT1A 3MGNA 1NTMK 4K3AA 1GL2B 4TLFA 3PP5A 3M06A 1H0TA 1N86A 1PGPA 2WSEH 4GDOA 3CX5I 4WB4A 2J58A 1M56D 4IFDK 3PHLA 1IFNA 4LGDE 1Z56A 2AXCA 3L70G 4PV1B 1SQVG 2IZ0A 5GTIE 2RMZA 5DJUB 1SQBD 4OH8B 4W80A 1QVGO 2FXOA 1NTKD 1Q90D 2JJLA 3O8ZA 5CMZA 3HE5A 3L71D 2C9LY 3WMM0 2YIUB 1SQQK 2A45G 2LXBA 4Y99C 1LP1B 1PPJD 1P84E 1BSNA 1FOSE 3L72J 4Y28J 2KS1A 1UIIA 3H32B 4PD4H 2C9NY 3JCUE 1K05A 2KZJA 1RE3C 1JMBA 2Y0EA 4WY4A 2KNCB 1RF0C 4IL6X 3L36A 2MKVA 1AFOA 2G3AA 1W5CE 3CX5D 1LT9C 5KAIH 2BEZF 3LW5J 1QEXA 3HE4B 1L4AD 5M1BA 1LWUA 2E75C 5AVXB 3L74J 2Y9ZA 1WMKA 2NPSA 2KLUA 2JEEA 4JPZB 3RK3C 1URQC 1S3JA 3A2AA 3HTKB 3N7NA 4IOIH 2XNDH 1KORA 3TDKA 1QGKB 3SWFA 2C0WA 3G3ZA 1BDDA 3B5NA 2FFDB 3H1ID 3O6QA 3RK2B 2Y0CA 3H1KE 3FGAD 3L75E 1SQPE 1HH0A 2AEJA 4XA4A 5B66H 1E79H 3H1LG 2W6JH 3M9BA 2QJPB 5APTA 2QM7A 2WPSA 3PLNA 2E42A 3AE2C 2E74B 1SQXG 2A06E 1H89A 2Q5UA 1NTKJ 2ZT9C 1H8AA 1N7SB 2WVRA 3S1KA 1S72P 4GKGA 3L71J 4U7JA 1L0NK 3SWKA 1KYOI 2QJKB 1JY3N 2OYIA 1SQQD 2K9YA 3T97A 2Q7CA 2N1TC 5CJ0A 2YKQA 1VQPP 2H43A 1H0TB 1IK7A 4UB8E 1HUCA 2W6BA 2BCCE 1VQOP 3LW5H 3A0HE 4I7ZC 5AVRB 1NKNA 3NXSA 3A0BE 3AEFC 3FX0A 1EZVI 4JQ0D 3TSIA 1Q2NA 4DT0A 3L73G 5AW2B 4GOEA 1PV3A 3KZIE 2E75D 1S2EA 3CCQP 3BVHA 1FS0E 2ZYAA 2Z5HA 2KSEA 1YYCA 3HE5B 1M8OB 3RK3D 2XDJA 3V2RA 1K73Q 2FYUG 1URQD 2QJYB 2WSFH 2WZ7A 3CCJP 1NYHA 2QE7H 2KS1B 3AE6C 2J5UA 1ZMEC 1KYOD 3L70E 3HD7C 3V5BA 1SQVE 1XTCC 1FZCC 3ABVC 4WY4B 2E43A 3H1IJ 3GF3A 2AXTH 4NPEA 1JY3P 4CPGA 2ZVOB 1L0LG 1VL2A 2WWWA 3TGUD 2Q6QA 2OTLP 3GHGA 1USEA 3RL0C 1EZVD 4N78E 1NU1J 4D6TG 1PP9G 2ZT9D 5BU8B 2NPSB 1L4AA 1JY2N 1NTZD 1X79B 1PIXA 4AYCA 1LNQA 4C7NA 1LTJA 1BGYD 2N1TD 1SQQJ 1EDLA 2WPRA 1YBKA 1XTGB 5KLVD 1YTZI 2K1AA 3B5NB 3O6QB 3NFQA 2JR8A 1T3UA 3B4SA 1FJPA 3Q5RA 1S5LE 1KC8Q 1FZGA 3EFFK 1RH5B 1TU3F 2JO1A 3MUDC 2VRSA 3CL3D 2PFXA 4H13B 2E76C 1N73A 4IL6H 4W7YA 1NVOA 2OYHC 3AE5C 3FXDA 1E5WA 3CWBE 3F89A 1MUUA 2Q1KA 2QIWA 3R2PA 1S1CX 1KD1Q 1JTHA 3JC22 2KIKA 3T97B 1HJ0A 3I5CA 4RO0A 2D2CC 5APSA 4U3FD 1T3JA 1GTWA 1SQBE 2IPPA 1JM0A 3HD7D 1IFPA 3H1LE 4RESB 2ZFCA 2B9BA 1D7MA 1J1DC 1JY2P 1FZEA 1RQUA 4H44C 3NTNA 1GDTA 2WITA 4BRYA 1SQXE 3BRVB 1AQTA 1RE3A 5AW0B 3TGUJ 3H6PA 3AE8C 1RF0A 5H2FE 3KHUA 3W68A 3KPEA 5CHXA 4OGQC 3RL0D 5B5EH 5KLIC 2MJZA 2ZXXA 4HH2A 1NTKK 3H1JJ 3P8MC 3L75G 3AEBC 4R4MA 3R4YA 1L0NG 1NTZJ 1LTAC 3M0AA 1JNMA 4BXLA 3CC4P 1BGYJ 1JOCA 3IN6A 2BEQD 3AE1C 5KLVJ 4I1LA 4ZNCA 2QVAA 3L73E 1R8EA 3H1KJ 3CXHE 3IR9A 1S9KE 2YXQB 2FFDA 1KILD 5GTIH 2O1KA 2QEXP 4H0LC 1BE3D 1YQ4C 1YJWP 2FYUE 3GHGB 1MFTA 1NTME 2E76D 3PH0A 5KJ7C 2ZXEB 1P84H 1N7LA 1FE6A 5KAFE 3L74D 4M3LA 1FC2C 1DEEG 1L4AB 3JCUH 3C1LA 1PFIA 2QG4A 3CCVP 3VYIA 4C7NB 1OW8A 2FYNB 1LTJB 2JWDA 2JDIH 2YMKA 1YIJP 1L0LE 2D2CD 3WU2E 1GK4A 2IBZG 4U3FJ 1OVVA 2HYNA 1BCCE 1LTBC 2N1TA 1KQFB 1QLED 2XZRA 3L37A 4WBAA 1ZOYC 1Q86Q 3CCUP 5AVSB 4D6TE 1PP9E 4MN4C 1M1JC 3ITKA 1VDFA 5DJTB 1OWAA 4AQRD 4OGQD 1KB9E 2QA4P 1NU1K 2H8PD 4LC1A 1IK9A 1N73B 1ZV8A 3NMDA 2FKWB 2R32A 4PV1C 1ZR4A 1IFDA 1NO4A 3L72G 1MV8A 4L73A 1JTHB 3KQGA 1ZRTD 3Q3DA 1GU4A 2KP8A 2DW3A 1A02J 2K37A 3H25A 2KSJA 4Y99B 4ZKUA 2YIUC 1LTTC 3V2QA 4HB1A 1W2BO 2ITAA 4BRYB 3RGUA 3HD7A 3OJAB 5GTHE 4R4LA 2WTYA 1OZHA 4H0LD 3E1RA 3K5BA 1BE3J 3OAKA 3BCCG 3H1HD 1DD3A 3VN0A 2PP6A 5APQA 5KJ7D 1Y8AA 3G4SP 4EDFA 3CC2P 2E75B 1M1KQ 5TISE 4UB8H 2IZ1A 3RK3B 2XNXA 3MIWA 3A0HH 3CWBG 3A0BH 2WSFJ 1NAFA 1UIXA 2WPVB 2WT7A 1RQVA 3VMAA 2GUVA 4KHXA 1AJYA 2FYZA 3KZIH 1RE4C 1GK6A 3WUUA 1L0NE 1OVUA 1KILA 3BRTB 1SQBG 2CK3H 2XV5A 4ZMDA 2WQYC 1LJ2A 1FDMA 3KDPB 3AEAC 1NTKG 1S4XA 3BASA 4TT3H 1BSHA 2RKLA 3L71G 1NU1D 3G9RA 2M3EA 4HJGH 1AQ5A 1P84I 1NTZK 4PD4E 3A5TA 2OYHA 3P8CE 2QJPC 4NPDA 2YXRB 1VF5B 1X22A 3RL0g 2FXMA 2ZT9B 1FAVA 2CPSA 5KLVK 1FJKA 1N7SC 3AECC 1MFZA 3M9HA 3USSA 2QJKC 3JSVC 1IZNB 2N1TB 1SQPK 1VPCA 2A45H 1HGZA 2R44A 1LTIC 1PGQA 2Q3EA 1GU5A 1N8RQ 3S9OA 1T6AA 1M7LA 3H1HJ 5KKZB 1OFCX 1OW6A 2IBZE 3U59A 5AW5B 5CBNA 3CCMP 3CCRP 3EWKA 4I2LC 5AVUB 1P84D 3D71A 2R5BA 2CPBA 1NTMG 1Q82Q 5APWA 1Y9BA 3CCSP 1S5LH 5B66E 3V4WA 3L73J 4GOFA 2G8YA 2FXPA 3GF7A 4O9BA 3KXDA 1FDOA 4DOJA 3HD7B 2OTJP 2OQQA 1VQ6P 2W27A 2FYUJ 2L5GB 3N4XA 2V7QH 1KQLA 2O01J 1OX3A 4WY4C 3KYQA 3L72E 3GW6A 4K35A 1DEBA 1BCCG 5AW1B 3M91A 1L2PA 2Q3IA 1NKZB 3MHVA 2WSSH 2I8DA 5AVVB 1KILE 3RL0B 3H1JD 4NPFX 5KJ7A 3GG2A 1Y47A 3IFMA 1SQQG 2HODA 1LWUC 1SQVK 1ZXGA 2L91A 3AEDC 1N7SD 2NPSC 1T2KC 2JWAA 4KT0J 2WSCH 2I1JA 3BCCE 2M8RA 2R3CA 5H2FH 3D70A 1J1EB 3H1KD 4RKUJ 2WT7B 3L75D 1SQPD 1JO5A 2FY8A 1G2CA 2M5AA 3B5NC 1SFCC 1WRGA 1KILB 3WUTA 1M1JA 5AVQB 5CBOA 3FWNA 2A06D 1DX7A 1LTGC 3ZDMA 1YTZT 4YXDC 3MTUE 2E76B 2OYHB 4H13C 4ASVA 1R5SA 3CXHH 1USDA 2AXTE 4C46A 4I6MC 3CMEP 5K5GB 2PAJA 1FDIA 1CSBA 2D2CB 2OYIC 2O01H 2BCCD 2P2UA 3AE4C 1NTKE 4LLHA 1Q81Q 3AE7C 1RF1C 1IFJA 2A45I 3L71E 1LGHB 1EXIA 4L75A 2GA1A 4WY4D 3LIDA 3M0DC 1IFIA 1PPJE 1SS1A 1EZVG 4A7PA 3RBXA 3PTZA 4JYBA 3E1IA 1HF9A 2AEMA 3WU2H 1HBWA 4OGQB 3AEGC 1LT9A 3S4RA 2LR2A 5KLIB 4ASWA 2KI7B 1BGYG 4OWFA 4UB6E 1QVFO 3CX5E 2NPSD 3AEEC 3L70D 3II6A 1SQVD 1URQA 2YO2A 1NWQA 2RH0A 1RHZB 1WT6A 2LXCB 1CI6A 1VQKP 1KQSO 3PRJA 1KB9H 3L75J 1MZ9A 2B89A 1ZN5A 1SQPJ 1SFCD 2QM8A 1HVVA 1EXJA 2PGDA 3G6EP 2ZJSE 3IAOA 3HUSC 1FZBA
chains in the Genus database with same CATH topology
3KZIE 5B5EE 5B66E 5E79E 1W5CE 3A0HE 3JCUE 1S5LE 3WU2E 3A0BE 5H2FE 5TISE 4UB6E 4IL6E 4PJ0E 5KAFE 5GTHE 4UB8E 5KAIE 5GTIE 2AXTE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI E;  5B5E E;  5B66 E;  5E79 E;  1W5C E;  3A0H E;  3JCU E;  1S5L E;  3WU2 E;  3A0B E;  5H2F E;  5TIS E;  4UB6 E;  4IL6 E;  4PJ0 E;  5KAF E;  5GTH E;  4UB8 E;  5KAI E;  5GTI E;  2AXT E; 
#chains in the Genus database with same CATH topology
 5APU A;  4EOT A;  4H0L B;  1RE4 A;  1GW3 A;  5E79 E;  3GLM A;  1T8Z A;  5CJ4 A;  4N78 D;  5AW6 B;  3V6I A;  1VQ4 P;  1M57 D;  1ZLL A;  3H1I E;  1PGJ A;  4PJ0 E;  1S5L X;  4YXW H;  1EC5 A;  1QL1 A;  4H13 D;  1VQM P;  1X8Y A;  3TF5 A;  5CCH C;  5APY A;  2I1K A;  2PRR A;  4EYY Q;  1KV4 A;  3TK1 A;  2HOD B;  5AVZ B;  4EIJ A;  2ZYG A;  1N2D C;  5GTH H;  1G1J A;  2UWJ E;  4YPC A;  1NU1 E;  5AVT B;  2IFM A;  1LTJ C;  4H44 D;  4GT1 A;  2BCC J;  3CCL P;  2FYU K;  2W90 A;  1GL2 C;  3E7K A;  1G2C B;  4L74 A;  2M5A B;  2R5D A;  2OGU A;  1SQQ E;  1M1J B;  3CWB D;  5TIS H;  4EI2 A;  3A3Y B;  2OTK E;  3W67 A;  3TNU A;  2GM4 A;  1DD4 A;  1YJN P;  1NH4 A;  1AVY A;  1L0L K;  1N73 C;  1IO4 A;  1EDI A;  3QWO C;  1SP4 A;  3CXH I;  5AW8 B;  2C0X A;  1ZR2 A;  2QSI A;  1KN7 A;  1ZP0 C;  3H1L D;  3L70 J;  2H7H A;  1SQV J;  2P58 A;  1OW7 A;  4HKZ H;  1A02 F;  3FXE A;  1SQX D;  2YNY A;  3TYY A;  3I56 P;  1BE3 G;  4DCK A;  3RK3 E;  3UIA A;  1JB0 J;  1KMI Z;  2O3J A;  1U57 A;  1GZL A;  1FZC A;  3V2N A;  2JP3 A;  3V2P A;  2HG5 D;  1U7J A;  1SLQ A;  1JUN A;  1KYO E;  4DZO A;  3L74 G;  4JBZ A;  1LTS C;  1LT9 B;  4BWN A;  3Q1M A;  4QMA A;  4N3Y B;  5CCH D;  3EFG A;  3P32 A;  3TGU E;  3U1C A;  2O01 N;  5TJH A;  3L4F A;  3CD6 P;  1VQN P;  3C9I A;  3BCC J;  2IDB A;  2HFE D;  2J59 M;  2N9Y B;  1URQ B;  3L73 D;  3EQ2 A;  4IFM A;  3CXH D;  1S9K D;  1EZV E;  1CI6 B;  3H1J E;  3C8V A;  2OYO A;  2B87 A;  1H88 A;  1HJB A;  1GL2 D;  3G71 P;  2QRX A;  1DH3 A;  3V4Q A;  1KB9 I;  5AW4 B;  1NTZ E;  3MD0 A;  2N9B A;  2P1J A;  2FYU D;  4HYT B;  3VMY A;  3BAT A;  1BDC A;  1BGY E;  1NTM D;  2FFD C;  3CI9 A;  3RK2 C;  3AE3 C;  2P7J A;  1SFC A;  1AV1 A;  5KLV E;  2HLO A;  1KFN A;  3CWB J;  2JKV A;  3VP9 A;  2V7Q J;  3CLQ A;  1IJD B;  2HPC A;  1YI2 P;  3MUD A;  1AA0 A;  4PV1 D;  2KLV A;  4WWI A;  3VTP C;  4JYC A;  5CCG C;  1JY3 O;  3VP8 A;  1PPJ G;  3SWY A;  1L0L D;  1NAY A;  2E74 C;  2RN0 A;  2E5T A;  5AW7 B;  1SQB J;  4N6J A;  2KXP B;  1BCC D;  2R3S A;  3H1L J;  1VF5 C;  2M0B A;  4B86 A;  2YKP A;  2KYV A;  1VQ5 P;  4WVZ A;  4KJM A;  1QL2 A;  3CC7 P;  1SQX J;  4DJG A;  5KAI E;  4D6T D;  1PP9 D;  2WSC J;  4GIF A;  3AE9 C;  1RF1 A;  3H1H G;  2AEF A;  1X0T A;  1KB9 D;  1W2E A;  4U3F E;  4I7Z B;  5AW3 B;  1J2J B;  3M0D A;  5BU5 A;  1NGM B;  1EQ7 A;  5AVY B;  3TNU B;  3SSU A;  2Y9Y A;  1FZF A;  2H88 C;  3Q5P A;  5KKZ C;  3CPW O;  2Z4E A;  2IX7 C;  4RJT A;  2ZAE B;  2OAR A;  3H1I G;  1NHL A;  4YTP C;  2QJY C;  1FU1 A;  3MP7 B;  5L8R J;  3D6Y A;  2WPQ A;  2H89 C;  1NOH A;  3HRN A;  1FZC B;  1ZW0 A;  3RK2 D;  2K9J A;  4PD4 I;  1NTM J;  1EDK A;  1HGV A;  1NU1 G;  1Q7Y Q;  1OMI A;  2W6A A;  1CZQ A;  3HUS A;  1JY2 O;  3L35 A;  1NJI Q;  3LIE A;  5CCG D;  2IFN A;  4ZKP A;  2M3B A;  1HTL C;  1DIP A;  1VQ7 P;  1HWT C;  2E5Y A;  2B88 A;  1BE3 E;  2E74 D;  1VQ9 P;  1L0L J;  1OXZ A;  3B8E B;  5CCH A;  1AVO A;  1KFM A;  1LWU B;  1VF5 D;  3VMZ A;  1BCC J;  1RY3 A;  1PL5 A;  4XE5 B;  5EFW B;  5APX A;  2B87 B;  3Q5S A;  3L74 E;  3I55 P;  4D6T J;  1PP9 J;  1GD2 E;  1PGO A;  1VQ8 P;  1L0N D;  1G1I A;  2IBZ I;  2IYP A;  1J1E C;  2FBW C;  1GL2 A;  1K04 A;  1SFC B;  3RBZ A;  5C39 A;  2YMY A;  4UB6 H;  1YIT P;  2YO3 A;  1YQ3 C;  3CX5 H;  3A7O A;  4PD4 D;  1OIP A;  1KIL C;  2HPC B;  3P8C D;  4OVN F;  2ZYD A;  1X9V A;  1M90 Q;  2Z5I A;  4L76 A;  3U1A A;  2O1J A;  4AUW A;  3PJS K;  1YJ9 P;  1JEK A;  1MKM A;  3M9Q A;  1FOS F;  2KZI A;  3OA7 A;  3F5H A;  5E79 H;  2KUB A;  3TGU G;  1EDJ A;  1J1D B;  4W7Z A;  2OYI B;  4JF7 A;  1LP1 A;  4H44 B;  3FWL A;  2HR3 A;  1IFM A;  1RF1 B;  4PJ0 H;  2K88 A;  2KOG A;  1ZRT E;  2W83 C;  4C7R A;  5KAF H;  3H32 A;  5KTB A;  2YKO A;  1YHQ P;  4IFF A;  3SFD C;  2IBZ D;  3MZW B;  3H1J G;  3OW2 O;  2V4H A;  3D6Z A;  1NTZ G;  2KNC A;  2WMM A;  1QX8 A;  2GUS A;  1PZQ A;  3CCE P;  1KQG B;  1VQL P;  2WSE J;  1SQB K;  1JCD A;  2P10 A;  2IYO A;  5KLV G;  1SVF A;  3HE4 A;  5APV A;  1T2K D;  1GW4 A;  3H1H E;  1K9M Q;  3H1K G;  2W8Z A;  1SQX K;  4GOD A;  1SQP G;  1K8A Q;  3B71 A;  2P67 A;  1OVR A;  4IL6 E;  2ZVN B;  3GMA A;  3HTK A;  1L0N J;  3IF4 A;  3B5N D;  3L72 D;  2XKM A;  1R5L A;  2A06 G;  2K9J B;  5BVZ A;  3VOP A;  3CMA P;  2LKM A;  3HUS B;  2POH A;  5AW9 B;  1GMJ A;  3P7K A;  1JMM A;  1FBM A;  3GHG C;  1KZU B;  1IC2 A;  2BAS A;  2KB7 P;  4Z1M H;  2NZ2 A;  2Y0D A;  2XU6 A;  5CCG A;  3SFE C;  3Q2Y A;  4U3F G;  5AVW B;  2KK7 A;  1FZA A;  1JCC A;  3BCC D;  1KTM A;  1L4A C;  2Q9I A;  2BCC G;  2SPZ A;  4XFJ A;  2FYN C;  3WUV A;  1CW5 A;  1N7S A;  1U7M A;  3QH9 A;  2K3R A;  5B5E E;  1KYO H;  3VMX A;  2NRG A;  1LT1 A;  3MGN A;  1NTM K;  4K3A A;  1GL2 B;  4TLF A;  3PP5 A;  3M06 A;  1H0T A;  1N86 A;  1PGP A;  2WSE H;  4GDO A;  3CX5 I;  4WB4 A;  2J58 A;  1M56 D;  4IFD K;  3PHL A;  1IFN A;  4LGD E;  1Z56 A;  2AXC A;  3L70 G;  4PV1 B;  1SQV G;  2IZ0 A;  5GTI E;  2RMZ A;  5DJU B;  1SQB D;  4OH8 B;  4W80 A;  1QVG O;  2FXO A;  1NTK D;  1Q90 D;  2JJL A;  3O8Z A;  5CMZ A;  3HE5 A;  3L71 D;  2C9L Y;  3WMM 0;  2YIU B;  1SQQ K;  2A45 G;  2LXB A;  4Y99 C;  1LP1 B;  1PPJ D;  1P84 E;  1BSN A;  1FOS E;  3L72 J;  4Y28 J;  2KS1 A;  1UII A;  3H32 B;  4PD4 H;  2C9N Y;  3JCU E;  1K05 A;  2KZJ A;  1RE3 C;  1JMB A;  2Y0E A;  4WY4 A;  2KNC B;  1RF0 C;  4IL6 X;  3L36 A;  2MKV A;  1AFO A;  2G3A A;  1W5C E;  3CX5 D;  1LT9 C;  5KAI H;  2BEZ F;  3LW5 J;  1QEX A;  3HE4 B;  1L4A D;  5M1B A;  1LWU A;  2E75 C;  5AVX B;  3L74 J;  2Y9Z A;  1WMK A;  2NPS A;  2KLU A;  2JEE A;  4JPZ B;  3RK3 C;  1URQ C;  1S3J A;  3A2A A;  3HTK B;  3N7N A;  4IOI H;  2XND H;  1KOR A;  3TDK A;  1QGK B;  3SWF A;  2C0W A;  3G3Z A;  1BDD A;  3B5N A;  2FFD B;  3H1I D;  3O6Q A;  3RK2 B;  2Y0C A;  3H1K E;  3FGA D;  3L75 E;  1SQP E;  1HH0 A;  2AEJ A;  4XA4 A;  5B66 H;  1E79 H;  3H1L G;  2W6J H;  3M9B A;  2QJP B;  5APT A;  2QM7 A;  2WPS A;  3PLN A;  2E42 A;  3AE2 C;  2E74 B;  1SQX G;  2A06 E;  1H89 A;  2Q5U A;  1NTK J;  2ZT9 C;  1H8A A;  1N7S B;  2WVR A;  3S1K A;  1S72 P;  4GKG A;  3L71 J;  4U7J A;  1L0N K;  3SWK A;  1KYO I;  2QJK B;  1JY3 N;  2OYI A;  1SQQ D;  2K9Y A;  3T97 A;  2Q7C A;  2N1T C;  5CJ0 A;  2YKQ A;  1VQP P;  2H43 A;  1H0T B;  1IK7 A;  4UB8 E;  1HUC A;  2W6B A;  2BCC E;  1VQO P;  3LW5 H;  3A0H E;  4I7Z C;  5AVR B;  1NKN A;  3NXS A;  3A0B E;  3AEF C;  3FX0 A;  1EZV I;  4JQ0 D;  3TSI A;  1Q2N A;  4DT0 A;  3L73 G;  5AW2 B;  4GOE A;  1PV3 A;  3KZI E;  2E75 D;  1S2E A;  3CCQ P;  3BVH A;  1FS0 E;  2ZYA A;  2Z5H A;  2KSE A;  1YYC A;  3HE5 B;  1M8O B;  3RK3 D;  2XDJ A;  3V2R A;  1K73 Q;  2FYU G;  1URQ D;  2QJY B;  2WSF H;  2WZ7 A;  3CCJ P;  1NYH A;  2QE7 H;  2KS1 B;  3AE6 C;  2J5U A;  1ZME C;  1KYO D;  3L70 E;  3HD7 C;  3V5B A;  1SQV E;  1XTC C;  1FZC C;  3ABV C;  4WY4 B;  2E43 A;  3H1I J;  3GF3 A;  2AXT H;  4NPE A;  1JY3 P;  4CPG A;  2ZVO B;  1L0L G;  1VL2 A;  2WWW A;  3TGU D;  2Q6Q A;  2OTL P;  3GHG A;  1USE A;  3RL0 C;  1EZV D;  4N78 E;  1NU1 J;  4D6T G;  1PP9 G;  2ZT9 D;  5BU8 B;  2NPS B;  1L4A A;  1JY2 N;  1NTZ D;  1X79 B;  1PIX A;  4AYC A;  1LNQ A;  4C7N A;  1LTJ A;  1BGY D;  2N1T D;  1SQQ J;  1EDL A;  2WPR A;  1YBK A;  1XTG B;  5KLV D;  1YTZ I;  2K1A A;  3B5N B;  3O6Q B;  3NFQ A;  2JR8 A;  1T3U A;  3B4S A;  1FJP A;  3Q5R A;  1S5L E;  1KC8 Q;  1FZG A;  3EFF K;  1RH5 B;  1TU3 F;  2JO1 A;  3MUD C;  2VRS A;  3CL3 D;  2PFX A;  4H13 B;  2E76 C;  1N73 A;  4IL6 H;  4W7Y A;  1NVO A;  2OYH C;  3AE5 C;  3FXD A;  1E5W A;  3CWB E;  3F89 A;  1MUU A;  2Q1K A;  2QIW A;  3R2P A;  1S1C X;  1KD1 Q;  1JTH A;  3JC2 2;  2KIK A;  3T97 B;  1HJ0 A;  3I5C A;  4RO0 A;  2D2C C;  5APS A;  4U3F D;  1T3J A;  1GTW A;  1SQB E;  2IPP A;  1JM0 A;  3HD7 D;  1IFP A;  3H1L E;  4RES B;  2ZFC A;  2B9B A;  1D7M A;  1J1D C;  1JY2 P;  1FZE A;  1RQU A;  4H44 C;  3NTN A;  1GDT A;  2WIT A;  4BRY A;  1SQX E;  3BRV B;  1AQT A;  1RE3 A;  5AW0 B;  3TGU J;  3H6P A;  3AE8 C;  1RF0 A;  5H2F E;  3KHU A;  3W68 A;  3KPE A;  5CHX A;  4OGQ C;  3RL0 D;  5B5E H;  5KLI C;  2MJZ A;  2ZXX A;  4HH2 A;  1NTK K;  3H1J J;  3P8M C;  3L75 G;  3AEB C;  4R4M A;  3R4Y A;  1L0N G;  1NTZ J;  1LTA C;  3M0A A;  1JNM A;  4BXL A;  3CC4 P;  1BGY J;  1JOC A;  3IN6 A;  2BEQ D;  3AE1 C;  5KLV J;  4I1L A;  4ZNC A;  2QVA A;  3L73 E;  1R8E A;  3H1K J;  3CXH E;  3IR9 A;  1S9K E;  2YXQ B;  2FFD A;  1KIL D;  5GTI H;  2O1K A;  2QEX P;  4H0L C;  1BE3 D;  1YQ4 C;  1YJW P;  2FYU E;  3GHG B;  1MFT A;  1NTM E;  2E76 D;  3PH0 A;  5KJ7 C;  2ZXE B;  1P84 H;  1N7L A;  1FE6 A;  5KAF E;  3L74 D;  4M3L A;  1FC2 C;  1DEE G;  1L4A B;  3JCU H;  3C1L A;  1PFI A;  2QG4 A;  3CCV P;  3VYI A;  4C7N B;  1OW8 A;  2FYN B;  1LTJ B;  2JWD A;  2JDI H;  2YMK A;  1YIJ P;  1L0L E;  2D2C D;  3WU2 E;  1GK4 A;  2IBZ G;  4U3F J;  1OVV A;  2HYN A;  1BCC E;  1LTB C;  2N1T A;  1KQF B;  1QLE D;  2XZR A;  3L37 A;  4WBA A;  1ZOY C;  1Q86 Q;  3CCU P;  5AVS B;  4D6T E;  1PP9 E;  4MN4 C;  1M1J C;  3ITK A;  1VDF A;  5DJT B;  1OWA A;  4AQR D;  4OGQ D;  1KB9 E;  2QA4 P;  1NU1 K;  2H8P D;  4LC1 A;  1IK9 A;  1N73 B;  1ZV8 A;  3NMD A;  2FKW B;  2R32 A;  4PV1 C;  1ZR4 A;  1IFD A;  1NO4 A;  3L72 G;  1MV8 A;  4L73 A;  1JTH B;  3KQG A;  1ZRT D;  3Q3D A;  1GU4 A;  2KP8 A;  2DW3 A;  1A02 J;  2K37 A;  3H25 A;  2KSJ A;  4Y99 B;  4ZKU A;  2YIU C;  1LTT C;  3V2Q A;  4HB1 A;  1W2B O;  2ITA A;  4BRY B;  3RGU A;  3HD7 A;  3OJA B;  5GTH E;  4R4L A;  2WTY A;  1OZH A;  4H0L D;  3E1R A;  3K5B A;  1BE3 J;  3OAK A;  3BCC G;  3H1H D;  1DD3 A;  3VN0 A;  2PP6 A;  5APQ A;  5KJ7 D;  1Y8A A;  3G4S P;  4EDF A;  3CC2 P;  2E75 B;  1M1K Q;  5TIS E;  4UB8 H;  2IZ1 A;  3RK3 B;  2XNX A;  3MIW A;  3A0H H;  3CWB G;  3A0B H;  2WSF J;  1NAF A;  1UIX A;  2WPV B;  2WT7 A;  1RQV A;  3VMA A;  2GUV A;  4KHX A;  1AJY A;  2FYZ A;  3KZI H;  1RE4 C;  1GK6 A;  3WUU A;  1L0N E;  1OVU A;  1KIL A;  3BRT B;  1SQB G;  2CK3 H;  2XV5 A;  4ZMD A;  2WQY C;  1LJ2 A;  1FDM A;  3KDP B;  3AEA C;  1NTK G;  1S4X A;  3BAS A;  4TT3 H;  1BSH A;  2RKL A;  3L71 G;  1NU1 D;  3G9R A;  2M3E A;  4HJG H;  1AQ5 A;  1P84 I;  1NTZ K;  4PD4 E;  3A5T A;  2OYH A;  3P8C E;  2QJP C;  4NPD A;  2YXR B;  1VF5 B;  1X22 A;  3RL0 g;  2FXM A;  2ZT9 B;  1FAV A;  2CPS A;  5KLV K;  1FJK A;  1N7S C;  3AEC C;  1MFZ A;  3M9H A;  3USS A;  2QJK C;  3JSV C;  1IZN B;  2N1T B;  1SQP K;  1VPC A;  2A45 H;  1HGZ A;  2R44 A;  1LTI C;  1PGQ A;  2Q3E A;  1GU5 A;  1N8R Q;  3S9O A;  1T6A A;  1M7L A;  3H1H J;  5KKZ B;  1OFC X;  1OW6 A;  2IBZ E;  3U59 A;  5AW5 B;  5CBN A;  3CCM P;  3CCR P;  3EWK A;  4I2L C;  5AVU B;  1P84 D;  3D71 A;  2R5B A;  2CPB A;  1NTM G;  1Q82 Q;  5APW A;  1Y9B A;  3CCS P;  1S5L H;  5B66 E;  3V4W A;  3L73 J;  4GOF A;  2G8Y A;  2FXP A;  3GF7 A;  4O9B A;  3KXD A;  1FDO A;  4DOJ A;  3HD7 B;  2OTJ P;  2OQQ A;  1VQ6 P;  2W27 A;  2FYU J;  2L5G B;  3N4X A;  2V7Q H;  1KQL A;  2O01 J;  1OX3 A;  4WY4 C;  3KYQ A;  3L72 E;  3GW6 A;  4K35 A;  1DEB A;  1BCC G;  5AW1 B;  3M91 A;  1L2P A;  2Q3I A;  1NKZ B;  3MHV A;  2WSS H;  2I8D A;  5AVV B;  1KIL E;  3RL0 B;  3H1J D;  4NPF X;  5KJ7 A;  3GG2 A;  1Y47 A;  3IFM A;  1SQQ G;  2HOD A;  1LWU C;  1SQV K;  1ZXG A;  2L91 A;  3AED C;  1N7S D;  2NPS C;  1T2K C;  2JWA A;  4KT0 J;  2WSC H;  2I1J A;  3BCC E;  2M8R A;  2R3C A;  5H2F H;  3D70 A;  1J1E B;  3H1K D;  4RKU J;  2WT7 B;  3L75 D;  1SQP D;  1JO5 A;  2FY8 A;  1G2C A;  2M5A A;  3B5N C;  1SFC C;  1WRG A;  1KIL B;  3WUT A;  1M1J A;  5AVQ B;  5CBO A;  3FWN A;  2A06 D;  1DX7 A;  1LTG C;  3ZDM A;  1YTZ T;  4YXD C;  3MTU E;  2E76 B;  2OYH B;  4H13 C;  4ASV A;  1R5S A;  3CXH H;  1USD A;  2AXT E;  4C46 A;  4I6M C;  3CME P;  5K5G B;  2PAJ A;  1FDI A;  1CSB A;  2D2C B;  2OYI C;  2O01 H;  2BCC D;  2P2U A;  3AE4 C;  1NTK E;  4LLH A;  1Q81 Q;  3AE7 C;  1RF1 C;  1IFJ A;  2A45 I;  3L71 E;  1LGH B;  1EXI A;  4L75 A;  2GA1 A;  4WY4 D;  3LID A;  3M0D C;  1IFI A;  1PPJ E;  1SS1 A;  1EZV G;  4A7P A;  3RBX A;  3PTZ A;  4JYB A;  3E1I A;  1HF9 A;  2AEM A;  3WU2 H;  1HBW A;  4OGQ B;  3AEG C;  1LT9 A;  3S4R A;  2LR2 A;  5KLI B;  4ASW A;  2KI7 B;  1BGY G;  4OWF A;  4UB6 E;  1QVF O;  3CX5 E;  2NPS D;  3AEE C;  3L70 D;  3II6 A;  1SQV D;  1URQ A;  2YO2 A;  1NWQ A;  2RH0 A;  1RHZ B;  1WT6 A;  2LXC B;  1CI6 A;  1VQK P;  1KQS O;  3PRJ A;  1KB9 H;  3L75 J;  1MZ9 A;  2B89 A;  1ZN5 A;  1SQP J;  1SFC D;  2QM8 A;  1HVV A;  1EXJ A;  2PGD A;  3G6E P;  2ZJS E;  3IAO A;  3HUS C;  1FZB A; 
#chains in the Genus database with same CATH homology
 3KZI E;  5B5E E;  5B66 E;  5E79 E;  1W5C E;  3A0H E;  3JCU E;  1S5L E;  3WU2 E;  3A0B E;  5H2F E;  5TIS E;  4UB6 E;  4IL6 E;  4PJ0 E;  5KAF E;  5GTH E;  4UB8 E;  5KAI E;  5GTI E;  2AXT E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...