5B5EE

Crystal structure analysis of photosystem ii complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 20
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5b5eE00
5KAIE 5GTIE 3WU2E 5KAFE 3JCUE 4UB8E 5B5EE 1S5LE 5E79E 3A0BE 4IL6E 5GTHE 4UB6E 5B66E 1W5CE 5TISE 3KZIE 2AXTE 3A0HE 4PJ0E 5H2FE
chains in the Genus database with same CATH superfamily
1S2EA 4ZKPA 5B66H 2K9YA 4EOTA 3Q3DA 1N7SC 3L73G 2OYOA 2XKMA 1K8AQ 1KB9I 1GZLA 5CJ4A 2IBZE 1CW5A 2QE7H 3MZWB 3CWBG 3U1CA 3L36A 4IL6X 4OGQB 1S4XA 2QG4A 5AVQB 3B5NC 2N1TC 1RF1C 5GTIE 1USEA 1BCCE 3EQ2A 3Q1MA 1YI2P 2KI7B 1CZQA 1SQVJ 5APUA 2POHA 2YMYA 4MN4C 4C7NA 1RH5B 2E76D 4D6TJ 3GHGC 3A0HE 2JWDA 4A7PA 1VF5B 2P58A 2KIKA 2GA1A 2FYNC 1EDKA 2E74D 1AVOA 1BGYD 5KAIH 1N7SB 1IO4A 1NOHA 2QJYC 2ZXEB 3P7KA 1VQ4P 1SQPD 2ZAEB 2Q3IA 4HKZH 5KJ7A 3O8ZA 4WY4C 3V2NA 2HODA 1GTWA 3VMYA 3GMAA 1J1DC 1ZP0C 2N1TB 4I7ZC 3MHVA 1KZUB 3MTUE 1RF1B 3CCUP 3PP5A 1Y47A 1QL2A 1SVFA 2Q5UA 2XV5A 1ZRTE 3MP7B 1FZCC 4AUWA 2DW3A 1DX7A 5CBOA 3M9QA 1IFNA 3T97B 1IFPA 3GHGB 3H1IJ 4PD4E 3A0HH 1VQMP 3CXHI 5E79E 2FYNB 2JO1A 4UB6E 1NKZB 5APWA 1LTTC 1L0NE 2C0XA 2JKVA 2QJYB 3A3YB 1VQ9P 5APTA 1JY3P 1MZ9A 2OQQA 4GOFA 3S4RA 2HYNA 4TT3H 1WMKA 4WY4B 2YIUC 1M90Q 4H13D 3L37A 4BXLA 1J1DB 4I7ZB 2OYHA 3TYYA 3BVHA 3H1LJ 1L0LG 2FYUD 1EQ7A 1SFCA 1SQQG 1HJBA 3AE1C 2LXBA 4N3YB 1QLED 1FZCB 3G3ZA 1YTZT 5BVZA 3TGUD 1NAFA 1KYOE 1NU1J 1JMMA 3HD7D 1YQ3C 3SSUA 4IOIH 4YXWH 1OFCX 5CJ0A 1L0NK 3U1AA 2QA4P 1ZR4A 3TSIA 4KJMA 3BCCD 2WZ7A 2JEEA 1BDCA 3CC2P 3RBZA 2YNYA 3I56P 2BCCE 2I8DA 3KQGA 1HGVA 1VQ8P 1Q81Q 2YIUB 3L74D 4I1LA 2M8RA 2L5GB 3AEEC 1KTMA 3AE7C 1JCDA 3NXSA 1KD1Q 1JY3O 3B5ND 3O6QB 2QM8A 2N1TD 4ZNCA 2M5AB 2NRGA 2L91A 5KAFH 4IFDK 1NTZE 1OVVA 1LJ2A 1KQFB 3VYIA 5H2FE 2Q1KA 4PV1C 1VQ5P 2QM7A 2KB7P 3AEFC 1EDIA 1VPCA 3A0BE 1LTJA 4IFFA 1W5CE 1UIXA 2JP3A 2IYOA 3A2AA 2QJPC 4N78E 5M1BA 3HTKB 4GOEA 4WY4D 4JPZB 1TU3F 3H1JE 1PL5A 3V2PA 3HRNA 4UB8H 1NTZK 1FAVA 3H1KD 1ZW0A 4U3FE 1YQ4C 1NVOA 2PP6A 4M3LA 1T2KC 2G8YA 2KNCA 1JEKA 5H2FH 4PV1B 1J1EC 3FGAD 3V4QA 4H0LC 3GF7A 5AVZB 2ZYDA 3T97A 1LWUC 2H88C 1SQBG 2FYUJ 2PAJA 2FFDA 1YBKA 3HE4B 1KILD 5C39A 1PV3A 1IJDB 1USDA 3ZDMA 2E42A 2QJPB 2OGUA 2YO3A 1BE3E 1NTMG 1JUNA 1M57D 5KKZC 2WT7A 1N7LA 3W68A 1BGYG 1YJWP 1JY2O 3BCCJ 3B71A 1PP9E 3CMEP 1SQPG 3M06A 2JR8A 4LGDE 1J1EB 2WPSA 1Q82Q 3L74J 3H6PA 3KZIE 4H0LB 2KXPB 3CXHD 1P84E 2B87A 1LWUB 1X9VA 2Y9ZA 5CCHD 1FS0E 1D7MA 2FBWC 1X8YA 3RK2D 1ZLLA 2W8ZA 1AFOA 3IN6A 1Q90D 3OAKA 2W6BA 2Y0CA 3L70E 1KB9E 2SPZA 1OWAA 3H1HG 5KKZB 1RE4C 2WSCJ 3L71J 1NKNA 3L73E 2BEQD 5AVTB 1KORA 2FYZA 3O6QA 2E74C 2M5AA 5AVXB 3CWBE 3H1JG 2K9JB 3V2RA 3KZIH 2K88A 1P84H 1ZOYC 2YXRB 2FYUG 2ZT9C 3AEGC 4RJTA 3PRJA 3C9IA 3G71P 3TGUG 5APYA 1BSHA 1N73C 4W80A 5CHXA 3WUTA 3JC22 4L76A 2O01N 3E1IA 2IDBA 1RF0C 1J2JB 2IX7C 2OYIC 1NTKG 2R32A 5AW8B 4ZKUA 1FOSF 1BCCD 1URQD 1MV8A 2E5YA 2AEJA 1NJIQ 2ZXXA 2E74B 2GUVA 1SQXJ 3V2QA 2ZYGA 1S9KD 1M56D 2BEZF 2ZVNB 1Y8AA 1FZGA 2KOGA 1EDJA 2HPCB 2GM4A 1U7JA 2ZT9B 2IPPA 4H13C 2C9LY 3NTNA 1T3UA 5KLVJ 2YMKA 1FZAA 1JTHB 1X79B 3LIDA 2P7JA 3CX5E 1N73B 3RGUA 3HE4A 2K37A 1JY2N 4PJ0E 3A5TA 2OYIB 1H89A 3JSVC 3HD7C 1VQ6P 2PFXA 2KUBA 2O01J 2FXOA 3FX0A 1QGKB 1LTBC 2N9YB 5AVUB 2IFNA 1L0LE 2H7HA 4H13B 3RL0D 3H1KG 5AW4B 3GW6A 2RMZA 3NFQA 1SQQE 1NU1D 3M0DC 3JCUH 1HVVA 1L0ND 5BU8B 5DJTB 1N8RQ 4GODA 2Y0DA 3RL0g 1JB0J 2RN0A 1KQSO 1PFIA 1AA0A 3CL3D 4I6MC 5AW7B 2MJZA 3HD7B 1S1CX 2O3JA 3CC4P 3GG2A 3QWOC 2N9BA 1NAYA 4H44C 2R5BA 1NH4A 2YKPA 3V6IA 1M1JC 1L0LK 2C9NY 4LC1A 4JYCA 1S5LE 4XA4A 1SQQK 1FZEA 2K9JA 3CI9A 2A06D 2G3AA 2ZT9D 1PPJD 3P8CD 1YIJP 3CCLP 1BCCJ 3B5NB 1Q2NA 2BCCD 3GLMA 1RE3C 5GTIH 1JCCA 2P10A 3VP8A 4RO0A 1VQPP 3C1LA 2MKVA 3MD0A 3EWKA 3L75G 5APVA 1MUUA 2J5UA 2OTLP 1GL2A 5DJUB 1SFCD 2XNXA 3R4YA 4H44B 3MUDC 1ZMEC 1M1JB 2NPSD 2V4HA 1AJYA 1KILC 1H0TA 1G2CB 1LTAC 1FU1A 1LTGC 1W2BO 2HPCA 3ABVC 1PGPA 2ZFCA 2LXCB 3FXDA 1KC8Q 4BWNA 1CI6B 3BRTB 1JTHA 3D71A 4N78D 1SQVG 3KPEA 3Q5RA 2QRXA 1SQBE 1RY3A 4ASVA 4D6TG 1QL1A 1HTLC 3VMXA 4PD4H 2OYIA 3U59A 2FXPA 1L0NJ 5E79H 1PZQA 1JOCA 5CCHC 4UB6H 2RKLA 1NTME 1KILB 1L4AA 1JM0A 2KS1B 4BRYB 3BATA 3RK2C 1BGYE 1MFTA 3OW2O 1LTIC 1SQPE 1K04A 1EZVD 3K5BA 2AXTE 1LP1B 2XNDH 1OW6A 5AW5B 4RKUJ 2ZJSE 5AW0B 1SQBK 1BE3D 3PH0A 5APXA 2WSFJ 3TDKA 1G1JA 2KZJA 1FBMA 3H1IG 1KYOH 1FDMA 2WSFH 3VTPC 1NTMK 3VN0A 1BSNA 1PP9D 3AE9C 3HD7A 4R4MA 3HE5B 3L71D 4H44D 2BCCJ 1LT9C 2AEFA 3H1HE 1Y9BA 1YJNP 3RK2B 3I55P 1VL2A 1YTZI 1SQPK 3CCJP 1P84D 2KSEA 1JY2P 1HGZA 3AEDC 3SWFA 1N7SA 1VDFA 3TK1A 3W67A 3H1LG 2Y9YA 3M0DA 3TNUB 2W6JH 3TF5A 1NTZJ 3I5CA 1URQC 3E1RA 3FXEA 3B5NA 2FYUE 2N1TA 3OJAB 1SS1A 1GMJA 1RF1A 1LNQA 1U57A 1NU1G 3PHLA 2M3BA 1HH0A 1ZR2A 1U7MA 2P67A 3AE2C 3VP9A 4DJGA 1GD2E 2PRRA 3WMM0 4NPFX 3VMZA 2JDIH 3TGUE 2HLOA 2YXQB 2WMMA 1IFIA 1LT9B 4L75A 3KXDA 1OIPA 3A0BH 3GHGA 1VQNP 3CWBD 1A02J 2KZIA 2WSEH 4HYTB 1SQXD 1NTKE 5B5EE 3C8VA 3USSA 3VMAA 1FDOA 1G2CA 2R3CA 4U3FJ 1M7LA 2KLUA 4WY4A 2FYUK 2WQYC 3WUUA 1URQB 3V5BA 4WVZA 1H88A 5CCGD 5KLVD 3P32A 5L8RJ 1RE3A 1XTCC 1CI6A 3L72D 2Q3EA 3QH9A 2A06G 3RK3D 3SWYA 2LKMA 1PPJG 4ZMDA 1VQKP 1LTSC 1OX3A 2M3EA 4U7JA 1OMIA 3AE5C 1FZCA 3IFMA 3RL0C 3CC7P 5AVYB 1NTKK 1IFJA 1FC2C 4YTPC 2VRSA 1BE3J 4RESB 4L73A 1T6AA 2KS1A 4BRYA 4AQRD 3VOPA 4Y28J 4B86A 5AW6B 2B88A 1PP9J 2HFED 4LLHA 3F5HA 1T3JA 2B9BA 4DCKA 3H1KE 2YKQA 2IYPA 4QMAA 1ZV8A 3RL0B 2KLVA 2CK3H 2Z5HA 3FWNA 2RH0A 5AW1B 5AW9B 5CBNA 3AE6C 1DIPA 5CCHA 2A45H 2GUSA 4XFJA 1G1IA 3F89A 3L70J 1AVYA 1KILE 1L0LD 1SP4A 1Q7YQ 3CCEP 2HODB 1KB9H 2W6AA 2IBZD 2B89A 3L73J 5GTHE 2HG5D 3EFFK 3BCCG 2NZ2A 2ITAA 3HTKA 5APSA 4WBAA 1GW3A 1SFCC 4NPDA 1JO5A 3CWBJ 1EDLA 3CLQA 2NPSC 1GU5A 1QVGO 3L74G 1IFDA 1EZVG 1NYHA 1HF9A 3CXHE 1KQGB 2XU6A 3H32B 1HWTC 3L75E 4YXDC 1EZVI 3IF4A 1ZN5A 1LT9A 2QSIA 3L72J 1T8ZA 4Y99C 3M0AA 5B66E 4TLFA 2UWJE 3S9OA 3ITKA 1FZBA 5GTHH 5AVRB 2O1JA 3L71G 1CSBA 1R5SA 1PGOA 2IZ0A 1SFCB 3M91A 1IFMA 4W7ZA 2KK7A 2NPSB 1NHLA 1URQA 3IAOA 3II6A 2WSSH 1ZRTD 4HJGH 3Q5SA 3LIEA 1LGHB 3WUVA 4PD4D 2D2CD 1P84I 2FXMA 2QIWA 1OZHA 4R4LA 1SQVE 2QVAA 1LTJC 5KLIC 1DEBA 1KFNA 1E79H 2JWAA 1RQVA 2A45I 1LWUA 4K35A 4D6TE 2W83C 5AVVB 4Y99B 2WITA 3CX5H 5KAIE 3BRVB 4KHXA 2E75D 3HUSC 2WPRA 2FKWB 5KJ7D 3M9HA 2CPBA 1AV1A 4PJ0H 2O1KA 2R3SA 2Z4EA 5EFWB 2I1KA 2ZVOB 2AXCA 1K9MQ 1SQXG 3UIAA 1SQBD 1L0LJ 3CD6P 1IC2A 1S9KE 1GL2D 1KYOD 1SQVK 1EXIA 1SQQJ 1S72P 1LTJB 4O9BA 5KLIB 5KLVG 1NTMD 4WWIA 2FFDC 3AE4C 3MIWA 3L72G 2Y0EA 3H1IE 4C7RA 1HUCA 2R44A 1KQLA 1K05A 3HUSB 4HH2A 1OVUA 3AEBC 2AEMA 1A02F 4EDFA 1YITP 2QJKC 4WB4A 3N4XA 3H25A 1FOSE 3AECC 1FDIA 1LT1A 1RE4A 1W2EA 2KNCB 2OTJP 1NTZD 3NMDA 3KDPB 2IFMA 2WVRA 3PJSK 3H1LE 1S5LH 1NO4A 1YJ9P 5BU5A 4DT0A 1VQ7P 4JF7A 1GW4A 2FFDB 2JJLA 1XTGB 3H1HD 1DD4A 1L4AD 2E43A 1NU1E 1Z56A 1AQTA 3H32A 1YYCA 1EC5A 3CMAP 3CX5I 4JBZA 2WPVB 5CCGC 2KP8A 1RHZB 1H8AA 1M8OB 3RK3C 2WT7B 1N73A 2I1JA 2KYVA 2QJKB 3H1JD 1RF0A 2H89C 1S5LX 4U3FD 1ZXGA 4OGQD 2WWWA 4XE5B 2IBZG 2NPSA 1IZNB 5KAFE 2B87B 4AYCA 1NU1K 4L74A 1BCCG 2YO2A 1SLQA 3BASA 2IBZI 2A06E 1VF5D 1PPJE 3P8CE 1OVRA 2Q6QA 3D70A 3EFGA 1NTKD 1SQBJ 3GF3A 1QVFO 4NPEA 3RK3B 1N7SD 3E7KA 1NGMB 3N7NA 4IFMA 2KSJA 3PTZA 1Q86Q 1NTMJ 3P8MC 1X0TA 1KV4A 2R5DA 4UB8E 2XZRA 1BGYJ 3PLNA 2PGDA 1HBWA 1FE6A 1L2PA 2K3RA 1SQPJ 1RQUA 3L35A 1QX8A 5AW2B 2WTYA 2AXTH 3A7OA 2H8PD 2IZ1A 1DD3A 2M0BA 4C46A 1N2DC 2J58A 5TISE 3CCQP 3L70D 1KB9D 4K3AA 3R2PA 1HJ0A 4W7YA 3HUSA 3WU2E 2OARA 3SWKA 4DZOA 1E5WA 1L0NG 3H1HJ 3AE8C 3L73D 4PD4I 2WSEJ 1GDTA 1MKMA 2K1AA 1OW7A 5KTBA 1X22A 3BCCE 5APQA 1M1JA 5AVWB 4EI2A 3KHUA 3D6YA 3H1JJ 1KFMA 1QEXA 2OTKE 3L74E 1EZVE 2YKOA 4GT1A 5TISH 1IK7A 4Z1MH 3SFDC 3TGUJ 3WU2H 4I2LC 1K73Q 5CMZA 1KYOI 3L4FA 2D2CC 2BCCG 2H43A 4YPCA 1NTKJ 1GK6A 3MUDA 3L71E 2W27A 3G9RA 4KT0J 2Z5IA 1KILA 5B5EH 1BDDA 4JYBA 3CCRP 2E75C 5KJ7C 3Q2YA 3IR9A 1KMIZ 3L75D 3B4SA 1M1KQ 1NTZG 1WT6A 3CCMP 3M9BA 3CX5D 4OWFA 1LP1A 4OVNF 1FJPA 1WRGA 4GIFA 1OXZA 2XDJA 5CCGA 1PGQA 1JY3N 3MGNA 1GL2C 4C7NB 1UIIA 3G4SP 2FY8A 2Q9IA 2D2CB 2ZYAA 1MFZA 2E76C 1DEEG 1JNMA 1YHQP 4N6JA 1S3JA 3AE3C 2WSCH 1FJKA 1R5LA 1IK9A 5TJHA 1NWQA 3HE5A 4JQ0D 3D6ZA 2W90A 3RBXA 3OA7A 2P1JA 4GDOA 2BASA 2E75B 2Q7CA 1SQXE 4PV1D 4U3FG 1SQVD 1GU4A 3Q5PA 1SQQD 4EIJA 4EYYQ 1DH3A 2C0WA 3CCSP 1VQLP 3H1KJ 2OYHC 4D6TD 3FWLA 3TNUA 5KLVE 1GL2B 4IL6E 3L72E 3RK3E 1PIXA 2E76B 3AEAC 2LR2A 5K5GB 1KN7A 2V7QJ 3CCVP 1FZFA 2CPSA 3SFEC 1L4AC 1BE3G 1H0TB 1R8EA 1SQXK 3CPWO 1T2KD 2V7QH 2QEXP 1OW8A 1N86A 1PP9G 1JMBA 4CPGA 4H0LD 4HB1A 4GKGA 2OYHB 3H1ID 4DOJA 3JCUE 1EXJA 5KLVK 2P2UA 1PGJA 4OGQC 3B8EB 3KYQA 4IL6H 4OH8B 3V4WA 2J59M 1GK4A 5AW3B 1VQOP 2A45G 3L75J 2E5TA 3CXHH 2HR3A 1L4AB 3S1KA 3LW5J 3L70G 4ASWA 1AQ5A 1VF5C 3H1LD 3G6EP 5AVSB 2WPQA 3LW5H 2O01H
chains in the Genus database with same CATH topology
5KAIE 5GTIE 3WU2E 5KAFE 3JCUE 4UB8E 5B5EE 1S5LE 5E79E 3A0BE 4IL6E 5GTHE 4UB6E 5B66E 1W5CE 5TISE 3KZIE 2AXTE 3A0HE 4PJ0E 5H2FE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI E;  5GTI E;  3WU2 E;  5KAF E;  3JCU E;  4UB8 E;  5B5E E;  1S5L E;  5E79 E;  3A0B E;  4IL6 E;  5GTH E;  4UB6 E;  5B66 E;  1W5C E;  5TIS E;  3KZI E;  2AXT E;  3A0H E;  4PJ0 E;  5H2F E; 
#chains in the Genus database with same CATH topology
 1S2E A;  4ZKP A;  5B66 H;  2K9Y A;  4EOT A;  3Q3D A;  1N7S C;  3L73 G;  2OYO A;  2XKM A;  1K8A Q;  1KB9 I;  1GZL A;  5CJ4 A;  2IBZ E;  1CW5 A;  2QE7 H;  3MZW B;  3CWB G;  3U1C A;  3L36 A;  4IL6 X;  4OGQ B;  1S4X A;  2QG4 A;  5AVQ B;  3B5N C;  2N1T C;  1RF1 C;  5GTI E;  1USE A;  1BCC E;  3EQ2 A;  3Q1M A;  1YI2 P;  2KI7 B;  1CZQ A;  1SQV J;  5APU A;  2POH A;  2YMY A;  4MN4 C;  4C7N A;  1RH5 B;  2E76 D;  4D6T J;  3GHG C;  3A0H E;  2JWD A;  4A7P A;  1VF5 B;  2P58 A;  2KIK A;  2GA1 A;  2FYN C;  1EDK A;  2E74 D;  1AVO A;  1BGY D;  5KAI H;  1N7S B;  1IO4 A;  1NOH A;  2QJY C;  2ZXE B;  3P7K A;  1VQ4 P;  1SQP D;  2ZAE B;  2Q3I A;  4HKZ H;  5KJ7 A;  3O8Z A;  4WY4 C;  3V2N A;  2HOD A;  1GTW A;  3VMY A;  3GMA A;  1J1D C;  1ZP0 C;  2N1T B;  4I7Z C;  3MHV A;  1KZU B;  3MTU E;  1RF1 B;  3CCU P;  3PP5 A;  1Y47 A;  1QL2 A;  1SVF A;  2Q5U A;  2XV5 A;  1ZRT E;  3MP7 B;  1FZC C;  4AUW A;  2DW3 A;  1DX7 A;  5CBO A;  3M9Q A;  1IFN A;  3T97 B;  1IFP A;  3GHG B;  3H1I J;  4PD4 E;  3A0H H;  1VQM P;  3CXH I;  5E79 E;  2FYN B;  2JO1 A;  4UB6 E;  1NKZ B;  5APW A;  1LTT C;  1L0N E;  2C0X A;  2JKV A;  2QJY B;  3A3Y B;  1VQ9 P;  5APT A;  1JY3 P;  1MZ9 A;  2OQQ A;  4GOF A;  3S4R A;  2HYN A;  4TT3 H;  1WMK A;  4WY4 B;  2YIU C;  1M90 Q;  4H13 D;  3L37 A;  4BXL A;  1J1D B;  4I7Z B;  2OYH A;  3TYY A;  3BVH A;  3H1L J;  1L0L G;  2FYU D;  1EQ7 A;  1SFC A;  1SQQ G;  1HJB A;  3AE1 C;  2LXB A;  4N3Y B;  1QLE D;  1FZC B;  3G3Z A;  1YTZ T;  5BVZ A;  3TGU D;  1NAF A;  1KYO E;  1NU1 J;  1JMM A;  3HD7 D;  1YQ3 C;  3SSU A;  4IOI H;  4YXW H;  1OFC X;  5CJ0 A;  1L0N K;  3U1A A;  2QA4 P;  1ZR4 A;  3TSI A;  4KJM A;  3BCC D;  2WZ7 A;  2JEE A;  1BDC A;  3CC2 P;  3RBZ A;  2YNY A;  3I56 P;  2BCC E;  2I8D A;  3KQG A;  1HGV A;  1VQ8 P;  1Q81 Q;  2YIU B;  3L74 D;  4I1L A;  2M8R A;  2L5G B;  3AEE C;  1KTM A;  3AE7 C;  1JCD A;  3NXS A;  1KD1 Q;  1JY3 O;  3B5N D;  3O6Q B;  2QM8 A;  2N1T D;  4ZNC A;  2M5A B;  2NRG A;  2L91 A;  5KAF H;  4IFD K;  1NTZ E;  1OVV A;  1LJ2 A;  1KQF B;  3VYI A;  5H2F E;  2Q1K A;  4PV1 C;  1VQ5 P;  2QM7 A;  2KB7 P;  3AEF C;  1EDI A;  1VPC A;  3A0B E;  1LTJ A;  4IFF A;  1W5C E;  1UIX A;  2JP3 A;  2IYO A;  3A2A A;  2QJP C;  4N78 E;  5M1B A;  3HTK B;  4GOE A;  4WY4 D;  4JPZ B;  1TU3 F;  3H1J E;  1PL5 A;  3V2P A;  3HRN A;  4UB8 H;  1NTZ K;  1FAV A;  3H1K D;  1ZW0 A;  4U3F E;  1YQ4 C;  1NVO A;  2PP6 A;  4M3L A;  1T2K C;  2G8Y A;  2KNC A;  1JEK A;  5H2F H;  4PV1 B;  1J1E C;  3FGA D;  3V4Q A;  4H0L C;  3GF7 A;  5AVZ B;  2ZYD A;  3T97 A;  1LWU C;  2H88 C;  1SQB G;  2FYU J;  2PAJ A;  2FFD A;  1YBK A;  3HE4 B;  1KIL D;  5C39 A;  1PV3 A;  1IJD B;  1USD A;  3ZDM A;  2E42 A;  2QJP B;  2OGU A;  2YO3 A;  1BE3 E;  1NTM G;  1JUN A;  1M57 D;  5KKZ C;  2WT7 A;  1N7L A;  3W68 A;  1BGY G;  1YJW P;  1JY2 O;  3BCC J;  3B71 A;  1PP9 E;  3CME P;  1SQP G;  3M06 A;  2JR8 A;  4LGD E;  1J1E B;  2WPS A;  1Q82 Q;  3L74 J;  3H6P A;  3KZI E;  4H0L B;  2KXP B;  3CXH D;  1P84 E;  2B87 A;  1LWU B;  1X9V A;  2Y9Z A;  5CCH D;  1FS0 E;  1D7M A;  2FBW C;  1X8Y A;  3RK2 D;  1ZLL A;  2W8Z A;  1AFO A;  3IN6 A;  1Q90 D;  3OAK A;  2W6B A;  2Y0C A;  3L70 E;  1KB9 E;  2SPZ A;  1OWA A;  3H1H G;  5KKZ B;  1RE4 C;  2WSC J;  3L71 J;  1NKN A;  3L73 E;  2BEQ D;  5AVT B;  1KOR A;  2FYZ A;  3O6Q A;  2E74 C;  2M5A A;  5AVX B;  3CWB E;  3H1J G;  2K9J B;  3V2R A;  3KZI H;  2K88 A;  1P84 H;  1ZOY C;  2YXR B;  2FYU G;  2ZT9 C;  3AEG C;  4RJT A;  3PRJ A;  3C9I A;  3G71 P;  3TGU G;  5APY A;  1BSH A;  1N73 C;  4W80 A;  5CHX A;  3WUT A;  3JC2 2;  4L76 A;  2O01 N;  3E1I A;  2IDB A;  1RF0 C;  1J2J B;  2IX7 C;  2OYI C;  1NTK G;  2R32 A;  5AW8 B;  4ZKU A;  1FOS F;  1BCC D;  1URQ D;  1MV8 A;  2E5Y A;  2AEJ A;  1NJI Q;  2ZXX A;  2E74 B;  2GUV A;  1SQX J;  3V2Q A;  2ZYG A;  1S9K D;  1M56 D;  2BEZ F;  2ZVN B;  1Y8A A;  1FZG A;  2KOG A;  1EDJ A;  2HPC B;  2GM4 A;  1U7J A;  2ZT9 B;  2IPP A;  4H13 C;  2C9L Y;  3NTN A;  1T3U A;  5KLV J;  2YMK A;  1FZA A;  1JTH B;  1X79 B;  3LID A;  2P7J A;  3CX5 E;  1N73 B;  3RGU A;  3HE4 A;  2K37 A;  1JY2 N;  4PJ0 E;  3A5T A;  2OYI B;  1H89 A;  3JSV C;  3HD7 C;  1VQ6 P;  2PFX A;  2KUB A;  2O01 J;  2FXO A;  3FX0 A;  1QGK B;  1LTB C;  2N9Y B;  5AVU B;  2IFN A;  1L0L E;  2H7H A;  4H13 B;  3RL0 D;  3H1K G;  5AW4 B;  3GW6 A;  2RMZ A;  3NFQ A;  1SQQ E;  1NU1 D;  3M0D C;  3JCU H;  1HVV A;  1L0N D;  5BU8 B;  5DJT B;  1N8R Q;  4GOD A;  2Y0D A;  3RL0 g;  1JB0 J;  2RN0 A;  1KQS O;  1PFI A;  1AA0 A;  3CL3 D;  4I6M C;  5AW7 B;  2MJZ A;  3HD7 B;  1S1C X;  2O3J A;  3CC4 P;  3GG2 A;  3QWO C;  2N9B A;  1NAY A;  4H44 C;  2R5B A;  1NH4 A;  2YKP A;  3V6I A;  1M1J C;  1L0L K;  2C9N Y;  4LC1 A;  4JYC A;  1S5L E;  4XA4 A;  1SQQ K;  1FZE A;  2K9J A;  3CI9 A;  2A06 D;  2G3A A;  2ZT9 D;  1PPJ D;  3P8C D;  1YIJ P;  3CCL P;  1BCC J;  3B5N B;  1Q2N A;  2BCC D;  3GLM A;  1RE3 C;  5GTI H;  1JCC A;  2P10 A;  3VP8 A;  4RO0 A;  1VQP P;  3C1L A;  2MKV A;  3MD0 A;  3EWK A;  3L75 G;  5APV A;  1MUU A;  2J5U A;  2OTL P;  1GL2 A;  5DJU B;  1SFC D;  2XNX A;  3R4Y A;  4H44 B;  3MUD C;  1ZME C;  1M1J B;  2NPS D;  2V4H A;  1AJY A;  1KIL C;  1H0T A;  1G2C B;  1LTA C;  1FU1 A;  1LTG C;  1W2B O;  2HPC A;  3ABV C;  1PGP A;  2ZFC A;  2LXC B;  3FXD A;  1KC8 Q;  4BWN A;  1CI6 B;  3BRT B;  1JTH A;  3D71 A;  4N78 D;  1SQV G;  3KPE A;  3Q5R A;  2QRX A;  1SQB E;  1RY3 A;  4ASV A;  4D6T G;  1QL1 A;  1HTL C;  3VMX A;  4PD4 H;  2OYI A;  3U59 A;  2FXP A;  1L0N J;  5E79 H;  1PZQ A;  1JOC A;  5CCH C;  4UB6 H;  2RKL A;  1NTM E;  1KIL B;  1L4A A;  1JM0 A;  2KS1 B;  4BRY B;  3BAT A;  3RK2 C;  1BGY E;  1MFT A;  3OW2 O;  1LTI C;  1SQP E;  1K04 A;  1EZV D;  3K5B A;  2AXT E;  1LP1 B;  2XND H;  1OW6 A;  5AW5 B;  4RKU J;  2ZJS E;  5AW0 B;  1SQB K;  1BE3 D;  3PH0 A;  5APX A;  2WSF J;  3TDK A;  1G1J A;  2KZJ A;  1FBM A;  3H1I G;  1KYO H;  1FDM A;  2WSF H;  3VTP C;  1NTM K;  3VN0 A;  1BSN A;  1PP9 D;  3AE9 C;  3HD7 A;  4R4M A;  3HE5 B;  3L71 D;  4H44 D;  2BCC J;  1LT9 C;  2AEF A;  3H1H E;  1Y9B A;  1YJN P;  3RK2 B;  3I55 P;  1VL2 A;  1YTZ I;  1SQP K;  3CCJ P;  1P84 D;  2KSE A;  1JY2 P;  1HGZ A;  3AED C;  3SWF A;  1N7S A;  1VDF A;  3TK1 A;  3W67 A;  3H1L G;  2Y9Y A;  3M0D A;  3TNU B;  2W6J H;  3TF5 A;  1NTZ J;  3I5C A;  1URQ C;  3E1R A;  3FXE A;  3B5N A;  2FYU E;  2N1T A;  3OJA B;  1SS1 A;  1GMJ A;  1RF1 A;  1LNQ A;  1U57 A;  1NU1 G;  3PHL A;  2M3B A;  1HH0 A;  1ZR2 A;  1U7M A;  2P67 A;  3AE2 C;  3VP9 A;  4DJG A;  1GD2 E;  2PRR A;  3WMM 0;  4NPF X;  3VMZ A;  2JDI H;  3TGU E;  2HLO A;  2YXQ B;  2WMM A;  1IFI A;  1LT9 B;  4L75 A;  3KXD A;  1OIP A;  3A0B H;  3GHG A;  1VQN P;  3CWB D;  1A02 J;  2KZI A;  2WSE H;  4HYT B;  1SQX D;  1NTK E;  5B5E E;  3C8V A;  3USS A;  3VMA A;  1FDO A;  1G2C A;  2R3C A;  4U3F J;  1M7L A;  2KLU A;  4WY4 A;  2FYU K;  2WQY C;  3WUU A;  1URQ B;  3V5B A;  4WVZ A;  1H88 A;  5CCG D;  5KLV D;  3P32 A;  5L8R J;  1RE3 A;  1XTC C;  1CI6 A;  3L72 D;  2Q3E A;  3QH9 A;  2A06 G;  3RK3 D;  3SWY A;  2LKM A;  1PPJ G;  4ZMD A;  1VQK P;  1LTS C;  1OX3 A;  2M3E A;  4U7J A;  1OMI A;  3AE5 C;  1FZC A;  3IFM A;  3RL0 C;  3CC7 P;  5AVY B;  1NTK K;  1IFJ A;  1FC2 C;  4YTP C;  2VRS A;  1BE3 J;  4RES B;  4L73 A;  1T6A A;  2KS1 A;  4BRY A;  4AQR D;  3VOP A;  4Y28 J;  4B86 A;  5AW6 B;  2B88 A;  1PP9 J;  2HFE D;  4LLH A;  3F5H A;  1T3J A;  2B9B A;  4DCK A;  3H1K E;  2YKQ A;  2IYP A;  4QMA A;  1ZV8 A;  3RL0 B;  2KLV A;  2CK3 H;  2Z5H A;  3FWN A;  2RH0 A;  5AW1 B;  5AW9 B;  5CBN A;  3AE6 C;  1DIP A;  5CCH A;  2A45 H;  2GUS A;  4XFJ A;  1G1I A;  3F89 A;  3L70 J;  1AVY A;  1KIL E;  1L0L D;  1SP4 A;  1Q7Y Q;  3CCE P;  2HOD B;  1KB9 H;  2W6A A;  2IBZ D;  2B89 A;  3L73 J;  5GTH E;  2HG5 D;  3EFF K;  3BCC G;  2NZ2 A;  2ITA A;  3HTK A;  5APS A;  4WBA A;  1GW3 A;  1SFC C;  4NPD A;  1JO5 A;  3CWB J;  1EDL A;  3CLQ A;  2NPS C;  1GU5 A;  1QVG O;  3L74 G;  1IFD A;  1EZV G;  1NYH A;  1HF9 A;  3CXH E;  1KQG B;  2XU6 A;  3H32 B;  1HWT C;  3L75 E;  4YXD C;  1EZV I;  3IF4 A;  1ZN5 A;  1LT9 A;  2QSI A;  3L72 J;  1T8Z A;  4Y99 C;  3M0A A;  5B66 E;  4TLF A;  2UWJ E;  3S9O A;  3ITK A;  1FZB A;  5GTH H;  5AVR B;  2O1J A;  3L71 G;  1CSB A;  1R5S A;  1PGO A;  2IZ0 A;  1SFC B;  3M91 A;  1IFM A;  4W7Z A;  2KK7 A;  2NPS B;  1NHL A;  1URQ A;  3IAO A;  3II6 A;  2WSS H;  1ZRT D;  4HJG H;  3Q5S A;  3LIE A;  1LGH B;  3WUV A;  4PD4 D;  2D2C D;  1P84 I;  2FXM A;  2QIW A;  1OZH A;  4R4L A;  1SQV E;  2QVA A;  1LTJ C;  5KLI C;  1DEB A;  1KFN A;  1E79 H;  2JWA A;  1RQV A;  2A45 I;  1LWU A;  4K35 A;  4D6T E;  2W83 C;  5AVV B;  4Y99 B;  2WIT A;  3CX5 H;  5KAI E;  3BRV B;  4KHX A;  2E75 D;  3HUS C;  2WPR A;  2FKW B;  5KJ7 D;  3M9H A;  2CPB A;  1AV1 A;  4PJ0 H;  2O1K A;  2R3S A;  2Z4E A;  5EFW B;  2I1K A;  2ZVO B;  2AXC A;  1K9M Q;  1SQX G;  3UIA A;  1SQB D;  1L0L J;  3CD6 P;  1IC2 A;  1S9K E;  1GL2 D;  1KYO D;  1SQV K;  1EXI A;  1SQQ J;  1S72 P;  1LTJ B;  4O9B A;  5KLI B;  5KLV G;  1NTM D;  4WWI A;  2FFD C;  3AE4 C;  3MIW A;  3L72 G;  2Y0E A;  3H1I E;  4C7R A;  1HUC A;  2R44 A;  1KQL A;  1K05 A;  3HUS B;  4HH2 A;  1OVU A;  3AEB C;  2AEM A;  1A02 F;  4EDF A;  1YIT P;  2QJK C;  4WB4 A;  3N4X A;  3H25 A;  1FOS E;  3AEC C;  1FDI A;  1LT1 A;  1RE4 A;  1W2E A;  2KNC B;  2OTJ P;  1NTZ D;  3NMD A;  3KDP B;  2IFM A;  2WVR A;  3PJS K;  3H1L E;  1S5L H;  1NO4 A;  1YJ9 P;  5BU5 A;  4DT0 A;  1VQ7 P;  4JF7 A;  1GW4 A;  2FFD B;  2JJL A;  1XTG B;  3H1H D;  1DD4 A;  1L4A D;  2E43 A;  1NU1 E;  1Z56 A;  1AQT A;  3H32 A;  1YYC A;  1EC5 A;  3CMA P;  3CX5 I;  4JBZ A;  2WPV B;  5CCG C;  2KP8 A;  1RHZ B;  1H8A A;  1M8O B;  3RK3 C;  2WT7 B;  1N73 A;  2I1J A;  2KYV A;  2QJK B;  3H1J D;  1RF0 A;  2H89 C;  1S5L X;  4U3F D;  1ZXG A;  4OGQ D;  2WWW A;  4XE5 B;  2IBZ G;  2NPS A;  1IZN B;  5KAF E;  2B87 B;  4AYC A;  1NU1 K;  4L74 A;  1BCC G;  2YO2 A;  1SLQ A;  3BAS A;  2IBZ I;  2A06 E;  1VF5 D;  1PPJ E;  3P8C E;  1OVR A;  2Q6Q A;  3D70 A;  3EFG A;  1NTK D;  1SQB J;  3GF3 A;  1QVF O;  4NPE A;  3RK3 B;  1N7S D;  3E7K A;  1NGM B;  3N7N A;  4IFM A;  2KSJ A;  3PTZ A;  1Q86 Q;  1NTM J;  3P8M C;  1X0T A;  1KV4 A;  2R5D A;  4UB8 E;  2XZR A;  1BGY J;  3PLN A;  2PGD A;  1HBW A;  1FE6 A;  1L2P A;  2K3R A;  1SQP J;  1RQU A;  3L35 A;  1QX8 A;  5AW2 B;  2WTY A;  2AXT H;  3A7O A;  2H8P D;  2IZ1 A;  1DD3 A;  2M0B A;  4C46 A;  1N2D C;  2J58 A;  5TIS E;  3CCQ P;  3L70 D;  1KB9 D;  4K3A A;  3R2P A;  1HJ0 A;  4W7Y A;  3HUS A;  3WU2 E;  2OAR A;  3SWK A;  4DZO A;  1E5W A;  1L0N G;  3H1H J;  3AE8 C;  3L73 D;  4PD4 I;  2WSE J;  1GDT A;  1MKM A;  2K1A A;  1OW7 A;  5KTB A;  1X22 A;  3BCC E;  5APQ A;  1M1J A;  5AVW B;  4EI2 A;  3KHU A;  3D6Y A;  3H1J J;  1KFM A;  1QEX A;  2OTK E;  3L74 E;  1EZV E;  2YKO A;  4GT1 A;  5TIS H;  1IK7 A;  4Z1M H;  3SFD C;  3TGU J;  3WU2 H;  4I2L C;  1K73 Q;  5CMZ A;  1KYO I;  3L4F A;  2D2C C;  2BCC G;  2H43 A;  4YPC A;  1NTK J;  1GK6 A;  3MUD A;  3L71 E;  2W27 A;  3G9R A;  4KT0 J;  2Z5I A;  1KIL A;  5B5E H;  1BDD A;  4JYB A;  3CCR P;  2E75 C;  5KJ7 C;  3Q2Y A;  3IR9 A;  1KMI Z;  3L75 D;  3B4S A;  1M1K Q;  1NTZ G;  1WT6 A;  3CCM P;  3M9B A;  3CX5 D;  4OWF A;  1LP1 A;  4OVN F;  1FJP A;  1WRG A;  4GIF A;  1OXZ A;  2XDJ A;  5CCG A;  1PGQ A;  1JY3 N;  3MGN A;  1GL2 C;  4C7N B;  1UII A;  3G4S P;  2FY8 A;  2Q9I A;  2D2C B;  2ZYA A;  1MFZ A;  2E76 C;  1DEE G;  1JNM A;  1YHQ P;  4N6J A;  1S3J A;  3AE3 C;  2WSC H;  1FJK A;  1R5L A;  1IK9 A;  5TJH A;  1NWQ A;  3HE5 A;  4JQ0 D;  3D6Z A;  2W90 A;  3RBX A;  3OA7 A;  2P1J A;  4GDO A;  2BAS A;  2E75 B;  2Q7C A;  1SQX E;  4PV1 D;  4U3F G;  1SQV D;  1GU4 A;  3Q5P A;  1SQQ D;  4EIJ A;  4EYY Q;  1DH3 A;  2C0W A;  3CCS P;  1VQL P;  3H1K J;  2OYH C;  4D6T D;  3FWL A;  3TNU A;  5KLV E;  1GL2 B;  4IL6 E;  3L72 E;  3RK3 E;  1PIX A;  2E76 B;  3AEA C;  2LR2 A;  5K5G B;  1KN7 A;  2V7Q J;  3CCV P;  1FZF A;  2CPS A;  3SFE C;  1L4A C;  1BE3 G;  1H0T B;  1R8E A;  1SQX K;  3CPW O;  1T2K D;  2V7Q H;  2QEX P;  1OW8 A;  1N86 A;  1PP9 G;  1JMB A;  4CPG A;  4H0L D;  4HB1 A;  4GKG A;  2OYH B;  3H1I D;  4DOJ A;  3JCU E;  1EXJ A;  5KLV K;  2P2U A;  1PGJ A;  4OGQ C;  3B8E B;  3KYQ A;  4IL6 H;  4OH8 B;  3V4W A;  2J59 M;  1GK4 A;  5AW3 B;  1VQO P;  2A45 G;  3L75 J;  2E5T A;  3CXH H;  2HR3 A;  1L4A B;  3S1K A;  3LW5 J;  3L70 G;  4ASW A;  1AQ5 A;  1VF5 C;  3H1L D;  3G6E P;  5AVS B;  2WPQ A;  3LW5 H;  2O01 H; 
#chains in the Genus database with same CATH homology
 5KAI E;  5GTI E;  3WU2 E;  5KAF E;  3JCU E;  4UB8 E;  5B5E E;  1S5L E;  5E79 E;  3A0B E;  4IL6 E;  5GTH E;  4UB6 E;  5B66 E;  1W5C E;  5TIS E;  3KZI E;  2AXT E;  3A0H E;  4PJ0 E;  5H2F E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...