5B5EE

Crystal structure analysis of photosystem ii complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 20
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5b5eE00
4UB8E 5E79E 5B5EE 5B66E 5GTIE 5KAFE 4UB6E 2AXTE 1S5LE 4PJ0E 5KAIE 5H2FE 3A0HE 3KZIE 3WU2E 3A0BE 5TISE 1W5CE 5GTHE 4IL6E 3JCUE
chains in the Genus database with same CATH superfamily
1KYOI 3SWKA 1L0ND 2G8YA 2AEFA 1KC8Q 2QIWA 4D6TD 1FJKA 1KILE 1OX3A 1L0NE 2WPVB 4D6TE 3WUUA 1KTMA 3OAKA 1RE3A 3H1LG 1AA0A 1M1JC 2E75B 4KHXA 1JY2N 3VTPC 1N7SC 2OYHC 2IX7C 1WRGA 1EC5A 1KN7A 1SQVJ 2FFDB 3L70G 1URQA 2W6BA 1RF0C 2IBZI 2BCCJ 4H0LB 4WWIA 1R5SA 4RJTA 5GTIH 3D70A 1RQVA 4U7JA 2HODA 1YJ9P 3AE6C 1PPJG 2IDBA 1TU3F 1Q90D 1NTMD 3TGUJ 5KLIC 5B5EE 1LT9B 2JP3A 5C39A 5AW9B 1RF1A 2H88C 1ZV8A 3CC2P 3MGNA 2H8PD 1KFNA 4I7ZB 3KHUA 2JR8A 1DH3A 4WY4B 5CCHD 1YHQP 3II6A 1IFDA 4YXDC 5H2FE 3H1KD 2E76C 5AW5B 3CWBG 3SWFA 4R4LA 2HYNA 2QM7A 2KXPB 3PHLA 4CPGA 2AEJA 4DJGA 2A06G 1CZQA 3E1IA 3AE4C 3V4QA 3MZWB 2XDJA 3T97B 3M06A 5APUA 1KILB 1H88A 3FWNA 5KKZB 2Y9YA 1SLQA 1N2DC 3RL0g 3HD7D 3WU2H 2Y0DA 4NPFX 1JUNA 3E7KA 3O6QA 1H8AA 1JOCA 1M90Q 1CSBA 1JNMA 5KAIE 4R4MA 3TNUB 3HTKB 2ZVOB 1LTJB 3A0BE 1LP1A 3RK2D 1QL1A 2K1AA 4MN4C 1PGPA 2LR2A 1AVYA 5KJ7D 2QJKB 3HD7A 1J1DB 3LIDA 2FYUD 2M5AB 3BRTB 4U3FE 3RK3C 4YTPC 5CCGC 2LXBA 2FBWC 1JB0J 4KT0J 1SVFA 2BEZF 5AVYB 1IFPA 4TT3H 1SQVG 1AV1A 3AE9C 5BU5A 2Z4EA 1VQ6P 1GK6A 4K35A 1NTZK 1JCCA 2KS1B 3OJAB 4YPCA 5KAIH 2BCCG 3CX5D 3VOPA 1EZVI 1NTKD 2FXOA 2V4HA 2J5UA 1NTKE 2A45H 3Q5PA 3Q5RA 3TGUG 3I56P 3HUSC 4EOTA 1KFMA 1LWUB 4IOIH 2K88A 1GK4A 2BASA 2QEXP 4IL6E 3A0HH 2POHA 2YMYA 1KQLA 2XNDH 3AE5C 3GHGC 1EXIA 1KORA 3GG2A 1BDDA 3L71D 3JCUH 3AE7C 3EQ2A 2M3BA 1IFIA 3L71E 2H43A 3G71P 3MD0A 1SQBJ 3L73D 2QJPB 1X22A 4AYCA 4H44C 2QA4P 1DEEG 1VQNP 2N9YB 3CX5H 1T2KD 2FXPA 3S9OA 2IBZG 1BE3D 1NU1J 4LC1A 5EFWB 1U7JA 3L75D 2M3EA 5TJHA 1BE3E 3M9HA 3SWYA 1YBKA 3L75E 1JEKA 3K5BA 1GTWA 3BRVB 1M7LA 1Q81Q 3BCCJ 3P8CE 1SQQK 2P1JA 3CMAP 2DW3A 4RKUJ 3VYIA 5AVUB 1QVFO 1FZFA 2FXMA 1HWTC 5AW7B 1KB9D 2AXTH 4N3YB 2ZJSE 1L0NJ 4W7YA 1YTZI 2OYIA 4D6TJ 1OMIA 3M9QA 1G2CB 2OGUA 1EDJA 1UIIA 2QE7H 3A7OA 3RL0C 2KP8A 1JY3N 2Y9ZA 3L72D 3TSIA 2WTYA 1NTMK 2IYPA 2NPSC 3U59A 2PGDA 3L72E 5APVA 4GDOA 2R32A 3SSUA 1HGVA 2YNYA 2B9BA 3AEAC 3CCJP 2L91A 2P10A 2P2UA 1M1KQ 2YXQB 3TDKA 1RY3A 3M9BA 2O1KA 3SFEC 1LNQA 2JKVA 3N7NA 1KB9H 2WQYC 5K5GB 1N7SD 1IFMA 1AQ5A 1VQ9P 1VF5D 1RH5B 1GW4A 1LTGC 1FZCA 3VMZA 1X9VA 1VQPP 3L4FA 2WWWA 2A45I 2XNXA 3NXSA 3PH0A 2WSSH 1PGOA 1S2EA 2QJYB 2WMMA 4JBZA 1L2PA 2JWDA 1SQBG 1BCCD 2B87B 1NKNA 4C7RA 1GU5A 3AE8C 4L76A 1FE6A 3AE3C 2QM8A 5KLVD 1BCCE 4GT1A 1NU1G 1YYCA 4EYYQ 3H1JE 1NTZE 3PJSK 1OVVA 1PP9E 1K05A 1RF0A 5B66E 1ZRTD 4I1LA 2Q3IA 4Y99B 3G3ZA 4QMAA 2FYUK 4L75A 3BCCG 5CBNA 3ABVC 5AW4B 1FDMA 3CX5I 1VPCA 2E76D 1GMJA 4I2LC 1FZAA 3UIAA 2UWJE 2Y0CA 2D2CB 5GTHE 3VP9A 1EZVE 2KLUA 2R5DA 1NYHA 1UIXA 3QH9A 4B86A 4H13B 1L0NG 3R4YA 2OTLP 4WBAA 5CMZA 1NKZB 5AVTB 4D6TG 4U3FJ 4W7ZA 3IR9A 3A5TA 1EQ7A 4HYTB 3B71A 2QRXA 4ZMDA 3TYYA 3HRNA 3PTZA 2YIUB 1M1JB 4BRYA 1JMBA 2KNCB 3V2QA 1QL2A 1N7SB 5GTIE 2OYHB 4GIFA 4OH8B 1VF5B 3Q3DA 1FZCC 1SFCA 5APXA 3F89A 2C9LY 3HE5B 1KV4A 4C7NA 1M57D 2R3SA 1L0LK 5GTHH 1NTKJ 5APYA 1SQQD 1JTHB 3D71A 1FU1A 1QEXA 1URQD 4OGQB 1GL2C 3RK3D 5CCGD 1L4AA 1SQQE 3BASA 4A7PA 2JO1A 2WVRA 3KZIE 4UB6H 1NO4A 5KLIB 3KDPB 3BATA 1DD4A 3S1KA 5AVQB 2E43A 3V5BA 3CPWO 1PFIA 2N1TB 1N73B 3L71J 2LKMA 1NVOA 5CCGA 2K9JB 2RH0A 1S5LX 4ZKPA 2CK3H 1KB9I 2XZRA 2ITAA 3CC7P 3EWKA 2E76B 4OWFA 1NTME 4JYCA 1IFNA 1E79H 2ZVNB 3WU2E 3H1LD 1M56D 2HPCA 2JDIH 3VMYA 3KZIH 1GD2E 3H1LE 3L75J 5AVSB 2KSJA 4O9BA 3HUSA 3U1AA 1LGHB 1FS0E 2FYNB 1VQ4P 3GHGA 3H1KE 4H44D 2A45G 1YIJP 2WSEJ 1PPJD 2C0XA 4EDFA 3TF5A 2MKVA 1XTGB 2J59M 1WMKA 4M3LA 4ZNCA 1FC2C 4U3FG 1HTLC 3PRJA 2JEEA 1H0TA 1SFCC 3S4RA 4GOFA 3FWLA 2K37A 1Y9BA 3H1HD 5AVVB 1URQB 4N78D 3D6ZA 1YI2P 3H1HE 4HKZH 4N78E 1L4AC 2WPRA 2HODB 2FYZA 1DIPA 1OVUA 3CWBD 1T6AA 1RF1B 1Y47A 3CWBE 1CI6A 1N8RQ 1NTKG 4UB8H 4LLHA 2A06D 3A0HE 2FYUE 1T8ZA 4K3AA 3H32A 4NPDA 3PLNA 1KILC 1DX7A 1Y8AA 1IC2A 2A06E 2WSFJ 3RGUA 1KQFB 2JWAA 2O01H 3JCUE 3CCUP 1JY2O 3RL0D 2WITA 2FY8A 1MKMA 1VQKP 4RESB 4IFMA 1SQXK 2YMKA 5KLVK 3C1LA 2O3JA 2ZAEB 2KSEA 2NPSD 5AW2B 1LTIC 3G6EP 2AEMA 1LTJC 3L71G 3G9RA 3OW2O 3WUTA 3FGAD 3CX5E 1J1DC 1R5LA 1KMIZ 3LW5H 3ZDMA 5AW3B 5M1BA 3PP5A 2YKPA 1BCCJ 4W80A 2NPSA 3GLMA 2AXCA 2WT7A 2I1KA 3H1JJ 3O6QB 1NTZJ 4AUWA 1AVOA 4H44B 1PP9J 1SQPK 1L0LD 2Q5UA 1NH4A 5DJTB 3B4SA 2WPSA 3L75G 1R8EA 5E79H 3KXDA 3CCEP 1LP1B 2HLOA 1L0LE 3M0DA 1QVGO 3RBZA 1QX8A 1XTCC 1S1CX 4PV1C 1BGYD 3HD7B 1HBWA 3CCSP 4PD4D 3CD6P 1BGYE 2BCCD 2L5GB 2HR3A 3V6IA 2AXTE 5CCHC 4PD4E 1GDTA 3L73E 4IFFA 1J2JB 3OA7A 3TGUD 3RK2B 3VP8A 1HUCA 2K3RA 4IFDK 4L73A 2B89A 1JO5A 2ZYDA 2HG5D 2MJZA 3Q1MA 3AEGC 2H89C 3D6YA 3B5NA 4HH2A 1FZGA 2PRRA 3CCQP 1S9KD 2QJPC 2W90A 3FXDA 1P84D 1FBMA 2YXRB 1OFCX 3H1ID 1S9KE 4PD4H 1Q82Q 1P84E 1ZXGA 3BVHA 2IBZD 3H1IE 3AEBC 1KD1Q 1KB9E 3IFMA 1RE4C 2IFNA 4XA4A 2R44A 1FZBA 1SQQJ 1VQLP 5CJ4A 2CPSA 3C9IA 1YITP 3R2PA 1NHLA 1VQ5P 1M8OB 3AEEC 5TISH 2H7HA 3H25A 1WT6A 3EFGA 1OXZA 1FDOA 5AW0B 2R5BA 1BSHA 5AW8B 3MUDA 3HE4A 4DT0A 2B88A 1U57A 1PGQA 3W67A 3M0DC 2PFXA 3GF3A 3V2PA 1QGKB 1BCCG 3RBXA 1P84H 3H1JG 1NTMJ 1NTZG 1PP9G 3CMEP 3E1RA 1ZR2A 3CC4P 1D7MA 2SPZA 4I6MC 3JC22 1J1EB 1GL2A 2KYVA 2WSCH 1JY3P 2KOGA 2Q6QA 1SQXD 1GU4A 2OYIB 2ZT9C 3H1KJ 3B5NC 1MFTA 3L36A 1EZVG 1SQXE 1X8YA 4BXLA 5KLVE 4WVZA 5DJUB 3FX0A 2YO2A 3P8MC 4PJ0E 5BVZA 1SS1A 2O01J 1ZN5A 1ZRTE 1VQ8P 1G1IA 2Y0EA 2KUBA 5AVZB 5AVRB 3O8ZA 1NOHA 3H1HJ 1KQGB 1S5LE 2P7JA 1SQPD 1Q7YQ 5BU8B 2PAJA 1K9MQ 1ZMEC 3NTNA 1SQPE 1YTZT 1SQBD 1HVVA 1VQOP 1A02F 1Q2NA 1ZW0A 3NFQA 2FFDA 3AE1C 4UB6E 1FZCB 2FYUJ 2NRGA 3L74D 1SFCD 3MUDC 1VDFA 2Q3EA 1GW3A 4PJ0H 3B8EB 2XU6A 2BEQD 4EI2A 3L74E 1SP4A 3L37A 1JY3O 1VL2A 1IK7A 1LT9A 1L4AD 4JYBA 3G4SP 3IAOA 4PD4I 1LTBC 5APQA 1S5LH 1ZP0C 1U7MA 2D2CC 1FOSF 1BSNA 2GUVA 1NWQA 5L8RJ 2OTKE 4ASVA 1DD3A 3MP7B 2GUSA 4H13C 4WY4A 3GMAA 1IK9A 1SQVK 1KILD 1X79B 3A3YB 1NTMG 1G1JA 3CLQA 1EDIA 1K8AQ 3RK3E 2W27A 5APWA 2E74C 4RO0A 2Q9IA 3MTUE 1MFZA 4ASWA 2KIKA 2YIUC 4DCKA 3WUVA 1L0LJ 3T97A 1KILA 1VF5C 3CCLP 2XV5A 1FZEA 1P84I 1HGZA 1BGYJ 3IF4A 3H1KG 4JPZB 3L73J 3Q2YA 2PP6A 4OGQC 2E75C 2V7QH 3TNUA 3HTKA 3M0AA 1LTJA 4GKGA 1NGMB 1AJYA 3KQGA 2LXCB 1BE3J 2YKOA 3WMM0 4BRYB 1HJBA 2P67A 2FFDC 2M5AA 5AVXB 3I55P 5CHXA 2N1TC 1N73C 1JY2P 4PV1D 3KPEA 1FDIA 1SFCB 3H1HG 3L70D 4H0LC 2ZFCA 1BDCA 1GZLA 4C7NB 1YJWP 3VMXA 3L70E 1S3JA 4UB8E 3Q5SA 2W6AA 4DOJA 3AE2C 1VQ7P 1L4AB 3FXEA 2ZXXA 1LT9C 1FAVA 4L74A 1PPJE 2KS1A 2FYUG 3H1IJ 4WB4A 2OYOA 3MIWA 1T3JA 3LIEA 4I7ZC 5CCHA 4WY4C 3RK3B 5B5EH 1OW6A 3H6PA 1LWUA 3KYQA 2HFED 3V2NA 2IPPA 3VN0A 2WSCJ 2E5YA 1IJDB 1E5WA 3I5CA 3C8VA 3L72J 2FYNC 2O01N 4ZKUA 1RE3C 4DZOA 1FOSE 3V4WA 3SFDC 1JMMA 2YKQA 2HPCB 5H2FH 5KKZC 1HJ0A 1OZHA 2R3CA 4U3FD 3HUSB 5E79E 3CXHD 4NPEA 4C46A 1URQC 1W2BO 1MZ9A 3CXHE 1L0LG 3GHGB 2GM4A 3CCVP 2W8ZA 1USDA 1RE4A 2CPBA 5KJ7A 2QJKC 2OTJP 1BGYG 2ZXEB 3U1CA 1USEA 3AECC 1RF1C 3V2RA 1PV3A 4PV1B 3EFFK 1OWAA 3L73G 1H0TB 1PGJA 4HJGH 3P7KA 1CW5A 3A0BH 1DEBA 2VRSA 1SQXJ 1OW8A 5KLVJ 2W83C 1IZNB 1BE3G 3P32A 1IFJA 1SQBK 1SQVD 2RKLA 2Z5HA 1VQMP 3CXHH 1SQVE 4N6JA 2P58A 1NU1K 2KLVA 3F5HA 1G2CA 1CI6B 2O1JA 4JQ0D 1EDLA 5KAFE 5AW6B 2KI7B 4HB1A 3H32B 2BCCE 3GW6A 4LGDE 2ZT9D 3B5ND 1SQPJ 1LWUC 4XFJA 1KYOD 3M91A 5APTA 3VMAA 2K9YA 1RHZB 3TGUE 1JM0A 1KYOE 3H1IG 1W2EA 1Z56A 2QSIA 1LTAC 4OVNF 4TLFA 2Q7CA 1N86A 2N9BA 5TISE 3GF7A 3AEFC 1AFOA 2OQQA 3L74J 2GA1A 4IL6H 3HD7C 2I8DA 3RL0B 2ZYAA 1L0NK 3L72G 3P8CD 1KZUB 5KAFH 1YQ3C 2NPSB 3AEDC 2IZ0A 2WT7B 2E42A 3RK2C 4YXWH 1H89A 2M8RA 1K73Q 5KJ7C 2V7QJ 5CJ0A 2IBZE 1KYOH 4GODA 2B87A 4JF7A 2IZ1A 1AQTA 4IL6X 3CCMP 2JJLA 1EXJA 1KQSO 3USSA 1S4XA 2D2CD 3MHVA 1LT1A 1HF9A 1YJNP 2W6JH 1S72P 4H13D 2ZYGA 1EDKA 1GL2D 1SQXG 1NJIQ 5KLVG 1X0TA 3IN6A 2ZT9B 3B5NB 2WSEH 2E74D 2RN0A 1W5CE 4KJMA 3H1LJ 3CI9A 1OVRA 3CCRP 4AQRD 2FKWB 1MUUA 5KTBA 5APSA 5CBOA 3A2AA 4Y28J 5AVWB 2KB7P 3L70J 1SQPG 2NZ2A 1M1JA 2IYOA 1PL5A 2KNCA 4OGQD 2E75D 1A02J 1N7SA 2C0WA 4GOEA 2OYHA 3TK1A 3H1JD 1T2KC 1NTZD 2WZ7A 3CXHI 2QVAA 1PP9D 2Q1KA 3HE5A 1OW7A 1N7LA 3L74G 3W68A 4EIJA 1ZOYC 2N1TD 1YQ4C 1LJ2A 2WSFH 1J1EC 1ZLLA 2KK7A 1JTHA 4BWNA 2Z5IA 3HE4B 4H0LD 2OARA 2QJYC 3NMDA 2I1JA 4XE5B 2M0BA 1PIXA 2E5TA 1PZQA 1IO4A 2OYIC 1NAYA 2XKMA 3LW5J 3N4XA 1SQBE 3CWBJ 2N1TA 1N73A 3QWOC 3CL3D 1NU1D 1EZVD 1MV8A 1ZR4A 2RMZA 2KZIA 5AW1B 2K9JA 1NU1E 1SQQG 2G3AA 1T3UA 4Y99C 1K04A 4WY4D 1GL2B 1LTSC 1QLED 3ITKA 1OIPA 1Q86Q 1FJPA 1LTTC 1HH0A 2KZJA 2WPQA 3BCCD 5B66H 1NTKK 2YO3A 2E74B 3L35A 4Z1MH 2J58A 3JSVC 2IFMA 3BCCE 2C9NY 1RQUA 2QG4A 1NAFA 1JCDA
chains in the Genus database with same CATH topology
4UB8E 5E79E 5B5EE 5B66E 5GTIE 5KAFE 4UB6E 2AXTE 1S5LE 4PJ0E 5KAIE 5H2FE 3A0HE 3KZIE 3WU2E 3A0BE 5TISE 1W5CE 5GTHE 4IL6E 3JCUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 E;  5E79 E;  5B5E E;  5B66 E;  5GTI E;  5KAF E;  4UB6 E;  2AXT E;  1S5L E;  4PJ0 E;  5KAI E;  5H2F E;  3A0H E;  3KZI E;  3WU2 E;  3A0B E;  5TIS E;  1W5C E;  5GTH E;  4IL6 E;  3JCU E; 
#chains in the Genus database with same CATH topology
 1KYO I;  3SWK A;  1L0N D;  2G8Y A;  2AEF A;  1KC8 Q;  2QIW A;  4D6T D;  1FJK A;  1KIL E;  1OX3 A;  1L0N E;  2WPV B;  4D6T E;  3WUU A;  1KTM A;  3OAK A;  1RE3 A;  3H1L G;  1AA0 A;  1M1J C;  2E75 B;  4KHX A;  1JY2 N;  3VTP C;  1N7S C;  2OYH C;  2IX7 C;  1WRG A;  1EC5 A;  1KN7 A;  1SQV J;  2FFD B;  3L70 G;  1URQ A;  2W6B A;  1RF0 C;  2IBZ I;  2BCC J;  4H0L B;  4WWI A;  1R5S A;  4RJT A;  5GTI H;  3D70 A;  1RQV A;  4U7J A;  2HOD A;  1YJ9 P;  3AE6 C;  1PPJ G;  2IDB A;  1TU3 F;  1Q90 D;  1NTM D;  3TGU J;  5KLI C;  5B5E E;  1LT9 B;  2JP3 A;  5C39 A;  5AW9 B;  1RF1 A;  2H88 C;  1ZV8 A;  3CC2 P;  3MGN A;  2H8P D;  1KFN A;  4I7Z B;  3KHU A;  2JR8 A;  1DH3 A;  4WY4 B;  5CCH D;  1YHQ P;  3II6 A;  1IFD A;  4YXD C;  5H2F E;  3H1K D;  2E76 C;  5AW5 B;  3CWB G;  3SWF A;  4R4L A;  2HYN A;  2QM7 A;  2KXP B;  3PHL A;  4CPG A;  2AEJ A;  4DJG A;  2A06 G;  1CZQ A;  3E1I A;  3AE4 C;  3V4Q A;  3MZW B;  2XDJ A;  3T97 B;  3M06 A;  5APU A;  1KIL B;  1H88 A;  3FWN A;  5KKZ B;  2Y9Y A;  1SLQ A;  1N2D C;  3RL0 g;  3HD7 D;  3WU2 H;  2Y0D A;  4NPF X;  1JUN A;  3E7K A;  3O6Q A;  1H8A A;  1JOC A;  1M90 Q;  1CSB A;  1JNM A;  5KAI E;  4R4M A;  3TNU B;  3HTK B;  2ZVO B;  1LTJ B;  3A0B E;  1LP1 A;  3RK2 D;  1QL1 A;  2K1A A;  4MN4 C;  1PGP A;  2LR2 A;  1AVY A;  5KJ7 D;  2QJK B;  3HD7 A;  1J1D B;  3LID A;  2FYU D;  2M5A B;  3BRT B;  4U3F E;  3RK3 C;  4YTP C;  5CCG C;  2LXB A;  2FBW C;  1JB0 J;  4KT0 J;  1SVF A;  2BEZ F;  5AVY B;  1IFP A;  4TT3 H;  1SQV G;  1AV1 A;  3AE9 C;  5BU5 A;  2Z4E A;  1VQ6 P;  1GK6 A;  4K35 A;  1NTZ K;  1JCC A;  2KS1 B;  3OJA B;  4YPC A;  5KAI H;  2BCC G;  3CX5 D;  3VOP A;  1EZV I;  1NTK D;  2FXO A;  2V4H A;  2J5U A;  1NTK E;  2A45 H;  3Q5P A;  3Q5R A;  3TGU G;  3I56 P;  3HUS C;  4EOT A;  1KFM A;  1LWU B;  4IOI H;  2K88 A;  1GK4 A;  2BAS A;  2QEX P;  4IL6 E;  3A0H H;  2POH A;  2YMY A;  1KQL A;  2XND H;  3AE5 C;  3GHG C;  1EXI A;  1KOR A;  3GG2 A;  1BDD A;  3L71 D;  3JCU H;  3AE7 C;  3EQ2 A;  2M3B A;  1IFI A;  3L71 E;  2H43 A;  3G71 P;  3MD0 A;  1SQB J;  3L73 D;  2QJP B;  1X22 A;  4AYC A;  4H44 C;  2QA4 P;  1DEE G;  1VQN P;  2N9Y B;  3CX5 H;  1T2K D;  2FXP A;  3S9O A;  2IBZ G;  1BE3 D;  1NU1 J;  4LC1 A;  5EFW B;  1U7J A;  3L75 D;  2M3E A;  5TJH A;  1BE3 E;  3M9H A;  3SWY A;  1YBK A;  3L75 E;  1JEK A;  3K5B A;  1GTW A;  3BRV B;  1M7L A;  1Q81 Q;  3BCC J;  3P8C E;  1SQQ K;  2P1J A;  3CMA P;  2DW3 A;  4RKU J;  3VYI A;  5AVU B;  1QVF O;  1FZF A;  2FXM A;  1HWT C;  5AW7 B;  1KB9 D;  2AXT H;  4N3Y B;  2ZJS E;  1L0N J;  4W7Y A;  1YTZ I;  2OYI A;  4D6T J;  1OMI A;  3M9Q A;  1G2C B;  2OGU A;  1EDJ A;  1UII A;  2QE7 H;  3A7O A;  3RL0 C;  2KP8 A;  1JY3 N;  2Y9Z A;  3L72 D;  3TSI A;  2WTY A;  1NTM K;  2IYP A;  2NPS C;  3U59 A;  2PGD A;  3L72 E;  5APV A;  4GDO A;  2R32 A;  3SSU A;  1HGV A;  2YNY A;  2B9B A;  3AEA C;  3CCJ P;  2L91 A;  2P10 A;  2P2U A;  1M1K Q;  2YXQ B;  3TDK A;  1RY3 A;  3M9B A;  2O1K A;  3SFE C;  1LNQ A;  2JKV A;  3N7N A;  1KB9 H;  2WQY C;  5K5G B;  1N7S D;  1IFM A;  1AQ5 A;  1VQ9 P;  1VF5 D;  1RH5 B;  1GW4 A;  1LTG C;  1FZC A;  3VMZ A;  1X9V A;  1VQP P;  3L4F A;  2WWW A;  2A45 I;  2XNX A;  3NXS A;  3PH0 A;  2WSS H;  1PGO A;  1S2E A;  2QJY B;  2WMM A;  4JBZ A;  1L2P A;  2JWD A;  1SQB G;  1BCC D;  2B87 B;  1NKN A;  4C7R A;  1GU5 A;  3AE8 C;  4L76 A;  1FE6 A;  3AE3 C;  2QM8 A;  5KLV D;  1BCC E;  4GT1 A;  1NU1 G;  1YYC A;  4EYY Q;  3H1J E;  1NTZ E;  3PJS K;  1OVV A;  1PP9 E;  1K05 A;  1RF0 A;  5B66 E;  1ZRT D;  4I1L A;  2Q3I A;  4Y99 B;  3G3Z A;  4QMA A;  2FYU K;  4L75 A;  3BCC G;  5CBN A;  3ABV C;  5AW4 B;  1FDM A;  3CX5 I;  1VPC A;  2E76 D;  1GMJ A;  4I2L C;  1FZA A;  3UIA A;  2UWJ E;  2Y0C A;  2D2C B;  5GTH E;  3VP9 A;  1EZV E;  2KLU A;  2R5D A;  1NYH A;  1UIX A;  3QH9 A;  4B86 A;  4H13 B;  1L0N G;  3R4Y A;  2OTL P;  4WBA A;  5CMZ A;  1NKZ B;  5AVT B;  4D6T G;  4U3F J;  4W7Z A;  3IR9 A;  3A5T A;  1EQ7 A;  4HYT B;  3B71 A;  2QRX A;  4ZMD A;  3TYY A;  3HRN A;  3PTZ A;  2YIU B;  1M1J B;  4BRY A;  1JMB A;  2KNC B;  3V2Q A;  1QL2 A;  1N7S B;  5GTI E;  2OYH B;  4GIF A;  4OH8 B;  1VF5 B;  3Q3D A;  1FZC C;  1SFC A;  5APX A;  3F89 A;  2C9L Y;  3HE5 B;  1KV4 A;  4C7N A;  1M57 D;  2R3S A;  1L0L K;  5GTH H;  1NTK J;  5APY A;  1SQQ D;  1JTH B;  3D71 A;  1FU1 A;  1QEX A;  1URQ D;  4OGQ B;  1GL2 C;  3RK3 D;  5CCG D;  1L4A A;  1SQQ E;  3BAS A;  4A7P A;  2JO1 A;  2WVR A;  3KZI E;  4UB6 H;  1NO4 A;  5KLI B;  3KDP B;  3BAT A;  1DD4 A;  3S1K A;  5AVQ B;  2E43 A;  3V5B A;  3CPW O;  1PFI A;  2N1T B;  1N73 B;  3L71 J;  2LKM A;  1NVO A;  5CCG A;  2K9J B;  2RH0 A;  1S5L X;  4ZKP A;  2CK3 H;  1KB9 I;  2XZR A;  2ITA A;  3CC7 P;  3EWK A;  2E76 B;  4OWF A;  1NTM E;  4JYC A;  1IFN A;  1E79 H;  2ZVN B;  3WU2 E;  3H1L D;  1M56 D;  2HPC A;  2JDI H;  3VMY A;  3KZI H;  1GD2 E;  3H1L E;  3L75 J;  5AVS B;  2KSJ A;  4O9B A;  3HUS A;  3U1A A;  1LGH B;  1FS0 E;  2FYN B;  1VQ4 P;  3GHG A;  3H1K E;  4H44 D;  2A45 G;  1YIJ P;  2WSE J;  1PPJ D;  2C0X A;  4EDF A;  3TF5 A;  2MKV A;  1XTG B;  2J59 M;  1WMK A;  4M3L A;  4ZNC A;  1FC2 C;  4U3F G;  1HTL C;  3PRJ A;  2JEE A;  1H0T A;  1SFC C;  3S4R A;  4GOF A;  3FWL A;  2K37 A;  1Y9B A;  3H1H D;  5AVV B;  1URQ B;  4N78 D;  3D6Z A;  1YI2 P;  3H1H E;  4HKZ H;  4N78 E;  1L4A C;  2WPR A;  2HOD B;  2FYZ A;  1DIP A;  1OVU A;  3CWB D;  1T6A A;  1RF1 B;  1Y47 A;  3CWB E;  1CI6 A;  1N8R Q;  1NTK G;  4UB8 H;  4LLH A;  2A06 D;  3A0H E;  2FYU E;  1T8Z A;  4K3A A;  3H32 A;  4NPD A;  3PLN A;  1KIL C;  1DX7 A;  1Y8A A;  1IC2 A;  2A06 E;  2WSF J;  3RGU A;  1KQF B;  2JWA A;  2O01 H;  3JCU E;  3CCU P;  1JY2 O;  3RL0 D;  2WIT A;  2FY8 A;  1MKM A;  1VQK P;  4RES B;  4IFM A;  1SQX K;  2YMK A;  5KLV K;  3C1L A;  2O3J A;  2ZAE B;  2KSE A;  2NPS D;  5AW2 B;  1LTI C;  3G6E P;  2AEM A;  1LTJ C;  3L71 G;  3G9R A;  3OW2 O;  3WUT A;  3FGA D;  3CX5 E;  1J1D C;  1R5L A;  1KMI Z;  3LW5 H;  3ZDM A;  5AW3 B;  5M1B A;  3PP5 A;  2YKP A;  1BCC J;  4W80 A;  2NPS A;  3GLM A;  2AXC A;  2WT7 A;  2I1K A;  3H1J J;  3O6Q B;  1NTZ J;  4AUW A;  1AVO A;  4H44 B;  1PP9 J;  1SQP K;  1L0L D;  2Q5U A;  1NH4 A;  5DJT B;  3B4S A;  2WPS A;  3L75 G;  1R8E A;  5E79 H;  3KXD A;  3CCE P;  1LP1 B;  2HLO A;  1L0L E;  3M0D A;  1QVG O;  3RBZ A;  1QX8 A;  1XTC C;  1S1C X;  4PV1 C;  1BGY D;  3HD7 B;  1HBW A;  3CCS P;  4PD4 D;  3CD6 P;  1BGY E;  2BCC D;  2L5G B;  2HR3 A;  3V6I A;  2AXT E;  5CCH C;  4PD4 E;  1GDT A;  3L73 E;  4IFF A;  1J2J B;  3OA7 A;  3TGU D;  3RK2 B;  3VP8 A;  1HUC A;  2K3R A;  4IFD K;  4L73 A;  2B89 A;  1JO5 A;  2ZYD A;  2HG5 D;  2MJZ A;  3Q1M A;  3AEG C;  2H89 C;  3D6Y A;  3B5N A;  4HH2 A;  1FZG A;  2PRR A;  3CCQ P;  1S9K D;  2QJP C;  2W90 A;  3FXD A;  1P84 D;  1FBM A;  2YXR B;  1OFC X;  3H1I D;  1S9K E;  4PD4 H;  1Q82 Q;  1P84 E;  1ZXG A;  3BVH A;  2IBZ D;  3H1I E;  3AEB C;  1KD1 Q;  1KB9 E;  3IFM A;  1RE4 C;  2IFN A;  4XA4 A;  2R44 A;  1FZB A;  1SQQ J;  1VQL P;  5CJ4 A;  2CPS A;  3C9I A;  1YIT P;  3R2P A;  1NHL A;  1VQ5 P;  1M8O B;  3AEE C;  5TIS H;  2H7H A;  3H25 A;  1WT6 A;  3EFG A;  1OXZ A;  1FDO A;  5AW0 B;  2R5B A;  1BSH A;  5AW8 B;  3MUD A;  3HE4 A;  4DT0 A;  2B88 A;  1U57 A;  1PGQ A;  3W67 A;  3M0D C;  2PFX A;  3GF3 A;  3V2P A;  1QGK B;  1BCC G;  3RBX A;  1P84 H;  3H1J G;  1NTM J;  1NTZ G;  1PP9 G;  3CME P;  3E1R A;  1ZR2 A;  3CC4 P;  1D7M A;  2SPZ A;  4I6M C;  3JC2 2;  1J1E B;  1GL2 A;  2KYV A;  2WSC H;  1JY3 P;  2KOG A;  2Q6Q A;  1SQX D;  1GU4 A;  2OYI B;  2ZT9 C;  3H1K J;  3B5N C;  1MFT A;  3L36 A;  1EZV G;  1SQX E;  1X8Y A;  4BXL A;  5KLV E;  4WVZ A;  5DJU B;  3FX0 A;  2YO2 A;  3P8M C;  4PJ0 E;  5BVZ A;  1SS1 A;  2O01 J;  1ZN5 A;  1ZRT E;  1VQ8 P;  1G1I A;  2Y0E A;  2KUB A;  5AVZ B;  5AVR B;  3O8Z A;  1NOH A;  3H1H J;  1KQG B;  1S5L E;  2P7J A;  1SQP D;  1Q7Y Q;  5BU8 B;  2PAJ A;  1K9M Q;  1ZME C;  3NTN A;  1SQP E;  1YTZ T;  1SQB D;  1HVV A;  1VQO P;  1A02 F;  1Q2N A;  1ZW0 A;  3NFQ A;  2FFD A;  3AE1 C;  4UB6 E;  1FZC B;  2FYU J;  2NRG A;  3L74 D;  1SFC D;  3MUD C;  1VDF A;  2Q3E A;  1GW3 A;  4PJ0 H;  3B8E B;  2XU6 A;  2BEQ D;  4EI2 A;  3L74 E;  1SP4 A;  3L37 A;  1JY3 O;  1VL2 A;  1IK7 A;  1LT9 A;  1L4A D;  4JYB A;  3G4S P;  3IAO A;  4PD4 I;  1LTB C;  5APQ A;  1S5L H;  1ZP0 C;  1U7M A;  2D2C C;  1FOS F;  1BSN A;  2GUV A;  1NWQ A;  5L8R J;  2OTK E;  4ASV A;  1DD3 A;  3MP7 B;  2GUS A;  4H13 C;  4WY4 A;  3GMA A;  1IK9 A;  1SQV K;  1KIL D;  1X79 B;  3A3Y B;  1NTM G;  1G1J A;  3CLQ A;  1EDI A;  1K8A Q;  3RK3 E;  2W27 A;  5APW A;  2E74 C;  4RO0 A;  2Q9I A;  3MTU E;  1MFZ A;  4ASW A;  2KIK A;  2YIU C;  4DCK A;  3WUV A;  1L0L J;  3T97 A;  1KIL A;  1VF5 C;  3CCL P;  2XV5 A;  1FZE A;  1P84 I;  1HGZ A;  1BGY J;  3IF4 A;  3H1K G;  4JPZ B;  3L73 J;  3Q2Y A;  2PP6 A;  4OGQ C;  2E75 C;  2V7Q H;  3TNU A;  3HTK A;  3M0A A;  1LTJ A;  4GKG A;  1NGM B;  1AJY A;  3KQG A;  2LXC B;  1BE3 J;  2YKO A;  3WMM 0;  4BRY B;  1HJB A;  2P67 A;  2FFD C;  2M5A A;  5AVX B;  3I55 P;  5CHX A;  2N1T C;  1N73 C;  1JY2 P;  4PV1 D;  3KPE A;  1FDI A;  1SFC B;  3H1H G;  3L70 D;  4H0L C;  2ZFC A;  1BDC A;  1GZL A;  4C7N B;  1YJW P;  3VMX A;  3L70 E;  1S3J A;  4UB8 E;  3Q5S A;  2W6A A;  4DOJ A;  3AE2 C;  1VQ7 P;  1L4A B;  3FXE A;  2ZXX A;  1LT9 C;  1FAV A;  4L74 A;  1PPJ E;  2KS1 A;  2FYU G;  3H1I J;  4WB4 A;  2OYO A;  3MIW A;  1T3J A;  3LIE A;  4I7Z C;  5CCH A;  4WY4 C;  3RK3 B;  5B5E H;  1OW6 A;  3H6P A;  1LWU A;  3KYQ A;  2HFE D;  3V2N A;  2IPP A;  3VN0 A;  2WSC J;  2E5Y A;  1IJD B;  1E5W A;  3I5C A;  3C8V A;  3L72 J;  2FYN C;  2O01 N;  4ZKU A;  1RE3 C;  4DZO A;  1FOS E;  3V4W A;  3SFD C;  1JMM A;  2YKQ A;  2HPC B;  5H2F H;  5KKZ C;  1HJ0 A;  1OZH A;  2R3C A;  4U3F D;  3HUS B;  5E79 E;  3CXH D;  4NPE A;  4C46 A;  1URQ C;  1W2B O;  1MZ9 A;  3CXH E;  1L0L G;  3GHG B;  2GM4 A;  3CCV P;  2W8Z A;  1USD A;  1RE4 A;  2CPB A;  5KJ7 A;  2QJK C;  2OTJ P;  1BGY G;  2ZXE B;  3U1C A;  1USE A;  3AEC C;  1RF1 C;  3V2R A;  1PV3 A;  4PV1 B;  3EFF K;  1OWA A;  3L73 G;  1H0T B;  1PGJ A;  4HJG H;  3P7K A;  1CW5 A;  3A0B H;  1DEB A;  2VRS A;  1SQX J;  1OW8 A;  5KLV J;  2W83 C;  1IZN B;  1BE3 G;  3P32 A;  1IFJ A;  1SQB K;  1SQV D;  2RKL A;  2Z5H A;  1VQM P;  3CXH H;  1SQV E;  4N6J A;  2P58 A;  1NU1 K;  2KLV A;  3F5H A;  1G2C A;  1CI6 B;  2O1J A;  4JQ0 D;  1EDL A;  5KAF E;  5AW6 B;  2KI7 B;  4HB1 A;  3H32 B;  2BCC E;  3GW6 A;  4LGD E;  2ZT9 D;  3B5N D;  1SQP J;  1LWU C;  4XFJ A;  1KYO D;  3M91 A;  5APT A;  3VMA A;  2K9Y A;  1RHZ B;  3TGU E;  1JM0 A;  1KYO E;  3H1I G;  1W2E A;  1Z56 A;  2QSI A;  1LTA C;  4OVN F;  4TLF A;  2Q7C A;  1N86 A;  2N9B A;  5TIS E;  3GF7 A;  3AEF C;  1AFO A;  2OQQ A;  3L74 J;  2GA1 A;  4IL6 H;  3HD7 C;  2I8D A;  3RL0 B;  2ZYA A;  1L0N K;  3L72 G;  3P8C D;  1KZU B;  5KAF H;  1YQ3 C;  2NPS B;  3AED C;  2IZ0 A;  2WT7 B;  2E42 A;  3RK2 C;  4YXW H;  1H89 A;  2M8R A;  1K73 Q;  5KJ7 C;  2V7Q J;  5CJ0 A;  2IBZ E;  1KYO H;  4GOD A;  2B87 A;  4JF7 A;  2IZ1 A;  1AQT A;  4IL6 X;  3CCM P;  2JJL A;  1EXJ A;  1KQS O;  3USS A;  1S4X A;  2D2C D;  3MHV A;  1LT1 A;  1HF9 A;  1YJN P;  2W6J H;  1S72 P;  4H13 D;  2ZYG A;  1EDK A;  1GL2 D;  1SQX G;  1NJI Q;  5KLV G;  1X0T A;  3IN6 A;  2ZT9 B;  3B5N B;  2WSE H;  2E74 D;  2RN0 A;  1W5C E;  4KJM A;  3H1L J;  3CI9 A;  1OVR A;  3CCR P;  4AQR D;  2FKW B;  1MUU A;  5KTB A;  5APS A;  5CBO A;  3A2A A;  4Y28 J;  5AVW B;  2KB7 P;  3L70 J;  1SQP G;  2NZ2 A;  1M1J A;  2IYO A;  1PL5 A;  2KNC A;  4OGQ D;  2E75 D;  1A02 J;  1N7S A;  2C0W A;  4GOE A;  2OYH A;  3TK1 A;  3H1J D;  1T2K C;  1NTZ D;  2WZ7 A;  3CXH I;  2QVA A;  1PP9 D;  2Q1K A;  3HE5 A;  1OW7 A;  1N7L A;  3L74 G;  3W68 A;  4EIJ A;  1ZOY C;  2N1T D;  1YQ4 C;  1LJ2 A;  2WSF H;  1J1E C;  1ZLL A;  2KK7 A;  1JTH A;  4BWN A;  2Z5I A;  3HE4 B;  4H0L D;  2OAR A;  2QJY C;  3NMD A;  2I1J A;  4XE5 B;  2M0B A;  1PIX A;  2E5T A;  1PZQ A;  1IO4 A;  2OYI C;  1NAY A;  2XKM A;  3LW5 J;  3N4X A;  1SQB E;  3CWB J;  2N1T A;  1N73 A;  3QWO C;  3CL3 D;  1NU1 D;  1EZV D;  1MV8 A;  1ZR4 A;  2RMZ A;  2KZI A;  5AW1 B;  2K9J A;  1NU1 E;  1SQQ G;  2G3A A;  1T3U A;  4Y99 C;  1K04 A;  4WY4 D;  1GL2 B;  1LTS C;  1QLE D;  3ITK A;  1OIP A;  1Q86 Q;  1FJP A;  1LTT C;  1HH0 A;  2KZJ A;  2WPQ A;  3BCC D;  5B66 H;  1NTK K;  2YO3 A;  2E74 B;  3L35 A;  4Z1M H;  2J58 A;  3JSV C;  2IFM A;  3BCC E;  2C9N Y;  1RQU A;  2QG4 A;  1NAF A;  1JCD A; 
#chains in the Genus database with same CATH homology
 4UB8 E;  5E79 E;  5B5E E;  5B66 E;  5GTI E;  5KAF E;  4UB6 E;  2AXT E;  1S5L E;  4PJ0 E;  5KAI E;  5H2F E;  3A0H E;  3KZI E;  3WU2 E;  3A0B E;  5TIS E;  1W5C E;  5GTH E;  4IL6 E;  3JCU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...