3TSIA

Structure of the parainfluenza virus 5 (piv5) hemagglutinin-neuraminidase (hn) stalk domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
50
structure length
50
Chain Sequence
SPSSGLGSITDLLNNILSVANQIIYNSAVALPLQLDTLESTLLTAIKSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Hemagglutinin-neuraminidase
publication title Structure and mutagenesis of the parainfluenza virus 5 hemagglutinin-neuraminidase stalk domain reveals a four-helix bundle and the role of the stalk in fusion promotion.
pubmed doi rcsb
source organism Simian virus 5
total genus 23
structure length 50
sequence length 50
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 2011-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3tsiA00
3PP5A 2HG5D 2KOGA 4LGDE 3TSIA 1KILB 1NHLA 1KILA 1L4AC 2PP6A 4W80A 3RL0C 2H8PD 2XDJA 3HTKB 5CCGD 4W7YA 2M8RA 1XTGB 1HVVA 1L4AB 3RL0B 1SFCC 1L4AA 1N7SC 3B5NC 2N1TB 3RL0D 2N1TA 1KILD 4N78E 2YMYA 3HD7C 3KYQA 2N1TC 4WY4C 1T3JA 1SFCB 1N7SB 3B5NB 1SFCA 1JTHB 1GL2B 1SFCD 1N7SA 3B5NA 2NPSC 1JTHA 2HFED 5KJ7C 4OH8B 2WZ7A 3HD7B 3RK2B 1L4AD 1GL2C 4WY4B 3HD7A 5CCHC 2N1TD 4WY4A 3RK3C 4WY4D 3VOPA 2NPSB 1URQB 3RK2C 2NPSA 5KJ7A 3P8CE 5KJ7D 1N7SD 1URQC 1GL2A 3B5ND 5CCHA 3RK3B 1GL2D 5CCHD 3RK3D 3HD7D 3RK2D 3M0DC 1KILC 4W7ZA 5CCGA 4JF7A 1URQA 2NPSD 1URQD 5CCGC
chains in the Genus database with same CATH superfamily
1PP9D 2QJPB 1Z56A 3O8ZA 2KOGA 1GK4A 3H1KG 3CX5E 1Y9BA 1YI2P 2IZ0A 1SQQE 1G2CA 1JEKA 1ZLLA 1YTZT 1UIXA 3H1KE 3KZIE 2M8RA 1HVVA 1NWQA 1RF0C 1L2PA 2R5BA 3H1JD 1RE3A 3CCSP 2Y0EA 3AE8C 1YJ9P 4TLFA 5AVTB 3CD6P 1IC2A 2Q1KA 1T3JA 1VF5C 2P2UA 1JTHB 1JTHA 5AW5B 3C8VA 2WSEJ 4H44C 3CCUP 2R44A 3SFEC 1N86A 2SPZA 3E1RA 3RK3C 4AQRD 5CHXA 1NTZG 1W2BO 1JY2P 3TGUD 3RK2C 4L75A 1PGJA 3G71P 2P58A 2LXCB 2FYNB 3CWBJ 3MP7B 3RBZA 4HB1A 3M0DC 1OFCX 1EQ7A 3H1HD 3I55P 5K5GB 3L37A 1NVOA 3AE4C 1PL5A 4ASWA 5KLIB 3FWLA 4LGDE 5BU8B 1OXZA 2E74D 2G3AA 2KNCA 2GM4A 3HTKB 1NU1G 3HTKA 2J5UA 1BCCD 1PV3A 2PRRA 1YTZI 1GU5A 3IFMA 2Y0CA 3A0HH 1LTSC 1ZW0A 1USEA 1SFCC 2Q6QA 1BGYE 3A5TA 3IN6A 1NU1E 2ZYGA 4GIFA 1LT9C 1QVFO 4U3FG 5AVUB 1LJ2A 1KV4A 3I5CA 1QEXA 1SQPG 2OYIC 1H88A 3VYIA 2P7JA 3BVHA 1GD2E 2HYNA 1FZFA 4RKUJ 3V2QA 1AQTA 3VOPA 3L70D 3CLQA 1X22A 4UB6E 2KB7P 3AE9C 2Q7CA 3MUDA 2M3BA 1RQVA 2JDIH 3L73J 1GL2A 3SWKA 2IBZG 4NPFX 2BEQD 4OGQB 4RO0A 1NYHA 4JYBA 2LR2A 3M9BA 4JYCA 1R8EA 1NAFA 2RMZA 5CCGC 1L0LE 1GK6A 1WRGA 3CC7P 2WMMA 3L71E 2ZFCA 1EDIA 4KJMA 2XV5A 5KLVG 1VQPP 5TJHA 3A7OA 1NTMJ 3MTUE 1WT6A 3UIAA 1L4AB 1NKZB 1L4AA 4EOTA 5APQA 5AVYB 1T8ZA 3CI9A 4N78E 2YKPA 3VTPC 2K1AA 1KB9E 3GHGC 2Y0DA 1N7LA 3I56P 2AXCA 4MN4C 1H89A 2FYUK 2IYOA 3HD7B 3RK2B 3CWBG 3HD7A 2AEFA 1NTKJ 3P8CD 2E75C 3VN0A 3CL3D 1QL1A 3P7KA 4L74A 3CWBE 3H1IJ 3PTZA 1FZAA 3CCLP 1X9VA 5KTBA 1JM0A 2QM7A 1S3JA 1S2EA 3CXHI 1YYCA 3GLMA 4W7ZA 2CK3H 2YKQA 3OW2O 3MIWA 3PP5A 1N73C 3L75D 2FYUD 3B8EB 1KYOI 4D6TG 4IL6X 3HE5B 1EDKA 1JY3P 2V7QH 3B4SA 1QGKB 3HE5A 3G3ZA 3AE6C 1SQVK 4OGQD 2ZT9D 4I1LA 4GOEA 1FZGA 1IFIA 1LT9B 1FZEA 2A45I 1IK7A 2B89A 2O01J 3OA7A 1CI6B 2D2CC 1CI6A 2R3SA 2RH0A 1JUNA 1HWTC 3WU2H 2VRSA 2OYIB 3H1LG 3TGUE 3GG2A 3TF5A 1NTZD 1Y8AA 4I7ZC 3L73G 3CMAP 1SP4A 1L4AD 3LIEA 4WY4B 4WY4A 1FBMA 3HRNA 3KDPB 2XNXA 3IF4A 2RN0A 3AEGC 1M57D 1BDDA 3A0HE 3KHUA 3RK3D 5APUA 3HD7D 3RK2D 2IX7C 3L74D 2YMKA 5CCGA 1G1JA 2KYVA 2BASA 1L0NK 1HBWA 1GTWA 1NAYA 2KS1B 3PRJA 1KTMA 1NTMG 2QJYC 2JP3A 3FX0A 3G9RA 1JMMA 2H7HA 1PPJD 1T6AA 2KZJA 1AFOA 3NFQA 2P10A 2BCCD 4W80A 4IOIH 1NTME 1GZLA 2POHA 2AEMA 1KFMA 1LTBC 1NH4A 2HLOA 2KP8A 1GMJA 4U3FD 2LKMA 1N7SC 5KKZC 3JCUE 4GDOA 1SQPD 4LC1A 1X79B 4K35A 3G4SP 2YKOA 1HUCA 1L0ND 1SQVJ 1NTKG 4OWFA 1J2JB 3NXSA 5APVA 1SFCD 5KJ7C 4EDFA 3H32A 4YTPC 2FXMA 5KLVK 3CCRP 4C7NB 1SVFA 2UWJE 2KK7A 4C7NA 2YO2A 1BGYJ 3V6IA 3H1IE 1WMKA 1FOSF 3Q1MA 1X8YA 2OTKE 4YXDC 1E5WA 1VPCA 5AW7B 4XFJA 3Q5SA 3E7KA 1SQXK 2ZJSE 1S5LX 4N6JA 1X0TA 3AEBC 2R3CA 2IDBA 5H2FE 1VDFA 3IR9A 2JWDA 4Z1MH 1Y47A 1Q86Q 1PZQA 1ZOYC 4EIJA 5KLVD 3AEEC 4HH2A 1NGMB 1FC2C 3SWYA 3RL0C 2OYHC 2KZIA 3L35A 3SSUA 4ZKPA 5CCGD 3BRTB 2WSCH 2XU6A 1IFPA 1SQQG 3Q5RA 1T2KC 4BRYB 1SQXD 2OYOA 1L0LJ 4BRYA 4KT0J 4PV1C 1JY2O 2YMYA 2YIUB 3L71J 5CJ0A 4I7ZB 1DEEG 1HH0A 2FFDC 1BE3J 3V2PA 1E79H 3E1IA 3P32A 1S4XA 3TYYA 1JCCA 3LW5J 2H89C 5AVQB 3MGNA 3VMXA 1RH5B 4Y99C 4AUWA 3OAKA 2KSJA 1MKMA 3CC2P 2QE7H 2QVAA 4B86A 2QJKC 4I2LC 3PJSK 2FYUE 1DD3A 5APWA 1M56D 4D6TD 1KQGB 1EZVE 3AE5C 1R5SA 2C9NY 3W67A 1OVRA 3CCEP 5B66H 1LTGC 2OQQA 1H8AA 3BCCJ 1KILB 1PP9J 4PD4D 1KILA 1P84D 1LT1A 1FDMA 2ZVNB 1IFNA 1VL2A 1A02F 5KKZB 1XTGB 3HUSC 1JB0J 2QRXA 3PLNA 3S4RA 2L91A 3AE2C 5AVRB 3N7NA 3H1LD 3R4YA 3H25A 2IBZI 4JBZA 1EXIA 2M3EA 3H1JJ 4ZNCA 2W6JH 1HGVA 1S1CX 1SQVE 4HYTB 3CXHD 1BGYG 2N1TC 2YXRB 1LTJB 1LTJA 3CCVP 4GT1A 1U7JA 1HGZA 1VQ4P 1AV1A 1FJKA 1M8OB 2DW3A 1GDTA 2E42A 1KYOD 2P1JA 3MZWB 5AW0B 4ASVA 1IJDB 3CXHH 4YPCA 4PJ0E 3L74E 4R4LA 2A06D 1RF1C 3TGUJ 2G8YA 2GUSA 1PIXA 2C9LY 5AW8B 4C7RA 1KYOH 1LTIC 1PPJE 3TDKA 1U57A 2BCCE 1VQ5P 2B9BA 3VMZA 2Z5HA 3H1HJ 2FXOA 2HG5D 1ZR2A 1H0TB 2QSIA 3ITKA 2A45H 2O1KA 1H0TA 1KC8Q 1MV8A 2ZT9B 3EFFK 1L0LG 2H8PD 1VQ7P 5APTA 1JCDA 1L0NE 3L71G 3FXEA 1AJYA 1ZXGA 1YQ3C 3L72D 1MFZA 1BCCJ 2K37A 4UB8H 3B5NC 2HPCB 1SQBK 2YNYA 3AE7C 3U59A 4JQ0D 1KILD 5B5EE 1VQ6P 1BE3E 1RF0A 1RQUA 3TNUB 3TNUA 2K9JB 2NPSC 1M1JC 1KN7A 1IK9A 1DX7A 1USDA 1ZRTE 5AVWB 2AEJA 4O9BA 3FGAD 1LP1B 1VF5B 4WB4A 1VQMP 1NO4A 2M5AB 3WUUA 2E76C 2M5AA 2QJKB 3A3YB 3D6YA 4H44B 3Q2YA 1VQLP 5KJ7D 3L70J 1FE6A 2YXQB 3A0BH 1URQC 3RK3B 3OJAB 2KLUA 4PD4I 1JY3O 1P84I 1SQBD 5AW3B 3EFGA 3V2RA 2WTYA 3BCCG 2IFMA 1DEBA 1FZCC 4I6MC 4LLHA 1IFJA 4M3LA 2FBWC 3BCCE 4DOJA 4DZOA 4GOFA 3CX5D 1PP9E 3BATA 2KXPB 3M0DA 1SQXE 1SQQD 3HUSB 2IYPA 2XDJA 3II6A 3H1KD 2JJLA 1NTZK 4NPEA 3H1JE 1PFIA 2N1TB 3RL0D 1IFDA 2N1TA 3IAOA 3N4XA 1GW3A 2R5DA 3M06A 1SFCB 1SFCA 3F89A 2E5YA 2QM8A 1T2KD 2MKVA 3AEFC 1LT9A 5B66E 2IPPA 5BU5A 2W90A 3TGUG 5CCHC 4H0LC 1KQLA 2HODB 3S1KA 2IZ1A 2HODA 2OYIA 5KAIH 3KQGA 3AE1C 3SWFA 1EDLA 2PFXA 1NU1K 1OWAA 4H13C 1ZMEC 2QEXP 1VF5D 3A2AA 2V7QJ 3H1HE 1AVYA 2GA1A 4JF7A 3HE4B 1FDIA 4H44D 3HE4A 1FJPA 1A02J 1RE3C 2XKMA 1IFMA 1NHLA 3L75J 2FYUJ 1EXJA 1SQPK 3V4QA 2P67A 1CZQA 1ZR4A 3CCJP 3CXHE 5APSA 4XE5B 1K05A 1KZUB 1KD1Q 1BCCE 2KS1A 2O1JA 1NU1D 2OTLP 5DJTB 1J1DC 4A7PA 2W6AA 3QH9A 2WSFH 4EYYQ 2W6BA 2K88A 2E5TA 1FOSE 2A06E 2HFED 2W8ZA 3B71A 2FXPA 1NTZJ 2N1TD 3GHGB 1HF9A 1RE4C 1PGQA 3GHGA 5GTIH 4DCKA 1URQB 3L4FA 3GMAA 1K9MQ 3L70E 3S9OA 3CX5I 1OW8A 3H1IG 1LWUC 4AYCA 5C39A 3CCMP 1RHZB 2PGDA 2E75B 4UB8E 1YITP 2FKWB 2IBZD 1AVOA 1CSBA 3CC4P 3MHVA 5AVZB 1QL2A 3L74J 2WSFJ 1AA0A 2CPSA 1DD4A 2WPQA 4ZKUA 1IO4A 2E43A 4GODA 1KILE 3AE3C 1N73B 1OX3A 2FY8A 1N73A 2BCCJ 2KSEA 4IFFA 2Q3IA 1OW6A 2V4HA 3A0BE 2YO3A 3Q5PA 2Q9IA 4WBAA 4N78D 1Q7YQ 4U3FJ 2ZYDA 1KB9D 1SQPJ 1SS1A 1YHQP 2D2CB 3C9IA 2WSSH 3P8MC 4H0LB 1KFNA 1L0NJ 3MUDC 3NTNA 3AECC 1SQBE 1GL2C 2B87B 2HR3A 2Q5UA 4IL6H 5TISH 3RGUA 3KXDA 1CW5A 3CWBD 1EC5A 3P8CE 1YQ4C 5CJ4A 3TK1A 3MD0A 3D71A 2RKLA 2ITAA 5E79H 4BWNA 2ZAEB 3EQ2A 1G2CB 2E76D 2N9BA 1OVUA 3L75G 2FYUG 1FS0E 2W83C 1URQD 1OW7A 4ZMDA 2I1KA 1EZVG 1S9KD 1JOCA 3L75E 1PGOA 1W5CE 2WSCJ 1FZBA 5DJUB 2NRGA 1L4AC 2PP6A 5KLVJ 5AVXB 3FXDA 2E75D 4CPGA 1D7MA 3WU2E 2QJYB 1W2EA 3M9QA 1J1DB 1HJBA 2WITA 3BASA 1LNQA 5KAIE 4GKGA 2QA4P 3M0AA 2AXTH 1M90Q 1YBKA 2MJZA 2ZXXA 1VQOP 3M91A 3HD7C 1SQXJ 4WVZA 1KQSO 1N7SB 5EFWB 1N7SA 1SQVG 1BDCA 2OTJP 1NTZE 2JWAA 1RE4A 3Q3DA 4PD4H 1P84H 3R2PA 1MFTA 1NTMK 3L73D 5KJ7A 1LWUB 4K3AA 1UIIA 4RESB 5BVZA 1LWUA 1MZ9A 1JO5A 2D2CD 5APXA 3L74G 5CCHD 3GF3A 1U7MA 4H0LD 2KNCB 2PAJA 1GW4A 4TT3H 2W27A 3RK3E 1HJ0A 2XNDH 5CBNA 2WPRA 3KPEA 2KIKA 3RL0g 2H43A 4NPDA 1HTLC 4DJGA 1PPJG 4D6TJ 1ZP0C 2QG4A 2BCCG 5AW4B 3CMEP 4H13D 4N3YB 1Q82Q 1NTKK 1J1EC 2K9YA 2WVRA 1KB9I 1NTMD 3O6QB 1Q90D 3O6QA 2KUBA 2I8DA 5GTIE 2QIWA 3RL0B 3U1AA 2OYHB 4QMAA 1KMIZ 1FDOA 4U3FE 2OYHA 1L0NG 1VQNP 2H88C 1JY2N 3H1LJ 1SQPE 5CMZA 3SFDC 4RJTA 5L8RJ 4HKZH 1S5LH 4WY4C 5KAFH 2IFNA 3ABVC 3LIDA 1GL2B 3JCUH 4PV1B 1BE3G 2C0WA 2J59M 1NTKD 2XZRA 2HPCA 2I1JA 4JPZB 3H1ID 2FFDB 5CBOA 2FFDA 3L36A 2JKVA 2IBZE 3WMM0 3V2NA 1QLED 3FWNA 1NOHA 1QVGO 1JMBA 1N7SD 4U7JA 4Y99B 2K9JA 4Y28J 2KLVA 4EI2A 1LP1A 1SQQK 5GTHH 3H6PA 1N8RQ 2L5GB 3WUVA 1OZHA 2BEZF 4YXWH 5M1BA 3GF7A 1GU4A 5AW1B 5KLVE 2NZ2A 3AEDC 5AW9B 4HJGH 5H2FH 1PP9G 4IL6E 3U1CA 5TISE 1YJWP 1ZN5A 1JNMA 1SQXG 2B88A 1NJIQ 2WPVB 5E79E 1PGPA 1SLQA 2WT7B 2M0BA 3L72J 2WT7A 3HUSA 3H1JG 2O01H 1QX8A 1FAVA 2Z4EA 1LGHB 3C1LA 1XTCC 2WPSA 3W68A 3CX5H 1IZNB 2KI7B 2WZ7A 1KORA 1OIPA 2GUVA 3EWKA 3CCQP 5APYA 3KZIH 1Q2NA 2OARA 1AQ5A 3D70A 3M9HA 2CPBA 1GL2D 1LTAC 4PV1D 1S9KE 2AXTE 1RY3A 1EZVD 1KQFB 4BXLA 1NKNA 2E74C 1RF1B 1SQBJ 1RF1A 4D6TE 2JO1A 3V4WA 3F5HA 1J1EB 4XA4A 3VMYA 4KHXA 5AW6B 5AVSB 3GW6A 3H1HG 2QJPC 2O01N 3V5BA 4PD4E 1P84E 1N2DC 1SQQJ 1OVVA 4W7YA 3H1KJ 2YIUC 1YIJP 4WWIA 3H1LE 2N9YB 1SQVD 1BCCG 3VP9A 3JSVC 3KYQA 1K8AQ 1VQKP 3L73E 3B5NB 2R32A 3B5NA 2Y9ZA 1BGYD 2JEEA 3PH0A 4IFMA 2A06G 2Z5IA 1KYOE 2ZXEB 2NPSB 1M1JB 2NPSA 3ZDMA 2J58A 1M1JA 1BSNA 2A45G 1T3UA 3G6EP 3NMDA 1L0LK 1JY3N 1YJNP 3L70G 2E76B 4PJ0H 2FYNC 1DIPA 1VQ8P 1VQ9P 4L73A 1KILC 3WUTA 1URQA 1S5LE 5KAFE 2ZVOB 2Q3EA 4DT0A 5AVVB 3TSIA 1FZCB 1G1IA 1FZCA 5KLIC 4UB6H 3T97B 3T97A 3L72G 3VP8A 3QWOC 1MUUA 1L0LD 1TU3F 1S72P 3H32B 1LTJC 2JR8A 3L72E 4R4MA 1OMIA 3L71D 1NTKE 3RBXA 3USSA 1BE3D 3VMAA 1NU1J 3AEAC 2WWWA 5GTHE 1K04A 3K5BA 1EDJA 1M7LA 1ZRTD 1K73Q 3BRVB 4OH8B 4C46A 3D6ZA 2OGUA 1EZVI 5B5EH 2C0XA 2O3JA 1BSHA 2LXBA 4WY4D 1FU1A 1M1KQ 1SQBG 4OVNF 1Q81Q 1R5LA 4IFDK 3LW5H 1DH3A 3CPWO 2Y9YA 2FYZA 2WQYC 3B5ND 5CCHA 2E74B 3JC22 4L76A 2B87A 2K3RA 1ZV8A 1KB9H 4OGQC 2WSEH 2ZT9C 3PHLA 1LTTC 2NPSD 3BCCD 2ZYAA 4H13B 5AW2B
chains in the Genus database with same CATH topology
1Z56A 5AW4B 4DOJA 4DZOA 3O8ZA 2KOGA 4N3YB 1GK4A 3BATA 1NTKK 1JMMA 3M0DA 2H7HA 1AFOA 3NFQA 1J1EC 3HUSB 4W80A 2XDJA 3II6A 1G2CA 1ZLLA 1YTZT 1GZLA 2POHA 1KFMA 2M8RA 1LTBC 2JJLA 1HVVA 1NWQA 1NH4A 1RF0C 2HLOA 2R5BA 1RE3A 2KP8A 1NTZK 2LKMA 3RL0B 3U1AA 2OYHB 1N7SC 1PFIA 2N1TB 2OYHA 3RL0D 1IFDA 1JY2N 2N1TA 5AVTB 4LC1A 1X79B 3N4XA 1IC2A 5CMZA 2YKOA 1GW3A 2R5DA 3M06A 1HUCA 4WY4C 1T3JA 2IFNA 1SFCB 2P2UA 3LIDA 1J2JB 3NXSA 1SFCA 5APVA 1JTHB 1GL2B 1SFCD 2QM8A 1T2KD 1JTHA 5AW5B 5KJ7C 3H32A 2C0WA 1LT9A 2FXMA 5KLVK 2J59M 1SVFA 2IPPA 4C7NB 5BU5A 4C7NA 1N86A 5CCHC 2XZRA 2HPCA 2I1JA 2YO2A 3RK3C 2FFDB 4AQRD 1KQLA 2HODB 5CHXA 2FFDA 1JY2P 3L36A 3WMM0 3RK2C 2HODA 3V2NA 1FOSF 2OYIA 1X8YA 1NOHA 1E5WA 1VPCA 3KQGA 3SWFA 1N7SD 4Y99B 5AW7B 1NU1K 1OWAA 1SQXK 2KLVA 4N6JA 3M0DC 1SQQK 1EQ7A 3A2AA 3H6PA 2R3CA 2L5GB 4JF7A 1VDFA 3IR9A 3L37A 3HE4B 3HE4A 4EIJA 1FJPA 1GU4A 4HH2A 4LGDE 5AW1B 5BU8B 1A02J 1OXZA 1RE3C 2XKMA 1IFMA 1NHLA 3SWYA 1SQPK 3RL0C 3V4QA 2OYHC 5AW9B 3L35A 2GM4A 2P67A 3HTKB 3U1CA 1CZQA 1ZR4A 3HTKA 4ZKPA 1ZN5A 5APSA 4XE5B 5CCGD 3BRTB 1JNMA 2WSCH 1YTZI 1GU5A 1KZUB 2XU6A 3IFMA 2O1JA 1LTSC 1SFCC 1T2KC 1J1DC 3A5TA 4GIFA 1LT9C 1SLQA 2WT7B 2W6AA 2WT7A 1JY2O 2WSFH 2YMYA 3HUSA 2W6BA 2O01H 5CJ0A 5AVUB 1HH0A 1FAVA 2FFDC 3V2PA 2Z4EA 1LGHB 3I5CA 2OYIC 1FOSE 1XTCC 2WPSA 2HFED 1H88A 3VYIA 3E1IA 3P32A 3TYYA 2P7JA 3BVHA 1GD2E 2WZ7A 2HYNA 1FZFA 1JCCA 3V2QA 2GUVA 5AVQB 3MGNA 3VMXA 2N1TD 3GHGB 4Y99C 3VOPA 1RE4C 4AUWA 5APYA 3GHGA 1URQB 3L4FA 3CLQA 2KB7P 2Q7CA 3OAKA 2KSJA 3MUDA 2OARA 1AQ5A 2M3BA 3M9HA 4B86A 2CPBA 1GL2A 4I2LC 1GL2D 1LTAC 1LWUC 5APWA 1S9KE 4AYCA 1RY3A 2FKWB 1NKNA 1RF1B 1CSBA 1RF1A 2C9NY 5AVZB 4JYBA 3M9BA 4JYCA 1QL2A 3V4WA 1NAFA 5CCGC 1J1EB 4XA4A 3VMYA 1LTGC 4KHXA 1H8AA 1GK6A 5AW6B 2CPSA 5AVSB 1WRGA 2WPQA 1KILB 4ZKUA 1KILA 2ZFCA 1FDMA 1IFNA 1IO4A 2E43A 3V5BA 1N2DC 1N73B 2XV5A 1A02F 1N73A 4W7YA 3A7OA 1XTGB 3HUSC 3MTUE 4IFFA 2Q3IA 1WT6A 3UIAA 5AVRB 1L4AB 3N7NA 1NKZB 1L4AA 2YO3A 2Q9IA 4EOTA 5APQA 4WBAA 4N78D 5AVYB 1T8ZA 1HGVA 3CI9A 3VP9A 4HYTB 4N78E 2YKPA 3VTPC 3KYQA 2N1TC 1LTJB 1LTJA 3GHGC 3B5NB 4GT1A 2R32A 1N7LA 3C9IA 3B5NA 1H89A 3P8MC 1KFNA 1HGZA 2FYUK 3NTNA 1FJKA 3HD7B 3RK2B 1GDTA 2E42A 1GL2C 3HD7A 2Q5UA 2JEEA 2P1JA 4IFMA 5AW0B 2Z5IA 1IJDB 2ZXEB 2NPSB 3P8CD 1CW5A 1M1JB 2NPSA 3VN0A 3CL3D 1QL1A 3P7KA 2J58A 1M1JA 3P8CE 2A45G 1T3UA 3NMDA 1L0LK 1RF1C 5CJ4A 1FZAA 1JY3N 3MD0A 3TK1A 1X9VA 5KTBA 2GUSA 2QM7A 2C9LY 5AW8B 3EQ2A 4C7RA 1LTIC 1G2CB 2N9BA 1YYCA 1KILC 4W7ZA 3VMZA 1URQA 2Z5HA 1URQD 2YKQA 2I1KA 3MIWA 3PP5A 1N73C 3B8EB 5AVVB 2HG5D 1S9KD 1ZR2A 1JOCA 2A45H 2O1KA 3HE5B 3TSIA 1JY3P 1FZCB 1FZBA 1G1IA 3HE5A 3G3ZA 1FZCA 1MV8A 1L4AC 2PP6A 1SQVK 2H8PD 5AVXB 5APTA 3T97A 4I1LA 3VP8A 1FZGA 1JCDA 1IFIA 1MUUA 1W2EA 3M9QA 1J1DB 1HJBA 2WITA 3BASA 3H32B 1LT9B 1FZEA 2A45I 4GKGA 1LTJC 1MFZA 3OA7A 3M0AA 1CI6B 3B5NC 2HPCB 1SQBK 1CI6A 2YNYA 3U59A 1JUNA 2MJZA 1HWTC 1KILD 2VRSA 2OYIB 3M91A 3HD7C 2WWWA 1RF0A 3TNUB 1N7SB 3TNUA 1N7SA 1M7LA 2NPSC 1M1JC 3BRVB 4OH8B 1IK9A 1DX7A 4C46A 5AVWB 1RE4A 4O9BA 1SP4A 1L4AD 3LIEA 4WY4B 2C0XA 3R2PA 4WB4A 4WY4A 1NO4A 4WY4D 1NTMK 1FU1A 1FBMA 3A3YB 3HRNA 5KJ7A 1LWUB 3KDPB 5KJ7D 4RESB 5BVZA 4IFDK 3LW5H 1LWUA 1DH3A 2XNXA 1MZ9A 2FYZA 1JO5A 1URQC 3B5ND 5APXA 3RK3B 5CCHA 3OJAB 5CCHD 1JY3O 3RK3D 5AW3B 5APUA 3EFGA 2PAJA 1GW4A 2W27A 3V2RA 2WTYA 3HD7D 3RK2D 2IFMA 1DEBA 2IX7C 1ZV8A 1FZCC 2WPRA 5CCGA 3KPEA 1G1JA 2H43A 2WSEH 4I6MC 2KYVA 2BASA 1L0NK 4LLHA 1LTTC 1GTWA 1HTLC 1HBWA 2NPSD 1IFJA 5AW2B 4M3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PP5 A;  2HG5 D;  2KOG A;  4LGD E;  3TSI A;  1KIL B;  1NHL A;  1KIL A;  1L4A C;  2PP6 A;  4W80 A;  3RL0 C;  2H8P D;  2XDJ A;  3HTK B;  5CCG D;  4W7Y A;  2M8R A;  1XTG B;  1HVV A;  1L4A B;  3RL0 B;  1SFC C;  1L4A A;  1N7S C;  3B5N C;  2N1T B;  3RL0 D;  2N1T A;  1KIL D;  4N78 E;  2YMY A;  3HD7 C;  3KYQ A;  2N1T C;  4WY4 C;  1T3J A;  1SFC B;  1N7S B;  3B5N B;  1SFC A;  1JTH B;  1GL2 B;  1SFC D;  1N7S A;  3B5N A;  2NPS C;  1JTH A;  2HFE D;  5KJ7 C;  4OH8 B;  2WZ7 A;  3HD7 B;  3RK2 B;  1L4A D;  1GL2 C;  4WY4 B;  3HD7 A;  5CCH C;  2N1T D;  4WY4 A;  3RK3 C;  4WY4 D;  3VOP A;  2NPS B;  1URQ B;  3RK2 C;  2NPS A;  5KJ7 A;  3P8C E;  5KJ7 D;  1N7S D;  1URQ C;  1GL2 A;  3B5N D;  5CCH A;  3RK3 B;  1GL2 D;  5CCH D;  3RK3 D;  3HD7 D;  3RK2 D;  3M0D C;  1KIL C;  4W7Z A;  5CCG A;  4JF7 A;  1URQ A;  2NPS D;  1URQ D;  5CCG C; 
#chains in the Genus database with same CATH topology
 1PP9 D;  2QJP B;  1Z56 A;  3O8Z A;  2KOG A;  1GK4 A;  3H1K G;  3CX5 E;  1Y9B A;  1YI2 P;  2IZ0 A;  1SQQ E;  1G2C A;  1JEK A;  1ZLL A;  1YTZ T;  1UIX A;  3H1K E;  3KZI E;  2M8R A;  1HVV A;  1NWQ A;  1RF0 C;  1L2P A;  2R5B A;  3H1J D;  1RE3 A;  3CCS P;  2Y0E A;  3AE8 C;  1YJ9 P;  4TLF A;  5AVT B;  3CD6 P;  1IC2 A;  2Q1K A;  1T3J A;  1VF5 C;  2P2U A;  1JTH B;  1JTH A;  5AW5 B;  3C8V A;  2WSE J;  4H44 C;  3CCU P;  2R44 A;  3SFE C;  1N86 A;  2SPZ A;  3E1R A;  3RK3 C;  4AQR D;  5CHX A;  1NTZ G;  1W2B O;  1JY2 P;  3TGU D;  3RK2 C;  4L75 A;  1PGJ A;  3G71 P;  2P58 A;  2LXC B;  2FYN B;  3CWB J;  3MP7 B;  3RBZ A;  4HB1 A;  3M0D C;  1OFC X;  1EQ7 A;  3H1H D;  3I55 P;  5K5G B;  3L37 A;  1NVO A;  3AE4 C;  1PL5 A;  4ASW A;  5KLI B;  3FWL A;  4LGD E;  5BU8 B;  1OXZ A;  2E74 D;  2G3A A;  2KNC A;  2GM4 A;  3HTK B;  1NU1 G;  3HTK A;  2J5U A;  1BCC D;  1PV3 A;  2PRR A;  1YTZ I;  1GU5 A;  3IFM A;  2Y0C A;  3A0H H;  1LTS C;  1ZW0 A;  1USE A;  1SFC C;  2Q6Q A;  1BGY E;  3A5T A;  3IN6 A;  1NU1 E;  2ZYG A;  4GIF A;  1LT9 C;  1QVF O;  4U3F G;  5AVU B;  1LJ2 A;  1KV4 A;  3I5C A;  1QEX A;  1SQP G;  2OYI C;  1H88 A;  3VYI A;  2P7J A;  3BVH A;  1GD2 E;  2HYN A;  1FZF A;  4RKU J;  3V2Q A;  1AQT A;  3VOP A;  3L70 D;  3CLQ A;  1X22 A;  4UB6 E;  2KB7 P;  3AE9 C;  2Q7C A;  3MUD A;  2M3B A;  1RQV A;  2JDI H;  3L73 J;  1GL2 A;  3SWK A;  2IBZ G;  4NPF X;  2BEQ D;  4OGQ B;  4RO0 A;  1NYH A;  4JYB A;  2LR2 A;  3M9B A;  4JYC A;  1R8E A;  1NAF A;  2RMZ A;  5CCG C;  1L0L E;  1GK6 A;  1WRG A;  3CC7 P;  2WMM A;  3L71 E;  2ZFC A;  1EDI A;  4KJM A;  2XV5 A;  5KLV G;  1VQP P;  5TJH A;  3A7O A;  1NTM J;  3MTU E;  1WT6 A;  3UIA A;  1L4A B;  1NKZ B;  1L4A A;  4EOT A;  5APQ A;  5AVY B;  1T8Z A;  3CI9 A;  4N78 E;  2YKP A;  3VTP C;  2K1A A;  1KB9 E;  3GHG C;  2Y0D A;  1N7L A;  3I56 P;  2AXC A;  4MN4 C;  1H89 A;  2FYU K;  2IYO A;  3HD7 B;  3RK2 B;  3CWB G;  3HD7 A;  2AEF A;  1NTK J;  3P8C D;  2E75 C;  3VN0 A;  3CL3 D;  1QL1 A;  3P7K A;  4L74 A;  3CWB E;  3H1I J;  3PTZ A;  1FZA A;  3CCL P;  1X9V A;  5KTB A;  1JM0 A;  2QM7 A;  1S3J A;  1S2E A;  3CXH I;  1YYC A;  3GLM A;  4W7Z A;  2CK3 H;  2YKQ A;  3OW2 O;  3MIW A;  3PP5 A;  1N73 C;  3L75 D;  2FYU D;  3B8E B;  1KYO I;  4D6T G;  4IL6 X;  3HE5 B;  1EDK A;  1JY3 P;  2V7Q H;  3B4S A;  1QGK B;  3HE5 A;  3G3Z A;  3AE6 C;  1SQV K;  4OGQ D;  2ZT9 D;  4I1L A;  4GOE A;  1FZG A;  1IFI A;  1LT9 B;  1FZE A;  2A45 I;  1IK7 A;  2B89 A;  2O01 J;  3OA7 A;  1CI6 B;  2D2C C;  1CI6 A;  2R3S A;  2RH0 A;  1JUN A;  1HWT C;  3WU2 H;  2VRS A;  2OYI B;  3H1L G;  3TGU E;  3GG2 A;  3TF5 A;  1NTZ D;  1Y8A A;  4I7Z C;  3L73 G;  3CMA P;  1SP4 A;  1L4A D;  3LIE A;  4WY4 B;  4WY4 A;  1FBM A;  3HRN A;  3KDP B;  2XNX A;  3IF4 A;  2RN0 A;  3AEG C;  1M57 D;  1BDD A;  3A0H E;  3KHU A;  3RK3 D;  5APU A;  3HD7 D;  3RK2 D;  2IX7 C;  3L74 D;  2YMK A;  5CCG A;  1G1J A;  2KYV A;  2BAS A;  1L0N K;  1HBW A;  1GTW A;  1NAY A;  2KS1 B;  3PRJ A;  1KTM A;  1NTM G;  2QJY C;  2JP3 A;  3FX0 A;  3G9R A;  1JMM A;  2H7H A;  1PPJ D;  1T6A A;  2KZJ A;  1AFO A;  3NFQ A;  2P10 A;  2BCC D;  4W80 A;  4IOI H;  1NTM E;  1GZL A;  2POH A;  2AEM A;  1KFM A;  1LTB C;  1NH4 A;  2HLO A;  2KP8 A;  1GMJ A;  4U3F D;  2LKM A;  1N7S C;  5KKZ C;  3JCU E;  4GDO A;  1SQP D;  4LC1 A;  1X79 B;  4K35 A;  3G4S P;  2YKO A;  1HUC A;  1L0N D;  1SQV J;  1NTK G;  4OWF A;  1J2J B;  3NXS A;  5APV A;  1SFC D;  5KJ7 C;  4EDF A;  3H32 A;  4YTP C;  2FXM A;  5KLV K;  3CCR P;  4C7N B;  1SVF A;  2UWJ E;  2KK7 A;  4C7N A;  2YO2 A;  1BGY J;  3V6I A;  3H1I E;  1WMK A;  1FOS F;  3Q1M A;  1X8Y A;  2OTK E;  4YXD C;  1E5W A;  1VPC A;  5AW7 B;  4XFJ A;  3Q5S A;  3E7K A;  1SQX K;  2ZJS E;  1S5L X;  4N6J A;  1X0T A;  3AEB C;  2R3C A;  2IDB A;  5H2F E;  1VDF A;  3IR9 A;  2JWD A;  4Z1M H;  1Y47 A;  1Q86 Q;  1PZQ A;  1ZOY C;  4EIJ A;  5KLV D;  3AEE C;  4HH2 A;  1NGM B;  1FC2 C;  3SWY A;  3RL0 C;  2OYH C;  2KZI A;  3L35 A;  3SSU A;  4ZKP A;  5CCG D;  3BRT B;  2WSC H;  2XU6 A;  1IFP A;  1SQQ G;  3Q5R A;  1T2K C;  4BRY B;  1SQX D;  2OYO A;  1L0L J;  4BRY A;  4KT0 J;  4PV1 C;  1JY2 O;  2YMY A;  2YIU B;  3L71 J;  5CJ0 A;  4I7Z B;  1DEE G;  1HH0 A;  2FFD C;  1BE3 J;  3V2P A;  1E79 H;  3E1I A;  3P32 A;  1S4X A;  3TYY A;  1JCC A;  3LW5 J;  2H89 C;  5AVQ B;  3MGN A;  3VMX A;  1RH5 B;  4Y99 C;  4AUW A;  3OAK A;  2KSJ A;  1MKM A;  3CC2 P;  2QE7 H;  2QVA A;  4B86 A;  2QJK C;  4I2L C;  3PJS K;  2FYU E;  1DD3 A;  5APW A;  1M56 D;  4D6T D;  1KQG B;  1EZV E;  3AE5 C;  1R5S A;  2C9N Y;  3W67 A;  1OVR A;  3CCE P;  5B66 H;  1LTG C;  2OQQ A;  1H8A A;  3BCC J;  1KIL B;  1PP9 J;  4PD4 D;  1KIL A;  1P84 D;  1LT1 A;  1FDM A;  2ZVN B;  1IFN A;  1VL2 A;  1A02 F;  5KKZ B;  1XTG B;  3HUS C;  1JB0 J;  2QRX A;  3PLN A;  3S4R A;  2L91 A;  3AE2 C;  5AVR B;  3N7N A;  3H1L D;  3R4Y A;  3H25 A;  2IBZ I;  4JBZ A;  1EXI A;  2M3E A;  3H1J J;  4ZNC A;  2W6J H;  1HGV A;  1S1C X;  1SQV E;  4HYT B;  3CXH D;  1BGY G;  2N1T C;  2YXR B;  1LTJ B;  1LTJ A;  3CCV P;  4GT1 A;  1U7J A;  1HGZ A;  1VQ4 P;  1AV1 A;  1FJK A;  1M8O B;  2DW3 A;  1GDT A;  2E42 A;  1KYO D;  2P1J A;  3MZW B;  5AW0 B;  4ASV A;  1IJD B;  3CXH H;  4YPC A;  4PJ0 E;  3L74 E;  4R4L A;  2A06 D;  1RF1 C;  3TGU J;  2G8Y A;  2GUS A;  1PIX A;  2C9L Y;  5AW8 B;  4C7R A;  1KYO H;  1LTI C;  1PPJ E;  3TDK A;  1U57 A;  2BCC E;  1VQ5 P;  2B9B A;  3VMZ A;  2Z5H A;  3H1H J;  2FXO A;  2HG5 D;  1ZR2 A;  1H0T B;  2QSI A;  3ITK A;  2A45 H;  2O1K A;  1H0T A;  1KC8 Q;  1MV8 A;  2ZT9 B;  3EFF K;  1L0L G;  2H8P D;  1VQ7 P;  5APT A;  1JCD A;  1L0N E;  3L71 G;  3FXE A;  1AJY A;  1ZXG A;  1YQ3 C;  3L72 D;  1MFZ A;  1BCC J;  2K37 A;  4UB8 H;  3B5N C;  2HPC B;  1SQB K;  2YNY A;  3AE7 C;  3U59 A;  4JQ0 D;  1KIL D;  5B5E E;  1VQ6 P;  1BE3 E;  1RF0 A;  1RQU A;  3TNU B;  3TNU A;  2K9J B;  2NPS C;  1M1J C;  1KN7 A;  1IK9 A;  1DX7 A;  1USD A;  1ZRT E;  5AVW B;  2AEJ A;  4O9B A;  3FGA D;  1LP1 B;  1VF5 B;  4WB4 A;  1VQM P;  1NO4 A;  2M5A B;  3WUU A;  2E76 C;  2M5A A;  2QJK B;  3A3Y B;  3D6Y A;  4H44 B;  3Q2Y A;  1VQL P;  5KJ7 D;  3L70 J;  1FE6 A;  2YXQ B;  3A0B H;  1URQ C;  3RK3 B;  3OJA B;  2KLU A;  4PD4 I;  1JY3 O;  1P84 I;  1SQB D;  5AW3 B;  3EFG A;  3V2R A;  2WTY A;  3BCC G;  2IFM A;  1DEB A;  1FZC C;  4I6M C;  4LLH A;  1IFJ A;  4M3L A;  2FBW C;  3BCC E;  4DOJ A;  4DZO A;  4GOF A;  3CX5 D;  1PP9 E;  3BAT A;  2KXP B;  3M0D A;  1SQX E;  1SQQ D;  3HUS B;  2IYP A;  2XDJ A;  3II6 A;  3H1K D;  2JJL A;  1NTZ K;  4NPE A;  3H1J E;  1PFI A;  2N1T B;  3RL0 D;  1IFD A;  2N1T A;  3IAO A;  3N4X A;  1GW3 A;  2R5D A;  3M06 A;  1SFC B;  1SFC A;  3F89 A;  2E5Y A;  2QM8 A;  1T2K D;  2MKV A;  3AEF C;  1LT9 A;  5B66 E;  2IPP A;  5BU5 A;  2W90 A;  3TGU G;  5CCH C;  4H0L C;  1KQL A;  2HOD B;  3S1K A;  2IZ1 A;  2HOD A;  2OYI A;  5KAI H;  3KQG A;  3AE1 C;  3SWF A;  1EDL A;  2PFX A;  1NU1 K;  1OWA A;  4H13 C;  1ZME C;  2QEX P;  1VF5 D;  3A2A A;  2V7Q J;  3H1H E;  1AVY A;  2GA1 A;  4JF7 A;  3HE4 B;  1FDI A;  4H44 D;  3HE4 A;  1FJP A;  1A02 J;  1RE3 C;  2XKM A;  1IFM A;  1NHL A;  3L75 J;  2FYU J;  1EXJ A;  1SQP K;  3V4Q A;  2P67 A;  1CZQ A;  1ZR4 A;  3CCJ P;  3CXH E;  5APS A;  4XE5 B;  1K05 A;  1KZU B;  1KD1 Q;  1BCC E;  2KS1 A;  2O1J A;  1NU1 D;  2OTL P;  5DJT B;  1J1D C;  4A7P A;  2W6A A;  3QH9 A;  2WSF H;  4EYY Q;  2W6B A;  2K88 A;  2E5T A;  1FOS E;  2A06 E;  2HFE D;  2W8Z A;  3B71 A;  2FXP A;  1NTZ J;  2N1T D;  3GHG B;  1HF9 A;  1RE4 C;  1PGQ A;  3GHG A;  5GTI H;  4DCK A;  1URQ B;  3L4F A;  3GMA A;  1K9M Q;  3L70 E;  3S9O A;  3CX5 I;  1OW8 A;  3H1I G;  1LWU C;  4AYC A;  5C39 A;  3CCM P;  1RHZ B;  2PGD A;  2E75 B;  4UB8 E;  1YIT P;  2FKW B;  2IBZ D;  1AVO A;  1CSB A;  3CC4 P;  3MHV A;  5AVZ B;  1QL2 A;  3L74 J;  2WSF J;  1AA0 A;  2CPS A;  1DD4 A;  2WPQ A;  4ZKU A;  1IO4 A;  2E43 A;  4GOD A;  1KIL E;  3AE3 C;  1N73 B;  1OX3 A;  2FY8 A;  1N73 A;  2BCC J;  2KSE A;  4IFF A;  2Q3I A;  1OW6 A;  2V4H A;  3A0B E;  2YO3 A;  3Q5P A;  2Q9I A;  4WBA A;  4N78 D;  1Q7Y Q;  4U3F J;  2ZYD A;  1KB9 D;  1SQP J;  1SS1 A;  1YHQ P;  2D2C B;  3C9I A;  2WSS H;  3P8M C;  4H0L B;  1KFN A;  1L0N J;  3MUD C;  3NTN A;  3AEC C;  1SQB E;  1GL2 C;  2B87 B;  2HR3 A;  2Q5U A;  4IL6 H;  5TIS H;  3RGU A;  3KXD A;  1CW5 A;  3CWB D;  1EC5 A;  3P8C E;  1YQ4 C;  5CJ4 A;  3TK1 A;  3MD0 A;  3D71 A;  2RKL A;  2ITA A;  5E79 H;  4BWN A;  2ZAE B;  3EQ2 A;  1G2C B;  2E76 D;  2N9B A;  1OVU A;  3L75 G;  2FYU G;  1FS0 E;  2W83 C;  1URQ D;  1OW7 A;  4ZMD A;  2I1K A;  1EZV G;  1S9K D;  1JOC A;  3L75 E;  1PGO A;  1W5C E;  2WSC J;  1FZB A;  5DJU B;  2NRG A;  1L4A C;  2PP6 A;  5KLV J;  5AVX B;  3FXD A;  2E75 D;  4CPG A;  1D7M A;  3WU2 E;  2QJY B;  1W2E A;  3M9Q A;  1J1D B;  1HJB A;  2WIT A;  3BAS A;  1LNQ A;  5KAI E;  4GKG A;  2QA4 P;  3M0A A;  2AXT H;  1M90 Q;  1YBK A;  2MJZ A;  2ZXX A;  1VQO P;  3M91 A;  3HD7 C;  1SQX J;  4WVZ A;  1KQS O;  1N7S B;  5EFW B;  1N7S A;  1SQV G;  1BDC A;  2OTJ P;  1NTZ E;  2JWA A;  1RE4 A;  3Q3D A;  4PD4 H;  1P84 H;  3R2P A;  1MFT A;  1NTM K;  3L73 D;  5KJ7 A;  1LWU B;  4K3A A;  1UII A;  4RES B;  5BVZ A;  1LWU A;  1MZ9 A;  1JO5 A;  2D2C D;  5APX A;  3L74 G;  5CCH D;  3GF3 A;  1U7M A;  4H0L D;  2KNC B;  2PAJ A;  1GW4 A;  4TT3 H;  2W27 A;  3RK3 E;  1HJ0 A;  2XND H;  5CBN A;  2WPR A;  3KPE A;  2KIK A;  3RL0 g;  2H43 A;  4NPD A;  1HTL C;  4DJG A;  1PPJ G;  4D6T J;  1ZP0 C;  2QG4 A;  2BCC G;  5AW4 B;  3CME P;  4H13 D;  4N3Y B;  1Q82 Q;  1NTK K;  1J1E C;  2K9Y A;  2WVR A;  1KB9 I;  1NTM D;  3O6Q B;  1Q90 D;  3O6Q A;  2KUB A;  2I8D A;  5GTI E;  2QIW A;  3RL0 B;  3U1A A;  2OYH B;  4QMA A;  1KMI Z;  1FDO A;  4U3F E;  2OYH A;  1L0N G;  1VQN P;  2H88 C;  1JY2 N;  3H1L J;  1SQP E;  5CMZ A;  3SFD C;  4RJT A;  5L8R J;  4HKZ H;  1S5L H;  4WY4 C;  5KAF H;  2IFN A;  3ABV C;  3LID A;  1GL2 B;  3JCU H;  4PV1 B;  1BE3 G;  2C0W A;  2J59 M;  1NTK D;  2XZR A;  2HPC A;  2I1J A;  4JPZ B;  3H1I D;  2FFD B;  5CBO A;  2FFD A;  3L36 A;  2JKV A;  2IBZ E;  3WMM 0;  3V2N A;  1QLE D;  3FWN A;  1NOH A;  1QVG O;  1JMB A;  1N7S D;  4U7J A;  4Y99 B;  2K9J A;  4Y28 J;  2KLV A;  4EI2 A;  1LP1 A;  1SQQ K;  5GTH H;  3H6P A;  1N8R Q;  2L5G B;  3WUV A;  1OZH A;  2BEZ F;  4YXW H;  5M1B A;  3GF7 A;  1GU4 A;  5AW1 B;  5KLV E;  2NZ2 A;  3AED C;  5AW9 B;  4HJG H;  5H2F H;  1PP9 G;  4IL6 E;  3U1C A;  5TIS E;  1YJW P;  1ZN5 A;  1JNM A;  1SQX G;  2B88 A;  1NJI Q;  2WPV B;  5E79 E;  1PGP A;  1SLQ A;  2WT7 B;  2M0B A;  3L72 J;  2WT7 A;  3HUS A;  3H1J G;  2O01 H;  1QX8 A;  1FAV A;  2Z4E A;  1LGH B;  3C1L A;  1XTC C;  2WPS A;  3W68 A;  3CX5 H;  1IZN B;  2KI7 B;  2WZ7 A;  1KOR A;  1OIP A;  2GUV A;  3EWK A;  3CCQ P;  5APY A;  3KZI H;  1Q2N A;  2OAR A;  1AQ5 A;  3D70 A;  3M9H A;  2CPB A;  1GL2 D;  1LTA C;  4PV1 D;  1S9K E;  2AXT E;  1RY3 A;  1EZV D;  1KQF B;  4BXL A;  1NKN A;  2E74 C;  1RF1 B;  1SQB J;  1RF1 A;  4D6T E;  2JO1 A;  3V4W A;  3F5H A;  1J1E B;  4XA4 A;  3VMY A;  4KHX A;  5AW6 B;  5AVS B;  3GW6 A;  3H1H G;  2QJP C;  2O01 N;  3V5B A;  4PD4 E;  1P84 E;  1N2D C;  1SQQ J;  1OVV A;  4W7Y A;  3H1K J;  2YIU C;  1YIJ P;  4WWI A;  3H1L E;  2N9Y B;  1SQV D;  1BCC G;  3VP9 A;  3JSV C;  3KYQ A;  1K8A Q;  1VQK P;  3L73 E;  3B5N B;  2R32 A;  3B5N A;  2Y9Z A;  1BGY D;  2JEE A;  3PH0 A;  4IFM A;  2A06 G;  2Z5I A;  1KYO E;  2ZXE B;  2NPS B;  1M1J B;  2NPS A;  3ZDM A;  2J58 A;  1M1J A;  1BSN A;  2A45 G;  1T3U A;  3G6E P;  3NMD A;  1L0L K;  1JY3 N;  1YJN P;  3L70 G;  2E76 B;  4PJ0 H;  2FYN C;  1DIP A;  1VQ8 P;  1VQ9 P;  4L73 A;  1KIL C;  3WUT A;  1URQ A;  1S5L E;  5KAF E;  2ZVO B;  2Q3E A;  4DT0 A;  5AVV B;  3TSI A;  1FZC B;  1G1I A;  1FZC A;  5KLI C;  4UB6 H;  3T97 B;  3T97 A;  3L72 G;  3VP8 A;  3QWO C;  1MUU A;  1L0L D;  1TU3 F;  1S72 P;  3H32 B;  1LTJ C;  2JR8 A;  3L72 E;  4R4M A;  1OMI A;  3L71 D;  1NTK E;  3RBX A;  3USS A;  1BE3 D;  3VMA A;  1NU1 J;  3AEA C;  2WWW A;  5GTH E;  1K04 A;  3K5B A;  1EDJ A;  1M7L A;  1ZRT D;  1K73 Q;  3BRV B;  4OH8 B;  4C46 A;  3D6Z A;  2OGU A;  1EZV I;  5B5E H;  2C0X A;  2O3J A;  1BSH A;  2LXB A;  4WY4 D;  1FU1 A;  1M1K Q;  1SQB G;  4OVN F;  1Q81 Q;  1R5L A;  4IFD K;  3LW5 H;  1DH3 A;  3CPW O;  2Y9Y A;  2FYZ A;  2WQY C;  3B5N D;  5CCH A;  2E74 B;  3JC2 2;  4L76 A;  2B87 A;  2K3R A;  1ZV8 A;  1KB9 H;  4OGQ C;  2WSE H;  2ZT9 C;  3PHL A;  1LTT C;  2NPS D;  3BCC D;  2ZYA A;  4H13 B;  5AW2 B; 
#chains in the Genus database with same CATH homology
 1Z56 A;  5AW4 B;  4DOJ A;  4DZO A;  3O8Z A;  2KOG A;  4N3Y B;  1GK4 A;  3BAT A;  1NTK K;  1JMM A;  3M0D A;  2H7H A;  1AFO A;  3NFQ A;  1J1E C;  3HUS B;  4W80 A;  2XDJ A;  3II6 A;  1G2C A;  1ZLL A;  1YTZ T;  1GZL A;  2POH A;  1KFM A;  2M8R A;  1LTB C;  2JJL A;  1HVV A;  1NWQ A;  1NH4 A;  1RF0 C;  2HLO A;  2R5B A;  1RE3 A;  2KP8 A;  1NTZ K;  2LKM A;  3RL0 B;  3U1A A;  2OYH B;  1N7S C;  1PFI A;  2N1T B;  2OYH A;  3RL0 D;  1IFD A;  1JY2 N;  2N1T A;  5AVT B;  4LC1 A;  1X79 B;  3N4X A;  1IC2 A;  5CMZ A;  2YKO A;  1GW3 A;  2R5D A;  3M06 A;  1HUC A;  4WY4 C;  1T3J A;  2IFN A;  1SFC B;  2P2U A;  3LID A;  1J2J B;  3NXS A;  1SFC A;  5APV A;  1JTH B;  1GL2 B;  1SFC D;  2QM8 A;  1T2K D;  1JTH A;  5AW5 B;  5KJ7 C;  3H32 A;  2C0W A;  1LT9 A;  2FXM A;  5KLV K;  2J59 M;  1SVF A;  2IPP A;  4C7N B;  5BU5 A;  4C7N A;  1N86 A;  5CCH C;  2XZR A;  2HPC A;  2I1J A;  2YO2 A;  3RK3 C;  2FFD B;  4AQR D;  1KQL A;  2HOD B;  5CHX A;  2FFD A;  1JY2 P;  3L36 A;  3WMM 0;  3RK2 C;  2HOD A;  3V2N A;  1FOS F;  2OYI A;  1X8Y A;  1NOH A;  1E5W A;  1VPC A;  3KQG A;  3SWF A;  1N7S D;  4Y99 B;  5AW7 B;  1NU1 K;  1OWA A;  1SQX K;  2KLV A;  4N6J A;  3M0D C;  1SQQ K;  1EQ7 A;  3A2A A;  3H6P A;  2R3C A;  2L5G B;  4JF7 A;  1VDF A;  3IR9 A;  3L37 A;  3HE4 B;  3HE4 A;  4EIJ A;  1FJP A;  1GU4 A;  4HH2 A;  4LGD E;  5AW1 B;  5BU8 B;  1A02 J;  1OXZ A;  1RE3 C;  2XKM A;  1IFM A;  1NHL A;  3SWY A;  1SQP K;  3RL0 C;  3V4Q A;  2OYH C;  5AW9 B;  3L35 A;  2GM4 A;  2P67 A;  3HTK B;  3U1C A;  1CZQ A;  1ZR4 A;  3HTK A;  4ZKP A;  1ZN5 A;  5APS A;  4XE5 B;  5CCG D;  3BRT B;  1JNM A;  2WSC H;  1YTZ I;  1GU5 A;  1KZU B;  2XU6 A;  3IFM A;  2O1J A;  1LTS C;  1SFC C;  1T2K C;  1J1D C;  3A5T A;  4GIF A;  1LT9 C;  1SLQ A;  2WT7 B;  2W6A A;  2WT7 A;  1JY2 O;  2WSF H;  2YMY A;  3HUS A;  2W6B A;  2O01 H;  5CJ0 A;  5AVU B;  1HH0 A;  1FAV A;  2FFD C;  3V2P A;  2Z4E A;  1LGH B;  3I5C A;  2OYI C;  1FOS E;  1XTC C;  2WPS A;  2HFE D;  1H88 A;  3VYI A;  3E1I A;  3P32 A;  3TYY A;  2P7J A;  3BVH A;  1GD2 E;  2WZ7 A;  2HYN A;  1FZF A;  1JCC A;  3V2Q A;  2GUV A;  5AVQ B;  3MGN A;  3VMX A;  2N1T D;  3GHG B;  4Y99 C;  3VOP A;  1RE4 C;  4AUW A;  5APY A;  3GHG A;  1URQ B;  3L4F A;  3CLQ A;  2KB7 P;  2Q7C A;  3OAK A;  2KSJ A;  3MUD A;  2OAR A;  1AQ5 A;  2M3B A;  3M9H A;  4B86 A;  2CPB A;  1GL2 A;  4I2L C;  1GL2 D;  1LTA C;  1LWU C;  5APW A;  1S9K E;  4AYC A;  1RY3 A;  2FKW B;  1NKN A;  1RF1 B;  1CSB A;  1RF1 A;  2C9N Y;  5AVZ B;  4JYB A;  3M9B A;  4JYC A;  1QL2 A;  3V4W A;  1NAF A;  5CCG C;  1J1E B;  4XA4 A;  3VMY A;  1LTG C;  4KHX A;  1H8A A;  1GK6 A;  5AW6 B;  2CPS A;  5AVS B;  1WRG A;  2WPQ A;  1KIL B;  4ZKU A;  1KIL A;  2ZFC A;  1FDM A;  1IFN A;  1IO4 A;  2E43 A;  3V5B A;  1N2D C;  1N73 B;  2XV5 A;  1A02 F;  1N73 A;  4W7Y A;  3A7O A;  1XTG B;  3HUS C;  3MTU E;  4IFF A;  2Q3I A;  1WT6 A;  3UIA A;  5AVR B;  1L4A B;  3N7N A;  1NKZ B;  1L4A A;  2YO3 A;  2Q9I A;  4EOT A;  5APQ A;  4WBA A;  4N78 D;  5AVY B;  1T8Z A;  1HGV A;  3CI9 A;  3VP9 A;  4HYT B;  4N78 E;  2YKP A;  3VTP C;  3KYQ A;  2N1T C;  1LTJ B;  1LTJ A;  3GHG C;  3B5N B;  4GT1 A;  2R32 A;  1N7L A;  3C9I A;  3B5N A;  1H89 A;  3P8M C;  1KFN A;  1HGZ A;  2FYU K;  3NTN A;  1FJK A;  3HD7 B;  3RK2 B;  1GDT A;  2E42 A;  1GL2 C;  3HD7 A;  2Q5U A;  2JEE A;  2P1J A;  4IFM A;  5AW0 B;  2Z5I A;  1IJD B;  2ZXE B;  2NPS B;  3P8C D;  1CW5 A;  1M1J B;  2NPS A;  3VN0 A;  3CL3 D;  1QL1 A;  3P7K A;  2J58 A;  1M1J A;  3P8C E;  2A45 G;  1T3U A;  3NMD A;  1L0L K;  1RF1 C;  5CJ4 A;  1FZA A;  1JY3 N;  3MD0 A;  3TK1 A;  1X9V A;  5KTB A;  2GUS A;  2QM7 A;  2C9L Y;  5AW8 B;  3EQ2 A;  4C7R A;  1LTI C;  1G2C B;  2N9B A;  1YYC A;  1KIL C;  4W7Z A;  3VMZ A;  1URQ A;  2Z5H A;  1URQ D;  2YKQ A;  2I1K A;  3MIW A;  3PP5 A;  1N73 C;  3B8E B;  5AVV B;  2HG5 D;  1S9K D;  1ZR2 A;  1JOC A;  2A45 H;  2O1K A;  3HE5 B;  3TSI A;  1JY3 P;  1FZC B;  1FZB A;  1G1I A;  3HE5 A;  3G3Z A;  1FZC A;  1MV8 A;  1L4A C;  2PP6 A;  1SQV K;  2H8P D;  5AVX B;  5APT A;  3T97 A;  4I1L A;  3VP8 A;  1FZG A;  1JCD A;  1IFI A;  1MUU A;  1W2E A;  3M9Q A;  1J1D B;  1HJB A;  2WIT A;  3BAS A;  3H32 B;  1LT9 B;  1FZE A;  2A45 I;  4GKG A;  1LTJ C;  1MFZ A;  3OA7 A;  3M0A A;  1CI6 B;  3B5N C;  2HPC B;  1SQB K;  1CI6 A;  2YNY A;  3U59 A;  1JUN A;  2MJZ A;  1HWT C;  1KIL D;  2VRS A;  2OYI B;  3M91 A;  3HD7 C;  2WWW A;  1RF0 A;  3TNU B;  1N7S B;  3TNU A;  1N7S A;  1M7L A;  2NPS C;  1M1J C;  3BRV B;  4OH8 B;  1IK9 A;  1DX7 A;  4C46 A;  5AVW B;  1RE4 A;  4O9B A;  1SP4 A;  1L4A D;  3LIE A;  4WY4 B;  2C0X A;  3R2P A;  4WB4 A;  4WY4 A;  1NO4 A;  4WY4 D;  1NTM K;  1FU1 A;  1FBM A;  3A3Y B;  3HRN A;  5KJ7 A;  1LWU B;  3KDP B;  5KJ7 D;  4RES B;  5BVZ A;  4IFD K;  3LW5 H;  1LWU A;  1DH3 A;  2XNX A;  1MZ9 A;  2FYZ A;  1JO5 A;  1URQ C;  3B5N D;  5APX A;  3RK3 B;  5CCH A;  3OJA B;  5CCH D;  1JY3 O;  3RK3 D;  5AW3 B;  5APU A;  3EFG A;  2PAJ A;  1GW4 A;  2W27 A;  3V2R A;  2WTY A;  3HD7 D;  3RK2 D;  2IFM A;  1DEB A;  2IX7 C;  1ZV8 A;  1FZC C;  2WPR A;  5CCG A;  3KPE A;  1G1J A;  2H43 A;  2WSE H;  4I6M C;  2KYV A;  2BAS A;  1L0N K;  4LLH A;  1LTT C;  1GTW A;  1HTL C;  1HBW A;  2NPS D;  1IFJ A;  5AW2 B;  4M3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...