2QSIA

Crystal structure of putative hydrogenase expression/formation protein hupg from rhodopseudomonas palustris cga009
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
b'PTLVDEATVDDFIAHSGKIVVLFFRGDAVRFPEAADLAVVLPELINAFPGRLVAAEVAAEAERGLMARFGVAVCPSLAVVQPERTLGVIAKIQDWSSYLAQIGAMLAEVDQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrogenase expression/formation protein hupG
publication title Structure of putative hydrogenase expression/formation protein hupG from Rhodopseudomonas palustris CGA009.
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 23
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07449 HyaE Hydrogenase-1 expression protein HyaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qsiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2qsiA01
3DXBA 4MZWA 1EWXA 4K7OA 4NV2A 4EXJA 4FO5A 1EGOA 2DJ2A 5L71A 3JCML 2QSIA 3TOTA 1HNBA 1TTZA 3UJ1A 2IPAA 1JZWA 2MMAA 1GLPA 3TKPA 2N5AA 3F6DA 1JLVA 2C3QA 4WKWA 2CVKA 5IOXA 4FYCA 4PNFA 3KH9A 4KGIA 4MPFA 2J9HA 3GN3A 1S3CA 2C0GA 2LJKA 3IK7A 5A4UA 3O6TA 3RDWA 1VF3A 2OA7A 4F9ZA 5DJMA 2AB6A 5G30A 4V2NA 1TK0B 1URMA 3H4KA 5H5QA 4BWSA 5J3RA 1SENA 3A5WA 1XVQA 2R5GA 2O89A 2QC7A 3TRXA 2G2QA 2KP2A 2DMLA 1EZKA 2YN1A 1T3BA 3C8EA 4ZBAA 2MMOA 4KW6A 1GH2A 1GL8A 1M9BA 1UVZA 2EIOA 2XBQA 3ZREA 4O5RA 3P8WA 4N30A 3LQ7A 4EVMA 2GQKA 2NPBA 3VWVA 1R4WA 1HQOA 3TB2A 5IMVA 3PH9A 4EDZA 2FYNC 2OE3A 4L0WA 1TOFA 2K9YA 1PKWA 4G10A 4Q5RA 3U6VA 1GP1A 4N0VA 3VURA 1O81A 1BG5A 3H79A 4KDYA 3VI5A 1BQ7A 1EOHA 4HEA2 4TW5A 3EMXA 4AJ8A 13GSA 3HKRA 3FR9A 2H76A 1V98A 6GSVA 4IGJA 1G6YA 2NBSA 1G7EA 4H86A 4K6XA 1AIUA 4AGSA 1MD4A 2WULA 1SK0A 1GTBA 5HFKA 3LSZA 4DSSA 2YIUC 2M46A 3M8NA 3G7JA 1XIYA 4DSQA 2O7KA 1KNGA 1GTIA 3HY2A 5HR1A 4TR4A 1PSQA 1SK1A 4OD7A 1T4ZA 1X5CA 4KT0J 2FWGA 2C4JA 2C0FA 2PGTA 2E2MA 2FA8A 2OJLA 4FYUA 4WETA 2H71A 5C04A 1EGRA 4NV5A 4LL1B 1FAAA 4ILFA 4NMUA 1VGLA 1R7HA 3TDGA 2CVBA 2VD0A 2LUSA 3IRAA 3ME7A 1ZCPA 1DBYA 4I7ZB 2VCTA 4X0XA 1N2AA 4N10A 1B9YC 4IELA 3E9JB 1HD2A 1B4QA 2FHEA 3O3TA 4YH2A 4F2IA 3LG6A 2GZZA 1PMTA 4O92A 5D9XA 1XWCA 2FLSA 2TRXA 3LFLA 1OC8A 3F0IA 2CAQA 4XS4B 1E6BA 3ZFLA 3GNJA 4IJ3A 5INYA 3CYNA 2I81A 1MDJA 2YP6A 5HR3A 3F4RA 3KM6A 3GV1A 2JACA 2LS5A 4ZBDA 3MSZA 3ZTLA 1ZYQB 1HNAA 2ON7A 1UN2A 2XPEA 1EEMA 2DJKA 4MJBA 3Q6OA 3L9UA 2LJAA 4ZL8A 4HUAA 3Q74A 1Z7PA 2LSTA 1TJDA 5DJLA 4HJ2A 4YQUA 5ECPB 3DWVA 3BJ5A 3HZ8A 2ZT9B 4XHMA 2ZCTA 17GSA 1PX6A 1GNWA 3DEXA 1KTEA 1ML6A 3A2WA 2RUFA 1WE0A 4RUVA 2QKEA 2EIRA 5DCGA 2L59A 3DVWA 4ECBA 3KTBA 5D96A 2HZEB 1SU9A 1WMJA 2REMA 3D21A 1B9XC 4ZL9A 1QXHA 5FWGA 2OBIA 1HYUA 2YJHA 4GF0A 1MD3A 5KN2A 1H4OA 3VPTA 3IBHA 1NW2A 2TRCP 1SYRA 3HA9A 5E59A 4CHSA 3LJRA 1F9MA 3I9V2 1LJRA 2H6ZA 3D22A 4KX4A 3IK9A 1FB6A 4GSTA 2YWNA 3KP9A 1K3YA 5EY6A 2PWJA 1XZOA 3P2AA 1QMVA 2DJJA 1A0FA 2A4VA 5IMDA 4F03A 3GTUA 1Z5YE 2HRFA 3ERFA 4FYBA 4JEDA 3PR8A 3QFBC 1ERUA 2M72A 5J5NA 1ABAA 2DC5A 3DD3A 3GUSA 1ZMAA 3N9JA 1C72A 2R2JA 3FYGA 2VOCA 2ES7A 1S5LX 2JZSA 3NOFA 3LWAA 2L4QA 2A2SA 4EO3A 1Z6NA 3GX0A 4O7HA 3APSA 4MJAA 4F82A 5CRGA 1YF1A 1MTCA 5CREA 5J9BA 1T1VA 5AIVA 1FB0A 1VF2A 4EF0A 3W8SA 1OVNA 1PD21 5FHIA 2JSYA 2IMDA 1IYHA 4IQ1A 2C0EA 3DGQA 1FW1A 2O8VB 2WPVB 2H73A 1O73A 4TXOA 4GLTA 2VCXA 5GSTA 2RM6A 4IVFA 4G2EA 6GSWA 4GTUA 4YAVA 2NVLA 4JR6A 1T8EB 1S3AA 4HJMA 1V2AA 2ALBA 1EV4A 2FWFA 4KCEA 4H0LB 4CW9A 3HVSA 5KN3A 2AYTA 4TN8A 3LORA 1GNEA 1U3IA 2H70A 3A2XA 2B1LA 2J23A 4WF4A 1TXXA 3TCOA 2E76B 4EE0A 2JZTA 3GIXA 4TRXA 3EE2A 2ZNMA 1U87A 3ED3A 2VL2C 3KXOA 4LMVA 2C3NA 3I43A 4TR1B 1GUKA 3TJKA 5CAXA 5CRDA 4K0GA 2IIYA 4RQXA 1Y6EA 1O8XA 1M2DA 2JL4A 3RBTA 2LRCA 2DJ0A 4OFNA 4JZQA 1TRVA 5G1KA 5DAKA 5AN1A 5ECIB 4J2FA 1XW9A 3TKSE 2H0HA 1OAZA 2M80A 5H5SA 2LJRA 20GSA 4PUAA 5ECNB 3HYPA 3IA1A 2WCIA 3G7YA 2F8FA 1AQWA 4JU5A 1FVJA 3GYKA 2LNTA 2B7KA 2CVDA 5EL8A 1EP8A 1GULA 1GSQA 3WGDA 3KEBA 2RIIA 4KAEA 5KN0A 3QFAC 2PVQA 4LL4B 5ECHB 5IIZA 4WR4A 4TVEA 5AIXA 4XTSA 3QAGA 6GSTA 3L4NA 1DUGA 10GSA 5HR0A 4AJ6A 1LU4A 1O8WA 1YJ6A 4L0UA 3IHQA 3V1WA 2C0DA 5JCWA 5B6NA 1TRSA 4MZCA 1K0AA 3M9JA 2PU9C 4Q5NA 2HT9A 4K0NA 1JZRA 2H6YA 2H0GA 1AQXA 4D73B 2R6KA 2E0QA 1ST9A 3ZRDA 2BJXA 2CT6A 1QQ2A 3KGKA 4DVCA 2WS2A 2YCDA 2N5BA 4NHWA 2I9HA 2OKAA 4KDUA 4ZB6A 3KTLA 2B5YA 1J0FA 2L6CA 4PX1A 2FUG2 5DDLA 1ERTA 3DMLA 1R26A 4DSSB 3ZYWA 4MK3A 2IN3A 4KDXA 3TRPA 4E8EA 3PINA 3TJJA 2H66A 3P90A 1DE1A 3GHAA 5JCUA 2O85A 1A23A 2G0FA 2V32A 4KCAA 2FD3A 4NPBA 3HD5A 3TGZA 2L6DA 3IXRA 2GSSA 3SBCA 3L9SA 1J9BA 3Q19A 4JR4A 3FZAA 4RI7A 3IR4A 3HCZA 2V6OA 5A4VA 1HNCA 5KEJA 1GSSA 3FW2A 2FWHA 1GSEA 2F8AA 4Q5QA 1TK5B 2VIMA 2A2RA 3TKRA 3LEFA 4J56E 4MH2A 5IMFA 1M9AA 3M9KA 2YZUA 1M7TA 3KD0A 2VAFA 2V41A 4KA0A 3CRUA 1ACVA 2ZUPA 4HDEA 1R5AA 3UMAA 4AJ7A 1G6WA 1K0NA 3APOA 5C00A 3N5OA 3ZIJA 2EIQA 2IWTA 1GUMA 5CRWA 4GQCA 5ECLB 4OWYA 2GDRA 4K9ZA 5IO0A 4F0BA 1XWAA 5EVOA 1M2BA 1SD8A 4ML1A 5B6MA 3QR6A 1A2LA 3QCPA 5D9VA 1M2AA 4ZILA 3P7XA 4ECJA 2QJKC 4MA9A 5ECRB 2GZPA 1SKWB 3FR3A 4CDOA 2MYGA 2PBJA 3UARA 1SL1B 5F0GA 1TKDB 1EP7A 1J08A 2GTUA 1MEKA 5J4UA 1RQMA 2FGXA 5ECMB 4HZ4A 1KBNA 2KHPA 3ZIVA 3APQA 3J7Yb 2OADA 1CQHA 2GQLA 2VLUA 3VWWA 2GLRA 3H93A 2LNSA 3MNGA 2V1MA 3HHVA 1FVKA 2DMMA 1PRXA 4MJCA 3TKQA 2CZ2A 1ILOA 2XHFA 2DIYA 3ERWA 2CAIA 3DKSA 4WBRD 3VWUA 1TW9A 1AW9A 4ZIJA 2WSFJ 5HR2A 3WD6A 5DQSA 1X9WB 3UEMA 11GSA 4BVYA 2VM2A 3W8JA 2K8VA 3GA4A 3GL3A 2K9FA 2IFQB 1UC7A 3F3QA 2VCWA 5HFGA 1AQVA 1K0MA 4MLYA 4V2MA 4MDCA 4ID0A 1A24A 3F6FA 2WB9A 3UIWA 1JLWA 3CSIA 2B6MA 3HVXA 2LEGA 3GL5A 2X64A 3CBUA 4BWQA 4TKYA 1K0CA 4XRAA 5AISA 2YWIA 4QL9A 1TDIA 4I8BA 1VF1A 3UBKA 4QL7A 3W6GA 1E2YA 1ZZYA 2QJYC 1SYXA 3G7IA 3IDVA 2GQMA 2VD1A 1ERVA 4ZB9A 2GSTA 2RLIA 4PXOA 1GWCA 1PN9A 1X5DA 2F9SA 2DLXA 2H1GA 2IMIA 3QOUA 3NIVA 3VPQA 5GSSA 8GSSA 1S3DA 2VCVA 3CSHA 3HJMA 3ZMKA 1AAZA 3DYRA 5CO3A 3ZITA 1BJXA 4K7IA 2EC4A 4K1FA 1MDIA 1EV9A 2PMTA 4EUYA 4GQFA 3BBYA 3M0FA 1H75A 2IMEA 2HE3A 3F8UA 3GH9A 2OBKA 5ELAA 4ECIA 9GSSA 1OE8A 2QJPC 2VO4A 1JB0J 1XXUA 1NSWA 3QD9A 4GSNA 3J7Yk 2CX3A 3HJPA 5GZZB 4FH8A 1TRUA 1Z7RA 5DCHA 3I69A 3MDKA 3SWLA 2LQOA 1TI1A 5A4WA 4JE1A 3FZ4A 2KLXA 4OMVA 3C7MA 4TOPA 3GRXA 2PUKC 5DAKB 5G1LA 1GTUA 4ECCA 2JU5A 3NZNA 4PUFC 4HI7A 2B3SA 3VFIA 4GRFA 4KNDA 4KH7A 2R4VA 1OC3A 3TKSC 5A5KA 4I97A 3EC3A 4IQAA 2I4AA 5DBQA 1XCCA 2AJQB 3FKFA 3FR6A 4IHUA 1W4VA 4TXVA 2VCQA 2P0GA 5DALB 2GT6A 5IPHA 2K8SA 3FRCA 5JCGA 1SJIA 4RKUJ 2WGRA 4MZBA 3LXTA 1K0DA 2N5FA 1AC1A 1FO5A 1A8YA 1YEXA 5D73A 2XBIA 2C80A 3FHKA 2NTOA 5KLIC 3GKNA 2H19A 5IMZA 3KZQA 2X8CA 3ZZXA 1F6MC 3G9BA 3M3MA 3A3TA 12GSA 1SJ6A 1PL1A 3ZFBA 2YWMA 3EINA 3L9VA 4MF6A 1I9DA 4RQRA 4ZBBA 19GSA 4I2UA 4BVXA 3CTFA 1K3OA 5FT3A 3LXZA 4KSOA 4QQ7A 2X8GA 3D4TA 3ZMLA 2E74B 2VCZA 1SL0B 2LTKA 2GVPA 3EMPA 1DE2A 18GSA 4KUNA 2H6XA 2GGTA 4WBJA 5ID2A 1U6TA 5IMCA 4MP4A 2H72A 4FIWA 5LD0A 2HFDA 3EWLA 4N0ZA 3IPZA 2RM5A 1FHEA 2DSAA 2WZ9A 4AF2A 4BL7A 1LBKA 1XOBA 2PN8A 2GT5A 4IBPA 4Z7XA 3WT1A 5CRHA 4X1UA 1XW6A 4MF7A 4OFMA 5GAPD 3US3A 1QK8A 3QDNA 4ZL7A 4IS0A 3TOUA 3L78A 2WSEJ 2DIZA 5IOWA 1CQGA 4PURA 2FY6A 4MCUA 2BMXA 3BCIA 5IMAA 1NHYA 1ON4A 4J57E 1ZYEA 3D6IA 3ZVJD 3D4MA 4MF5A 3TJGA 4K2DA 5H5RA 1KEBA 2R3XA 1O7UA 1JHBA 3E0UA 1YEPA 2X99A 4KE3A 1Z6MA 3KMNA 1B4PA 2TIRA 2MZCA 2YV7A 2LV3A 3D5JA 2C1YA 2HNLA 2L5OA 2HRNA 4V1Ap 5IM9A 2H0IA 5JWQB 1K3LA 1K0BA 3KH7A 4DSRA 3O76A 2PVOC 1B8XA 1GLQA 3U5RE 5F06A 3EURA 3K8NA 1A0RP 4O32A 1TK8B 1EEJA 2JZRA 3KJYA 2FWEA 4ULXA 4WR5A 1GSUA 3UVHA 3GURA 3CSJA 1ZOFA 1WRYA 2HSYA 4TR1A 1ERWA 2WDUA 3KMOA 3DRNA 1JZOA 4I5QA 22GSA 1BYEA 3QAVA 1IYIA 2RUEA 3HJOA 2P5RA 4GCIA 2YOIA 2HYXA 3A2VA 1AUCA 3GKMA 4PV1B 1JFUA 6GSXA 5DQYA 5B7CA 2PERA 2O01J 1SL2B 6GSUA 1XBSA 4V2LA 4I2TA 1Q90D 1FOVA 2D2CB 3F9UA 2MBSA 1Z9HA 2K18A 1YZXA 1Z3EA 4GWRA 2DJ1A 4NXIA 2ON5A 3L0HA 1USBA 1O6JA 1PKZA 4HU9A 3ERGA 3WGEA 3TKSA 5IPGA 1OC9A 3EVIA 2QGVA 1G7OA 3DIEA 4IJIA 2WRTA 2F51A 1QUWA 16GSA 5J9CA 1Y25A 3M1GA 1XFLA 1RW1A 3HVVA 5G5EA 2VLTA 1SKRB 3FEUA 4D73A 1A2JA 2O87A 4HOJA 1ZGNA 4P3YB 1WJKA 2FCHA 2E7PA 4MPGA 2XC2A 1SK2A 2I3YA 1X9MB 2B5XA 2E2GA 2KUCA 5EPFA 1XWKA 4YQVA 1F37A 5KKZC 2FA4A 4ACSA 3RHCA 4KSMA 3BCKA 1EOGA 3D0ZA 4EKZA 1XOAA 1THXA 4YQMA 3VK9A 3Q18A 1YDKA 2LRNA 3C1SA 4DEJA 1W89A 1YQ1A 5ECKB 3F4SA 2YZHA 4ML6A 2CZ3A 5COHA 3OR5A 4ZXGA 3DVXA 4PQHA 3IAM2 2YJ7A 3EU3A 2HZFA 2V2GA 5JWOB 3ZVJA 2D2ZA 2I1UA 2VL2A 3MWHA 3H1NA 2B5EA 5F07A 3IAS2 1PX7A 1PL2A 3GX8A 2YWOA 5B8BA 3UAPA 3EU4A 1ZL9A 3GKKA 2VUPA 4G19A 2XPDA 3EYTA 4Y28J 3GTUB 4EDYA 2IMKA 2H30A 4H44B 4NHZA 4GXZA 1O85A 4LLRA 2X8HA 3F3RA 2H01A 4NWYA 3CRTA 2AV4A 3LGCA 4PNGA 2H1AA 2H8LA 3S9FA 1V58A 3LYPA 1SD9A 5ECOB 1A2MA 2IL3A 3FK8A 5LCZA 2Z9SA 3R2QA 5KN1A 3KIJA 3WYWA 2H1DA 4XS1A 5F05A 5G31A 2VM1A 4MH3A 2MMNA 4OO5A 2BTOT 1PQNA 2H1BA 1U3AA 4IP6A 2WFCA 4OCFA 2LKUA 3LYKA 3GMFA 1VF4A 4IKHA 3RHBA 1OKTA 2PPTA 3IOSA 1N8JA 2L5LA 4IW9A 1X5EA 1YKCA 2HI7A 1VF5B 1Q4JA 2F3MA 3PGTA 5HFIA 4PGTA 5ELGA 4PQIA 3BD2A 4TXOB 2L4CA 1OE7A 4OFTA 1QFNA 5G5FA 1G0TA 4X43A 3HDCA 3UVTA 1TU8A 2DBCA 1NHOA 1F3AA 4JRRA 1YKAA 2YPMA 4ZB8A 1PGTA 2FNOA 1R5PA 1T7PB 1PA3A 3ME8A 4MJEA 4KB3A 3RAZA 5GAND 2KP1A 3AY8A 2OE0A 1BAYA 1QGVA 3C71A 4BA7A 1WWJA 3VWXA 4Q5FA 1GSFA 1TRWA 2HSHA 4L5OA 4IP1A 4BPYA 5CP1A 1DSBA 2AAWA 3GKXA 4G9HA 3ZL5A 1WOUA 1SJZA 4ISDA 2H74A 1WIKA 3E3EA 5B8AA 2P31A 4V1Ag 5D9TA 1A8LA 4RI6A 1FG4A 2HXKA 1MDKA 2VL3A 5D93A 1GUHA 1NM3A 2H75A 4EL1A 3CXGA 4IN0A 1Q98A 2E75B 1XVWA 4OCEA 3TUEA 3IE3A 1B48A 3TRQA 4E8HA 5HQPA 3CMIA 2IJYA 3UOMA 1AXDA 6GSSA 4XS4A 1UA5A 3QPMA 4HQZA 5D9WA 4L5LA 2QIWA 2GS3A 4I6XA 3UL3A 2B1KA 3C1RA 1V9WA 3GSSA 4XCSA 4K7NA 4IL6X 4F0CA 2IFQA 5ID2B 3I6AA 2CV4A 4MABA 3TJBA 3H8QA 2JADA 4HQSA 1GSYA 5L8RJ 4POKA 1GTAA 4TR0A 2K6VA 4WF5A 3QAWA 3ZLPA 3F4TA 4OO4A 4HS1A 3IC4A 1T4YA 2CX4A 3WT2A 1M99A 4K8MA 3KP8A 2AHEA 1K0OA 1F3BA 4XIHA 1BEDA 2MBTA 1GRXA 2HZEA 3LW5J 4XRDA 1I5GA 1U88A 1TP9A 4EC0A 3GSTA 2LQQA 2GSRA 2GZYA 3CTGA 3WGXA 5AGYA 5ENUA 2C8UA 3MAKA 4L8EA 4H13B 1THOA 3FZ5A 2CQ9A 3BOAA 4JBBA 4POBA 2JSZA 1V40A 4HZ2A 3HXSA 5E4WA 2LRTA 2OACA 5JWRB 2OE1A 1V57A 3RPNA 1RK4A 1T00A 3C8VA 2P5QA 1OKDA 4TR3A 14GSA 2B7JA 2HLSA 1YY7A 2YANA 5DVBA 5IO2A 4PQ1A 4WEYA 3VI7A 4NAXA 2MMZA 1JZDA 3F63A 7GSSA 2IMFA 4POLA 1WPIA 2KOKA 2V6KA 1X9SB 3QMXA 1VRSD 3TJFA 2NDOA 1SKSB 4LA1A 2DJ3A 2YV9A 2WJUA 1XWGA 4GSSA 5G2ZA 5LNKe 2L57A 4XS6A 1GSDA 1BX9A 3UBLA 3C73A 3RPPA 1XW5A 5D8IA 5ABRA 3KCMA 5CYYA 3VLNA 1YF0A 4HU7A 5CNWA 2WSCJ 5ECSA 4LMWA 3ISOA 4MMMA 1X0RA 2C3TA 2VLVA 2R37A 1TU7A 1F2EA 5J41A 3IV4A 4POMA 6GSYA 1WP0A 4WXTA 4N11A 2YNXA 5DALA 1TI3A 3HZ4A 1OC9B 4YAPA 1ZRTE 2AUVA 3GH6A 3GFKA 5ECQB 3FY7A 3FZ9A 1XPVA 5IQYA 5F8BA 1M0UA 2GSQA 2CA8A 2VL9A 4OGQB 1XWBA 1OYJA
chains in the Genus database with same CATH superfamily
3DXBA 1SQXG 2A45I 4MZWA 2NPSD 2M3BA 3M06A 1EWXA 4IL6H 3E7KA 4K7OA 4NV2A 4EXJA 1YIJP 1VQ6P 1BDDA 4FO5A 3W67A 1P84I 1T3UA 1EGOA 1S5LH 2DJ2A 5L71A 3JCML 2QSIA 3TOTA 1HNBA 2OYIB 1TTZA 3UJ1A 2IPAA 1JZWA 1Q7YQ 2MMAA 1GLPA 2XNDH 3TKPA 1KQLA 2JR8A 3IAOA 1NOHA 4B86A 1KILD 1BSNA 2N5AA 2BCCD 3CCUP 1LTIC 3R2PA 1JLVA 2C3QA 3F6DA 4WKWA 2CVKA 5IOXA 3CQFA 1KN7A 4FYCA 4PNFA 3KH9A 1K73Q 4DT0A 4KGIA 4MPFA 2J9HA 3GN3A 1S3CA 1EC5A 2C0GA 3H1LG 2LJKA 1S5LE 1IFMA 3H1ID 3IK7A 4PD4I 1FOSF 3O6TA 5A4UA 3RDWA 1VF3A 1SQVK 1USEA 2OA7A 4F9ZA 5DJMA 2AB6A 2XV5A 5G30A 4H44C 1N73B 2OYHC 4V2NA 2N1TC 1M7LA 3KDPB 4D6TD 1TK0B 3V2RA 1URMA 3H4KA 5H5QA 4BWSA 5J3RA 1SENA 3FGAD 1IK9A 3A5WA 1QEXA 1XVQA 2R5GA 2O89A 3AEEC 2QC7A 3TRXA 4WWIA 3AE9C 1BGYD 3V2PA 2G2QA 4JQ0D 2KP2A 2IYPA 2DMLA 1EZKA 2YN1A 1T3BA 3C8EA 4ZBAA 4WY4C 2MMOA 4KW6A 2R3CA 4BRYB 1GH2A 1LTJA 1GL8A 1M9BA 1UVZA 4LC1A 2Z5HA 2EIOA 2XBQA 3ZREA 3CWBG 4UB6H 5KLVG 4O5RA 3B5NA 1N7SA 4C7NB 3P8WA 1YTZI 4N30A 1ZXGA 3LQ7A 4WB4A 4EVMA 1FE6A 2GQKA 5BU5A 2NPBA 3VWVA 1YQ4C 1R4WA 2A45G 3P8CE 4N78D 1SLQA 1HQOA 3TB2A 5IMVA 1JTHB 1UIIA 4WVZA 3PH9A 3AE1C 4EDZA 3HUSA 5AVZB 2FYNC 3P7KA 2OE3A 4L0WA 2V7QJ 1TOFA 1Z56A 2K9YA 3UIAA 1PKWA 4XA4A 4G10A 1R5LA 3E1IA 3TNUA 1Q81Q 4Q5RA 3U6VA 4UB6E 1GP1A 4HYTB 4N0VA 3VURA 1O81A 1BG5A 3H79A 4KDYA 3VI5A 2QVAA 2Y0CA 1BQ7A 1EOHA 3GF7A 4HEA2 4TW5A 2W8ZA 3EMXA 4AJ8A 13GSA 2P67A 3HKRA 3FR9A 3BCCE 2H76A 1V98A 6GSVA 3L75J 4IGJA 5CCGC 1G6YA 2NBSA 1G7EA 4H86A 4K6XA 1AIUA 4AGSA 1MD4A 3CI9A 1SK0A 2WULA 2N9BA 2AEJA 1GTBA 1PGPA 5HFKA 3LSZA 1OIPA 1Q82Q 1YYCA 1KMIZ 2K9JA 4DSSA 1EDLA 2YIUC 2M46A 3M8NA 3G7JA 1XIYA 4DSQA 1GL2D 1Y47A 2O7KA 3H32A 1KNGA 1GTIA 5KJ7A 3HY2A 5HR1A 4TR4A 1PSQA 1SK1A 4OD7A 3L73G 1KORA 2Q1KA 3TSIA 1T4ZA 1PP9J 3L74E 1X5CA 2CPSA 4TLFA 4KT0J 4AQRD 2FWGA 3H1JG 2C4JA 1WT6A 5DJUB 2C0FA 2PGTA 2RKLA 2E2MA 2M0BA 2YO2A 1IO4A 1GD2E 1NTMG 2FA8A 2ZYGA 2OJLA 4FYUA 3ABVC 4WETA 2H71A 4U3FG 1NTZG 5C04A 5APYA 2CPBA 2FYUG 1FZCB 2E75C 1SQPJ 1EGRA 1KYOH 2A06G 3PRJA 4NV5A 4LL1B 1FAAA 3HE4A 3P8MC 2FKWB 4K35A 4ILFA 4NMUA 2DKIA 1VGLA 1R7HA 3TDGA 3VN0A 2CVBA 2VD0A 2LUSA 3IRAA 1L0NJ 2O1KA 3AECC 3ME7A 1ZCPA 3TGUG 1DBYA 2KUBA 2Z5IA 3HTKA 1YHQP 1SQXE 2IDBA 4I7ZB 2VCTA 4X0XA 1FZEA 2OYOA 1N2AA 2JJLA 1B9YC 4N10A 4IELA 1EZVI 1ZW0A 3E9JB 3HD7C 1HD2A 3MD0A 1B4QA 2FHEA 2NPSA 3O3TA 4YH2A 1GK6A 2E5TA 1KYOE 2E5YA 4F2IA 3LG6A 1ZV8A 3OAKA 4XFJA 3L75D 1PMTA 2GZZA 4K5SA 1JNMA 3CC7P 1GK4A 3RK3C 4O92A 5D9XA 1KFNA 1XWCA 2YMYA 2FLSA 2TRXA 3A0HE 3HE5A 1OC8A 3F0IA 3LFLA 4JF7A 3L72G 2CAQA 4XS4B 1E6BA 3H1KJ 3ZFLA 3GNJA 2L5GB 4IJ3A 5INYA 1USDA 3EFFK 3CYNA 2I81A 1KILA 1T8ZA 3Q5RA 1LP1A 1MDJA 2YP6A 5HR3A 3F4RA 3KM6A 1H0TA 1PP9D 2JACA 3GV1A 5AVRB 2LS5A 4ZBDA 3MSZA 3ZTLA 1ZYQB 1HNAA 2ON7A 2R3SA 1UN2A 3H1LE 2XPEA 2XU6A 1EEMA 4Y99B 2DJKA 4MJBA 3PTZA 2UZ8A 3Q6OA 3USSA 3L9UA 2LJAA 4ZL8A 3RK2C 4Z2TA 4HUAA 3Q74A 1Z7PA 2B9BA 1RF1B 2LSTA 3M0DC 2FXPA 1TJDA 5DJLA 4HJ2A 2HFED 4YQUA 5ECPB 3DWVA 3BJ5A 1SQPD 1CZQA 2KSJA 3HZ8A 2KZJA 3SWYA 2ZT9B 4XHMA 1PPJD 2ZCTA 17GSA 1PX6A 1H89A 1GNWA 1M1JB 3DEXA 1KTEA 1ML6A 2A45H 2WPQA 2P7JA 5TISH 3A2WA 2RUFA 4YKFA 1JCCA 1WE0A 2H89C 1L0ND 4RUVA 2QKEA 2EIRA 5DCGA 2P2UA 2L59A 3DVWA 4DJGA 4ECBA 1E5WA 3KTBA 5AVVB 5D96A 1G1JA 2HZEB 1SU9A 1WMJA 1P84H 2REMA 2IPPA 3D21A 1L4AD 1RF0C 2HYNA 4Z1MH 1B9XC 3CWBE 4ZNCA 5APUA 5KLVE 4ZL9A 1QXHA 5FWGA 2OBIA 1HYUA 2YJHA 1MV8A 4GF0A 2QM7A 1MD3A 5KN2A 2E42A 1IZNB 1H4OA 3VPTA 3IBHA 2WWWA 1NW2A 2AEFA 2TRCP 1SYRA 3HA9A 5E59A 2C0WA 4CHSA 3LJRA 1F9MA 2K88A 1KB9I 3I9V2 1LJRA 2H6ZA 2WSFH 5AW4B 1EZVG 3D22A 4KX4A 3IK9A 1YBKA 1FB6A 2XNXA 1NU1G 4GSTA 3H1KD 1NTKE 4N6JA 1L0LJ 2YWNA 1P84E 4Z2UA 1J1DB 3KP9A 1Y8AA 5CJ0A 1K3YA 4PD4H 4PTSA 4W7YA 4YXDC 5BMUA 5EY6A 1JMBA 5CCHD 3RK3E 3IFMA 1IFDA 2PWJA 1XZOA 3P2AA 4AYCA 1AV1A 1D7MA 1X8YA 3L73D 1QMVA 3KQGA 2DJJA 1A0FA 2A4VA 5IMDA 1OZHA 1PGJA 4F03A 1BE3J 3GTUA 2KXPB 1Z5YE 3VP8A 2OYHA 1EXIA 2N1TA 1E79H 1JMMA 2HRFA 3ERFA 4FYBA 4JEDA 3PR8A 3QFBC 1DH3A 2Q3IA 4EDFA 2M3EA 1DEEG 2OTJP 4PD4E 1ERUA 2M72A 4WBAA 5J5NA 1ABAA 2DC5A 3DD3A 3GUSA 1LT1A 1ZMAA 2NRGA 1GL2A 3N9JA 1C72A 2POHA 2R2JA 3RL0B 3FYGA 2VOCA 3G4SP 3AE8C 2ES7A 4IOIH 1S5LX 1KV4A 2JZSA 4YTPC 3MUDC 3H1JE 3RBXA 3NOFA 3LWAA 1J1EB 2L4QA 2A2SA 4EO3A 2KLUA 1Z6NA 3GX0A 4O7HA 3APSA 4MJAA 4F82A 3SWFA 5CRGA 1NTME 1YF1A 1MTCA 5CREA 1AQ5A 1NTZE 5AVYB 1RE3C 5J9BA 3RL0g 3CL3D 1T1VA 2FYUE 5AIVA 1FB0A 1VF2A 2A06E 2WSSH 4EF0A 2E74D 3W8SA 3T97B 1OVNA 1PD21 4HB1A 5FHIA 2JSYA 1LT9B 1AQTA 1NAFA 2IMDA 4C7RA 1IYHA 4IQ1A 3FX0A 2C0EA 1GZLA 1L0LD 4EIJA 1IC2A 3DGQA 1FW1A 2O8VB 2WPVB 4OGQC 2H73A 1O73A 1HGVA 4TXOA 4GLTA 2VCXA 5GSTA 3ZDMA 2RM6A 1VQLP 4IVFA 4G2EA 1URQB 6GSWA 4GIFA 4GTUA 4YAVA 1W2BO 2NVLA 4JR6A 1SP4A 1T8EB 1S3AA 1V2AA 4HJMA 3WUVA 1EV4A 2ALBA 2FWFA 1BE3D 4KCEA 1QL1A 4H0LB 5CCGA 3SSUA 1YQ3C 1SQPK 4ASWA 2OYIC 4CW9A 1BCCG 3L72E 2QG4A 3HVSA 2QJYB 3CMEP 1N7SD 5KN3A 2AYTA 1SQQJ 4TN8A 3LORA 1L0NK 1GNEA 1U3IA 2H70A 1FDOA 4HSCX 3A2XA 3WUUA 4M3LA 2B1LA 2J23A 4WF4A 3A0BH 5AVUB 3LW9A 2KYVA 1XG8A 1TXXA 4GOEA 3OJAB 3TCOA 2XKMA 2E76B 4HH2A 1UIXA 4EE0A 2JZTA 3GIXA 4TRXA 3CX5I 3EE2A 1HBWA 2ZNMA 1N73C 3Q5PA 1U87A 2VL2C 3ED3A 3KXOA 4LMVA 2C3NA 1YJWP 3I43A 4TR1B 1GUKA 3TJKA 5CAXA 1NHLA 5CRDA 3GHGB 2OARA 2Q7CA 4ZKPA 2IIYA 4K0GA 1QVGO 4RQXA 1Y6EA 3LIEA 1O8XA 1M2DA 2JL4A 3WMM0 3A0BE 3RBTA 2LRCA 2DJ0A 1NKZB 4OFNA 4JZQA 1TRVA 2QJPB 5G1KA 5DAKA 5AN1A 5ECIB 4HKZH 4J2FA 3AE6C 1XW9A 1S9KD 1SQVE 1X22A 4EIQA 3TKSE 2H0HA 2PGDA 1OAZA 2M80A 5H5SA 2LJRA 20GSA 4PUAA 2GUSA 4NPDA 3CD6P 5KJ7D 5ECNB 3HYPA 3IA1A 2WCIA 3G7YA 2F8FA 1AQWA 3NTNA 1Q86Q 4JU5A 1FVJA 3PH0A 4C46A 3CCVP 1K8AQ 3GYKA 2LNTA 2B7KA 5AW8B 2CVDA 5EL8A 1EZVE 1EP8A 1NU1E 1ZRTD 1GULA 2W27A 1GSQA 1IK7A 3WGDA 1LTJB 3KEBA 1HF9A 2RIIA 1U57A 1SQQD 2QA2A 4KAEA 5KN0A 2C9LY 3QFAC 2PVQA 4LL4B 5ECHB 2I1JA 2Q6QA 3B5NB 3L71J 5IIZA 4WR4A 4TVEA 5AIXA 1JO5A 4XTSA 3QAGA 1S3JA 2WPRA 6GSTA 1M56D 3L4NA 2IBZE 3KYQA 1DUGA 10GSA 5HR0A 3L70G 4AJ6A 1YTZT 1LU4A 3S1KA 1O8WA 1YJ6A 4K2XA 4L0UA 4PV1D 3IHQA 3V1WA 2C0DA 1N7LA 3M0DA 5JCWA 5B6NA 1FS0E 3HUSB 1TRSA 2KNCA 1VQNP 4MZCA 1K0AA 3AEFC 1JY2P 3M9JA 1MFTA 1X9VA 2PU9C 3TNUB 4Q5NA 2HT9A 4K0NA 1JZRA 2H6YA 2D2CD 1SQBG 2H0GA 1L0LK 3AEGC 1RE4C 3MTUE 1AQXA 4D73B 1AA0A 1VQMP 3BASA 5CHXA 4MN4C 2R6KA 2E0QA 1ST9A 3ZRDA 1JCDA 2BJXA 2CT6A 1QQ2A 3M9HA 3KGKA 4IFMA 4DVCA 1AVYA 1RF0A 2WS2A 2YCDA 1KB9H 2N5BA 4NHWA 2I9HA 2OKAA 4KDUA 2WTYA 4ZB6A 3KTLA 2B5YA 1J0FA 3BCCJ 1QVFO 2L6CA 4PX1A 1M3IA 2G3AA 2FUG2 5DDLA 1ERTA 3DMLA 1R26A 2K9JB 1FOHA 4DSSB 3ZYWA 4MK3A 2IN3A 5KLIB 3V2QA 4KDXA 3TRPA 2RMZA 2QEXP 4E8EA 3PINA 3TJJA 2W83C 2H66A 3CCEP 5GTIH 2B89A 3P90A 1VQPP 1DE1A 1DD3A 3GHAA 5JCUA 3CCLP 3FWNA 3V2NA 3FMWA 2O85A 1A23A 2WSEH 1KB9E 3L74J 2HR3A 2G0FA 2ZXXA 2V32A 3CLQA 4KCAA 3L71D 4I7ZC 2FD3A 4NPBA 2OQQA 3HD5A 3V5BA 1SFCB 1FZFA 2L6DA 3TGZA 3IXRA 2GSSA 2PFXA 3SBCA 3L9SA 4ICYA 1J9BA 4MNNA 3Q19A 1RY3A 4JR4A 3IN6A 5GTIE 3FZAA 4RI7A 2GA1A 3IR4A 3HCZA 2V6OA 3P8CD 5DJTB 1BCCE 5A4VA 1HNCA 5KEJA 2Q9IA 1LJ2A 1GSSA 3FW2A 2KSEA 2FWHA 3HTKB 3TK1A 1GSEA 4PJ0H 2F8AA 4Q5QA 1J2JB 1TK5B 2X4AA 2VIMA 1SQXJ 4DZOA 2A2RA 3TKRA 2NPSB 3LEFA 4J56E 4MH2A 5IMFA 3CCQP 1M9AA 4Y99C 3M9KA 2YZUA 4O5QA 1M7TA 3KD0A 2IX7C 1VQ5P 2VAFA 3PPUA 2V41A 3BCCD 4KA0A 3CRUA 1ACVA 2ZUPA 4HDEA 1R5AA 1RF1C 3UMAA 3HE5B 1NTKG 1VF5C 2ITAA 4AJ7A 1G6WA 2ZT9C 1K0NA 3APOA 5C00A 4PJ0E 3N5OA 3ZIJA 2FXMA 2EIQA 1KILB 1M1JC 1LP1B 3MYDA 3O6QA 2PRRA 2IWTA 1GUMA 2Y9YA 5CRWA 1H0TB 4GQCA 5ECLB 4OWYA 3M9BA 2GDRA 4K9ZA 1SQQK 2WQYC 5IO0A 1JEKA 3CCRP 3CC4P 4F0BA 1NO4A 4H44D 2N1TD 3L74D 1XWAA 3AE3C 5EVOA 2BEZF 3H1LJ 4DCKA 1M2BA 1SD8A 2DW3A 3M91A 2O3JA 4ML1A 5B6MA 3QR6A 1A2LA 1X0TA 3QCPA 5D9VA 5M1BA 1M2AA 4IFFA 1NH4A 4ZILA 4W7ZA 4AUWA 3P7XA 4ECJA 2M5AA 2Y0EA 2I1KA 4WY4D 2QJKC 1S3RA 1WRGA 3BRVB 4MA9A 2OYIA 2JWAA 4L75A 5ECRB 2GZPA 2O01H 1HH0A 1SKWB 3FR3A 2P58A 2A4HA 2DKHA 1J1DC 1W5CE 4CDOA 3BRTB 2MYGA 5E79H 2PBJA 1HJBA 3UARA 1A02J 1SL1B 1AJYA 5F0GA 2WITA 1TKDB 2MJZA 1EP7A 3A5TA 1J08A 4UB8E 1SQXD 2GTUA 3SFEC 3W68A 3CWBJ 5KLVJ 2CK3H 1Y9BA 1KQFB 1JY3P 1MEKA 4KF9A 5J4UA 1ZLLA 1RQMA 2FGXA 3L70E 5ECMB 1KYOD 4HZ4A 3CXHE 1VF5D 1KBNA 2LXBA 2KHPA 1KQGB 3GF3A 3ZIVA 3EFGA 1N73A 3APQA 3J7Yb 2OADA 1CQHA 2GQLA 3A0HH 2HRAA 2N9YB 2VLUA 3VWWA 2GLRA 3H93A 2LNSA 2AXTH 2V1MA 3MNGA 2H8PD 5E79E 1JY2O 1PGOA 3HHVA 1FVKA 2YNYA 3CX5E 2DMMA 1PRXA 1SQBE 4MJCA 1GW4A 3TKQA 2CZ2A 4KJMA 3RL0C 3BVHA 1LTBC 1ILOA 2XHFA 2DIYA 5CCGD 2WT7A 3ERWA 2CAIA 4CPGA 4BRYA 3DKSA 3G9RA 1N2DC 4WBRD 3VWUA 1J1EC 4I1LA 3H1LD 4CY6A 1TW9A 1AW9A 2OYHB 4ZIJA 3U1AA 1U7JA 3AEAC 2J59M 3ITKA 2WSFJ 3L35A 5HR2A 3WD6A 2AXTE 5DQSA 3SFDC 2IBZI 1DEBA 1X9WB 3AEDC 3HRNA 3UEMA 11GSA 1EDJA 2VM2A 4BVYA 3W8JA 2K8VA 2RN0A 2R44A 3GA4A 3GL3A 2K9FA 2IFQB 1GL2B 1UC7A 2OTLP 1JTHA 3F3QA 5AW9B 1LT9C 2WZ7A 1FOSE 2VCWA 5HFGA 1AQVA 1K0MA 4EIPA 4MLYA 3H1HG 4V2MA 3L73J 4MDCA 2JP3A 4ID0A 3D6YA 2VRSA 1LTSC 5AVQB 3A3YB 1A24A 1S1CX 2YXQB 2RH0A 3H1JJ 3F6FA 2E75D 1NWQA 2WB9A 3UIWA 1JLWA 3CSIA 1URQC 3CWBD 5KLVD 2B6MA 2G8YA 3HVXA 1NTMJ 2LEGA 3MP7B 3GL5A 2X64A 2JEEA 3CBUA 4BWQA 4TKYA 1K0CA 4U3FJ 1NTZJ 1KC8Q 1VDFA 4XRAA 2BEQD 5AISA 2FYUJ 2YWIA 1PZQA 4QL9A 1TDIA 4I8BA 4R4MA 1VF1A 3C1LA 1VQOP 3UBKA 4QL7A 4H13C 3W6GA 1E2YA 4TT3H 5APTA 1ZZYA 2QJYC 1SYXA 3HD7D 3G7IA 1SQVG 3IDVA 2GQMA 1EXJA 2VD1A 1VPCA 1NTKD 1ERVA 1CSBA 1P84D 1M90Q 3FWLA 3TGUJ 4ZB9A 2GSTA 1RE4A 2RLIA 4PXOA 1GWCA 1PN9A 3AE4C 3RK3D 1X5DA 2F9SA 2DLXA 2H1GA 2IMIA 3QOUA 3NIVA 3VPQA 5GSSA 8GSSA 2OTKE 1S3DA 2VCVA 1EDIA 3CSHA 2B87B 3HJMA 3ZMKA 1AAZA 2E76C 2HPCA 3DYRA 5CO3A 3ZITA 1BJXA 4K7IA 2EC4A 5KKZB 4K1FA 1MDIA 1OWAA 4NPFX 2PAJA 3AEBC 3M9QA 3IHGA 1EV9A 1VQKP 2PMTA 4GQFA 1LWUC 3BBYA 4EUYA 3M0FA 2YIUB 3JSVC 3GHGC 3L72J 4PD4D 1H75A 1M1KQ 2IMEA 2HE3A 3F8UA 3GH9A 5AVXB 2OBKA 5ELAA 4ECIA 9GSSA 3BATA 2IBZG 3RK2D 1OE8A 2QJPC 4ZMDA 3R4YA 2VO4A 1GDTA 2JKVA 3A7OA 1JB0J 2FYZA 1SQXK 1XXUA 3H1JD 1VQ4P 1NSWA 3QD9A 4GSNA 3J7Yk 2IFMA 2CX3A 1NTMD 5KTBA 1EQ7A 3HJPA 1X79B 5APVA 5GZZB 4FH8A 2KLVA 1TRUA 1Z7RA 4U3FD 1NTZD 5DCHA 3I5CA 4JYCA 3I69A 2FYUD 3MDKA 1MFZA 4H13D 3PLNA 3SWLA 3IF4A 4BIKA 2A06D 2LQOA 3C9IA 3E1RA 1TI1A 5A4WA 4JE1A 4WY4A 3FZ4A 1FBMA 2KLXA 4OMVA 1LNQA 3C7MA 4TOPA 3KPEA 4GDOA 1U7MA 3GRXA 2PUKC 5DAKB 5G1LA 1LTJC 1GTUA 3MIXA 4ECCA 2JU5A 3NZNA 2NZ2A 3JCUE 3O8ZA 4PUFC 3TGUD 4HI7A 2B3SA 3VFIA 1OVVA 5TJHA 1L4AB 4GRFA 4KNDA 4OH8B 4KH7A 2JWDA 2R4VA 3S9OA 1OC3A 2SPZA 5AVSB 4RJTA 3TKSC 5A5KA 2R0PA 2FFDC 1JY3O 4I97A 3QH9A 3EC3A 4IQAA 2I4AA 3HUSC 5DBQA 1NU1J 1XCCA 1GU5A 3FKFA 2AJQB 3L72D 1M1JA 3FR6A 3VOPA 4IHUA 1RHZB 1W4VA 4TXVA 2HODA 2VCQA 1OXZA 2P0GA 5DALB 1ZYPA 2GT6A 5AW1B 5BU8B 4U7JA 5IPHA 2K8SA 3FRCA 5JCGA 1SJIA 4RKUJ 2WGRA 1HVVA 5KLVK 4MZBA 2BCCG 1RH5B 2Z4EA 3LXTA 1K0DA 2N5FA 1AC1A 1FO5A 1A8YA 2KNCB 1H88A 3U59A 3NXSA 1YEXA 2R0CA 2XBIA 5D73A 3N4XA 3NFQA 2C80A 3VMYA 3FHKA 2NTOA 1PFIA 5KLIC 4G0IA 3GKNA 3WU2H 3CXHI 2H19A 5IMZA 3KZQA 2X8CA 2KS1A 3ZZXA 3H1IG 1F6MC 3II6A 3MHVA 3G9BA 3M3MA 3H1HE 3A3TA 12GSA 1SJ6A 3EQ2A 1PL1A 3ZFBA 4JYBA 4D6TG 3MGNA 2YWMA 3EINA 3L9VA 2KI7B 4MF6A 1I9DA 5AW3B 4RQRA 4ZBBA 19GSA 1SQVD 1SFCC 4I2UA 2I8DA 4BVXA 3CTFA 1BGYG 1K3OA 5FT3A 3LXZA 2KOGA 4HJGH 3WU2E 3CCJP 4KSOA 4QQ7A 2X8GA 3D4TA 3ZMLA 2E74B 2VCZA 3D6ZA 1SL0B 2AEMA 2LTKA 4OGQD 1G2CA 2GVPA 3EMPA 1EZVD 3L36A 1NU1D 1JY2N 1DE2A 18GSA 4KUNA 2H6XA 4A7PA 1G1IA 2ZAEB 3HD7A 2GGTA 1TU3F 4WBJA 5ID2A 1U6TA 5IMCA 4MP4A 3D71A 2H72A 1M3JA 1PIXA 3LW5H 4FIWA 5LD0A 2NPSC 2HFDA 2H43A 3EWLA 1ZN5A 3QWOC 1IFNA 2P1JA 4N0ZA 3IPZA 2RM5A 1LTAC 1FHEA 3AE5C 2DSAA 1QX8A 2WZ9A 1NTMK 4AF2A 4BL7A 1LBKA 1XOBA 2PN8A 1FC2C 2GT5A 4IBPA 4Z7XA 1FDMA 1NTZK 3WT1A 5CRHA 4X1UA 1XW6A 4MF7A 2KIKA 1OVRA 2FYUK 3KXDA 4OFMA 3GG2A 2HRKA 5GAPD 3US3A 1QK8A 3QDNA 4ZL7A 4IS0A 3TOUA 1BCCJ 3L78A 4BWNA 2C9NY 4YPCA 1N7SB 2WSEJ 2DIZA 5IOWA 1CQGA 1T2KC 1PN0A 4PURA 2FY6A 4MCUA 2BMXA 1LT9A 3BCIA 5IMAA 1NHYA 1ON4A 4L74A 4J57E 1ZYEA 3D6IA 3ZVJD 5APQA 3I55P 3D4MA 4JBZA 5C39A 4MF5A 3TJGA 4K2DA 1KD1Q 1OVUA 5H5RA 3G3ZA 1KEBA 2BASA 2R3XA 1O7UA 1URQA 1JHBA 2KK7A 3E0UA 1YEPA 2X99A 4KE3A 1Z6MA 2Y9ZA 3KMNA 3KZIH 1OMIA 4K3AA 5BVZA 1B4PA 2TIRA 5B5EE 2MZCA 2YV7A 3CCSP 1VQ8P 3O6QB 2LV3A 3D5JA 2C1YA 1HUCA 2HNLA 2L5OA 2HRNA 1IJDB 4V1Ap 5IM9A 3Q5SA 2H0IA 3GW6A 5JWQB 1Q2NA 1K3LA 1K0BA 3KH7A 1KB9D 3O76A 4DSRA 2PVOC 1SS1A 1T6AA 1FZCC 1B8XA 1GLQA 3KZIE 3U5RE 5F06A 3H32B 2R32A 2HG5D 3EURA 3K8NA 2M5AB 1A0RP 4I2LC 3FXEA 4O32A 5CMZA 1HWTC 1TK8B 1EEJA 2JZRA 3KJYA 2FWEA 4ULXA 4WR5A 1GSUA 3UVHA 4G0LA 2JO1A 3GURA 3CSJA 1ZOFA 1WRYA 2HSYA 1LWUA 4TR1A 1ERWA 4ASVA 2QA4P 1BCCD 1T2KD 2WDUA 3KMOA 2HLOA 5AW6B 3GHGA 4BXLA 3Q3DA 1ZR2A 3L37A 4IL6E 3DRNA 1JZOA 5KAFH 3TDKA 3L75G 4I5QA 2WSCH 1EDKA 3GLMA 22GSA 3B71A 5GTHH 4EI2A 3VMXA 1BYEA 3QAVA 1XTCC 1IYIA 4N3YB 5AW0B 2RUEA 3HE4B 3HJOA 2Q3EA 1ZP0C 1VQ9P 2P5RA 1KILE 4GCIA 2YOIA 2BCCE 2HYXA 3A2VA 3U1CA 1AUCA 3GKMA 3L70J 2IYOA 4PV1B 1JFUA 3S4RA 6GSXA 2WPSA 5DQYA 1PP9G 5B7CA 4JPZB 1ZMEC 2O01J 2PERA 1SL2B 4GODA 6GSUA 4FQUA 5KAFE 2WVRA 3H1IE 1XBSA 1GL2C 4V2LA 4EYYQ 4I2TA 1NU1K 1Q90D 1FOVA 5GTHE 2D2CB 3MUDA 1R8EA 1SQBJ 3F9UA 2WT7B 3EPTA 3OA7A 2MBSA 1Z9HA 3L71E 2K18A 1PL5A 1FDIA 1AVOA 1M57D 1NAYA 1T3JA 3EWKA 4D6TE 1CI6A 2E43A 1YZXA 3LIDA 1A02F 1Z3EA 2DJ1A 4GWRA 2ON5A 4NXIA 3L0HA 1SQPG 2H7HA 3V4QA 2AXCA 1OFCX 1PPJG 1USBA 1RE3A 1O6JA 1PKZA 2GM4A 4HU9A 1BGYE 3ERGA 2YXRB 3WGEA 1JY3N 3TKSA 4BVYB 5IPGA 1M8OB 2FFDA 1L0NG 1OC9A 3EVIA 2QGVA 1G7OA 3DIEA 3HVNA 4IJIA 2WRTA 3F5HA 2F51A 1QUWA 16GSA 1S72P 3B4SA 5J9CA 1Y25A 3M1GA 2KP8A 2LXCB 1XFLA 1RW1A 1R5SA 3HVVA 5G5EA 4A5PA 2VLTA 1SKRB 2W90A 4CY8A 1FU1A 3FEUA 4UB8H 5KAIH 4D73A 2QE7H 4I6MC 1A2JA 2O87A 1FZBA 4HOJA 2K37A 4N78E 1ZGNA 4P3YB 1WJKA 2FCHA 5AW7B 1ZYNA 1GTWA 2E7PA 4MPGA 2XC2A 1SK2A 2I3YA 1JOCA 1X9MB 2B5XA 3CXHH 3H1KG 1W2EA 2A2PA 2E2GA 2KUCA 5EPFA 1XWKA 4YQVA 3L70D 5KKZC 1F37A 2FA4A 4ACSA 3CXHD 2Y0DA 4KSMA 3RHCA 3BCKA 1EOGA 3D0ZA 4EKZA 1XOAA 1THXA 4YQMA 3VK9A 2OGUA 1N86A 1OW7A 3Q18A 4O9BA 1YDKA 2LRNA 2QRXA 3CX5H 3VMZA 3C1SA 4DEJA 5KAIE 1W89A 5AVWB 2FXOA 1YQ1A 3L4FA 5ECKB 3F4SA 3CX5D 2YZHA 1SQBD 2FY8A 4ML6A 2CZ3A 1MKMA 3RGUA 1NGMB 5COHA 5B66H 3OR5A 3CPWO 4ZXGA 3DVXA 4PQHA 3G71P 3IAM2 3D70A 2YJ7A 3EU3A 1NVOA 2C0XA 2J5UA 2HZFA 2V2GA 4IFDK 5JWOB 2HPCB 3ZVJA 2MKVA 2D2ZA 2JDIH 2I1UA 2VL2A 2ZT9D 1PFOA 3MWHA 1SFCA 3P32A 3H1NA 2YKQA 1MZ9A 1AFOA 2GUVA 1HJ0A 1NTKJ 2B5EA 5F07A 3IAS2 1PX7A 1PL2A 2V7QH 3GX8A 1KZUB 4RESB 1DX7A 5B66E 2YWOA 5B8BA 3UAPA 3EU4A 1ZL9A 3GKKA 2VUPA 5CJ4A 4G19A 2XPDA 3EYTA 1NKNA 2LR2A 4Y28J 3GTUB 4EDYA 2IZ0A 2IMKA 2H30A 4H44B 1H8AA 4NHZA 2N1TB 4C7NA 4GXZA 1O85A 4LLRA 1HGZA 1L4AC 2X8HA 3F3RA 2UWJE 1GMJA 2H01A 4NWYA 3CRTA 2AV4A 3LGCA 4PNGA 4L76A 1IFJA 1L0LG 3TF5A 2H1AA 2H8LA 5KOWA 3S9FA 1V58A 3LYPA 2YKPA 1KQSO 1SD9A 5APWA 4WY4B 5ECOB 1A2MA 2IL3A 3FK8A 5LCZA 2Z9SA 3R2QA 5KN1A 3KIJA 3WUTA 4R4LA 3WYWA 2H1DA 5BRTA 1ZOYC 4XS1A 5F05A 5G31A 1NJIQ 2VM1A 4MH3A 2MMNA 4OO5A 1MUUA 2BTOT 3AE7C 1PQNA 1K9MQ 2H1BA 1U3AA 4IP6A 2WFCA 4OCFA 1CW5A 2LKUA 3L75E 3LYKA 3GMFA 1VF4A 1BE3G 5CCHC 3B8EB 4IKHA 3RHBA 1OKTA 1QL2A 2PPTA 3IOSA 1N8JA 3Q1MA 2L5LA 4IW9A 4H0LC 1X5EA 3PJSK 1QGKB 3IR9A 1YKCA 2HI7A 2FYNB 2YMKA 4OWFA 1VF5B 1Q4JA 2F3MA 3PGTA 2PP6A 3VTPC 5HFIA 1PP9E 4PGTA 5ELGA 3RL0D 4L73A 4PQIA 3BD2A 4EOTA 4TXOB 2L4CA 1OE7A 4OFTA 4DOJA 2O1JA 1QFNA 2XZRA 4O5UA 5G5FA 2J58A 1G0TA 4X43A 2HODB 3HDCA 3UVTA 1TU8A 2DBCA 1NHOA 1F3AA 2B88A 4JRRA 1K05A 1YKAA 4YXWH 3F89A 2YPMA 4ZB8A 1PV3A 2W6JH 1PGTA 2FNOA 1R5PA 1T7PB 1PA3A 3ME8A 2W6AA 4MJEA 1SQPE 4KB3A 3RAZA 5GAND 1PPJE 2KP1A 3AY8A 2OE0A 1FZCA 4LLHA 1BAYA 5EFWB 1QGVA 3C71A 4BA7A 3SWKA 1WWJA 3VWXA 4Q5FA 2ZVNB 3H6PA 1GSFA 1TRWA 2HSHA 1L0NE 2YO3A 4L5OA 4IP1A 2QJKB 3NMDA 5TISE 5CP1A 4BPYA 1DSBA 2P10A 2AAWA 2KS1B 3GKXA 4G9HA 3ZL5A 1WOUA 2E74C 1SJZA 1PGQA 4ISDA 2H74A 1WIKA 3E3EA 5B8AA 2P31A 4V1Ag 5D9TA 1A8LA 4RI6A 2XDJA 1LTGC 3N7NA 1FG4A 2HXKA 3VYIA 1LGHB 1URQD 1MDKA 2VL3A 3JCUH 5D93A 1GUHA 3H1HJ 1NM3A 1FZGA 1SQBK 2H75A 4EL1A 3G6EP 3A2AA 3CXGA 4IN0A 1Q98A 2E75B 1IFPA 3Q2YA 1XVWA 4BVXB 5APXA 4OCEA 4H0LD 3OW2O 5AW2B 3TUEA 1OW8A 3JC22 4RO0A 1JM0A 2ZFCA 3IE3A 1OX3A 3H1KE 2Q5UA 3M0AA 1B48A 3TRQA 4E8HA 5HQPA 3CMIA 4XE5B 2IJYA 3UOMA 1SQQG 1AXDA 2K3RA 6GSSA 1G2CB 1VL2A 1UA5A 4XS4A 3QPMA 4HQZA 2H88C 5D9WA 4L5LA 2KB7P 2QIWA 2GS3A 4I6XA 3UL3A 1DD4A 1YITP 2B1KA 3C1RA 1V9WA 1HTLC 1KFMA 4K5RA 3TYYA 3GSSA 3B5NC 4K7NA 4XCSA 1N7SC 1LTTC 3HD7B 4IL6X 4F0CA 3CMAP 2IFQA 3L73E 5ID2B 1SQVJ 3I6AA 2CV4A 4USSA 4MABA 2IFNA 4QMAA 1VQ7P 3V6IA 3H8QA 3TJBA 2E76D 1GU4A 2JADA 4HQSA 1GSYA 5L8RJ 4POKA 1GTAA 4TR0A 3RK3B 4W80A 2ZYAA 4ZKUA 3PP5A 4BL7B 1RF1A 2K6VA 4GOFA 4WF5A 3QAWA 3ZLPA 3F4TA 4U3FE 4OO4A 4HS1A 3IC4A 1T4YA 2K1AA 2CX4A 1BSHA 3WT2A 2M8RA 1M99A 3R3EA 4K8MA 1IFIA 3KP8A 1FJKA 2AHEA 1K0OA 1K04A 1F3BA 4XIHA 1ZR4A 1BEDA 1RQUA 2MBTA 1GRXA 5CBNA 1BDCA 3RBZA 2HZEA 3TGUE 3LW5J 3RK2B 4XRDA 1I5GA 3H1HD 5K5GB 1S4XA 1U88A 3CC2P 3PHLA 1TP9A 4EC0A 3GSTA 2HSMA 2LQQA 2GSRA 2GZYA 2QA1A 5KJ7C 2LKMA 3CTGA 2B87A 4KHXA 3WGXA 5AGYA 1L0LE 5ENUA 1XTGB 2C8UA 3GMAA 3MAKA 4L8EA 4H13B 1THOA 1NTKK 2V4HA 4NPEA 3L71G 1S2EA 3IC8A 3FZ5A 1WMKA 3B5ND 2FBWC 2CQ9A 3BOAA 2IZ1A 4JBBA 4POBA 1SVFA 2JSZA 1V40A 4HZ2A 3HXSA 3AE2C 5E4WA 2LRTA 3K5BA 2OACA 3I56P 5JWRB 1QLED 1BE3E 2ZJSE 2OE1A 2WMMA 4Z2RA 1V57A 1FZAA 3RPNA 1RK4A 1T00A 3C8VA 1YI2P 2P5QA 1OKDA 4TR3A 14GSA 3FXDA 1FJPA 2B7JA 3CCMP 5CBOA 2HLSA 4PV1C 1KYOI 1YY7A 1LWUB 2W6BA 2YANA 5DVBA 5IO2A 4PQ1A 4WEYA 3VI7A 1L2PA 2MMZA 2X49A 4NAXA 4GT1A 1JZDA 2ZVOB 3F63A 3A5IA 7GSSA 2D2CC 2IMFA 2KZIA 4POLA 1WPIA 3BCCG 4LGDE 1KTMA 2L91A 3KHUA 2KOKA 4X4JA 2V6KA 5AW5B 1X9SB 1OW6A 2YKOA 2IBZD 3QMXA 1VRSD 2ZXEB 3TJFA 2NDOA 1SKSB 4LA1A 2DJ3A 2YV9A 1L4AA 2WJUA 1XWGA 4GSSA 5G2ZA 2BCCJ 5AVTB 5KOXA 1FAVA 5LNKe 2L57A 3T97A 4XS6A 1KILC 1GSDA 2QM8A 5B5EH 1BX9A 3H25A 2O01N 3C73A 3RPPA 3UBLA 1N8RQ 1XW5A 1JUNA 5D8IA 3L74G 5APSA 5ABRA 4GKGA 4G0KA 1S9KE 3KCMA 5CYYA 3VLNA 1YF0A 5H2FH 2R0GA 4HU7A 3H1IJ 5CNWA 2WSCJ 5ECSA 1NYHA 4LMWA 3ISOA 4MMMA 1X0RA 1CI6B 1SFCD 2C3TA 2VLVA 3MZWB 1RQVA 2R37A 1TU7A 1F2EA 4OVNF 5J41A 3IV4A 4D6TJ 3V4WA 4POMA 6GSYA 3VMAA 3VP9A 1WP0A 4WXTA 5CCHA 1YJNP 4N11A 2YNXA 5DALA 2ZYDA 3MIWA 1TI3A 2R5BA 3HZ4A 1GW3A 2FFDB 1OC9B 4YAPA 1ZRTE 2AUVA 3GH6A 4YKGA 3GFKA 5ECQB 1BGYJ 3FY7A 3FZ9A 1XPVA 2R5DA 5IQYA 1SQQE 5F8BA 5H2FE 1M0UA 1YJ9P 1DIPA 2GSQA 2CA8A 2VL9A 4OGQB 1XWBA 1OYJA
chains in the Genus database with same CATH topology
3DXBA 4MZWA 1EWXA 4K7OA 4NV2A 4EXJA 4FO5A 1EGOA 2DJ2A 5L71A 3JCML 2QSIA 3TOTA 1HNBA 1TTZA 3UJ1A 2IPAA 1JZWA 2MMAA 1GLPA 3TKPA 3IAOA 2N5AA 3F6DA 1JLVA 2C3QA 4WKWA 2CVKA 5IOXA 4FYCA 4PNFA 3KH9A 4KGIA 4MPFA 2J9HA 3GN3A 1S3CA 2C0GA 2LJKA 3IK7A 5A4UA 3O6TA 3RDWA 1VF3A 2OA7A 4F9ZA 5DJMA 2AB6A 5G30A 4H44C 4V2NA 1TK0B 1URMA 3H4KA 5H5QA 4BWSA 5J3RA 1SENA 3FGAD 3A5WA 1XVQA 2R5GA 2O89A 3AEEC 2QC7A 3TRXA 3AE9C 2G2QA 2KP2A 2DMLA 1EZKA 2YN1A 1T3BA 3C8EA 4ZBAA 2MMOA 4KW6A 1GH2A 1GL8A 1M9BA 1UVZA 2EIOA 2XBQA 3ZREA 4O5RA 3P8WA 4N30A 3LQ7A 4EVMA 2GQKA 2NPBA 3VWVA 1YQ4C 1R4WA 1HQOA 3TB2A 5IMVA 3PH9A 3AE1C 4EDZA 2FYNC 2OE3A 4L0WA 2V7QJ 1TOFA 2K9YA 1PKWA 4G10A 4Q5RA 3U6VA 1GP1A 4N0VA 3VURA 1O81A 1BG5A 3H79A 4KDYA 3VI5A 1BQ7A 1EOHA 3GF7A 4HEA2 4TW5A 3EMXA 4AJ8A 13GSA 3HKRA 3FR9A 2H76A 1V98A 6GSVA 4IGJA 1G6YA 2NBSA 1G7EA 4H86A 4K6XA 1AIUA 4AGSA 1MD4A 2WULA 1SK0A 1GTBA 5HFKA 3LSZA 1KMIZ 4DSSA 3M8NA 2YIUC 2M46A 3G7JA 1XIYA 4DSQA 2O7KA 1KNGA 1GTIA 3HY2A 5HR1A 4TR4A 1PSQA 1SK1A 4OD7A 1KORA 1T4ZA 1X5CA 4KT0J 2FWGA 2C4JA 2C0FA 2PGTA 2E2MA 2FA8A 2OJLA 4FYUA 3ABVC 4WETA 2H71A 5C04A 2E75C 1EGRA 4NV5A 4LL1B 1FAAA 4ILFA 4NMUA 2DKIA 1VGLA 1R7HA 3TDGA 2CVBA 2VD0A 2LUSA 3IRAA 3AECC 3ME7A 1ZCPA 1DBYA 2IDBA 4I7ZB 2VCTA 4X0XA 1N2AA 4N10A 1B9YC 4IELA 3E9JB 1HD2A 1B4QA 2FHEA 3O3TA 4YH2A 4F2IA 3LG6A 4XFJA 2GZZA 1PMTA 4K5SA 4O92A 5D9XA 1XWCA 2FLSA 2TRXA 3LFLA 1OC8A 3F0IA 2CAQA 4XS4B 1E6BA 3ZFLA 3GNJA 4IJ3A 5INYA 3CYNA 2I81A 3Q5RA 1MDJA 2YP6A 5HR3A 3F4RA 3KM6A 3GV1A 2JACA 2LS5A 4ZBDA 3MSZA 3ZTLA 1ZYQB 1HNAA 2ON7A 1UN2A 2XPEA 1EEMA 2DJKA 4MJBA 2UZ8A 3Q6OA 3L9UA 2LJAA 4ZL8A 4Z2TA 4HUAA 3Q74A 1Z7PA 2LSTA 2FXPA 1TJDA 5DJLA 4HJ2A 4YQUA 5ECPB 3DWVA 3BJ5A 3HZ8A 2ZT9B 4XHMA 2ZCTA 17GSA 1PX6A 1GNWA 3DEXA 1KTEA 1ML6A 3A2WA 4YKFA 2RUFA 1WE0A 2H89C 4RUVA 2QKEA 2EIRA 5DCGA 2L59A 3DVWA 4ECBA 3KTBA 5D96A 2HZEB 1SU9A 1WMJA 2REMA 3D21A 4Z1MH 1B9XC 4ZL9A 1QXHA 5FWGA 2OBIA 1HYUA 2YJHA 4GF0A 1MD3A 5KN2A 1H4OA 3VPTA 3IBHA 1NW2A 2TRCP 1SYRA 3HA9A 5E59A 4CHSA 3LJRA 1F9MA 3I9V2 1LJRA 2H6ZA 3D22A 4KX4A 3IK9A 1FB6A 4GSTA 2YWNA 4Z2UA 3KP9A 1K3YA 4PTSA 4YXDC 5BMUA 5EY6A 3RK3E 2PWJA 1XZOA 3P2AA 1QMVA 2DJJA 1A0FA 2A4VA 5IMDA 4F03A 3GTUA 1Z5YE 1EXIA 2HRFA 3ERFA 4FYBA 4JEDA 3PR8A 3QFBC 1ERUA 2M72A 5J5NA 1ABAA 2DC5A 3DD3A 3GUSA 1ZMAA 3N9JA 1C72A 2R2JA 3FYGA 2VOCA 3AE8C 2ES7A 1S5LX 2JZSA 4YTPC 3NOFA 3LWAA 2L4QA 2A2SA 4EO3A 1Z6NA 3GX0A 4O7HA 3APSA 4MJAA 4F82A 5CRGA 1YF1A 1MTCA 5CREA 5J9BA 3RL0g 1T1VA 5AIVA 1FB0A 1VF2A 4EF0A 2E74D 3W8SA 3T97B 1OVNA 1PD21 5FHIA 2JSYA 2IMDA 1IYHA 4IQ1A 2C0EA 3DGQA 1FW1A 2O8VB 2WPVB 4OGQC 2H73A 1O73A 4TXOA 4GLTA 2VCXA 5GSTA 2RM6A 4IVFA 4G2EA 6GSWA 4GTUA 4YAVA 2NVLA 4JR6A 1T8EB 1S3AA 4HJMA 1V2AA 2ALBA 1EV4A 2FWFA 4KCEA 4H0LB 1YQ3C 4CW9A 3HVSA 5KN3A 2AYTA 4TN8A 3LORA 1GNEA 1U3IA 2H70A 1FDOA 3A2XA 2B1LA 2J23A 4WF4A 3LW9A 1TXXA 3TCOA 2E76B 1UIXA 4EE0A 2JZTA 3GIXA 4TRXA 3EE2A 2ZNMA 3Q5PA 1U87A 2VL2C 3ED3A 3KXOA 4LMVA 2C3NA 3I43A 4TR1B 1GUKA 3TJKA 5CAXA 5CRDA 4K0GA 2IIYA 4RQXA 1Y6EA 1O8XA 1M2DA 2JL4A 3RBTA 2LRCA 2DJ0A 4OFNA 4JZQA 1TRVA 5G1KA 5DAKA 5AN1A 5ECIB 4J2FA 3AE6C 1XW9A 4EIQA 3TKSE 2H0HA 1OAZA 2M80A 5H5SA 2LJRA 20GSA 4PUAA 5ECNB 3HYPA 3IA1A 2WCIA 3G7YA 2F8FA 1AQWA 4JU5A 1FVJA 3GYKA 2LNTA 2B7KA 2CVDA 5EL8A 1EP8A 1GULA 1GSQA 1IK7A 3WGDA 3KEBA 1HF9A 2RIIA 1U57A 2QA2A 4KAEA 5KN0A 3QFAC 2PVQA 4LL4B 5ECHB 5IIZA 4WR4A 4TVEA 5AIXA 4XTSA 3QAGA 6GSTA 3L4NA 1DUGA 10GSA 5HR0A 4AJ6A 1LU4A 1O8WA 1YJ6A 4K2XA 4L0UA 4PV1D 3IHQA 3V1WA 2C0DA 5JCWA 5B6NA 1TRSA 4MZCA 1K0AA 3AEFC 3M9JA 2PU9C 4Q5NA 2HT9A 4K0NA 1JZRA 2H6YA 2D2CD 2H0GA 3AEGC 1AQXA 4D73B 2R6KA 2E0QA 1ST9A 3ZRDA 2BJXA 2CT6A 1QQ2A 3KGKA 4DVCA 2WS2A 2YCDA 2N5BA 4NHWA 2I9HA 2OKAA 4KDUA 4ZB6A 3KTLA 2B5YA 1J0FA 2L6CA 4PX1A 2G3AA 2FUG2 5DDLA 1ERTA 3DMLA 1R26A 1FOHA 4DSSB 3ZYWA 4MK3A 2IN3A 4KDXA 3TRPA 4E8EA 3PINA 3TJJA 2H66A 3P90A 1DE1A 1DD3A 3GHAA 5JCUA 3FMWA 2O85A 1A23A 2G0FA 2V32A 4KCAA 4I7ZC 2FD3A 4NPBA 2OQQA 3HD5A 3TGZA 2L6DA 3IXRA 2GSSA 3SBCA 3L9SA 4ICYA 1J9BA 4MNNA 3Q19A 4JR4A 3IN6A 3FZAA 4RI7A 3IR4A 3HCZA 2V6OA 5A4VA 1HNCA 5KEJA 1GSSA 3FW2A 2FWHA 1GSEA 2F8AA 4Q5QA 1TK5B 2X4AA 2VIMA 2A2RA 3TKRA 3LEFA 4J56E 4MH2A 5IMFA 1M9AA 3M9KA 2YZUA 4O5QA 1M7TA 3KD0A 2VAFA 3PPUA 2V41A 4KA0A 3CRUA 1ACVA 2ZUPA 4HDEA 1R5AA 3UMAA 1VF5C 4AJ7A 1G6WA 2ZT9C 1K0NA 3APOA 5C00A 3N5OA 3ZIJA 2EIQA 3MYDA 3O6QA 2IWTA 1GUMA 5CRWA 4GQCA 5ECLB 4OWYA 2GDRA 4K9ZA 2WQYC 5IO0A 4F0BA 4H44D 1XWAA 3AE3C 5EVOA 2BEZF 1M2BA 1SD8A 4ML1A 5B6MA 3QR6A 1A2LA 3QCPA 5D9VA 5M1BA 1M2AA 4ZILA 3P7XA 4ECJA 2QJKC 4MA9A 5ECRB 2GZPA 1SKWB 3FR3A 2A4HA 2DKHA 4CDOA 2MYGA 2PBJA 3UARA 1SL1B 1AJYA 5F0GA 1TKDB 1EP7A 1J08A 2GTUA 3SFEC 1Y9BA 1KQFB 1MEKA 4KF9A 5J4UA 1RQMA 2FGXA 5ECMB 4HZ4A 1VF5D 1KBNA 2KHPA 1KQGB 3GF3A 3ZIVA 3APQA 3J7Yb 2OADA 1CQHA 2GQLA 2HRAA 2VLUA 3VWWA 2GLRA 3H93A 2LNSA 3MNGA 2V1MA 3HHVA 1FVKA 2DMMA 1PRXA 4MJCA 3TKQA 2CZ2A 1ILOA 2XHFA 2DIYA 3ERWA 2CAIA 3DKSA 3G9RA 4WBRD 3VWUA 4CY6A 1TW9A 1AW9A 4ZIJA 3AEAC 2WSFJ 5HR2A 3WD6A 5DQSA 3SFDC 1X9WB 3AEDC 3UEMA 11GSA 4BVYA 2VM2A 3W8JA 2K8VA 3GA4A 3GL3A 2K9FA 2IFQB 1UC7A 3F3QA 2VCWA 5HFGA 1AQVA 1K0MA 4EIPA 4MLYA 4V2MA 4MDCA 2JP3A 4ID0A 3D6YA 1A24A 1S1CX 3F6FA 2E75D 2WB9A 3UIWA 1JLWA 3CSIA 2B6MA 2G8YA 3HVXA 2LEGA 3GL5A 2X64A 3CBUA 4BWQA 4TKYA 1K0CA 4XRAA 2BEQD 5AISA 2YWIA 4QL9A 1TDIA 4I8BA 4R4MA 1VF1A 3UBKA 4QL7A 4H13C 3W6GA 1E2YA 4TT3H 1ZZYA 2QJYC 1SYXA 3G7IA 3IDVA 2GQMA 1EXJA 2VD1A 1ERVA 4ZB9A 2GSTA 2RLIA 4PXOA 1GWCA 1PN9A 3AE4C 1X5DA 2F9SA 2DLXA 2H1GA 2IMIA 3QOUA 3NIVA 3VPQA 5GSSA 8GSSA 1S3DA 2VCVA 3CSHA 3HJMA 3ZMKA 1AAZA 2E76C 3DYRA 5CO3A 3ZITA 1BJXA 4K7IA 2EC4A 4K1FA 1MDIA 3AEBC 3IHGA 1EV9A 2PMTA 4EUYA 4GQFA 3BBYA 3M0FA 1H75A 2IMEA 2HE3A 3F8UA 3GH9A 2OBKA 5ELAA 4ECIA 9GSSA 1OE8A 2QJPC 3R4YA 2VO4A 1JB0J 1XXUA 1NSWA 3QD9A 4GSNA 3J7Yk 2CX3A 3HJPA 5GZZB 4FH8A 1TRUA 1Z7RA 5DCHA 3I69A 3MDKA 4H13D 3SWLA 2LQOA 1TI1A 5A4WA 4JE1A 3FZ4A 2KLXA 4OMVA 3C7MA 4TOPA 4GDOA 3GRXA 2PUKC 5DAKB 5G1LA 1GTUA 3MIXA 4ECCA 2JU5A 3NZNA 2NZ2A 4PUFC 4HI7A 2B3SA 3VFIA 4GRFA 4KNDA 4KH7A 2R4VA 3S9OA 1OC3A 3TKSC 5A5KA 2R0PA 4I97A 3EC3A 4IQAA 2I4AA 5DBQA 1XCCA 2AJQB 3FKFA 3FR6A 4IHUA 1W4VA 4TXVA 2VCQA 2P0GA 5DALB 1ZYPA 2GT6A 4U7JA 5IPHA 2K8SA 3FRCA 5JCGA 1SJIA 4RKUJ 2WGRA 4MZBA 3LXTA 1K0DA 2N5FA 1AC1A 1FO5A 1A8YA 1YEXA 2R0CA 2XBIA 5D73A 2C80A 3FHKA 2NTOA 4G0IA 5KLIC 3GKNA 2H19A 5IMZA 3KZQA 2X8CA 3ZZXA 1F6MC 3G9BA 3M3MA 3A3TA 12GSA 1SJ6A 1PL1A 3ZFBA 2YWMA 3EINA 3L9VA 4MF6A 1I9DA 4RQRA 4ZBBA 19GSA 4I2UA 4BVXA 3CTFA 1K3OA 5FT3A 3LXZA 4KSOA 4QQ7A 2X8GA 3D4TA 3ZMLA 2E74B 2VCZA 3D6ZA 1SL0B 2LTKA 4OGQD 2GVPA 3EMPA 1DE2A 18GSA 4KUNA 2H6XA 2GGTA 1TU3F 4WBJA 5ID2A 1U6TA 5IMCA 4MP4A 3D71A 2H72A 1PIXA 4FIWA 5LD0A 2HFDA 3EWLA 4N0ZA 3IPZA 2RM5A 1FHEA 3AE5C 2DSAA 2WZ9A 4AF2A 4BL7A 1LBKA 1XOBA 2PN8A 2GT5A 4IBPA 4Z7XA 3WT1A 5CRHA 4X1UA 1XW6A 4MF7A 4OFMA 2HRKA 5GAPD 3US3A 1QK8A 3QDNA 4ZL7A 4IS0A 3TOUA 3L78A 2WSEJ 2DIZA 5IOWA 1CQGA 1PN0A 4PURA 2FY6A 4MCUA 2BMXA 3BCIA 5IMAA 1NHYA 1ON4A 4J57E 1ZYEA 3D6IA 3ZVJD 3D4MA 4MF5A 3TJGA 4K2DA 5H5RA 1KEBA 2R3XA 1O7UA 1JHBA 3E0UA 1YEPA 2X99A 4KE3A 1Z6MA 3KMNA 1OMIA 1B4PA 2TIRA 2MZCA 2YV7A 2LV3A 3D5JA 2C1YA 2HNLA 2L5OA 2HRNA 4V1Ap 5IM9A 3Q5SA 2H0IA 5JWQB 1K3LA 1K0BA 3KH7A 4DSRA 3O76A 2PVOC 1B8XA 1GLQA 3U5RE 5F06A 3EURA 3K8NA 1A0RP 4O32A 1TK8B 1EEJA 2JZRA 3KJYA 2FWEA 4ULXA 4WR5A 1GSUA 3UVHA 4G0LA 2JO1A 3GURA 3CSJA 1ZOFA 1WRYA 2HSYA 4TR1A 1ERWA 2WDUA 3KMOA 3Q3DA 3DRNA 1JZOA 4I5QA 3GLMA 22GSA 3B71A 1BYEA 3QAVA 1IYIA 2RUEA 3HJOA 1ZP0C 2P5RA 1KILE 4GCIA 2YOIA 2HYXA 3A2VA 1AUCA 3GKMA 4PV1B 1JFUA 6GSXA 5DQYA 5B7CA 1ZMEC 2O01J 2PERA 1SL2B 6GSUA 4FQUA 1XBSA 4V2LA 4I2TA 1Q90D 1FOVA 2D2CB 1R8EA 3F9UA 3EPTA 2MBSA 1Z9HA 2K18A 1PL5A 1FDIA 3EWKA 1YZXA 1Z3EA 4GWRA 2DJ1A 4NXIA 2ON5A 3L0HA 1USBA 1O6JA 1PKZA 4HU9A 3ERGA 3WGEA 3TKSA 4BVYB 5IPGA 1OC9A 3EVIA 2QGVA 1G7OA 3DIEA 4IJIA 2WRTA 2F51A 1QUWA 16GSA 5J9CA 1Y25A 3M1GA 1XFLA 1RW1A 3HVVA 5G5EA 4A5PA 2VLTA 1SKRB 4CY8A 3FEUA 4D73A 1A2JA 2O87A 4HOJA 1ZGNA 4P3YB 1WJKA 2FCHA 1ZYNA 2E7PA 4MPGA 2XC2A 1SK2A 2I3YA 1X9MB 2B5XA 2A2PA 2E2GA 2KUCA 5EPFA 1XWKA 4YQVA 1F37A 5KKZC 2FA4A 4ACSA 3RHCA 4KSMA 3BCKA 1EOGA 3D0ZA 4EKZA 1XOAA 1THXA 4YQMA 3VK9A 1OW7A 3Q18A 1YDKA 2LRNA 3C1SA 4DEJA 1W89A 1YQ1A 5ECKB 3F4SA 2YZHA 4ML6A 2CZ3A 1MKMA 1NGMB 5COHA 3OR5A 4ZXGA 3DVXA 4PQHA 3IAM2 3D70A 2YJ7A 3EU3A 2HZFA 2J5UA 2V2GA 5JWOB 3ZVJA 2MKVA 2D2ZA 2I1UA 2VL2A 2ZT9D 3MWHA 3H1NA 1HJ0A 2B5EA 5F07A 3IAS2 1PX7A 1PL2A 3GX8A 2YWOA 5B8BA 3UAPA 3EU4A 1ZL9A 3GKKA 2VUPA 4G19A 2XPDA 3EYTA 4Y28J 3GTUB 4EDYA 2IMKA 2H30A 4H44B 4NHZA 4GXZA 1O85A 4LLRA 2X8HA 3F3RA 1GMJA 2H01A 4NWYA 3CRTA 2AV4A 3LGCA 4PNGA 2H1AA 2H8LA 5KOWA 3S9FA 1V58A 3LYPA 1SD9A 5ECOB 1A2MA 2IL3A 3FK8A 5LCZA 2Z9SA 3R2QA 5KN1A 3KIJA 3WYWA 4R4LA 5BRTA 2H1DA 1ZOYC 4XS1A 5F05A 5G31A 2VM1A 4MH3A 2MMNA 4OO5A 2BTOT 3AE7C 1PQNA 2H1BA 1U3AA 4IP6A 2WFCA 4OCFA 2LKUA 3LYKA 3GMFA 1VF4A 4IKHA 3RHBA 1OKTA 2PPTA 3IOSA 1N8JA 3Q1MA 2L5LA 4IW9A 4H0LC 1X5EA 1YKCA 2HI7A 2YMKA 1VF5B 1Q4JA 2F3MA 3PGTA 5HFIA 4PGTA 5ELGA 4PQIA 3BD2A 4TXOB 2L4CA 1OE7A 4OFTA 1QFNA 4O5UA 5G5FA 1G0TA 4X43A 3HDCA 3UVTA 1TU8A 2DBCA 1NHOA 1F3AA 4JRRA 1K05A 1YKAA 2YPMA 4ZB8A 1PV3A 1PGTA 2FNOA 1R5PA 1T7PB 1PA3A 3ME8A 4MJEA 4KB3A 3RAZA 5GAND 2KP1A 3AY8A 2OE0A 1BAYA 1QGVA 3C71A 4BA7A 1WWJA 3VWXA 4Q5FA 1GSFA 1TRWA 2HSHA 4L5OA 4IP1A 4BPYA 5CP1A 1DSBA 2P10A 2AAWA 3GKXA 4G9HA 3ZL5A 1WOUA 2E74C 1SJZA 4ISDA 2H74A 1WIKA 3E3EA 5B8AA 2P31A 4V1Ag 5D9TA 1A8LA 4RI6A 1FG4A 2HXKA 1MDKA 2VL3A 5D93A 1GUHA 1NM3A 2H75A 4EL1A 3CXGA 4IN0A 1Q98A 2E75B 3Q2YA 1XVWA 4BVXB 4OCEA 4H0LD 3TUEA 1OW8A 3IE3A 1B48A 3TRQA 4E8HA 5HQPA 3CMIA 2IJYA 3UOMA 1AXDA 6GSSA 4XS4A 1VL2A 1UA5A 3QPMA 4HQZA 2H88C 5D9WA 4L5LA 2QIWA 2GS3A 4I6XA 3UL3A 1DD4A 2B1KA 3C1RA 1V9WA 4K5RA 3GSSA 4XCSA 4K7NA 4IL6X 4F0CA 2IFQA 5ID2B 3I6AA 2CV4A 4USSA 4MABA 3TJBA 3H8QA 2E76D 2JADA 4HQSA 1GSYA 5L8RJ 4POKA 1GTAA 4TR0A 4BL7B 2K6VA 4WF5A 3QAWA 3ZLPA 3F4TA 4OO4A 4HS1A 3IC4A 1T4YA 2CX4A 3WT2A 1M99A 3R3EA 4K8MA 3KP8A 2AHEA 1K0OA 1K04A 1F3BA 4XIHA 1BEDA 1RQUA 2MBTA 1GRXA 2HZEA 3LW5J 4XRDA 1I5GA 1U88A 1TP9A 4EC0A 3GSTA 2HSMA 2LQQA 2GSRA 2GZYA 2QA1A 3CTGA 3WGXA 5AGYA 5ENUA 2C8UA 3GMAA 3MAKA 4L8EA 4H13B 1THOA 3IC8A 3FZ5A 1WMKA 2FBWC 2CQ9A 3BOAA 4JBBA 4POBA 2JSZA 1V40A 4HZ2A 3HXSA 3AE2C 5E4WA 2LRTA 2OACA 5JWRB 2OE1A 4Z2RA 1V57A 3RPNA 1RK4A 1T00A 3C8VA 2P5QA 1OKDA 4TR3A 14GSA 2B7JA 2HLSA 4PV1C 1YY7A 2YANA 5DVBA 5IO2A 4PQ1A 4WEYA 3VI7A 2MMZA 2X49A 4NAXA 1JZDA 3F63A 3A5IA 7GSSA 2D2CC 2IMFA 4POLA 1WPIA 1KTMA 2KOKA 4X4JA 2V6KA 1X9SB 1OW6A 3QMXA 1VRSD 3TJFA 2NDOA 1SKSB 4LA1A 2DJ3A 2YV9A 2WJUA 1XWGA 4GSSA 5G2ZA 5LNKe 5KOXA 2L57A 4XS6A 1GSDA 1BX9A 3H25A 3UBLA 3C73A 3RPPA 1XW5A 5D8IA 5ABRA 4G0KA 3KCMA 5CYYA 3VLNA 1YF0A 2R0GA 4HU7A 5CNWA 2WSCJ 5ECSA 1NYHA 4LMWA 3ISOA 4MMMA 1X0RA 2C3TA 2VLVA 1RQVA 2R37A 1TU7A 1F2EA 5J41A 3IV4A 4POMA 6GSYA 1WP0A 4WXTA 4N11A 2YNXA 5DALA 1TI3A 3HZ4A 1OC9B 4YAPA 4YKGA 1ZRTE 2AUVA 3GH6A 3GFKA 5ECQB 3FY7A 3FZ9A 1XPVA 5IQYA 5F8BA 1M0UA 1DIPA 2GSQA 2CA8A 2VL9A 4OGQB 1XWBA 1OYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXB A;  4MZW A;  1EWX A;  4K7O A;  4NV2 A;  4EXJ A;  4FO5 A;  1EGO A;  2DJ2 A;  5L71 A;  3JCM L;  2QSI A;  3TOT A;  1HNB A;  1TTZ A;  3UJ1 A;  2IPA A;  1JZW A;  2MMA A;  1GLP A;  3TKP A;  2N5A A;  3F6D A;  1JLV A;  2C3Q A;  4WKW A;  2CVK A;  5IOX A;  4FYC A;  4PNF A;  3KH9 A;  4KGI A;  4MPF A;  2J9H A;  3GN3 A;  1S3C A;  2C0G A;  2LJK A;  3IK7 A;  5A4U A;  3O6T A;  3RDW A;  1VF3 A;  2OA7 A;  4F9Z A;  5DJM A;  2AB6 A;  5G30 A;  4V2N A;  1TK0 B;  1URM A;  3H4K A;  5H5Q A;  4BWS A;  5J3R A;  1SEN A;  3A5W A;  1XVQ A;  2R5G A;  2O89 A;  2QC7 A;  3TRX A;  2G2Q A;  2KP2 A;  2DML A;  1EZK A;  2YN1 A;  1T3B A;  3C8E A;  4ZBA A;  2MMO A;  4KW6 A;  1GH2 A;  1GL8 A;  1M9B A;  1UVZ A;  2EIO A;  2XBQ A;  3ZRE A;  4O5R A;  3P8W A;  4N30 A;  3LQ7 A;  4EVM A;  2GQK A;  2NPB A;  3VWV A;  1R4W A;  1HQO A;  3TB2 A;  5IMV A;  3PH9 A;  4EDZ A;  2FYN C;  2OE3 A;  4L0W A;  1TOF A;  2K9Y A;  1PKW A;  4G10 A;  4Q5R A;  3U6V A;  1GP1 A;  4N0V A;  3VUR A;  1O81 A;  1BG5 A;  3H79 A;  4KDY A;  3VI5 A;  1BQ7 A;  1EOH A;  4HEA 2;  4TW5 A;  3EMX A;  4AJ8 A;  13GS A;  3HKR A;  3FR9 A;  2H76 A;  1V98 A;  6GSV A;  4IGJ A;  1G6Y A;  2NBS A;  1G7E A;  4H86 A;  4K6X A;  1AIU A;  4AGS A;  1MD4 A;  2WUL A;  1SK0 A;  1GTB A;  5HFK A;  3LSZ A;  4DSS A;  2YIU C;  2M46 A;  3M8N A;  3G7J A;  1XIY A;  4DSQ A;  2O7K A;  1KNG A;  1GTI A;  3HY2 A;  5HR1 A;  4TR4 A;  1PSQ A;  1SK1 A;  4OD7 A;  1T4Z A;  1X5C A;  4KT0 J;  2FWG A;  2C4J A;  2C0F A;  2PGT A;  2E2M A;  2FA8 A;  2OJL A;  4FYU A;  4WET A;  2H71 A;  5C04 A;  1EGR A;  4NV5 A;  4LL1 B;  1FAA A;  4ILF A;  4NMU A;  1VGL A;  1R7H A;  3TDG A;  2CVB A;  2VD0 A;  2LUS A;  3IRA A;  3ME7 A;  1ZCP A;  1DBY A;  4I7Z B;  2VCT A;  4X0X A;  1N2A A;  4N10 A;  1B9Y C;  4IEL A;  3E9J B;  1HD2 A;  1B4Q A;  2FHE A;  3O3T A;  4YH2 A;  4F2I A;  3LG6 A;  2GZZ A;  1PMT A;  4O92 A;  5D9X A;  1XWC A;  2FLS A;  2TRX A;  3LFL A;  1OC8 A;  3F0I A;  2CAQ A;  4XS4 B;  1E6B A;  3ZFL A;  3GNJ A;  4IJ3 A;  5INY A;  3CYN A;  2I81 A;  1MDJ A;  2YP6 A;  5HR3 A;  3F4R A;  3KM6 A;  3GV1 A;  2JAC A;  2LS5 A;  4ZBD A;  3MSZ A;  3ZTL A;  1ZYQ B;  1HNA A;  2ON7 A;  1UN2 A;  2XPE A;  1EEM A;  2DJK A;  4MJB A;  3Q6O A;  3L9U A;  2LJA A;  4ZL8 A;  4HUA A;  3Q74 A;  1Z7P A;  2LST A;  1TJD A;  5DJL A;  4HJ2 A;  4YQU A;  5ECP B;  3DWV A;  3BJ5 A;  3HZ8 A;  2ZT9 B;  4XHM A;  2ZCT A;  17GS A;  1PX6 A;  1GNW A;  3DEX A;  1KTE A;  1ML6 A;  3A2W A;  2RUF A;  1WE0 A;  4RUV A;  2QKE A;  2EIR A;  5DCG A;  2L59 A;  3DVW A;  4ECB A;  3KTB A;  5D96 A;  2HZE B;  1SU9 A;  1WMJ A;  2REM A;  3D21 A;  1B9X C;  4ZL9 A;  1QXH A;  5FWG A;  2OBI A;  1HYU A;  2YJH A;  4GF0 A;  1MD3 A;  5KN2 A;  1H4O A;  3VPT A;  3IBH A;  1NW2 A;  2TRC P;  1SYR A;  3HA9 A;  5E59 A;  4CHS A;  3LJR A;  1F9M A;  3I9V 2;  1LJR A;  2H6Z A;  3D22 A;  4KX4 A;  3IK9 A;  1FB6 A;  4GST A;  2YWN A;  3KP9 A;  1K3Y A;  5EY6 A;  2PWJ A;  1XZO A;  3P2A A;  1QMV A;  2DJJ A;  1A0F A;  2A4V A;  5IMD A;  4F03 A;  3GTU A;  1Z5Y E;  2HRF A;  3ERF A;  4FYB A;  4JED A;  3PR8 A;  3QFB C;  1ERU A;  2M72 A;  5J5N A;  1ABA A;  2DC5 A;  3DD3 A;  3GUS A;  1ZMA A;  3N9J A;  1C72 A;  2R2J A;  3FYG A;  2VOC A;  2ES7 A;  1S5L X;  2JZS A;  3NOF A;  3LWA A;  2L4Q A;  2A2S A;  4EO3 A;  1Z6N A;  3GX0 A;  4O7H A;  3APS A;  4MJA A;  4F82 A;  5CRG A;  1YF1 A;  1MTC A;  5CRE A;  5J9B A;  1T1V A;  5AIV A;  1FB0 A;  1VF2 A;  4EF0 A;  3W8S A;  1OVN A;  1PD2 1;  5FHI A;  2JSY A;  2IMD A;  1IYH A;  4IQ1 A;  2C0E A;  3DGQ A;  1FW1 A;  2O8V B;  2WPV B;  2H73 A;  1O73 A;  4TXO A;  4GLT A;  2VCX A;  5GST A;  2RM6 A;  4IVF A;  4G2E A;  6GSW A;  4GTU A;  4YAV A;  2NVL A;  4JR6 A;  1T8E B;  1S3A A;  4HJM A;  1V2A A;  2ALB A;  1EV4 A;  2FWF A;  4KCE A;  4H0L B;  4CW9 A;  3HVS A;  5KN3 A;  2AYT A;  4TN8 A;  3LOR A;  1GNE A;  1U3I A;  2H70 A;  3A2X A;  2B1L A;  2J23 A;  4WF4 A;  1TXX A;  3TCO A;  2E76 B;  4EE0 A;  2JZT A;  3GIX A;  4TRX A;  3EE2 A;  2ZNM A;  1U87 A;  3ED3 A;  2VL2 C;  3KXO A;  4LMV A;  2C3N A;  3I43 A;  4TR1 B;  1GUK A;  3TJK A;  5CAX A;  5CRD A;  4K0G A;  2IIY A;  4RQX A;  1Y6E A;  1O8X A;  1M2D A;  2JL4 A;  3RBT A;  2LRC A;  2DJ0 A;  4OFN A;  4JZQ A;  1TRV A;  5G1K A;  5DAK A;  5AN1 A;  5ECI B;  4J2F A;  1XW9 A;  3TKS E;  2H0H A;  1OAZ A;  2M80 A;  5H5S A;  2LJR A;  20GS A;  4PUA A;  5ECN B;  3HYP A;  3IA1 A;  2WCI A;  3G7Y A;  2F8F A;  1AQW A;  4JU5 A;  1FVJ A;  3GYK A;  2LNT A;  2B7K A;  2CVD A;  5EL8 A;  1EP8 A;  1GUL A;  1GSQ A;  3WGD A;  3KEB A;  2RII A;  4KAE A;  5KN0 A;  3QFA C;  2PVQ A;  4LL4 B;  5ECH B;  5IIZ A;  4WR4 A;  4TVE A;  5AIX A;  4XTS A;  3QAG A;  6GST A;  3L4N A;  1DUG A;  10GS A;  5HR0 A;  4AJ6 A;  1LU4 A;  1O8W A;  1YJ6 A;  4L0U A;  3IHQ A;  3V1W A;  2C0D A;  5JCW A;  5B6N A;  1TRS A;  4MZC A;  1K0A A;  3M9J A;  2PU9 C;  4Q5N A;  2HT9 A;  4K0N A;  1JZR A;  2H6Y A;  2H0G A;  1AQX A;  4D73 B;  2R6K A;  2E0Q A;  1ST9 A;  3ZRD A;  2BJX A;  2CT6 A;  1QQ2 A;  3KGK A;  4DVC A;  2WS2 A;  2YCD A;  2N5B A;  4NHW A;  2I9H A;  2OKA A;  4KDU A;  4ZB6 A;  3KTL A;  2B5Y A;  1J0F A;  2L6C A;  4PX1 A;  2FUG 2;  5DDL A;  1ERT A;  3DML A;  1R26 A;  4DSS B;  3ZYW A;  4MK3 A;  2IN3 A;  4KDX A;  3TRP A;  4E8E A;  3PIN A;  3TJJ A;  2H66 A;  3P90 A;  1DE1 A;  3GHA A;  5JCU A;  2O85 A;  1A23 A;  2G0F A;  2V32 A;  4KCA A;  2FD3 A;  4NPB A;  3HD5 A;  3TGZ A;  2L6D A;  3IXR A;  2GSS A;  3SBC A;  3L9S A;  1J9B A;  3Q19 A;  4JR4 A;  3FZA A;  4RI7 A;  3IR4 A;  3HCZ A;  2V6O A;  5A4V A;  1HNC A;  5KEJ A;  1GSS A;  3FW2 A;  2FWH A;  1GSE A;  2F8A A;  4Q5Q A;  1TK5 B;  2VIM A;  2A2R A;  3TKR A;  3LEF A;  4J56 E;  4MH2 A;  5IMF A;  1M9A A;  3M9K A;  2YZU A;  1M7T A;  3KD0 A;  2VAF A;  2V41 A;  4KA0 A;  3CRU A;  1ACV A;  2ZUP A;  4HDE A;  1R5A A;  3UMA A;  4AJ7 A;  1G6W A;  1K0N A;  3APO A;  5C00 A;  3N5O A;  3ZIJ A;  2EIQ A;  2IWT A;  1GUM A;  5CRW A;  4GQC A;  5ECL B;  4OWY A;  2GDR A;  4K9Z A;  5IO0 A;  4F0B A;  1XWA A;  5EVO A;  1M2B A;  1SD8 A;  4ML1 A;  5B6M A;  3QR6 A;  1A2L A;  3QCP A;  5D9V A;  1M2A A;  4ZIL A;  3P7X A;  4ECJ A;  2QJK C;  4MA9 A;  5ECR B;  2GZP A;  1SKW B;  3FR3 A;  4CDO A;  2MYG A;  2PBJ A;  3UAR A;  1SL1 B;  5F0G A;  1TKD B;  1EP7 A;  1J08 A;  2GTU A;  1MEK A;  5J4U A;  1RQM A;  2FGX A;  5ECM B;  4HZ4 A;  1KBN A;  2KHP A;  3ZIV A;  3APQ A;  3J7Y b;  2OAD A;  1CQH A;  2GQL A;  2VLU A;  3VWW A;  2GLR A;  3H93 A;  2LNS A;  3MNG A;  2V1M A;  3HHV A;  1FVK A;  2DMM A;  1PRX A;  4MJC A;  3TKQ A;  2CZ2 A;  1ILO A;  2XHF A;  2DIY A;  3ERW A;  2CAI A;  3DKS A;  4WBR D;  3VWU A;  1TW9 A;  1AW9 A;  4ZIJ A;  2WSF J;  5HR2 A;  3WD6 A;  5DQS A;  1X9W B;  3UEM A;  11GS A;  4BVY A;  2VM2 A;  3W8J A;  2K8V A;  3GA4 A;  3GL3 A;  2K9F A;  2IFQ B;  1UC7 A;  3F3Q A;  2VCW A;  5HFG A;  1AQV A;  1K0M A;  4MLY A;  4V2M A;  4MDC A;  4ID0 A;  1A24 A;  3F6F A;  2WB9 A;  3UIW A;  1JLW A;  3CSI A;  2B6M A;  3HVX A;  2LEG A;  3GL5 A;  2X64 A;  3CBU A;  4BWQ A;  4TKY A;  1K0C A;  4XRA A;  5AIS A;  2YWI A;  4QL9 A;  1TDI A;  4I8B A;  1VF1 A;  3UBK A;  4QL7 A;  3W6G A;  1E2Y A;  1ZZY A;  2QJY C;  1SYX A;  3G7I A;  3IDV A;  2GQM A;  2VD1 A;  1ERV A;  4ZB9 A;  2GST A;  2RLI A;  4PXO A;  1GWC A;  1PN9 A;  1X5D A;  2F9S A;  2DLX A;  2H1G A;  2IMI A;  3QOU A;  3NIV A;  3VPQ A;  5GSS A;  8GSS A;  1S3D A;  2VCV A;  3CSH A;  3HJM A;  3ZMK A;  1AAZ A;  3DYR A;  5CO3 A;  3ZIT A;  1BJX A;  4K7I A;  2EC4 A;  4K1F A;  1MDI A;  1EV9 A;  2PMT A;  4EUY A;  4GQF A;  3BBY A;  3M0F A;  1H75 A;  2IME A;  2HE3 A;  3F8U A;  3GH9 A;  2OBK A;  5ELA A;  4ECI A;  9GSS A;  1OE8 A;  2QJP C;  2VO4 A;  1JB0 J;  1XXU A;  1NSW A;  3QD9 A;  4GSN A;  3J7Y k;  2CX3 A;  3HJP A;  5GZZ B;  4FH8 A;  1TRU A;  1Z7R A;  5DCH A;  3I69 A;  3MDK A;  3SWL A;  2LQO A;  1TI1 A;  5A4W A;  4JE1 A;  3FZ4 A;  2KLX A;  4OMV A;  3C7M A;  4TOP A;  3GRX A;  2PUK C;  5DAK B;  5G1L A;  1GTU A;  4ECC A;  2JU5 A;  3NZN A;  4PUF C;  4HI7 A;  2B3S A;  3VFI A;  4GRF A;  4KND A;  4KH7 A;  2R4V A;  1OC3 A;  3TKS C;  5A5K A;  4I97 A;  3EC3 A;  4IQA A;  2I4A A;  5DBQ A;  1XCC A;  2AJQ B;  3FKF A;  3FR6 A;  4IHU A;  1W4V A;  4TXV A;  2VCQ A;  2P0G A;  5DAL B;  2GT6 A;  5IPH A;  2K8S A;  3FRC A;  5JCG A;  1SJI A;  4RKU J;  2WGR A;  4MZB A;  3LXT A;  1K0D A;  2N5F A;  1AC1 A;  1FO5 A;  1A8Y A;  1YEX A;  5D73 A;  2XBI A;  2C80 A;  3FHK A;  2NTO A;  5KLI C;  3GKN A;  2H19 A;  5IMZ A;  3KZQ A;  2X8C A;  3ZZX A;  1F6M C;  3G9B A;  3M3M A;  3A3T A;  12GS A;  1SJ6 A;  1PL1 A;  3ZFB A;  2YWM A;  3EIN A;  3L9V A;  4MF6 A;  1I9D A;  4RQR A;  4ZBB A;  19GS A;  4I2U A;  4BVX A;  3CTF A;  1K3O A;  5FT3 A;  3LXZ A;  4KSO A;  4QQ7 A;  2X8G A;  3D4T A;  3ZML A;  2E74 B;  2VCZ A;  1SL0 B;  2LTK A;  2GVP A;  3EMP A;  1DE2 A;  18GS A;  4KUN A;  2H6X A;  2GGT A;  4WBJ A;  5ID2 A;  1U6T A;  5IMC A;  4MP4 A;  2H72 A;  4FIW A;  5LD0 A;  2HFD A;  3EWL A;  4N0Z A;  3IPZ A;  2RM5 A;  1FHE A;  2DSA A;  2WZ9 A;  4AF2 A;  4BL7 A;  1LBK A;  1XOB A;  2PN8 A;  2GT5 A;  4IBP A;  4Z7X A;  3WT1 A;  5CRH A;  4X1U A;  1XW6 A;  4MF7 A;  4OFM A;  5GAP D;  3US3 A;  1QK8 A;  3QDN A;  4ZL7 A;  4IS0 A;  3TOU A;  3L78 A;  2WSE J;  2DIZ A;  5IOW A;  1CQG A;  4PUR A;  2FY6 A;  4MCU A;  2BMX A;  3BCI A;  5IMA A;  1NHY A;  1ON4 A;  4J57 E;  1ZYE A;  3D6I A;  3ZVJ D;  3D4M A;  4MF5 A;  3TJG A;  4K2D A;  5H5R A;  1KEB A;  2R3X A;  1O7U A;  1JHB A;  3E0U A;  1YEP A;  2X99 A;  4KE3 A;  1Z6M A;  3KMN A;  1B4P A;  2TIR A;  2MZC A;  2YV7 A;  2LV3 A;  3D5J A;  2C1Y A;  2HNL A;  2L5O A;  2HRN A;  4V1A p;  5IM9 A;  2H0I A;  5JWQ B;  1K3L A;  1K0B A;  3KH7 A;  4DSR A;  3O76 A;  2PVO C;  1B8X A;  1GLQ A;  3U5R E;  5F06 A;  3EUR A;  3K8N A;  1A0R P;  4O32 A;  1TK8 B;  1EEJ A;  2JZR A;  3KJY A;  2FWE A;  4ULX A;  4WR5 A;  1GSU A;  3UVH A;  3GUR A;  3CSJ A;  1ZOF A;  1WRY A;  2HSY A;  4TR1 A;  1ERW A;  2WDU A;  3KMO A;  3DRN A;  1JZO A;  4I5Q A;  22GS A;  1BYE A;  3QAV A;  1IYI A;  2RUE A;  3HJO A;  2P5R A;  4GCI A;  2YOI A;  2HYX A;  3A2V A;  1AUC A;  3GKM A;  4PV1 B;  1JFU A;  6GSX A;  5DQY A;  5B7C A;  2PER A;  2O01 J;  1SL2 B;  6GSU A;  1XBS A;  4V2L A;  4I2T A;  1Q90 D;  1FOV A;  2D2C B;  3F9U A;  2MBS A;  1Z9H A;  2K18 A;  1YZX A;  1Z3E A;  4GWR A;  2DJ1 A;  4NXI A;  2ON5 A;  3L0H A;  1USB A;  1O6J A;  1PKZ A;  4HU9 A;  3ERG A;  3WGE A;  3TKS A;  5IPG A;  1OC9 A;  3EVI A;  2QGV A;  1G7O A;  3DIE A;  4IJI A;  2WRT A;  2F51 A;  1QUW A;  16GS A;  5J9C A;  1Y25 A;  3M1G A;  1XFL A;  1RW1 A;  3HVV A;  5G5E A;  2VLT A;  1SKR B;  3FEU A;  4D73 A;  1A2J A;  2O87 A;  4HOJ A;  1ZGN A;  4P3Y B;  1WJK A;  2FCH A;  2E7P A;  4MPG A;  2XC2 A;  1SK2 A;  2I3Y A;  1X9M B;  2B5X A;  2E2G A;  2KUC A;  5EPF A;  1XWK A;  4YQV A;  1F37 A;  5KKZ C;  2FA4 A;  4ACS A;  3RHC A;  4KSM A;  3BCK A;  1EOG A;  3D0Z A;  4EKZ A;  1XOA A;  1THX A;  4YQM A;  3VK9 A;  3Q18 A;  1YDK A;  2LRN A;  3C1S A;  4DEJ A;  1W89 A;  1YQ1 A;  5ECK B;  3F4S A;  2YZH A;  4ML6 A;  2CZ3 A;  5COH A;  3OR5 A;  4ZXG A;  3DVX A;  4PQH A;  3IAM 2;  2YJ7 A;  3EU3 A;  2HZF A;  2V2G A;  5JWO B;  3ZVJ A;  2D2Z A;  2I1U A;  2VL2 A;  3MWH A;  3H1N A;  2B5E A;  5F07 A;  3IAS 2;  1PX7 A;  1PL2 A;  3GX8 A;  2YWO A;  5B8B A;  3UAP A;  3EU4 A;  1ZL9 A;  3GKK A;  2VUP A;  4G19 A;  2XPD A;  3EYT A;  4Y28 J;  3GTU B;  4EDY A;  2IMK A;  2H30 A;  4H44 B;  4NHZ A;  4GXZ A;  1O85 A;  4LLR A;  2X8H A;  3F3R A;  2H01 A;  4NWY A;  3CRT A;  2AV4 A;  3LGC A;  4PNG A;  2H1A A;  2H8L A;  3S9F A;  1V58 A;  3LYP A;  1SD9 A;  5ECO B;  1A2M A;  2IL3 A;  3FK8 A;  5LCZ A;  2Z9S A;  3R2Q A;  5KN1 A;  3KIJ A;  3WYW A;  2H1D A;  4XS1 A;  5F05 A;  5G31 A;  2VM1 A;  4MH3 A;  2MMN A;  4OO5 A;  2BTO T;  1PQN A;  2H1B A;  1U3A A;  4IP6 A;  2WFC A;  4OCF A;  2LKU A;  3LYK A;  3GMF A;  1VF4 A;  4IKH A;  3RHB A;  1OKT A;  2PPT A;  3IOS A;  1N8J A;  2L5L A;  4IW9 A;  1X5E A;  1YKC A;  2HI7 A;  1VF5 B;  1Q4J A;  2F3M A;  3PGT A;  5HFI A;  4PGT A;  5ELG A;  4PQI A;  3BD2 A;  4TXO B;  2L4C A;  1OE7 A;  4OFT A;  1QFN A;  5G5F A;  1G0T A;  4X43 A;  3HDC A;  3UVT A;  1TU8 A;  2DBC A;  1NHO A;  1F3A A;  4JRR A;  1YKA A;  2YPM A;  4ZB8 A;  1PGT A;  2FNO A;  1R5P A;  1T7P B;  1PA3 A;  3ME8 A;  4MJE A;  4KB3 A;  3RAZ A;  5GAN D;  2KP1 A;  3AY8 A;  2OE0 A;  1BAY A;  1QGV A;  3C71 A;  4BA7 A;  1WWJ A;  3VWX A;  4Q5F A;  1GSF A;  1TRW A;  2HSH A;  4L5O A;  4IP1 A;  4BPY A;  5CP1 A;  1DSB A;  2AAW A;  3GKX A;  4G9H A;  3ZL5 A;  1WOU A;  1SJZ A;  4ISD A;  2H74 A;  1WIK A;  3E3E A;  5B8A A;  2P31 A;  4V1A g;  5D9T A;  1A8L A;  4RI6 A;  1FG4 A;  2HXK A;  1MDK A;  2VL3 A;  5D93 A;  1GUH A;  1NM3 A;  2H75 A;  4EL1 A;  3CXG A;  4IN0 A;  1Q98 A;  2E75 B;  1XVW A;  4OCE A;  3TUE A;  3IE3 A;  1B48 A;  3TRQ A;  4E8H A;  5HQP A;  3CMI A;  2IJY A;  3UOM A;  1AXD A;  6GSS A;  4XS4 A;  1UA5 A;  3QPM A;  4HQZ A;  5D9W A;  4L5L A;  2QIW A;  2GS3 A;  4I6X A;  3UL3 A;  2B1K A;  3C1R A;  1V9W A;  3GSS A;  4XCS A;  4K7N A;  4IL6 X;  4F0C A;  2IFQ A;  5ID2 B;  3I6A A;  2CV4 A;  4MAB A;  3TJB A;  3H8Q A;  2JAD A;  4HQS A;  1GSY A;  5L8R J;  4POK A;  1GTA A;  4TR0 A;  2K6V A;  4WF5 A;  3QAW A;  3ZLP A;  3F4T A;  4OO4 A;  4HS1 A;  3IC4 A;  1T4Y A;  2CX4 A;  3WT2 A;  1M99 A;  4K8M A;  3KP8 A;  2AHE A;  1K0O A;  1F3B A;  4XIH A;  1BED A;  2MBT A;  1GRX A;  2HZE A;  3LW5 J;  4XRD A;  1I5G A;  1U88 A;  1TP9 A;  4EC0 A;  3GST A;  2LQQ A;  2GSR A;  2GZY A;  3CTG A;  3WGX A;  5AGY A;  5ENU A;  2C8U A;  3MAK A;  4L8E A;  4H13 B;  1THO A;  3FZ5 A;  2CQ9 A;  3BOA A;  4JBB A;  4POB A;  2JSZ A;  1V40 A;  4HZ2 A;  3HXS A;  5E4W A;  2LRT A;  2OAC A;  5JWR B;  2OE1 A;  1V57 A;  3RPN A;  1RK4 A;  1T00 A;  3C8V A;  2P5Q A;  1OKD A;  4TR3 A;  14GS A;  2B7J A;  2HLS A;  1YY7 A;  2YAN A;  5DVB A;  5IO2 A;  4PQ1 A;  4WEY A;  3VI7 A;  4NAX A;  2MMZ A;  1JZD A;  3F63 A;  7GSS A;  2IMF A;  4POL A;  1WPI A;  2KOK A;  2V6K A;  1X9S B;  3QMX A;  1VRS D;  3TJF A;  2NDO A;  1SKS B;  4LA1 A;  2DJ3 A;  2YV9 A;  2WJU A;  1XWG A;  4GSS A;  5G2Z A;  5LNK e;  2L57 A;  4XS6 A;  1GSD A;  1BX9 A;  3UBL A;  3C73 A;  3RPP A;  1XW5 A;  5D8I A;  5ABR A;  3KCM A;  5CYY A;  3VLN A;  1YF0 A;  4HU7 A;  5CNW A;  2WSC J;  5ECS A;  4LMW A;  3ISO A;  4MMM A;  1X0R A;  2C3T A;  2VLV A;  2R37 A;  1TU7 A;  1F2E A;  5J41 A;  3IV4 A;  4POM A;  6GSY A;  1WP0 A;  4WXT A;  4N11 A;  2YNX A;  5DAL A;  1TI3 A;  3HZ4 A;  1OC9 B;  4YAP A;  1ZRT E;  2AUV A;  3GH6 A;  3GFK A;  5ECQ B;  3FY7 A;  3FZ9 A;  1XPV A;  5IQY A;  5F8B A;  1M0U A;  2GSQ A;  2CA8 A;  2VL9 A;  4OGQ B;  1XWB A;  1OYJ A; 
#chains in the Genus database with same CATH topology
 3DXB A;  1SQX G;  2A45 I;  4MZW A;  2NPS D;  2M3B A;  3M06 A;  1EWX A;  4IL6 H;  3E7K A;  4K7O A;  4NV2 A;  4EXJ A;  1YIJ P;  1VQ6 P;  1BDD A;  4FO5 A;  3W67 A;  1P84 I;  1T3U A;  1EGO A;  1S5L H;  2DJ2 A;  5L71 A;  3JCM L;  2QSI A;  3TOT A;  1HNB A;  2OYI B;  1TTZ A;  3UJ1 A;  2IPA A;  1JZW A;  1Q7Y Q;  2MMA A;  1GLP A;  2XND H;  3TKP A;  1KQL A;  2JR8 A;  3IAO A;  1NOH A;  4B86 A;  1KIL D;  1BSN A;  2N5A A;  2BCC D;  3CCU P;  1LTI C;  3R2P A;  1JLV A;  2C3Q A;  3F6D A;  4WKW A;  2CVK A;  5IOX A;  3CQF A;  1KN7 A;  4FYC A;  4PNF A;  3KH9 A;  1K73 Q;  4DT0 A;  4KGI A;  4MPF A;  2J9H A;  3GN3 A;  1S3C A;  1EC5 A;  2C0G A;  3H1L G;  2LJK A;  1S5L E;  1IFM A;  3H1I D;  3IK7 A;  4PD4 I;  1FOS F;  3O6T A;  5A4U A;  3RDW A;  1VF3 A;  1SQV K;  1USE A;  2OA7 A;  4F9Z A;  5DJM A;  2AB6 A;  2XV5 A;  5G30 A;  4H44 C;  1N73 B;  2OYH C;  4V2N A;  2N1T C;  1M7L A;  3KDP B;  4D6T D;  1TK0 B;  3V2R A;  1URM A;  3H4K A;  5H5Q A;  4BWS A;  5J3R A;  1SEN A;  3FGA D;  1IK9 A;  3A5W A;  1QEX A;  1XVQ A;  2R5G A;  2O89 A;  3AEE C;  2QC7 A;  3TRX A;  4WWI A;  3AE9 C;  1BGY D;  3V2P A;  2G2Q A;  4JQ0 D;  2KP2 A;  2IYP A;  2DML A;  1EZK A;  2YN1 A;  1T3B A;  3C8E A;  4ZBA A;  4WY4 C;  2MMO A;  4KW6 A;  2R3C A;  4BRY B;  1GH2 A;  1LTJ A;  1GL8 A;  1M9B A;  1UVZ A;  4LC1 A;  2Z5H A;  2EIO A;  2XBQ A;  3ZRE A;  3CWB G;  4UB6 H;  5KLV G;  4O5R A;  3B5N A;  1N7S A;  4C7N B;  3P8W A;  1YTZ I;  4N30 A;  1ZXG A;  3LQ7 A;  4WB4 A;  4EVM A;  1FE6 A;  2GQK A;  5BU5 A;  2NPB A;  3VWV A;  1YQ4 C;  1R4W A;  2A45 G;  3P8C E;  4N78 D;  1SLQ A;  1HQO A;  3TB2 A;  5IMV A;  1JTH B;  1UII A;  4WVZ A;  3PH9 A;  3AE1 C;  4EDZ A;  3HUS A;  5AVZ B;  2FYN C;  3P7K A;  2OE3 A;  4L0W A;  2V7Q J;  1TOF A;  1Z56 A;  2K9Y A;  3UIA A;  1PKW A;  4XA4 A;  4G10 A;  1R5L A;  3E1I A;  3TNU A;  1Q81 Q;  4Q5R A;  3U6V A;  4UB6 E;  1GP1 A;  4HYT B;  4N0V A;  3VUR A;  1O81 A;  1BG5 A;  3H79 A;  4KDY A;  3VI5 A;  2QVA A;  2Y0C A;  1BQ7 A;  1EOH A;  3GF7 A;  4HEA 2;  4TW5 A;  2W8Z A;  3EMX A;  4AJ8 A;  13GS A;  2P67 A;  3HKR A;  3FR9 A;  3BCC E;  2H76 A;  1V98 A;  6GSV A;  3L75 J;  4IGJ A;  5CCG C;  1G6Y A;  2NBS A;  1G7E A;  4H86 A;  4K6X A;  1AIU A;  4AGS A;  1MD4 A;  3CI9 A;  1SK0 A;  2WUL A;  2N9B A;  2AEJ A;  1GTB A;  1PGP A;  5HFK A;  3LSZ A;  1OIP A;  1Q82 Q;  1YYC A;  1KMI Z;  2K9J A;  4DSS A;  1EDL A;  2YIU C;  2M46 A;  3M8N A;  3G7J A;  1XIY A;  4DSQ A;  1GL2 D;  1Y47 A;  2O7K A;  3H32 A;  1KNG A;  1GTI A;  5KJ7 A;  3HY2 A;  5HR1 A;  4TR4 A;  1PSQ A;  1SK1 A;  4OD7 A;  3L73 G;  1KOR A;  2Q1K A;  3TSI A;  1T4Z A;  1PP9 J;  3L74 E;  1X5C A;  2CPS A;  4TLF A;  4KT0 J;  4AQR D;  2FWG A;  3H1J G;  2C4J A;  1WT6 A;  5DJU B;  2C0F A;  2PGT A;  2RKL A;  2E2M A;  2M0B A;  2YO2 A;  1IO4 A;  1GD2 E;  1NTM G;  2FA8 A;  2ZYG A;  2OJL A;  4FYU A;  3ABV C;  4WET A;  2H71 A;  4U3F G;  1NTZ G;  5C04 A;  5APY A;  2CPB A;  2FYU G;  1FZC B;  2E75 C;  1SQP J;  1EGR A;  1KYO H;  2A06 G;  3PRJ A;  4NV5 A;  4LL1 B;  1FAA A;  3HE4 A;  3P8M C;  2FKW B;  4K35 A;  4ILF A;  4NMU A;  2DKI A;  1VGL A;  1R7H A;  3TDG A;  3VN0 A;  2CVB A;  2VD0 A;  2LUS A;  3IRA A;  1L0N J;  2O1K A;  3AEC C;  3ME7 A;  1ZCP A;  3TGU G;  1DBY A;  2KUB A;  2Z5I A;  3HTK A;  1YHQ P;  1SQX E;  2IDB A;  4I7Z B;  2VCT A;  4X0X A;  1FZE A;  2OYO A;  1N2A A;  2JJL A;  1B9Y C;  4N10 A;  4IEL A;  1EZV I;  1ZW0 A;  3E9J B;  3HD7 C;  1HD2 A;  3MD0 A;  1B4Q A;  2FHE A;  2NPS A;  3O3T A;  4YH2 A;  1GK6 A;  2E5T A;  1KYO E;  2E5Y A;  4F2I A;  3LG6 A;  1ZV8 A;  3OAK A;  4XFJ A;  3L75 D;  1PMT A;  2GZZ A;  4K5S A;  1JNM A;  3CC7 P;  1GK4 A;  3RK3 C;  4O92 A;  5D9X A;  1KFN A;  1XWC A;  2YMY A;  2FLS A;  2TRX A;  3A0H E;  3HE5 A;  1OC8 A;  3F0I A;  3LFL A;  4JF7 A;  3L72 G;  2CAQ A;  4XS4 B;  1E6B A;  3H1K J;  3ZFL A;  3GNJ A;  2L5G B;  4IJ3 A;  5INY A;  1USD A;  3EFF K;  3CYN A;  2I81 A;  1KIL A;  1T8Z A;  3Q5R A;  1LP1 A;  1MDJ A;  2YP6 A;  5HR3 A;  3F4R A;  3KM6 A;  1H0T A;  1PP9 D;  2JAC A;  3GV1 A;  5AVR B;  2LS5 A;  4ZBD A;  3MSZ A;  3ZTL A;  1ZYQ B;  1HNA A;  2ON7 A;  2R3S A;  1UN2 A;  3H1L E;  2XPE A;  2XU6 A;  1EEM A;  4Y99 B;  2DJK A;  4MJB A;  3PTZ A;  2UZ8 A;  3Q6O A;  3USS A;  3L9U A;  2LJA A;  4ZL8 A;  3RK2 C;  4Z2T A;  4HUA A;  3Q74 A;  1Z7P A;  2B9B A;  1RF1 B;  2LST A;  3M0D C;  2FXP A;  1TJD A;  5DJL A;  4HJ2 A;  2HFE D;  4YQU A;  5ECP B;  3DWV A;  3BJ5 A;  1SQP D;  1CZQ A;  2KSJ A;  3HZ8 A;  2KZJ A;  3SWY A;  2ZT9 B;  4XHM A;  1PPJ D;  2ZCT A;  17GS A;  1PX6 A;  1H89 A;  1GNW A;  1M1J B;  3DEX A;  1KTE A;  1ML6 A;  2A45 H;  2WPQ A;  2P7J A;  5TIS H;  3A2W A;  2RUF A;  4YKF A;  1JCC A;  1WE0 A;  2H89 C;  1L0N D;  4RUV A;  2QKE A;  2EIR A;  5DCG A;  2P2U A;  2L59 A;  3DVW A;  4DJG A;  4ECB A;  1E5W A;  3KTB A;  5AVV B;  5D96 A;  1G1J A;  2HZE B;  1SU9 A;  1WMJ A;  1P84 H;  2REM A;  2IPP A;  3D21 A;  1L4A D;  1RF0 C;  2HYN A;  4Z1M H;  1B9X C;  3CWB E;  4ZNC A;  5APU A;  5KLV E;  4ZL9 A;  1QXH A;  5FWG A;  2OBI A;  1HYU A;  2YJH A;  1MV8 A;  4GF0 A;  2QM7 A;  1MD3 A;  5KN2 A;  2E42 A;  1IZN B;  1H4O A;  3VPT A;  3IBH A;  2WWW A;  1NW2 A;  2AEF A;  2TRC P;  1SYR A;  3HA9 A;  5E59 A;  2C0W A;  4CHS A;  3LJR A;  1F9M A;  2K88 A;  1KB9 I;  3I9V 2;  1LJR A;  2H6Z A;  2WSF H;  5AW4 B;  1EZV G;  3D22 A;  4KX4 A;  3IK9 A;  1YBK A;  1FB6 A;  2XNX A;  1NU1 G;  4GST A;  3H1K D;  1NTK E;  4N6J A;  1L0L J;  2YWN A;  1P84 E;  4Z2U A;  1J1D B;  3KP9 A;  1Y8A A;  5CJ0 A;  1K3Y A;  4PD4 H;  4PTS A;  4W7Y A;  4YXD C;  5BMU A;  5EY6 A;  1JMB A;  5CCH D;  3RK3 E;  3IFM A;  1IFD A;  2PWJ A;  1XZO A;  3P2A A;  4AYC A;  1AV1 A;  1D7M A;  1X8Y A;  3L73 D;  1QMV A;  3KQG A;  2DJJ A;  1A0F A;  2A4V A;  5IMD A;  1OZH A;  1PGJ A;  4F03 A;  1BE3 J;  3GTU A;  2KXP B;  1Z5Y E;  3VP8 A;  2OYH A;  1EXI A;  2N1T A;  1E79 H;  1JMM A;  2HRF A;  3ERF A;  4FYB A;  4JED A;  3PR8 A;  3QFB C;  1DH3 A;  2Q3I A;  4EDF A;  2M3E A;  1DEE G;  2OTJ P;  4PD4 E;  1ERU A;  2M72 A;  4WBA A;  5J5N A;  1ABA A;  2DC5 A;  3DD3 A;  3GUS A;  1LT1 A;  1ZMA A;  2NRG A;  1GL2 A;  3N9J A;  1C72 A;  2POH A;  2R2J A;  3RL0 B;  3FYG A;  2VOC A;  3G4S P;  3AE8 C;  2ES7 A;  4IOI H;  1S5L X;  1KV4 A;  2JZS A;  4YTP C;  3MUD C;  3H1J E;  3RBX A;  3NOF A;  3LWA A;  1J1E B;  2L4Q A;  2A2S A;  4EO3 A;  2KLU A;  1Z6N A;  3GX0 A;  4O7H A;  3APS A;  4MJA A;  4F82 A;  3SWF A;  5CRG A;  1NTM E;  1YF1 A;  1MTC A;  5CRE A;  1AQ5 A;  1NTZ E;  5AVY B;  1RE3 C;  5J9B A;  3RL0 g;  3CL3 D;  1T1V A;  2FYU E;  5AIV A;  1FB0 A;  1VF2 A;  2A06 E;  2WSS H;  4EF0 A;  2E74 D;  3W8S A;  3T97 B;  1OVN A;  1PD2 1;  4HB1 A;  5FHI A;  2JSY A;  1LT9 B;  1AQT A;  1NAF A;  2IMD A;  4C7R A;  1IYH A;  4IQ1 A;  3FX0 A;  2C0E A;  1GZL A;  1L0L D;  4EIJ A;  1IC2 A;  3DGQ A;  1FW1 A;  2O8V B;  2WPV B;  4OGQ C;  2H73 A;  1O73 A;  1HGV A;  4TXO A;  4GLT A;  2VCX A;  5GST A;  3ZDM A;  2RM6 A;  1VQL P;  4IVF A;  4G2E A;  1URQ B;  6GSW A;  4GIF A;  4GTU A;  4YAV A;  1W2B O;  2NVL A;  4JR6 A;  1SP4 A;  1T8E B;  1S3A A;  1V2A A;  4HJM A;  3WUV A;  1EV4 A;  2ALB A;  2FWF A;  1BE3 D;  4KCE A;  1QL1 A;  4H0L B;  5CCG A;  3SSU A;  1YQ3 C;  1SQP K;  4ASW A;  2OYI C;  4CW9 A;  1BCC G;  3L72 E;  2QG4 A;  3HVS A;  2QJY B;  3CME P;  1N7S D;  5KN3 A;  2AYT A;  1SQQ J;  4TN8 A;  3LOR A;  1L0N K;  1GNE A;  1U3I A;  2H70 A;  1FDO A;  4HSC X;  3A2X A;  3WUU A;  4M3L A;  2B1L A;  2J23 A;  4WF4 A;  3A0B H;  5AVU B;  3LW9 A;  2KYV A;  1XG8 A;  1TXX A;  4GOE A;  3OJA B;  3TCO A;  2XKM A;  2E76 B;  4HH2 A;  1UIX A;  4EE0 A;  2JZT A;  3GIX A;  4TRX A;  3CX5 I;  3EE2 A;  1HBW A;  2ZNM A;  1N73 C;  3Q5P A;  1U87 A;  2VL2 C;  3ED3 A;  3KXO A;  4LMV A;  2C3N A;  1YJW P;  3I43 A;  4TR1 B;  1GUK A;  3TJK A;  5CAX A;  1NHL A;  5CRD A;  3GHG B;  2OAR A;  2Q7C A;  4ZKP A;  2IIY A;  4K0G A;  1QVG O;  4RQX A;  1Y6E A;  3LIE A;  1O8X A;  1M2D A;  2JL4 A;  3WMM 0;  3A0B E;  3RBT A;  2LRC A;  2DJ0 A;  1NKZ B;  4OFN A;  4JZQ A;  1TRV A;  2QJP B;  5G1K A;  5DAK A;  5AN1 A;  5ECI B;  4HKZ H;  4J2F A;  3AE6 C;  1XW9 A;  1S9K D;  1SQV E;  1X22 A;  4EIQ A;  3TKS E;  2H0H A;  2PGD A;  1OAZ A;  2M80 A;  5H5S A;  2LJR A;  20GS A;  4PUA A;  2GUS A;  4NPD A;  3CD6 P;