2QSIA

Crystal structure of putative hydrogenase expression/formation protein hupg from rhodopseudomonas palustris cga009
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
PTLVDEATVDDFIAHSGKIVVLFFRGDAVRFPEAADLAVVLPELINAFPGRLVAAEVAAEAERGLMARFGVAVCPSLAVVQPERTLGVIAKIQDWSSYLAQIGAMLAEVDQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrogenase expression/formation protein hupG
publication title Structure of putative hydrogenase expression/formation protein hupG from Rhodopseudomonas palustris CGA009.
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 23
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07449 HyaE Hydrogenase-1 expression protein HyaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qsiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2qsiA01
4ZB6A 4ECCA 4MH3A 2DJ0A 6GSWA 3TJBA 5IOWA 1JZOA 5J5NA 1UA5A 5F06A 5ECMB 3G7YA 4KNDA 4XIHA 4KW6A 4IBPA 3L9SA 4RQXA 1TI3A 1FAAA 3C8VA 1QFNA 3C1SA 4ULXA 2GQLA 1TTZA 2G2QA 5ELGA 5KN3A 1NM3A 2X8HA 3AY8A 1FVKA 2A2SA 2C0EA 3FR9A 2E75B 3VWXA 2EIRA 5DVBA 3SBCA 1SKWB 4X1UA 1TK0B 2H19A 4HJ2A 2HNLA 3TOTA 2H6XA 1GTAA 5IMZA 2IFQA 1UVZA 2BMXA 3L9VA 2PN8A 2I81A 1SJ6A 5A5KA 3TRXA 2VCXA 4XCSA 3Q6OA 1E6BA 5FWGA 16GSA 4G2EA 2R37A 3P7XA 1YKCA 3UMAA 2GTUA 4NMUA 1K3OA 2IMIA 4EDZA 5E59A 4LA1A 18GSA 4XS4A 1AQVA 4WBRD 3EYTA 2K9FA 1XPVA 2H66A 4I2TA 5EY6A 3WT2A 6GSVA 2F9SA 1ERUA 3HZ4A 1EV9A 4PV1B 1PSQA 3GA4A 4TVEA 3UJ1A 3GX8A 2YZHA 3CSJA 7GSSA 1DE1A 4PQIA 1A2LA 3P8WA 22GSA 4EXJA 4PX1A 1URMA 4EUYA 1SL2B 19GSA 4XHMA 2JSZA 2NDOA 1AIUA 2WGRA 3CSIA 4PGTA 4YQMA 1SK1A 1WRYA 5CP1A 2GDRA 4X0XA 4POKA 2H72A 2MBSA 2FY6A 3C1RA 1O81A 4ZL9A 1T4YA 2VD0A 3BCIA 1TKDB 1AW9A 4YAVA 1O73A 4K7NA 4KSMA 4HDEA 4FIWA 4KT0J 3ISOA 3GX0A 1XW5A 1AQXA 3I43A 4J56E 1QGVA 1K0AA 2DSAA 1USBA 3GN3A 5AIVA 1LBKA 2H76A 2X8CA 1C72A 2B1KA 3DD3A 3M3MA 1GNEA 2HRFA 2H71A 4X43A 5ECSA 3TRPA 1XWCA 6GSYA 1SKRB 2VCVA 1YY7A 1G7EA 1EOGA 5KEJA 5F8BA 1KBNA 5GZZB 2LNTA 5F07A 2IN3A 1SK0A 4MZBA 3EU3A 2YOIA 3D0ZA 2DIYA 2RIIA 4IELA 2XBQA 1TJDA 4DEJA 1A2MA 1HNBA 2IMEA 2XPDA 10GSA 3R2QA 4TXVA 5G5FA 4PQ1A 1X9SB 3LXTA 4GCIA 1V58A 4JU5A 1S3AA 2DLXA 5IO2A 2E2MA 1ZZYA 4NHWA 2K9YA 4MJCA 3W6GA 1GP1A 2HRNA 3H8QA 2P31A 1FW1A 1V98A 2VD1A 1U88A 2ZCTA 3KGKA 4G10A 3EVIA 4L0WA 4P3YB 1PA3A 2TRCP 3ZITA 4AGSA 3KMOA 1SJZA 2E0QA 3VURA 2QJKC 2VLUA 3MSZA 3QPMA 3A2XA 3EMXA 5CYYA 1ZYEA 5IPHA 3I69A 1XXUA 3VI7A 2YANA 3QAVA 2F8AA 1MDIA 2NTOA 1FOVA 2VAFA 2YJ7A 4Q5RA 2TIRA 4F9ZA 1KTEA 5AISA 2FWFA 2VLTA 2GQMA 2HXKA 1K0DA 2O89A 2RM5A 5C04A 1Z7RA 3GSSA 2LNSA 2JSYA 3QD9A 3ZLPA 4TKYA 3FW2A 1THXA 1OYJA 4CHSA 4HU7A 3E9JB 5ECQB 4RI7A 2CX4A 2HFDA 2VL3A 4V2NA 1GSUA 1XWKA 5DBQA 3UL3A 3EINA 4NXIA 4IP6A 4MMMA 4PUFC 2JADA 1V9WA 3G7IA 4TR1B 4H44B 3J7Yb 4KAEA 4POLA 1MEKA 1CQHA 3APQA 4BWQA 3IHQA 1GTBA 1O7UA 2L5LA 2R5GA 3CTFA 4OCEA 2VLVA 3HHVA 1ZMAA 2VL2C 1EGOA 5EVOA 2C1YA 3FZ4A 2FUG2 1PN9A 3BJ5A 3FR6A 1SL1B 2IMFA 2L4CA 1M99A 2GSTA 2EC4A 3ZIVA 1E2YA 1AC1A 1F3AA 4IN0A 2VM1A 4K8MA 4MH2A 4DVCA 1I5GA 4OGQB 4I6XA 3GIXA 2GVPA 1M7TA 5J9CA 4XS6A 1YDKA 1ON4A 4HQZA 3O6TA 5B6NA 4TN8A 1ZOFA 4JE1A 3IDVA 2VCTA 3KJYA 3TCOA 1ZGNA 1MDJA 1YZXA 3BCKA 4KH7A 3TB2A 4MP4A 2YWMA 2FNOA 2IL3A 5KLIC 2LEGA 4DSRA 2DJJA 3FYGA 3E0UA 3FRCA 1THOA 4GTUA 2YWNA 3FZ5A 2LQOA 4FYUA 1XW6A 4RUVA 5EL8A 1SD9A 4EKZA 4HS1A 1A23A 2I4AA 3ZFLA 2NBSA 5G1LA 1WOUA 4MF7A 2ES7A 4F82A 4K2DA 4ZBAA 3GFKA 6GSTA 3GSTA 11GSA 3GKKA 4TR1A 3TUEA 1PRXA 1GLPA 1J9BA 1JZRA 1O8XA 2FYNC 3WT1A 3H4KA 4N11A 1M9BA 5LNKe 3RHCA 3I6AA 4EC0A 3DXBA 1KEBA 4IW9A 2C3NA 3DVWA 2IMKA 3D4TA 3IPZA 3RBTA 2L6DA 1T3BA 4PUAA 3A2WA 1ERTA 1UN2A 5D9WA 5IMAA 4LMWA 5A4WA 2IWTA 1B4PA 1U3AA 5GSSA 5ECIB 2VO4A 3LJRA 1BX9A 5FT3A 1ZYQB 2C80A 1A8YA 2FD3A 3LFLA 5KKZC 3DVXA 3J7Yk 2FWEA 3M8NA 1HYUA 4OO5A 3FKFA 1RW1A 2XBIA 4K6XA 4N0VA 4KUNA 3VFIA 2OA7A 1GSYA 3RDWA 4O92A 3SWLA 2HZEB 4H13B 4MDCA 4MK3A 2F51A 2QSIA 2L57A 3UARA 4MCUA 4KSOA 4CDOA 5HFIA 1GUKA 4L0UA 1J08A 1I9DA 2DMLA 4KGIA 20GSA 3QFBC 3KEBA 1M2DA 2I9HA 2YPMA 4ZL7A 1G6WA 2V1MA 3GUSA 5A4VA 3F9UA 3GRXA 4I5QA 3HD5A 4WXTA 5DAKB 2JZRA 4GSSA 6GSXA 2WDUA 3H1NA 4YQUA 3DGQA 4IKHA 2YJHA 2DC5A 2V32A 3VLNA 4MZCA 4XTSA 1FG4A 4JBBA 2GZZA 1S3DA 4V2MA 4G19A 1G0TA 1PKZA 2H30A 3K8NA 1WWJA 4J2FA 4LL1B 3IE3A 3ZMKA 2NVLA 5B6MA 1T00A 2C4JA 4EO3A 2WSFJ 5G2ZA 1X5DA 5J9BA 2WJUA 1EZKA 2L6CA 1X5EA 3N9JA 1AUCA 2MZCA 1MDKA 5JCUA 1WP0A 5IMCA 4NAXA 3DEXA 2VCQA 5DALB 1Z7PA 2RUEA 3DYRA 5DJLA 1CQGA 1B48A 3M9KA 1TRWA 2GS3A 4DSSA 1G7OA 1F2EA 3CMIA 4AJ7A 4D73B 3GURA 3L9UA 2MMZA 4ECBA 1HD2A 4FO5A 2HZEA 4HJMA 1HNCA 3F8UA 3L78A 3CYNA 2R4VA 1XCCA 1EEJA 2O8VB 1TRUA 4IP1A 3GTUB 4QL7A 2XPEA 2VM2A 2A2RA 1KNGA 1AQWA 3QOUA 4Y28J 2VL2A 4KE3A 1SJIA 4ML6A 1GRXA 1OC8A 1GUHA 2H1AA 3IA1A 5DAKA 5H5RA 1OE8A 1A2JA 2C8UA 3HVVA 3LGCA 4IJ3A 1GTUA 2CA8A 3JCML 5D96A 4TR4A 3FK8A 3F6DA 3ZIJA 5IMFA 4O7HA 3VK9A 1F37A 2VCZA 2PGTA 3GMFA 4WF4A 2M46A 1AAZA 1K0BA 1Q98A 1GL8A 3BD2A 3P2AA 1OC9B 3ZTLA 1LJRA 4GWRA 1JB0J 1VRSD 2L4QA 5ECKB 2MMOA 1JZWA 2REMA 2FA8A 1XWGA 1O6JA 3W8JA 2V6KA 3KMNA 1FHEA 2YWIA 3UAPA 4OD7A 3CRTA 1GNWA 3F63A 2KP1A 1FB6A 3ERGA 4HU9A 2LTKA 3FEUA 1TU7A 4OCFA 2WULA 6GSUA 2PMTA 3NZNA 3DIEA 4WF5A 4JR4A 4IVFA 2R3XA 3PH9A 5CNWA 5ECPB 2AAWA 1H75A 3ERWA 1T4ZA 5ECLB 3KTBA 2HSHA 2FLSA 3F0IA 4WEYA 4EDYA 5JWQB 1O8WA 3C71A 2PBJA 1HNAA 2YCDA 5F0GA 1EOHA 4NV5A 1GSSA 2PWJA 2QJPC 3TJGA 1TRSA 1V2AA 2J23A 1VF3A 5IMDA 3ZFBA 5LD0A 3UVHA 3GYKA 2DBCA 4HZ4A 2CQ9A 3WYWA 2KOKA 3A2VA 1YQ1A 2FHEA 2CVKA 5J4UA 1IYIA 4KCEA 4PQHA 3IBHA 2EIOA 3QFAC 4IS0A 3U5RE 2WRTA 4HOJA 1GULA 3O76A 3ZVJA 4DSQA 4WBJA 2O85A 3GKMA 4OWYA 2N5AA 3F3QA 4K9ZA 1TW9A 2WSEJ 1M0UA 4NHZA 3GNJA 3QMXA 3US3A 1GTIA 1XVQA 4JRRA 2B7KA 3KH9A 2H0GA 2FWGA 1NW2A 2GT5A 2WFCA 2HT9A 3G7JA 2KP2A 4POBA 4GQCA 2CZ3A 4NWYA 1ERWA 2ALBA 5D9XA 1XIYA 3C8EA 3KP8A 2YV7A 5C00A 3ZREA 4OFMA 2P5RA 3Q18A 3LEFA 1JLVA 2HSYA 4BVYA 3TJFA 5EPFA 5IM9A 4XRDA 3TJKA 2C0FA 1TU8A 3IXRA 3VI5A 3I9V2 2X8GA 2GLRA 4BVXA 2B3SA 5ELAA 2DMMA 4BPYA 3WGEA 2WPVB 3IK7A 4H86A 2OACA 4EVMA 5B7CA 2OJLA 3FZAA 4KA0A 4I7ZB 4V1Ap 1T1VA 2AJQB 1EWXA 4N30A 3LG6A 1K0OA 3QDNA 2RLIA 1K0NA 2CVDA 1SU9A 4LMVA 1GWCA 4ZB8A 3M9JA 4KDXA 4ZL8A 2H0IA 1Z9HA 3EC3A 4ECJA 2O87A 4ZILA 2V2GA 4K7OA 2OE1A 1B8XA 2LRNA 4CW9A 1K3LA 5ECOB 2N5BA 17GSA 1V40A 2H70A 1SYXA 2BTOT 4OO4A 5IMVA 4TXOB 5D9TA 1QK8A 4JR6A 1ZL9A 5J3RA 1G6YA 4JZQA 1U3IA 3UVTA 2H75A 1RQMA 2LKUA 5IO0A 5H5SA 3KZQA 4F2IA 1UC7A 1ML6A 2PUKC 2K18A 2OE0A 5GAPD 4ZIJA 1PL2A 3KTLA 2KLXA 2E74B 3BOAA 3MAKA 1A8LA 5CRHA 2QIWA 4E8HA 2WS2A 4PXOA 4GF0A 1J0FA 2H8LA 1XZOA 3P90A 2FCHA 5IQYA 1SKSB 3FHKA 3U6VA 3LQ7A 3L4NA 2AB6A 4OMVA 2YN1A 1TK8B 4TRXA 3ZYWA 3VPTA 1RK4A 5B8AA 1N2AA 2DIZA 12GSA 4I2UA 5HR3A 2VUPA 3D4MA 1DBYA 2QC7A 1H4OA 3ZL5A 1F6MC 2GSQA 5DDLA 4XRAA 3TDGA 4TW5A 4NPBA 5H5QA 1QMVA 5HFGA 3LWAA 4ECIA 3CRUA 4QL9A 1K3YA 2AUVA 3D22A 4YAPA 4PNFA 2ZUPA 5IIZA 5HR1A 8GSSA 1R7HA 1EGRA 3LYPA 4IL6X 2VIMA 3LORA 4K0GA 3IV4A 3D21A 2VCWA 1PD21 3HKRA 2JACA 4KDYA 2NPBA 4ISDA 1W89A 4MPFA 3TRQA 1U87A 2YP6A 4KB3A 2DJ1A 4TXOA 3IC4A 5LCZA 1Q4JA 1S3CA 2HE3A 1F3BA 3FY7A 3H79A 2PU9C 2P5QA 3Q74A 4GLTA 3BBYA 3ZZXA 5ECHB 2LJRA 1K0MA 2GSSA 2R6KA 2ZNMA 4F0BA 4MJAA 4ZBDA 5GSTA 4ID0A 1DSBA 1LU4A 3MWHA 1SK2A 3UEMA 1WE0A 2L59A 2KHPA 2C0DA 4IQAA 4MPGA 4F03A 4MA9A 5D93A 4XS4B 4BL7A 1AXDA 4I8BA 3HXSA 3ZRDA 2H1BA 5AN1A 3ZMLA 2YV9A 3HJMA 1MD4A 1PKWA 3VPQA 1BAYA 2N5FA 3TKQA 3HYPA 3TKPA 3NIVA 2CT6A 3WD6A 3KIJA 1XBSA 2I3YA 4HZ2A 2B5EA 2FWHA 5ECRB 3F4SA 3A5WA 3KP9A 2PERA 4IGJA 3H93A 5CRWA 4EF0A 1TK5B 1GLQA 2JU5A 1ILOA 1Z3EA 4YQVA 1TP9A 2MYGA 3HJOA 1X9WB 1BG5A 3F4RA 4MF5A 4RI6A 4KX4A 3FR3A 5ECNB 3TKSC 2J9HA 4GQFA 4ZBBA 5JWRB 2C0GA 3HZ8A 2CX3A 4MZWA 3PGTA 2LRTA 2CZ2A 3GKNA 1DUGA 1NHOA 1HQOA 2GZYA 1GSDA 1WPIA 3EMPA 4EE0A 4FH8A 1BEDA 3O3TA 2E7PA 1FVJA 1XVWA 3LXZA 3PR8A 2QKEA 1FB0A 1GSFA 2D2ZA 3W8SA 2G0FA 3IOSA 1MD3A 2HI7A 4ZB9A 4RKUJ 3CTGA 4OFNA 5F05A 5KN1A 5FHIA 4POMA 3KXOA 4L8EA 3PINA 3UIWA 1XOBA 4JEDA 3WGXA 3L0HA 2CAQA 2K8VA 4WR5A 1XWBA 3IRAA 3HDCA 3IAS2 4O5RA 3IK9A 1Z6NA 1XWAA 3M0FA 3MNGA 2H01A 2VL9A 1X0RA 2GGTA 1M9AA 4MF6A 1NSWA 2OE3A 3C7MA 2OKAA 1TDIA 2X99A 1B4QA 3C73A 2GZPA 2F8FA 2IMDA 2MMNA 1Z6MA 1VF5B 5E4WA 5AIXA 2M80A 3G9BA 1S5LX 1JLWA 1U6TA 4AJ8A 4TR0A 3EURA 1OE7A 1V57A 3FZ9A 2JZTA 2P0GA 4ML1A 1X9MB 1R4WA 4ACSA 1OVNA 2DJKA 5DALA 5L8RJ 2HLSA 3CBUA 3ED3A 1N8JA 3HA9A 1A0RP 3KM6A 5INYA 3F3RA 4J57E 3LYKA 2M72A 4MJEA 1Z5YE 2B1LA 3IAM2 2ON7A 3GL3A 2K6VA 2DJ3A 2OADA 3TGZA 2GSRA 1YJ6A 4IJIA 2XC2A 1TOFA 2LS5A 4D73A 1JHBA 2FGXA 4WETA 6GSSA 1YKAA 2YZUA 1T7PB 5DQSA 3TJJA 1W4VA 4RQRA 2E2GA 1GH2A 2H6ZA 5G31A 2RUFA 4ZXGA 4ILFA 4N10A 4Q5NA 2R2JA 2A4VA 3GTUA 2O01J 4MABA 2LUSA 5B8BA 2KUCA 2YWOA 2LRCA 3N5OA 5CO3A 2I1UA 1VGLA 5G30A 1T8EB 1R5AA 3OR5A 3MDKA 1TI1A 2YIUC 3RPNA 1TRVA 5CREA 1OKDA 1R5PA 4Q5FA 3HVSA 4FYCA 2PPTA 4WKWA 2H74A 4AJ6A 4BWSA 1K0CA 1MTCA 4E8EA 2FA4A 5HFKA 1FO5A 2CV4A 5JCGA 4HI7A 5D73A 1YEPA 1OC9A 3F6FA 1OC3A 5ENUA 1YF0A 1ZRTE 2H6YA 5G1KA 5GAND 3QCPA 4NV2A 1WIKA 1JZDA 3E3EA 1ERVA 2F3MA 2YNXA 2Z9SA 5COHA 3IR4A 3DWVA 3DKSA 9GSSA 3LW5J 3APSA 2LJAA 3HY2A 3EWLA 4LLRA 3NOFA 1SD8A 1QXHA 1M2BA 1QQ2A 4LL4B 1OAZA 3QAGA 1VF1A 1PX7A 2IIYA 5HQPA 4HUAA 1R26A 3KD0A 13GSA 5JCWA 3TOUA 1B9XC 1NHYA 3GH9A 5G5EA 1SYRA 1M2AA 2O7KA 2HZFA 3F4TA 4WR4A 1GUMA 3GL5A 5D8IA 1JFUA 2AV4A 1O85A 2QJYC 1BYEA 5JWOB 5IOXA 1Y25A 2RM6A 4GSTA 3CSHA 4I97A 4AF2A 2L5OA 3A3TA 5KN0A 3ZVJD 5HR2A 2H1DA 2HYXA 3DRNA 4IQ1A 1OKTA 3ERFA 1PL1A 1XFLA 1IYHA 1YF1A 2BJXA 3GKXA 4QQ7A 14GSA 3UBLA 5D9VA 5DCHA 4Z7XA 1DE2A 1ACVA 4H0LB 2PVOC 2XHFA 1X5CA 2WSCJ 2ZT9B 4MJBA 1F9MA 3GV1A 2LJKA 5DCGA 2AHEA 5ID2B 3TKSE 5DQYA 3KH7A 5CAXA 1Y6EA 2C3TA 3ME8A 1XW9A 2DJ2A 1QUWA 3TKSA 1VF4A 3CXGA 3VWWA 2B5XA 1ST9A 1Q90D 5IPGA 1PGTA 3V1WA 3UOMA 4MLYA 2V41A 2OBIA 2GT6A 2D2CB 3UBKA 2K8SA 1YEXA 4Q5QA 3DMLA 5KN2A 1B9YC 1SL0B 2LSTA 5CRDA 3Q19A 4O32A 4PNGA 3APOA 4YH2A 3EE2A 1ZCPA 2V6OA 2ON5A 3VWVA 2MMAA 2X64A 3D5JA 2H1GA 2C3QA 2IPAA 4HEA2 2B6MA 4V2LA 5AGYA 4G9HA 2WZ9A 4L5OA 4OFTA 4FYBA 4L5LA 1ABAA 4EL1A 3HVXA 4N0ZA 1WMJA 3RAZA 3HJPA 4K7IA 4HQSA 5HR0A 1GSEA 4K1FA 2H73A 2OBKA 5CRGA 3EU4A 4BA7A 1WJKA 2MBTA 1EP8A 1EEMA 1A24A 1BJXA 5J41A 3D6IA 3HCZA 3QAWA 2LQQA 2EIQA 3RHBA 3TKRA 4XS1A 3M1GA 2WCIA 2GQKA 2CAIA 5ID2A 4TR3A 3ME7A 5DJMA 1XOAA 3QR6A 1SENA 2IFQB 4GSNA 4TOPA 4F0CA 2AYTA 1BQ7A 4GXZA 1A0FA 1TXXA 4DSSB 2B7JA 2E76B 1EP7A 2IJYA 2LV3A 5ABRA 2PVQA 3LSZA 4GRFA 3S9FA 3GHAA 5L71A 1VF2A 2WB9A 1PQNA 1PX6A 1GSQA 3KCMA 2JZSA 1EV4A 4KCAA 2VOCA 2QGVA 3RPPA 1PMTA 4IHUA 4KDUA 3GH6A 3WGDA 2TRXA 4K0NA 2H0HA 3VWUA 2CVBA 2JL4A 2B5YA 4PURA 4V1Ag 5A4UA
chains in the Genus database with same CATH superfamily
4ZB6A 3L74J 4ECCA 4MH3A 2DJ0A 6GSWA 3GF3A 1H0TB 3TJBA 5AW4B 5IOWA 4OGQD 1JZOA 1LT9C 3NXSA 2NPSB 3HE5B 3VMAA 5J5NA 1UA5A 3M0DC 4M3LA 1AVOA 5F06A 5ECMB 4EYYQ 3H1HG 2N1TB 3UIAA 3G7YA 1ZN5A 4KNDA 1BGYJ 1NKZB 2P10A 3L70J 1AQTA 1VQPP 4XIHA 4KW6A 5CCHD 5BU8B 4IBPA 3L9SA 4RQXA 1TI3A 1FAAA 3C8VA 1QFNA 1OZHA 4D6TG 3C1SA 4ULXA 2GQLA 3TGUJ 4K5SA 1TTZA 2G2QA 5ELGA 5KN3A 1NM3A 1PP9G 3AECC 2OGUA 2GA1A 2X8HA 1MKMA 3AY8A 1YI2P 1YITP 1FVKA 2A2SA 4WVZA 3I56P 2YXRB 4EOTA 2C0EA 3FR9A 2E75B 4R4MA 3VWXA 1OX3A 1IFDA 2W6BA 2FXMA 2EIRA 5DVBA 3SBCA 1SKWB 4X1UA 2SPZA 1EQ7A 1TK0B 5CJ4A 1FZEA 2H19A 1L0NG 4HJ2A 2HNLA 1FU1A 3TOTA 2H6XA 4Z2TA 3KZIE 1RE4C 3RL0g 3QH9A 1GTAA 2V7QH 5IMZA 2IFQA 2PRRA 1UVZA 1AA0A 3L72G 4CY6A 2BMXA 3L9VA 2PN8A 2I81A 1SJ6A 5A5KA 1GTWA 3TRXA 4IL6H 2VCXA 4XCSA 3Q6OA 1Y47A 2H88C 1KILB 4UB6E 1E6BA 1J1EC 2HPCA 5FWGA 3D6ZA 16GSA 5B5EE 2XU6A 4G2EA 2R37A 3P7XA 1YKCA 1ZYPA 4EI2A 3UMAA 2MKVA 5KLVD 2GTUA 4NMUA 3L73D 1NKNA 1K3OA 2IMIA 4EDZA 5E59A 5CMZA 3I55P 4LA1A 18GSA 3H1JG 4XS4A 3FXDA 3P7KA 1AQVA 3CX5I 1NTKE 4WBRD 4TT3H 3EYTA 1NYHA 2K9FA 1XPVA 2H66A 4IFDK 3H1ID 1D7MA 4I2TA 1OVRA 2F9SA 5EY6A 1ERUA 3WT2A 6GSVA 1EZVI 3HZ4A 1VQ5P 1EV9A 3H1KE 1JY2O 2Q7CA 4PV1B 1PSQA 3GA4A 2YKQA 4TVEA 3UJ1A 4UB8E 3GX8A 4KJMA 2YZHA 3CSJA 7GSSA 3L71E 2A45H 3RK3D 1DE1A 4PQIA 2KS1B 3RBZA 1SQPJ 5CCGA 1A2LA 22GSA 3P8WA 3HUSB 1L0LK 2PAJA 4L76A 4ZKUA 4JYCA 4PX1A 4EXJA 1URMA 4EUYA 1SL2B 1H0TA 3M06A 19GSA 1T8ZA 4XHMA 2JSZA 1SQBD 2NDOA 1AIUA 2WGRA 3CSIA 4PGTA 4BWNA 1NU1D 4YQMA 1SK1A 3BVHA 1WRYA 5CP1A 2GDRA 4X0XA 4POKA 2H72A 2MBSA 3AEBC 2K9JB 2FY6A 3C1RA 1O81A 4ZL9A 2G8YA 1T4YA 1FZAA 2VD0A 3BCIA 1T6AA 2KIKA 2H7HA 2N1TA 1TKDB 1NJIQ 1AW9A 4YAVA 3PH0A 1IK7A 2ZT9C 1O73A 4K7NA 3JCUH 3AE7C 5AW1B 4KSMA 3CCSP 4R4LA 2L91A 2IFNA 2IBZD 3OW2O 1YJ9P 2GUVA 1N7SA 4HDEA 1IFPA 2WT7B 4FIWA 4KT0J 3ISOA 3GX0A 1XW5A 1X0TA 4H13D 1AQXA 1UIIA 3I43A 2M0BA 2R0GA 4J56E 1QGVA 1JOCA 1K0AA 2DSAA 1USBA 3GN3A 4IOIH 5AIVA 1LBKA 2POHA 1L4AB 1KYOD 2H76A 2X8CA 1C72A 2WVRA 2B1KA 1DH3A 3DD3A 3M3MA 2DKIA 2Y9ZA 1GNEA 4XFJA 4K35A 2HRFA 1G1IA 2D2CC 2H71A 4X43A 5ECSA 3TRPA 2KOGA 1JUNA 1XWCA 6GSYA 1KILE 5APUA 1SKRB 2VCVA 1YY7A 1G7EA 1SQQJ 1EOGA 5KEJA 3L75E 1MFZA 5F8BA 1KBNA 5GZZB 3CWBE 2LNTA 5F07A 2IN3A 1SK0A 4MZBA 2LXBA 3EU3A 1KILA 1LT1A 1LWUC 2YOIA 3D0ZA 3SWFA 1W5CE 4XA4A 2DIYA 2RIIA 1HWTC 4IELA 1LT9B 1NTMJ 2XBQA 1TJDA 4DEJA 1A2MA 1HNBA 2IMEA 2XPDA 1KB9H 5KJ7C 10GSA 3R2QA 4TXVA 5G5FA 4PQ1A 1X9SB 3LXTA 4GCIA 1V58A 4JU5A 1S3AA 2DLXA 2ZYDA 3D6YA 5IO2A 2E2MA 1K05A 1ZZYA 4JPZB 4NHWA 2K9YA 1YTZT 4MJCA 3W6GA 2BCCD 1GP1A 2HRNA 3H8QA 2XV5A 1PPJD 5AVRB 1FOSE 2P31A 1FW1A 1V98A 2VD1A 1U88A 1FDOA 4WB4A 2ZCTA 3KGKA 3EVIA 4G10A 2Y0DA 2OARA 2AEJA 3B5NC 4L0WA 4P3YB 1PA3A 2TRCP 3ZITA 4AGSA 2KNCB 3KMOA 1SJZA 2E0QA 3VURA 2QJKC 3EWKA 2VLUA 3MSZA 2QM7A 3QPMA 1PV3A 2KI7B 3A2XA 3G9RA 3BCCE 3EMXA 5CYYA 1QVFO 1ZYEA 5APSA 5IPHA 3I69A 4GOEA 2ZVNB 1SQXK 1XXUA 2YANA 3VI7A 3QAVA 2F8AA 2B88A 1MDIA 5CBNA 2NTOA 1FOVA 2K9JA 3CC4P 2VAFA 3P8CD 2J59M 2YMKA 2JP3A 5DJUB 2YJ7A 4Q5RA 2TIRA 4F9ZA 3Q2YA 1NGMB 1KTEA 5AISA 2FWFA 5AVQB 2VLTA 5KLVG 2Z5HA 2A4HA 4QMAA 3L73G 2GQMA 2OYIA 2HXKA 2O01H 1K0DA 2O89A 2RM5A 5C04A 1Z7RA 3GSSA 2LNSA 2JSYA 3QD9A 2WT7A 1NTZD 3ZLPA 4TKYA 3FW2A 3H1IG 1THXA 1OYJA 4O5QA 4CHSA 1J1DB 2WMMA 3E9JB 4HU7A 5BRTA 5ECQB 1GK4A 1GD2E 1VQOP 4RI7A 2CX4A 2HFDA 2VL3A 2ZVOB 2J58A 2E76C 1S5LH 3RL0B 2R32A 1EDKA 2QVAA 2AXTE 4V2NA 1GSUA 1XWKA 1AFOA 5DBQA 4WY4B 2YNYA 1P84H 3UL3A 1K73Q 1H8AA 1URQA 3EINA 3G6EP 4NXIA 4IP6A 4MMMA 4PUFC 2JADA 1SQBG 1V9WA 3G7IA 1NU1G 4TR1B 2BEZF 2R3SA 4FQUA 4H44B 3J7Yb 4KAEA 4POLA 1MEKA 1CQHA 2QG4A 3A0BE 3APQA 4BWQA 1AV1A 3IHQA 4Z2UA 3L74E 4LC1A 4PD4D 2KUBA 3CX5E 4W80A 1GTBA 1O7UA 2L5LA 2R5GA 3CTFA 4OCEA 3CCEP 3GHGC 3ITKA 3H1KJ 1EZVE 2VLVA 3HHVA 1ZMAA 1LT9A 1L0NK 2VL2C 1EGOA 5EVOA 3KDPB 2C1YA 3FZ4A 2FUG2 1PN9A 2OYHC 3BJ5A 3FR6A 1SL1B 2IBZG 3L71J 2IMFA 2L4CA 3M0DA 4G0LA 1M99A 3CLQA 2GSTA 2EC4A 3ZIVA 1E2YA 1HJBA 1L0LJ 1AC1A 1QGKB 1F3AA 2VM1A 4IN0A 4K8MA 4MH2A 1PGPA 3L70E 4DVCA 5B66H 1I5GA 3LW5H 1USEA 4DOJA 1N2DC 4OGQB 4I6XA 1YIJP 4K5RA 1EXJA 3GIXA 4C7NA 3F89A 2GVPA 2NPSC 1M7TA 3KZIH 5J9CA 4XS6A 1YDKA 4USSA 1ON4A 4HQZA 3O6TA 5APQA 5B6NA 1VQNP 4TN8A 1ZRTD 2NRGA 3TDKA 1ZOFA 1WT6A 2GUSA 4JE1A 3IDVA 2KSJA 3Q5SA 5KAIE 2VCTA 1G2CA 3KJYA 4C46A 5B5EH 3S9OA 3TCOA 1LTTC 4L74A 4A5PA 1ZGNA 1MDJA 1YZXA 1E79H 2Q9IA 3BCKA 4KH7A 3TB2A 1RE4A 3G3ZA 1U7JA 1T2KD 1BCCD 1SFCD 3L35A 2IBZI 2YWMA 4MP4A 2FNOA 2IL3A 5KLIC 2RH0A 3R4YA 2LEGA 1IFNA 2JWDA 4DSRA 2DJJA 2KYVA 3FYGA 1G1JA 3E0UA 3VMZA 3VP8A 1LWUB 1ZLLA 2KZIA 3FRCA 4BXLA 2GM4A 3KYQA 1THOA 2YWNA 3FZ5A 4GTUA 2LQOA 4FYUA 3P32A 1XW6A 4RUVA 5EL8A 1SD9A 5APWA 4EKZA 4HS1A 1A23A 2I4AA 3ZFLA 1PPJG 2NBSA 3L75J 1N8RQ 1WOUA 3ZDMA 5G1LA 3CWBJ 4BL7B 4MF7A 2ES7A 2KSEA 3T97B 3SWYA 2WSCH 4F82A 4K2DA 4ZBAA 4NPDA 2KK7A 1RF1C 3GFKA 5DJTB 6GSTA 2FXOA 3MIWA 3GSTA 2JO1A 11GSA 1JNMA 3GKKA 4TR1A 3TUEA 2IYOA 2KZJA 1PRXA 1FOHA 3IFMA 4YKGA 1SQVD 1GLPA 1J9BA 1SQPE 2NZ2A 1JZRA 1WRGA 1O8XA 1NAFA 1H88A 2PP6A 3U1AA 2FYNC 3WT1A 3H4KA 4N11A 1M9BA 5LNKe 2YO2A 1LP1B 3RHCA 3I6AA 4EC0A 3IR9A 3DXBA 4RO0A 1KEBA 4PV1C 4IW9A 2C3NA 3DVWA 1W2BO 2IMKA 1IJDB 3D4TA 1IZNB 3AE8C 3IPZA 3A2AA 1NTZG 1J2JB 1X8YA 3RBTA 2L6DA 3S1KA 3MUDC 1KD1Q 1T3BA 1DD3A 4PUAA 1CI6B 3KHUA 3A2WA 1ERTA 3HUSC 1UN2A 2QA1A 5D9WA 5IMAA 4LMWA 3BCCJ 5A4WA 1S9KE 1ZOYC 2IWTA 1B4PA 1PN0A 1SQXJ 1U3AA 5GSSA 4IFMA 4HSCX 5ECIB 3FX0A 2VO4A 3C1LA 3LJRA 1BX9A 5FT3A 1ZYQB 2O1KA 2C80A 1A8YA 2FD3A 4I1LA 5AVXB 2WITA 3LFLA 3E1RA 5KKZC 1K8AQ 3DVXA 4ZNCA 3J7Yk 2FWEA 2AEMA 3M8NA 1VDFA 2Y0EA 4YPCA 3V4QA 1HYUA 4OO5A 3FKFA 1HVVA 1KQLA 1RW1A 2XBIA 4K6XA 4N0VA 2R3CA 1LTJC 2XNDH 4KUNA 1KQSO 2K88A 3VFIA 2OA7A 4KHXA 1GSYA 3RDWA 3GLMA 4O92A 3SWLA 2HZEB 3CXHI 4H13B 4MDCA 4MK3A 2F51A 2QSIA 2L57A 1PGJA 3UARA 4MCUA 2IFMA 1Q81Q 3M9BA 4KSOA 4CDOA 5TJHA 5HFIA 3M9HA 1GUKA 4L0UA 1L4AC 3H1HJ 3W67A 5AW2B 1J08A 1I9DA 4I6MC 1LWUA 2DMLA 4KGIA 20GSA 3QFBC 3KEBA 4HYTB 1XTCC 1M2DA 2I9HA 3GHGB 2YPMA 4ZL7A 3PRJA 1T2KC 1G6WA 3TNUA 3L4FA 2WZ7A 3WU2E 4D6TJ 5KJ7A 2V1MA 3GUSA 5A4VA 3F9UA 5AVVB 1PP9J 3GRXA 3AEGC 4I5QA 3HD5A 3CCJP 1R8EA 4WXTA 5DAKB 1QEXA 1IO4A 2JZRA 5H2FE 4GSSA 3T97A 6GSXA 2WDUA 3H1NA 2KP8A 4YQUA 5KLVK 3DGQA 2A06D 4IKHA 2YJHA 2DC5A 2V32A 3VLNA 1L0NJ 4MZCA 4XTSA 1FJPA 5E79E 1FG4A 4JBBA 2GZZA 1S3DA 4V2MA 4G19A 1G0TA 1PKZA 2H30A 2YO3A 3K8NA 1WWJA 4J2FA 4LL1B 3IE3A 3ZMKA 2NVLA 5B6MA 1T00A 3B5NA 3HD7D 3L72J 4H0LD 2C4JA 4EO3A 2WSFJ 1HH0A 4YTPC 1KB9D 3VYIA 5G2ZA 1X5DA 3BATA 3H1LD 3PTZA 1FE6A 5J9BA 3BASA 1EZKA 2WJUA 2L6CA 1X5EA 3N9JA 5KAFH 1AUCA 2B9BA 2J5UA 3MGNA 1MDKA 2MZCA 1SQBK 2XNXA 3AE5C 5JCUA 1NU1K 5KLIB 3H1JJ 1WP0A 5IMCA 4NAXA 2AXTH 2VCQA 3DEXA 1FC2C 2I1JA 3A3YB 3M0AA 5DALB 1Z7PA 1YYCA 1KFNA 4LLHA 3CPWO 2RUEA 3DYRA 4HH2A 3OA7A 2WPQA 5DJLA 3KPEA 1CQGA 1B48A 4MN4C 3M9KA 2FYUD 3PP5A 1TRWA 2IBZE 2E74D 2GS3A 4DSSA 4RESB 3A0BH 4BIKA 3E1IA 1G7OA 1F2EA 4BRYB 3W68A 3CMIA 4AJ7A 4D73B 1RF0C 3GURA 3L9UA 2MMZA 3HTKB 4ECBA 1SQVG 2B89A 1HD2A 1W2EA 1RF1B 4FO5A 1PL5A 1YTZI 1ZR2A 2HZEA 3G4SP 4HJMA 1HNCA 1BE3D 2M3BA 3F8UA 3L78A 1J1DC 3CYNA 3S4RA 2R4VA 1XCCA 1EEJA 2O8VB 2FXPA 1TRUA 1FS0E 3RL0C 4IP1A 1M8OB 1FDMA 1NTMD 3GTUB 4QL7A 1SVFA 4WY4C 2XPEA 2VM2A 2A2RA 2FYNB 3GHGA 1AQWA 1KNGA 1EDJA 3QOUA 4Y28J 2VL2A 4KE3A 1KORA 1SJIA 1CSBA 1DD4A 2OYHA 2A45G 1JCCA 4ML6A 1GRXA 1OC8A 1GUHA 2H1AA 1P84D 4H44C 3IA1A 5DAKA 5H5RA 2JJLA 4ICYA 1OE8A 1GL2D 1L0LE 1A2JA 2C8UA 3V4WA 3HVVA 1M1JB 3LGCA 1N73B 4IJ3A 1GTUA 4B86A 2CA8A 3JCML 5D96A 2BEQD 1JMMA 4TR4A 3WUVA 4AQRD 2NPSA 3FK8A 3F6DA 3ZIJA 5IMFA 3HE5A 4O7HA 3AE6C 1LGHB 3VK9A 5KKZB 1F37A 2VCZA 2PGTA 3GMFA 1OW8A 4WF4A 2M46A 2X4AA 1PPJE 1AAZA 1K0BA 1Q98A 1KFMA 1GL8A 1GW3A 4N3YB 2YKPA 4I2LC 3BD2A 3P2AA 1OC9B 3ZTLA 1LJRA 4GWRA 1JB0J 1PGQA 5TISE 1LTJB 4OGQC 3Q1MA 1VRSD 2L4QA 5ECKB 2MMOA 1JZWA 2RKLA 3H32B 2REMA 1SLQA 3JC22 2FA8A 1XWGA 1O6JA 3W8JA 2V6KA 2PFXA 3KMNA 4Z2RA 1FHEA 2YWIA 3UAPA 4OD7A 3CRTA 1GNWA 1GW4A 2KP1A 3F63A 2M3EA 3A5TA 2C0WA 1FB6A 3ERGA 4HU9A 2LTKA 3FEUA 4BVYB 3P8CE 3AE9C 4DJGA 1TU7A 5CCHC 3HVNA 4OCFA 3LW9A 1VQ8P 3O6QB 2WULA 6GSUA 3VP9A 2PMTA 3NZNA 1FJKA 3DIEA 2A06G 1N7LA 4WF5A 3CXHE 4JR4A 4IVFA 2R3XA 1SFCB 1JY3N 3F5HA 3PH9A 5CNWA 1YBKA 4BVXB 3AE3C 5ECPB 1RQUA 5M1BA 2AAWA 2ZXXA 1H75A 1NTZK 2AXCA 2OTJP 3ERWA 3HTKA 1T4ZA 5ECLB 3KTBA 2HSHA 3CCMP 1RF1A 2FLSA 3F0IA 5APTA 4WEYA 4EDYA 5JWQB 4LGDE 1O8WA 3C71A 2PBJA 1NTKD 3A7OA 3H1LG 1HNAA 2YCDA 5F0GA 1EOHA 3V2NA 4NV5A 1GSSA 2PWJA 2QJPC 3FGAD 3TJGA 1TRSA 1V2AA 3H1KD 2J23A 1VF3A 1VQ4P 5CCGD 5IMDA 3ZFBA 1WMKA 1QVGO 5LD0A 2O1JA 5KLVJ 3L73J 3UVHA 3GYKA 2DBCA 4HZ4A 2CQ9A 3WYWA 2KOKA 3A2VA 1YQ1A 2FHEA 4G0KA 2JR8A 2CVKA 5J4UA 1IYIA 2KXPB 1LTAC 5APXA 3D71A 4KCEA 4PQHA 3IBHA 2EIOA 3QFAC 4IS0A 1QL2A 1NAYA 1KN7A 3U5RE 2WRTA 4HOJA 3MUDA 1GULA 1VQMP 1MFTA 2KS1A 3O76A 1RQVA 3ZVJA 3EQ2A 3AE2C 2FYUG 3HUSA 4DSQA 4WBJA 2O85A 3Q5RA 3GKMA 4OWYA 1S72P 2N5AA 3F3QA 4OH8B 1SQXE 3U1CA 1N7SD 1R5SA 4K9ZA 5AW3B 4Y99B 2WSEJ 1TW9A 1M0UA 2IPPA 4NHZA 1QX8A 3GNJA 3QMXA 3US3A 1GTIA 2FKWB 1XVQA 1NU1J 3VMXA 4JRRA 3RK3C 4O9BA 1T3JA 1BE3G 1GL2C 2B7KA 3KH9A 2H0GA 2FWGA 1NW2A 2GT5A 2WFCA 2HT9A 4WBAA 3G7JA 1T3UA 2PGDA 2KP2A 2E42A 5GTHE 4POBA 3IC8A 1LTJA 4GQCA 5AW9B 2CZ3A 1NTMG 1YQ3C 3H32A 4NWYA 1JMBA 5KOXA 2QRXA 1ERWA 2KLUA 2ALBA 1Y8AA 5D9XA 3WU2H 1XIYA 3WMM0 3C8EA 3KP8A 1OVUA 1SS1A 2YV7A 1L2PA 5C00A 3ZREA 4OFMA 2P5RA 1DX7A 3Q18A 3LEFA 1JLVA 2Y0CA 1L4AA 2HSYA 4BVYA 3V2RA 3H1HE 3TJFA 5EPFA 5IM9A 4XRDA 1KILD 4Z1MH 3TJKA 1NHLA 2C0FA 1FZCB 1TU8A 2IZ1A 3IXRA 3VI5A 3I9V2 2M5AB 5E79H 3CWBD 2X8GA 1OW6A 4H13C 3ABVC 4D6TE 2GLRA 4BVXA 4JYBA 2B3SA 5ELAA 1PP9E 3C9IA 3WUUA 1QLED 1OIPA 1LJ2A 2DMMA 4BPYA 1KQGB 2C9LY 3WGEA 2QM8A 1NWQA 2HR3A 2HODB 2WPVB 1Q86Q 3IK7A 1L0NE 4H86A 2OACA 4EVMA 5B7CA 2OJLA 3FZAA 4KA0A 4I7ZB 3AE4C 4V1Ap 5AVTB 1T1VA 2AJQB 2W27A 1EWXA 3GF7A 3L72E 4N30A 1JCDA 5AW8B 3CL3D 3LG6A 2R5BA 1IFIA 1K0OA 1VL2A 2M8RA 1ZYNA 2ITAA 3HE4B 3QDNA 2RLIA 1K0NA 2CVDA 1SU9A 1SQVK 1ZV8A 2W90A 2N9YB 1VF5D 4LMVA 1GWCA 4ZB8A 3BCCD 3M9JA 4KDXA 4ZL8A 5C39A 3HD7B 2H0IA 1Z9HA 1RH5B 4EIPA 3EC3A 4ECJA 2O87A 2KNCA 4ZILA 2V2GA 4K7OA 2OE1A 4U3FD 3H1JE 1B8XA 2MJZA 2LRNA 4UB6H 3PLNA 4CW9A 1K3LA 5AVYB 5ECOB 2N5BA 17GSA 1V40A 2H70A 1SYXA 2BTOT 4OO4A 2HYNA 5IMVA 1AVYA 2LXCB 4TXOB 4C7RA 3KXDA 5D9TA 1QK8A 1S3JA 1HGZA 4JR6A 1JY2N 1ZL9A 5J3RA 5GTIE 1NTKG 1G6YA 4JZQA 1U3IA 3UVTA 5AVSB 3TK1A 2H75A 1RQMA 2LKUA 1RF0A 3H1KG 2QEXP 2QA4P 5IO0A 1URQD 5H5SA 3KZQA 1KYOI 4F2IA 1JY3P 1UC7A 1ML6A 2PUKC 2K18A 2JDIH 2OE0A 2BCCG 4ZIJA 5GAPD 4UB8H 2FY8A 1PL2A 3KTLA 1HF9A 1M3IA 2KLXA 2QA2A 2E74B 1NTZJ 3BOAA 2QJPB 3MAKA 3A0HE 4PJ0E 1A8LA 5CRHA 2QIWA 2Q3IA 4E8HA 1OXZA 2WS2A 4PXOA 4GF0A 1J0FA 2H8LA 1XZOA 3P90A 3IN6A 4WY4A 3FWNA 3MTUE 2FCHA 1IK9A 2M5AA 5IQYA 1SKSB 3FHKA 1AQ5A 5APVA 3U59A 3U6VA 3L74D 3LQ7A 3L4NA 2HFED 2H43A 2AB6A 4OMVA 2YIUB 2YN1A 1TK8B 4TRXA 3ZYWA 1EZVD 3VPTA 1RK4A 5B8AA 1N2AA 2DIZA 4HJGH 12GSA 1JTHB 4I2UA 5HR3A 2VUPA 4N78E 3D4MA 1ZR4A 3GW6A 3B8EB 1DBYA 2HG5D 2QC7A 1BGYD 3L70D 1H4OA 3ZL5A 1M7LA 1F6MC 2GSQA 5APYA 3RK3B 5DDLA 3CC7P 4XRAA 3TDGA 4TW5A 1PIXA 1GL2B 2X49A 4NPBA 5H5QA 1QMVA 5HFGA 2LKMA 3LWAA 2Y9YA 4ECIA 3MD0A 3CRUA 2B87B 4QL9A 1M1JC 3TGUD 1K3YA 1N73C 2AUVA 3D22A 4YAPA 4PNFA 1A02F 2ZUPA 5AVUB 3HE4A 5IIZA 2FBWC 5AW0B 5HR1A 2YXQB 8GSSA 2P1JA 1R7HA 1EGRA 1PGOA 3IF4A 3CXHH 1OFCX 4DCKA 1LTSC 3H6PA 2RN0A 3LYPA 4IL6X 1FDIA 2VIMA 3I5CA 1PZQA 1RY3A 5AVWB 3TSIA 3LORA 4K0GA 3IV4A 3D21A 2KLVA 1JEKA 2VCWA 1PD21 3HKRA 5CCHA 3GMAA 2JACA 4KDYA 2NPBA 4ISDA 1W89A 3SFDC 4MPFA 3TRQA 1U87A 2YP6A 4KB3A 2Z5IA 2DJ1A 4TXOA 2R44A 3IC4A 1DIPA 5LCZA 4K2XA 1Q4JA 1S3CA 2HE3A 1F3BA 3FY7A 3H79A 2PU9C 5BVZA 2P5QA 3Q74A 4GLTA 3BBYA 2K3RA 3ZZXA 5ECHB 1Q82Q 2LJRA 3RGUA 1K0MA 2GSSA 2R6KA 2FYUE 1LTBC 2HPCB 2ZNMA 2FYUK 4F0BA 4MJAA 4ZBDA 5GSTA 1IFJA 4JBZA 1Q7YQ 1DSBA 3A5IA 4ID0A 2CK3H 2O3JA 3KQGA 1HJ0A 1LU4A 3MWHA 1SK2A 3UEMA 1WE0A 2L59A 2KHPA 1SFCC 2ZJSE 2C0DA 4IQAA 4MPGA 2QJYB 1M1KQ 4F03A 4MA9A 5D93A 4NPFX 4EDFA 3AEDC 4XS4B 4JF7A 4BL7A 5AW7B 1AXDA 3O8ZA 4I8BA 3HXSA 2R5DA 3ZRDA 5KLVE 2H1BA 5AN1A 3L73E 3ZMLA 2YV9A 3HJMA 4GKGA 4U3FG 1MD4A 1PKWA 1MZ9A 3VPQA 1BAYA 2N5FA 3AEEC 4PD4I 3HYPA 1NTMK 3TKPA 3TKQA 3NIVA 2V7QJ 1SQPD 2CT6A 2Q5UA 3USSA 3H1IE 3WD6A 2N9BA 3KIJA 1XBSA 3VTPC 1S5LE 2I3YA 3MIXA 1BCCG 1JM0A 4HZ2A 2B5EA 3FXEA 2FWHA 2ZT9D 1JTHA 1P84E 5GTHH 4IFFA 4N6JA 3RK2D 3RK3E 5ECRB 1EXIA 1LP1A 1VQ7P 3F4SA 1SQVJ 3IHGA 1XG8A 1UIXA 2JWAA 3A5WA 2A2PA 3KP9A 2PERA 1SQBE 1USDA 3EFFK 4IGJA 1HBWA 3H93A 1S9KD 3CQFA 3CCUP 1NU1E 5CRWA 1VQKP 3FWLA 4EF0A 1ZW0A 1GL2A 1CI6A 3Q3DA 1TK5B 1GLQA 2JU5A 2B87A 1NH4A 1BDDA 1ILOA 1Z3EA 4YQVA 1TP9A 2MYGA 3HJOA 1X9WB 1N7SB 1BG5A 4Y99C 2D2CD 3F4RA 3AEAC 1JY2P 1A02J 4MF5A 4RI6A 4KX4A 3FR3A 5ECNB 1GU5A 3TKSC 3L74G 2J9HA 4GQFA 3SFEC 3MZWB 4ZBBA 5BMUA 5JWRB 1KMIZ 2C0GA 3HZ8A 3CX5H 2CX3A 5B66E 2IX7C 1EZVG 4MZWA 4X4JA 1SQQD 3PGTA 3VMYA 2FYZA 2LRTA 2CZ2A 1KYOE 2LR2A 1DUGA 1NHOA 3GKNA 1HQOA 2GZYA 1GSDA 4AUWA 5BU5A 2P58A 5KJ7D 1WPIA 3EMPA 4EE0A 4FH8A 1BEDA 1KC8Q 4AYCA 3O3TA 2E7PA 1FVJA 2XZRA 1XVWA 2WSFH 3MHVA 1BGYG 3L70G 3LXZA 3PJSK 3CD6P 3PR8A 2QKEA 3FMWA 1FZCC 2JEEA 5AW6B 3SWKA 3TGUG 1FB0A 1GSFA 2D2ZA 4JQ0D 3W8SA 1ZXGA 2OTLP 2DW3A 2G0FA 3IOSA 1MD3A 2HI7A 4ZB9A 4RKUJ 3CTGA 4OFNA 5F05A 5KN1A 1HTLC 2V4HA 3KXOA 3B5ND 4POMA 2WTYA 5FHIA 2Q3EA 4L8EA 3PINA 1S3RA 3UIWA 1XOBA 4JEDA 5K5GB 4GDOA 1NTKK 3WGXA 3L0HA 5KAIH 2FFDC 2CAQA 2K8VA 3P8MC 3BRVB 4WR5A 1XWBA 3IRAA 4RJTA 3HDCA 3EFGA 3IAS2 4O5RA 1DEBA 2Z4EA 3IK9A 4ASVA 2BCCE 4I7ZC 1Z6NA 1XWAA 3M0FA 3MNGA 2H01A 2VL9A 1FAVA 5GTIH 1M3JA 3EPTA 1MUUA 2AEFA 3E7KA 1X0RA 1M9AA 2GGTA 1NSWA 4MF6A 2OE3A 2ZYAA 3C7MA 1BDCA 2OKAA 1TDIA 2C0XA 2X99A 1Z56A 4YXDC 4L75A 2E5TA 1GK6A 1NOHA 1B4QA 4GOFA 2GZPA 3C73A 2F8FA 2IMDA 2MMNA 1Z6MA 1VF5B 5E4WA 5AIXA 4K3AA 3H1LJ 2I1KA 2M80A 3G9BA 1S5LX 2A45I 1JLWA 1U6TA 4AJ8A 4TR0A 4H0LC 3HD7C 3CCVP 1OE7A 3EURA 1V57A 3FZ9A 2JZTA 2P0GA 3A0HH 4PJ0H 4ML1A 1IFMA 3CCRP 2E76D 1X9MB 1R4WA 1RE3C 2OYIB 2HLOA 4ACSA 1OVNA 3RK2C 3R2PA 2DJKA 5DALA 5L8RJ 5CBOA 2HLSA 3CBUA 3ED3A 4WWIA 1N8JA 3HA9A 3NFQA 1A0RP 3KM6A 1OW7A 5INYA 3F3RA 4J57E 3QWOC 1PFOA 4HKZH 3LYKA 3CMEP 2M72A 4MJEA 1Z5YE 1YJNP 2B1LA 3IAM2 1SQPG 2ON7A 3GL3A 1NTZE 2K6VA 2DJ3A 1VQ6P 2OADA 3TGZA 2OYOA 2XKMA 4PTSA 2GSRA 1YJ6A 4IJIA 4BRYA 2XC2A 2FYUJ 3NTNA 3II6A 1TOFA 2LS5A 1IC2A 4D73A 1SP4A 1RHZB 1URQB 1JHBA 2FGXA 4WETA 6GSSA 3SSUA 1YKAA 2YZUA 1T7PB 5DQSA 3TJJA 3VN0A 1W4VA 4RQRA 2E2GA 1GH2A 1NO4A 2H6ZA 5G31A 5CHXA 1JO5A 2RUFA 4ZXGA 2E74C 4ILFA 1N86A 4N10A 4W7YA 4Q5NA 1BE3J 2R2JA 2A4VA 1YQ4C 3GTUA 1Q2NA 2O01J 4MABA 1MV8A 3RBXA 2QE7H 2LUSA 4A7PA 5B8BA 3L71D 3NMDA 2WSSH 1X9VA 2I8DA 2KUCA 2YWOA 2LRCA 3WUTA 3N5OA 5CO3A 2I1UA 1VGLA 4PD4E 5G30A 2NPSD 1L0LD 1T8EB 1FZFA 1R5AA 3OR5A 3H1IJ 3MDKA 1TI1A 2YIUC 3RPNA 1TRVA 5CREA 5CJ0A 3GG2A 1OKDA 3N4XA 1YJWP 1R5PA 2N1TD 2E5YA 1CZQA 4CY8A 2IDBA 4OWFA 1VPCA 1M1JA 4Q5FA 1N73A 3HVSA 4FYCA 2PPTA 1S1CX 2OTKE 4WKWA 4W7ZA 4C7NB 2H74A 4AJ6A 4BWSA 3V5BA 1K0CA 1MTCA 4E8EA 1KB9I 1SQQG 3MP7B 1SQBJ 2FA4A 5HFKA 1FO5A 1M57D 2CV4A 5JCGA 4HI7A 5D73A 4G0IA 1OMIA 1YEPA 2E75D 4EIQA 1G2CB 1OC9A 3F6FA 2XDJA 1OC3A 5ENUA 1YF0A 1ZRTE 2H6YA 1KTMA 5G1KA 5GAND 4U3FE 3QCPA 4NV2A 1M90Q 1WIKA 1HUCA 1KV4A 1JZDA 3MYDA 2HSMA 1H89A 3E3EA 2P67A 3PHLA 1ERVA 2F3MA 2HRAA 2IYPA 1EC5A 2YNXA 2Z9SA 3IR4A 5COHA 3DWVA 3Q5PA 3DKSA 5H2FH 9GSSA 1BCCE 3CXHD 3LW5J 2LJAA 3APSA 3EWLA 3HY2A 4LLRA 1J1EB 3B71A 4ASWA 1EDIA 3NOFA 3O6QA 1SD8A 1QXHA 4MNNA 1M2BA 2KB7P 1QQ2A 4LL4B 3L75D 1OVVA 1OAZA 3QAGA 5KAFE 1VF1A 1PX7A 2IIYA 5HQPA 1FBMA 1SFCA 4HUAA 2E43A 3CCQP 1R26A 3KD0A 13GSA 5JCWA 1E5WA 1X22A 2G3AA 3TOUA 2W6JH 3CC2P 1B9XC 3V6IA 1NHYA 3GH9A 1VQLP 1SYRA 5G5EA 2FFDB 1TU3F 1Y9BA 1M2AA 2O7KA 2HZFA 1GMJA 3F4TA 4WR4A 1GUMA 2HRKA 3GL5A 4PV1D 2WSEH 4DT0A 5D8IA 1JFUA 2AV4A 1O85A 2O01N 2QJYC 1BYEA 5JWOB 1GU4A 5IOXA 1Y25A 2RM6A 4GSTA 3CSHA 4L73A 1VQ9P 4I97A 4AF2A 1NTKJ 2L5OA 4IL6E 3A3TA 5KN0A 3ZVJD 5HR2A 2C9NY 1FOSF 2H1DA 1P84I 2HYXA 3DRNA 4IQ1A 1OKTA 1K04A 3ERFA 1PL1A 1XFLA 1IYHA 1YF1A 2BJXA 1SQVE 3GKXA 4QQ7A 1K9MQ 2YKOA 14GSA 3UBLA 2BCCJ 3B4SA 5D9VA 5DCHA 4Z7XA 1DE2A 1ACVA 4H0LB 2YMYA 1SQXD 2PVOC 1X5CA 5CCGC 1GZLA 2XHFA 2WWWA 2W83C 2WSCJ 2ZT9B 4MJBA 2WPRA 1BGYE 1F9MA 1LTIC 3GV1A 3RK2B 2LJKA 5DCGA 2AHEA 5ID2B 3TKSE 2ZYGA 5DQYA 4DZOA 5EFWB 1KYOH 3KH7A 5CAXA 1Y6EA 2C3TA 3TGUE 3VOPA 2L5GB 3ME8A 1XW9A 2DJ2A 1QUWA 2N1TC 3TKSA 1VF4A 1L4AD 3CXGA 4YXWH 4GT1A 3VWWA 2B5XA 1PFIA 1ST9A 1Q90D 3TYYA 5IPGA 1PGTA 3V2PA 3V1WA 2W6AA 4GIFA 5KTBA 3UOMA 4MLYA 2V41A 1N7SC 1GDTA 2OBIA 2GT6A 2D2CB 3UBKA 4U7JA 2K8SA 1YEXA 4Q5QA 1YHQP 1LTGC 3H1HD 3L71G 3DMLA 3IAOA 2CPSA 5KN2A 1B9YC 1FZBA 1SL0B 2LSTA 5CRDA 2ZFCA 1L0LG 3BRTB 2E75C 1HGVA 2JKVA 3Q19A 3TF5A 4O32A 1U7MA 4PNGA 3APOA 4YH2A 3EE2A 3JCUE 3CMAP 4GODA 1ZCPA 2V6OA 4D6TD 1FZCA 2UWJE 2ON5A 3VWVA 1PP9D 1KZUB 1FZGA 2VRSA 2MMAA 2X64A 1U57A 3TNUB 3D5JA 2H1GA 2C3QA 2BASA 3CX5D 1ZMEC 2IPAA 4HEA2 2B6MA 4V2LA 5KOWA 3M9QA 1M56D 3AE1C 2UZ8A 2ZXEB 1L0ND 2OQQA 3R3EA 5AGYA 1KILC 4G9HA 4O5UA 1ZP0C 2WZ9A 4L5OA 2FFDA 4OFTA 1XTGB 5TISH 4CPGA 1BSNA 3OAKA 4HB1A 2HODA 4FYBA 3L72D 1CW5A 4L5LA 1ABAA 1NVOA 2WQYC 3OJAB 1AJYA 3HVXA 4N0ZA 4EL1A 2A06E 2H89C 3B5NB 4TLFA 2P7JA 4NPEA 1WMJA 2R0CA 3HJPA 3RAZA 3K5BA 4K7IA 2QJKB 4HQSA 5HR0A 1OWAA 1SQPK 4OVNF 1GSEA 4K1FA 2H73A 1LNQA 2OBKA 5CRGA 2K37A 2RMZA 3CI9A 3EU4A 5AW5B 4BA7A 4YKFA 1JY3O 1WJKA 2MBTA 1EP8A 4EIJA 1EEMA 3PPUA 1A24A 1BJXA 1KB9E 3H1JD 5J41A 2CPBA 3D6IA 3HCZA 1S4XA 3L36A 1DEEG 3QAWA 3L75G 3H1LE 3CWBG 3HD7A 2Q6QA 4XE5B 3D70A 2LQQA 2EIQA 2ZAEB 3RHBA 3TKRA 1RE3A 1EDLA 2K1AA 4XS1A 3M1GA 2WCIA 2GQKA 2CAIA 4KF9A 2WPSA 5ID2A 4TR3A 1KQFB 3CCLP 3L37A 2Q1KA 4U3FJ 3ME7A 1XOAA 5DJMA 3QR6A 1VF5C 1SENA 2R0PA 1BSHA 2IFQB 4GSNA 4TOPA 4F0CA 2AYTA 1BQ7A 4GXZA 1A0FA 1TXXA 4DSSB 2B7JA 2E76B 1EP7A 1QL1A 2IJYA 3RL0D 1S2EA 3H25A 2LV3A 5ABRA 2OYIC 3LIEA 1BCCJ 2PVQA 3LSZA 4WY4D 2H8PD 4GRFA 3S9FA 3GHAA 5L71A 1R5LA 1VF2A 2WB9A 1PQNA 4PD4H 1GSQA 1PX6A 3KCMA 3HRNA 2JZSA 2P2UA 1EV4A 4KCAA 2VOCA 1SQQE 2QGVA 2IZ0A 1SQQK 3G71P 4H44D 3RPPA 3M91A 5AVZB 1PMTA 4IHUA 2DKHA 4KDUA 1X79B 1BE3E 3GH6A 3BCCG 3N7NA 3WGDA 1SQXG 4ZMDA 2TRXA 4ZKPA 1URQC 4K0NA 1NTME 2H0HA 2OYHB 3JSVC 3VWUA 2CVBA 2JL4A 2B5YA 4PURA 4V1Ag 2W8ZA 4N78D 5A4UA 3LIDA 3AEFC 3V2QA
chains in the Genus database with same CATH topology
4ZB6A 4ECCA 4MH3A 2DJ0A 6GSWA 3GF3A 3TJBA 5IOWA 4OGQD 1JZOA 5J5NA 1UA5A 5F06A 5ECMB 3G7YA 4KNDA 2P10A 4XIHA 4KW6A 4IBPA 3L9SA 4RQXA 1TI3A 1FAAA 3C8VA 1QFNA 3C1SA 4ULXA 2GQLA 4K5SA 1TTZA 2G2QA 5ELGA 5KN3A 1NM3A 3AECC 2X8HA 1MKMA 3AY8A 1FVKA 2A2SA 2C0EA 3FR9A 2E75B 4R4MA 3VWXA 2EIRA 5DVBA 3SBCA 1SKWB 4X1UA 1TK0B 2H19A 4HJ2A 2HNLA 3TOTA 2H6XA 4Z2TA 3RL0g 1GTAA 5IMZA 2IFQA 1UVZA 4CY6A 2BMXA 3L9VA 2PN8A 2I81A 1SJ6A 5A5KA 3TRXA 2VCXA 4XCSA 3Q6OA 2H88C 1E6BA 5FWGA 3D6ZA 16GSA 4G2EA 2R37A 3P7XA 1YKCA 1ZYPA 3UMAA 2MKVA 2GTUA 4NMUA 1K3OA 2IMIA 4EDZA 5E59A 4LA1A 18GSA 4XS4A 1AQVA 4WBRD 4TT3H 3EYTA 1NYHA 2K9FA 1XPVA 2H66A 4I2TA 5EY6A 3WT2A 6GSVA 2F9SA 1ERUA 3HZ4A 1EV9A 4PV1B 1PSQA 3GA4A 4TVEA 3UJ1A 3GX8A 2YZHA 3CSJA 7GSSA 1DE1A 4PQIA 1A2LA 3P8WA 22GSA 4EXJA 4PX1A 1URMA 4EUYA 1SL2B 19GSA 4XHMA 2JSZA 2NDOA 1AIUA 2WGRA 3CSIA 4PGTA 4YQMA 1SK1A 1WRYA 5CP1A 2GDRA 4X0XA 4POKA 2H72A 2MBSA 3AEBC 2FY6A 3C1RA 1O81A 4ZL9A 2G8YA 1T4YA 2VD0A 3BCIA 1TKDB 1AW9A 4YAVA 1IK7A 2ZT9C 1O73A 4K7NA 3AE7C 4KSMA 4R4LA 4HDEA 4FIWA 4KT0J 3ISOA 3GX0A 1XW5A 4H13D 1AQXA 3I43A 2R0GA 4J56E 1QGVA 1K0AA 2DSAA 1USBA 3GN3A 5AIVA 1LBKA 2H76A 2X8CA 1C72A 2B1KA 3DD3A 3M3MA 2DKIA 1GNEA 4XFJA 2HRFA 2D2CC 2H71A 4X43A 5ECSA 3TRPA 1XWCA 6GSYA 1KILE 1SKRB 2VCVA 1YY7A 1G7EA 1EOGA 5KEJA 5F8BA 1KBNA 5GZZB 2LNTA 5F07A 2IN3A 1SK0A 4MZBA 3EU3A 2YOIA 3D0ZA 2DIYA 2RIIA 4IELA 2XBQA 1TJDA 4DEJA 1A2MA 1HNBA 2IMEA 2XPDA 10GSA 3R2QA 4TXVA 5G5FA 4PQ1A 1X9SB 3LXTA 4GCIA 1V58A 4JU5A 1S3AA 2DLXA 3D6YA 5IO2A 2E2MA 1K05A 1ZZYA 4NHWA 2K9YA 4MJCA 3W6GA 1GP1A 2HRNA 3H8QA 2P31A 1FW1A 1V98A 2VD1A 1U88A 1FDOA 2ZCTA 3KGKA 4G10A 3EVIA 4L0WA 4P3YB 1PA3A 2TRCP 3ZITA 4AGSA 3KMOA 1SJZA 2E0QA 3VURA 2QJKC 3EWKA 2VLUA 3MSZA 3QPMA 1PV3A 3A2XA 3G9RA 3EMXA 5CYYA 1ZYEA 5IPHA 3I69A 1XXUA 3VI7A 2YANA 3QAVA 2F8AA 1MDIA 2NTOA 1FOVA 2VAFA 2YJ7A 2YMKA 2JP3A 4Q5RA 2TIRA 4F9ZA 3Q2YA 1NGMB 1KTEA 5AISA 2FWFA 2VLTA 2A4HA 2GQMA 2HXKA 1K0DA 2O89A 2RM5A 5C04A 1Z7RA 3GSSA 2LNSA 2JSYA 3QD9A 3ZLPA 4TKYA 3FW2A 1THXA 1OYJA 4O5QA 4CHSA 4HU7A 3E9JB 5BRTA 5ECQB 4RI7A 2CX4A 2HFDA 2VL3A 2E76C 4V2NA 1GSUA 1XWKA 5DBQA 3UL3A 3EINA 4NXIA 4IP6A 4MMMA 4PUFC 2JADA 1V9WA 3G7IA 4TR1B 2BEZF 4FQUA 4H44B 3J7Yb 4KAEA 4POLA 1MEKA 1CQHA 3APQA 4BWQA 3IHQA 4Z2UA 1GTBA 1O7UA 2L5LA 2R5GA 3CTFA 4OCEA 2VLVA 3HHVA 1ZMAA 2VL2C 1EGOA 5EVOA 2C1YA 3FZ4A 2FUG2 1PN9A 3BJ5A 3FR6A 1SL1B 2IMFA 2L4CA 4G0LA 1M99A 2GSTA 2EC4A 3ZIVA 1E2YA 1AC1A 1F3AA 4IN0A 2VM1A 4K8MA 4MH2A 4DVCA 1I5GA 4OGQB 4I6XA 4K5RA 1EXJA 3GIXA 2GVPA 1M7TA 5J9CA 4XS6A 1YDKA 4USSA 1ON4A 4HQZA 3O6TA 5B6NA 4TN8A 1ZOFA 4JE1A 3IDVA 3Q5SA 2VCTA 3KJYA 3S9OA 3TCOA 4A5PA 1ZGNA 1MDJA 1YZXA 3BCKA 4KH7A 3TB2A 4MP4A 2YWMA 2FNOA 2IL3A 5KLIC 3R4YA 2LEGA 4DSRA 2DJJA 3FYGA 3E0UA 3FRCA 1THOA 4GTUA 2YWNA 3FZ5A 2LQOA 4FYUA 1XW6A 4RUVA 5EL8A 1SD9A 4EKZA 4HS1A 1A23A 2I4AA 3ZFLA 2NBSA 5G1LA 1WOUA 4BL7B 4MF7A 2ES7A 3T97B 4F82A 4K2DA 4ZBAA 3GFKA 6GSTA 3GSTA 2JO1A 11GSA 3GKKA 4TR1A 3TUEA 1PRXA 1FOHA 4YKGA 1GLPA 1J9BA 2NZ2A 1JZRA 1O8XA 2FYNC 3WT1A 3H4KA 4N11A 1M9BA 5LNKe 3RHCA 3I6AA 4EC0A 3DXBA 1KEBA 4PV1C 4IW9A 2C3NA 3DVWA 2IMKA 3D4TA 3AE8C 3IPZA 3RBTA 2L6DA 1T3BA 1DD3A 4PUAA 3A2WA 1ERTA 1UN2A 2QA1A 5D9WA 5IMAA 4LMWA 5A4WA 1ZOYC 2IWTA 1B4PA 1PN0A 1U3AA 5GSSA 5ECIB 2VO4A 3LJRA 1BX9A 5FT3A 1ZYQB 2C80A 1A8YA 2FD3A 3LFLA 5KKZC 3DVXA 3J7Yk 2FWEA 3M8NA 1HYUA 4OO5A 3FKFA 1RW1A 2XBIA 4K6XA 4N0VA 4KUNA 3VFIA 2OA7A 1GSYA 3RDWA 3GLMA 4O92A 3SWLA 2HZEB 4H13B 4MDCA 4MK3A 2F51A 2QSIA 2L57A 3UARA 4MCUA 4KSOA 4CDOA 5HFIA 1GUKA 4L0UA 1J08A 1I9DA 2DMLA 4KGIA 20GSA 3QFBC 3KEBA 1M2DA 2I9HA 2YPMA 4ZL7A 1G6WA 2V1MA 3GUSA 5A4VA 3F9UA 3GRXA 3AEGC 4I5QA 3HD5A 1R8EA 4WXTA 5DAKB 2JZRA 4GSSA 6GSXA 2WDUA 3H1NA 4YQUA 3DGQA 4IKHA 2YJHA 2DC5A 2V32A 3VLNA 4MZCA 4XTSA 1FG4A 4JBBA 2GZZA 1S3DA 4V2MA 4G19A 1G0TA 1PKZA 2H30A 3K8NA 1WWJA 4J2FA 4LL1B 3IE3A 3ZMKA 2NVLA 5B6MA 1T00A 4H0LD 2C4JA 4EO3A 2WSFJ 4YTPC 5G2ZA 1X5DA 5J9BA 2WJUA 1EZKA 2L6CA 1X5EA 3N9JA 1AUCA 2MZCA 2J5UA 1MDKA 3AE5C 5JCUA 1WP0A 5IMCA 4NAXA 3DEXA 2VCQA 5DALB 1Z7PA 2RUEA 3DYRA 5DJLA 1CQGA 1B48A 3M9KA 1TRWA 2E74D 2GS3A 4DSSA 1G7OA 1F2EA 3CMIA 4AJ7A 4D73B 3GURA 3L9UA 2MMZA 4ECBA 1HD2A 4FO5A 1PL5A 2HZEA 4HJMA 1HNCA 3F8UA 3L78A 3CYNA 2R4VA 1XCCA 1EEJA 2O8VB 2FXPA 1TRUA 4IP1A 3GTUB 4QL7A 2XPEA 2VM2A 2A2RA 1KNGA 1AQWA 3QOUA 4Y28J 2VL2A 4KE3A 1KORA 1SJIA 1DD4A 4ML6A 1GRXA 1OC8A 1GUHA 2H1AA 4H44C 3IA1A 5DAKA 5H5RA 4ICYA 1OE8A 1A2JA 2C8UA 3HVVA 3LGCA 4IJ3A 1GTUA 2CA8A 3JCML 5D96A 2BEQD 4TR4A 3FK8A 3F6DA 3ZIJA 5IMFA 4O7HA 3AE6C 3VK9A 1F37A 2VCZA 2PGTA 3GMFA 1OW8A 4WF4A 2M46A 2X4AA 1AAZA 1K0BA 1Q98A 1GL8A 3BD2A 3P2AA 1OC9B 3ZTLA 1LJRA 4GWRA 1JB0J 4OGQC 1VRSD 3Q1MA 2L4QA 5ECKB 2MMOA 1JZWA 2REMA 2FA8A 1XWGA 1O6JA 3W8JA 2V6KA 3KMNA 4Z2RA 1FHEA 2YWIA 3UAPA 4OD7A 3CRTA 1GNWA 3F63A 2KP1A 1FB6A 3ERGA 4HU9A 2LTKA 3FEUA 4BVYB 3AE9C 1TU7A 4OCFA 3LW9A 2WULA 6GSUA 2PMTA 3NZNA 3DIEA 4WF5A 4JR4A 4IVFA 2R3XA 3PH9A 5CNWA 4BVXB 3AE3C 5ECPB 1RQUA 5M1BA 2AAWA 1H75A 3ERWA 1T4ZA 5ECLB 3KTBA 2HSHA 2FLSA 3F0IA 4WEYA 4EDYA 5JWQB 1O8WA 3C71A 2PBJA 1HNAA 2YCDA 5F0GA 1EOHA 4NV5A 1GSSA 2PWJA 2QJPC 3FGAD 3TJGA 1TRSA 1V2AA 2J23A 1VF3A 5IMDA 3ZFBA 1WMKA 5LD0A 3UVHA 3GYKA 2DBCA 4HZ4A 2CQ9A 3WYWA 2KOKA 3A2VA 1YQ1A 2FHEA 4G0KA 2CVKA 5J4UA 1IYIA 3D71A 4KCEA 4PQHA 3IBHA 2EIOA 3QFAC 4IS0A 3U5RE 2WRTA 4HOJA 1GULA 3O76A 1RQVA 3ZVJA 3AE2C 4DSQA 4WBJA 2O85A 3Q5RA 3GKMA 4OWYA 2N5AA 3F3QA 4K9ZA 1TW9A 2WSEJ 1M0UA 4NHZA 3GNJA 3QMXA 3US3A 1GTIA 1XVQA 4JRRA 2B7KA 3KH9A 2H0GA 2FWGA 1NW2A 2GT5A 2WFCA 2HT9A 3G7JA 2KP2A 4POBA 3IC8A 4GQCA 2CZ3A 1YQ3C 4NWYA 5KOXA 1ERWA 2ALBA 5D9XA 1XIYA 3C8EA 3KP8A 2YV7A 5C00A 3ZREA 4OFMA 2P5RA 3Q18A 3LEFA 1JLVA 2HSYA 4BVYA 3TJFA 5EPFA 5IM9A 4XRDA 4Z1MH 3TJKA 2C0FA 1TU8A 3IXRA 3VI5A 3I9V2 2X8GA 1OW6A 4H13C 3ABVC 2GLRA 4BVXA 2B3SA 5ELAA 2DMMA 4BPYA 1KQGB 3WGEA 2WPVB 3IK7A 4H86A 2OACA 4EVMA 5B7CA 2OJLA 3FZAA 4KA0A 4I7ZB 3AE4C 4V1Ap 1T1VA 2AJQB 1EWXA 3GF7A 4N30A 3LG6A 1K0OA 1VL2A 1ZYNA 3QDNA 2RLIA 1K0NA 2CVDA 1SU9A 1VF5D 4LMVA 1GWCA 4ZB8A 3M9JA 4KDXA 4ZL8A 2H0IA 1Z9HA 4EIPA 3EC3A 4ECJA 2O87A 4ZILA 2V2GA 4K7OA 2OE1A 1B8XA 2LRNA 4CW9A 1K3LA 5ECOB 2N5BA 17GSA 1V40A 2H70A 1SYXA 2BTOT 4OO4A 5IMVA 4TXOB 5D9TA 1QK8A 4JR6A 1ZL9A 5J3RA 1G6YA 4JZQA 1U3IA 3UVTA 2H75A 1RQMA 2LKUA 5IO0A 5H5SA 3KZQA 4F2IA 1UC7A 1ML6A 2PUKC 2K18A 2OE0A 5GAPD 4ZIJA 1PL2A 3KTLA 1HF9A 2KLXA 2QA2A 2E74B 3BOAA 3MAKA 1A8LA 5CRHA 2QIWA 4E8HA 2WS2A 4PXOA 4GF0A 1J0FA 2H8LA 1XZOA 3P90A 3IN6A 2FCHA 5IQYA 1SKSB 3FHKA 3U6VA 3LQ7A 3L4NA 2AB6A 4OMVA 2YN1A 1TK8B 4TRXA 3ZYWA 3VPTA 1RK4A 5B8AA 1N2AA 2DIZA 12GSA 4I2UA 5HR3A 2VUPA 3D4MA 1DBYA 2QC7A 1H4OA 3ZL5A 1F6MC 2GSQA 5DDLA 4XRAA 3TDGA 4TW5A 1PIXA 2X49A 4NPBA 5H5QA 1QMVA 5HFGA 3LWAA 4ECIA 3CRUA 4QL9A 1K3YA 2AUVA 3D22A 4YAPA 4PNFA 2ZUPA 5IIZA 2FBWC 5HR1A 8GSSA 1R7HA 1EGRA 3LYPA 4IL6X 1FDIA 2VIMA 3LORA 4K0GA 3IV4A 3D21A 2VCWA 1PD21 3HKRA 3GMAA 2JACA 4KDYA 2NPBA 4ISDA 1W89A 3SFDC 4MPFA 3TRQA 1U87A 2YP6A 4KB3A 2DJ1A 4TXOA 3IC4A 1DIPA 5LCZA 4K2XA 1Q4JA 1S3CA 2HE3A 1F3BA 3FY7A 3H79A 2PU9C 2P5QA 3Q74A 4GLTA 3BBYA 3ZZXA 5ECHB 2LJRA 1K0MA 2GSSA 2R6KA 2ZNMA 4F0BA 4MJAA 4ZBDA 5GSTA 3A5IA 1DSBA 4ID0A 1HJ0A 1LU4A 3MWHA 1SK2A 3UEMA 1WE0A 2L59A 2KHPA 2C0DA 4IQAA 4MPGA 4F03A 4MA9A 5D93A 3AEDC 4XS4B 4BL7A 1AXDA 4I8BA 3HXSA 3ZRDA 2H1BA 5AN1A 3ZMLA 2YV9A 3HJMA 1MD4A 1PKWA 3VPQA 1BAYA 2N5FA 3AEEC 3HYPA 3TKQA 3TKPA 3NIVA 2V7QJ 2CT6A 3WD6A 3KIJA 1XBSA 2I3YA 3MIXA 4HZ2A 2B5EA 2FWHA 2ZT9D 3RK3E 5ECRB 1EXIA 3F4SA 3IHGA 1UIXA 3A5WA 2A2PA 3KP9A 2PERA 4IGJA 3H93A 5CRWA 4EF0A 3Q3DA 1TK5B 1GLQA 2JU5A 1ILOA 1Z3EA 4YQVA 1TP9A 2MYGA 3HJOA 1X9WB 1BG5A 2D2CD 3F4RA 3AEAC 4MF5A 4RI6A 4KX4A 3FR3A 5ECNB 3TKSC 2J9HA 4GQFA 3SFEC 4ZBBA 5BMUA 5JWRB 1KMIZ 2C0GA 3HZ8A 2CX3A 4MZWA 4X4JA 3PGTA 2LRTA 2CZ2A 3GKNA 1DUGA 1NHOA 1HQOA 2GZYA 1GSDA 1WPIA 3EMPA 4EE0A 4FH8A 1BEDA 3O3TA 2E7PA 1FVJA 1XVWA 3LXZA 3PR8A 2QKEA 1FB0A 1GSFA 2D2ZA 3W8SA 2G0FA 3IOSA 1MD3A 2HI7A 4ZB9A 4RKUJ 3CTGA 4OFNA 5F05A 5KN1A 5FHIA 4POMA 3KXOA 4L8EA 3PINA 3UIWA 1XOBA 4JEDA 4GDOA 3WGXA 3L0HA 2CAQA 2K8VA 4WR5A 1XWBA 3IRAA 3HDCA 3IAS2 4O5RA 3IK9A 4I7ZC 1Z6NA 1XWAA 3M0FA 3MNGA 2H01A 2VL9A 3EPTA 3FMWA 1X0RA 2GGTA 1M9AA 4MF6A 1NSWA 2OE3A 3C7MA 2OKAA 1TDIA 2X99A 4YXDC 1B4QA 3C73A 2GZPA 2F8FA 2IMDA 2MMNA 1Z6MA 1VF5B 5E4WA 5AIXA 2M80A 3G9BA 1S5LX 1JLWA 1U6TA 4AJ8A 4TR0A 4H0LC 3EURA 1OE7A 1V57A 3FZ9A 2JZTA 2P0GA 4ML1A 2E76D 1X9MB 1R4WA 4ACSA 1OVNA 2DJKA 5DALA 5L8RJ 2HLSA 3CBUA 3ED3A 1N8JA 3HA9A 1A0RP 3KM6A 1OW7A 5INYA 3F3RA 4J57E 3LYKA 2M72A 4MJEA 1Z5YE 2B1LA 3IAM2 2ON7A 3GL3A 2K6VA 2DJ3A 2OADA 3TGZA 4PTSA 2GSRA 1YJ6A 4IJIA 2XC2A 1TOFA 2LS5A 4D73A 1JHBA 2FGXA 4WETA 6GSSA 1YKAA 2YZUA 1T7PB 5DQSA 3TJJA 1W4VA 4RQRA 2E2GA 1GH2A 2H6ZA 5G31A 2RUFA 4ZXGA 2E74C 4ILFA 4N10A 4Q5NA 2R2JA 2A4VA 1YQ4C 3GTUA 2O01J 4MABA 2LUSA 5B8BA 2KUCA 2YWOA 2LRCA 3N5OA 5CO3A 2I1UA 1VGLA 5G30A 1T8EB 1R5AA 3OR5A 3MDKA 1TI1A 2YIUC 3RPNA 1TRVA 5CREA 1OKDA 1R5PA 4CY8A 2IDBA 4Q5FA 3HVSA 4FYCA 2PPTA 1S1CX 4WKWA 2H74A 4AJ6A 4BWSA 1K0CA 1MTCA 4E8EA 2FA4A 5HFKA 1FO5A 2CV4A 5JCGA 4HI7A 5D73A 4G0IA 1OMIA 1YEPA 2E75D 4EIQA 1OC9A 3F6FA 1OC3A 5ENUA 1YF0A 1ZRTE 2H6YA 1KTMA 5G1KA 5GAND 3QCPA 4NV2A 1WIKA 3MYDA 1JZDA 2HSMA 3E3EA 1ERVA 2F3MA 2HRAA 2YNXA 2Z9SA 3IR4A 5COHA 3DWVA 3Q5PA 3DKSA 9GSSA 3LW5J 3APSA 2LJAA 3HY2A 3EWLA 4LLRA 3B71A 3NOFA 3O6QA 1SD8A 1QXHA 4MNNA 1M2BA 1QQ2A 4LL4B 1OAZA 3QAGA 1VF1A 1PX7A 2IIYA 5HQPA 4HUAA 1R26A 3KD0A 13GSA 5JCWA 2G3AA 3TOUA 1B9XC 1NHYA 3GH9A 5G5EA 1SYRA 1TU3F 1Y9BA 1M2AA 2O7KA 2HZFA 1GMJA 3F4TA 4WR4A 1GUMA 2HRKA 3GL5A 4PV1D 5D8IA 1JFUA 2AV4A 1O85A 2QJYC 1BYEA 5JWOB 5IOXA 1Y25A 2RM6A 4GSTA 3CSHA 4I97A 4AF2A 2L5OA 3A3TA 5KN0A 3ZVJD 5HR2A 2H1DA 2HYXA 3DRNA 4IQ1A 1OKTA 1K04A 3ERFA 1PL1A 1XFLA 1IYHA 1YF1A 2BJXA 3GKXA 4QQ7A 14GSA 3UBLA 5D9VA 5DCHA 4Z7XA 1DE2A 1ACVA 4H0LB 2PVOC 2XHFA 1X5CA 2WSCJ 2ZT9B 4MJBA 1F9MA 3GV1A 2LJKA 5DCGA 2AHEA 5ID2B 3TKSE 5DQYA 3KH7A 5CAXA 1Y6EA 2C3TA 3ME8A 1XW9A 2DJ2A 1QUWA 3TKSA 1VF4A 3CXGA 3VWWA 2B5XA 1ST9A 1Q90D 5IPGA 1PGTA 3V1WA 3UOMA 4MLYA 2V41A 2OBIA 2GT6A 2D2CB 3UBKA 4U7JA 2K8SA 1YEXA 4Q5QA 3DMLA 3IAOA 5KN2A 1B9YC 1SL0B 2LSTA 5CRDA 2E75C 3Q19A 4O32A 4PNGA 3APOA 4YH2A 3EE2A 1ZCPA 2V6OA 2ON5A 3VWVA 2MMAA 2X64A 1U57A 3D5JA 2H1GA 2C3QA 2IPAA 1ZMEC 4HEA2 2B6MA 4V2LA 5KOWA 3AE1C 2UZ8A 2OQQA 3R3EA 5AGYA 4G9HA 4O5UA 1ZP0C 2WZ9A 4L5OA 4OFTA 4FYBA 4L5LA 1ABAA 2WQYC 1AJYA 4EL1A 3HVXA 4N0ZA 2H89C 1WMJA 2R0CA 3RAZA 3HJPA 4K7IA 4HQSA 5HR0A 1GSEA 4K1FA 2H73A 2OBKA 5CRGA 3EU4A 4BA7A 4YKFA 1WJKA 2MBTA 1EP8A 1EEMA 3PPUA 1A24A 1BJXA 5J41A 3D6IA 3HCZA 3QAWA 2LQQA 3D70A 2EIQA 3RHBA 3TKRA 4XS1A 3M1GA 2WCIA 2GQKA 2CAIA 4KF9A 5ID2A 4TR3A 1KQFB 3ME7A 5DJMA 1XOAA 3QR6A 1VF5C 1SENA 2R0PA 2IFQB 4GSNA 4TOPA 4F0CA 2AYTA 1BQ7A 4GXZA 1A0FA 1TXXA 4DSSB 2B7JA 2E76B 1EP7A 2IJYA 2LV3A 5ABRA 3H25A 2PVQA 3LSZA 4GRFA 3S9FA 3GHAA 5L71A 1VF2A 2WB9A 1PQNA 1PX6A 1GSQA 3KCMA 2JZSA 1EV4A 4KCAA 2VOCA 2QGVA 4H44D 3RPPA 1PMTA 4IHUA 2DKHA 4KDUA 3GH6A 3WGDA 2TRXA 4K0NA 2H0HA 3VWUA 2CVBA 2JL4A 2B5YA 4PURA 4V1Ag 5A4UA 3AEFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZB6 A;  4ECC A;  4MH3 A;  2DJ0 A;  6GSW A;  3TJB A;  5IOW A;  1JZO A;  5J5N A;  1UA5 A;  5F06 A;  5ECM B;  3G7Y A;  4KND A;  4XIH A;  4KW6 A;  4IBP A;  3L9S A;  4RQX A;  1TI3 A;  1FAA A;  3C8V A;  1QFN A;  3C1S A;  4ULX A;  2GQL A;  1TTZ A;  2G2Q A;  5ELG A;  5KN3 A;  1NM3 A;  2X8H A;  3AY8 A;  1FVK A;  2A2S A;  2C0E A;  3FR9 A;  2E75 B;  3VWX A;  2EIR A;  5DVB A;  3SBC A;  1SKW B;  4X1U A;  1TK0 B;  2H19 A;  4HJ2 A;  2HNL A;  3TOT A;  2H6X A;  1GTA A;  5IMZ A;  2IFQ A;  1UVZ A;  2BMX A;  3L9V A;  2PN8 A;  2I81 A;  1SJ6 A;  5A5K A;  3TRX A;  2VCX A;  4XCS A;  3Q6O A;  1E6B A;  5FWG A;  16GS A;  4G2E A;  2R37 A;  3P7X A;  1YKC A;  3UMA A;  2GTU A;  4NMU A;  1K3O A;  2IMI A;  4EDZ A;  5E59 A;  4LA1 A;  18GS A;  4XS4 A;  1AQV A;  4WBR D;  3EYT A;  2K9F A;  1XPV A;  2H66 A;  4I2T A;  5EY6 A;  3WT2 A;  6GSV A;  2F9S A;  1ERU A;  3HZ4 A;  1EV9 A;  4PV1 B;  1PSQ A;  3GA4 A;  4TVE A;  3UJ1 A;  3GX8 A;  2YZH A;  3CSJ A;  7GSS A;  1DE1 A;  4PQI A;  1A2L A;  3P8W A;  22GS A;  4EXJ A;  4PX1 A;  1URM A;  4EUY A;  1SL2 B;  19GS A;  4XHM A;  2JSZ A;  2NDO A;  1AIU A;  2WGR A;  3CSI A;  4PGT A;  4YQM A;  1SK1 A;  1WRY A;  5CP1 A;  2GDR A;  4X0X A;  4POK A;  2H72 A;  2MBS A;  2FY6 A;  3C1R A;  1O81 A;  4ZL9 A;  1T4Y A;  2VD0 A;  3BCI A;  1TKD B;  1AW9 A;  4YAV A;  1O73 A;  4K7N A;  4KSM A;  4HDE A;  4FIW A;  4KT0 J;  3ISO A;  3GX0 A;  1XW5 A;  1AQX A;  3I43 A;  4J56 E;  1QGV A;  1K0A A;  2DSA A;  1USB A;  3GN3 A;  5AIV A;  1LBK A;  2H76 A;  2X8C A;  1C72 A;  2B1K A;  3DD3 A;  3M3M A;  1GNE A;  2HRF A;  2H71 A;  4X43 A;  5ECS A;  3TRP A;  1XWC A;  6GSY A;  1SKR B;  2VCV A;  1YY7 A;  1G7E A;  1EOG A;  5KEJ A;  5F8B A;  1KBN A;  5GZZ B;  2LNT A;  5F07 A;  2IN3 A;  1SK0 A;  4MZB A;  3EU3 A;  2YOI A;  3D0Z A;  2DIY A;  2RII A;  4IEL A;  2XBQ A;  1TJD A;  4DEJ A;  1A2M A;  1HNB A;  2IME A;  2XPD A;  10GS A;  3R2Q A;  4TXV A;  5G5F A;  4PQ1 A;  1X9S B;  3LXT A;  4GCI A;  1V58 A;  4JU5 A;  1S3A A;  2DLX A;  5IO2 A;  2E2M A;  1ZZY A;  4NHW A;  2K9Y A;  4MJC A;  3W6G A;  1GP1 A;  2HRN A;  3H8Q A;  2P31 A;  1FW1 A;  1V98 A;  2VD1 A;  1U88 A;  2ZCT A;  3KGK A;  4G10 A;  3EVI A;  4L0W A;  4P3Y B;  1PA3 A;  2TRC P;  3ZIT A;  4AGS A;  3KMO A;  1SJZ A;  2E0Q A;  3VUR A;  2QJK C;  2VLU A;  3MSZ A;  3QPM A;  3A2X A;  3EMX A;  5CYY A;  1ZYE A;  5IPH A;  3I69 A;  1XXU A;  3VI7 A;  2YAN A;  3QAV A;  2F8A A;  1MDI A;  2NTO A;  1FOV A;  2VAF A;  2YJ7 A;  4Q5R A;  2TIR A;  4F9Z A;  1KTE A;  5AIS A;  2FWF A;  2VLT A;  2GQM A;  2HXK A;  1K0D A;  2O89 A;  2RM5 A;  5C04 A;  1Z7R A;  3GSS A;  2LNS A;  2JSY A;  3QD9 A;  3ZLP A;  4TKY A;  3FW2 A;  1THX A;  1OYJ A;  4CHS A;  4HU7 A;  3E9J B;  5ECQ B;  4RI7 A;  2CX4 A;  2HFD A;  2VL3 A;  4V2N A;  1GSU A;  1XWK A;  5DBQ A;  3UL3 A;  3EIN A;  4NXI A;  4IP6 A;  4MMM A;  4PUF C;  2JAD A;  1V9W A;  3G7I A;  4TR1 B;  4H44 B;  3J7Y b;  4KAE A;  4POL A;  1MEK A;  1CQH A;  3APQ A;  4BWQ A;  3IHQ A;  1GTB A;  1O7U A;  2L5L A;  2R5G A;  3CTF A;  4OCE A;  2VLV A;  3HHV A;  1ZMA A;  2VL2 C;  1EGO A;  5EVO A;  2C1Y A;  3FZ4 A;  2FUG 2;  1PN9 A;  3BJ5 A;  3FR6 A;  1SL1 B;  2IMF A;  2L4C A;  1M99 A;  2GST A;  2EC4 A;  3ZIV A;  1E2Y A;  1AC1 A;  1F3A A;  4IN0 A;  2VM1 A;  4K8M A;  4MH2 A;  4DVC A;  1I5G A;  4OGQ B;  4I6X A;  3GIX A;  2GVP A;  1M7T A;  5J9C A;  4XS6 A;  1YDK A;  1ON4 A;  4HQZ A;  3O6T A;  5B6N A;  4TN8 A;  1ZOF A;  4JE1 A;  3IDV A;  2VCT A;  3KJY A;  3TCO A;  1ZGN A;  1MDJ A;  1YZX A;  3BCK A;  4KH7 A;  3TB2 A;  4MP4 A;  2YWM A;  2FNO A;  2IL3 A;  5KLI C;  2LEG A;  4DSR A;  2DJJ A;  3FYG A;  3E0U A;  3FRC A;  1THO A;  4GTU A;  2YWN A;  3FZ5 A;  2LQO A;  4FYU A;  1XW6 A;  4RUV A;  5EL8 A;  1SD9 A;  4EKZ A;  4HS1 A;  1A23 A;  2I4A A;  3ZFL A;  2NBS A;  5G1L A;  1WOU A;  4MF7 A;  2ES7 A;  4F82 A;  4K2D A;  4ZBA A;  3GFK A;  6GST A;  3GST A;  11GS A;  3GKK A;  4TR1 A;  3TUE A;  1PRX A;  1GLP A;  1J9B A;  1JZR A;  1O8X A;  2FYN C;  3WT1 A;  3H4K A;  4N11 A;  1M9B A;  5LNK e;  3RHC A;  3I6A A;  4EC0 A;  3DXB A;  1KEB A;  4IW9 A;  2C3N A;  3DVW A;  2IMK A;  3D4T A;  3IPZ A;  3RBT A;  2L6D A;  1T3B A;  4PUA A;  3A2W A;  1ERT A;  1UN2 A;  5D9W A;  5IMA A;  4LMW A;  5A4W A;  2IWT A;  1B4P A;  1U3A A;  5GSS A;  5ECI B;  2VO4 A;  3LJR A;  1BX9 A;  5FT3 A;  1ZYQ B;  2C80 A;  1A8Y A;  2FD3 A;  3LFL A;  5KKZ C;  3DVX A;  3J7Y k;  2FWE A;  3M8N A;  1HYU A;  4OO5 A;  3FKF A;  1RW1 A;  2XBI A;  4K6X A;  4N0V A;  4KUN A;  3VFI A;  2OA7 A;  1GSY A;  3RDW A;  4O92 A;  3SWL A;  2HZE B;  4H13 B;  4MDC A;  4MK3 A;  2F51 A;  2QSI A;  2L57 A;  3UAR A;  4MCU A;  4KSO A;  4CDO A;  5HFI A;  1GUK A;  4L0U A;  1J08 A;  1I9D A;  2DML A;  4KGI A;  20GS A;  3QFB C;  3KEB A;  1M2D A;  2I9H A;  2YPM A;  4ZL7 A;  1G6W A;  2V1M A;  3GUS A;  5A4V A;  3F9U A;  3GRX A;  4I5Q A;  3HD5 A;  4WXT A;  5DAK B;  2JZR A;  4GSS A;  6GSX A;  2WDU A;  3H1N A;  4YQU A;  3DGQ A;  4IKH A;  2YJH A;  2DC5 A;  2V32 A;  3VLN A;  4MZC A;  4XTS A;  1FG4 A;  4JBB A;  2GZZ A;  1S3D A;  4V2M A;  4G19 A;  1G0T A;  1PKZ A;  2H30 A;  3K8N A;  1WWJ A;  4J2F A;  4LL1 B;  3IE3 A;  3ZMK A;  2NVL A;  5B6M A;  1T00 A;  2C4J A;  4EO3 A;  2WSF J;  5G2Z A;  1X5D A;  5J9B A;  2WJU A;  1EZK A;  2L6C A;  1X5E A;  3N9J A;  1AUC A;  2MZC A;  1MDK A;  5JCU A;  1WP0 A;  5IMC A;  4NAX A;  3DEX A;  2VCQ A;  5DAL B;  1Z7P A;  2RUE A;  3DYR A;  5DJL A;  1CQG A;  1B48 A;  3M9K A;  1TRW A;  2GS3 A;  4DSS A;  1G7O A;  1F2E A;  3CMI A;  4AJ7 A;  4D73 B;  3GUR A;  3L9U A;  2MMZ A;  4ECB A;  1HD2 A;  4FO5 A;  2HZE A;  4HJM A;  1HNC A;  3F8U A;  3L78 A;  3CYN A;  2R4V A;  1XCC A;  1EEJ A;  2O8V B;  1TRU A;  4IP1 A;  3GTU B;  4QL7 A;  2XPE A;  2VM2 A;  2A2R A;  1KNG A;  1AQW A;  3QOU A;  4Y28 J;  2VL2 A;  4KE3 A;  1SJI A;  4ML6 A;  1GRX A;  1OC8 A;  1GUH A;  2H1A A;  3IA1 A;  5DAK A;  5H5R A;  1OE8 A;  1A2J A;  2C8U A;  3HVV A;  3LGC A;  4IJ3 A;  1GTU A;  2CA8 A;  3JCM L;  5D96 A;  4TR4 A;  3FK8 A;  3F6D A;  3ZIJ A;  5IMF A;  4O7H A;  3VK9 A;  1F37 A;  2VCZ A;  2PGT A;  3GMF A;  4WF4 A;  2M46 A;  1AAZ A;  1K0B A;  1Q98 A;  1GL8 A;  3BD2 A;  3P2A A;  1OC9 B;  3ZTL A;  1LJR A;  4GWR A;  1JB0 J;  1VRS D;  2L4Q A;  5ECK B;  2MMO A;  1JZW A;  2REM A;  2FA8 A;  1XWG A;  1O6J A;  3W8J A;  2V6K A;  3KMN A;  1FHE A;  2YWI A;  3UAP A;  4OD7 A;  3CRT A;  1GNW A;  3F63 A;  2KP1 A;  1FB6 A;  3ERG A;  4HU9 A;  2LTK A;  3FEU A;  1TU7 A;  4OCF A;  2WUL A;  6GSU A;  2PMT A;  3NZN A;  3DIE A;  4WF5 A;  4JR4 A;  4IVF A;  2R3X A;  3PH9 A;  5CNW A;  5ECP B;  2AAW A;  1H75 A;  3ERW A;  1T4Z A;  5ECL B;  3KTB A;  2HSH A;  2FLS A;  3F0I A;  4WEY A;  4EDY A;  5JWQ B;  1O8W A;  3C71 A;  2PBJ A;  1HNA A;  2YCD A;  5F0G A;  1EOH A;  4NV5 A;  1GSS A;  2PWJ A;  2QJP C;  3TJG A;  1TRS A;  1V2A A;  2J23 A;  1VF3 A;  5IMD A;  3ZFB A;  5LD0 A;  3UVH A;  3GYK A;  2DBC A;  4HZ4 A;  2CQ9 A;  3WYW A;  2KOK A;  3A2V A;  1YQ1 A;  2FHE A;  2CVK A;  5J4U A;  1IYI A;  4KCE A;  4PQH A;  3IBH A;  2EIO A;  3QFA C;  4IS0 A;  3U5R E;  2WRT A;  4HOJ A;  1GUL A;  3O76 A;  3ZVJ A;  4DSQ A;  4WBJ A;  2O85 A;  3GKM A;  4OWY A;  2N5A A;  3F3Q A;  4K9Z A;  1TW9 A;  2WSE J;  1M0U A;  4NHZ A;  3GNJ A;  3QMX A;  3US3 A;  1GTI A;  1XVQ A;  4JRR A;  2B7K A;  3KH9 A;  2H0G A;  2FWG A;  1NW2 A;  2GT5 A;  2WFC A;  2HT9 A;  3G7J A;  2KP2 A;  4POB A;  4GQC A;  2CZ3 A;  4NWY A;  1ERW A;  2ALB A;  5D9X A;  1XIY A;  3C8E A;  3KP8 A;  2YV7 A;  5C00 A;  3ZRE A;  4OFM A;  2P5R A;  3Q18 A;  3LEF A;  1JLV A;  2HSY A;  4BVY A;  3TJF A;  5EPF A;  5IM9 A;  4XRD A;  3TJK A;  2C0F A;  1TU8 A;  3IXR A;  3VI5 A;  3I9V 2;  2X8G A;  2GLR A;  4BVX A;  2B3S A;  5ELA A;  2DMM A;  4BPY A;  3WGE A;  2WPV B;  3IK7 A;  4H86 A;  2OAC A;  4EVM A;  5B7C A;  2OJL A;  3FZA A;  4KA0 A;  4I7Z B;  4V1A p;  1T1V A;  2AJQ B;  1EWX A;  4N30 A;  3LG6 A;  1K0O A;  3QDN A;  2RLI A;  1K0N A;  2CVD A;  1SU9 A;  4LMV A;  1GWC A;  4ZB8 A;  3M9J A;  4KDX A;  4ZL8 A;  2H0I A;  1Z9H A;  3EC3 A;  4ECJ A;  2O87 A;  4ZIL A;  2V2G A;  4K7O A;  2OE1 A;  1B8X A;  2LRN A;  4CW9 A;  1K3L A;  5ECO B;  2N5B A;  17GS A;  1V40 A;  2H70 A;  1SYX A;  2BTO T;  4OO4 A;  5IMV A;  4TXO B;  5D9T A;  1QK8 A;  4JR6 A;  1ZL9 A;  5J3R A;  1G6Y A;  4JZQ A;  1U3I A;  3UVT A;  2H75 A;  1RQM A;  2LKU A;  5IO0 A;  5H5S A;  3KZQ A;  4F2I A;  1UC7 A;  1ML6 A;  2PUK C;  2K18 A;  2OE0 A;  5GAP D;  4ZIJ A;  1PL2 A;  3KTL A;  2KLX A;  2E74 B;  3BOA A;  3MAK A;  1A8L A;  5CRH A;  2QIW A;  4E8H A;  2WS2 A;  4PXO A;  4GF0 A;  1J0F A;  2H8L A;  1XZO A;  3P90 A;  2FCH A;  5IQY A;  1SKS B;  3FHK A;  3U6V A;  3LQ7 A;  3L4N A;  2AB6 A;  4OMV A;  2YN1 A;  1TK8 B;  4TRX A;  3ZYW A;  3VPT A;  1RK4 A;  5B8A A;  1N2A A;  2DIZ A;  12GS A;  4I2U A;  5HR3 A;  2VUP A;  3D4M A;  1DBY A;  2QC7 A;  1H4O A;  3ZL5 A;  1F6M C;  2GSQ A;  5DDL A;  4XRA A;  3TDG A;  4TW5 A;  4NPB A;  5H5Q A;  1QMV A;  5HFG A;  3LWA A;  4ECI A;  3CRU A;  4QL9 A;  1K3Y A;  2AUV A;  3D22 A;  4YAP A;  4PNF A;  2ZUP A;  5IIZ A;  5HR1 A;  8GSS A;  1R7H A;  1EGR A;  3LYP A;  4IL6 X;  2VIM A;  3LOR A;  4K0G A;  3IV4 A;  3D21 A;  2VCW A;  1PD2 1;  3HKR A;  2JAC A;  4KDY A;  2NPB A;  4ISD A;  1W89 A;  4MPF A;  3TRQ A;  1U87 A;  2YP6 A;  4KB3 A;  2DJ1 A;  4TXO A;  3IC4 A;  5LCZ A;  1Q4J A;  1S3C A;  2HE3 A;  1F3B A;  3FY7 A;  3H79 A;  2PU9 C;  2P5Q A;  3Q74 A;  4GLT A;  3BBY A;  3ZZX A;  5ECH B;  2LJR A;  1K0M A;  2GSS A;  2R6K A;  2ZNM A;  4F0B A;  4MJA A;  4ZBD A;  5GST A;  4ID0 A;  1DSB A;  1LU4 A;  3MWH A;  1SK2 A;  3UEM A;  1WE0 A;  2L59 A;  2KHP A;  2C0D A;  4IQA A;  4MPG A;  4F03 A;  4MA9 A;  5D93 A;  4XS4 B;  4BL7 A;  1AXD A;  4I8B A;  3HXS A;  3ZRD A;  2H1B A;  5AN1 A;  3ZML A;  2YV9 A;  3HJM A;  1MD4 A;  1PKW A;  3VPQ A;  1BAY A;  2N5F A;  3TKQ A;  3HYP A;  3TKP A;  3NIV A;  2CT6 A;  3WD6 A;  3KIJ A;  1XBS A;  2I3Y A;  4HZ2 A;  2B5E A;  2FWH A;  5ECR B;  3F4S A;  3A5W A;  3KP9 A;  2PER A;  4IGJ A;  3H93 A;  5CRW A;  4EF0 A;  1TK5 B;  1GLQ A;  2JU5 A;  1ILO A;  1Z3E A;  4YQV A;  1TP9 A;  2MYG A;  3HJO A;  1X9W B;  1BG5 A;  3F4R A;  4MF5 A;  4RI6 A;  4KX4 A;  3FR3 A;  5ECN B;  3TKS C;  2J9H A;  4GQF A;  4ZBB A;  5JWR B;  2C0G A;  3HZ8 A;  2CX3 A;  4MZW A;  3PGT A;  2LRT A;  2CZ2 A;  3GKN A;  1DUG A;  1NHO A;  1HQO A;  2GZY A;  1GSD A;  1WPI A;  3EMP A;  4EE0 A;  4FH8 A;  1BED A;  3O3T A;  2E7P A;  1FVJ A;  1XVW A;  3LXZ A;  3PR8 A;  2QKE A;  1FB0 A;  1GSF A;  2D2Z A;  3W8S A;  2G0F A;  3IOS A;  1MD3 A;  2HI7 A;  4ZB9 A;  4RKU J;  3CTG A;  4OFN A;  5F05 A;  5KN1 A;  5FHI A;  4POM A;  3KXO A;  4L8E A;  3PIN A;  3UIW A;  1XOB A;  4JED A;  3WGX A;  3L0H A;  2CAQ A;  2K8V A;  4WR5 A;  1XWB A;  3IRA A;  3HDC A;  3IAS 2;  4O5R A;  3IK9 A;  1Z6N A;  1XWA A;  3M0F A;  3MNG A;  2H01 A;  2VL9 A;  1X0R A;  2GGT A;  1M9A A;  4MF6 A;  1NSW A;  2OE3 A;  3C7M A;  2OKA A;  1TDI A;  2X99 A;  1B4Q A;  3C73 A;  2GZP A;  2F8F A;  2IMD A;  2MMN A;  1Z6M A;  1VF5 B;  5E4W A;  5AIX A;  2M80 A;  3G9B A;  1S5L X;  1JLW A;  1U6T A;  4AJ8 A;  4TR0 A;  3EUR A;  1OE7 A;  1V57 A;  3FZ9 A;  2JZT A;  2P0G A;  4ML1 A;  1X9M B;  1R4W A;  4ACS A;  1OVN A;  2DJK A;  5DAL A;  5L8R J;  2HLS A;  3CBU A;  3ED3 A;  1N8J A;  3HA9 A;  1A0R P;  3KM6 A;  5INY A;  3F3R A;  4J57 E;  3LYK A;  2M72 A;  4MJE A;  1Z5Y E;  2B1L A;  3IAM 2;  2ON7 A;  3GL3 A;  2K6V A;  2DJ3 A;  2OAD A;  3TGZ A;  2GSR A;  1YJ6 A;  4IJI A;  2XC2 A;  1TOF A;  2LS5 A;  4D73 A;  1JHB A;  2FGX A;  4WET A;  6GSS A;  1YKA A;  2YZU A;  1T7P B;  5DQS A;  3TJJ A;  1W4V A;  4RQR A;  2E2G A;  1GH2 A;  2H6Z A;  5G31 A;  2RUF A;  4ZXG A;  4ILF A;  4N10 A;  4Q5N A;  2R2J A;  2A4V A;  3GTU A;  2O01 J;  4MAB A;  2LUS A;  5B8B A;  2KUC A;  2YWO A;  2LRC A;  3N5O A;  5CO3 A;  2I1U A;  1VGL A;  5G30 A;  1T8E B;  1R5A A;  3OR5 A;  3MDK A;  1TI1 A;  2YIU C;  3RPN A;  1TRV A;  5CRE A;  1OKD A;  1R5P A;  4Q5F A;  3HVS A;  4FYC A;  2PPT A;  4WKW A;  2H74 A;  4AJ6 A;  4BWS A;  1K0C A;  1MTC A;  4E8E A;  2FA4 A;  5HFK A;  1FO5 A;  2CV4 A;  5JCG A;  4HI7 A;  5D73 A;  1YEP A;  1OC9 A;  3F6F A;  1OC3 A;  5ENU A;  1YF0 A;  1ZRT E;  2H6Y A;  5G1K A;  5GAN D;  3QCP A;  4NV2 A;  1WIK A;  1JZD A;  3E3E A;  1ERV A;  2F3M A;  2YNX A;  2Z9S A;  5COH A;  3IR4 A;  3DWV A;  3DKS A;  9GSS A;  3LW5 J;  3APS A;  2LJA A;  3HY2 A;  3EWL A;  4LLR A;  3NOF A;  1SD8 A;  1QXH A;  1M2B A;  1QQ2 A;  4LL4 B;  1OAZ A;  3QAG A;  1VF1 A;  1PX7 A;  2IIY A;  5HQP A;  4HUA A;  1R26 A;  3KD0 A;  13GS A;  5JCW A;  3TOU A;  1B9X C;  1NHY A;  3GH9 A;  5G5E A;  1SYR A;  1M2A A;  2O7K A;  2HZF A;  3F4T A;  4WR4 A;  1GUM A;  3GL5 A;  5D8I A;  1JFU A;  2AV4 A;  1O85 A;  2QJY C;  1BYE A;  5JWO B;  5IOX A;  1Y25 A;  2RM6 A;  4GST A;  3CSH A;  4I97 A;  4AF2 A;  2L5O A;  3A3T A;  5KN0 A;  3ZVJ D;  5HR2 A;  2H1D A;  2HYX A;  3DRN A;  4IQ1 A;  1OKT A;  3ERF A;  1PL1 A;  1XFL A;  1IYH A;  1YF1 A;  2BJX A;  3GKX A;  4QQ7 A;  14GS A;  3UBL A;  5D9V A;  5DCH A;  4Z7X A;  1DE2 A;  1ACV A;  4H0L B;  2PVO C;  2XHF A;  1X5C A;  2WSC J;  2ZT9 B;  4MJB A;  1F9M A;  3GV1 A;  2LJK A;  5DCG A;  2AHE A;  5ID2 B;  3TKS E;  5DQY A;  3KH7 A;  5CAX A;  1Y6E A;  2C3T A;  3ME8 A;  1XW9 A;  2DJ2 A;  1QUW A;  3TKS A;  1VF4 A;  3CXG A;  3VWW A;  2B5X A;  1ST9 A;  1Q90 D;  5IPG A;  1PGT A;  3V1W A;  3UOM A;  4MLY A;  2V41 A;  2OBI A;  2GT6 A;  2D2C B;  3UBK A;  2K8S A;  1YEX A;  4Q5Q A;  3DML A;  5KN2 A;  1B9Y C;  1SL0 B;  2LST A;  5CRD A;  3Q19 A;  4O32 A;  4PNG A;  3APO A;  4YH2 A;  3EE2 A;  1ZCP A;  2V6O A;  2ON5 A;  3VWV A;  2MMA A;  2X64 A;  3D5J A;  2H1G A;  2C3Q A;  2IPA A;  4HEA 2;  2B6M A;  4V2L A;  5AGY A;  4G9H A;  2WZ9 A;  4L5O A;  4OFT A;  4FYB A;  4L5L A;  1ABA A;  4EL1 A;  3HVX A;  4N0Z A;  1WMJ A;  3RAZ A;  3HJP A;  4K7I A;  4HQS A;  5HR0 A;  1GSE A;  4K1F A;  2H73 A;  2OBK A;  5CRG A;  3EU4 A;  4BA7 A;  1WJK A;  2MBT A;  1EP8 A;  1EEM A;  1A24 A;  1BJX A;  5J41 A;  3D6I A;  3HCZ A;  3QAW A;  2LQQ A;  2EIQ A;  3RHB A;  3TKR A;  4XS1 A;  3M1G A;  2WCI A;  2GQK A;  2CAI A;  5ID2 A;  4TR3 A;  3ME7 A;  5DJM A;  1XOA A;  3QR6 A;  1SEN A;  2IFQ B;  4GSN A;  4TOP A;  4F0C A;  2AYT A;  1BQ7 A;  4GXZ A;  1A0F A;  1TXX A;  4DSS B;  2B7J A;  2E76 B;  1EP7 A;  2IJY A;  2LV3 A;  5ABR A;  2PVQ A;  3LSZ A;  4GRF A;  3S9F A;  3GHA A;  5L71 A;  1VF2 A;  2WB9 A;  1PQN A;  1PX6 A;  1GSQ A;  3KCM A;  2JZS A;  1EV4 A;  4KCA A;  2VOC A;  2QGV A;  3RPP A;  1PMT A;  4IHU A;  4KDU A;  3GH6 A;  3WGD A;  2TRX A;  4K0N A;  2H0H A;  3VWU A;  2CVB A;  2JL4 A;  2B5Y A;  4PUR A;  4V1A g;  5A4U A; 
#chains in the Genus database with same CATH topology
 4ZB6 A;  3L74 J;  4ECC A;  4MH3 A;  2DJ0 A;  6GSW A;  3GF3 A;  1H0T B;  3TJB A;  5AW4 B;  5IOW A;  4OGQ D;  1JZO A;  1LT9 C;  3NXS A;  2NPS B;  3HE5 B;  3VMA A;  5J5N A;  1UA5 A;  3M0D C;  4M3L A;  1AVO A;  5F06 A;  5ECM B;  4EYY Q;  3H1H G;  2N1T B;  3UIA A;  3G7Y A;  1ZN5 A;  4KND A;  1BGY J;  1NKZ B;  2P10 A;  3L70 J;  1AQT A;  1VQP P;  4XIH A;  4KW6 A;  5CCH D;  5BU8 B;  4IBP A;  3L9S A;  4RQX A;  1TI3 A;  1FAA A;  3C8V A;  1QFN A;  1OZH A;  4D6T G;  3C1S A;  4ULX A;  2GQL A;  3TGU J;  4K5S A;  1TTZ A;  2G2Q A;  5ELG A;  5KN3 A;  1NM3 A;  1PP9 G;  3AEC C;  2OGU A;  2GA1 A;  2X8H A;  1MKM A;  3AY8 A;  1YI2 P;  1YIT P;  1FVK A;  2A2S A;  4WVZ A;  3I56 P;  2YXR B;  4EOT A;  2C0E A;  3FR9 A;  2E75 B;  4R4M A;  3VWX A;  1OX3 A;  1IFD A;  2W6B A;  2FXM A;  2EIR A;  5DVB A;  3SBC A;  1SKW B;  4X1U A;  2SPZ A;  1EQ7 A;  1TK0 B;  5CJ4 A;  1FZE A;  2H19 A;  1L0N G;  4HJ2 A;  2HNL A;  1FU1 A;  3TOT A;  2H6X A;  4Z2T A;  3KZI E;  1RE4 C;  3RL0 g;  3QH9 A;  1GTA A;  2V7Q H;  5IMZ A;  2IFQ A;  2PRR A;  1UVZ A;  1AA0 A;  3L72 G;  4CY6 A;  2BMX A;  3L9V A;  2PN8 A;  2I81 A;  1SJ6 A;  5A5K A;  1GTW A;  3TRX A;  4IL6 H;  2VCX A;  4XCS A;  3Q6O A;  1Y47 A;  2H88 C;  1KIL B;  4UB6 E;  1E6B A;  1J1E C;  2HPC A;  5FWG A;  3D6Z A;  16GS A;  5B5E E;  2XU6 A;  4G2E A;  2R37 A;  3P7X A;  1YKC A;  1ZYP A;  4EI2 A;  3UMA A;  2MKV A;  5KLV D;  2GTU A;  4NMU A;  3L73 D;  1NKN A;  1K3O A;  2IMI A;  4EDZ A;  5E59 A;  5CMZ A;  3I55 P;  4LA1 A;  18GS A;  3H1J G;  4XS4 A;  3FXD A;  3P7K A;  1AQV A;  3CX5 I;  1NTK E;  4WBR D;  4TT3 H;  3EYT A;  1NYH A;  2K9F A;  1XPV A;  2H66 A;  4IFD K;  3H1I D;  1D7M A;  4I2T A;  1OVR A;  2F9S A;  5EY6 A;  1ERU A;  3WT2 A;  6GSV A;  1EZV I;  3HZ4 A;  1VQ5 P;  1EV9 A;  3H1K E;  1JY2 O;  2Q7C A;  4PV1 B;  1PSQ A;  3GA4 A;  2YKQ A;  4TVE A;  3UJ1 A;  4UB8 E;  3GX8 A;  4KJM A;  2YZH A;  3CSJ A;  7GSS A;  3L71 E;  2A45 H;  3RK3 D;  1DE1 A;  4PQI A;  2KS1 B;  3RBZ A;  1SQP J;  5CCG A;  1A2L A;  22GS A;  3P8W A;  3HUS B;  1L0L K;  2PAJ A;  4L76 A;  4ZKU A;  4JYC A;  4PX1 A;  4EXJ A;  1URM A;  4EUY A;  1SL2 B;  1H0T A;  3M06 A;  19GS A;  1T8Z A;  4XHM A;  2JSZ A;  1SQB D;  2NDO A;  1AIU A;  2WGR A;  3CSI A;  4PGT A;  4BWN A;  1NU1 D;  4YQM A;  1SK1 A;  3BVH A;  1WRY A;  5CP1 A;  2GDR A;  4X0X A;  4POK A;  2H72 A;  2MBS A;  3AEB C;  2K9J B;  2FY6 A;  3C1R A;  1O81 A;  4ZL9 A;  2G8Y A;  1T4Y A;  1FZA A;  2VD0 A;  3BCI A;  1T6A A;  2KIK A;  2H7H A;  2N1T A;  1TKD B;  1NJI Q;  1AW9 A;  4YAV A;  3PH0 A;  1IK7 A;  2ZT9 C;  1O73 A;  4K7N A;  3JCU H;  3AE7 C;  5AW1 B;  4KSM A;  3CCS P;  4R4L A;  2L91 A;  2IFN A;  2IBZ D;  3OW2 O;  1YJ9 P;  2GUV A;  1N7S A;  4HDE A;  1IFP A;  2WT7 B;  4FIW A;  4KT0 J;  3ISO A;  3GX0 A;  1XW5 A;  1X0T A;  4H13 D;  1AQX A;  1UII A;  3I43 A;  2M0B A;  2R0G A;  4J56 E;  1QGV A;  1JOC A;  1K0A A;  2DSA A;  1USB A;  3GN3 A;  4IOI H;  5AIV A;  1LBK A;  2POH A;  1L4A B;  1KYO D;  2H76 A;  2X8C A;  1C72 A;  2WVR A;  2B1K A;  1DH3 A;  3DD3 A;  3M3M A;  2DKI A;  2Y9Z A;  1GNE A;  4XFJ A;  4K35 A;  2HRF A;  1G1I A;  2D2C C;  2H71 A;  4X43 A;  5ECS A;  3TRP A;  2KOG A;  1JUN A;  1XWC A;  6GSY A;  1KIL E;  5APU A;  1SKR B;  2VCV A;  1YY7 A;  1G7E A;  1SQQ J;  1EOG A;  5KEJ A;  3L75 E;  1MFZ A;  5F8B A;  1KBN A;  5GZZ B;  3CWB E;  2LNT A;  5F07 A;  2IN3 A;  1SK0 A;  4MZB A;  2LXB A;  3EU3 A;  1KIL A;  1LT1 A;  1LWU C;  2YOI A;  3D0Z A;  3SWF A;  1W5C E;  4XA4 A;  2DIY A;  2RII A;  1HWT C;  4IEL A;  1LT9 B;  1NTM J;  2XBQ A;  1TJD A;  4DEJ A;  1A2M A;  1HNB A;  2IME A;  2XPD A;  1KB9 H;  5KJ7 C;  10GS A;  3R2Q A;  4TXV A;  5G5F A;  4PQ1 A;  1X9S B;  3LXT A;  4GCI A;  1V58 A;  4JU5 A;  1S3A A;  2DLX A;  2ZYD A;  3D6Y A;  5IO2 A;  2E2M A;  1K05 A;  1ZZY A;  4JPZ B;  4NHW A;  2K9Y A;  1YTZ T;  4MJC A;  3W6G A;  2BCC D;  1GP1 A;  2HRN A;  3H8Q A;  2XV5 A;  1PPJ D;  5AVR B;  1FOS E;  2P31 A;  1FW1 A;  1V98 A;  2VD1 A;  1U88 A;  1FDO A;  4WB4 A;  2ZCT A;  3KGK A;  3EVI A;  4G10 A;  2Y0D A;  2OAR A;  2AEJ A;  3B5N C;  4L0W A;  4P3Y B;  1PA3 A;  2TRC P;  3ZIT A;  4AGS A;  2KNC B;  3KMO A;  1SJZ A;  2E0Q A;  3VUR A;  2QJK C;  3EWK A;  2VLU A;  3MSZ A;  2QM7 A;  3QPM A;  1PV3 A;  2KI7 B;  3A2X A;  3G9R A;  3BCC E;  3EMX A;  5CYY A;  1QVF O;  1ZYE A;  5APS A;  5IPH A;  3I69 A;  4GOE A;  2ZVN B;  1SQX K;  1XXU A;  2YAN A;  3VI7 A;  3QAV A;  2F8A A;  2B88 A;  1MDI A;  5CBN A;  2NTO A;  1FOV A;  2K9J A;  3CC4 P;  2VAF A;  3P8C D;  2J59 M;  2YMK A;  2JP3 A;  5DJU B;  2YJ7 A;  4Q5R A;  2TIR A;  4F9Z A;  3Q2Y A;  1NGM B;  1KTE A;  5AIS A;  2FWF A;  5AVQ B;  2VLT A;  5KLV G;  2Z5H A;  2A4H A;  4QMA A;  3L73 G;  2GQM A;  2OYI A;  2HXK A;  2O01 H;  1K0D A;  2O89 A;  2RM5 A;  5C04 A;  1Z7R A;  3GSS A;  2LNS A;  2JSY A;  3QD9 A;  2WT7 A;  1NTZ D;  3ZLP A;  4TKY A;  3FW2 A;  3H1I G;  1THX A;  1OYJ A;  4O5Q A;  4CHS A;  1J1D B;  2WMM A;  3E9J B;  4HU7 A;  5BRT A;  5ECQ B;  1GK4 A;  1GD2 E;  1VQO P;  4RI7 A;  2CX4 A;  2HFD A;  2VL3 A;  2ZVO B;  2J58 A;  2E76 C;  1S5L H;  3RL0 B;  2R32 A;  1EDK A;  2QVA A;  2AXT E;  4V2N A;  1GSU A;  1XWK A;  1AFO A;  5DBQ A;  4WY4 B;  2YNY A;  1P84 H;  3UL3 A;  1K73 Q;  1H8A A;  1URQ A;  3EIN A;  3G6E P;  4NXI A;  4IP6 A;  4MMM A;  4PUF C;  2JAD A;  1SQB G;  1V9W A;  3G7I A;  1NU1 G;  4TR1 B;  2BEZ F;  2R3S A;  4FQU A;  4H44 B;  3J7Y b;  4KAE A;  4POL A;  1MEK A;  1CQH A;  2QG4 A;  3A0B E;  3APQ A;  4BWQ A;  1AV1 A;  3IHQ A;  4Z2U A;  3L74 E;  4LC1 A;  4PD4 D;  2KUB A;  3CX5 E;  4W80 A;  1GTB A;  1O7U A;  2L5L A;  2R5G A;  3CTF A;  4OCE A;  3CCE P;  3GHG C;  3ITK A;  3H1K J;  1EZV E;  2VLV A;  3HHV A;  1ZMA A;  1LT9 A;  1L0N K;  2VL2 C;  1EGO A;  5EVO A;  3KDP B;  2C1Y A;  3FZ4 A;  2FUG 2;  1PN9 A;  2OYH C;  3BJ5 A;  3FR6 A;  1SL1 B;  2IBZ G;  3L71 J;  2IMF A;  2L4C A;  3M0D A;  4G0L A;  1M99 A;  3CLQ A;  2GST A;  2EC4 A;  3ZIV A;  1E2Y A;  1HJB A;  1L0L J;  1AC1 A;  1QGK B;  1F3A A;  2VM1 A;  4IN0 A;  4K8M A;  4MH2 A;  1PGP A;  3L70 E;  4DVC A;  5B66 H;  1I5G A;  3LW5 H;  1USE A;  4DOJ A;  1N2D C;  4OGQ B;  4I6X A;  1YIJ P;  4K5R A;  1EXJ A;  3GIX A;  4C7N A;  3F89 A;  2GVP A;  2NPS C;  1M7T A;  3KZI H;  5J9C A;  4XS6 A;  1YDK A;  4USS A;  1ON4 A;  4HQZ A;  3O6T A;  5APQ A;  5B6N A;  1VQN P;  4TN8 A;  1ZRT D;  2NRG A;  3TDK A;  1ZOF A;  1WT6 A;  2GUS A;  4JE1 A;  3IDV A;  2KSJ A;  3Q5S A;  5KAI E;  2VCT A;  1G2C A;  3KJY A;  4C46 A;  5B5E H;  3S9O A;  3TCO A;  1LTT C;  4L74 A;  4A5P A;  1ZGN A;  1MDJ A;  1YZX A;  1E79 H;  2Q9I A;  3BCK A;  4KH7 A;  3TB2 A;  1RE4 A;  3G3Z A;  1U7J A;  1T2K D;  1BCC D;  1SFC D;  3L35 A;  2IBZ I;  2YWM A;  4MP4 A;  2FNO A;  2IL3 A;  5KLI C;  2RH0 A;  3R4Y A;  2LEG A;  1IFN A;  2JWD A;  4DSR A;  2DJJ A;  2KYV A;  3FYG A;  1G1J A;  3E0U A;  3VMZ A;  3VP8 A;  1LWU B;  1ZLL A;  2KZI A;  3FRC A;  4BXL A;  2GM4 A;  3KYQ A;  1THO A;  2YWN A;  3FZ5 A;  4GTU A;  2LQO A;  4FYU A;  3P32 A;  1XW6 A;  4RUV A;  5EL8 A;  1SD9 A;  5APW A;  4EKZ A;  4HS1 A;  1A23 A;  2I4A A;  3ZFL A;  1PPJ G;  2NBS A;  3L75 J;  1N8R Q;  1WOU A;  3ZDM A;  5G1L A;  3CWB J;  4BL7 B;  4MF7 A;  2ES7 A;  2KSE A;  3T97 B;  3SWY A;  2WSC H;  4F82 A;  4K2D A;  4ZBA A;  4NPD A;  2KK7 A;  1RF1 C;  3GFK A;  5DJT B;  6GST A;  2FXO A;  3MIW A;  3GST A;  2JO1 A;  11GS A;  1JNM A;  3GKK A;  4TR1 A;  3TUE A;  2IYO A;  2KZJ A;  1PRX A;  1FOH A;  3IFM A;  4YKG A;  1SQV D;  1GLP A;  1J9B A;  1SQP E;  2NZ2 A;  1JZR A;  1WRG A;  1O8X A;  1NAF A;  1H88 A;  2PP6 A;  3U1A A;  2FYN C;  3WT1 A;  3H4K A;  4N11 A;  1M9B A;  5LNK e;  2YO2 A;  1LP1 B;  3RHC A;  3I6A A;  4EC0 A;  3IR9 A;  3DXB A;  4RO0 A;  1KEB A;  4PV1 C;  4IW9 A;  2C3N A;  3DVW A;  1W2B O;  2IMK A;  1IJD B;  3D4T A;  1IZN B;  3AE8 C;  3IPZ A;  3A2A A;  1NTZ G;  1J2J B;  1X8Y A;  3RBT A;  2L6D A;  3S1K A;  3MUD C;  1KD1 Q;  1T3B A;  1DD3 A;  4PUA A;  1CI6 B;  3KHU A;  3A2W A;  1ERT A;  3HUS C;  1UN2 A;  2QA1 A;  5D9W A;  5IMA A;  4LMW A;  3BCC J;  5A4W A;  1S9K E;  1ZOY C;  2IWT A;  1B4P A;  1PN0 A;  1SQX J;  1U3A A;  5GSS A;  4IFM A;  4HSC X;  5ECI B;  3FX0 A;  2VO4 A;  3C1L A;  3LJR A;  1BX9 A;  5FT3 A;  1ZYQ B;  2O1K A;  2C80 A;  1A8Y A;  2FD3 A;  4I1L A;  5AVX B;  2W