2QSIA

Crystal structure of putative hydrogenase expression/formation protein hupg from rhodopseudomonas palustris cga009
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
PTLVDEATVDDFIAHSGKIVVLFFRGDAVRFPEAADLAVVLPELINAFPGRLVAAEVAAEAERGLMARFGVAVCPSLAVVQPERTLGVIAKIQDWSSYLAQIGAMLAEVDQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of putative hydrogenase expression/formation protein hupG from Rhodopseudomonas palustris CGA009.
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
molecule keywords Putative hydrogenase expression/formation protein hupG
total genus 23
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07449 HyaE Hydrogenase-1 expression protein HyaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qsiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2qsiA01
1CQHA 3EVIA 2DJ0A 3IOSA 1B9XC 12GSA 1BEDA 2GQMA 4WBRD 4POBA 4HOJA 4KT0J 4RQRA 4P3YB 2VLVA 3D21A 2H66A 5F07A 2F8AA 2NVLA 2H6ZA 3DD3A 3FR9A 3F3RA 4TN8A 5L8RJ 5D93A 3HY2A 2H6XA 1BQ7A 2R6KA 5H5SA 4ZL7A 5DJLA 5CREA 1J08A 2IWTA 1LJRA 3NZNA 2DSAA 1VF4A 4ML1A 5DCGA 2XPEA 3WD6A 2PU9C 3GKNA 2C0DA 4ULXA 2YV9A 2F8FA 1Y25A 3KMNA 1SU9A 2PPTA 4XRDA 4JU5A 1S3CA 3I6AA 3CXGA 3DXBA 3LORA 2PMTA 1NHYA 2GLRA 2PUKC 1WPIA 1RQMA 2L6CA 4N0ZA 1HD2A 1GUHA 2V1MA 3IC4A 2DJ2A 3TKRA 4WF4A 2V2GA 2OBKA 3M9JA 4G10A 1SJ6A 2F51A 1ST9A 4F2IA 1CQGA 3QPMA 1HNCA 1T8EB 5E59A 4NV2A 4X43A 3ZRDA 2VL9A 4XIHA 5DALA 4JRRA 3QAWA 2OE3A 2FWFA 2YWNA 2O85A 2E76B 3WT1A 2P0GA 3GV1A 1TRSA 1F3AA 3H8QA 3GN3A 5IMVA 2DIYA 2YWOA 5D73A 5B7CA 2MBTA 1VF2A 4H86A 1USBA 5CRWA 5ECOB 2FA4A 2IMDA 3A5WA 5G2ZA 5H5RA 4GCIA 1JZWA 4Q5QA 1X0RA 1AQWA 1M2AA 2F9SA 2FLSA 4E8EA 3A2VA 4OCFA 2D2ZA 2C3QA 4MH3A 3GKKA 2WULA 6GSVA 1O73A 2MMNA 1WMJA 2B5YA 1DSBA 2R5GA 1AIUA 1MTCA 1R5PA 2WSEJ 1V58A 2J9HA 3PINA 3GX8A 1SKWB 4NXIA 4QL9A 1V2AA 1XZOA 2XPDA 3TJFA 2V6KA 3ED3A 4PUAA 1K0BA 2HRFA 3CSJA 1NHOA 4I7ZB 1BYEA 2MMZA 1GTUA 3VPTA 1UC7A 1M9AA 4JZQA 3HVXA 4Z7XA 2WB9A 2FYNC 1PMTA 2X8HA 3DRNA 4KUNA 5C00A 3ZITA 4H13B 1EWXA 3CTGA 2GVPA 4EVMA 1TOFA 3HHVA 2LS5A 3IR4A 5CO3A 4HQZA 2E2GA 3VI5A 5F8BA 1XW5A 2FCHA 1X9WB 4K0GA 1G0TA 4NPBA 1K3LA 5KN1A 3GKXA 4L0WA 2GSTA 2IIYA 5KKZC 4MDCA 1Q98A 1FVJA 4OGQB 2RUFA 1ZMAA 4V2MA 4OFTA 2MBSA 1FOVA 5ECQB 4HU7A 1OE7A 2YJ7A 3M0FA 5KN0A 2VCVA 5LNKe 4ZIJA 1TXXA 1G6YA 1XWCA 2IL3A 2LRTA 2I81A 2F3MA 3CMIA 1EOGA 5IMCA 1X9MB 5KLIC 5KEJA 1QFNA 2IMKA 1FVKA 4X1UA 17GSA 4GRFA 2DJ3A 3UARA 2VCZA 4Q5RA 2B3SA 1K0AA 4DSQA 2LNTA 3P90A 4CW9A 5ID2A 4K6XA 2C0EA 2OKAA 1B4PA 5D9VA 4GWRA 5A5KA 1TK5B 1DUGA 4I97A 2H19A 4J56E 3M8NA 3HD5A 5F06A 3NIVA 5G5FA 4HUAA 4XTSA 1DBYA 4IQAA 4MF7A 2N5AA 4Y28J 3KH7A 2KHPA 3GX0A 4G2EA 2HSHA 1GH2A 2P31A 2PERA 5AIXA 4MA9A 2H1BA 2H0GA 3VWUA 2HZEB 4HQSA 1THXA 1JB0J 4KAEA 1U88A 1O8XA 3UBKA 1URMA 2PN8A 1T3BA 4ECIA 1ERTA 5EPFA 1VGLA 4PQHA 2G0FA 2L6DA 4AJ6A 1TW9A 1XWBA 3IAS2 1W4VA 2GQLA 2RM6A 6GSSA 3HKRA 1GRXA 2H0HA 6GSYA 3DIEA 2IJYA 2V6OA 2N5FA 4POKA 4ZBAA 3FZAA 3GH9A 1O6JA 3HCZA 3LEFA 2CZ3A 3IA1A 3FZ4A 4POMA 4EKZA 4WBJA 3FRCA 3GTUA 3VURA 1TU8A 1ZZYA 2GGTA 4H44B 2TRCP 4KB3A 1A24A 2BMXA 1JFUA 1SYXA 3GH6A 1QK8A 2A2SA 5IOWA 1Y6EA 1HYUA 5IO2A 4KNDA 3ZVJA 1ERVA 3L9SA 3QDNA 5AN1A 1XWGA 2GTUA 3VWXA 4YH2A 1SL2B 1S5LX 5JWRB 1WIKA 1AXDA 4OCEA 1N2AA 1O85A 3HJMA 4NMUA 3C73A 2JSZA 3D6IA 3FHKA 4KDXA 3ZMKA 4Q5NA 5CP1A 18GSA 5B6NA 4PXOA 3IHQA 2VCXA 3H4KA 1GSEA 1O81A 5HR1A 4L5OA 2FHEA 4O7HA 4PQ1A 1F9MA 1EEMA 1V9WA 4KCAA 3BJ5A 1GSSA 3D22A 5AISA 1OC9A 2WCIA 1G6WA 1OC8A 5EL8A 4BVYA 4L5LA 4ZXGA 1NM3A 4K0NA 5DJMA 5IMAA 1SKSB 1ZRTE 3TKSA 4OO5A 2HNLA 1RW1A 3A3TA 4EF0A 2BJXA 3Q18A 2VCWA 2HSYA 4ZB8A 2N5BA 2GSRA 1SD8A 3LYPA 3O3TA 4WXTA 2NTOA 2E74B 3UVHA 1U87A 3GYKA 2YZHA 2IPAA 5JWOB 1SK2A 2R37A 2VAFA 3UJ1A 3TKQA 2I1UA 3EU4A 2QJKC 5L71A 3GIXA 3ZVJD 2B6MA 2FNOA 3KJYA 2NPBA 1PL1A 2P5QA 3M9KA 4MJAA 2HT9A 5LCZA 2E0QA 3DKSA 3LXZA 3EWLA 1EV4A 5J5NA 5HR2A 5D9TA 1ILOA 4TXOB 2HFDA 1A8LA 11GSA 3BBYA 1R26A 3U5RE 5B8BA 1TI1A 4K1FA 4KDYA 4HZ4A 1SK0A 1TRWA 4WR4A 5J9BA 1K0MA 1W89A 4MJBA 3ZMLA 4EDZA 3K8NA 4MZCA 5IQYA 2WFCA 3KMOA 2HE3A 2L4CA 1R7HA 1EZKA 2VD0A 1XXUA 5HFGA 2PVOC 4FIWA 1RK4A 1T1VA 2WRTA 4MJCA 1GSQA 3MSZA 3OR5A 1A23A 3ZLPA 1EGRA 2H70A 1TTZA 2XHFA 2DBCA 2VUPA 5H5QA 1FHEA 1Z5YE 1HQOA 4MPFA 3FK8A 3QAVA 1ML6A 2HYXA 1YJ6A 1Z6MA 4IP6A 2QGVA 3H1NA 7GSSA 2VL2A 2C0GA 3C71A 4TXOA 2C80A 5CRDA 1MD3A 1OC3A 1SK1A 4F0CA 5IM9A 3VK9A 1PSQA 4HI7A 2R3XA 2I3YA 3ERWA 3TJBA 5KN2A 4BL7A 5D9WA 1U6TA 3PH9A 2H01A 3SBCA 2YWMA 3KM6A 5JWQB 3I43A 2RUEA 4YAPA 1B9YC 4IBPA 4HZ2A 4RI7A 2YANA 3P2AA 1PKZA 2ON5A 1MEKA 3L0HA 1TJDA 3HZ4A 1EGOA 3Q6OA 4N0VA 1A0RP 4X0XA 1TK8B 4XS4B 2LQOA 3QAGA 1V98A 4PV1B 3TUEA 2JZSA 1GUMA 2CX4A 1UN2A 5LD0A 1NW2A 5GSTA 2DJJA 2GSQA 2OA7A 3MDKA 2KUCA 4XS4A 4NV5A 2AB6A 2LKUA 5DAKA 1XW6A 1HNBA 3FEUA 3GRXA 2QJPC 2QC7A 2IMFA 4CHSA 2LQQA 3GA4A 5DVBA 2CZ2A 3TOUA 4AGSA 5J41A 2C3NA 5ID2B 4F0BA 3E3EA 1JHBA 4PNFA 3LJRA 3ME8A 2GT6A 5JCUA 3IPZA 3UEMA 1Z6NA 5INYA 3P8WA 2DC5A 1QGVA 2PVQA 4LL1B 4N10A 3WYWA 1KBNA 4ML6A 1SJIA 3IAM2 5IMZA 2CA8A 3QFBC 1QMVA 3C1SA 1T7PB 1U3AA 2YP6A 3RHBA 2H0IA 4F82A 4BPYA 1ACVA 3RDWA 5JCWA 3BCIA 3IDVA 4ECBA 2C3TA 1PD21 1YKAA 1FB0A 1FW1A 3F4RA 4JR4A 3KXOA 3LQ7A 2H1GA 2K9FA 2LJKA 2P5RA 2R2JA 2O7KA 3CRTA 4MK3A 1MDKA 4KCEA 1AUCA 1SYRA 5D8IA 2JACA 3VWWA 1TKDB 1WJKA 3LG6A 5ENUA 1XVQA 5IPHA 4H0LB 4XS6A 1GSYA 4ZBDA 4PNGA 2M46A 2HRNA 3KTBA 2FD3A 4KGIA 5IMDA 2M80A 4EDYA 2LV3A 1K0OA 3IK9A 2DMLA 1TRUA 2DLXA 1WRYA 3GMFA 2LEGA 3KGKA 3TCOA 1ZYQB 3UBLA 1S3DA 2QKEA 1B4QA 3MAKA 2V41A 1B8XA 2RLIA 5FT3A 4IJIA 6GSTA 3EINA 1XIYA 3KH9A 4XCSA 1VF5B 1FO5A 4GQCA 1T4ZA 3TRXA 3ISOA 5AGYA 4TR1B 2VO4A 2WZ9A 3GKMA 2BTOT 4MCUA 3A2WA 1A0FA 4KH7A 3ZTLA 4HU9A 1TK0B 1S3AA 3EE2A 1N8JA 4YQMA 3ME7A 3TJJA 1WP0A 4BA7A 3J7Yb 10GSA 1BAYA 5DCHA 2WSFJ 3V1WA 1TDIA 2O8VB 1LU4A 3UIWA 4DVCA 2TIRA 3F9UA 4RKUJ 4TKYA 5IIZA 4V2LA 3IV4A 3LGCA 2LRCA 1ABAA 2YV7A 3E9JB 2ZCTA 6GSWA 1ZCPA 5CNWA 1XWAA 3GSTA 5ECNB 3G7JA 1TRVA 2AV4A 3F6FA 3C8VA 3FZ9A 1KEBA 1OAZA 2YCDA 2YJHA 4HJ2A 1X9SB 2LTKA 4GLTA 3KZQA 4K2DA 3RHCA 1GP1A 1M7TA 3G7YA 1OC9B 1SKRB 2B7KA 4XHMA 2REMA 20GSA 5D96A 4TXVA 4FYCA 4LMVA 5HFIA 1FG4A 4IP1A 3ZL5A 2X8GA 1XWKA 1SD9A 2H30A 2H1AA 4FYUA 1GLPA 4TR4A 1XBSA 2OJLA 1GSFA 3LW5J 1AC1A 4IELA 4K7IA 4MF6A 2M72A 1SJZA 2IFQB 1JLWA 3FKFA 3NOFA 4MF5A 3GFKA 1T4YA 3M1GA 4HJMA 4YQVA 4ZBBA 1M9BA 4TOPA 1O8WA 1M0UA 4F9ZA 2HZFA 4MZBA 3G7IA 1VF1A 4JE1A 2HLSA 8GSSA 4ECCA 3EC3A 3LSZA 3UMAA 5ECLB 1GNEA 5C04A 2J23A 2KP2A 3F4SA 3KIJA 1Q90D 1A8YA 2VCQA 1IYIA 3I69A 5IOXA 4LA1A 1G7OA 5DQSA 3KP8A 3L9UA 3BD2A 2DIZA 2H71A 3S9FA 3TKSC 2CVBA 4GSNA 4BWSA 3QD9A 3QCPA 2WSCJ 1U3IA 2H8LA 2EIQA 2FUG2 1JZOA 2EIOA 4ILFA 2CQ9A 3D4MA 1PGTA 3TGZA 1J0FA 2L59A 5EY6A 2GZZA 5IMFA 3UVTA 1K0DA 2CVKA 3D4TA 1V40A 1X5CA 3FW2A 4AF2A 1AQXA 5A4VA 1DE2A 4ZB6A 2CX3A 3RPNA 4L0UA 4I2UA 3ZIVA 16GSA 1ERWA 2A4VA 2HXKA 3LYKA 1A2LA 5D9XA 5ABRA 4KA0A 4GXZA 5HR3A 1GSDA 1GTAA 1XFLA 4IN0A 2L57A 2WS2A 13GSA 5A4UA 2K9YA 2AJQB 5IPGA 4J57E 1ERUA 3O76A 1PN9A 3A2XA 2C0FA 5ECHB 4ZILA 5KN3A 1B48A 3ZREA 1GWCA 4MP4A 1H4OA 1GSUA 4LMWA 3TB2A 2GZYA 6GSXA 5J3RA 1F37A 3J7Yk 1PL2A 3FYGA 3TOTA 1AW9A 3APOA 3O6TA 3L9VA 3P7XA 2I9HA 1PX7A 1E2YA 5AIVA 4IQ1A 3I9V2 3CSHA 2XBIA 2FY6A 1GL8A 3KEBA 1X5DA 3Q74A 1AQVA 3HVVA 4NWYA 1YKCA 2XC2A 1R4WA 4FH8A 4I8BA 1YF0A 4XRAA 3W6GA 5HR0A 2R4VA 2H76A 3CSIA 1YDKA 2V32A 4J2FA 3D5JA 14GSA 5DAKB 3FR6A 4PQIA 1LBKA 3D0ZA 1XVWA 2LUSA 2LJRA 4GSSA 4BVXA 2Z9SA 1H75A 4N11A 1YY7A 1WWJA 1XPVA 4DSSA 2FWEA 2C4JA 5HQPA 2ZT9B 3TKSE 2X99A 1YF1A 2JADA 2A2RA 4EO3A 5DBQA 3TRPA 3GL3A 4IGJA 4JEDA 1OYJA 3W8SA 2E2MA 3RPPA 4IJ3A 3US3A 2H1DA 1IYHA 3HYPA 3L78A 3DGQA 4OFMA 3F4TA 3DMLA 4CDOA 1K0CA 4OMVA 1EV9A 3FY7A 4IS0A 2FA8A 3VPQA 5G31A 1XOBA 4EUYA 2ES7A 2QJYC 4L8EA 4G19A 4D73A 2AYTA 1VF3A 4HDEA 1WE0A 4V1Ag 3AY8A 5G1LA 2B5EA 1EOHA 3ZFBA 4I5QA 1K3OA 4BWQA 2DJ1A 1FAAA 1SENA 3GHAA 3LXTA 4LL4B 1EEJA 1QUWA 2RIIA 2GSSA 4KX4A 2B1LA 1KNGA 2K8SA 3MNGA 3EURA 1T00A 2C1YA 3IK7A 3L4NA 2QSIA 4GF0A 4K7OA 2X8CA 4HEA2 2AUVA 1THOA 3C7MA 3JCML 5GZZB 5ELGA 1M99A 4ZL9A 4GSTA 4NHZA 4KSMA 1GTBA 1BX9A 2B7JA 3TJGA 4LLRA 3W8JA 1XCCA 1FB6A 4JBBA 3PR8A 3U6VA 4YAVA 2CVDA 4V2NA 3IXRA 2MMAA 2DJKA 2L5OA 2AAWA 3GSSA 4TRXA 2IMEA 2IMIA 2H74A 1GTIA 2JU5A 2EIRA 5ECKB 5ECSA 2YZUA 1MDIA 22GSA 4RI6A 2ON7A 4WR5A 1JLVA 5F0GA 3GTUB 2LNSA 4YQUA 2H75A 3ERFA 2DMMA 2QIWA 2K6VA 1KTEA 1C72A 3TJKA 1ZGNA 3F0IA 1M2BA 2TRXA 4QL7A 3F6DA 3IRAA 2YWIA 5E4WA 3N9JA 1GLQA 4IL6X 3FZ5A 1QXHA 3ZIJA 2CAIA 1GULA 3APSA 2B1KA 3GUSA 5A4WA 1GNWA 4RUVA 1MD4A 1K0NA 3APQA 4KE3A 1PKWA 4N30A 5CRGA 3IBHA 3C8EA 3CRUA 3H93A 3WT2A 2KOKA 1PA3A 2VM2A 1YQ1A 1OKDA 2G2QA 3WGXA 1Z7RA 3F3QA 4KW6A 4AJ7A 2YPMA 1YEXA 5GAPD 2O87A 2LRNA 1DE1A 2E75B 4PGTA 5ECPB 2O01J 3QFAC 4ACSA 4FO5A 4WF5A 2L5LA 3TRQA 2K8VA 4KSOA 3UAPA 2GT5A 2WPVB 4I6XA 1SL1B 1Q4JA 2E7PA 2YN1A 1EP7A 1J9BA 1TI3A 2PWJA 3F8UA 1XOAA 2FWGA 1M2DA 1JZRA 5GSSA 3HJPA 4JR6A 4DSSB 1F6MC 2FWHA 4ISDA 2NBSA 2HI7A 2WGRA 4OWYA 1VRSD 4PUFC 2L4QA 4MZWA 3HVSA 1JZDA 4OD7A 5G30A 2EC4A 3RBTA 1AAZA 4NAXA 2WDUA 4OO4A 4WEYA 2VIMA 3E0UA 1R5AA 3QMXA 1GUKA 1O7UA 3CYNA 2LJAA 1OE8A 2OADA 1MDJA 1ZL9A 2B5XA 4HS1A 1QQ2A 3VFIA 3BOAA 2C8UA 1F3BA 3UL3A 3CTFA 9GSSA 4D73B 2JL4A 1TP9A 3FR3A 3F63A 3TDGA 4IVFA 2ALBA 3CBUA 4FYBA 2IFQA 2GS3A 2VL3A 4Q5FA 3ERGA 3IE3A 4TR3A 2YOIA 1Z9HA 5CAXA 2KLXA 5DALB 3TKPA 3VWVA 1V57A 3KD0A 2D2CB 4ZL8A 3Q19A 2KP1A 3GNJA 4O32A 2GDRA 1YEPA 4XS1A 4ECJA 2FGXA 3VLNA 5FHIA 5ECMB 4IKHA 2H6YA 2H72A 4IW9A 19GSA 2K18A 1WOUA 5DQYA 3ZYWA 2GZPA 2VOCA 2X64A 4ID0A 4DEJA 2XBQA 3HA9A 3WGEA 3DWVA 4F03A 3EYTA 1HNAA 2OE0A 4AJ8A 3MWHA 4WKWA 4K8MA 1G7EA 1A2JA 2JZTA 2VLUA 4GQFA 3HXSA 1K3YA 3C1RA 1E6BA 2YNXA 3M3MA 5G1KA 4G9HA 1SL0B 3KP9A 5GAND 1UVZA 5ECRB 4EL1A 4I2TA 1I9DA 2IN3A 1XW9A 3N5OA 1NSWA 3QOUA 4O5RA 1F2EA 2GQKA 4EC0A 2JZRA 3WGDA 4O92A 4K7NA 1PX6A 3DYRA 3UOMA 5COHA 3GL5A 1Z7PA 1YZXA 4KDUA 4EE0A 2VM1A 2RM5A 2ZNMA 4MABA 3EMXA 2VLTA 4IHUA 2VD1A 4TW5A 3PGTA 2MMOA 2VCTA 4TR1A 1I5GA 3DVXA 4MMMA 2LSTA 4K9ZA 4MPGA 2PBJA 1UA5A 2ZUPA 5HFKA 2MYGA 3H79A 4NHWA 4V1Ap 1X5EA 2AHEA 3RAZA 2H73A 5ECIB 3G9BA 4DSRA 5G5EA 3KTLA 5CRHA 1Z3EA 3ZFLA 2MZCA 2YIUC 3HDCA 5EVOA 2I4AA 3LFLA 1PQNA 3KCMA 2NDOA 4OFNA 3DEXA 4RQXA 4WETA 4MH2A 2HZEA 1ON4A 4QQ7A 4PURA 2PGTA 5B8AA 5DDLA 3DVWA 5F05A 3R2QA 4E8HA 5FWGA 5B6MA 2WJUA 2VL2C 5ELAA 2OACA 2O89A 4MLYA 1OKTA 3HJOA 4MJEA 4ZB9A 3EU3A 5CYYA 1OVNA 4GTUA 3GURA 3LWAA 4POLA 1BG5A 4PX1A 6GSUA 5JCGA 4EXJA 2CAQA 1A2MA 4TVEA 2OE1A 5IO0A 1PRXA 3VI7A 1BJXA 3EMPA 1EP8A 3QR6A 1TU7A 2CV4A 2JSYA 3BCKA 3ZZXA 3HZ8A 1ZOFA 4TR0A 2CT6A 3SWLA 5J4UA 1ZYEA 2OBIA 5J9CA
chains in the Genus database with same CATH superfamily
1VQ9P 1CQHA 3EVIA 4C46A 2DJ0A 3IOSA 2K9JB 2W6AA 1B9XC 3H6PA 12GSA 2FFDB 3AE4C 1BEDA 2GQMA 4WBRD 2WZ7A 4POBA 4HOJA 1FOHA 3PP5A 4KT0J 4RQRA 4P3YB 1PP9E 2KS1B 1BDDA 3V2NA 2VLVA 3D21A 2H66A 5F07A 4ZKPA 2F8AA 4HJGH 4WB4A 2IYPA 2NVLA 1PL5A 2H6ZA 1D7MA 3DD3A 2QA1A 3FR9A 3F3RA 4TN8A 5L8RJ 5D93A 3HY2A 2H6XA 4BRYA 1N86A 1BQ7A 4WWIA 2R6KA 4Z2TA 1CI6A 5H5SA 5DJLA 4ZL7A 5CREA 2C0WA 1J08A 2IWTA 1S3JA 1LJRA 2M0BA 3NZNA 2P58A 2DSAA 1VF4A 4ML1A 1BCCD 3L36A 5BU5A 2AEMA 4NPFX 5DCGA 3IAOA 2XPEA 3WD6A 2PU9C 4EOTA 3IC8A 1PFIA 4OVNF 3GKNA 2C0DA 4ULXA 2YV9A 1Q86Q 1KILE 1MFZA 2F8FA 1Y25A 3KMNA 3ITKA 1PGQA 1NAFA 1SU9A 2PPTA 3CPWO 4XRDA 4JU5A 1HVVA 3KXDA 1S3CA 3I6AA 1SQPD 3CXGA 3DXBA 3LORA 2HR3A 2BCCJ 3M9QA 1KYOH 2PMTA 2IFNA 1NHYA 2GLRA 1YJ9P 2ZYAA 2PUKC 3G9RA 1WPIA 1RQMA 1H0TA 2L6CA 4N0ZA 1HD2A 3S4RA 1GUHA 2V1MA 1JY2P 3IC4A 4LC1A 2DJ2A 3TKRA 4WF4A 2V2GA 1SQVK 2OBKA 3M9JA 4G10A 3RL0C 1SJ6A 2F51A 2HG5D 2JP3A 3P7KA 3AEDC 2WTYA 1ST9A 2R32A 3HE5B 4DJGA 4F2IA 1CQGA 1DEBA 1PGPA 4UB8H 3QPMA 1HNCA 5APTA 3CXHH 1T8EB 5E59A 4NV2A 4X43A 3ZRDA 3FWLA 2ZT9D 2VL9A 4XIHA 5DALA 4JRRA 4I2LC 3QAWA 1LTJC 2OE3A 4EYYQ 2FWFA 2YWNA 2O85A 2E76B 3WT1A 1NU1E 2P1JA 4L76A 5CBNA 5E79E 2P0GA 1LGHB 1X8YA 1GMJA 2W27A 3GV1A 2B9BA 1TRSA 5AW0B 3L70E 1F3AA 1EQ7A 1JTHA 1VF5C 3H8QA 1N7SD 2B89A 3FGAD 3GN3A 5IMVA 2DIYA 2YWOA 5D73A 1IFJA 5B7CA 2MBTA 2A2PA 5CJ4A 1VF2A 3WMM0 4H86A 1USBA 5CRWA 2UZ8A 5ECOB 2FA4A 2IMDA 3CL3D 3A5WA 1SQPE 1OMIA 1S72P 3H25A 5G2ZA 5H5RA 4G0KA 4GCIA 1JZWA 4Q5QA 1X0RA 1AQWA 4YXWH 1M2AA 2F9SA 2FLSA 3BASA 3KDPB 2H89C 4E8EA 1ZR2A 3A3YB 3A2VA 1EZVD 4OCFA 2D2ZA 2C3QA 3PJSK 4MH3A 3LIDA 3GKKA 1ZRTD 2WULA 6GSVA 1O73A 2MMNA 3MIXA 1WMJA 2B5YA 3FX0A 1DSBA 2R5GA 1AIUA 1MTCA 1R5PA 2OYHC 3L71E 2WQYC 2QRXA 2WSEJ 3B8EB 1V58A 2J9HA 1L0LD 3PINA 3GX8A 1FAVA 1SKWB 1LJ2A 1OWAA 4NXIA 5CCGD 4PD4H 4QL9A 1V2AA 1XZOA 2XPDA 3TJFA 1OFCX 4TLFA 2V6KA 5AVZB 3VP9A 3ED3A 4PUAA 2I1KA 1K0BA 2HRFA 3CSJA 3MYDA 1NU1D 2HPCB 1NHOA 4I7ZB 1BYEA 2BCCE 2MMZA 1QEXA 3L75E 3Q1MA 1GTUA 3VPTA 5DJTB 2FY8A 1UC7A 5GTHH 1M9AA 4JZQA 1KD1Q 3HVXA 4Z7XA 1NGMB 2WB9A 2FYNC 1PMTA 2X8HA 3AE6C 3DRNA 4KUNA 5C00A 3ZITA 4H13B 3MTUE 1Q7YQ 1EWXA 3CTGA 2GVPA 4I1LA 3R4YA 4EVMA 5CBOA 1NTZG 1TOFA 5AW8B 2KNCB 3HHVA 1Q81Q 2LS5A 3II6A 1ZV8A 1VQLP 3IR4A 5CO3A 4EIQA 1YYCA 4GT1A 3I56P 4HQZA 2E2GA 3VMYA 3VI5A 3RK3E 5F8BA 3NXSA 1XW5A 2FCHA 4I7ZC 1X9WB 3USSA 4K0GA 1G0TA 4NPBA 1K3LA 1N7SA 3GHGA 5KN1A 3GKXA 4L0WA 3V2PA 2GSTA 2IIYA 5KKZC 4UB8E 3B5NA 4MDCA 2POHA 2A45H 1Q98A 1VQOP 1FVJA 4OGQB 2RUFA 1L0NK 1ZMAA 4V2MA 1NTKK 3JC22 2OYIA 1NAYA 1NU1J 4OFTA 2MBSA 1FOVA 1HTLC 5B66H 1T3JA 3WUVA 5ECQB 1KQSO 1OE7A 4HU7A 3L72G 2YJ7A 5KJ7C 2DKHA 1G1JA 3M0FA 4CY8A 1L0NE 1M1JA 3H1KG 5KN0A 3Q5SA 1ZMEC 1SVFA 3OJAB 1SQQE 4YKGA 3CWBD 2VCVA 1LWUB 5LNKe 1RF1C 4ZIJA 4XE5B 3IN6A 1TXXA 1G6YA 1XWCA 2IL3A 2LRTA 2I81A 2F3MA 3CMIA 2QVAA 1EOGA 5IMCA 1X9MB 5KLIC 5KEJA 5BU8B 1QFNA 2IMKA 2KIKA 1FVKA 4X1UA 17GSA 5AVVB 1M8OB 2KS1A 2CPBA 2O1KA 2DJ3A 4GRFA 1RF0A 5KAIH 3UARA 2VCZA 4Q5RA 1ZW0A 1ZN5A 3CCEP 2KXPB 2B3SA 1K0AA 3CWBG 4DSQA 1JO5A 1R5SA 2LNTA 3P90A 4CW9A 5ID2A 3HE4B 4K6XA 2C0EA 2OKAA 1B4PA 5D9VA 1GU4A 1OVUA 4GWRA 5A5KA 2Z5IA 1JUNA 1TK5B 1DUGA 1KB9I 1W5CE 4I97A 3RL0D 2H19A 1XG8A 1AV1A 2BCCG 4J56E 2ZVOB 4BXLA 3B5ND 3M8NA 3HD5A 5F06A 2HLOA 3NIVA 5G5FA 4HUAA 4XTSA 3M0DC 1DBYA 4IQAA 1JY3N 2Y0EA 4MF7A 5AVYB 2N5AA 4Y28J 1NH4A 3KH7A 2KHPA 3GX0A 3WUUA 1Q82Q 4G2EA 2HSHA 1GH2A 5CCHA 3BCCE 3TYYA 1H89A 2P31A 2PERA 5AIXA 4MA9A 4H44D 1SQQJ 1IFPA 4WY4B 2H1BA 2H0GA 3VWUA 2X4AA 3AEEC 2HZEB 1QLED 4HQSA 1THXA 3C9IA 1VF5D 1JB0J 2N1TA 4WVZA 3H1JE 4KAEA 5KOWA 1U88A 1EDLA 4PV1C 1O8XA 3UBKA 1KQGB 3PHLA 1URMA 1FZBA 4WY4C 5AW6B 2PN8A 1T3BA 4ECIA 1VQ6P 1OX3A 1ERTA 5EPFA 3L70G 1VGLA 4PQHA 2G0FA 2L6DA 4AJ6A 1TW9A 1XWBA 3IAS2 1LTJB 2WITA 1W4VA 2GQLA 2OYOA 1URQC 2RM6A 6GSSA 3HKRA 3BRVB 3BCCJ 1GRXA 1LWUC 3E1IA 2H0HA 6GSYA 3DIEA 1JMBA 1FDOA 1SQPG 2ZFCA 2IJYA 4Z2UA 1T3UA 4EIJA 2V6OA 1OW7A 2ZXXA 2N5FA 4POKA 3MGNA 1HH0A 2R0GA 2Q6QA 2XZRA 4PJ0E 1GZLA 3HUSA 4ZBAA 3L74D 3FZAA 3GH9A 2YO3A 1O6JA 3HCZA 3LEFA 2FXOA 1JEKA 1NTKJ 2CZ3A 1ZXGA 3IA1A 3FZ4A 4POMA 1BCCG 2CPSA 3CX5D 4EKZA 1USDA 4WBJA 1SQVE 2FYUE 3FRCA 1QL2A 3GTUA 1TU8A 3VURA 1ZZYA 2GGTA 3VTPC 4H44B 2TRCP 5BMUA 1MKMA 2FYUD 4KB3A 2ZXEB 1A24A 2BMXA 2ZAEB 1KTMA 1JFUA 5M1BA 1PP9D 5APYA 3CCQP 1SYXA 3GH6A 1S9KD 1QK8A 2A2SA 5IOWA 1HF9A 1HYUA 5B5EE 1Y6EA 2R5BA 4KNDA 5IO2A 3ZVJA 1ERVA 4Z2RA 3L9SA 3QDNA 5AN1A 1XWGA 2M3EA 2NPSB 2GTUA 3VWXA 4YH2A 1SL2B 3V4WA 1S5LX 2YMYA 5JWRB 1WIKA 1AXDA 4OCEA 2OTKE 1N2AA 1O85A 2FYUG 3B5NB 3P32A 3HJMA 3Q2YA 2ZYGA 4NMUA 3C73A 3G71P 2JSZA 3D6IA 3FHKA 4B86A 4KDXA 3ZMKA 4Q5NA 5CP1A 3BCCG 5TISE 18GSA 2H8PD 4JF7A 4JYBA 5B6NA 2FYZA 4PXOA 3IHQA 1NTZE 2VCXA 3H4KA 1GSEA 3PRJA 1PPJG 2NZ2A 1O81A 1GL2B 5HR1A 4L5OA 1VL2A 2FHEA 4O7HA 2G3AA 4PQ1A 1T8ZA 1F9MA 2WSSH 2P67A 1EEMA 5C39A 1JCDA 3D6ZA 4JQ0D 1V9WA 4KCAA 4EI2A 3BJ5A 1YHQP 1GSSA 3D22A 5TJHA 5AISA 1OC9A 2OTLP 2YKPA 1BDCA 2WCIA 3ZDMA 1G6WA 4U3FE 1OC8A 2YKQA 1FZAA 1K8AQ 5EL8A 3L35A 1FOSF 4BVYA 4L5LA 4ZXGA 1NM3A 3RBXA 4K0NA 5DJMA 5IMAA 3HD7C 1USEA 2HYNA 1SKSB 1ZRTE 2BEQD 3TKSA 4OO5A 1N2DC 1OW6A 2HNLA 1M7LA 1RW1A 3A3TA 4EF0A 2KB7P 3H1ID 1KILB 2BJXA 3Q18A 3CCSP 2VCWA 2HSYA 4ZB8A 3H1HJ 3CC4P 2N5BA 4HB1A 2GSRA 4WBAA 5KTBA 1SD8A 3RK2C 3LYPA 3H1KE 4OGQD 5CJ0A 2KZIA 3O3TA 1ZLLA 4BVXB 1U57A 1SQQG 3Q5PA 4WXTA 2NTOA 2ZT9C 1R5LA 2E74B 4N6JA 1U87A 3UVHA 3GYKA 2YZHA 4RO0A 2IPAA 1RY3A 5JWOB 3MHVA 1SK2A 1BGYD 4DCKA 2R37A 2VAFA 4D6TJ 1RF0C 3UJ1A 1NO4A 2N1TD 2I8DA 1SFCD 3TKQA 1IFNA 2I1UA 3EU4A 2QJKC 5L71A 2YXRB 3GIXA 3ZVJD 2B6MA 2FNOA 3KJYA 2NPBA 1KB9D 4AUWA 1KILD 2OTJP 2MJZA 1PL1A 2I1JA 5CHXA 1N73C 3CMEP 2P5QA 3M9KA 4MJAA 2HT9A 4K5RA 5LCZA 2E0QA 2W90A 2QEXP 3DKSA 3SWKA 3LXZA 1DD4A 1EV4A 3EWLA 5J5NA 5HR2A 5D9TA 2KZJA 1ILOA 4TXOB 2HFDA 1NU1G 1G2CB 1A8LA 2AEJA 3BBYA 11GSA 1LTGC 1IFIA 3NMDA 3CCUP 3H1LG 3A0HH 1BE3J 3OW2O 1R26A 3U5RE 2XKMA 2FXPA 5B8BA 1TI1A 1GK6A 4K1FA 5AVSB 4KDYA 4HZ4A 3CC2P 1SK0A 1TRWA 2LKMA 4WR4A 5J9BA 1EZVE 1PN0A 1K0MA 1W89A 4MJBA 3ZMLA 4EDZA 1FZFA 3L72J 3H1IE 3K8NA 4MZCA 5IQYA 1MZ9A 2WFCA 1ZYPA 3O6QB 2DW3A 3KMOA 2HE3A 2LR2A 4GIFA 1P84E 2L4CA 1R7HA 1EZKA 3H1JG 2VD0A 1XXUA 5HFGA 1UIXA 2PVOC 4FIWA 3LW9A 1RK4A 1T1VA 2E75C 2KK7A 2WRTA 4MJCA 3H1HE 5H2FE 1GSQA 3MSZA 3OR5A 1A23A 3ZLPA 3H1IG 1EGRA 2H70A 1TTZA 2XHFA 2DBCA 2VUPA 5H5QA 3HD7D 1FHEA 4PTSA 1NOHA 1Z5YE 1HQOA 4MPFA 3MUDA 3FK8A 3QAVA 1ML6A 2HYXA 1YJ6A 1AQ5A 1Z6MA 4IP6A 1G1IA 1L4AD 2QGVA 3H1NA 4AQRD 7GSSA 4W7YA 4XA4A 1L4AA 2VL2A 2IPPA 1G2CA 2C0GA 3C71A 4TXOA 2C80A 1LTAC 2NPSD 1J1DB 3L74J 4UB6E 1NWQA 5CRDA 3H1HG 5AVUB 1MD3A 2ZVNB 1OC3A 2L5GB 3M91A 1SK1A 4F0CA 5IM9A 1W2BO 3VK9A 4M3LA 1PSQA 2E74C 4HI7A 2R3XA 4GOEA 2Q9IA 3MIWA 1Q2NA 2I3YA 1KFMA 2E76D 3ERWA 4YXDC 3TJBA 5KN2A 1SFCC 4BL7A 2Y0CA 5D9WA 2IYOA 1U6TA 2PAJA 2P10A 3VMZA 3PH9A 2H01A 3SBCA 1EXJA 2YWMA 1IFDA 3KM6A 5JWQB 5CCHD 4NPDA 3I43A 2JJLA 5AVXB 2RUEA 1MFTA 4YAPA 1B9YC 3G4SP 4IBPA 4HZ2A 3VYIA 4RI7A 3EFFK 4GOFA 2YANA 3EFGA 3P2AA 1PKZA 1W2EA 2ON5A 2O1JA 2PGDA 1MEKA 3L0HA 1TJDA 5APWA 4O9BA 3HZ4A 1EGOA 3Q6OA 4N0VA 3NFQA 4OWFA 1A0RP 4X0XA 1TK8B 2J5UA 2NRGA 4N78E 4XS4B 2LQOA 3QAGA 2BCCD 1V98A 4PV1B 3TUEA 2JZSA 3JCUE 4N78D 1GUMA 1YBKA 2CX4A 3HTKB 1UN2A 1NW2A 5LD0A 2DJJA 5GSTA 1BSNA 2GSQA 2OA7A 3MDKA 2KUCA 4XS4A 1CW5A 4NV5A 5AW7B 2AB6A 4K3AA 2LKUA 5DAKA 1XW6A 1HNBA 1Y8AA 3FEUA 3GRXA 2M5AA 2QJPC 2QC7A 2IMFA 4CHSA 2LQQA 1NTKG 5E79H 4HSCX 1L0NG 2N9YB 1OW8A 3GA4A 2W8ZA 4MN4C 5DVBA 2CZ2A 3TOUA 5EFWB 5B5EH 1LT9C 1PV3A 4AGSA 2GA1A 5J41A 2HSMA 2C3NA 2WWWA 5ID2B 4F0BA 4XFJA 3M9BA 3E3EA 1NTMG 1FZEA 1JHBA 4PNFA 3LJRA 3ME8A 2GT6A 2W83C 3HUSC 4PD4I 1K04A 2NPSA 5JCUA 3IPZA 5AW9B 3UEMA 4H0LC 1Z6NA 3M9HA 3PLNA 2A06D 3BVHA 5INYA 3AECC 3P8WA 1MV8A 2DC5A 5AVTB 2KLUA 1QGVA 2PVQA 4LL1B 4N10A 1GL2A 3WYWA 3L71D 1KBNA 3RL0g 4ML6A 1SJIA 3IAM2 3RL0B 5IMZA 2CA8A 3TF5A 3QFBC 1JNMA 1QMVA 3C1SA 1T7PB 1U3AA 4IOIH 2YP6A 3CCMP 1S9KE 3RHBA 2H0IA 1GL2C 3B4SA 4GODA 4F82A 4HYTB 4BPYA 2K88A 3EQ2A 4WY4A 1ACVA 3RDWA 5JCWA 3BCIA 3IDVA 4ECBA 2C3TA 4UB6H 1PD21 1YKAA 3GG2A 1FB0A 1FW1A 3F4RA 3L71G 4JR4A 3KXOA 3LQ7A 2H1GA 2K9FA 2LJKA 2O01H 2P5RA 2R2JA 2O7KA 3CRTA 1JY3P 2KOGA 4MK3A 1MDKA 1SQBK 1P84H 4LLHA 4KCEA 1AUCA 2QJKB 1SYRA 1SQVJ 2W6BA 1S3RA 1FZCC 2HRAA 3H1LE 1DX7A 2E74D 2N9BA 2P7JA 5D8IA 5H2FH 2JACA 3D70A 3VWWA 1TKDB 1YQ4C 1ZOYC 1WJKA 3LG6A 5ENUA 2YNYA 4JYCA 1XVQA 5IPHA 4H0LB 5CCGA 1SP4A 1PZQA 1SQXK 4W7ZA 2L91A 4TT3H 3VOPA 4XS6A 1GSYA 1S1CX 3NTNA 4ZBDA 1QVGO 4PNGA 2JWAA 2M46A 1SQBE 2HRNA 2WT7A 1NYHA 1GTWA 2E75D 2WPSA 3T97A 2A45G 2FD3A 3KTBA 4RJTA 4KGIA 1SQBD 3BCCD 5IMDA 2M80A 4EDYA 4K2XA 2FFDA 5DJUB 2LV3A 1K0OA 2R0CA 2K9JA 3IK9A 1KMIZ 2DMLA 1M1JB 2C0XA 1TRUA 1WRYA 2DLXA 2LEGA 3GMFA 3Q3DA 3KGKA 3TCOA 3CCJP 1ZYQB 3V5BA 3AE1C 5APXA 3UBLA 1S3DA 2QKEA 1B4QA 3A0HE 3MAKA 2V41A 1B8XA 2RLIA 4OH8B 5FT3A 4IJIA 6GSTA 4I6MC 5KLVD 1L0LJ 3V2QA 2FXMA 1Y47A 3EINA 1XIYA 3KH9A 4XCSA 1VF5B 1FO5A 4GQCA 1T4ZA 3TRXA 1RE3A 3ISOA 5AGYA 3KHUA 4TR1B 4BIKA 1YIJP 2E76C 2VO4A 2WZ9A 3GKMA 3AE7C 2BTOT 2H7HA 4MCUA 3A2WA 3HD7B 1A0FA 4KH7A 3ZTLA 2R0PA 1NTZD 2OGUA 4HU9A 1TK0B 1DEEG 3PH0A 2H43A 1S3AA 3EE2A 1FU1A 1WMKA 1N8JA 4YQMA 4ZMDA 2GUVA 3ME7A 3TJJA 2R5DA 3JCUH 5CMZA 1WP0A 1RQVA 3CXHI 2E5TA 1OIPA 2H88C 4BA7A 2LXBA 2K3RA 2UWJE 1RHZB 2JWDA 3J7Yb 2KYVA 10GSA 2ITAA 1BAYA 5DCHA 2WSFJ 2Y9ZA 1KQLA 3V1WA 1TDIA 2O8VB 1LU4A 3UIWA 4DVCA 2TIRA 1SQQK 3F9UA 2WMMA 4YTPC 1YI2P 2AXTH 1IO4A 4OGQC 1KV4A 4RKUJ 4TKYA 2N1TB 3O8ZA 5IIZA 4V2LA 3IV4A 3LGCA 4C7NB 2LRCA 3H1JD 4GKGA 1ABAA 2YV7A 3E9JB 2ZCTA 1R8EA 3V6IA 6GSWA 1ZCPA 5CNWA 4CPGA 1KZUB 1XWAA 4DT0A 3GSTA 5KKZB 1BCCE 5ECNB 2KP8A 3G7JA 1TRVA 1M1JC 2AV4A 1HGZA 3C8VA 3F6FA 2IX7C 4YPCA 2B87A 3FZ9A 1KEBA 1OAZA 4D6TG 2YCDA 2YJHA 1SQXG 4HJ2A 1KFNA 3RBZA 1X9SB 2XDJA 3A0BE 1A02J 4MNNA 2LTKA 4GLTA 3KZQA 3N7NA 3V4QA 4K2DA 3RHCA 1GP1A 1M7TA 3ABVC 3G7YA 3A0BH 1OC9B 1SKRB 2B7KA 1M1KQ 4XHMA 2REMA 20GSA 3MZWB 5D96A 1RQUA 3C1LA 4FYCA 4TXVA 4LMVA 5HFIA 1JY3O 1FG4A 4BWNA 4IP1A 2X8GA 3ZL5A 1XWKA 1SD9A 3TGUG 1HJBA 2H30A 2H1AA 2YKOA 1LT9A 4FYUA 1GLPA 4TR4A 1XBSA 4D6TD 2B88A 2OJLA 1GSFA 4L73A 1J2JB 2KUBA 3LW5J 1AC1A 3E1RA 1NTZK 4IELA 4K7IA 2A06G 3RGUA 3M06A 4MF6A 2M72A 4KHXA 1GD2E 2R3SA 1NTMK 4O5QA 1SJZA 2IFQB 1FBMA 1JLWA 3FKFA 3NOFA 4MF5A 3GFKA 1PGOA 1T4YA 3M1GA 4GDOA 4HJMA 4YQVA 1BGYE 4ZBBA 1YITP 5KJ7D 1M9BA 4TOPA 1O8WA 3W67A 4H13C 1M0UA 1SQVG 1HJ0A 4F9ZA 2HZFA 4G0LA 2Q7CA 2FKWB 4MZBA 3G7IA 3TNUB 1NTKD 1VF1A 4JE1A 2HLSA 1SQXJ 4ASWA 8GSSA 4ECCA 3EC3A 4PD4E 5AVQB 3LSZA 1FS0E 3UMAA 4CY6A 5ECLB 1GNEA 5C04A 2J23A 2Q1KA 2KP2A 3F5HA 3F4SA 4PV1D 4KF9A 4HKZH 3WU2E 4BL7B 3E7KA 1AJYA 3KIJA 1N8RQ 2Y9YA 1Q90D 1A8YA 1M90Q 2VCQA 1IYIA 3I69A 5IOXA 4N3YB 1FOSE 3RK3C 4LA1A 1G7OA 1IK7A 5DQSA 1PFOA 3KP8A 3L9UA 3A5IA 4X4JA 3BD2A 4A7PA 1VDFA 2DIZA 2H71A 3S9FA 3TKSC 2CVBA 3GLMA 4GSNA 4BWSA 2V7QH 4RESB 3QD9A 3QCPA 2WSCJ 1U3IA 2H8LA 4DOJA 2EIQA 1P84D 3CCRP 1M3IA 2FUG2 3BRTB 4JBZA 1JZOA 2EIOA 4ILFA 5KJ7A 3CXHE 2CQ9A 3D4MA 1PGTA 3CQFA 2HPCA 5AW3B 3TGZA 1J0FA 4ZKUA 2L59A 1H88A 5EY6A 1KYOI 1EC5A 2GZZA 2IBZG 1FE6A 3AE2C 5IMFA 3UVTA 1S5LH 1K0DA 1AVOA 5APVA 2CVKA 1X22A 1VQPP 3D4TA 1NKZB 1V40A 3CI9A 1X5CA 1RH5B 1AQXA 3FW2A 4AF2A 5A4VA 1NU1K 4U3FJ 3P8MC 4WY4D 3B5NC 1L4AB 1HBWA 1DE2A 4ZB6A 2CX3A 1KB9E 4L0UA 3RPNA 4I2UA 4KJMA 3ZIVA 16GSA 1ERWA 1BSHA 5AW5B 2A4VA 2HXKA 2WT7B 3K5BA 2A4HA 1A2LA 4IFMA 3LYKA 1KYOE 3LIEA 1S2EA 5D9XA 3GMAA 5ABRA 4KA0A 4GXZA 5HR3A 2FYNB 1QVFO 1GSDA 2NPSC 1GTAA 1XFLA 4IN0A 1FC2C 3SFEC 3GW6A 4NPEA 2L57A 2WS2A 3H1LD 13GSA 5A4UA 2K9YA 2C9LY 5KAIE 2AJQB 4DZOA 5IPGA 1EDIA 4J57E 1VQ7P 1ERUA 3HE4A 1MUUA 3QWOC 3O76A 2JKVA 1PN9A 3A2XA 2R3CA 3Q5RA 3TDKA 1VQNP 2C0FA 5ECHB 3L70J 4ZILA 3SWFA 5KN3A 1B48A 3ZREA 1VQKP 1M3JA 3VP8A 1GWCA 1FZCB 3L4FA 4MP4A 1H4OA 1GSUA 4LMWA 3TB2A 2GZYA 6GSXA 1T2KD 3OAKA 2YXQB 1F37A 5J3RA 1BE3G 3J7Yk 1PL2A 3F89A 2HRKA 2QA4P 3FYGA 4JPZB 3TOTA 1AW9A 3APOA 3W68A 3O6TA 1LWUA 3L9VA 1P84I 2I9HA 1PX7A 3P7XA 3L73G 3CCVP 3TK1A 1E2YA 5AIVA 4IQ1A 3I9V2 1NVOA 3CSHA 1NHLA 2XBIA 3H1HD 1BCCJ 1JM0A 5AW2B 2FY6A 1GL8A 3KEBA 2WPQA 1X5DA 3Q74A 2E43A 3A5TA 2CK3H 1AQVA 3HVVA 4NWYA 1YKCA 3L37A 1EZVI 1SQQD 2XC2A 2V7QJ 3SFDC 2Q3IA 1GW4A 3FWNA 1R4WA 4R4MA 4FH8A 4I8BA 4USSA 1YF0A 4XRAA 2AXTE 3W6GA 5HR0A 2R4VA 2PFXA 2H76A 1DIPA 3CSIA 1SQPJ 1YDKA 5CCGC 2V32A 4J2FA 2QE7H 3L71J 1LTTC 3D5JA 14GSA 1N7SB 3GHGB 5DAKB 3FR6A 2IBZE 3AEAC 3RK3D 4PQIA 1LBKA 4ICYA 3D0ZA 1XVWA 2LUSA 1L0NJ 2LJRA 2FYUK 4GSSA 4BVXA 3H32A 2Z9SA 3TSIA 1Y9BA 2XNDH 1H75A 4N11A 1U7JA 1YY7A 1WWJA 1XPVA 4DSSA 2AXCA 2FWEA 2C4JA 2RN0A 5HQPA 2ZT9B 2YO2A 1UIIA 2KLVA 1AA0A 2X99A 3MD0A 3TKSE 3EPTA 1YF1A 2JADA 2A2RA 4EO3A 5KLVK 3P8CE 1SQVD 3B71A 3EWKA 2Q3EA 5DBQA 1K05A 1HUCA 3TRPA 3G3ZA 3GL3A 4IFFA 4IGJA 4JEDA 1OYJA 3W8SA 1FJKA 2E2MA 1IFMA 3RPPA 3RK2D 4IJ3A 3US3A 1X79B 2H1DA 1SQXD 1IYHA 3HYPA 1U7MA 1N7SC 3GHGC 3DGQA 3L78A 4OFMA 2QM7A 1GL2D 3F4TA 4Y99C 3DMLA 1YJNP 4CDOA 1K0CA 4OMVA 1EV9A 3A7OA 3FY7A 1PP9J 4IS0A 5AVWB 2FA8A 3VPQA 1RF1A 5G31A 1XOBA 5KAFH 4EUYA 2ES7A 2QJYC 4L8EA 4G19A 4D73A 2AYTA 1VF3A 2IFMA 4HDEA 2Y0DA 2KSEA 1LNQA 1WE0A 4K5SA 1RF1B 1QL1A 2YIUB 4V1Ag 3MUDC 3AY8A 5G1LA 2IBZD 4L75A 4AYCA 4O5UA 2B5EA 1EOHA 3CCLP 2M3BA 3MP7B 1OXZA 5BVZA 1URQB 3ZFBA 2QM8A 1K3OA 5KLVJ 1RE3C 3FXDA 4I5QA 4BWQA 2DJ1A 1FAAA 1SENA 3GHAA 1ZP0C 3LXTA 4R4LA 2ZYDA 3WUTA 4LL4B 1EEJA 1QUWA 3AEFC 1KB9H 3CD6P 2RIIA 2GSSA 4KX4A 2V4HA 3SWYA 3CX5H 3P8CD 2B1LA 2M8RA 1S4XA 1KNGA 1X0TA 3S9OA 2K8SA 3MNGA 2O3JA 1T00A 3CX5E 3EURA 2C1YA 3IK7A 3L4NA 2QSIA 4GF0A 4K7OA 2X8CA 3OA7A 2JR8A 1THOA 2AUVA 4HEA2 5KOXA 5GTIH 2RMZA 3C7MA 1JTHB 3JCML 3I5CA 1NTME 5GZZB 5ELGA 1M99A 4ZL9A 1PPJD 4GSTA 4NHZA 1WT6A 4KSMA 5KLVE 1GTBA 1BX9A 1H8AA 2WVRA 1OZHA 2B7JA 3AE9C 3AEGC 2WPRA 3TJGA 4LLRA 1S5LE 3V2RA 4ASVA 3W8JA 1M57D 1XCCA 1FB6A 1LTJA 4JBBA 1NTKE 2K37A 3VN0A 3PR8A 3U6VA 1IZNB 4YAVA 2CVDA 4V2NA 1EDKA 2IZ1A 2MMAA 3IXRA 3R2PA 2DJKA 4Z1MH 2L5OA 2AAWA 1LTIC 3GSSA 4TRXA 2MKVA 1JY2O 2FFDC 1EZVG 4W80A 2IMEA 2IMIA 1VQ4P 3H1JJ 3HUSB 2OYIB 2H74A 1GTIA 2JU5A 2AEFA 1HGVA 1PGJA 3L74E 3PPUA 2EIRA 4YKFA 5ECKB 5ECSA 2YZUA 1MDIA 1FJPA 2OQQA 22GSA 4RI6A 2ON7A 4WR5A 2QA2A 1JLVA 1A02F 5F0GA 3GTUB 2LNSA 4YQUA 2H75A 3ERFA 2DMMA 2QIWA 3T97B 1FDIA 1JMMA 2K6VA 2Q5UA 1KTEA 1C72A 3TJKA 1ZGNA 1N7LA 3F0IA 1M2BA 5APQA 3U1AA 2TRXA 3F6DA 4QL7A 3IRAA 2YWIA 5E4WA 3N9JA 1GLQA 4IL6X 3FZ5A 2G8YA 3L74G 1QXHA 3ZIJA 3L73E 1NTMD 1DH3A 2CAIA 1OVVA 5APSA 1J1EC 2PP6A 3IFMA 1GULA 3R3EA 1PIXA 2QG4A 1CI6B 3APSA 3LW5H 3CXHD 3L72D 2B1KA 2ZJSE 3GUSA 2OYIC 5A4WA 1SQBG 1GNWA 3HE5A 4RUVA 1MD4A 2LXCB 3L72E 2VRSA 1K0NA 3H1KJ 3APQA 4KE3A 1PKWA 1FZGA 4N30A 4K35A 1J1DC 3IBHA 5CRGA 5KLIB 3C8EA 3CRUA 2D2CD 3FXEA 3IR9A 1TU3F 2DKIA 1X9VA 3H93A 3WT2A 2KOKA 1PA3A 2VM2A 1URQD 5AVRB 1YQ1A 1OKDA 2G2QA 1E5WA 3CX5I 3GF3A 3TNUA 3WGXA 1Z7RA 1BGYG 2WSCH 3AEBC 3BATA 4L74A 3F3QA 1ZYNA 3IF4A 3AE3C 4KW6A 4AJ7A 2IDBA 1VQMP 2YPMA 1YEXA 5GAPD 1L0LK 2O87A 2E42A 2LRNA 1GW3A 2KNCA 1DE1A 2E75B 4PGTA 5ECPB 1KILA 2O01J 4IL6H 1NTMJ 3QFAC 1LP1A 2OYHA 4ACSA 4FO5A 4WF5A 2L5LA 2JO1A 3TRQA 2K8VA 4KSOA 3UAPA 4H0LD 2GT5A 3M0AA 5BRTA 1YTZI 2WPVB 4I6XA 1SQPK 2WSEH 1SL1B 3H1KD 1JOCA 1Q4JA 4BRYB 4C7NA 2J58A 3D71A 1AVYA 1AFOA 2E7PA 2YN1A 1EP7A 4U3FG 1SQBJ 1J9BA 1TI3A 2GM4A 2PWJA 1L0LE 3F8UA 1SS1A 2R44A 1XOAA 2FWGA 1L0ND 1M2DA 1JZRA 5GSSA 3HJPA 4JR6A 4DSSB 2XV5A 3KZIE 1F6MC 2FWHA 4ISDA 4H13D 4PD4D 2NBSA 1LTSC 4PJ0H 2HI7A 2WGRA 4OWYA 1VRSD 2KI7B 4PUFC 2RKLA 2L4QA 4MZWA 3HVSA 1JY2N 1JZDA 4OD7A 3HTKA 5G30A 1ZR4A 2EC4A 3L75J 3RBTA 1AAZA 5AW1B 4NAXA 1N73A 2WDUA 4OO4A 4WEYA 2VIMA 3E0UA 1R5AA 3QMXA 1GUKA 1O7UA 1IC2A 3CYNA 2LJAA 1OE8A 2OADA 1N73B 1LP1B 2OYHB 1MDJA 2BEZF 1ZL9A 1L2PA 1NTZJ 2N1TC 3KYQA 2B5XA 4HS1A 1QQ2A 3VFIA 4D6TE 3BOAA 1QX8A 2C8UA 1F3BA 3UL3A 1EDJA 2IBZI 3CTFA 3U1CA 9GSSA 5KAFE 2J59M 1KILC 4D73B 2JL4A 1GK4A 1TP9A 3FR3A 2PRRA 2IZ0A 3F63A 4IVFA 2ALBA 3CBUA 3TDGA 1KQFB 1K9MQ 4FYBA 1SFCA 2IFQA 1LT1A 3L75G 1YQ3C 2GS3A 2VL3A 4Q5FA 3ERGA 3IE3A 4TR3A 2YOIA 2XU6A 1XTCC 1Z9HA 5CAXA 2KLXA 5DALB 3TKPA 3VWVA 1NJIQ 5K5GB 1V57A 3KD0A 2D2CB 4ZL8A 3Q19A 2KP1A 3GNJA 4O32A 1LT9B 2GDRA 2WSFH 1YEPA 4XS1A 4ECJA 3H1LJ 1XTGB 3L75D 2FGXA 1T6AA 5FHIA 5ECMB 3VLNA 2FBWC 1VPCA 2QJPB 4IKHA 3A2AA 3GF7A 2H6YA 2D2CC 2H72A 4IW9A 19GSA 2K18A 1WOUA 1YJWP 1K73Q 5DQYA 3ZYWA 2GZPA 3L70D 3VMXA 2VOCA 2X64A 1KYOD 4ID0A 1IK9A 4DEJA 2XBQA 3HA9A 3WGEA 3DWVA 3S1KA 4F03A 2BASA 2W6JH 3EYTA 3G6EP 1L0LG 3N4XA 3AE5C 1HNAA 3RK2B 1KC8Q 2OE0A 3IHGA 4AJ8A 1GU5A 3MWHA 1GDTA 3CWBJ 4WKWA 5B66E 4K8MA 2OARA 1G7EA 1A2JA 2YMKA 2JZTA 2VLUA 4GQFA 2RH0A 3HXSA 3O6QA 1CSBA 3H1IJ 3CMAP 1K3YA 2A06E 3C1RA 1E6BA 3HVNA 2YNXA 3WU2H 4FQUA 1IJDB 3M3MA 5G1KA 4G9HA 1SL0B 3SSUA 3KP9A 5GAND 1UVZA 5GTIE 4ZNCA 2Z4EA 5ECRB 4EL1A 4I2TA 4H44C 1YTZT 1T2KC 1Z56A 1I9DA 2IN3A 2P2UA 1XW9A 1FZCA 1BGYJ 1QGKB 1NSWA 3N5OA 1FDMA 3QOUA 4EDFA 2KSJA 4O5RA 1F2EA 2XNXA 3M0DA 2GQKA 4EC0A 2GUSA 2JZRA 1PPJE 3CWBE 3WGDA 4O92A 4K7NA 1SLQA 1CZQA 1JCCA 4IL6E 1PX6A 3DYRA 3UOMA 1OVRA 5COHA 3GL5A 3L73J 1DD3A 5CCHC 1YZXA 1Z7PA 4KDUA 4EE0A 1M56D 2M5AB 2O01N 4IFDK 2VM1A 3JSVC 2RM5A 2ZNMA 4MABA 3EMXA 2VLTA 3AE8C 2HODB 4IHUA 2QJYB 2VD1A 4TW5A 1H0TB 3PGTA 2MMOA 2VCTA 2B87B 4TR1A 3KPEA 1KORA 1I5GA 3HRNA 3I55P 3DVXA 4MMMA 1VQ5P 2LSTA 4K9ZA 4MPGA 3KQGA 1EXIA 3TGUJ 2SPZA 4Y99B 3H32B 1VQ8P 2PBJA 1NKNA 5GTHE 1UA5A 3CLQA 2ZUPA 5HFKA 2MYGA 3H79A 4NHWA 4V1Ap 1X5EA 2AHEA 3RAZA 2H73A 1RE4A 5ECIB 3G9BA 4DSRA 3VMAA 5G5EA 3KTLA 5CRHA 1Z3EA 4U3FD 3ZFLA 2MZCA 2YIUC 3HDCA 5EVOA 2I4AA 3KZIH 3LFLA 1PQNA 2JDIH 4HH2A 2NDOA 3KCMA 4OFNA 3DEXA 4RQXA 4BVYB 4WETA 4MH2A 2HZEA 1LTBC 4A5PA 1ON4A 1HWTC 4QQ7A 4PURA 4U7JA 2PGTA 5B8AA 4LGDE 3QH9A 5DDLA 3L73D 2K1AA 3DVWA 5F05A 1E79H 3R2QA 1SQXE 4E8HA 5FWGA 5B6MA 2WJUA 1L4AC 2VL2C 5ELAA 1WRGA 2E5YA 2OACA 2O89A 5TISH 3PTZA 4MLYA 1OKTA 3HJOA 2JEEA 5APUA 4MJEA 4ZB9A 1BE3D 2HODA 3EU3A 1AQTA 2A45I 5CYYA 1OVNA 4GTUA 3D6YA 2HFED 3GURA 4G0IA 3LWAA 4EIPA 4POLA 1BE3E 3TGUD 1SFCB 1BG5A 4PX1A 6GSUA 4QMAA 5JCGA 3RK3B 4EXJA 2CAQA 3TGUE 3U59A 2FYUJ 3FMWA 1RE4C 1A2MA 4TVEA 2OE1A 5IO0A 1PRXA 3VI7A 5AW4B 1KN7A 5KLVG 2X49A 1BJXA 1URQA 3EMPA 2C9NY 3CC7P 1EP8A 3QR6A 1TU7A 4C7RA 1PP9G 2CV4A 2JSYA 3BCKA 3ZZXA 3HZ8A 1ZOFA 4TR0A 1J1EB 2Z5HA 3HD7A 3UIAA 2CT6A 3SWLA 5J4UA 1ZYEA 2OBIA 5J9CA
chains in the Genus database with same CATH topology
1CQHA 3EVIA 2DJ0A 3IOSA 1B9XC 12GSA 3AE4C 1BEDA 2GQMA 4WBRD 4POBA 4HOJA 1FOHA 4KT0J 4RQRA 4P3YB 2VLVA 3D21A 2H66A 5F07A 2F8AA 2NVLA 1PL5A 2H6ZA 3DD3A 2QA1A 3FR9A 3F3RA 4TN8A 5L8RJ 5D93A 3HY2A 2H6XA 1BQ7A 2R6KA 4Z2TA 5H5SA 4ZL7A 5DJLA 5CREA 1J08A 2IWTA 1LJRA 3NZNA 2DSAA 1VF4A 4ML1A 5DCGA 3IAOA 2XPEA 3WD6A 2PU9C 3IC8A 3GKNA 2C0DA 4ULXA 2YV9A 1KILE 2F8FA 1Y25A 3KMNA 1SU9A 2PPTA 4XRDA 4JU5A 1S3CA 3I6AA 3CXGA 3DXBA 3LORA 2PMTA 1NHYA 2GLRA 2PUKC 3G9RA 1WPIA 1RQMA 2L6CA 4N0ZA 1HD2A 1GUHA 2V1MA 3IC4A 2DJ2A 3TKRA 4WF4A 2V2GA 2OBKA 3M9JA 4G10A 1SJ6A 2F51A 2JP3A 3AEDC 1ST9A 4F2IA 1CQGA 3QPMA 1HNCA 1T8EB 5E59A 4NV2A 4X43A 3ZRDA 2ZT9D 2VL9A 4XIHA 5DALA 4JRRA 3QAWA 2OE3A 2FWFA 2YWNA 2O85A 2E76B 3WT1A 2P0GA 1GMJA 3GV1A 1TRSA 1F3AA 3H8QA 1VF5C 3FGAD 3GN3A 5IMVA 2DIYA 2YWOA 5D73A 5B7CA 2MBTA 2A2PA 1VF2A 4H86A 1USBA 5CRWA 2UZ8A 5ECOB 2FA4A 2IMDA 3A5WA 1OMIA 3H25A 5G2ZA 5H5RA 4G0KA 4GCIA 1JZWA 4Q5QA 1X0RA 1AQWA 1M2AA 2F9SA 2FLSA 2H89C 4E8EA 3A2VA 4OCFA 2D2ZA 2C3QA 4MH3A 3GKKA 2WULA 6GSVA 1O73A 2MMNA 3MIXA 1WMJA 2B5YA 1DSBA 2R5GA 1AIUA 1MTCA 1R5PA 2WQYC 2WSEJ 1V58A 2J9HA 3PINA 3GX8A 1SKWB 4NXIA 4QL9A 1V2AA 1XZOA 2XPDA 3TJFA 2V6KA 3ED3A 4PUAA 1K0BA 2HRFA 3CSJA 3MYDA 1NHOA 4I7ZB 1BYEA 2MMZA 3Q1MA 1GTUA 3VPTA 1UC7A 1M9AA 4JZQA 3HVXA 4Z7XA 1NGMB 2WB9A 2FYNC 1PMTA 2X8HA 3AE6C 3DRNA 4KUNA 5C00A 3ZITA 4H13B 1EWXA 3CTGA 2GVPA 3R4YA 4EVMA 1TOFA 3HHVA 2LS5A 3IR4A 5CO3A 4EIQA 4HQZA 2E2GA 3VI5A 3RK3E 5F8BA 1XW5A 2FCHA 4I7ZC 1X9WB 4K0GA 1G0TA 4NPBA 1K3LA 5KN1A 3GKXA 4L0WA 2GSTA 2IIYA 5KKZC 4MDCA 1Q98A 1FVJA 4OGQB 2RUFA 1ZMAA 4V2MA 4OFTA 2MBSA 1FOVA 5ECQB 4HU7A 1OE7A 2YJ7A 2DKHA 3M0FA 5KN0A 4CY8A 3Q5SA 1ZMEC 4YKGA 2VCVA 5LNKe 4ZIJA 3IN6A 1TXXA 1G6YA 1XWCA 2IL3A 2LRTA 2I81A 2F3MA 3CMIA 1EOGA 5IMCA 1X9MB 5KLIC 5KEJA 1QFNA 2IMKA 1FVKA 4X1UA 17GSA 4GRFA 2DJ3A 3UARA 2VCZA 4Q5RA 2B3SA 1K0AA 4DSQA 2LNTA 3P90A 4CW9A 5ID2A 4K6XA 2C0EA 2OKAA 1B4PA 5D9VA 4GWRA 5A5KA 1TK5B 1DUGA 4I97A 2H19A 4J56E 3M8NA 3HD5A 5F06A 3NIVA 5G5FA 4HUAA 4XTSA 1DBYA 4IQAA 4MF7A 2N5AA 4Y28J 3KH7A 2KHPA 3GX0A 4G2EA 2HSHA 1GH2A 2P31A 2PERA 5AIXA 4MA9A 4H44D 2H1BA 2H0GA 3VWUA 2X4AA 3AEEC 2HZEB 4HQSA 1THXA 1VF5D 1JB0J 4KAEA 5KOWA 1U88A 4PV1C 1O8XA 3UBKA 1KQGB 1URMA 2PN8A 1T3BA 4ECIA 1ERTA 5EPFA 1VGLA 4PQHA 2G0FA 2L6DA 4AJ6A 1TW9A 1XWBA 3IAS2 1W4VA 2GQLA 2RM6A 6GSSA 3HKRA 1GRXA 2H0HA 6GSYA 3DIEA 1FDOA 2IJYA 4Z2UA 2V6OA 1OW7A 2N5FA 4POKA 2R0GA 4ZBAA 3FZAA 3GH9A 1O6JA 3HCZA 3LEFA 2CZ3A 3IA1A 3FZ4A 4POMA 4EKZA 4WBJA 3FRCA 3GTUA 3VURA 1TU8A 1ZZYA 2GGTA 4H44B 2TRCP 5BMUA 1MKMA 4KB3A 1A24A 2BMXA 1KTMA 1JFUA 5M1BA 1SYXA 3GH6A 1QK8A 2A2SA 5IOWA 1HF9A 1HYUA 1Y6EA 5IO2A 4KNDA 3ZVJA 1ERVA 4Z2RA 3L9SA 3QDNA 5AN1A 1XWGA 2GTUA 3VWXA 4YH2A 1SL2B 1S5LX 5JWRB 1WIKA 1AXDA 4OCEA 1N2AA 1O85A 3HJMA 3Q2YA 4NMUA 3C73A 2JSZA 3D6IA 3FHKA 4KDXA 3ZMKA 4Q5NA 5CP1A 18GSA 5B6NA 4PXOA 3IHQA 2VCXA 3H4KA 1GSEA 2NZ2A 1O81A 5HR1A 4L5OA 1VL2A 2FHEA 4O7HA 2G3AA 4PQ1A 1F9MA 1EEMA 3D6ZA 1V9WA 4KCAA 3BJ5A 1GSSA 3D22A 5AISA 1OC9A 2WCIA 1G6WA 1OC8A 5EL8A 4BVYA 4L5LA 4ZXGA 1NM3A 4K0NA 5DJMA 5IMAA 1SKSB 1ZRTE 2BEQD 3TKSA 4OO5A 1OW6A 2HNLA 1RW1A 3A3TA 4EF0A 2BJXA 3Q18A 2VCWA 2HSYA 4ZB8A 2N5BA 2GSRA 1SD8A 3LYPA 4OGQD 4BVXB 3O3TA 1U57A 3Q5PA 4WXTA 2NTOA 2ZT9C 2E74B 3UVHA 1U87A 3GYKA 2YZHA 2IPAA 5JWOB 1SK2A 2R37A 2VAFA 3UJ1A 3TKQA 2I1UA 3EU4A 2QJKC 5L71A 3GIXA 3ZVJD 2B6MA 2FNOA 3KJYA 2NPBA 1PL1A 2P5QA 3M9KA 4MJAA 2HT9A 4K5RA 5LCZA 2E0QA 3DKSA 3LXZA 1DD4A 1EV4A 3EWLA 5J5NA 5HR2A 5D9TA 1ILOA 4TXOB 2HFDA 1A8LA 11GSA 3BBYA 1R26A 3U5RE 2FXPA 5B8BA 1TI1A 4K1FA 4KDYA 4HZ4A 1SK0A 1TRWA 4WR4A 5J9BA 1PN0A 1K0MA 1W89A 4MJBA 3ZMLA 4EDZA 3K8NA 4MZCA 5IQYA 2WFCA 1ZYPA 3KMOA 2HE3A 2L4CA 1R7HA 1EZKA 2VD0A 1XXUA 5HFGA 1UIXA 2PVOC 4FIWA 3LW9A 1RK4A 1T1VA 2E75C 2WRTA 4MJCA 1GSQA 3MSZA 3OR5A 1A23A 3ZLPA 1EGRA 2H70A 1TTZA 2XHFA 2DBCA 2VUPA 5H5QA 1FHEA 4PTSA 1Z5YE 1HQOA 4MPFA 3FK8A 3QAVA 1ML6A 2HYXA 1YJ6A 1Z6MA 4IP6A 2QGVA 3H1NA 7GSSA 2VL2A 2C0GA 3C71A 4TXOA 2C80A 5CRDA 1MD3A 1OC3A 1SK1A 4F0CA 5IM9A 3VK9A 1PSQA 2E74C 4HI7A 2R3XA 2I3YA 2E76D 3ERWA 4YXDC 3TJBA 5KN2A 4BL7A 5D9WA 1U6TA 2P10A 3PH9A 2H01A 3SBCA 1EXJA 2YWMA 3KM6A 5JWQB 3I43A 2RUEA 4YAPA 1B9YC 4IBPA 4HZ2A 4RI7A 2YANA 3P2AA 1PKZA 2ON5A 1MEKA 3L0HA 1TJDA 3HZ4A 1EGOA 3Q6OA 4N0VA 1A0RP 4X0XA 1TK8B 2J5UA 4XS4B 2LQOA 3QAGA 1V98A 4PV1B 3TUEA 2JZSA 1GUMA 2CX4A 1UN2A 1NW2A 5LD0A 2DJJA 5GSTA 2GSQA 2OA7A 3MDKA 2KUCA 4XS4A 4NV5A 2AB6A 2LKUA 5DAKA 1XW6A 1HNBA 3FEUA 3GRXA 2QJPC 2QC7A 2IMFA 4CHSA 2LQQA 1OW8A 3GA4A 5DVBA 2CZ2A 3TOUA 1PV3A 4AGSA 5J41A 2HSMA 2C3NA 5ID2B 4F0BA 4XFJA 3E3EA 1JHBA 4PNFA 3LJRA 3ME8A 2GT6A 1K04A 5JCUA 3IPZA 3UEMA 4H0LC 1Z6NA 5INYA 3AECC 3P8WA 2DC5A 1QGVA 2PVQA 4LL1B 4N10A 3WYWA 1KBNA 3RL0g 4ML6A 1SJIA 3IAM2 5IMZA 2CA8A 3QFBC 1QMVA 3C1SA 1T7PB 1U3AA 2YP6A 3RHBA 2H0IA 4F82A 4BPYA 1ACVA 3RDWA 5JCWA 3BCIA 3IDVA 4ECBA 2C3TA 1PD21 1YKAA 1FB0A 1FW1A 3F4RA 4JR4A 3KXOA 3LQ7A 2H1GA 2K9FA 2LJKA 2P5RA 2R2JA 2O7KA 3CRTA 4MK3A 1MDKA 4KCEA 1AUCA 1SYRA 2HRAA 2E74D 5D8IA 2JACA 3D70A 3VWWA 1TKDB 1YQ4C 1ZOYC 1WJKA 3LG6A 5ENUA 1XVQA 5IPHA 4H0LB 4TT3H 4XS6A 1GSYA 1S1CX 4ZBDA 4PNGA 2M46A 2HRNA 1NYHA 2E75D 3KTBA 2FD3A 4KGIA 5IMDA 2M80A 4EDYA 4K2XA 2LV3A 1K0OA 2R0CA 3IK9A 1KMIZ 2DMLA 1TRUA 2DLXA 1WRYA 3GMFA 2LEGA 3KGKA 3Q3DA 3TCOA 1ZYQB 3AE1C 3UBLA 1S3DA 2QKEA 1B4QA 3MAKA 2V41A 1B8XA 2RLIA 5FT3A 4IJIA 6GSTA 3EINA 1XIYA 3KH9A 4XCSA 1VF5B 1FO5A 4GQCA 1T4ZA 3TRXA 3ISOA 5AGYA 4TR1B 2E76C 2VO4A 2WZ9A 3GKMA 3AE7C 2BTOT 4MCUA 3A2WA 1A0FA 4KH7A 3ZTLA 2R0PA 4HU9A 1TK0B 1S3AA 3EE2A 1WMKA 1N8JA 4YQMA 3ME7A 3TJJA 1WP0A 1RQVA 2H88C 4BA7A 3J7Yb 10GSA 1BAYA 5DCHA 2WSFJ 3V1WA 1TDIA 2O8VB 1LU4A 3UIWA 4DVCA 2TIRA 3F9UA 4YTPC 4OGQC 4RKUJ 4TKYA 5IIZA 4V2LA 3IV4A 3LGCA 2LRCA 1ABAA 2YV7A 3E9JB 2ZCTA 1R8EA 6GSWA 1ZCPA 5CNWA 1XWAA 3GSTA 5ECNB 3G7JA 1TRVA 2AV4A 3F6FA 3C8VA 3FZ9A 1KEBA 1OAZA 2YCDA 2YJHA 4HJ2A 1X9SB 4MNNA 2LTKA 4GLTA 3KZQA 4K2DA 3RHCA 1GP1A 1M7TA 3ABVC 3G7YA 1OC9B 1SKRB 2B7KA 4XHMA 2REMA 20GSA 5D96A 1RQUA 4TXVA 4FYCA 4LMVA 5HFIA 1FG4A 4IP1A 3ZL5A 2X8GA 1XWKA 1SD9A 2H30A 2H1AA 4FYUA 1GLPA 4TR4A 1XBSA 2OJLA 1GSFA 3LW5J 1AC1A 4IELA 4K7IA 4MF6A 2M72A 4O5QA 1SJZA 2IFQB 1JLWA 3FKFA 3NOFA 4MF5A 3GFKA 1T4YA 3M1GA 4GDOA 4HJMA 4YQVA 4ZBBA 1M9BA 4TOPA 1O8WA 4H13C 1M0UA 1HJ0A 4F9ZA 2HZFA 4G0LA 4MZBA 3G7IA 1VF1A 4JE1A 2HLSA 8GSSA 4ECCA 3EC3A 3LSZA 3UMAA 4CY6A 5ECLB 1GNEA 5C04A 2J23A 2KP2A 3F4SA 4PV1D 4KF9A 4BL7B 1AJYA 3KIJA 1Q90D 1A8YA 2VCQA 1IYIA 3I69A 5IOXA 4LA1A 1G7OA 1IK7A 5DQSA 3KP8A 3L9UA 3A5IA 4X4JA 3BD2A 2DIZA 2H71A 3S9FA 3TKSC 2CVBA 3GLMA 4GSNA 4BWSA 3QD9A 3QCPA 2WSCJ 1U3IA 2H8LA 2EIQA 2FUG2 1JZOA 2EIOA 4ILFA 2CQ9A 3D4MA 1PGTA 3TGZA 1J0FA 2L59A 5EY6A 2GZZA 3AE2C 5IMFA 3UVTA 1K0DA 2CVKA 3D4TA 1V40A 1X5CA 3FW2A 4AF2A 1AQXA 5A4VA 1DE2A 4ZB6A 2CX3A 4L0UA 3RPNA 4I2UA 3ZIVA 16GSA 1ERWA 2A4VA 2HXKA 2A4HA 1A2LA 3LYKA 5D9XA 3GMAA 5ABRA 4KA0A 4GXZA 5HR3A 1GSDA 1GTAA 1XFLA 4IN0A 3SFEC 2L57A 2WS2A 13GSA 5A4UA 2K9YA 2AJQB 5IPGA 4J57E 1ERUA 3O76A 1PN9A 3A2XA 3Q5RA 2C0FA 5ECHB 4ZILA 5KN3A 1B48A 3ZREA 1GWCA 4MP4A 1H4OA 1GSUA 4LMWA 3TB2A 2GZYA 6GSXA 5J3RA 1F37A 3J7Yk 1PL2A 2HRKA 3FYGA 3TOTA 1AW9A 3APOA 3O6TA 3L9VA 3P7XA 2I9HA 1PX7A 1E2YA 5AIVA 4IQ1A 3I9V2 3CSHA 2XBIA 2FY6A 1GL8A 3KEBA 1X5DA 3Q74A 1AQVA 3HVVA 4NWYA 1YKCA 2XC2A 2V7QJ 3SFDC 1R4WA 4FH8A 4R4MA 4I8BA 4USSA 1YF0A 4XRAA 3W6GA 5HR0A 2R4VA 2H76A 1DIPA 3CSIA 1YDKA 2V32A 4J2FA 3D5JA 14GSA 5DAKB 3FR6A 3AEAC 4PQIA 1LBKA 4ICYA 3D0ZA 1XVWA 2LUSA 2LJRA 4GSSA 4BVXA 2Z9SA 1Y9BA 1H75A 4N11A 1YY7A 1WWJA 1XPVA 4DSSA 2FWEA 2C4JA 5HQPA 2ZT9B 3TKSE 2X99A 3EPTA 1YF1A 2JADA 2A2RA 4EO3A 3B71A 3EWKA 5DBQA 1K05A 3TRPA 3GL3A 4IGJA 4JEDA 1OYJA 3W8SA 2E2MA 3RPPA 4IJ3A 3US3A 2H1DA 1IYHA 3HYPA 3L78A 3DGQA 4OFMA 3F4TA 3DMLA 4CDOA 1K0CA 4OMVA 1EV9A 3FY7A 4IS0A 2FA8A 3VPQA 5G31A 1XOBA 4EUYA 2ES7A 2QJYC 4L8EA 4G19A 4D73A 2AYTA 1VF3A 4HDEA 1WE0A 4K5SA 4V1Ag 3AY8A 5G1LA 4O5UA 2B5EA 1EOHA 3ZFBA 4I5QA 1K3OA 4BWQA 2DJ1A 1FAAA 1SENA 3GHAA 1ZP0C 3LXTA 4R4LA 4LL4B 1EEJA 1QUWA 3AEFC 2RIIA 2GSSA 4KX4A 2B1LA 1KNGA 2K8SA 3S9OA 3MNGA 3EURA 1T00A 2C1YA 3IK7A 3L4NA 2QSIA 4GF0A 4K7OA 2X8CA 4HEA2 2AUVA 1THOA 5KOXA 3C7MA 3JCML 5GZZB 5ELGA 1M99A 4ZL9A 4GSTA 4NHZA 4KSMA 1GTBA 1BX9A 2B7JA 3AE9C 3AEGC 3TJGA 4LLRA 3W8JA 1XCCA 1FB6A 4JBBA 3PR8A 3U6VA 4YAVA 2CVDA 4V2NA 3IXRA 2MMAA 2DJKA 4Z1MH 2L5OA 2AAWA 3GSSA 4TRXA 2MKVA 2IMEA 2IMIA 2H74A 1GTIA 2JU5A 3PPUA 2EIRA 4YKFA 5ECKB 5ECSA 2YZUA 1MDIA 2OQQA 22GSA 4RI6A 2ON7A 4WR5A 2QA2A 1JLVA 5F0GA 3GTUB 2LNSA 4YQUA 2H75A 3ERFA 2DMMA 2QIWA 3T97B 1FDIA 2K6VA 1KTEA 1C72A 3TJKA 1ZGNA 3F0IA 1M2BA 2TRXA 4QL7A 3F6DA 3IRAA 2YWIA 5E4WA 3N9JA 1GLQA 4IL6X 3FZ5A 2G8YA 1QXHA 3ZIJA 2CAIA 1GULA 3R3EA 1PIXA 3APSA 2B1KA 3GUSA 5A4WA 1GNWA 4RUVA 1MD4A 1K0NA 3APQA 4KE3A 1PKWA 4N30A 5CRGA 3IBHA 3C8EA 3CRUA 2D2CD 1TU3F 2DKIA 3H93A 3WT2A 2KOKA 1PA3A 2VM2A 1YQ1A 1OKDA 2G2QA 3GF3A 3WGXA 1Z7RA 3AEBC 3F3QA 1ZYNA 3AE3C 4KW6A 4AJ7A 2IDBA 2YPMA 1YEXA 5GAPD 2O87A 2LRNA 1DE1A 2E75B 4PGTA 5ECPB 2O01J 3QFAC 4ACSA 4FO5A 4WF5A 2L5LA 2JO1A 3TRQA 2K8VA 4KSOA 3UAPA 4H0LD 2GT5A 5BRTA 2WPVB 4I6XA 1SL1B 1Q4JA 3D71A 2E7PA 2YN1A 1EP7A 1J9BA 1TI3A 2PWJA 3F8UA 1XOAA 2FWGA 1M2DA 1JZRA 5GSSA 3HJPA 4JR6A 4DSSB 1F6MC 2FWHA 4ISDA 4H13D 2NBSA 2HI7A 2WGRA 4OWYA 1VRSD 4PUFC 2L4QA 4MZWA 3HVSA 1JZDA 4OD7A 5G30A 2EC4A 3RBTA 1AAZA 4NAXA 2WDUA 4OO4A 4WEYA 2VIMA 3E0UA 1R5AA 3QMXA 1GUKA 1O7UA 3CYNA 2LJAA 1OE8A 2OADA 1MDJA 2BEZF 1ZL9A 2B5XA 4HS1A 1QQ2A 3VFIA 3BOAA 2C8UA 1F3BA 3UL3A 3CTFA 9GSSA 4D73B 2JL4A 1TP9A 3FR3A 3F63A 3TDGA 4IVFA 2ALBA 3CBUA 1KQFB 4FYBA 2IFQA 2GS3A 1YQ3C 2VL3A 4Q5FA 3ERGA 3IE3A 4TR3A 2YOIA 1Z9HA 5CAXA 2KLXA 5DALB 3TKPA 3VWVA 1V57A 3KD0A 2D2CB 4ZL8A 3Q19A 2KP1A 3GNJA 4O32A 2GDRA 1YEPA 4XS1A 4ECJA 2FGXA 3VLNA 5FHIA 5ECMB 2FBWC 4IKHA 3GF7A 2H6YA 2D2CC 2H72A 4IW9A 19GSA 2K18A 1WOUA 5DQYA 3ZYWA 2GZPA 2VOCA 2X64A 4ID0A 4DEJA 2XBQA 3HA9A 3WGEA 3DWVA 4F03A 3EYTA 3AE5C 1HNAA 2OE0A 3IHGA 4AJ8A 3MWHA 4WKWA 4K8MA 1G7EA 1A2JA 2YMKA 2JZTA 2VLUA 4GQFA 3HXSA 3O6QA 1K3YA 3C1RA 1E6BA 2YNXA 4FQUA 3M3MA 5G1KA 4G9HA 1SL0B 3KP9A 5GAND 1UVZA 5ECRB 4EL1A 4I2TA 4H44C 1I9DA 2IN3A 1XW9A 3N5OA 1NSWA 3QOUA 4O5RA 1F2EA 2GQKA 4EC0A 2JZRA 3WGDA 4O92A 4K7NA 1PX6A 3DYRA 3UOMA 5COHA 3GL5A 1Z7PA 1DD3A 1YZXA 4KDUA 4EE0A 2VM1A 2RM5A 2ZNMA 4MABA 3EMXA 2VLTA 3AE8C 4IHUA 2VD1A 4TW5A 3PGTA 2MMOA 2VCTA 4TR1A 1KORA 1I5GA 3DVXA 4MMMA 2LSTA 4K9ZA 4MPGA 1EXIA 2PBJA 1UA5A 2ZUPA 5HFKA 2MYGA 3H79A 4NHWA 4V1Ap 1X5EA 2AHEA 3RAZA 2H73A 5ECIB 3G9BA 4DSRA 5G5EA 3KTLA 5CRHA 1Z3EA 3ZFLA 2MZCA 2YIUC 3HDCA 5EVOA 2I4AA 3LFLA 1PQNA 3KCMA 2NDOA 4OFNA 3DEXA 4RQXA 4BVYB 4WETA 4MH2A 2HZEA 4A5PA 1ON4A 4QQ7A 4PURA 4U7JA 2PGTA 5B8AA 5DDLA 3DVWA 5F05A 3R2QA 4E8HA 5FWGA 5B6MA 2WJUA 2VL2C 5ELAA 2OACA 2O89A 4MLYA 1OKTA 3HJOA 4MJEA 4ZB9A 3EU3A 5CYYA 1OVNA 4GTUA 3D6YA 3GURA 4G0IA 3LWAA 4EIPA 4POLA 1BG5A 4PX1A 6GSUA 5JCGA 4EXJA 2CAQA 3FMWA 1A2MA 4TVEA 2OE1A 5IO0A 1PRXA 3VI7A 2X49A 1BJXA 3EMPA 1EP8A 3QR6A 1TU7A 2CV4A 2JSYA 3BCKA 3ZZXA 3HZ8A 1ZOFA 4TR0A 2CT6A 3SWLA 5J4UA 1ZYEA 2OBIA 5J9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQH A;  3EVI A;  2DJ0 A;  3IOS A;  1B9X C;  12GS A;  1BED A;  2GQM A;  4WBR D;  4POB A;  4HOJ A;  4KT0 J;  4RQR A;  4P3Y B;  2VLV A;  3D21 A;  2H66 A;  5F07 A;  2F8A A;  2NVL A;  2H6Z A;  3DD3 A;  3FR9 A;  3F3R A;  4TN8 A;  5L8R J;  5D93 A;  3HY2 A;  2H6X A;  1BQ7 A;  2R6K A;  5H5S A;  4ZL7 A;  5DJL A;  5CRE A;  1J08 A;  2IWT A;  1LJR A;  3NZN A;  2DSA A;  1VF4 A;  4ML1 A;  5DCG A;  2XPE A;  3WD6 A;  2PU9 C;  3GKN A;  2C0D A;  4ULX A;  2YV9 A;  2F8F A;  1Y25 A;  3KMN A;  1SU9 A;  2PPT A;  4XRD A;  4JU5 A;  1S3C A;  3I6A A;  3CXG A;  3DXB A;  3LOR A;  2PMT A;  1NHY A;  2GLR A;  2PUK C;  1WPI A;  1RQM A;  2L6C A;  4N0Z A;  1HD2 A;  1GUH A;  2V1M A;  3IC4 A;  2DJ2 A;  3TKR A;  4WF4 A;  2V2G A;  2OBK A;  3M9J A;  4G10 A;  1SJ6 A;  2F51 A;  1ST9 A;  4F2I A;  1CQG A;  3QPM A;  1HNC A;  1T8E B;  5E59 A;  4NV2 A;  4X43 A;  3ZRD A;  2VL9 A;  4XIH A;  5DAL A;  4JRR A;  3QAW A;  2OE3 A;  2FWF A;  2YWN A;  2O85 A;  2E76 B;  3WT1 A;  2P0G A;  3GV1 A;  1TRS A;  1F3A A;  3H8Q A;  3GN3 A;  5IMV A;  2DIY A;  2YWO A;  5D73 A;  5B7C A;  2MBT A;  1VF2 A;  4H86 A;  1USB A;  5CRW A;  5ECO B;  2FA4 A;  2IMD A;  3A5W A;  5G2Z A;  5H5R A;  4GCI A;  1JZW A;  4Q5Q A;  1X0R A;  1AQW A;  1M2A A;  2F9S A;  2FLS A;  4E8E A;  3A2V A;  4OCF A;  2D2Z A;  2C3Q A;  4MH3 A;  3GKK A;  2WUL A;  6GSV A;  1O73 A;  2MMN A;  1WMJ A;  2B5Y A;  1DSB A;  2R5G A;  1AIU A;  1MTC A;  1R5P A;  2WSE J;  1V58 A;  2J9H A;  3PIN A;  3GX8 A;  1SKW B;  4NXI A;  4QL9 A;  1V2A A;  1XZO A;  2XPD A;  3TJF A;  2V6K A;  3ED3 A;  4PUA A;  1K0B A;  2HRF A;  3CSJ A;  1NHO A;  4I7Z B;  1BYE A;  2MMZ A;  1GTU A;  3VPT A;  1UC7 A;  1M9A A;  4JZQ A;  3HVX A;  4Z7X A;  2WB9 A;  2FYN C;  1PMT A;  2X8H A;  3DRN A;  4KUN A;  5C00 A;  3ZIT A;  4H13 B;  1EWX A;  3CTG A;  2GVP A;  4EVM A;  1TOF A;  3HHV A;  2LS5 A;  3IR4 A;  5CO3 A;  4HQZ A;  2E2G A;  3VI5 A;  5F8B A;  1XW5 A;  2FCH A;  1X9W B;  4K0G A;  1G0T A;  4NPB A;  1K3L A;  5KN1 A;  3GKX A;  4L0W A;  2GST A;  2IIY A;  5KKZ C;  4MDC A;  1Q98 A;  1FVJ A;  4OGQ B;  2RUF A;  1ZMA A;  4V2M A;  4OFT A;  2MBS A;  1FOV A;  5ECQ B;  4HU7 A;  1OE7 A;  2YJ7 A;  3M0F A;  5KN0 A;  2VCV A;  5LNK e;  4ZIJ A;  1TXX A;  1G6Y A;  1XWC A;  2IL3 A;  2LRT A;  2I81 A;  2F3M A;  3CMI A;  1EOG A;  5IMC A;  1X9M B;  5KLI C;  5KEJ A;  1QFN A;  2IMK A;  1FVK A;  4X1U A;  17GS A;  4GRF A;  2DJ3 A;  3UAR A;  2VCZ A;  4Q5R A;  2B3S A;  1K0A A;  4DSQ A;  2LNT A;  3P90 A;  4CW9 A;  5ID2 A;  4K6X A;  2C0E A;  2OKA A;  1B4P A;  5D9V A;  4GWR A;  5A5K A;  1TK5 B;  1DUG A;  4I97 A;  2H19 A;  4J56 E;  3M8N A;  3HD5 A;  5F06 A;  3NIV A;  5G5F A;  4HUA A;  4XTS A;  1DBY A;  4IQA A;  4MF7 A;  2N5A A;  4Y28 J;  3KH7 A;  2KHP A;  3GX0 A;  4G2E A;  2HSH A;  1GH2 A;  2P31 A;  2PER A;  5AIX A;  4MA9 A;  2H1B A;  2H0G A;  3VWU A;  2HZE B;  4HQS A;  1THX A;  1JB0 J;  4KAE A;  1U88 A;  1O8X A;  3UBK A;  1URM A;  2PN8 A;  1T3B A;  4ECI A;  1ERT A;  5EPF A;  1VGL A;  4PQH A;  2G0F A;  2L6D A;  4AJ6 A;  1TW9 A;  1XWB A;  3IAS 2;  1W4V A;  2GQL A;  2RM6 A;  6GSS A;  3HKR A;  1GRX A;  2H0H A;  6GSY A;  3DIE A;  2IJY A;  2V6O A;  2N5F A;  4POK A;  4ZBA A;  3FZA A;  3GH9 A;  1O6J A;  3HCZ A;  3LEF A;  2CZ3 A;  3IA1 A;  3FZ4 A;  4POM A;  4EKZ A;  4WBJ A;  3FRC A;  3GTU A;  3VUR A;  1TU8 A;  1ZZY A;  2GGT A;  4H44 B;  2TRC P;  4KB3 A;  1A24 A;  2BMX A;  1JFU A;  1SYX A;  3GH6 A;  1QK8 A;  2A2S A;  5IOW A;  1Y6E A;  1HYU A;  5IO2 A;  4KND A;  3ZVJ A;  1ERV A;  3L9S A;  3QDN A;  5AN1 A;  1XWG A;  2GTU A;  3VWX A;  4YH2 A;  1SL2 B;  1S5L X;  5JWR B;  1WIK A;  1AXD A;  4OCE A;  1N2A A;  1O85 A;  3HJM A;  4NMU A;  3C73 A;  2JSZ A;  3D6I A;  3FHK A;  4KDX A;  3ZMK A;  4Q5N A;  5CP1 A;  18GS A;  5B6N A;  4PXO A;  3IHQ A;  2VCX A;  3H4K A;  1GSE A;  1O81 A;  5HR1 A;  4L5O A;  2FHE A;  4O7H A;  4PQ1 A;  1F9M A;  1EEM A;  1V9W A;  4KCA A;  3BJ5 A;  1GSS A;  3D22 A;  5AIS A;  1OC9 A;  2WCI A;  1G6W A;  1OC8 A;  5EL8 A;  4BVY A;  4L5L A;  4ZXG A;  1NM3 A;  4K0N A;  5DJM A;  5IMA A;  1SKS B;  1ZRT E;  3TKS A;  4OO5 A;  2HNL A;  1RW1 A;  3A3T A;  4EF0 A;  2BJX A;  3Q18 A;  2VCW A;  2HSY A;  4ZB8 A;  2N5B A;  2GSR A;  1SD8 A;  3LYP A;  3O3T A;  4WXT A;  2NTO A;  2E74 B;  3UVH A;  1U87 A;  3GYK A;  2YZH A;  2IPA A;  5JWO B;  1SK2 A;  2R37 A;  2VAF A;  3UJ1 A;  3TKQ A;  2I1U A;  3EU4 A;  2QJK C;  5L71 A;  3GIX A;  3ZVJ D;  2B6M A;  2FNO A;  3KJY A;  2NPB A;  1PL1 A;  2P5Q A;  3M9K A;  4MJA A;  2HT9 A;  5LCZ A;  2E0Q A;  3DKS A;  3LXZ A;  3EWL A;  1EV4 A;  5J5N A;  5HR2 A;  5D9T A;  1ILO A;  4TXO B;  2HFD A;  1A8L A;  11GS A;  3BBY A;  1R26 A;  3U5R E;  5B8B A;  1TI1 A;  4K1F A;  4KDY A;  4HZ4 A;  1SK0 A;  1TRW A;  4WR4 A;  5J9B A;  1K0M A;  1W89 A;  4MJB A;  3ZML A;  4EDZ A;  3K8N A;  4MZC A;  5IQY A;  2WFC A;  3KMO A;  2HE3 A;  2L4C A;  1R7H A;  1EZK A;  2VD0 A;  1XXU A;  5HFG A;  2PVO C;  4FIW A;  1RK4 A;  1T1V A;  2WRT A;  4MJC A;  1GSQ A;  3MSZ A;  3OR5 A;  1A23 A;  3ZLP A;  1EGR A;  2H70 A;  1TTZ A;  2XHF A;  2DBC A;  2VUP A;  5H5Q A;  1FHE A;  1Z5Y E;  1HQO A;  4MPF A;  3FK8 A;  3QAV A;  1ML6 A;  2HYX A;  1YJ6 A;  1Z6M A;  4IP6 A;  2QGV A;  3H1N A;  7GSS A;  2VL2 A;  2C0G A;  3C71 A;  4TXO A;  2C80 A;  5CRD A;  1MD3 A;  1OC3 A;  1SK1 A;  4F0C A;  5IM9 A;  3VK9 A;  1PSQ A;  4HI7 A;  2R3X A;  2I3Y A;  3ERW A;  3TJB A;  5KN2 A;  4BL7 A;  5D9W A;  1U6T A;  3PH9 A;  2H01 A;  3SBC A;  2YWM A;  3KM6 A;  5JWQ B;  3I43 A;  2RUE A;  4YAP A;  1B9Y C;  4IBP A;  4HZ2 A;  4RI7 A;  2YAN A;  3P2A A;  1PKZ A;  2ON5 A;  1MEK A;  3L0H A;  1TJD A;  3HZ4 A;  1EGO A;  3Q6O A;  4N0V A;  1A0R P;  4X0X A;  1TK8 B;  4XS4 B;  2LQO A;  3QAG A;  1V98 A;  4PV1 B;  3TUE A;  2JZS A;  1GUM A;  2CX4 A;  1UN2 A;  5LD0 A;  1NW2 A;  5GST A;  2DJJ A;  2GSQ A;  2OA7 A;  3MDK A;  2KUC A;  4XS4 A;  4NV5 A;  2AB6 A;  2LKU A;  5DAK A;  1XW6 A;  1HNB A;  3FEU A;  3GRX A;  2QJP C;  2QC7 A;  2IMF A;  4CHS A;  2LQQ A;  3GA4 A;  5DVB A;  2CZ2 A;  3TOU A;  4AGS A;  5J41 A;  2C3N A;  5ID2 B;  4F0B A;  3E3E A;  1JHB A;  4PNF A;  3LJR A;  3ME8 A;  2GT6 A;  5JCU A;  3IPZ A;  3UEM A;  1Z6N A;  5INY A;  3P8W A;  2DC5 A;  1QGV A;  2PVQ A;  4LL1 B;  4N10 A;  3WYW A;  1KBN A;  4ML6 A;  1SJI A;  3IAM 2;  5IMZ A;  2CA8 A;  3QFB C;  1QMV A;  3C1S A;  1T7P B;  1U3A A;  2YP6 A;  3RHB A;  2H0I A;  4F82 A;  4BPY A;  1ACV A;  3RDW A;  5JCW A;  3BCI A;  3IDV A;  4ECB A;  2C3T A;  1PD2 1;  1YKA A;  1FB0 A;  1FW1 A;  3F4R A;  4JR4 A;  3KXO A;  3LQ7 A;  2H1G A;  2K9F A;  2LJK A;  2P5R A;  2R2J A;  2O7K A;  3CRT A;  4MK3 A;  1MDK A;  4KCE A;  1AUC A;  1SYR A;  5D8I A;  2JAC A;  3VWW A;  1TKD B;  1WJK A;  3LG6 A;  5ENU A;  1XVQ A;  5IPH A;  4H0L B;  4XS6 A;  1GSY A;  4ZBD A;  4PNG A;  2M46 A;  2HRN A;  3KTB A;  2FD3 A;  4KGI A;  5IMD A;  2M80 A;  4EDY A;  2LV3 A;  1K0O A;  3IK9 A;  2DML A;  1TRU A;  2DLX A;  1WRY A;  3GMF A;  2LEG A;  3KGK A;  3TCO A;  1ZYQ B;  3UBL A;  1S3D A;  2QKE A;  1B4Q A;  3MAK A;  2V41 A;  1B8X A;  2RLI A;  5FT3 A;  4IJI A;  6GST A;  3EIN A;  1XIY A;  3KH9 A;  4XCS A;  1VF5 B;  1FO5 A;  4GQC A;  1T4Z A;  3TRX A;  3ISO A;  5AGY A;  4TR1 B;  2VO4 A;  2WZ9 A;  3GKM A;  2BTO T;  4MCU A;  3A2W A;  1A0F A;  4KH7 A;  3ZTL A;  4HU9 A;  1TK0 B;  1S3A A;  3EE2 A;  1N8J A;  4YQM A;  3ME7 A;  3TJJ A;  1WP0 A;  4BA7 A;  3J7Y b;  10GS A;  1BAY A;  5DCH A;  2WSF J;  3V1W A;  1TDI A;  2O8V B;  1LU4 A;  3UIW A;  4DVC A;  2TIR A;  3F9U A;  4RKU J;  4TKY A;  5IIZ A;  4V2L A;  3IV4 A;  3LGC A;  2LRC A;  1ABA A;  2YV7 A;  3E9J B;  2ZCT A;  6GSW A;  1ZCP A;  5CNW A;  1XWA A;  3GST A;  5ECN B;  3G7J A;  1TRV A;  2AV4 A;  3F6F A;  3C8V A;  3FZ9 A;  1KEB A;  1OAZ A;  2YCD A;  2YJH A;  4HJ2 A;  1X9S B;  2LTK A;  4GLT A;  3KZQ A;  4K2D A;  3RHC A;  1GP1 A;  1M7T A;  3G7Y A;  1OC9 B;  1SKR B;  2B7K A;  4XHM A;  2REM A;  20GS A;  5D96 A;  4TXV A;  4FYC A;  4LMV A;  5HFI A;  1FG4 A;  4IP1 A;  3ZL5 A;  2X8G A;  1XWK A;  1SD9 A;  2H30 A;  2H1A A;  4FYU A;  1GLP A;  4TR4 A;  1XBS A;  2OJL A;  1GSF A;  3LW5 J;  1AC1 A;  4IEL A;  4K7I A;  4MF6 A;  2M72 A;  1SJZ A;  2IFQ B;  1JLW A;  3FKF A;  3NOF A;  4MF5 A;  3GFK A;  1T4Y A;  3M1G A;  4HJM A;  4YQV A;  4ZBB A;  1M9B A;  4TOP A;  1O8W A;  1M0U A;  4F9Z A;  2HZF A;  4MZB A;  3G7I A;  1VF1 A;  4JE1 A;  2HLS A;  8GSS A;  4ECC A;  3EC3 A;  3LSZ A;  3UMA A;  5ECL B;  1GNE A;  5C04 A;  2J23 A;  2KP2 A;  3F4S A;  3KIJ A;  1Q90 D;  1A8Y A;  2VCQ A;  1IYI A;  3I69 A;  5IOX A;  4LA1 A;  1G7O A;  5DQS A;  3KP8 A;  3L9U A;  3BD2 A;  2DIZ A;  2H71 A;  3S9F A;  3TKS C;  2CVB A;  4GSN A;  4BWS A;  3QD9 A;  3QCP A;  2WSC J;  1U3I A;  2H8L A;  2EIQ A;  2FUG 2;  1JZO A;  2EIO A;  4ILF A;  2CQ9 A;  3D4M A;  1PGT A;  3TGZ A;  1J0F A;  2L59 A;  5EY6 A;  2GZZ A;  5IMF A;  3UVT A;  1K0D A;  2CVK A;  3D4T A;  1V40 A;  1X5C A;  3FW2 A;  4AF2 A;  1AQX A;  5A4V A;  1DE2 A;  4ZB6 A;  2CX3 A;  3RPN A;  4L0U A;  4I2U A;  3ZIV A;  16GS A;  1ERW A;  2A4V A;  2HXK A;  3LYK A;  1A2L A;  5D9X A;  5ABR A;  4KA0 A;  4GXZ A;  5HR3 A;  1GSD A;  1GTA A;  1XFL A;  4IN0 A;  2L57 A;  2WS2 A;  13GS A;  5A4U A;  2K9Y A;  2AJQ B;  5IPG A;  4J57 E;  1ERU A;  3O76 A;  1PN9 A;  3A2X A;  2C0F A;  5ECH B;  4ZIL A;  5KN3 A;  1B48 A;  3ZRE A;  1GWC A;  4MP4 A;  1H4O A;  1GSU A;  4LMW A;  3TB2 A;  2GZY A;  6GSX A;  5J3R A;  1F37 A;  3J7Y k;  1PL2 A;  3FYG A;  3TOT A;  1AW9 A;  3APO A;  3O6T A;  3L9V A;  3P7X A;  2I9H A;  1PX7 A;  1E2Y A;  5AIV A;  4IQ1 A;  3I9V 2;  3CSH A;  2XBI A;  2FY6 A;  1GL8 A;  3KEB A;  1X5D A;  3Q74 A;  1AQV A;  3HVV A;  4NWY A;  1YKC A;  2XC2 A;  1R4W A;  4FH8 A;  4I8B A;  1YF0 A;  4XRA A;  3W6G A;  5HR0 A;  2R4V A;  2H76 A;  3CSI A;  1YDK A;  2V32 A;  4J2F A;  3D5J A;  14GS A;  5DAK B;  3FR6 A;  4PQI A;  1LBK A;  3D0Z A;  1XVW A;  2LUS A;  2LJR A;  4GSS A;  4BVX A;  2Z9S A;  1H75 A;  4N11 A;  1YY7 A;  1WWJ A;  1XPV A;  4DSS A;  2FWE A;  2C4J A;  5HQP A;  2ZT9 B;  3TKS E;  2X99 A;  1YF1 A;  2JAD A;  2A2R A;  4EO3 A;  5DBQ A;  3TRP A;  3GL3 A;  4IGJ A;  4JED A;  1OYJ A;  3W8S A;  2E2M A;  3RPP A;  4IJ3 A;  3US3 A;  2H1D A;  1IYH A;  3HYP A;  3L78 A;  3DGQ A;  4OFM A;  3F4T A;  3DML A;  4CDO A;  1K0C A;  4OMV A;  1EV9 A;  3FY7 A;  4IS0 A;  2FA8 A;  3VPQ A;  5G31 A;  1XOB A;  4EUY A;  2ES7 A;  2QJY C;  4L8E A;  4G19 A;  4D73 A;  2AYT A;  1VF3 A;  4HDE A;  1WE0 A;  4V1A g;  3AY8 A;  5G1L A;  2B5E A;  1EOH A;  3ZFB A;  4I5Q A;  1K3O A;  4BWQ A;  2DJ1 A;  1FAA A;  1SEN A;  3GHA A;  3LXT A;  4LL4 B;  1EEJ A;  1QUW A;  2RII A;  2GSS A;  4KX4 A;  2B1L A;  1KNG A;  2K8S A;  3MNG A;  3EUR A;  1T00 A;  2C1Y A;  3IK7 A;  3L4N A;  2QSI A;  4GF0 A;  4K7O A;  2X8C A;  4HEA 2;  2AUV A;  1THO A;  3C7M A;  3JCM L;  5GZZ B;  5ELG A;  1M99 A;  4ZL9 A;  4GST A;  4NHZ A;  4KSM A;  1GTB A;  1BX9 A;  2B7J A;  3TJG A;  4LLR A;  3W8J A;  1XCC A;  1FB6 A;  4JBB A;  3PR8 A;  3U6V A;  4YAV A;  2CVD A;  4V2N A;  3IXR A;  2MMA A;  2DJK A;  2L5O A;  2AAW A;  3GSS A;  4TRX A;  2IME A;  2IMI A;  2H74 A;  1GTI A;  2JU5 A;  2EIR A;  5ECK B;  5ECS A;  2YZU A;  1MDI A;  22GS A;  4RI6 A;  2ON7 A;  4WR5 A;  1JLV A;  5F0G A;  3GTU B;  2LNS A;  4YQU A;  2H75 A;  3ERF A;  2DMM A;  2QIW A;  2K6V A;  1KTE A;  1C72 A;  3TJK A;  1ZGN A;  3F0I A;  1M2B A;  2TRX A;  4QL7 A;  3F6D A;  3IRA A;  2YWI A;  5E4W A;  3N9J A;  1GLQ A;  4IL6 X;  3FZ5 A;  1QXH A;  3ZIJ A;  2CAI A;  1GUL A;  3APS A;  2B1K A;  3GUS A;  5A4W A;  1GNW A;  4RUV A;  1MD4 A;  1K0N A;  3APQ A;  4KE3 A;  1PKW A;  4N30 A;  5CRG A;  3IBH A;  3C8E A;  3CRU A;  3H93 A;  3WT2 A;  2KOK A;  1PA3 A;  2VM2 A;  1YQ1 A;  1OKD A;  2G2Q A;  3WGX A;  1Z7R A;  3F3Q A;  4KW6 A;  4AJ7 A;  2YPM A;  1YEX A;  5GAP D;  2O87 A;  2LRN A;  1DE1 A;  2E75 B;  4PGT A;  5ECP B;  2O01 J;  3QFA C;  4ACS A;  4FO5 A;  4WF5 A;  2L5L A;  3TRQ A;  2K8V A;  4KSO A;  3UAP A;  2GT5 A;  2WPV B;  4I6X A;  1SL1 B;  1Q4J A;  2E7P A;  2YN1 A;  1EP7 A;  1J9B A;  1TI3 A;  2PWJ A;  3F8U A;  1XOA A;  2FWG A;  1M2D A;  1JZR A;  5GSS A;  3HJP A;  4JR6 A;  4DSS B;  1F6M C;  2FWH A;  4ISD A;  2NBS A;  2HI7 A;  2WGR A;  4OWY A;  1VRS D;  4PUF C;  2L4Q A;  4MZW A;  3HVS A;  1JZD A;  4OD7 A;  5G30 A;  2EC4 A;  3RBT A;  1AAZ A;  4NAX A;  2WDU A;  4OO4 A;  4WEY A;  2VIM A;  3E0U A;  1R5A A;  3QMX A;  1GUK A;  1O7U A;  3CYN A;  2LJA A;  1OE8 A;  2OAD A;  1MDJ A;  1ZL9 A;  2B5X A;  4HS1 A;  1QQ2 A;  3VFI A;  3BOA A;  2C8U A;  1F3B A;  3UL3 A;  3CTF A;  9GSS A;  4D73 B;  2JL4 A;  1TP9 A;  3FR3 A;  3F63 A;  3TDG A;  4IVF A;  2ALB A;  3CBU A;  4FYB A;  2IFQ A;  2GS3 A;  2VL3 A;  4Q5F A;  3ERG A;  3IE3 A;  4TR3 A;  2YOI A;  1Z9H A;  5CAX A;  2KLX A;  5DAL B;  3TKP A;  3VWV A;  1V57 A;  3KD0 A;  2D2C B;  4ZL8 A;  3Q19 A;  2KP1 A;  3GNJ A;  4O32 A;  2GDR A;  1YEP A;  4XS1 A;  4ECJ A;  2FGX A;  3VLN A;  5FHI A;  5ECM B;  4IKH A;  2H6Y A;  2H72 A;  4IW9 A;  19GS A;  2K18 A;  1WOU A;  5DQY A;  3ZYW A;  2GZP A;  2VOC A;  2X64 A;  4ID0 A;  4DEJ A;  2XBQ A;  3HA9 A;  3WGE A;  3DWV A;  4F03 A;  3EYT A;  1HNA A;  2OE0 A;  4AJ8 A;  3MWH A;  4WKW A;  4K8M A;  1G7E A;  1A2J A;  2JZT A;  2VLU A;  4GQF A;  3HXS A;  1K3Y A;  3C1R A;  1E6B A;  2YNX A;  3M3M A;  5G1K A;  4G9H A;  1SL0 B;  3KP9 A;  5GAN D;  1UVZ A;  5ECR B;  4EL1 A;  4I2T A;  1I9D A;  2IN3 A;  1XW9 A;  3N5O A;  1NSW A;  3QOU A;  4O5R A;  1F2E A;  2GQK A;  4EC0 A;  2JZR A;  3WGD A;  4O92 A;  4K7N A;  1PX6 A;  3DYR A;  3UOM A;  5COH A;  3GL5 A;  1Z7P A;  1YZX A;  4KDU A;  4EE0 A;  2VM1 A;  2RM5 A;  2ZNM A;  4MAB A;  3EMX A;  2VLT A;  4IHU A;  2VD1 A;  4TW5 A;  3PGT A;  2MMO A;  2VCT A;  4TR1 A;  1I5G A;  3DVX A;  4MMM A;  2LST A;  4K9Z A;  4MPG A;  2PBJ A;  1UA5 A;  2ZUP A;  5HFK A;  2MYG A;  3H79 A;  4NHW A;  4V1A p;  1X5E A;  2AHE A;  3RAZ A;  2H73 A;  5ECI B;  3G9B A;  4DSR A;  5G5E A;  3KTL A;  5CRH A;  1Z3E A;  3ZFL A;  2MZC A;  2YIU C;  3HDC A;  5EVO A;  2I4A A;  3LFL A;  1PQN A;  3KCM A;  2NDO A;  4OFN A;  3DEX A;  4RQX A;  4WET A;  4MH2 A;  2HZE A;  1ON4 A;  4QQ7 A;  4PUR A;  2PGT A;  5B8A A;  5DDL A;  3DVW A;  5F05 A;  3R2Q A;  4E8H A;  5FWG A;  5B6M A;  2WJU A;  2VL2 C;  5ELA A;  2OAC A;  2O89 A;  4MLY A;  1OKT A;  3HJO A;  4MJE A;  4ZB9 A;  3EU3 A;  5CYY A;  1OVN A;  4GTU A;  3GUR A;  3LWA A;  4POL A;  1BG5 A;  4PX1 A;  6GSU A;  5JCG A;  4EXJ A;  2CAQ A;  1A2M A;  4TVE A;  2OE1 A;  5IO0 A;  1PRX A;  3VI7 A;  1BJX A;  3EMP A;  1EP8 A;  3QR6 A;  1TU7 A;  2CV4 A;  2JSY A;  3BCK A;  3ZZX A;  3HZ8 A;  1ZOF A;  4TR0 A;  2CT6 A;  3SWL A;  5J4U A;  1ZYE A;  2OBI A;  5J9C A; 
#chains in the Genus database with same CATH topology
 1VQ9 P;  1CQH A;  3EVI A;  4C46 A;  2DJ0 A;  3IOS A;  2K9J B;  2W6A A;  1B9X C;  3H6P A;  12GS A;  2FFD B;  3AE4 C;  1BED A;  2GQM A;  4WBR D;  2WZ7 A;  4POB A;  4HOJ A;  1FOH A;  3PP5 A;  4KT0 J;  4RQR A;  4P3Y B;  1PP9 E;  2KS1 B;  1BDD A;  3V2N A;  2VLV A;  3D21 A;  2H66 A;  5F07 A;  4ZKP A;  2F8A A;  4HJG H;  4WB4 A;  2IYP A;  2NVL A;  1PL5 A;  2H6Z A;  1D7M A;  3DD3 A;  2QA1 A;  3FR9 A;  3F3R A;  4TN8 A;  5L8R J;  5D93 A;  3HY2 A;  2H6X A;  4BRY A;  1N86 A;  1BQ7 A;  4WWI A;  2R6K A;  4Z2T A;  1CI6 A;  5H5S A;  5DJL A;  4ZL7 A;  5CRE A;  2C0W A;  1J08 A;  2IWT A;  1S3J A;  1LJR A;  2M0B A;  3NZN A;  2P58 A;  2DSA A;  1VF4 A;  4ML1 A;  1BCC D;  3L36 A;  5BU5 A;  2AEM A;  4NPF X;  5DCG A;  3IAO A;  2XPE A;  3WD6 A;  2PU9 C;  4EOT A;  3IC8 A;  1PFI A;  4OVN F;  3GKN A;  2C0D A;  4ULX A;  2YV9 A;  1Q86 Q;  1KIL E;  1MFZ A;  2F8F A;  1Y25 A;  3KMN A;  3ITK A;  1PGQ A;  1NAF A;  1SU9 A;  2PPT A;  3CPW O;  4XRD A;  4JU5 A;  1HVV A;  3KXD A;  1S3C A;  3I6A A;  1SQP D;  3CXG A;  3DXB A;  3LOR A;  2HR3 A;  2BCC J;  3M9Q A;  1KYO H;  2PMT A;  2IFN A;  1NHY A;  2GLR A;  1YJ9 P;  2ZYA A;  2PUK C;  3G9R A;  1WPI A;  1RQM A;  1H0T A;  2L6C A;  4N0Z A;  1HD2 A;  3S4R A;  1GUH A;  2V1M A;  1JY2 P;  3IC4 A;  4LC1 A;  2DJ2 A;  3TKR A;  4WF4 A;  2V2G A;  1SQV K;  2OBK A;  3M9J A;  4G10 A;  3RL0 C;  1SJ6 A;  2F51 A;  2HG5 D;  2JP3 A;  3P7K A;  3AED C;  2WTY A;  1ST9 A;  2R32 A;  3HE5 B;  4DJG A;  4F2I A;  1CQG A;  1DEB A;  1PGP A;  4UB8 H;  3QPM A;  1HNC A;  5APT A;  3CXH H;  1T8E B;  5E59 A;  4NV2 A;  4X43 A;  3ZRD A;  3FWL A;  2ZT9 D;  2VL9 A;  4XIH A;  5DAL A;  4JRR A;  4I2L C;  3QAW A;  1LTJ C;  2OE3 A;  4EYY Q;  2FWF A;  2YWN A;  2O85 A;  2E76 B;  3WT1 A;  1NU1 E;  2P1J A;  4L76 A;  5CBN A;  5E79 E;  2P0G A;  1LGH B;  1X8Y A;  1GMJ A;  2W27 A;  3GV1 A;  2B9B A;  1TRS A;  5AW0 B;  3L70 E;  1F3A A;  1EQ7 A;  1JTH A;  1VF5 C;  3H8Q A;  1N7S D;  2B89 A;  3FGA D;  3GN3 A;  5IMV A;  2DIY A;  2YWO A;  5D73 A;  1IFJ A;  5B7C A;  2MBT A;  2A2P A;  5CJ4 A;  1VF2 A;  3WMM 0;  4H86 A;  1USB A;  5CRW A;  2UZ8 A;  5ECO B;  2FA4 A;  2IMD A;  3CL3 D;  3A5W A;  1SQP E;  1OMI A;  1S72 P;  3H25 A;  5G2Z A;  5H5R A;  4G0K A;  4GCI A;  1JZW A;  4Q5Q A;  1X0R A;  1AQW A;  4YXW H;  1M2A A;  2F9S A;  2FLS A;  3BAS A;  3KDP B;  2H89 C;  4E8E A;  1ZR2 A;  3A3Y B;  3A2V A;  1EZV D;  4OCF A;  2D2Z A;  2C3Q A;  3PJS K;  4MH3 A;  3LID A;  3GKK A;  1ZRT D;  2WUL A;  6GSV A;  1O73 A;  2MMN A;  3MIX A;  1WMJ A;  2B5Y A;  3FX0 A;  1DSB A;  2R5G A;  1AIU A;  1MTC A;  1R5P A;  2OYH C;  3L71 E;  2WQY C;  2QRX A;  2WSE J;  3B8E B;  1V58 A;  2J9H A;  1L0L D;  3PIN A;  3GX8 A;  1FAV A;  1SKW B;  1LJ2 A;  1OWA A;  4NXI A;  5CCG D;  4PD4 H;  4QL9 A;  1V2A A;  1XZO A;  2XPD A;  3TJF A;  1OFC X;  4TLF A;  2V6K A;  5AVZ B;  3VP9 A;  3ED3 A;  4PUA A;  2I1K A;  1K0B A;  2HRF A;  3CSJ A;  3MYD A;  1NU1 D;  2HPC B;  1NHO A;  4I7Z B;  1BYE A;  2BCC E;  2MMZ A;  1QEX A;  3L75 E;  3Q1M A;  1GTU A;  3VPT A;  5DJT B;  2FY8 A;  1UC7 A;  5GTH H;  1M9A A;  4JZQ A;  1KD1 Q;  3HVX A;  4Z7X A;  1NGM B;  2WB9 A;  2FYN C;  1PMT A;  2X8H A;  3AE6 C;  3DRN A;  4KUN A;  5C00 A;  3ZIT A;  4H13 B;  3MTU E;  1Q7Y Q;  1EWX A;  3CTG A;  2GVP A;  4I1L A;  3R4Y A;  4EVM A;  5CBO A;  1NTZ G;  1TOF A;  5AW8 B;  2KNC B;  3HHV A;  1Q81 Q;  2LS5 A;  3II6 A;  1ZV8 A;  1VQL P;  3IR4 A;  5CO3 A;  4EIQ A;  1YYC A;  4GT1 A;  3I56 P;  4HQZ A;  2E2G A;  3VMY A;  3VI5 A;  3RK3 E;  5F8B A;  3NXS A;  1XW5 A;  2FCH A;  4I7Z C;  1X9W B;  3USS A;  4K0G A;  1G0T A;  4NPB A;  1K3L A;  1N7S A;  3GHG A;  5KN1 A;  3GKX A;  4L0W A;  3V2P A;  2GST A;  2IIY A;  5KKZ C;  4UB8 E;  3B5N A;  4MDC A;  2POH A;  2A45 H;  1Q98 A;  1VQO P;  1FVJ A;  4OGQ B;  2RUF A;  1L0N K;  1ZMA A;  4V2M A;  1NTK K;  3JC2 2;  2OYI A;  1NAY A;  1NU1 J;  4OFT A;  2MBS A;  1FOV A;  1HTL C;  5B66 H;  1T3J A;  3WUV A;  5ECQ B;  1KQS O;  1OE7 A;  4HU7 A;  3L72 G;  2YJ7 A;  5KJ7 C;  2DKH A;  1G1J A;  3M0F A;  4CY8 A;  1L0N E;  1M1J A;  3H1K G;  5KN0 A;  3Q5S A;  1ZME C;  1SVF A;  3OJA B;  1SQQ E;  4YKG A;  3CWB D;  2VCV A;  1LWU B;  5LNK e;  1RF1 C;  4ZIJ A;  4XE5 B;  3IN6 A;  1TXX A;  1G6Y A;  1XWC A;  2IL3 A;  2LRT A;  2I81 A;  2F3M A;  3CMI A;  2QVA A;  1EOG A;  5IMC A;  1X9M B;  5KLI C;  5KEJ A;  5BU8 B;  1QFN A;  2IMK A;  2KIK A;  1FVK A;  4X1U A;  17GS A;  5AVV B;  1M8O B;  2KS1 A;  2CPB A;  2O1K A;  2DJ3 A;  4GRF A;  1RF0 A;  5KAI H;  3UAR A;  2VCZ A;  4Q5R A;  1ZW0 A;  1ZN5 A;  3CCE P;  2KXP B;  2B3S A;  1K0A A;  3CWB G;  4DSQ A;  1JO5 A;  1R5S A;  2LNT A;  3P90 A;  4CW9 A;  5ID2 A;  3HE4 B;  4K6X A;  2C0E A;  2OKA A;  1B4P A;  5D9V A;  1GU4 A;  1OVU A;  4GWR A;  5A5K A;  2Z5I A;  1JUN A;  1TK5 B;  1DUG A;  1KB9 I;  1W5C E;  4I97 A;  3RL0 D;  2H19 A;  1XG8 A;  1AV1 A;  2BCC G;  4J56 E;  2ZVO B;  4BXL A;  3B5N D;  3M8N A;  3HD5 A;  5F06 A;  2HLO A;  3NIV A;  5G5F A;  4HUA A;  4XTS A;  3M0D C;  1DBY A;  4IQA A;  1JY3 N;  2Y0E A;  4MF7 A;  5AVY B;  2N5A A;  4Y28 J;  1NH4 A;  3KH7 A;  2KHP A;  3GX0 A;  3WUU A;  1Q82 Q;  4G2E A;  2HSH A;  1GH2 A;  5CCH A;  3BCC E;  3TYY A;  1H89 A;  2P31 A;  2PER A;  5AIX A;  4MA9 A;  4H44 D;  1SQQ J;  1IFP A;  4WY4 B;  2H1B A;  2H0G A;  3VWU A;  2X4A A;  3AEE C;  2HZE B;  1QLE D;  4HQS A;  1THX A;  3C9I A;  1VF5 D;  1JB0 J;  2N1T A;  4WVZ A;  3H1J E;  4KAE A;  5KOW A;  1U88 A;  1EDL A;  4PV1 C;  1O8X A;  3UBK A;  1KQG B;  3PHL A;  1URM A;  1FZB A;  4WY4 C;  5AW6 B;  2PN8 A;  1T3B A;  4ECI A;  1VQ6 P;  1OX3 A;  1ERT A;  5EPF A;  3L70 G;  1VGL A;  4PQH A;  2G0F A;  2L6D A;  4AJ6 A;  1TW9 A;  1XWB A;  3IAS 2;  1LTJ B;  2WIT A;  1W4V A;  2GQL A;  2OYO A;  1URQ C;  2RM6 A;  6GSS A;  3HKR A;  3BRV B;  3BCC J;  1GRX A;  1LWU C;  3E1I A;  2H0H A;  6GSY A;  3DIE A;  1JMB A;  1FDO A;  1SQP G;  2ZFC A;  2IJY A;  4Z2U A;  1T3U A;  4EIJ A;  2V6O A;  1OW7 A;  2ZXX A;  2N5F A;  4POK A;  3MGN A;  1HH0 A;  2R0G A;  2Q6Q A;  2XZR A;  4PJ0 E;  1GZL A;  3HUS A;  4ZBA A;  3L74 D;  3FZA A;  3GH9 A;  2YO3 A;  1O6J A;  3HCZ A;  3LEF A;  2FXO A;  1JEK A;  1NTK J;  2CZ3 A;  1ZXG A;  3IA1 A;  3FZ4 A;  4POM A;  1BCC G;  2CPS A;  3CX5 D;  4EKZ A;  1USD A;  4WBJ A;  1SQV E;  2FYU E;  3FRC A;  1QL2 A;  3GTU A;  1TU8 A;  3VUR A;  1ZZY A;  2GGT A;  3VTP C;  4H44 B;  2TRC P;  5BMU A;  1MKM A;  2FYU D;  4KB3 A;  2ZXE B;  1A24 A;  2BMX A;  2ZAE B;  1KTM A;  1JFU A;  5M1B A;  1PP9 D;  5APY A;  3CCQ P;  1SYX A;  3GH6 A;  1S9K D;  1QK8 A;  2A2S A;  5IOW A;  1HF9 A;  1HYU A;  5B5E E;  1Y6E A;  2R5B A;  4KND A;  5IO2 A;  3ZVJ A;  1ERV A;  4Z2R A;  3L9S A;  3QDN A;  5AN1 A;  1XWG A;  2M3E A;  2NPS B;  2GTU A;  3VWX A;  4YH2 A;  1SL2 B;  3V4W A;  1S5L X;  2YMY A;  5JWR B;  1WIK A;  1AXD A;  4OCE A;  2OTK E;  1N2A A;  1O85 A;  2FYU G;  3B5N B;  3P32 A;  3HJM A;  3Q2Y A;  2ZYG A;  4NMU A;  3C73 A;  3G71 P;  2JSZ A;  3D6I A;  3FHK A;  4B86 A;  4KDX A;  3ZMK A;  4Q5N A;  5CP1 A;  3BCC G;  5TIS E;  18GS A;  2H8P D;  4JF7 A;  4JYB A;  5B6N A;  2FYZ A;  4PXO A;  3IHQ A;  1NTZ E;  2VCX A;  3H4K A;  1GSE A;  3PRJ A;  1PPJ G;  2NZ2 A;  1O81 A;  1GL2 B;  5HR1 A;  4L5O A;  1VL2 A;  2FHE A;  4O7H A;  2G3A A;  4PQ1 A;  1T8Z A;  1F9M A;  2WSS H;  2P67 A;  1EEM A;  5C39 A;  1JCD A;  3D6Z A;  4JQ0 D;  1V9W A;  4KCA A;  4EI2 A;  3BJ5 A;  1YHQ P;  1GSS A;  3D22 A;  5TJH A;  5AIS A;  1OC9 A;  2OTL P;  2YKP A;  1BDC A;  2WCI A;  3ZDM A;  1G6W A;  4U3F E;  1OC8 A;  2YKQ A;  1FZA A;  1K8A Q;  5EL8 A;  3L35 A;  1FOS F;  4BVY A;  4L5L A;  4ZXG A;  1NM3 A;  3RBX A;  4K0N A;  5DJM A;  5IMA A;  3HD7 C;  1USE A;  2HYN A;  1SKS B;  1ZRT E;  2BEQ D;  3TKS A;  4OO5 A;  1N2D C;  1OW6 A;  2HNL A;  1M7L A;  1RW1 A;  3A3T A;  4EF0 A;  2KB7 P;  3H1I D;  1KIL B;  2BJX A;  3Q18 A;  3CCS P;  2VCW A;  2HSY A;  4ZB8 A;  3H1H J;  3CC4 P;  2N5B A;  4HB1 A;  2GSR A;  4WBA A;  5KTB A;  1SD8 A;  3RK2 C;  3LYP A;  3H1K E;  4OGQ D;  5CJ0 A;  2KZI A;  3O3T A;  1ZLL A;  4BVX B;  1U57 A;  1SQQ G;  3Q5P A;  4WXT A;  2NTO A;  2ZT9 C;  1R5L A;  2E74 B;  4N6J A;  1U87 A;  3UVH A;  3GYK A;  2YZH A;  4RO0 A;  2IPA A;  1RY3 A;  5JWO B;  3MHV A;  1SK2 A;  1BGY D;  4DCK A;  2R37 A;  2VAF A;  4D6T J;  1RF0 C;  3UJ1 A;  1NO4 A;  2N1T D;  2I8D A;  1SFC