2QSIA

Crystal structure of putative hydrogenase expression/formation protein hupg from rhodopseudomonas palustris cga009
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
PTLVDEATVDDFIAHSGKIVVLFFRGDAVRFPEAADLAVVLPELINAFPGRLVAAEVAAEAERGLMARFGVAVCPSLAVVQPERTLGVIAKIQDWSSYLAQIGAMLAEVDQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrogenase expression/formation protein hupG
publication title Structure of putative hydrogenase expression/formation protein hupG from Rhodopseudomonas palustris CGA009.
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
total genus 23
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07449 HyaE Hydrogenase-1 expression protein HyaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qsiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2qsiA01
3WT1A 4H0LB 1MDJA 2MBSA 4GQCA 1KEBA 1AXDA 1FB6A 2H1DA 3APSA 5F05A 1YEXA 5DALA 4Q5QA 3DXBA 2DIZA 3HDCA 1A0FA 5A5KA 4KSOA 2GLRA 4F9ZA 3GNJA 2L6DA 3EMXA 3KH9A 2DC5A 1T4YA 4ZL7A 4Q5RA 3UIWA 5IIZA 1UA5A 5GAPD 2FD3A 5ECLB 2XBQA 2M72A 22GSA 2WSEJ 3RDWA 3D4MA 1GTBA 5JCUA 4MPGA 3A2VA 4Z7XA 4TW5A 4XCSA 1PSQA 3FW2A 3FZ4A 5KLIC 3M9JA 2DSAA 3WD6A 5DCHA 3RPPA 4ZILA 3ZLPA 2DMMA 2RIIA 3ZMKA 3M3MA 4MF6A 2OBIA 3Q74A 1HNBA 3H79A 2L5LA 4F0CA 4FO5A 4AJ7A 4DSSA 1PX7A 1S3DA 6GSSA 4RI7A 4GTUA 3H8QA 3LGCA 2B6MA 3I9V2 3ZTLA 4IN0A 1GNWA 5L71A 3GHAA 3E9JB 1J9BA 2V6KA 1WRYA 3LYKA 4MMMA 4YQUA 1PKWA 4POMA 3H4KA 2F8AA 1XWKA 1AIUA 5G5FA 3APQA 1ZYEA 2IFQA 4V1Ag 5D9TA 2OE0A 2YCDA 1ERUA 3CBUA 4L8EA 4XIHA 2HSYA 4ZL8A 1V40A 4BWSA 3J7Yb 1EEMA 5IM9A 5IOXA 1XWBA 1M99A 2YIUC 3L78A 1SL1B 4PQ1A 4I2TA 3F6FA 2IN3A 5J9BA 3IDVA 1URMA 3UARA 2QC7A 3KXOA 2N5BA 3VLNA 3UL3A 3DIEA 2HXKA 3R2QA 1H75A 2X64A 4JR6A 3BOAA 2HRNA 2D2ZA 2GDRA 4RUVA 1FB0A 3DEXA 2FA8A 2LQOA 1G6WA 5ELAA 1VRSD 1T3BA 3NIVA 3F4SA 1SL2B 1EOGA 4MH3A 1Z7PA 4MJBA 1ZCPA 2CVKA 1R7HA 4N30A 2YANA 4AJ6A 1A23A 3WGDA 1GTUA 2PVOC 2PGTA 4Y28J 1MDKA 2VIMA 1O7UA 1PRXA 2I1UA 4QQ7A 1ZYQB 2CQ9A 3LG6A 4OFMA 4MJEA 1SYXA 3G7IA 2MMZA 3L9SA 1KBNA 1FHEA 1SD9A 2TRXA 2GSSA 1GSFA 1WWJA 3HHVA 2VLVA 2GQMA 2B1LA 5IMDA 1SL0B 2QJPC 2OE3A 2V2GA 4JRRA 2B3SA 2VD0A 5DBQA 3GN3A 4PXOA 5D9WA 3RHCA 3KD0A 3APOA 4MH2A 5CRHA 1WJKA 2EIOA 5G2ZA 1S3AA 4JR4A 5IPHA 1PQNA 3LORA 4OMVA 2H0GA 5A4UA 3VI7A 2WJUA 2WSFJ 4KCAA 3TCOA 3HVVA 4QL9A 4KB3A 3ERFA 4LMVA 4TR0A 4TOPA 3QAWA 1V98A 4GWRA 6GSWA 1T8EB 1XXUA 2VOCA 2VL3A 16GSA 1TOFA 4TKYA 3VWUA 4POBA 2K6VA 2P31A 1F37A 3NOFA 1U3IA 4RQXA 2AJQB 3IAS2 3FR6A 2YJHA 2QJYC 2FYNC 3D21A 3ME7A 2OKAA 5COHA 5ECNB 4BVYA 1SKSB 4MA9A 1AC1A 1VF4A 1B9YC 2VL2C 3UBLA 1XZOA 2YPMA 2L4CA 5ECQB 1DUGA 3LW5J 4DEJA 1M2AA 3GSSA 3ZRDA 4NV2A 4L0WA 3LXTA 1JZDA 1ACVA 2O8VB 1M9BA 5B6NA 1XW9A 2KP1A 5KKZC 4IQAA 3ZVJA 1GSDA 1SJ6A 2L59A 5IO2A 1Y25A 4WKWA 4DSSB 1SJIA 3TKRA 2P0GA 5C04A 1GSUA 2VM1A 5G5EA 4F2IA 5J41A 1U88A 1HQOA 4HJMA 3TRXA 1QMVA 4IHUA 1SKRB 1YZXA 3S9FA 2V41A 3VWVA 1GRXA 3A3TA 3C73A 4OFNA 4XRAA 3UJ1A 1ABAA 3CRTA 3LYPA 2ZNMA 3HY2A 4K7IA 2XPEA 1B4QA 4WEYA 2JADA 3QR6A 1XWAA 3DVWA 2VL9A 3FZ9A 3TOTA 6GSUA 1SENA 2PUKC 5DQYA 3UMAA 4FYBA 2PBJA 2HT9A 2JZRA 3M8NA 4KE3A 2GSRA 4ML1A 3ZFBA 4OO5A 2K9FA 5B7CA 3CMIA 1A2MA 1GUMA 1OE8A 2O87A 1NM3A 2YWOA 2VAFA 2R5GA 5EVOA 3IE3A 3TJKA 5KN2A 1RK4A 1E2YA 1I9DA 2BMXA 2R2JA 4P3YB 2X8HA 1BX9A 3M0FA 4IS0A 2FGXA 4HQSA 3VK9A 2YV9A 1GLPA 2GSQA 3TKSC 1K0OA 2GZZA 3HJPA 1T7PB 2QSIA 1SK0A 4HI7A 5KN0A 4BPYA 3ZL5A 2CT6A 1G0TA 1WIKA 1GH2A 3TJFA 4K1FA 3PH9A 3O76A 3GUSA 2FWFA 3D5JA 4GSNA 1QXHA 2B7JA 1VF2A 2L6CA 2F3MA 1A8YA 1OKTA 3ERGA 2DJ0A 4MZBA 1Y6EA 3D0ZA 1GSEA 5G31A 13GSA 4FYCA 1QK8A 3GL3A 3IXRA 3O3TA 4PX1A 4LLRA 4HQZA 6GSVA 1JB0J 5C00A 1YY7A 6GSTA 2OADA 5AIXA 2GZPA 1JFUA 3MDKA 4PV1B 17GSA 5J3RA 1FO5A 3ZIJA 18GSA 5DAKA 3GRXA 1BAYA 3G7JA 1M2DA 3DRNA 2MMOA 1K0DA 1TK5B 2RLIA 2WS2A 4G9HA 1CQGA 1EGOA 4HS1A 2A2RA 1QQ2A 3FYGA 4PUAA 5EL8A 2LKUA 3DWVA 3WYWA 5CNWA 1TU8A 5CRGA 5CAXA 5J9CA 1PX6A 2LEGA 5JWQB 3D6IA 5ECHB 4XS1A 2QKEA 4JE1A 4KDYA 3NZNA 1W89A 4PQIA 2JZTA 3KP8A 3ISOA 2QJKC 4AJ8A 4H86A 2CZ2A 5J5NA 2XHFA 5HR2A 1DE2A 5HFKA 4KDUA 4ZBAA 5AGYA 2GTUA 4HU9A 2GGTA 3RHBA 4TR1A 3VWWA 2JACA 1ZGNA 2VLTA 1F9MA 1N2AA 2YV7A 1PKZA 3HVSA 4D73A 5G1KA 4HU7A 4CW9A 3FR3A 2PMTA 5JWOB 4NHZA 3BCIA 3IRAA 4K7NA 3UAPA 5FWGA 4ZL9A 19GSA 2NVLA 3LWAA 1XBSA 4TXVA 2MZCA 4Q5FA 5AN1A 1BYEA 3I43A 4CHSA 4YAPA 3D4TA 4WF5A 3FZ5A 2LJAA 1XW5A 4ZB9A 3KP9A 4MJAA 2NPBA 3DYRA 1Z7RA 4IVFA 1O6JA 1GSYA 6GSYA 5F07A 2H75A 5CO3A 3ZMLA 1NW2A 4K0NA 2YOIA 2YWMA 4V2MA 1EP7A 4QL7A 5IPGA 1PN9A 3HZ4A 4IKHA 3FEUA 3HVXA 2C0DA 1SKWB 3O6TA 1X0RA 5GSSA 2CVDA 1FAAA 1M0UA 2L57A 2YNXA 5IQYA 1GULA 2WULA 3VWXA 3ZYWA 4KA0A 3PGTA 2N5FA 1T4ZA 2X8GA 2C0EA 4GF0A 1X5EA 4V2NA 4X1UA 3LSZA 2REMA 4WR4A 3BBYA 1VGLA 2LJRA 2QGVA 3P7XA 5F8BA 4ECJA 5GAND 3K8NA 2R6KA 1R5PA 2KUCA 4EXJA 9GSSA 2CAIA 3CTGA 3F0IA 1TDIA 3U6VA 1XFLA 5D96A 4MZWA 2J23A 1UC7A 3ME8A 3V1WA 2ALBA 3J7Yk 1OC3A 3CSIA 4WXTA 1MD3A 4EVMA 2C4JA 3GFKA 4ILFA 4KSMA 2K8VA 2EIRA 2CA8A 2I3YA 4KAEA 1ILOA 3PR8A 4KNDA 3FK8A 4F82A 2LSTA 2CAQA 5DJLA 4F03A 1YJ6A 3SWLA 3RPNA 1EGRA 3UOMA 3GX8A 2C3QA 5ECKB 3IPZA 1MD4A 2NTOA 2C80A 4BWQA 2DJJA 3GMFA 5KN3A 4XTSA 5LCZA 4K0GA 1BG5A 1WE0A 1PL2A 1BEDA 2AYTA 2I4AA 4IQ1A 1GLQA 3TGZA 4GSSA 4IELA 3RBTA 3US3A 1PL1A 4EDYA 2H01A 5DAKB 4NAXA 2ZT9B 1TRWA 4MF5A 2B5YA 1SYRA 2PWJA 3Q18A 4KDXA 1EOHA 1OVNA 2OA7A 3CSJA 1DBYA 2QIWA 5DJMA 4PURA 5CYYA 2B1KA 2GVPA 3IK7A 2H6YA 1K0BA 2WGRA 4ZB6A 1XCCA 5DCGA 5IMZA 4MK3A 1GNEA 3GSTA 4N0VA 4N0ZA 2JSZA 2H1GA 4J57E 3FR9A 2O7KA 1V58A 4KH7A 2Z9SA 4J2FA 5B8AA 3GL5A 1K0NA 4GXZA 5HR1A 2H19A 4EL1A 4IJIA 3QPMA 3QMXA 1XVWA 1AUCA 4POKA 2JU5A 2P5RA 4TR1B 2AV4A 5A4VA 1X9MB 5L8RJ 4I6XA 1IYHA 4XRDA 4IP1A 1Z6NA 2PU9C 3SBCA 4D73B 2B5EA 4TVEA 3HJMA 2VL2A 2V32A 2RM5A 1AQXA 2AUVA 2NDOA 2O89A 4HZ4A 1LBKA 2PVQA 5IMCA 4ZXGA 12GSA 2WZ9A 5E59A 4TXOA 5DVBA 2IPAA 2RUFA 1TJDA 4K6XA 4EF0A 3MNGA 3IHQA 4TN8A 3HYPA 1A0RP 3W8SA 1FW1A 5FT3A 1AQVA 3KH7A 3LXZA 5GSTA 2R4VA 3VPQA 1Z5YE 2HNLA 5F0GA 4XS6A 1OE7A 3KIJA 2HYXA 3DGQA 1XWGA 2LQQA 1T00A 1O73A 2CV4A 2ES7A 3TRQA 1GP1A 2A2SA 2H1AA 2WSCJ 2FHEA 1DSBA 4WR5A 3TJJA 3BCKA 3MAKA 2HFDA 2EIQA 1GTIA 5HFIA 1V9WA 3AY8A 1AW9A 2OE1A 1OC9A 4JZQA 3KZQA 3C71A 2IJYA 3DMLA 5JWRB 3N9JA 3ZIVA 5IMVA 14GSA 3MWHA 5IMFA 4ULXA 2VCZA 2PN8A 1XWCA 3C8EA 4GRFA 1WPIA 1X5CA 5IO0A 3F9UA 1K3YA 2E0QA 4ZBDA 2YZHA 1FVJA 3H1NA 2FWHA 3P8WA 2O01J 5DQSA 3IC4A 4CDOA 1GSSA 1J08A 3W8JA 3GH6A 2X8CA 3VI5A 4EE0A 3C1SA 4HDEA 2FNOA 1VF5B 3TKSA 4ISDA 3W6GA 5B8BA 2BTOT 2GZYA 3UVTA 1SD8A 4YH2A 2XBIA 3LJRA 2VO4A 4WBJA 4MCUA 1QUWA 2MBTA 1B8XA 4WETA 3TJGA 2WCIA 4WBRD 2CZ3A 4AGSA 4E8EA 4HZ2A 1Z6MA 3HA9A 1ERTA 1O8WA 4MP4A 2M80A 1TK0B 1WP0A 4EO3A 1ZL9A 3L4NA 3KMNA 3HJOA 1F6MC 3L0HA 4I7ZB 2AB6A 1G7OA 5ECMB 2C0GA 4ZBBA 3KTBA 4RQRA 2IL3A 2M46A 4O5RA 4LL1B 4X43A 2LS5A 3FZAA 4I2UA 3I6AA 2KP2A 2IIYA 1LU4A 3H93A 3IOSA 2F51A 1ZOFA 1X5DA 1E6BA 1Z9HA 1W4VA 4KGIA 1G6YA 2FY6A 4I8BA 3GKMA 4ZB8A 2A4VA 4N11A 1GL8A 1XOAA 3GV1A 1X9WB 1B4PA 1JLWA 1MEKA 2P5QA 3QD9A 3PINA 3GTUA 2DJ2A 1GSQA 3GIXA 2ON5A 5ECPB 2EC4A 3L9VA 1K0AA 2H0HA 2C1YA 3ZITA 3QDNA 3QOUA 4BVXA 4L0UA 2E74B 1XVQA 5E4WA 1O81A 3F4RA 1M7TA 1YF0A 3F63A 3UBKA 4KUNA 3EU4A 4PQHA 4OD7A 2I9HA 4POLA 3TKSE 1YEPA 3GKNA 5ELGA 1NHYA 1PMTA 2GS3A 3GX0A 5B6MA 2CX4A 1JLVA 3Q6OA 1TKDB 4ID0A 4NV5A 1WOUA 1YQ1A 2N5AA 5LNKe 1KTEA 4TXOB 1R26A 4NPBA 2WRTA 3GH9A 2DMLA 1M9AA 3P2AA 4RKUJ 1ON4A 3HXSA 3KTLA 1QFNA 3G7YA 1TU7A 1EV9A 2WB9A 2BJXA 1TW9A 1SK2A 2LRCA 5AIVA 2L4QA 2XPDA 5HFGA 2DLXA 2VLUA 2H74A 1WMJA 3HD5A 4N10A 5FHIA 4OGQB 5CRDA 1EZKA 2HE3A 8GSSA 4L5OA 1VF1A 2RM6A 4X0XA 3EURA 3G9BA 2LNSA 2H8LA 2LV3A 5A4WA 4GSTA 2O85A 2FA4A 4PGTA 3IAM2 4OCEA 4ECIA 2KLXA 1OC9B 1HD2A 2C8UA 3CRUA 2F8FA 4IP6A 5CREA 1JZRA 2R37A 3HZ8A 2H71A 4LMWA 4NXIA 5ECOB 2HSHA 2LJKA 4KT0J 2LNTA 2E75B 2ON7A 2H0IA 4L5LA 3A5WA 1HNAA 2VM2A 1SJZA 4PUFC 3IA1A 2HRFA 3TRPA 2OJLA 4MDCA 1OKDA 3KMOA 1YKAA 3QAGA 4OFTA 1TXXA 4TR3A 4TR4A 4DSQA 1TRSA 2LTKA 3KM6A 4TRXA 3EYTA 1Q98A 4E8HA 1X9SB 2H6ZA 4MZCA 2H70A 5ID2A 3GKXA 3U5RE 2WPVB 1S5LX 2HZEA 2FUG2 1I5GA 3EVIA 4OWYA 2LUSA 1KNGA 3LFLA 4NMUA 2YZUA 1GUKA 2OBKA 2CX3A 3TKPA 5INYA 4ZIJA 1BJXA 4NHWA 2YP6A 1K0MA 4PNFA 1ML6A 4MF7A 1C72A 5ABRA 3KGKA 1ERWA 1F3AA 3EE2A 1RQMA 4MABA 4H44B 1TTZA 4HEA2 4V1Ap 4I97A 2TRCP 2FCHA 2H66A 3FHKA 5ENUA 2JZSA 2GQKA 2H30A 4GQFA 4PNGA 4GLTA 4YQVA 1TRUA 3JCML 1AAZA 5D9XA 4ECCA 4IJ3A 1UVZA 2AHEA 2FWGA 4MPFA 2MMNA 4HJ2A 3FRCA 2DJ3A 4AF2A 1F3BA 2ZUPA 3A2WA 5H5SA 1TRVA 1OYJA 2H73A 2R3XA 2WDUA 3Q19A 4OO4A 2RUEA 3ZREA 1Q90D 10GSA 2IMIA 3KJYA 1TI3A 4KCEA 2DJKA 2YN1A 3GTUB 5D73A 1Z3EA 3ZVJD 4HUAA 2K18A 4K8MA 3F6DA 5EY6A 2G2QA 1USBA 3QCPA 2E2MA 3VPTA 5D8IA 1YDKA 3C8VA 3GURA 3P90A 4XS4A 3UEMA 3EMPA 4K7OA 4IBPA 2OACA 2WFCA 3CSHA 4EKZA 1FOVA 4EDZA 2H76A 2V6OA 3GYKA 3GKKA 3E0UA 2IWTA 1A8LA 1QGVA 1PD21 2HI7A 3VFIA 2ZCTA 1THXA 3KEBA 3LQ7A 2JSYA 3D22A 5IMAA 1TK8B 5ECIB 1A24A 3WGEA 2DBCA 5HQPA 3C7MA 5H5RA 4BL7A 3M9KA 1OAZA 1T1VA 4NWYA 3IR4A 3WGXA 1FG4A 5CP1A 4MJCA 3HCZA 2PPTA 4YAVA 3A2XA 4Q5NA 5LD0A 5DALB 2KHPA 2D2CB 7GSSA 1XW6A 3TB2A 2GSTA 2YJ7A 4IGJA 2VCVA 3DVXA 4HOJA 2GQLA 3HKRA 1U87A 3IV4A 1NSWA 2VUPA 2H72A 2LRNA 3BD2A 1K0CA 3BJ5A 1LJRA 5F06A 3FKFA 5KEJA 1TP9A 2GT6A 2KOKA 2C0FA 2J9HA 5G1LA 1U3AA 5KN1A 1J0FA 4G10A 4IL6X 1AQWA 3F8UA 1XPVA 3ED3A 1K3OA 2VD1A 3TDGA 11GSA 1CQHA 5HR0A 2GT5A 3ERWA 4G19A 4LA1A 4GCIA 3LEFA 4H13B 3GA4A 2FWEA 2X99A 4IW9A 2NBSA 2H6XA 1BQ7A 1R5AA 1GTAA 2VCWA 5IOWA 1IYIA 4RI6A 1N8JA 4K9ZA 1HNCA 1OC8A 3QFBC 3C1RA 4FYUA 1U6TA 4G2EA 2H1BA 3DKSA 4WF4A 4ECBA 2CVBA 4DVCA 5CRWA 2G0FA 3E3EA 2IMEA 1ZRTE 2E76B 2TIRA 4BA7A 5D93A 3WT2A 2MMAA 2I81A 1V2AA 1JHBA 5ID2B 2F9SA 2VCTA 2HZEB 3CYNA 1HYUA 1F2EA 4K2DA 1SK1A 2IFQB 3F3RA 3EWLA 3DD3A 1H4OA 2MYGA 1DE1A 2L5OA 1EEJA 1VF3A 1M2BA 3IK9A 3QFAC 1YKCA 1O8XA 1JZWA 3M1GA 4JEDA 3TJBA 2AAWA 20GSA 4MLYA 2E2GA 3TKQA 2YWNA 3EU3A 1ST9A 4I5QA 5JCGA 1R4WA 4JU5A 1NHOA 2YWIA 1K3LA 2XC2A 4O7HA 2FLSA 4LL4B 1SU9A 4F0BA 3F4TA 2B5XA 3FY7A 1MTCA 3MSZA 1S3CA 4OCFA 2IMDA 1ZMAA 4KX4A 3CTFA 2C3NA 3I69A 1O85A 4FH8A 3TUEA 1TI1A 3OR5A 5ECRB 3RAZA 4J56E 4EUYA 6GSXA 1Q4JA 4ML6A 4ACSA 3N5OA 1UN2A 3F3QA 1JZOA 3EC3A 4O92A 2DJ1A 4XS4B 2IMKA 4JBBA 1V57A 1XIYA 2HLSA 5DDLA 1PA3A 4EC0A 5D9VA 5GZZB 4FIWA 4YQMA 1G7EA 3CXGA 5G30A 5JCWA 1ERVA 1EP8A 2LRTA 2IMFA 3UVHA 1RW1A 3EINA 1GWCA 3QAVA 1FVKA 1YF1A 5EPFA 5AISA 2E7PA 1EV4A 1B48A 5HR3A 2K9YA 4DSRA 1A2LA 1B9XC 1EWXA 2DIYA 5ECSA 1MDIA 4O32A 4V2LA 1XOBA 2PERA 1PGTA 1A2JA 4KW6A 3ZZXA 2VCQA 2K8SA 5H5QA 5J4UA 2B7KA 3IBHA 3TOUA 3KCMA 2HZFA 3L9UA 1THOA 3ZFLA 1GUHA 2JL4A 2V1MA 1ZZYA 3VURA 2C3TA 2VCXA 4XHMA
chains in the Genus database with same CATH superfamily
3WT1A 1FZFA 4H0LB 1MDJA 1Y8AA 3TGUJ 3N7NA 2JP3A 4GQCA 1KEBA 2MBSA 1AXDA 2ZYGA 3KZIH 1FB6A 2H1DA 3APSA 5F05A 3AE5C 1YEXA 4XE5B 2K9JA 5DALA 4Q5QA 3DXBA 1NTKG 5BVZA 2DIZA 2HRAA 3HDCA 1A0FA 5A5KA 1KZUB 1YQ4C 4KSOA 2GLRA 1M8OB 3C9IA 4F9ZA 2NPSC 2P67A 3GNJA 3M0AA 2L6DA 2SPZA 3EMXA 3KH9A 2DC5A 1T4YA 4ZL7A 4Q5RA 3UIWA 5IIZA 1N2DC 3D70A 3RL0C 3ITKA 3H1KG 5AVTB 2AXCA 1L0LD 1UA5A 5GAPD 2FD3A 5ECLB 3G71P 1FOSE 4TLFA 2XBQA 2YMKA 3HTKA 3MP7B 2M72A 5CMZA 22GSA 1SVFA 4O5QA 2WSEJ 3RDWA 3L74E 2BEQD 2KS1A 2WPQA 3D4MA 3CCSP 1GTBA 5CCHA 5JCUA 2H43A 4MPGA 3A2VA 2Q6QA 4Z7XA 4TW5A 4XCSA 1PSQA 3FW2A 3FZ4A 5KLIC 3M9JA 2DSAA 3WD6A 2B88A 5DCHA 3RPPA 3S4RA 1RY3A 4ZILA 4ZKUA 3FXDA 2M3EA 3ZLPA 3Q2YA 2DMMA 2RIIA 3ZMKA 3M3MA 4MF6A 2OBIA 3Q74A 5KJ7A 1VQPP 3V2QA 1HNBA 3H79A 2L5LA 4ZKPA 4DJGA 4F0CA 4W80A 4FO5A 5CCGD 4AJ7A 2KLVA 4DOJA 4DSSA 1PX7A 3HUSB 2PGDA 1CZQA 1S3DA 3RBXA 6GSSA 3L74J 4RI7A 1NU1G 4GTUA 1SFCC 2M3BA 3L70G 3H8QA 1U7MA 3LGCA 2B6MA 3I9V2 3ZTLA 5KAFE 4IN0A 1GNWA 5L71A 3JSVC 2Z4EA 3GHAA 1GK4A 3E9JB 4W7ZA 1J9BA 3A5IA 2V6KA 2XU6A 1WRYA 3T97B 5APQA 3LYKA 1A02J 2Z5IA 4MMMA 4YQUA 1PKWA 4POMA 1N73B 2FXMA 1USDA 4PV1D 3H4KA 2F8AA 3SWYA 1XWKA 1AIUA 5G5FA 3APQA 1GL2B 3Q5RA 1KILE 1AQTA 4DT0A 1ZYEA 2IFQA 4V1Ag 1HBWA 2JWDA 1NTMD 5D9TA 2OE0A 2YCDA 1ERUA 3CBUA 5KOWA 4L8EA 3HE4A 4JPZB 4XIHA 1ZV8A 2HSYA 4ZL8A 2O01N 3L73J 1V40A 4BWSA 3J7Yb 1EEMA 5IM9A 5IOXA 1XWBA 2KNCA 1H89A 3CX5D 2KUBA 1M99A 1SQXD 2YIUC 3L78A 5AVSB 1SL1B 1M90Q 4PQ1A 5C39A 4I2TA 3F6FA 2IN3A 3CCRP 5J9BA 1L0LK 1M56D 1GTWA 1M1KQ 3IDVA 1URMA 5APVA 1K04A 4U3FD 3CC7P 2QC7A 1JY3N 3KXOA 3UARA 2N5BA 1YQ3C 3UL3A 3DIEA 2HXKA 3R2QA 1HF9A 3VLNA 1H75A 2X64A 1HGZA 5KAIE 1PFOA 3BOAA 4JR6A 2P2UA 2HRNA 1KMIZ 2D2ZA 2GDRA 4RUVA 1PP9E 1FB0A 3L36A 3DEXA 3MYDA 1SQBG 2FA8A 2LQOA 1PFIA 4GDOA 1VF5C 2L91A 1G6WA 5ELAA 1VRSD 1T3BA 3CPWO 3NIVA 3SFDC 3F4SA 4A5PA 4JQ0D 4C7NA 1EQ7A 1EOGA 1SL2B 4MH3A 1Z7PA 2R32A 4MJBA 2IBZI 1ZCPA 2CVKA 1LTSC 2H88C 1R7HA 2Y9YA 4N30A 2YANA 4AJ6A 1A23A 3WGDA 3AECC 1GTUA 2PVOC 2PGTA 4Y28J 1OIPA 3H1JE 1MDKA 2VIMA 1SQVG 3CWBD 2KI7B 1O7UA 1PP9J 4BXLA 3AE6C 1PRXA 2I1UA 4QQ7A 3L71E 1ZYQB 5CCGA 2A45H 2CQ9A 3LG6A 1NHLA 4OFMA 4MJEA 1SYXA 3JCUE 1L4AA 4O5UA 3AE4C 3G7IA 2MMZA 1KN7A 3TGUG 3L9SA 1KBNA 1FHEA 4G0IA 1SD9A 2TRXA 4I7ZC 2BEZF 1GSFA 2GSSA 1MFZA 2ZJSE 1WWJA 3HHVA 2VLVA 1JY2P 4CY8A 3D6ZA 2B1LA 2GQMA 1BGYJ 5IMDA 1SL0B 2QJPC 2WQYC 2WSEH 2OE3A 3M9HA 2V2GA 4JRRA 2B3SA 2VD0A 5DBQA 3A7OA 3GN3A 4PXOA 5D9WA 3Q1MA 1VQ8P 2QA4P 1NAYA 3RHCA 2E42A 1FS0E 1DX7A 3L71J 2H7HA 3KD0A 3APOA 4MH2A 5CRHA 1NTMK 2AXTH 1WJKA 2EIOA 4L74A 4DZOA 3CC4P 5G2ZA 1S3AA 1R8EA 4JF7A 4JR4A 5IPHA 1PQNA 3LORA 4OMVA 1KILB 3GMAA 2H0GA 5A4UA 3VI7A 2WJUA 2WSFJ 4KCAA 1CI6A 3CXHD 1FZGA 3HVVA 3TCOA 4QL9A 4KB3A 3RK2C 1G2CA 3ERFA 4LMVA 4TR0A 3PP5A 4PV1C 1LTBC 3TDKA 1V98A 1SQXK 3QAWA 1VQLP 4GWRA 4TOPA 6GSWA 1T8EB 1BCCJ 2OTJP 1SQQE 1XXUA 2VOCA 3IF4A 1AFOA 2VL3A 3RK3D 16GSA 2P58A 1TOFA 4TKYA 3CL3D 3VWUA 4POBA 2K6VA 4XFJA 2P31A 1F37A 3NOFA 1U3IA 1LWUA 2X49A 4RQXA 2AJQB 4UB8H 3IAS2 2WTYA 4CPGA 2VRSA 4EOTA 1T3UA 1KYOH 1NVOA 1QVFO 3FR6A 3IAOA 2YJHA 3TF5A 1L0LE 2QJYC 1S5LE 2FYNC 3D21A 1QGKB 2M8RA 2OKAA 3ME7A 5COHA 5ECNB 2JEEA 5KLIB 4HJGH 4I1LA 3BVHA 4BVYA 1SQQJ 3HTKB 1SKSB 2IDBA 4MA9A 1AC1A 1VF4A 4A7PA 1B9YC 2VL2C 3UBLA 1XZOA 2YPMA 2IYPA 2L4CA 2KS1B 2R3SA 3LW5J 4IFMA 1DUGA 5ECQB 4JYCA 5KAFH 1N7LA 4DEJA 1M2AA 3MHVA 3GSSA 3ZRDA 2M0BA 5AVXB 5AW1B 4NV2A 4L0WA 3LXTA 1JZDA 1ACVA 2A2PA 5KLVG 4PJ0H 3U1AA 2O8VB 4PD4D 1M9BA 5B6NA 1XW9A 3B71A 2KP1A 5KKZC 4IQAA 1L0LJ 1SFCB 3ZVJA 1GSDA 1SJ6A 2L59A 2QRXA 4H44D 5IO2A 1Y25A 4WKWA 1K05A 2Q1KA 4DSSB 3M0DC 1KQFB 1SJIA 1RE4A 2ZXXA 3R2PA 5AW2B 3TKRA 3E1RA 2Y0DA 2JR8A 3WUVA 2P0GA 1LTJC 3H32B 5C04A 1LGHB 1GSUA 2KB7P 2VM1A 5G5EA 4N78D 4F2IA 5J41A 3CXHI 1U88A 1HQOA 3A2AA 3BCCE 4HJMA 3TRXA 1QMVA 4IHUA 3I56P 1SKRB 1YZXA 3HVNA 3S9FA 3N4XA 2V41A 2IBZE 4ASWA 1M7LA 3VWVA 3MIWA 1MKMA 4OGQC 5AVUB 1GRXA 1JMMA 3A3TA 3C73A 4OFNA 4XRAA 3UJ1A 1Z56A 2C0XA 3VYIA 1ABAA 3VMXA 3CCJP 3CRTA 3LYPA 1BSHA 2ZNMA 3HY2A 4K7IA 2XPEA 1B4QA 2N1TC 4WEYA 1RF0A 2JADA 4WY4B 3QR6A 1YJ9P 1FC2C 1XWAA 3HD7D 2ZT9D 2A45I 3DVWA 4BWNA 2AEFA 2VL9A 3BCCJ 3FZ9A 3TOTA 2HPCA 6GSUA 1SENA 2IFNA 5B5EH 2LXCB 2PUKC 5DQYA 2WT7A 3UMAA 1KQLA 4FYBA 2PBJA 2HT9A 2JZRA 1NWQA 1P84H 3M8NA 2KSJA 3CQFA 2GSRA 4KE3A 2E75C 2HODB 2KNCB 4ML1A 3ZFBA 4HKZH 4OO5A 2K9FA 5B7CA 3BASA 1H0TA 3CMIA 1A2MA 1OW6A 1GUMA 1OE8A 3RGUA 2R0GA 2OYIC 2R5BA 3CD6P 2FKWB 4ZNCA 2O87A 2GA1A 1NM3A 2YNYA 2YWOA 4GOEA 3H1LD 2VAFA 2R5GA 2KZJA 4U3FE 5EVOA 3IE3A 3H1ID 2GM4A 3TJKA 1NTZE 3MUDA 5KN2A 1GMJA 1RK4A 1E2YA 2E43A 1I9DA 2BMXA 2R2JA 4P3YB 2P7JA 2X8HA 1BX9A 3M0FA 2JDIH 2UWJE 4IS0A 2FGXA 1WT6A 3JCUH 4HQSA 3V4WA 3VK9A 3H1HD 1YIJP 2YV9A 1GLPA 2QVAA 2NPSD 2GSQA 3OA7A 1GK6A 1FZAA 1SQXJ 1K0OA 3TKSC 2GZZA 3HJPA 2WSFH 1T7PB 2QSIA 4C7NB 1SK0A 3RL0D 4HI7A 5KN0A 4BPYA 3ZL5A 5BMUA 2CT6A 1G0TA 3H1JG 1WIKA 1GH2A 1M3IA 4U3FJ 1T8ZA 1NTZJ 3TJFA 1EZVD 4K1FA 3CWBE 3PH9A 2FY8A 3L71G 1PPJD 3O76A 2CPSA 2K3RA 1KYOI 2PRRA 3GUSA 2FWFA 1S2EA 3QH9A 3D5JA 4GSNA 1G1JA 1QXHA 2B7JA 1VF2A 5EFWB 2L6CA 2F3MA 1A8YA 4W7YA 2ZVOB 5GTHE 1OKTA 3ERGA 2DJ0A 4MZBA 4X4JA 1Y6EA 3K5BA 5AVRB 3D0ZA 1Y47A 4IOIH 13GSA 1GSEA 5G31A 4FYCA 3JC22 1QK8A 5AW8B 1S4XA 4H44C 2OYHA 3GL3A 3IXRA 3CCUP 3O3TA 4PX1A 4LLRA 4HQZA 1X0TA 1ZP0C 2JJLA 1JY3P 6GSVA 1JB0J 4D6TD 3U1CA 3FGAD 3CWBJ 3R3EA 3P8CD 3USSA 5C00A 2J58A 3I5CA 1J1EB 1YY7A 1PIXA 6GSTA 2OADA 5AIXA 3FWNA 3F5HA 2GZPA 1JFUA 3MDKA 4O9BA 1LT9A 4PV1B 17GSA 5J3RA 1QL1A 4R4MA 1FO5A 2FYZA 3ZIJA 18GSA 5DAKA 3HD7A 3LIDA 1RE3C 1S5LH 1KB9D 3GRXA 5DJUB 3TNUA 1BAYA 3CXHE 3FMWA 1CI6B 1L0ND 1SQQG 3G7JA 1VL2A 3L75D 1M2DA 1IFNA 1G2CB 3VP9A 3M91A 3DRNA 3A5TA 2MMOA 1K0DA 1TK5B 2RLIA 2WS2A 3CC2P 4G9HA 1CQGA 4HS1A 1EGOA 4RO0A 1FZCA 1KV4A 2A2RA 1QQ2A 3FYGA 4PUAA 5EL8A 3RK3E 2LKUA 1TU3F 2NRGA 2WMMA 3DWVA 3WYWA 5CNWA 1TU8A 5CRGA 4MN4C 2JWAA 5CAXA 5J9CA 1PX6A 2LEGA 5JWQB 1LWUB 3D6IA 5ECHB 5GTIH 4XS1A 2QKEA 1XG8A 4JE1A 4KDYA 4YXWH 3NZNA 1W89A 3FXEA 4PQIA 2ZXEB 2JZTA 3KP8A 1KTMA 3ISOA 2QJKC 4AJ8A 4H86A 3H6PA 1QVGO 2CZ2A 5J5NA 3L72D 2XHFA 4UB6E 3AE7C 1SP4A 5HFKA 3EWKA 5HR2A 1DE2A 4BVYB 2FXPA 4KDUA 3M9BA 2KZIA 3V4QA 1SQPD 2NPSA 4ZBAA 5AGYA 2GUVA 2GTUA 4HU9A 2GGTA 1P84I 3RHBA 4TR1A 2FYUD 2YKQA 3VWWA 2JACA 1ZGNA 2VLTA 1F9MA 3C1LA 1N2AA 2YV7A 1ZLLA 1PKZA 3HVSA 4D73A 2JKVA 5G1KA 4HU7A 4CW9A 1VF5D 2AXTE 4EI2A 3FR3A 3E1IA 2PMTA 2KIKA 1S3JA 5JWOB 4NHZA 3BCIA 3IRAA 4K7NA 3UAPA 5FWGA 3BCCG 1VQMP 4BIKA 2YKOA 1FDMA 4ZL9A 3GHGC 1YHQP 19GSA 4N78E 2NVLA 3LWAA 1XBSA 3G9RA 4TXVA 2MZCA 1S9KE 4Q5FA 5AN1A 1BYEA 1ZXGA 2IBZG 3I43A 4G0LA 4CHSA 1KORA 4YAPA 1BSNA 2D2CC 1AVOA 3VN0A 1HTLC 3D4TA 4WF5A 1LTIC 3FZ5A 2LJAA 3CX5H 5APWA 2PAJA 3B5NC 1XW5A 4ZB9A 3KP9A 1BE3D 4MJAA 2NPBA 3DYRA 1Z7RA 4IVFA 4UB8E 1SFCA 1O6JA 1KYOE 1GSYA 6GSYA 3CMEP 5F07A 2H75A 5CO3A 3ZMLA 1NW2A 4K0NA 3G3ZA 2YOIA 2YWMA 2H8PD 4V2MA 1L0NK 1CW5A 1EP7A 2O3JA 4QL7A 5IPGA 3H32A 1EDJA 1PN9A 3HZ4A 2HPCB 1JUNA 4IKHA 2FBWC 1NTKD 1U57A 3Q5SA 2WT7B 3FEUA 3HVXA 2C0DA 1SKWB 3O6TA 5CCHC 1X0RA 3KYQA 3WU2H 2IX7C 5GSSA 1M1JC 2CVDA 1FAAA 1M0UA 1IFIA 2L57A 2YNXA 5IQYA 1GULA 3L73E 3RK3B 1H0TB 2WPRA 1KFNA 2G3AA 4PJ0E 2WULA 3VWXA 4U3FG 3H1KD 3ZYWA 4KA0A 3G4SP 3PGTA 4H13C 2N5FA 1T4ZA 1NTZG 2X8GA 3RK2D 1JEKA 3AEDC 2C0EA 1X5EA 4GF0A 4V2NA 4X1UA 2WSSH 4C46A 3H1LE 3LSZA 2REMA 1GW3A 1CSBA 4WR4A 2Q9IA 3BBYA 1VGLA 4WY4A 2LJRA 4EYYQ 1M57D 2QGVA 3P7XA 5F8BA 4ECJA 5GAND 1SQPK 2KP8A 3K8NA 1X8YA 2R6KA 1ZRTD 2C9LY 1L2PA 2FYUK 1QEXA 1R5PA 3P32A 1Q82Q 2KUCA 5GTHH 4EXJA 3AEEC 3H1HE 4EIQA 2CAIA 9GSSA 3CTGA 3GLMA 1FU1A 4L75A 3F0IA 1TDIA 2HODA 1DD3A 2E74D 3LIEA 3U6VA 4L76A 1XFLA 5D96A 2J23A 1UC7A 3ME8A 4MZWA 3V1WA 1EXJA 2ALBA 2E76C 3J7Yk 2ITAA 1OC3A 3A3YB 3CSIA 3CWBG 3H1LJ 4WXTA 4QMAA 1MD3A 4EVMA 1PGOA 2C4JA 3GFKA 3H1IJ 4Z2RA 5APTA 2Y0EA 1HJBA 4ILFA 4KSMA 2K8VA 2EIRA 1PPJE 2CA8A 5APYA 2R5DA 3L70D 2I3YA 4KAEA 1ILOA 3PR8A 4KNDA 3FK8A 4F82A 1T2KC 2LSTA 3H1HJ 2RKLA 2C9NY 4EDFA 2CAQA 5DJLA 5B5EE 1YJ6A 4F03A 3SWLA 1K73Q 3RPNA 1EGRA 2P1JA 3UOMA 3CXHH 3P7KA 3GX8A 2C3QA 5ECKB 3IPZA 1RF1C 1P84E 1MD4A 2NTOA 1BDDA 2C80A 2OYHB 4BWQA 1HJ0A 1USEA 2DJJA 5AW5B 4D6TE 2XNXA 1BGYE 3P8CE 2W90A 3GMFA 5KN3A 1BDCA 1Y9BA 2IZ1A 4XTSA 5LCZA 4K0GA 1BG5A 3TSIA 4LC1A 1WE0A 1HUCA 4TT3H 1PL2A 1BEDA 2PP6A 2AYTA 2I4AA 1NGMB 1LT9B 1GLQA 4IQ1A 3TGZA 4GSSA 3U59A 1NTKK 4IELA 3AE9C 3VOPA 3RBTA 3US3A 1K9MQ 1PL1A 4EDYA 3M9QA 2H01A 5DAKB 4OGQD 3HD7B 1IZNB 2ZT9B 1TRWA 4NAXA 2LR2A 3TNUB 1MUUA 1OFCX 1L0NE 4UB6H 3L75E 4MF5A 2B5YA 1SYRA 2PWJA 3Q18A 1IC2A 5K5GB 4KDXA 1EOHA 1OVNA 2OA7A 3CSJA 4D6TJ 2YO3A 1DBYA 2N1TD 1LTTC 2QIWA 1FZCB 5DJMA 3A0BE 1FE6A 2B1KA 2GVPA 4PURA 3IK7A 5CYYA 1E5WA 4EIJA 4BVXB 1BCCE 3CX5I 2H6YA 1K0BA 2WGRA 1UIIA 4ZB6A 1XCCA 5DCGA 2PFXA 4MK3A 1GNEA 3GSTA 4N0VA 4N0ZA 5IMZA 2JSZA 1Q86Q 2H1GA 4RESB 2A45G 3GW6A 4PD4H 4J57E 3FR9A 1SQBD 1FBMA 2O7KA 1V58A 4KH7A 1RQVA 2W83C 2Z9SA 4J2FA 2E75D 5B8AA 3GL5A 2Q3IA 3EFGA 1L0NJ 1OZHA 2UZ8A 3L75J 1K0NA 1NKZB 3WUTA 5APUA 3V6IA 3L72E 5AW6B 1JY2O 4GXZA 5HR1A 1EDIA 1AVYA 2H19A 4EL1A 2K1AA 4IJIA 3QPMA 1YITP 2RH0A 1J1DC 3QMXA 4NPEA 1FOSF 1XVWA 1AUCA 2NPSB 1N7SD 2FYUE 1S3RA 2JU5A 4POKA 2P5RA 3GF3A 4TR1B 1SQVD 2AV4A 3AE1C 5A4VA 3RL0B 1X9MB 1R5LA 1X9VA 3FWLA 5L8RJ 4I6XA 1NU1K 1IYHA 1W5CE 4XRDA 4XA4A 4IP1A 1Z6NA 2PU9C 3SBCA 4D73B 3O8ZA 2B5EA 4TVEA 3HJMA 1ZYNA 2VL2A 3V2PA 3TGUD 2V32A 2RM5A 2E74C 1AQXA 3OAKA 2AUVA 3L72J 2YXQB 2NDOA 2O89A 4HZ4A 1LBKA 2PVQA 5IMCA 2Q3EA 2R0PA 1LP1A 4ZXGA 1GDTA 12GSA 1J2JB 1AQ5A 1A02F 3FX0A 2WZ9A 3L74G 5KOXA 1URQC 1QX8A 1IFDA 2I1JA 2FYUJ 5E59A 4TXOA 5DVBA 2IPAA 2RUFA 1TJDA 4K6XA 3EQ2A 4EF0A 4N3YB 3MNGA 2HYNA 2WVRA 3CMAP 3IHQA 4TN8A 5AW4B 3EPTA 3HYPA 1A0RP 3W8SA 2MKVA 3A0HE 1NO4A 1FW1A 1AQVA 5FT3A 3M0DA 3KH7A 5GTIE 3LXZA 1VQ4P 1LTJA 1QLED 5GSTA 2R4VA 3VPQA 1Z5YE 2HNLA 5F0GA 4XS6A 1OE7A 3KIJA 2HYXA 1LTAC 4ICYA 2GUSA 4H0LC 3DGQA 1XWGA 2LQQA 1T00A 1O73A 4RJTA 2CV4A 4Z2TA 4B86A 2O1KA 4OVNF 2ES7A 3TRQA 1VQ6P 1GP1A 4NPDA 2A2SA 2H1AA 2WSCJ 2FHEA 3SSUA 3L73G 2OYOA 1DSBA 4WR5A 3TJJA 1HVVA 3BCKA 3MAKA 2N1TA 2HFDA 2EIQA 1GTIA 1YJWP 1SQBK 1FDIA 5HFIA 1V9WA 3BRTB 3AY8A 1AW9A 2QM7A 1NKNA 3OJAB 2OE1A 4USSA 1OC9A 4JZQA 4C7RA 1S72P 5CBOA 1YYCA 3KZQA 3C71A 1QL2A 2IJYA 3DMLA 1HWTC 5JWRB 3N9JA 3ZIVA 2KSEA 5IMVA 1LNQA 14GSA 3MWHA 5IMFA 4ULXA 1NTKJ 3H1HG 1NTME 2NZ2A 2QA1A 1OVRA 2YIUB 2YMYA 2VCZA 2PN8A 2OYIA 1XWCA 1SQVK 3C8EA 3AE8C 1VQ5P 4HB1A 2J5UA 5KLVD 1GD2E 1WPIA 4GRFA 1X5CA 5IO0A 3F9UA 1K3YA 2E0QA 4ZBDA 1Q7YQ 2V7QH 2HRKA 5KTBA 3WUUA 2YZHA 3CX5E 1FZEA 1SQXE 1FVJA 3H1NA 5AW9B 2FWHA 3P8WA 1FDOA 2O01J 5DQSA 3IC4A 4CDOA 1OXZA 1GSSA 3Q3DA 1Q2NA 1J08A 3W8JA 2Y0CA 3GH6A 4PD4I 2X8CA 3VI5A 4EE0A 3C1SA 4HDEA 2FNOA 1VF5B 2G8YA 1N7SC 1NTMJ 3TKSA 3HUSC 1PP9G 4ISDA 2K88A 2YO2A 3H25A 3L70E 3W6GA 1RF1B 5B8BA 2BTOT 4OWFA 2GZYA 3UVTA 1YBKA 1SD8A 4WB4A 4YH2A 3VMZA 2XBIA 3E7KA 3LJRA 2VO4A 1KB9H 4WBJA 4MCUA 1H8AA 1N8RQ 3PHLA 1QUWA 2I8DA 3WU2E 5CJ4A 2MBTA 1B8XA 4WETA 3TJGA 1KC8Q 2WCIA 4WBRD 1BGYG 2HFED 2CZ3A 2WWWA 1KILD 4AGSA 4E8EA 4HZ2A 1Z6MA 3HA9A 2M5AA 1GW4A 3A0BH 1ERTA 1O8WA 5TISE 4MP4A 4MNNA 3IHGA 5CHXA 2M80A 1N73C 1TK0B 1WP0A 3WMM0 2IZ0A 3L70J 1ZL9A 4EO3A 5AW3B 3EFFK 3L4NA 1GL2C 4U7JA 3KMNA 2QA2A 3HJOA 1F6MC 3MUDC 4I7ZB 2AB6A 3L0HA 1G7OA 3OW2O 5ECMB 2C0GA 4ZBBA 2D2CD 4I2LC 1FAVA 3KTBA 3VP8A 1L0NG 1VDFA 3L75G 2X4AA 4RQRA 2IL3A 2QJPB 3B5ND 2M46A 4LL1B 4O5RA 4X43A 2LS5A 3FZAA 4I2UA 3I6AA 2KP2A 2IIYA 1LU4A 3H93A 3IOSA 2OQQA 1BCCG 2XNDH 1ZOFA 2F51A 5AW0B 3AEAC 1X5DA 1E6BA 1Z9HA 1KD1Q 1W4VA 2A06D 3MIXA 5E79E 3HE5A 4KGIA 1E79H 1G6YA 2FY6A 4L73A 4I8BA 2Z5HA 1RE3A 4IL6E 3GKMA 4ZB8A 2A4VA 4N11A 5DJTB 1GL8A 3RK2B 1SQBE 5CCHD 1XOAA 3GV1A 1X9WB 1JMBA 4HYTB 1B4PA 1OVVA 1JLWA 2KK7A 2Q5UA 5KLVK 2CPBA 1MEKA 2P5QA 1KFMA 1WRGA 3QD9A 3PINA 3GTUA 4H13D 2DJ2A 1GSQA 3H1JD 3GIXA 2ON5A 1IFJA 1JY3O 5ECPB 2EC4A 3L9VA 1SLQA 1WMKA 1K0AA 2H0HA 2C1YA 1DD4A 3ZITA 3QDNA 3QOUA 4YTPC 4BVXA 1K8AQ 4L0UA 2B87A 2E74B 2WSCH 1RH5B 1XVQA 5E4WA 1O81A 3A0HH 3F4RA 5CBNA 1AA0A 2QJYB 1SQBJ 1M7TA 1YF0A 3F63A 2FYNB 3UBKA 4KUNA 3EU4A 4PQHA 4OD7A 2I9HA 3KHUA 3B8EB 1YI2P 1L0LG 1EZVI 4POLA 3TKSE 3II6A 1YEPA 3GKNA 4G0KA 5ELGA 1NHYA 4I6MC 1PMTA 2GS3A 3GX0A 5B6MA 2CX4A 1JLVA 1VQ7P 2OARA 2E76D 3Q6OA 2BCCD 1LP1B 1OWAA 1TKDB 3GG2A 4ID0A 4NV5A 1WOUA 1YQ1A 2N5AA 5AW7B 2IFMA 5LNKe 3VMYA 1SQVJ 1KTEA 4TXOB 4OH8B 1R26A 4NPBA 5KKZB 4Z2UA 2WRTA 3GH9A 2DMLA 1M9AA 4EIPA 3P2AA 4ZMDA 4RKUJ 1T2KD 1ON4A 3HXSA 3KTLA 1QFNA 3G7YA 1TU7A 1EV9A 2XDJA 2FFDC 4GOFA 2WB9A 2BJXA 3GHGA 4PD4E 1LTJB 1TW9A 1SK2A 2LRCA 4DCKA 3AEFC 3W67A 5AIVA 2O01H 1SQQD 2L4QA 2XPDA 3NFQA 1KILC 5HFGA 2DLXA 2VLUA 2KOGA 2H74A 1WMJA 3HD5A 4N10A 5FHIA 1KB9I 3B5NA 3KXDA 4OGQB 5CRDA 1EZKA 2HE3A 8GSSA 2IYOA 4L5OA 3B4SA 1OX3A 2W8ZA 3VMAA 1VF1A 2RM6A 4X0XA 3NXSA 3EURA 3G9BA 1OMIA 2QM8A 4LGDE 2LNSA 2H8LA 5H2FH 2LV3A 5A4WA 2N1TB 1VQNP 4GSTA 2IPPA 2O85A 2FA4A 4PGTA 2B9BA 3IAM2 4OCEA 2QG4A 4ECIA 2KLXA 1OC9B 1ZN5A 1HD2A 3CI9A 2C8UA 1NOHA 1NTMG 2OTKE 4M3LA 3Q5PA 5CJ0A 3CRUA 2F8FA 1M1JA 4IP6A 2R37A 1JZRA 3HZ8A 5CREA 2H71A 4LMWA 4NXIA 5ECOB 2HSHA 3S1KA 2LJKA 4KT0J 2LNTA 2E75B 1EDLA 2ON7A 2H0IA 4HH2A 4L5LA 3A5WA 5B66E 1HNAA 3I55P 2OYIB 2VM2A 1SJZA 5KLVE 1SQXG 4PUFC 3IA1A 3AE2C 2HRFA 3TRPA 2OJLA 4MDCA 2FXOA 1N7SB 2K37A 1OKDA 1YTZT 3KMOA 1L4AD 1YKAA 1Q81Q 5TISH 3G6EP 5TJHA 3QAGA 1LT1A 4YXDC 4OFTA 2BASA 1IFMA 1GU5A 1TXXA 4TR3A 4TR4A 1JTHA 4DSQA 2W6BA 3BCCD 5KJ7C 2YXRB 1TRSA 2LTKA 1JO5A 4Y99C 3KM6A 3H1IE 4TRXA 4CY6A 2DKIA 3EYTA 2IBZD 1U7JA 3PRJA 3PH0A 2Q7CA 1PGQA 1Q98A 1YJNP 4E8HA 2Y9ZA 1KQSO 3CCLP 3AEBC 1X9SB 2H6ZA 5KLVJ 3W68A 4MZCA 4GKGA 2XZRA 3V5BA 1VQOP 2H70A 5ID2A 2QE7H 1EXIA 3GKXA 3U5RE 2WPVB 1S5LX 2HZEA 2FUG2 1NAFA 1I5GA 1GU4A 3EVIA 4YKGA 3RBZA 4OWYA 2LUSA 1KNGA 3LFLA 4NMUA 2YZUA 1GUKA 1NH4A 5E79H 2HG5D 2M5AB 2OBKA 1XTGB 2CX3A 1SQQK 2R44A 3TKPA 1PZQA 1URQD 4K35A 5INYA 4IL6H 4ZIJA 1BJXA 2ZFCA 1EZVE 4NHWA 1T3JA 2C0WA 2WITA 1IK9A 3AE3C 4WY4C 4R4LA 1K0MA 2YP6A 4PNFA 1ML6A 1NU1D 1C72A 4MF7A 5ABRA 1RF1A 4Z1MH 3KGKA 1ERWA 1F3AA 3EE2A 1RQMA 1D7MA 4MABA 4H44B 1TTZA 4HEA2 4V1Ap 4I97A 2TRCP 1LTGC 2FCHA 2H66A 1MZ9A 4GT1A 3FHKA 3PJSK 5ENUA 2JZSA 2GQKA 2H30A 4GQFA 4PNGA 4GLTA 4YQVA 3CCMP 1TRUA 3JCML 1AAZA 5APSA 1NTZD 5D9XA 4ECCA 3IC8A 1X22A 2A06E 4IJ3A 1N86A 2E5TA 1UVZA 4H0LD 3HE5B 1IFPA 2AHEA 2FWGA 4MPFA 2MMNA 4HJ2A 4WBAA 3F89A 3FRCA 2DJ3A 4AF2A 1F3BA 2ZUPA 3A2WA 5H5SA 1TRVA 1OYJA 2RN0A 2H73A 2R3XA 2WDUA 3Q19A 4OO4A 2RUEA 3ZREA 1Q90D 1ZR4A 10GSA 2IMIA 3SWKA 3KJYA 4N6JA 2W27A 1TI3A 1GZLA 1KB9E 4KCEA 3O6QB 2DJKA 2YN1A 1DH3A 2V7QJ 3GTUB 5D73A 2XV5A 1Z3EA 3ZVJD 4HUAA 2K18A 4K8MA 2XKMA 3F6DA 1DEEG 2R0CA 5EY6A 2B89A 2G2QA 1USBA 2B87B 3QCPA 2QJKB 2E2MA 3VPTA 5D8IA 1YDKA 3C8VA 2W6AA 3GURA 3P90A 4XS4A 3UEMA 3EMPA 4K7OA 3R4YA 3L37A 4FQUA 2OACA 1FJKA 4IBPA 2WFCA 3CSHA 1W2BO 4EKZA 1FOVA 4WVZA 2MJZA 1OW7A 4EDZA 2H76A 2V6OA 3GYKA 3NTNA 5CCGC 3AEGC 3GKKA 4K2XA 3E0UA 1L4AC 5APXA 2IWTA 3H1JJ 2BCCE 3SWFA 1R5SA 1A8LA 1QGVA 2E5YA 1PN0A 1PD21 2JO1A 2HI7A 1EC5A 4LLHA 2FFDB 3VFIA 1SQPE 2ZCTA 1THXA 3KEBA 3LQ7A 2JSYA 3PPUA 3D22A 5IMAA 1AJYA 1TK8B 5ECIB 1A24A 3WGEA 2ZYDA 1YTZI 2DBCA 1J1EC 1LJ2A 5HQPA 3C7MA 2AEJA 5H5RA 4AUWA 4BL7A 3M9KA 1HGVA 1URQA 1T6AA 1OAZA 1T1VA 3CCVP 4NWYA 2O1JA 3GHGB 3IR4A 3WGXA 1FG4A 5CP1A 4MJCA 2BCCJ 3HCZA 2PPTA 4YAVA 3A2XA 4Q5NA 5LD0A 2K9JB 5DALB 2KHPA 2D2CB 5BU5A 4NPFX 1MV8A 7GSSA 1XW6A 3TB2A 2GSTA 2YJ7A 1SQPJ 2H89C 2HSMA 1NTZK 4IGJA 2DW3A 2WPSA 3B5NB 5B66H 3TYYA 2VCVA 4BRYA 3DVXA 1GL2D 4HOJA 2GQLA 3HKRA 1U87A 3IV4A 2W6JH 1NSWA 1HH0A 2VUPA 2H72A 3KQGA 2LRNA 3BD2A 1LWUC 1K0CA 2ZVNB 1BE3E 3BJ5A 1LJRA 3L35A 5F06A 3FKFA 5KEJA 3PLNA 1TP9A 2ZAEB 3ABVC 2GT6A 2CK3H 2KOKA 2C0FA 1FZBA 2J9HA 5G1LA 4KJMA 5M1BA 1U3AA 1ZYPA 5KN1A 4K5SA 1J0FA 4G10A 4IL6X 1M1JB 1AQWA 3F8UA 1XPVA 3ED3A 1W2EA 1SS1A 1K3OA 2VD1A 3TDGA 11GSA 1CQHA 5HR0A 2GT5A 3CCQP 3MTUE 3IR9A 3ERWA 4G19A 1NTKE 4LA1A 4GCIA 2OTLP 3LEFA 4H13B 3GA4A 2FWEA 1OVUA 1PGJA 2X99A 4IW9A 2J59M 2NBSA 1BE3J 4Y99B 1BQ7A 2H6XA 1R5AA 1GTAA 2VCWA 4AQRD 5IOWA 3H1LG 1IYIA 3H1KE 1N8JA 4RI6A 3H1IG 1VQKP 1S9KD 3KZIE 1JTHB 4K9ZA 1HNCA 1ZW0A 1OC8A 3L74D 3QFBC 1JNMA 2LKMA 2RMZA 3C1RA 1U6TA 3D71A 4FYUA 2N9BA 2H1BA 4G2EA 3DKSA 4WF4A 1RE4C 2KLUA 3IFMA 4ECBA 2CVBA 4DVCA 5CRWA 2G0FA 1PGPA 3E3EA 1ZR2A 2IMEA 1ZRTE 2E76B 3BRVB 2TIRA 4BA7A 1H88A 1RQUA 5D93A 3WT2A 2MMAA 2I81A 1V2AA 1JHBA 5ID2B 1NJIQ 4GIFA 2F9SA 1KYOD 2POHA 3L4FA 4IFDK 1JM0A 2VCTA 2HZEB 2N9YB 5H2FE 3CYNA 1N7SA 3H1KJ 3HUSA 1HYUA 4HSCX 5KAIH 1F2EA 4K2DA 1SK1A 5AVZB 2IFQB 3F3RA 1EZVG 3EWLA 1PPJG 4GODA 3DD3A 1H4OA 1VPCA 2OGUA 1FJPA 1JCDA 3HE4B 2MYGA 1DE1A 2L5OA 5AVQB 1RF0C 1NU1E 1EEJA 1VF3A 1M2BA 3IK9A 1DEBA 1EDKA 1X79B 3QFAC 1YKCA 1O8XA 3L73D 1JZWA 3T97A 3M1GA 1G1IA 4JEDA 3TJBA 2AAWA 3KPEA 20GSA 3QWOC 4MLYA 2E2GA 3TKQA 1N73A 2YWNA 3EU3A 2A06G 1MFTA 4YKFA 4K3AA 1ST9A 1FOHA 4ASVA 4I5QA 5JCGA 4D6TG 1R4WA 1GL2A 1KQGB 3MZWB 4JU5A 4WWIA 1NHOA 3RK3C 2YWIA 1K3LA 2XC2A 4O7HA 3RL0g 2FLSA 4LL4B 1SU9A 3SFEC 4F0BA 3F4TA 2B5XA 1NU1J 3S9OA 4JBZA 1MTCA 3FY7A 4KHXA 3MSZA 1ZMEC 2P10A 5AVVB 1S3CA 1XTCC 4OCFA 2IMDA 3HRNA 1ZMAA 4K5RA 4KX4A 1PV3A 1OW8A 3CTFA 2AEMA 2I1KA 3ZDMA 2C3NA 3I69A 1UIXA 2KYVA 3UIAA 1O85A 3NMDA 4FH8A 3TUEA 2YKPA 1TI1A 4KF9A 3OR5A 5ECRB 3RAZA 4J56E 4EUYA 6GSXA 1AV1A 1JY2N 2R3CA 3TK1A 1Q4JA 4PTSA 3M06A 3MD0A 4ML6A 1IO4A 4ACSA 3N5OA 1UN2A 5AVYB 1PL5A 5AVWB 3F3QA 3BATA 1PP9D 1JZOA 2HLOA 1IJDB 3EC3A 5BU8B 2KXPB 1L4AB 4O92A 2DJ1A 4YPCA 4XS4B 1M3JA 2IMKA 1IK7A 4JBBA 1P84D 1V57A 1XIYA 1J1DB 2HLSA 5DDLA 2BCCG 1PA3A 3L72G 4EC0A 2L5GB 5D9VA 5GZZB 2HR3A 4FIWA 4YQMA 1BGYD 1G7EA 3O6QA 3CXGA 5G30A 1SQPG 3LW5H 5JCWA 1ERVA 2FYUG 1SFCD 3CCEP 3CLQA 3D6YA 1DIPA 2OYHC 1EP8A 5KJ7D 4JYBA 4AYCA 2LRTA 1NYHA 2IMFA 3UVHA 4IFFA 1ZOYC 1SQVE 1RW1A 3L71D 3PTZA 3EINA 1GWCA 3KDPB 3QAVA 1FVKA 3MGNA 3LW9A 4BL7B 1YF1A 5EPFA 2ZYAA 5AISA 1LT9C 1URQB 2E7PA 1EV4A 2WZ7A 3V2NA 1B48A 5HR3A 2K9YA 3TGUE 2QEXP 4DSRA 1A2LA 1RHZB 1B9XC 1EWXA 2DIYA 3HD7C 2ZT9C 1MDIA 5ECSA 4O32A 1XOBA 4V2LA 3VTPC 2PERA 1BCCD 3V2RA 1A2JA 1PGTA 4KW6A 3ZZXA 2VCQA 5BRTA 2K8SA 1JOCA 3P8MC 5H5QA 5J4UA 2A4HA 2DKHA 2B7KA 3IBHA 2FFDA 1VQ9P 3TOUA 3KCMA 2HZFA 3L9UA 3GF7A 1FZCC 1THOA 3ZFLA 1S1CX 4BRYB 1JCCA 4WY4D 1GUHA 2LXBA 2JL4A 1BE3G 1KILA 2V1MA 3IN6A 1ZZYA 3VURA 2C3TA 2V4HA 2VCXA 4XHMA
chains in the Genus database with same CATH topology
3WT1A 4H0LB 1MDJA 2JP3A 4GQCA 1KEBA 2MBSA 1AXDA 1FB6A 2H1DA 3APSA 5F05A 3AE5C 1YEXA 5DALA 4Q5QA 3DXBA 2DIZA 2HRAA 3HDCA 1A0FA 5A5KA 1YQ4C 4KSOA 2GLRA 4F9ZA 3GNJA 2L6DA 3EMXA 3KH9A 2DC5A 1T4YA 4ZL7A 4Q5RA 3UIWA 5IIZA 3D70A 1UA5A 5GAPD 2FD3A 5ECLB 2XBQA 2YMKA 2M72A 22GSA 4O5QA 2WSEJ 3RDWA 2BEQD 3D4MA 1GTBA 5JCUA 4MPGA 3A2VA 4Z7XA 4TW5A 4XCSA 1PSQA 3FW2A 3FZ4A 5KLIC 3M9JA 2DSAA 3WD6A 5DCHA 3RPPA 4ZILA 3ZLPA 3Q2YA 2DMMA 2RIIA 3ZMKA 3M3MA 4MF6A 2OBIA 3Q74A 1HNBA 3H79A 2L5LA 4F0CA 4FO5A 4AJ7A 4DSSA 1PX7A 1S3DA 6GSSA 4RI7A 4GTUA 3H8QA 3LGCA 2B6MA 3I9V2 3ZTLA 4IN0A 1GNWA 5L71A 3GHAA 3E9JB 1J9BA 3A5IA 2V6KA 1WRYA 3T97B 3LYKA 4MMMA 4YQUA 1PKWA 4POMA 3H4KA 4PV1D 2F8AA 1XWKA 1AIUA 5G5FA 3APQA 3Q5RA 1KILE 1ZYEA 2IFQA 4V1Ag 5D9TA 2OE0A 2YCDA 1ERUA 3CBUA 5KOWA 4L8EA 4XIHA 2HSYA 4ZL8A 1V40A 4BWSA 3J7Yb 1EEMA 5IM9A 5IOXA 1XWBA 1M99A 2YIUC 3L78A 1SL1B 4PQ1A 4I2TA 3F6FA 2IN3A 5J9BA 3IDVA 1URMA 1K04A 3UARA 2QC7A 3KXOA 2N5BA 1YQ3C 3UL3A 3DIEA 3R2QA 2HXKA 1HF9A 3VLNA 1H75A 2X64A 4JR6A 3BOAA 2HRNA 1KMIZ 2D2ZA 2GDRA 4RUVA 1FB0A 3DEXA 3MYDA 2FA8A 2LQOA 4GDOA 1VF5C 1G6WA 5ELAA 1VRSD 1T3BA 3NIVA 3SFDC 3F4SA 4A5PA 1SL2B 1EOGA 4MH3A 1Z7PA 4MJBA 1ZCPA 2CVKA 2H88C 1R7HA 4N30A 2YANA 4AJ6A 1A23A 3WGDA 3AECC 1GTUA 2PVOC 2PGTA 4Y28J 1MDKA 2VIMA 1O7UA 3AE6C 1PRXA 2I1UA 4QQ7A 1ZYQB 2CQ9A 3LG6A 4OFMA 4MJEA 1SYXA 4O5UA 3AE4C 3G7IA 2MMZA 3L9SA 1KBNA 1FHEA 4G0IA 1SD9A 2TRXA 4I7ZC 2BEZF 1GSFA 2GSSA 1WWJA 3HHVA 2VLVA 4CY8A 3D6ZA 2B1LA 2GQMA 5IMDA 1SL0B 2QJPC 2WQYC 2OE3A 2V2GA 4JRRA 2B3SA 2VD0A 5DBQA 3GN3A 4PXOA 5D9WA 3Q1MA 3RHCA 3KD0A 3APOA 4MH2A 5CRHA 1WJKA 2EIOA 5G2ZA 1S3AA 1R8EA 4JR4A 5IPHA 1PQNA 3LORA 4OMVA 3GMAA 2H0GA 5A4UA 3VI7A 2WJUA 2WSFJ 4KCAA 3TCOA 3HVVA 4QL9A 4KB3A 3ERFA 4LMVA 4TR0A 4PV1C 4TOPA 3QAWA 1V98A 4GWRA 6GSWA 1T8EB 1XXUA 2VOCA 2VL3A 16GSA 1TOFA 4TKYA 3VWUA 4POBA 2K6VA 4XFJA 2P31A 1F37A 3NOFA 1U3IA 2X49A 4RQXA 2AJQB 3IAS2 3FR6A 3IAOA 2YJHA 2QJYC 2FYNC 3D21A 3ME7A 2OKAA 5COHA 5ECNB 4BVYA 1SKSB 2IDBA 4MA9A 1AC1A 1VF4A 1B9YC 2VL2C 3UBLA 1XZOA 2YPMA 2L4CA 5ECQB 1DUGA 3LW5J 4DEJA 1M2AA 3GSSA 3ZRDA 4NV2A 4L0WA 3LXTA 1JZDA 1ACVA 2A2PA 2O8VB 1M9BA 5B6NA 1XW9A 3B71A 2KP1A 5KKZC 4IQAA 3ZVJA 1GSDA 1SJ6A 2L59A 4H44D 5IO2A 1Y25A 4WKWA 1K05A 4DSSB 1KQFB 1SJIA 3TKRA 2P0GA 5C04A 1GSUA 2VM1A 5G5EA 4F2IA 5J41A 1U88A 1HQOA 4HJMA 3TRXA 1QMVA 4IHUA 1SKRB 1YZXA 3S9FA 2V41A 3VWVA 1MKMA 4OGQC 1GRXA 3A3TA 3C73A 4OFNA 4XRAA 3UJ1A 1ABAA 3CRTA 3LYPA 2ZNMA 3HY2A 4K7IA 2XPEA 1B4QA 4WEYA 2JADA 3QR6A 1XWAA 2ZT9D 3DVWA 2VL9A 3FZ9A 3TOTA 6GSUA 1SENA 2PUKC 5DQYA 3UMAA 4FYBA 2PBJA 2HT9A 2JZRA 3M8NA 4KE3A 2GSRA 4ML1A 2E75C 3ZFBA 4OO5A 2K9FA 5B7CA 3CMIA 1A2MA 1OW6A 1GUMA 1OE8A 2R0GA 2O87A 1NM3A 2YWOA 2VAFA 2R5GA 5EVOA 3IE3A 3TJKA 5KN2A 1GMJA 1RK4A 1E2YA 1I9DA 2BMXA 2R2JA 4P3YB 2X8HA 1BX9A 3M0FA 4IS0A 2FGXA 4HQSA 3VK9A 2YV9A 1GLPA 2GSQA 3TKSC 1K0OA 2GZZA 3HJPA 1T7PB 2QSIA 1SK0A 4HI7A 5KN0A 4BPYA 3ZL5A 5BMUA 2CT6A 1G0TA 1WIKA 1GH2A 3TJFA 4K1FA 3PH9A 3O76A 3GUSA 2FWFA 3D5JA 4GSNA 1QXHA 2B7JA 1VF2A 2L6CA 2F3MA 1A8YA 1OKTA 3ERGA 2DJ0A 4MZBA 4X4JA 1Y6EA 3D0ZA 1GSEA 5G31A 13GSA 4FYCA 1QK8A 4H44C 3GL3A 3IXRA 3O3TA 4PX1A 4LLRA 4HQZA 1ZP0C 6GSVA 1JB0J 3FGAD 3R3EA 5C00A 1YY7A 6GSTA 1PIXA 2OADA 5AIXA 2GZPA 1JFUA 3MDKA 4PV1B 17GSA 5J3RA 4R4MA 1FO5A 3ZIJA 18GSA 5DAKA 3GRXA 1BAYA 3FMWA 3G7JA 1VL2A 1M2DA 3DRNA 2MMOA 1K0DA 1TK5B 2RLIA 2WS2A 4G9HA 1CQGA 1EGOA 4HS1A 2A2RA 1QQ2A 3FYGA 4PUAA 5EL8A 3RK3E 2LKUA 1TU3F 3DWVA 3WYWA 5CNWA 1TU8A 5CRGA 5CAXA 5J9CA 1PX6A 2LEGA 5JWQB 3D6IA 5ECHB 4XS1A 2QKEA 4JE1A 4KDYA 3NZNA 1W89A 4PQIA 2JZTA 3KP8A 1KTMA 3ISOA 2QJKC 4AJ8A 4H86A 2CZ2A 5J5NA 2XHFA 3AE7C 5HR2A 5HFKA 3EWKA 1DE2A 4BVYB 2FXPA 4KDUA 4ZBAA 5AGYA 2GTUA 4HU9A 2GGTA 3RHBA 4TR1A 3VWWA 2JACA 1ZGNA 2VLTA 1F9MA 1N2AA 2YV7A 1PKZA 3HVSA 4D73A 5G1KA 4HU7A 4CW9A 1VF5D 3FR3A 2PMTA 5JWOB 4NHZA 3BCIA 3IRAA 4K7NA 3UAPA 5FWGA 4ZL9A 19GSA 2NVLA 3LWAA 1XBSA 3G9RA 4TXVA 2MZCA 4Q5FA 5AN1A 1BYEA 3I43A 4G0LA 4CHSA 1KORA 4YAPA 2D2CC 3D4TA 4WF5A 3FZ5A 2LJAA 1XW5A 4ZB9A 3KP9A 4MJAA 2NPBA 3DYRA 1Z7RA 4IVFA 1O6JA 1GSYA 6GSYA 5F07A 2H75A 5CO3A 3ZMLA 1NW2A 4K0NA 2YOIA 2YWMA 4V2MA 1EP7A 4QL7A 5IPGA 1PN9A 3HZ4A 4IKHA 2FBWC 1U57A 3Q5SA 3FEUA 3HVXA 2C0DA 1SKWB 3O6TA 1X0RA 5GSSA 2CVDA 1FAAA 1M0UA 2L57A 2YNXA 5IQYA 1GULA 2G3AA 2WULA 3VWXA 3ZYWA 4KA0A 3PGTA 4H13C 2N5FA 1T4ZA 2X8GA 3AEDC 2C0EA 1X5EA 4GF0A 4V2NA 4X1UA 3LSZA 2REMA 4WR4A 3BBYA 1VGLA 2LJRA 2QGVA 3P7XA 5F8BA 4ECJA 5GAND 3K8NA 2R6KA 1R5PA 2KUCA 4EXJA 3AEEC 4EIQA 9GSSA 2CAIA 3CTGA 3GLMA 3F0IA 1TDIA 1DD3A 2E74D 3U6VA 1XFLA 5D96A 2J23A 1UC7A 3ME8A 4MZWA 3V1WA 1EXJA 2ALBA 2E76C 3J7Yk 1OC3A 3CSIA 4WXTA 1MD3A 4EVMA 2C4JA 3GFKA 4Z2RA 4ILFA 4KSMA 2K8VA 2EIRA 2CA8A 2I3YA 4KAEA 1ILOA 3PR8A 4KNDA 3FK8A 4F82A 2LSTA 2CAQA 5DJLA 4F03A 1YJ6A 3SWLA 3RPNA 1EGRA 3UOMA 3GX8A 2C3QA 5ECKB 3IPZA 1MD4A 2NTOA 2C80A 4BWQA 1HJ0A 2DJJA 3GMFA 5KN3A 1Y9BA 4XTSA 5LCZA 4K0GA 1BG5A 1WE0A 4TT3H 1PL2A 1BEDA 2AYTA 2I4AA 1NGMB 1GLQA 4IQ1A 3TGZA 4GSSA 4IELA 3AE9C 3RBTA 3US3A 1PL1A 4EDYA 2H01A 5DAKB 4OGQD 4NAXA 2ZT9B 1TRWA 4MF5A 2B5YA 1SYRA 2PWJA 3Q18A 4KDXA 1EOHA 1OVNA 2OA7A 3CSJA 1DBYA 2QIWA 5DJMA 4PURA 5CYYA 2B1KA 2GVPA 3IK7A 4BVXB 2H6YA 1K0BA 2WGRA 4ZB6A 1XCCA 5DCGA 5IMZA 4MK3A 1GNEA 3GSTA 4N0VA 4N0ZA 2JSZA 2H1GA 4J57E 3FR9A 2O7KA 1V58A 4KH7A 1RQVA 2Z9SA 4J2FA 2E75D 5B8AA 3GL5A 2UZ8A 1K0NA 4GXZA 5HR1A 2H19A 4EL1A 4IJIA 3QPMA 3QMXA 1XVWA 1AUCA 4POKA 2JU5A 2P5RA 3GF3A 4TR1B 2AV4A 3AE1C 5A4VA 1X9MB 5L8RJ 4I6XA 1IYHA 4XRDA 4IP1A 1Z6NA 2PU9C 3SBCA 4D73B 2B5EA 4TVEA 3HJMA 1ZYNA 2VL2A 2V32A 2RM5A 2E74C 1AQXA 2AUVA 2NDOA 2O89A 4HZ4A 1LBKA 2PVQA 5IMCA 2R0PA 4ZXGA 12GSA 2WZ9A 5KOXA 5E59A 4TXOA 5DVBA 2IPAA 2RUFA 1TJDA 4K6XA 4EF0A 3MNGA 3IHQA 4TN8A 3EPTA 3HYPA 1A0RP 3W8SA 2MKVA 1FW1A 5FT3A 1AQVA 3KH7A 3LXZA 5GSTA 2R4VA 3VPQA 1Z5YE 2HNLA 5F0GA 4XS6A 1OE7A 3KIJA 2HYXA 4ICYA 4H0LC 3DGQA 1XWGA 2LQQA 1T00A 1O73A 2CV4A 4Z2TA 2ES7A 3TRQA 1GP1A 2A2SA 2H1AA 2WSCJ 2FHEA 1DSBA 4WR5A 3TJJA 3BCKA 3MAKA 2HFDA 2EIQA 1GTIA 1FDIA 5HFIA 1V9WA 3AY8A 1AW9A 2OE1A 4USSA 1OC9A 4JZQA 3KZQA 3C71A 2IJYA 3DMLA 5JWRB 3N9JA 3ZIVA 5IMVA 14GSA 3MWHA 5IMFA 4ULXA 2NZ2A 2QA1A 2VCZA 2PN8A 1XWCA 3C8EA 3AE8C 2J5UA 4GRFA 1WPIA 1X5CA 5IO0A 3F9UA 1K3YA 2E0QA 4ZBDA 2HRKA 2YZHA 1FVJA 3H1NA 2FWHA 3P8WA 1FDOA 2O01J 5DQSA 3IC4A 4CDOA 1GSSA 3Q3DA 1J08A 3W8JA 3GH6A 2X8CA 3VI5A 4EE0A 3C1SA 4HDEA 2FNOA 1VF5B 2G8YA 3TKSA 4ISDA 3H25A 3W6GA 5B8BA 2BTOT 2GZYA 3UVTA 1SD8A 4YH2A 2XBIA 3LJRA 2VO4A 4WBJA 4MCUA 1QUWA 2MBTA 1B8XA 4WETA 3TJGA 2WCIA 4WBRD 2CZ3A 4AGSA 4E8EA 4HZ2A 1Z6MA 3HA9A 1ERTA 1O8WA 4MP4A 4MNNA 3IHGA 2M80A 1TK0B 1WP0A 4EO3A 1ZL9A 3L4NA 4U7JA 3KMNA 2QA2A 3HJOA 1F6MC 3L0HA 4I7ZB 2AB6A 1G7OA 5ECMB 2C0GA 4ZBBA 2D2CD 3KTBA 2X4AA 4RQRA 2IL3A 2M46A 4O5RA 4LL1B 4X43A 2LS5A 3FZAA 4I2UA 3I6AA 2KP2A 2IIYA 1LU4A 3H93A 3IOSA 2OQQA 2F51A 1ZOFA 3AEAC 1X5DA 1E6BA 1Z9HA 1W4VA 3MIXA 4KGIA 1G6YA 2FY6A 4I8BA 3GKMA 4ZB8A 2A4VA 4N11A 1GL8A 1XOAA 3GV1A 1X9WB 1B4PA 1JLWA 1MEKA 2P5QA 3QD9A 3PINA 3GTUA 4H13D 2DJ2A 1GSQA 3GIXA 2ON5A 5ECPB 2EC4A 3L9VA 1WMKA 1K0AA 2H0HA 2C1YA 1DD4A 3ZITA 3QDNA 3QOUA 4YTPC 4BVXA 4L0UA 2E74B 1XVQA 5E4WA 1O81A 3F4RA 1M7TA 1YF0A 3F63A 3UBKA 4KUNA 3EU4A 4PQHA 4OD7A 2I9HA 4POLA 3TKSE 1YEPA 3GKNA 4G0KA 5ELGA 1NHYA 1PMTA 2GS3A 3GX0A 5B6MA 2CX4A 1JLVA 2E76D 3Q6OA 1TKDB 4ID0A 4NV5A 1WOUA 1YQ1A 2N5AA 5LNKe 1KTEA 4TXOB 1R26A 4NPBA 4Z2UA 2WRTA 3GH9A 2DMLA 1M9AA 4EIPA 3P2AA 4RKUJ 1ON4A 3HXSA 3KTLA 1QFNA 3G7YA 1TU7A 1EV9A 2WB9A 2BJXA 1TW9A 1SK2A 2LRCA 3AEFC 5AIVA 2L4QA 2XPDA 5HFGA 2DLXA 2VLUA 2H74A 1WMJA 3HD5A 4N10A 5FHIA 4OGQB 5CRDA 1EZKA 2HE3A 8GSSA 4L5OA 1VF1A 2RM6A 4X0XA 3EURA 3G9BA 1OMIA 2LNSA 2H8LA 2LV3A 5A4WA 4GSTA 2O85A 2FA4A 4PGTA 3IAM2 4OCEA 4ECIA 2KLXA 1OC9B 1HD2A 2C8UA 3CRUA 3Q5PA 2F8FA 4IP6A 2R37A 1JZRA 3HZ8A 5CREA 2H71A 4LMWA 4NXIA 5ECOB 2HSHA 2LJKA 4KT0J 2LNTA 2E75B 2ON7A 2H0IA 4L5LA 3A5WA 1HNAA 2VM2A 1SJZA 4PUFC 3IA1A 3AE2C 2HRFA 3TRPA 2OJLA 4MDCA 1OKDA 3KMOA 1YKAA 3QAGA 4OFTA 4YXDC 1TXXA 4TR3A 4TR4A 4DSQA 1TRSA 2LTKA 3KM6A 4TRXA 4CY6A 2DKIA 3EYTA 1Q98A 4E8HA 3AEBC 1X9SB 2H6ZA 4MZCA 2H70A 5ID2A 1EXIA 3GKXA 3U5RE 2WPVB 1S5LX 2HZEA 2FUG2 1I5GA 3EVIA 4YKGA 4OWYA 2LUSA 1KNGA 3LFLA 4NMUA 2YZUA 1GUKA 2OBKA 2CX3A 3TKPA 5INYA 4ZIJA 1BJXA 4NHWA 3AE3C 4R4LA 1K0MA 2YP6A 4PNFA 1ML6A 4MF7A 1C72A 5ABRA 4Z1MH 3KGKA 1ERWA 1F3AA 3EE2A 1RQMA 4MABA 4H44B 1TTZA 4HEA2 4V1Ap 4I97A 2TRCP 2FCHA 2H66A 3FHKA 5ENUA 2JZSA 2GQKA 2H30A 4GQFA 4PNGA 4GLTA 4YQVA 1TRUA 3JCML 1AAZA 5D9XA 4ECCA 3IC8A 4IJ3A 1UVZA 4H0LD 2AHEA 2FWGA 4MPFA 2MMNA 4HJ2A 3FRCA 2DJ3A 4AF2A 1F3BA 2ZUPA 3A2WA 5H5SA 1TRVA 1OYJA 2H73A 2R3XA 2WDUA 3Q19A 4OO4A 2RUEA 3ZREA 1Q90D 10GSA 2IMIA 3KJYA 1TI3A 4KCEA 2DJKA 2YN1A 2V7QJ 3GTUB 5D73A 1Z3EA 3ZVJD 4HUAA 2K18A 4K8MA 3F6DA 2R0CA 5EY6A 2G2QA 1USBA 3QCPA 2E2MA 3VPTA 5D8IA 1YDKA 3C8VA 3GURA 3P90A 4XS4A 3UEMA 3EMPA 4K7OA 3R4YA 4IBPA 4FQUA 2OACA 2WFCA 3CSHA 4EKZA 1FOVA 1OW7A 4EDZA 2H76A 2V6OA 3GYKA 3AEGC 3GKKA 4K2XA 3E0UA 2IWTA 1A8LA 1QGVA 1PN0A 1PD21 2JO1A 2HI7A 3VFIA 2ZCTA 1THXA 3KEBA 3LQ7A 2JSYA 3PPUA 3D22A 5IMAA 1AJYA 1TK8B 5ECIB 1A24A 3WGEA 2DBCA 5HQPA 3C7MA 5H5RA 4BL7A 3M9KA 1OAZA 1T1VA 4NWYA 3IR4A 3WGXA 1FG4A 5CP1A 4MJCA 3HCZA 2PPTA 4YAVA 3A2XA 4Q5NA 5LD0A 5DALB 2KHPA 2D2CB 7GSSA 1XW6A 3TB2A 2GSTA 2YJ7A 2H89C 2HSMA 4IGJA 2VCVA 3DVXA 4HOJA 2GQLA 3HKRA 1U87A 3IV4A 1NSWA 2VUPA 2H72A 2LRNA 3BD2A 1K0CA 3BJ5A 1LJRA 5F06A 3FKFA 5KEJA 1TP9A 3ABVC 2GT6A 2KOKA 2C0FA 2J9HA 5G1LA 5M1BA 1U3AA 1ZYPA 5KN1A 4K5SA 1J0FA 4G10A 4IL6X 1AQWA 3F8UA 1XPVA 3ED3A 1K3OA 2VD1A 3TDGA 11GSA 1CQHA 5HR0A 2GT5A 3ERWA 4G19A 4LA1A 4GCIA 3LEFA 4H13B 3GA4A 2FWEA 2X99A 4IW9A 2NBSA 2H6XA 1BQ7A 1R5AA 1GTAA 2VCWA 5IOWA 1IYIA 4RI6A 1N8JA 4K9ZA 1HNCA 1OC8A 3QFBC 3C1RA 4FYUA 4G2EA 1U6TA 3D71A 2H1BA 3DKSA 4WF4A 4ECBA 2CVBA 4DVCA 5CRWA 2G0FA 3E3EA 2IMEA 1ZRTE 2E76B 2TIRA 4BA7A 1RQUA 5D93A 3WT2A 2MMAA 2I81A 1V2AA 1JHBA 5ID2B 2F9SA 2VCTA 2HZEB 3CYNA 1HYUA 1F2EA 4K2DA 1SK1A 2IFQB 3F3RA 3EWLA 3DD3A 1H4OA 2MYGA 1DE1A 2L5OA 1EEJA 1VF3A 1M2BA 3IK9A 3QFAC 1YKCA 1O8XA 1JZWA 3M1GA 4JEDA 3TJBA 2AAWA 20GSA 4MLYA 2E2GA 3TKQA 2YWNA 3EU3A 4YKFA 1ST9A 1FOHA 4I5QA 5JCGA 1R4WA 1KQGB 4JU5A 1NHOA 2YWIA 1K3LA 2XC2A 4O7HA 3RL0g 2FLSA 4LL4B 1SU9A 3SFEC 4F0BA 3F4TA 2B5XA 3S9OA 3FY7A 1MTCA 3MSZA 1ZMEC 2P10A 1S3CA 4OCFA 2IMDA 1ZMAA 4K5RA 4KX4A 1PV3A 1OW8A 3CTFA 2C3NA 3I69A 1UIXA 1O85A 4FH8A 3TUEA 1TI1A 4KF9A 3OR5A 5ECRB 3RAZA 4J56E 4EUYA 6GSXA 1Q4JA 4PTSA 4ML6A 4ACSA 3N5OA 1UN2A 1PL5A 3F3QA 1JZOA 3EC3A 4O92A 2DJ1A 4XS4B 2IMKA 1IK7A 4JBBA 1V57A 1XIYA 2HLSA 5DDLA 1PA3A 4EC0A 5D9VA 5GZZB 4FIWA 4YQMA 1G7EA 3O6QA 3CXGA 5G30A 5JCWA 1ERVA 3D6YA 1DIPA 1EP8A 2LRTA 1NYHA 2IMFA 3UVHA 1ZOYC 1RW1A 3EINA 1GWCA 3QAVA 1FVKA 3LW9A 4BL7B 1YF1A 5EPFA 5AISA 2E7PA 1EV4A 1B48A 5HR3A 2K9YA 4DSRA 1A2LA 1B9XC 1EWXA 2DIYA 5ECSA 2ZT9C 1MDIA 4O32A 1XOBA 4V2LA 2PERA 1PGTA 1A2JA 4KW6A 3ZZXA 2VCQA 5BRTA 2K8SA 5H5QA 5J4UA 2A4HA 2DKHA 2B7KA 3IBHA 3TOUA 3KCMA 2HZFA 3L9UA 3GF7A 1THOA 3ZFLA 1S1CX 1GUHA 2JL4A 2V1MA 3IN6A 1ZZYA 3VURA 2C3TA 2VCXA 4XHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WT1 A;  4H0L B;  1MDJ A;  2MBS A;  4GQC A;  1KEB A;  1AXD A;  1FB6 A;  2H1D A;  3APS A;  5F05 A;  1YEX A;  5DAL A;  4Q5Q A;  3DXB A;  2DIZ A;  3HDC A;  1A0F A;  5A5K A;  4KSO A;  2GLR A;  4F9Z A;  3GNJ A;  2L6D A;  3EMX A;  3KH9 A;  2DC5 A;  1T4Y A;  4ZL7 A;  4Q5R A;  3UIW A;  5IIZ A;  1UA5 A;  5GAP D;  2FD3 A;  5ECL B;  2XBQ A;  2M72 A;  22GS A;  2WSE J;  3RDW A;  3D4M A;  1GTB A;  5JCU A;  4MPG A;  3A2V A;  4Z7X A;  4TW5 A;  4XCS A;  1PSQ A;  3FW2 A;  3FZ4 A;  5KLI C;  3M9J A;  2DSA A;  3WD6 A;  5DCH A;  3RPP A;  4ZIL A;  3ZLP A;  2DMM A;  2RII A;  3ZMK A;  3M3M A;  4MF6 A;  2OBI A;  3Q74 A;  1HNB A;  3H79 A;  2L5L A;  4F0C A;  4FO5 A;  4AJ7 A;  4DSS A;  1PX7 A;  1S3D A;  6GSS A;  4RI7 A;  4GTU A;  3H8Q A;  3LGC A;  2B6M A;  3I9V 2;  3ZTL A;  4IN0 A;  1GNW A;  5L71 A;  3GHA A;  3E9J B;  1J9B A;  2V6K A;  1WRY A;  3LYK A;  4MMM A;  4YQU A;  1PKW A;  4POM A;  3H4K A;  2F8A A;  1XWK A;  1AIU A;  5G5F A;  3APQ A;  1ZYE A;  2IFQ A;  4V1A g;  5D9T A;  2OE0 A;  2YCD A;  1ERU A;  3CBU A;  4L8E A;  4XIH A;  2HSY A;  4ZL8 A;  1V40 A;  4BWS A;  3J7Y b;  1EEM A;  5IM9 A;  5IOX A;  1XWB A;  1M99 A;  2YIU C;  3L78 A;  1SL1 B;  4PQ1 A;  4I2T A;  3F6F A;  2IN3 A;  5J9B A;  3IDV A;  1URM A;  3UAR A;  2QC7 A;  3KXO A;  2N5B A;  3VLN A;  3UL3 A;  3DIE A;  2HXK A;  3R2Q A;  1H75 A;  2X64 A;  4JR6 A;  3BOA A;  2HRN A;  2D2Z A;  2GDR A;  4RUV A;  1FB0 A;  3DEX A;  2FA8 A;  2LQO A;  1G6W A;  5ELA A;  1VRS D;  1T3B A;  3NIV A;  3F4S A;  1SL2 B;  1EOG A;  4MH3 A;  1Z7P A;  4MJB A;  1ZCP A;  2CVK A;  1R7H A;  4N30 A;  2YAN A;  4AJ6 A;  1A23 A;  3WGD A;  1GTU A;  2PVO C;  2PGT A;  4Y28 J;  1MDK A;  2VIM A;  1O7U A;  1PRX A;  2I1U A;  4QQ7 A;  1ZYQ B;  2CQ9 A;  3LG6 A;  4OFM A;  4MJE A;  1SYX A;  3G7I A;  2MMZ A;  3L9S A;  1KBN A;  1FHE A;  1SD9 A;  2TRX A;  2GSS A;  1GSF A;  1WWJ A;  3HHV A;  2VLV A;  2GQM A;  2B1L A;  5IMD A;  1SL0 B;  2QJP C;  2OE3 A;  2V2G A;  4JRR A;  2B3S A;  2VD0 A;  5DBQ A;  3GN3 A;  4PXO A;  5D9W A;  3RHC A;  3KD0 A;  3APO A;  4MH2 A;  5CRH A;  1WJK A;  2EIO A;  5G2Z A;  1S3A A;  4JR4 A;  5IPH A;  1PQN A;  3LOR A;  4OMV A;  2H0G A;  5A4U A;  3VI7 A;  2WJU A;  2WSF J;  4KCA A;  3TCO A;  3HVV A;  4QL9 A;  4KB3 A;  3ERF A;  4LMV A;  4TR0 A;  4TOP A;  3QAW A;  1V98 A;  4GWR A;  6GSW A;  1T8E B;  1XXU A;  2VOC A;  2VL3 A;  16GS A;  1TOF A;  4TKY A;  3VWU A;  4POB A;  2K6V A;  2P31 A;  1F37 A;  3NOF A;  1U3I A;  4RQX A;  2AJQ B;  3IAS 2;  3FR6 A;  2YJH A;  2QJY C;  2FYN C;  3D21 A;  3ME7 A;  2OKA A;  5COH A;  5ECN B;  4BVY A;  1SKS B;  4MA9 A;  1AC1 A;  1VF4 A;  1B9Y C;  2VL2 C;  3UBL A;  1XZO A;  2YPM A;  2L4C A;  5ECQ B;  1DUG A;  3LW5 J;  4DEJ A;  1M2A A;  3GSS A;  3ZRD A;  4NV2 A;  4L0W A;  3LXT A;  1JZD A;  1ACV A;  2O8V B;  1M9B A;  5B6N A;  1XW9 A;  2KP1 A;  5KKZ C;  4IQA A;  3ZVJ A;  1GSD A;  1SJ6 A;  2L59 A;  5IO2 A;  1Y25 A;  4WKW A;  4DSS B;  1SJI A;  3TKR A;  2P0G A;  5C04 A;  1GSU A;  2VM1 A;  5G5E A;  4F2I A;  5J41 A;  1U88 A;  1HQO A;  4HJM A;  3TRX A;  1QMV A;  4IHU A;  1SKR B;  1YZX A;  3S9F A;  2V41 A;  3VWV A;  1GRX A;  3A3T A;  3C73 A;  4OFN A;  4XRA A;  3UJ1 A;  1ABA A;  3CRT A;  3LYP A;  2ZNM A;  3HY2 A;  4K7I A;  2XPE A;  1B4Q A;  4WEY A;  2JAD A;  3QR6 A;  1XWA A;  3DVW A;  2VL9 A;  3FZ9 A;  3TOT A;  6GSU A;  1SEN A;  2PUK C;  5DQY A;  3UMA A;  4FYB A;  2PBJ A;  2HT9 A;  2JZR A;  3M8N A;  4KE3 A;  2GSR A;  4ML1 A;  3ZFB A;  4OO5 A;  2K9F A;  5B7C A;  3CMI A;  1A2M A;  1GUM A;  1OE8 A;  2O87 A;  1NM3 A;  2YWO A;  2VAF A;  2R5G A;  5EVO A;  3IE3 A;  3TJK A;  5KN2 A;  1RK4 A;  1E2Y A;  1I9D A;  2BMX A;  2R2J A;  4P3Y B;  2X8H A;  1BX9 A;  3M0F A;  4IS0 A;  2FGX A;  4HQS A;  3VK9 A;  2YV9 A;  1GLP A;  2GSQ A;  3TKS C;  1K0O A;  2GZZ A;  3HJP A;  1T7P B;  2QSI A;  1SK0 A;  4HI7 A;  5KN0 A;  4BPY A;  3ZL5 A;  2CT6 A;  1G0T A;  1WIK A;  1GH2 A;  3TJF A;  4K1F A;  3PH9 A;  3O76 A;  3GUS A;  2FWF A;  3D5J A;  4GSN A;  1QXH A;  2B7J A;  1VF2 A;  2L6C A;  2F3M A;  1A8Y A;  1OKT A;  3ERG A;  2DJ0 A;  4MZB A;  1Y6E A;  3D0Z A;  1GSE A;  5G31 A;  13GS A;  4FYC A;  1QK8 A;  3GL3 A;  3IXR A;  3O3T A;  4PX1 A;  4LLR A;  4HQZ A;  6GSV A;  1JB0 J;  5C00 A;  1YY7 A;  6GST A;  2OAD A;  5AIX A;  2GZP A;  1JFU A;  3MDK A;  4PV1 B;  17GS A;  5J3R A;  1FO5 A;  3ZIJ A;  18GS A;  5DAK A;  3GRX A;  1BAY A;  3G7J A;  1M2D A;  3DRN A;  2MMO A;  1K0D A;  1TK5 B;  2RLI A;  2WS2 A;  4G9H A;  1CQG A;  1EGO A;  4HS1 A;  2A2R A;  1QQ2 A;  3FYG A;  4PUA A;  5EL8 A;  2LKU A;  3DWV A;  3WYW A;  5CNW A;  1TU8 A;  5CRG A;  5CAX A;  5J9C A;  1PX6 A;  2LEG A;  5JWQ B;  3D6I A;  5ECH B;  4XS1 A;  2QKE A;  4JE1 A;  4KDY A;  3NZN A;  1W89 A;  4PQI A;  2JZT A;  3KP8 A;  3ISO A;  2QJK C;  4AJ8 A;  4H86 A;  2CZ2 A;  5J5N A;  2XHF A;  5HR2 A;  1DE2 A;  5HFK A;  4KDU A;  4ZBA A;  5AGY A;  2GTU A;  4HU9 A;  2GGT A;  3RHB A;  4TR1 A;  3VWW A;  2JAC A;  1ZGN A;  2VLT A;  1F9M A;  1N2A A;  2YV7 A;  1PKZ A;  3HVS A;  4D73 A;  5G1K A;  4HU7 A;  4CW9 A;  3FR3 A;  2PMT A;  5JWO B;  4NHZ A;  3BCI A;  3IRA A;  4K7N A;  3UAP A;  5FWG A;  4ZL9 A;  19GS A;  2NVL A;  3LWA A;  1XBS A;  4TXV A;  2MZC A;  4Q5F A;  5AN1 A;  1BYE A;  3I43 A;  4CHS A;  4YAP A;  3D4T A;  4WF5 A;  3FZ5 A;  2LJA A;  1XW5 A;  4ZB9 A;  3KP9 A;  4MJA A;  2NPB A;  3DYR A;  1Z7R A;  4IVF A;  1O6J A;  1GSY A;  6GSY A;  5F07 A;  2H75 A;  5CO3 A;  3ZML A;  1NW2 A;  4K0N A;  2YOI A;  2YWM A;  4V2M A;  1EP7 A;  4QL7 A;  5IPG A;  1PN9 A;  3HZ4 A;  4IKH A;  3FEU A;  3HVX A;  2C0D A;  1SKW B;  3O6T A;  1X0R A;  5GSS A;  2CVD A;  1FAA A;  1M0U A;  2L57 A;  2YNX A;  5IQY A;  1GUL A;  2WUL A;  3VWX A;  3ZYW A;  4KA0 A;  3PGT A;  2N5F A;  1T4Z A;  2X8G A;  2C0E A;  4GF0 A;  1X5E A;  4V2N A;  4X1U A;  3LSZ A;  2REM A;  4WR4 A;  3BBY A;  1VGL A;  2LJR A;  2QGV A;  3P7X A;  5F8B A;  4ECJ A;  5GAN D;  3K8N A;  2R6K A;  1R5P A;  2KUC A;  4EXJ A;  9GSS A;  2CAI A;  3CTG A;  3F0I A;  1TDI A;  3U6V A;  1XFL A;  5D96 A;  4MZW A;  2J23 A;  1UC7 A;  3ME8 A;  3V1W A;  2ALB A;  3J7Y k;  1OC3 A;  3CSI A;  4WXT A;  1MD3 A;  4EVM A;  2C4J A;  3GFK A;  4ILF A;  4KSM A;  2K8V A;  2EIR A;  2CA8 A;  2I3Y A;  4KAE A;  1ILO A;  3PR8 A;  4KND A;  3FK8 A;  4F82 A;  2LST A;  2CAQ A;  5DJL A;  4F03 A;  1YJ6 A;  3SWL A;  3RPN A;  1EGR A;  3UOM A;  3GX8 A;  2C3Q A;  5ECK B;  3IPZ A;  1MD4 A;  2NTO A;  2C80 A;  4BWQ A;  2DJJ A;  3GMF A;  5KN3 A;  4XTS A;  5LCZ A;  4K0G A;  1BG5 A;  1WE0 A;  1PL2 A;  1BED A;  2AYT A;  2I4A A;  4IQ1 A;  1GLQ A;  3TGZ A;  4GSS A;  4IEL A;  3RBT A;  3US3 A;  1PL1 A;  4EDY A;  2H01 A;  5DAK B;  4NAX A;  2ZT9 B;  1TRW A;  4MF5 A;  2B5Y A;  1SYR A;  2PWJ A;  3Q18 A;  4KDX A;  1EOH A;  1OVN A;  2OA7 A;  3CSJ A;  1DBY A;  2QIW A;  5DJM A;  4PUR A;  5CYY A;  2B1K A;  2GVP A;  3IK7 A;  2H6Y A;  1K0B A;  2WGR A;  4ZB6 A;  1XCC A;  5DCG A;  5IMZ A;  4MK3 A;  1GNE A;  3GST A;  4N0V A;  4N0Z A;  2JSZ A;  2H1G A;  4J57 E;  3FR9 A;  2O7K A;  1V58 A;  4KH7 A;  2Z9S A;  4J2F A;  5B8A A;  3GL5 A;  1K0N A;  4GXZ A;  5HR1 A;  2H19 A;  4EL1 A;  4IJI A;  3QPM A;  3QMX A;  1XVW A;  1AUC A;  4POK A;  2JU5 A;  2P5R A;  4TR1 B;  2AV4 A;  5A4V A;  1X9M B;  5L8R J;  4I6X A;  1IYH A;  4XRD A;  4IP1 A;  1Z6N A;  2PU9 C;  3SBC A;  4D73 B;  2B5E A;  4TVE A;  3HJM A;  2VL2 A;  2V32 A;  2RM5 A;  1AQX A;  2AUV A;  2NDO A;  2O89 A;  4HZ4 A;  1LBK A;  2PVQ A;  5IMC A;  4ZXG A;  12GS A;  2WZ9 A;  5E59 A;  4TXO A;  5DVB A;  2IPA A;  2RUF A;  1TJD A;  4K6X A;  4EF0 A;  3MNG A;  3IHQ A;  4TN8 A;  3HYP A;  1A0R P;  3W8S A;  1FW1 A;  5FT3 A;  1AQV A;  3KH7 A;  3LXZ A;  5GST A;  2R4V A;  3VPQ A;  1Z5Y E;  2HNL A;  5F0G A;  4XS6 A;  1OE7 A;  3KIJ A;  2HYX A;  3DGQ A;  1XWG A;  2LQQ A;  1T00 A;  1O73 A;  2CV4 A;  2ES7 A;  3TRQ A;  1GP1 A;  2A2S A;  2H1A A;  2WSC J;  2FHE A;  1DSB A;  4WR5 A;  3TJJ A;  3BCK A;  3MAK A;  2HFD A;  2EIQ A;  1GTI A;  5HFI A;  1V9W A;  3AY8 A;  1AW9 A;  2OE1 A;  1OC9 A;  4JZQ A;  3KZQ A;  3C71 A;  2IJY A;  3DML A;  5JWR B;  3N9J A;  3ZIV A;  5IMV A;  14GS A;  3MWH A;  5IMF A;  4ULX A;  2VCZ A;  2PN8 A;  1XWC A;  3C8E A;  4GRF A;  1WPI A;  1X5C A;  5IO0 A;  3F9U A;  1K3Y A;  2E0Q A;  4ZBD A;  2YZH A;  1FVJ A;  3H1N A;  2FWH A;  3P8W A;  2O01 J;  5DQS A;  3IC4 A;  4CDO A;  1GSS A;  1J08 A;  3W8J A;  3GH6 A;  2X8C A;  3VI5 A;  4EE0 A;  3C1S A;  4HDE A;  2FNO A;  1VF5 B;  3TKS A;  4ISD A;  3W6G A;  5B8B A;  2BTO T;  2GZY A;  3UVT A;  1SD8 A;  4YH2 A;  2XBI A;  3LJR A;  2VO4 A;  4WBJ A;  4MCU A;  1QUW A;  2MBT A;  1B8X A;  4WET A;  3TJG A;  2WCI A;  4WBR D;  2CZ3 A;  4AGS A;  4E8E A;  4HZ2 A;  1Z6M A;  3HA9 A;  1ERT A;  1O8W A;  4MP4 A;  2M80 A;  1TK0 B;  1WP0 A;  4EO3 A;  1ZL9 A;  3L4N A;  3KMN A;  3HJO A;  1F6M C;  3L0H A;  4I7Z B;  2AB6 A;  1G7O A;  5ECM B;  2C0G A;  4ZBB A;  3KTB A;  4RQR A;  2IL3 A;  2M46 A;  4O5R A;  4LL1 B;  4X43 A;  2LS5 A;  3FZA A;  4I2U A;  3I6A A;  2KP2 A;  2IIY A;  1LU4 A;  3H93 A;  3IOS A;  2F51 A;  1ZOF A;  1X5D A;  1E6B A;  1Z9H A;  1W4V A;  4KGI A;  1G6Y A;  2FY6 A;  4I8B A;  3GKM A;  4ZB8 A;  2A4V A;  4N11 A;  1GL8 A;  1XOA A;  3GV1 A;  1X9W B;  1B4P A;  1JLW A;  1MEK A;  2P5Q A;  3QD9 A;  3PIN A;  3GTU A;  2DJ2 A;  1GSQ A;  3GIX A;  2ON5 A;  5ECP B;  2EC4 A;  3L9V A;  1K0A A;  2H0H A;  2C1Y A;  3ZIT A;  3QDN A;  3QOU A;  4BVX A;  4L0U A;  2E74 B;  1XVQ A;  5E4W A;  1O81 A;  3F4R A;  1M7T A;  1YF0 A;  3F63 A;  3UBK A;  4KUN A;  3EU4 A;  4PQH A;  4OD7 A;  2I9H A;  4POL A;  3TKS E;  1YEP A;  3GKN A;  5ELG A;  1NHY A;  1PMT A;  2GS3 A;  3GX0 A;  5B6M A;  2CX4 A;  1JLV A;  3Q6O A;  1TKD B;  4ID0 A;  4NV5 A;  1WOU A;  1YQ1 A;  2N5A A;  5LNK e;  1KTE A;  4TXO B;  1R26 A;  4NPB A;  2WRT A;  3GH9 A;  2DML A;  1M9A A;  3P2A A;  4RKU J;  1ON4 A;  3HXS A;  3KTL A;  1QFN A;  3G7Y A;  1TU7 A;  1EV9 A;  2WB9 A;  2BJX A;  1TW9 A;  1SK2 A;  2LRC A;  5AIV A;  2L4Q A;  2XPD A;  5HFG A;  2DLX A;  2VLU A;  2H74 A;  1WMJ A;  3HD5 A;  4N10 A;  5FHI A;  4OGQ B;  5CRD A;  1EZK A;  2HE3 A;  8GSS A;  4L5O A;  1VF1 A;  2RM6 A;  4X0X A;  3EUR A;  3G9B A;  2LNS A;  2H8L A;  2LV3 A;  5A4W A;  4GST A;  2O85 A;  2FA4 A;  4PGT A;  3IAM 2;  4OCE A;  4ECI A;  2KLX A;  1OC9 B;  1HD2 A;  2C8U A;  3CRU A;  2F8F A;  4IP6 A;  5CRE A;  1JZR A;  2R37 A;  3HZ8 A;  2H71 A;  4LMW A;  4NXI A;  5ECO B;  2HSH A;  2LJK A;  4KT0 J;  2LNT A;  2E75 B;  2ON7 A;  2H0I A;  4L5L A;  3A5W A;  1HNA A;  2VM2 A;  1SJZ A;  4PUF C;  3IA1 A;  2HRF A;  3TRP A;  2OJL A;  4MDC A;  1OKD A;  3KMO A;  1YKA A;  3QAG A;  4OFT A;  1TXX A;  4TR3 A;  4TR4 A;  4DSQ A;  1TRS A;  2LTK A;  3KM6 A;  4TRX A;  3EYT A;  1Q98 A;  4E8H A;  1X9S B;  2H6Z A;  4MZC A;  2H70 A;  5ID2 A;  3GKX A;  3U5R E;  2WPV B;  1S5L X;  2HZE A;  2FUG 2;  1I5G A;  3EVI A;  4OWY A;  2LUS A;  1KNG A;  3LFL A;  4NMU A;  2YZU A;  1GUK A;  2OBK A;  2CX3 A;  3TKP A;  5INY A;  4ZIJ A;  1BJX A;  4NHW A;  2YP6 A;  1K0M A;  4PNF A;  1ML6 A;  4MF7 A;  1C72 A;  5ABR A;  3KGK A;  1ERW A;  1F3A A;  3EE2 A;  1RQM A;  4MAB A;  4H44 B;  1TTZ A;  4HEA 2;  4V1A p;  4I97 A;  2TRC P;  2FCH A;  2H66 A;  3FHK A;  5ENU A;  2JZS A;  2GQK A;  2H30 A;  4GQF A;  4PNG A;  4GLT A;  4YQV A;  1TRU A;  3JCM L;  1AAZ A;  5D9X A;  4ECC A;  4IJ3 A;  1UVZ A;  2AHE A;  2FWG A;  4MPF A;  2MMN A;  4HJ2 A;  3FRC A;  2DJ3 A;  4AF2 A;  1F3B A;  2ZUP A;  3A2W A;  5H5S A;  1TRV A;  1OYJ A;  2H73 A;  2R3X A;  2WDU A;  3Q19 A;  4OO4 A;  2RUE A;  3ZRE A;  1Q90 D;  10GS A;  2IMI A;  3KJY A;  1TI3 A;  4KCE A;  2DJK A;  2YN1 A;  3GTU B;  5D73 A;  1Z3E A;  3ZVJ D;  4HUA A;  2K18 A;  4K8M A;  3F6D A;  5EY6 A;  2G2Q A;  1USB A;  3QCP A;  2E2M A;  3VPT A;  5D8I A;  1YDK A;  3C8V A;  3GUR A;  3P90 A;  4XS4 A;  3UEM A;  3EMP A;  4K7O A;  4IBP A;  2OAC A;  2WFC A;  3CSH A;  4EKZ A;  1FOV A;  4EDZ A;  2H76 A;  2V6O A;  3GYK A;  3GKK A;  3E0U A;  2IWT A;  1A8L A;  1QGV A;  1PD2 1;  2HI7 A;  3VFI A;  2ZCT A;  1THX A;  3KEB A;  3LQ7 A;  2JSY A;  3D22 A;  5IMA A;  1TK8 B;  5ECI B;  1A24 A;  3WGE A;  2DBC A;  5HQP A;  3C7M A;  5H5R A;  4BL7 A;  3M9K A;  1OAZ A;  1T1V A;  4NWY A;  3IR4 A;  3WGX A;  1FG4 A;  5CP1 A;  4MJC A;  3HCZ A;  2PPT A;  4YAV A;  3A2X A;  4Q5N A;  5LD0 A;  5DAL B;  2KHP A;  2D2C B;  7GSS A;  1XW6 A;  3TB2 A;  2GST A;  2YJ7 A;  4IGJ A;  2VCV A;  3DVX A;  4HOJ A;  2GQL A;  3HKR A;  1U87 A;  3IV4 A;  1NSW A;  2VUP A;  2H72 A;  2LRN A;  3BD2 A;  1K0C A;  3BJ5 A;  1LJR A;  5F06 A;  3FKF A;  5KEJ A;  1TP9 A;  2GT6 A;  2KOK A;  2C0F A;  2J9H A;  5G1L A;  1U3A A;  5KN1 A;  1J0F A;  4G10 A;  4IL6 X;  1AQW A;  3F8U A;  1XPV A;  3ED3 A;  1K3O A;  2VD1 A;  3TDG A;  11GS A;  1CQH A;  5HR0 A;  2GT5 A;  3ERW A;  4G19 A;  4LA1 A;  4GCI A;  3LEF A;  4H13 B;  3GA4 A;  2FWE A;  2X99 A;  4IW9 A;  2NBS A;  2H6X A;  1BQ7 A;  1R5A A;  1GTA A;  2VCW A;  5IOW A;  1IYI A;  4RI6 A;  1N8J A;  4K9Z A;  1HNC A;  1OC8 A;  3QFB C;  3C1R A;  4FYU A;  1U6T A;  4G2E A;  2H1B A;  3DKS A;  4WF4 A;  4ECB A;  2CVB A;  4DVC A;  5CRW A;  2G0F A;  3E3E A;  2IME A;  1ZRT E;  2E76 B;  2TIR A;  4BA7 A;  5D93 A;  3WT2 A;  2MMA A;  2I81 A;  1V2A A;  1JHB A;  5ID2 B;  2F9S A;  2VCT A;  2HZE B;  3CYN A;  1HYU A;  1F2E A;  4K2D A;  1SK1 A;  2IFQ B;  3F3R A;  3EWL A;  3DD3 A;  1H4O A;  2MYG A;  1DE1 A;  2L5O A;  1EEJ A;  1VF3 A;  1M2B A;  3IK9 A;  3QFA C;  1YKC A;  1O8X A;  1JZW A;  3M1G A;  4JED A;  3TJB A;  2AAW A;  20GS A;  4MLY A;  2E2G A;  3TKQ A;  2YWN A;  3EU3 A;  1ST9 A;  4I5Q A;  5JCG A;  1R4W A;  4JU5 A;  1NHO A;  2YWI A;  1K3L A;  2XC2 A;  4O7H A;  2FLS A;  4LL4 B;  1SU9 A;  4F0B A;  3F4T A;  2B5X A;  3FY7 A;  1MTC A;  3MSZ A;  1S3C A;  4OCF A;  2IMD A;  1ZMA A;  4KX4 A;  3CTF A;  2C3N A;  3I69 A;  1O85 A;  4FH8 A;  3TUE A;  1TI1 A;  3OR5 A;  5ECR B;  3RAZ A;  4J56 E;  4EUY A;  6GSX A;  1Q4J A;  4ML6 A;  4ACS A;  3N5O A;  1UN2 A;  3F3Q A;  1JZO A;  3EC3 A;  4O92 A;  2DJ1 A;  4XS4 B;  2IMK A;  4JBB A;  1V57 A;  1XIY A;  2HLS A;  5DDL A;  1PA3 A;  4EC0 A;  5D9V A;  5GZZ B;  4FIW A;  4YQM A;  1G7E A;  3CXG A;  5G30 A;  5JCW A;  1ERV A;  1EP8 A;  2LRT A;  2IMF A;  3UVH A;  1RW1 A;  3EIN A;  1GWC A;  3QAV A;  1FVK A;  1YF1 A;  5EPF A;  5AIS A;  2E7P A;  1EV4 A;  1B48 A;  5HR3 A;  2K9Y A;  4DSR A;  1A2L A;  1B9X C;  1EWX A;  2DIY A;  5ECS A;  1MDI A;  4O32 A;  4V2L A;  1XOB A;  2PER A;  1PGT A;  1A2J A;  4KW6 A;  3ZZX A;  2VCQ A;  2K8S A;  5H5Q A;  5J4U A;  2B7K A;  3IBH A;  3TOU A;  3KCM A;  2HZF A;  3L9U A;  1THO A;  3ZFL A;  1GUH A;  2JL4 A;  2V1M A;  1ZZY A;  3VUR A;  2C3T A;  2VCX A;  4XHM A; 
#chains in the Genus database with same CATH topology
 3WT1 A;  1FZF A;  4H0L B;  1MDJ A;  1Y8A A;  3TGU J;  3N7N A;  2JP3 A;  4GQC A;  1KEB A;  2MBS A;  1AXD A;  2ZYG A;  3KZI H;  1FB6 A;  2H1D A;  3APS A;  5F05 A;  3AE5 C;  1YEX A;  4XE5 B;  2K9J A;  5DAL A;  4Q5Q A;  3DXB A;  1NTK G;  5BVZ A;  2DIZ A;  2HRA A;  3HDC A;  1A0F A;  5A5K A;  1KZU B;  1YQ4 C;  4KSO A;  2GLR A;  1M8O B;  3C9I A;  4F9Z A;  2NPS C;  2P67 A;  3GNJ A;  3M0A A;  2L6D A;  2SPZ A;  3EMX A;  3KH9 A;  2DC5 A;  1T4Y A;  4ZL7 A;  4Q5R A;  3UIW A;  5IIZ A;  1N2D C;  3D70 A;  3RL0 C;  3ITK A;  3H1K G;  5AVT B;  2AXC A;  1L0L D;  1UA5 A;  5GAP D;  2FD3 A;  5ECL B;  3G71 P;  1FOS E;  4TLF A;  2XBQ A;  2YMK A;  3HTK A;  3MP7 B;  2M72 A;  5CMZ A;  22GS A;  1SVF A;  4O5Q A;  2WSE J;  3RDW A;  3L74 E;  2BEQ D;  2KS1 A;  2WPQ A;  3D4M A;  3CCS P;  1GTB A;  5CCH A;  5JCU A;  2H43 A;  4MPG A;  3A2V A;  2Q6Q A;  4Z7X A;  4TW5 A;  4XCS A;  1PSQ A;  3FW2 A;  3FZ4 A;  5KLI C;  3M9J A;  2DSA A;  3WD6 A;  2B88 A;  5DCH A;  3RPP A;  3S4R A;  1RY3 A;  4ZIL A;  4ZKU A;  3FXD A;  2M3E A;  3ZLP A;  3Q2Y A;  2DMM A;  2RII A;  3ZMK A;  3M3M A;  4MF6 A;  2OBI A;  3Q74 A;  5KJ7 A;  1VQP P;  3V2Q A;  1HNB A;  3H79 A;  2L5L A;  4ZKP A;  4DJG A;  4F0C A;  4W80 A;  4FO5 A;  5CCG D;  4AJ7 A;  2KLV A;  4DOJ A;  4DSS A;  1PX7 A;  3HUS B;  2PGD A;  1CZQ A;  1S3D A;  3RBX A;  6GSS A;  3L74 J;  4RI7 A;  1NU1 G;  4GTU A;  1SFC C;  2M3B A;  3L70 G;  3H8Q A;  1U7M A;  3LGC A;  2B6M A;  3I9V 2;  3ZTL A;  5KAF E;  4IN0 A;  1GNW A;  5L71 A;  3JSV C;  2Z4E A;  3GHA A;  1GK4 A;  3E9J B;  4W7Z A;  1J9B A;  3A5I A;  2V6K A;  2XU6 A;  1WRY A;  3T97 B;  5APQ A;  3LYK A;  1A02 J;  2Z5I A;  4MMM A;  4YQU A;  1PKW A;  4POM A;  1N73 B;  2FXM A;  1USD A;  4PV1 D;  3H4K A;  2F8A A;  3SWY A;  1XWK A;  1AIU A;  5G5F A;  3APQ A;  1GL2 B;  3Q5R A;  1KIL E;  1AQT A;  4DT0 A;  1ZYE A;  2IFQ A;  4V1A g;  1HBW A;  2JWD A;  1NTM D;  5D9T A;  2OE0 A;  2YCD A;  1ERU A;  3CBU A;  5KOW A;  4L8E A;  3HE4 A;  4JPZ B;  4XIH A;  1ZV8 A;  2HSY A;  4ZL8 A;  2O01 N;  3L73 J;  1V40 A;  4BWS A;  3J7Y b;  1EEM A;  5IM9 A;  5IOX A;  1XWB A;  2KNC A;  1H89 A;  3CX5 D;  2KUB A;  1M99 A;  1SQX D;  2YIU C;  3L78 A;  5AVS B;  1SL1 B;  1M90 Q;  4PQ1 A;  5C39 A;  4I2T A;  3F6F A;  2IN3 A;  3CCR P;  5J9B A;  1L0L K;  1M56 D;  1GTW A;  1M1K Q;  3IDV A;  1URM A;  5APV A;  1K04 A;  4U3F D;  3CC7 P;  2QC7 A;  1JY3 N;  3KXO A;  3UAR A;  2N5B A;  1YQ3 C;  3UL3 A;  3DIE A;  2HXK A;  3R2Q A;  1HF9 A;  3VLN A;  1H75 A;  2X64 A;  1HGZ A;  5KAI E;  1PFO A;  3BOA A;  4JR6 A;  2P2U A;  2HRN A;  1KMI Z;  2D2Z A;  2GDR A;  4RUV A;  1PP9 E;  1FB0 A;  3L36 A;  3DEX A;  3MYD A;  1SQB G;  2FA8 A;  2LQO A;  1PFI A;  4GDO A;  1VF5 C;  2L91 A;  1G6W A;  5ELA A;  1VRS D;  1T3B A;  3CPW O;  3NIV A;  3SFD C;  3F4S A;  4A5P A;  4JQ0 D;  4C7N A;  1EQ7 A;  1EOG A;  1SL2 B;  4MH3 A;  1Z7P A;  2R32 A;  4MJB A;  2IBZ I;  1ZCP A;  2CVK A;  1LTS C;  2H88 C;  1R7H A;  2Y9Y A;  4N30 A;  2YAN A;  4AJ6 A;  1A23 A;  3WGD A;  3AEC C;  1GTU A;  2PVO C;  2PGT A;  4Y28 J;  1OIP A;  3H1J E;  1MDK A;  2VIM A;  1SQV G;  3CWB D;  2KI7 B;  1O7U A;  1PP9 J;  4BXL A;  3AE6 C;  1PRX A;  2I1U A;  4QQ7 A;  3L71 E;  1ZYQ B;  5CCG A;  2A45 H;  2CQ9 A;  3LG6 A;  1NHL A;  4OFM A;  4MJE A;  1SYX A;  3JCU E;  1L4A A;  4O5U A;  3AE4 C;  3G7I A;  2MMZ A;  1KN7 A;  3TGU G;  3L9S A;  1KBN A;  1FHE A;  4G0I A;  1SD9 A;  2TRX A;  4I7Z C;  2BEZ F;  1GSF A;  2GSS A;  1MFZ A;  2ZJS E;  1WWJ A;  3HHV A;  2VLV A;  1JY2 P;  4CY8 A;  3D6Z A;  2B1L A;  2GQM A;  1BGY J;  5IMD A;  1SL0 B;  2QJP C;  2WQY C;  2WSE H;  2OE3 A;  3M9H A;  2V2G A;  4JRR A;  2B3S A;  2VD0 A;  5DBQ A;  3A7O A;  3GN3 A;  4PXO A;  5D9W A;  3Q1M A;  1VQ8 P;  2QA4 P;  1NAY A;  3RHC A;  2E42 A;  1FS0 E;  1DX7 A;  3L71 J;  2H7H A;  3KD0 A;  3APO A;  4MH2 A;  5CRH A;  1NTM K;  2AXT H;  1WJK A;  2EIO A;  4L74 A;  4DZO A;  3CC4 P;  5G2Z A;  1S3A A;  1R8E A;  4JF7 A;  4JR4 A;  5IPH A;  1PQN A;  3LOR A;  4OMV A;  1KIL B;  3GMA A;  2H0G A;  5A4U A;  3VI7 A;  2WJU A;  2WSF J;  4KCA A;  1CI6 A;  3CXH D;  1FZG A;  3HVV A;  3TCO A;  4QL9 A;  4KB3 A;  3RK2 C;  1G2C A;  3ERF A;  4LMV A;  4TR0 A;  3PP5 A;  4PV1 C;  1LTB C;  3TDK A;  1V98 A;  1SQX K;  3QAW A;  1VQL P;  4GWR A;  4TOP A;  6GSW A;  1T8E B;  1BCC J;  2OTJ P;  1SQQ E;  1XXU A;  2VOC A;  3IF4 A;  1AFO A;  2VL3 A;  3RK3 D;  16GS A;  2P58 A;  1TOF A;  4TKY A;  3CL3 D;  3VWU A;  4POB A;  2K6V A;  4XFJ A;  2P31 A;  1F37 A;  3NOF A;  1U3I A;  1LWU A;  2X49 A;  4RQX A;  2AJQ B;  4UB8 H;  3IAS 2;  2WTY A;  4CPG A;  2VRS A;  4EOT A;  1T3U A;  1KYO H;  1NVO A;  1QVF O;  3FR6 A;  3IAO A;  2YJH A;  3TF5 A;  1L0L E;  2QJY C;  1S5L E;  2FYN C;  3D21 A;  1QGK B;  2M8R A;  2OKA A;  3ME7 A;  5COH A;  5ECN B;  2JEE A;  5KLI B;  4HJG H;  4I1L A;  3BVH A;  4BVY A;  1SQQ J;  3HTK B;  1SKS B;  2IDB A;  4MA9 A;  1AC1 A;  1VF4 A;  4A7P A;  1B9Y C;  2VL2 C;  3UBL A;  1XZO A;  2YPM A;  2IYP A;  2L4C A;  2KS1 B;  2R3S A;  3LW5 J;  4IFM A;  1DUG A;  5ECQ B;  4JYC A;  5KAF H;  1N7L A;  4DEJ A;  1M2A A;  3MHV A;  3GSS A;  3ZRD A;  2M0B A;  5AVX B;  5AW1 B;  4NV2 A;  4L0W A;  3LXT A;  1JZD A;  1ACV A;  2A2P A;  5KLV G;  4PJ0 H;  3U1A A;  2O8V B;  4PD4 D;  1M9B A;  5B6N A;  1XW9 A;  3B71 A;  2KP1 A;  5KKZ C;  4IQA A;  1L0L J;  1SFC B;  3ZVJ A;  1GSD A;  1SJ6 A;  2L59 A;  2QRX A;  4H44 D;  5IO2 A;  1Y25 A;  4WKW A;  1K05 A;  2Q1K A;  4DSS B;  3M0D C;  1KQF B;  1SJI A;  1RE4 A;  2ZXX A;  3R2P A;  5AW2 B;  3TKR A;  3E1R A;  2Y0D A;  2JR8 A;  3WUV A;  2P0G A;  1LTJ C;  3H32 B;  5C04 A;  1LGH B;  1GSU A;  2KB7 P;  2VM1 A;  5G5E A;  4N78 D;  4F2I A;  5J41 A;  3CXH I;  1U88 A;  1HQO A;  3A2A A;  3BCC E;  4HJM A;  3TRX A;  1QMV A;  4IHU A;  3I56 P;  1SKR B;  1YZX A;  3HVN A;  3S9F A;  3N4X A;  2V41 A;  2IBZ E;  4ASW A;  1M7L A;  3VWV A;  3MIW A;  1MKM A;  4OGQ C;  5AVU B;  1GRX A;  1JMM A;  3A3T A;  3C73 A;  4OFN A;  4XRA A;  3UJ1 A;  1Z56 A;  2C0X A;  3VYI A;  1ABA A;  3VMX A;  3CCJ P;  3CRT A;  3LYP A;  1BSH A;  2ZNM A;  3HY2 A;  4K7I A;  2XPE A;  1B4Q A;  2N1T C;  4WEY A;  1RF0 A;  2JAD A;  4WY4 B;  3QR6 A;  1YJ9 P;  1FC2 C;  1XWA A;  3HD7 D;  2ZT9 D;  2A45 I;  3DVW A;  4BWN A;  2AEF A;  2VL9 A;  3BCC J;  3FZ9 A;  3TOT A;  2HPC A;  6GSU A;  1SEN A;  2IFN A;  5B5E H;  2LXC B;  2PUK C;  5DQY A;  2WT7 A;  3UMA A;  1KQL A;  4FYB A;  2PBJ A;  2HT9 A;  2JZR A;  1NWQ A;  1P84 H;  3M8N A;  2KSJ A;  3CQF A;  2GSR A;  4KE3 A;  2E75 C;  2HOD B;  2KNC B;  4ML1 A;  3ZFB A;  4HKZ H;  4OO5 A;  2K9F A;  5B7C A;  3BAS A;  1H0T A;  3CMI A;  1A2M A;  1OW6 A;  1GUM A;  1OE8 A;  3RGU A;  2R0G A;  2OYI C;  2R5B A;  3CD6 P;  2FKW B;  4ZNC A;  2O87 A;  2GA1 A;  1NM3 A;  2YNY A;  2YWO A;  4GOE A;  3H1L D;  2VAF A;  2R5G A;  2KZJ A;  4U3F E;  5EVO A;  3IE3 A;  3H1I D;  2GM4 A;  3TJK A;  1NTZ E;  3MUD A;  5KN2 A;  1GMJ A;  1RK4 A;  1E2Y A;  2E43 A;  1I9D A;  2BMX A;  2R2J A;  4P3Y B;  2P7J A;  2X8H A;  1BX9 A;  3M0F A;  2JDI H;  2UWJ E;  4IS0 A;  2FGX A;  1WT6 A;  3JCU H;  4HQS A;  3V4W A;  3VK9 A;  3H1H D;  1YIJ P;  2YV9 A;  1GLP A;  2QVA A;  2NPS D;  2GSQ A;  3OA7 A;  1GK6 A;  1FZA A;  1SQX J;  1K0O A;  3TKS C;  2GZZ A;  3HJP A;  2WSF H;  1T7P B;  2QSI A;  4C7N B;  1SK0 A;  3RL0 D;  4HI7 A;  5KN0 A;  4BPY A;  3ZL5 A;  5BMU A;  2CT6 A;  1G0T A;  3H1J G;  1WIK A;  1GH2 A;  1M3I A;  4U3F J;  1T8Z A;  1NTZ J;  3TJF A;  1EZV D;  4K1F A;  3CWB E;  3PH9 A;  2FY8 A;  3L71 G;  1PPJ D;  3O76 A;  2CPS A;  2K3R A;  1KYO I;  2PRR A;  3GUS A;  2FWF A;  1S2E A;  3QH9 A;  3D5J A;  4GSN A;  1G1J A;  1QXH A;  2B7J A;  1VF2 A;  5EFW B;  2L6C A;  2F3M A;  1A8Y A;  4W7Y A;  2ZVO B;  5GTH E;  1OKT A;  3ERG A;  2DJ0 A;  4MZB A;  4X4J A;  1Y6E A;  3K5B A;  5AVR B;  3D0Z A;  1Y47 A;  4IOI H;  13GS A;  1GSE A;  5G31 A;  4FYC A;  3JC2 2;  1QK8 A;  5AW8 B;  1S4X A;  4H44 C;  2OYH A;  3GL3 A;  3IXR A;  3CCU P;  3O3T A;  4PX1 A;  4LLR A;  4HQZ A;  1X0T A;  1ZP0 C;  2JJL A;  1JY3 P;  6GSV A;  1JB0 J;  4D6T D;  3U1C A;  3FGA D;  3CWB J;  3R3E A;  3P8C D;  3USS A;  5C00 A;  2J58 A;  3I5C A;  1J1E B;  1YY7 A;  1PIX A;  6GST A;  2OAD A;  5AIX A;  3FWN A;  3F5H A;  2GZP A;  1JFU A;  3MDK A;  4O9B A;  1LT9 A;  4PV1 B;  17GS A;  5J3R A;  1Q