2QSIA

Crystal structure of putative hydrogenase expression/formation protein hupg from rhodopseudomonas palustris cga009
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
PTLVDEATVDDFIAHSGKIVVLFFRGDAVRFPEAADLAVVLPELINAFPGRLVAAEVAAEAERGLMARFGVAVCPSLAVVQPERTLGVIAKIQDWSSYLAQIGAMLAEVDQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of putative hydrogenase expression/formation protein hupG from Rhodopseudomonas palustris CGA009.
rcsb
source organism Rhodopseudomonas palustris
molecule tags Structural genomics, unknown function
molecule keywords Putative hydrogenase expression/formation protein hupG
total genus 23
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07449 HyaE Hydrogenase-1 expression protein HyaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qsiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2qsiA01
2REMA 2GQLA 5HR3A 1B4PA 1WRYA 2EIRA 4K0NA 4X0XA 1VF2A 3H79A 4N11A 3BD2A 3A2XA 5ECLB 4TXVA 1JB0J 2H0GA 2VCZA 1Z3EA 2YZHA 5CRDA 2H76A 2GSSA 4HQZA 1FB6A 3F9UA 1A0FA 3CTGA 1QQ2A 3FR9A 3EINA 2RM6A 1SK1A 2N5BA 5DJMA 4EC0A 3LORA 1HYUA 4KSOA 1SENA 3IAM2 2PUKC 3N5OA 4ML6A 1SD9A 3F4RA 3SWLA 1YEPA 3I9V2 4TXOB 5CYYA 3TJGA 2CZ2A 2P5RA 5INYA 1SL0B 3IOSA 5G31A 3ZL5A 3F4TA 5D96A 3IR4A 4TOPA 1XW6A 2B7JA 1GTAA 4HZ4A 1MD4A 2C0GA 4K0GA 4BWSA 1G0TA 2KLXA 3G7JA 1NHOA 1M2DA 1LBKA 2F9SA 4IJIA 1R5PA 2QIWA 3TKSE 4WBJA 2LKUA 3ZIVA 3VK9A 5HQPA 4D73B 3M3MA 2R5GA 4IW9A 2FLSA 1BEDA 1OKTA 3APOA 1TRSA 2E2GA 4JZQA 2OKAA 3Q19A 4MZBA 4GCIA 4JBBA 1OKDA 3EMPA 5IMZA 5CP1A 1NW2A 2YOIA 1A0RP 3FRCA 4HUAA 2X8CA 1BQ7A 1X9WB 3FZ5A 5ECSA 5J9BA 5D9TA 4GSNA 2V6OA 3UEMA 2K18A 4YAPA 3WT2A 4G19A 1TTZA 1XPVA 3IAS2 6GSXA 3HKRA 2KUCA 3F63A 1ZCPA 4CDOA 3GV1A 3NZNA 1X5CA 2FA4A 5DCHA 5D73A 2O85A 3NIVA 1HD2A 1NSWA 2B3SA 1SL1B 1Q4JA 2PVQA 3EVIA 1WP0A 9GSSA 3KH7A 4POKA 2K8VA 3TB2A 1PKZA 1GSFA 1AQXA 1BAYA 5IPGA 3UARA 1PN9A 1OVNA 2VM2A 2E76B 1QGVA 3HZ4A 5B6NA 4I8BA 4KAEA 5IO2A 2C0EA 1UA5A 3EU4A 3QAGA 4PQ1A 1HNBA 3ZITA 2C4JA 1M7TA 3HCZA 2O8VB 1T8EB 3FW2A 3UBLA 3EU3A 1ZMAA 4MABA 4AGSA 5DQYA 3FYGA 1WMJA 2H70A 2WJUA 2DJJA 4NHZA 1TOFA 2GQMA 1GUMA 2MMZA 5G30A 7GSSA 2HSHA 1EEMA 3TOUA 5IIZA 5E4WA 1YJ6A 5GAND 4AJ6A 5A4UA 3U5RE 3H4KA 2LJKA 3KP8A 4F0CA 3I69A 1XVWA 2O01J 5C00A 2H66A 2IMIA 2XC2A 4TR1A 1TU7A 4IP6A 2JL4A 2K9FA 2LTKA 1XCCA 2KP1A 3QAVA 2CA8A 1O7UA 5ECQB 1NM3A 2HRFA 4WEYA 4ILFA 5JWRB 3KGKA 1M9AA 4EUYA 1Y6EA 1YQ1A 4FYUA 5EY6A 1VF4A 2VO4A 1Z9HA 2AAWA 1VRSD 5A4VA 3VWXA 2JZRA 3FY7A 3TCOA 2DIYA 2WDUA 3FZ4A 3F3RA 3CRUA 2L5OA 1TI3A 4NV5A 2IMKA 1URMA 1K3LA 1QUWA 1ABAA 5DALB 1CQHA 4WF5A 1F6MC 2R2JA 2GTUA 1YZXA 2FUG2 5CRHA 5HR1A 4OO5A 3WGXA 3HJPA 1KEBA 4TR1B 3Q74A 4CHSA 4Z7XA 2X64A 3A2VA 4DVCA 2DJ1A 1B9YC 1GL8A 3ZTLA 1MEKA 3HDCA 2H74A 3GX0A 4XCSA 3BJ5A 3TKRA 3UVTA 1BG5A 4G9HA 5F0GA 2D2CB 4K7IA 2HZFA 1G6WA 5JCWA 4OFMA 4F03A 1EGOA 2LNTA 2VAFA 1NHYA 3F8UA 3VPTA 5ECRB 2YCDA 3QR6A 4G2EA 2GT6A 5ECNB 3QFBC 4PGTA 1T4ZA 5DJLA 2MZCA 5J3RA 2N5FA 2V32A 1U88A 3VWUA 2CX4A 2L4QA 5KN1A 5D9WA 4PQHA 3R2QA 2R37A 1VGLA 2GSQA 3GUSA 2ES7A 4NXIA 4NMUA 5HR0A 3F6DA 3E9JB 3FZAA 3ME8A 4I2TA 1JZDA 1PKWA 4XIHA 1GP1A 1GUKA 4KX4A 4IS0A 1JLVA 5EL8A 2VLTA 3TKPA 2ZCTA 4CW9A 3GSSA 1GRXA 2IN3A 2RIIA 2R4VA 2GT5A 1TRUA 18GSA 4FIWA 4K9ZA 4N0ZA 3BBYA 3CSHA 2WS2A 2L4CA 2EC4A 2RM5A 3C7MA 3HJOA 1GSSA 2XBIA 3GX8A 2HYXA 3HVSA 1UVZA 3TDGA 4IGJA 3WT1A 3PGTA 3ZRDA 3A2WA 1A2LA 5GZZB 3ZREA 4E8EA 5B8AA 5L8RJ 2DLXA 5J41A 2AJQB 3G7YA 4PX1A 1RK4A 4O32A 1VF3A 2J23A 5E59A 4X43A 4MF6A 2L6CA 2JSZA 3H8QA 2FYNC 4ID0A 2CV4A 2H1DA 3LXTA 2CAQA 5A4WA 3D0ZA 3U6VA 3ZIJA 1XBSA 1OYJA 1QK8A 4KA0A 3HD5A 5ECMB 3HY2A 3RBTA 2C3QA 1EGRA 5JWQB 3W8JA 1ZRTE 3CRTA 4EE0A 1AQVA 1J9BA 2WCIA 3F3QA 3FEUA 4GRFA 1X5EA 5DVBA 3L78A 4BPYA 1A8LA 5D9VA 3IXRA 4I5QA 4L5OA 1K0BA 2NTOA 4HOJA 1E6BA 4BWQA 2DBCA 4JR6A 5GAPD 3OR5A 4XRDA 3M8NA 3ZLPA 2FGXA 4Q5FA 1GNWA 3KIJA 4WXTA 2ZNMA 2GZPA 2CZ3A 5HR2A 1JZRA 1GULA 5F05A 3C73A 3LG6A 1PX7A 1JZOA 1SJIA 2YWMA 1G7OA 4OD7A 3VPQA 2H6XA 4KE3A 1O81A 2JZSA 1EP8A 4FO5A 3EURA 4GSTA 1J0FA 1AQWA 1FVKA 2ALBA 3C71A 4GF0A 2MMOA 3LXZA 4PURA 3DXBA 2YP6A 2AHEA 3GL5A 4ZB8A 5ECPB 5G5FA 3UIWA 1GSQA 1FB0A 2C3TA 1IYHA 2ON5A 5DCGA 1V98A 2H1AA 1YF1A 1S3DA 1OAZA 2WZ9A 3NOFA 1F37A 3DRNA 5IMAA 1PQNA 2PU9C 4TN8A 1YF0A 2CVBA 1USBA 4JR4A 1QFNA 2OACA 3EYTA 1W4VA 2AB6A 3ZVJD 1MD3A 1B4QA 2VD0A 5HFIA 1ILOA 4TR3A 1YDKA 2MYGA 1GSUA 5A5KA 4ZILA 1M0UA 2KP2A 1O85A 1XVQA 1DSBA 4PUAA 2GLRA 3UBKA 4V2LA 2HRNA 3S9FA 1TU8A 3KTBA 1SK0A 2VL3A 2MMNA 4ECBA 8GSSA 4YQMA 3P2AA 2VL2A 1SD8A 4MH3A 2LJAA 5F06A 2EIQA 4OFNA 3FHKA 3GN3A 2BJXA 3LSZA 3IHQA 3VFIA 3TKSA 5LNKe 1K0AA 3TUEA 4YH2A 4JU5A 4AF2A 2V2GA 1XW5A 1ERVA 3VWWA 1PD21 4J2FA 2LRNA 4ISDA 4MJBA 2H6ZA 4WETA 4KDYA 4LMWA 2H1BA 1DE1A 1OC8A 3I6AA 3DEXA 1DE2A 3BCIA 1BJXA 4Q5NA 4PUFC 5JCGA 2PMTA 4E8HA 4POBA 5LD0A 1R4WA 4XHMA 4KCEA 1XOBA 1J08A 1T3BA 3PR8A 2DJ3A 4PNFA 4WBRD 3US3A 2QJPC 2VLVA 3C8VA 1TKDB 1KNGA 2N5AA 2HNLA 1TI1A 2Z9SA 2DJKA 3VURA 4K1FA 3KCMA 4OCFA 5H5QA 2FD3A 2I1UA 4P3YB 4HJMA 5LCZA 3VLNA 6GSUA 2H0HA 4IQAA 3P90A 4TW5A 4L0WA 3EC3A 2XHFA 2PWJA 1AIUA 4IELA 1X5DA 1ZL9A 2FWHA 2HT9A 1JFUA 5JCUA 1T1VA 4F2IA 4WR4A 1T4YA 5KN3A 14GSA 2L5LA 1I9DA 4ML1A 2X99A 5D8IA 5ENUA 2DJ2A 3EMXA 3GHAA 3CTFA 2MBSA 2VCVA 1GSEA 4K8MA 1PX6A 2I81A 2WRTA 4MP4A 5CAXA 2DSAA 1DBYA 1F9MA 1GTUA 3HJMA 3KD0A 4IP1A 2LRTA 2H6YA 1WJKA 2OADA 1K3OA 12GSA 2R6KA 2WPVB 1PSQA 3LYKA 5F07A 1GLPA 3BCKA 1K0DA 4XS6A 2JADA 5F8BA 5ECHB 1VF1A 2FA8A 3LQ7A 3ERWA 3D21A 1FVJA 2DJ0A 3CYNA 4I97A 1N2AA 2K9YA 3GURA 5FWGA 2WSEJ 3FR6A 3UMAA 3KXOA 3VI5A 1SL2B 1B9XC 5ECKB 11GSA 2B1LA 4MPGA 4KH7A 2DMLA 4XTSA 1THXA 3M9KA 3RDWA 3DYRA 4F82A 1Q90D 4K7OA 1UC7A 2TRCP 1WWJA 2QGVA 2ZT9B 2NDOA 4MZWA 4XS1A 1ERTA 2LJRA 2M72A 3QAWA 1ZYEA 1XZOA 4EF0A 1WIKA 2IIYA 1C72A 1EP7A 3IDVA 1GSYA 1XW9A 3KJYA 4Q5RA 3LYPA 3LJRA 2IMDA 3H1NA 5IO0A 1GUHA 3AY8A 4ECIA 4HZ2A 3D22A 1A24A 3GKXA 3LGCA 1SKSB 1SYXA 1K0OA 4RQXA 4N30A 4IKHA 2PERA 3LW5J 3IA1A 1EWXA 2I9HA 4KW6A 2PVOC 1SU9A 4EDZA 2HLSA 3CXGA 4NAXA 4LLRA 5D93A 2XPDA 4NPBA 2C8UA 1DUGA 4GWRA 3C1RA 5H5SA 1TK0B 3IPZA 3MWHA 4ACSA 3V1WA 2VCTA 1V58A 5KN2A 1V40A 4DSRA 3Q6OA 3IV4A 2OJLA 4GLTA 1HNCA 1SJ6A 3ERFA 2GZYA 2HZEB 4ZBAA 2CAIA 2FWEA 2OBIA 1LJRA 13GSA 2NPBA 2FHEA 1WPIA 1SKRB 1S3CA 1EV4A 2WB9A 1Z7PA 3KZQA 2OE3A 2YJHA 4ULXA 2P5QA 4RQRA 4YQUA 2LV3A 6GSSA 2YV9A 3EE2A 2L57A 3L9VA 5B7CA 5DDLA 3VI7A 3IBHA 2H73A 4N10A 1MDJA 16GSA 3MNGA 3VWVA 4O7HA 4IN0A 1GNEA 3J7Yb 1V9WA 5COHA 6GSWA 2PGTA 4ZL8A 1V57A 3KTLA 4OWYA 3APSA 4D73A 5J9CA 3ZFLA 3TOTA 6GSTA 3PINA 3HXSA 2VCXA 2LRCA 3BOAA 3H93A 3GKKA 4PQIA 3KM6A 4V2MA 1T7PB 1GH2A 1AUCA 1PGTA 2E0QA 3TGZA 2K8SA 3TKQA 2HXKA 2HZEA 2WSCJ 2M80A 2YWIA 1HNAA 17GSA 4K6XA 4ZBDA 2RUFA 5G2ZA 1MDKA 2F8FA 3P7XA 4L0UA 4ZB6A 2H71A 3RPPA 1A8YA 4LMVA 5CRWA 3Q18A 1ZYQB 1VF5B 1AC1A 4JRRA 2JACA 4QL7A 3O3TA 3TKSC 3QD9A 2GSTA 2GS3A 3O6TA 3M9JA 2IMEA 1JZWA 3UL3A 2H01A 2B7KA 2E74B 5AGYA 3RHCA 1OE7A 3MDKA 1FO5A 1FAAA 3UOMA 2VL9A 2LEGA 1M9BA 1GWCA 2YWNA 3F6FA 4GQFA 2NBSA 4AJ7A 5KEJA 3WD6A 4ZBBA 4KT0J 2FWGA 2YV7A 5DBQA 3LFLA 4HU9A 5ID2B 2L59A 4RI7A 3UVHA 2VCQA 3GIXA 2PBJA 4N0VA 4KB3A 4ECJA 4PNGA 1Z5YE 2QJYC 3HVXA 1OE8A 5KLIC 2G2QA 1TRVA 2B1KA 4JE1A 1A23A 2PPTA 5J4UA 2F8AA 2A2SA 1G6YA 3W8SA 4HU7A 4AJ8A 5CO3A 2VM1A 3HHVA 2VOCA 3MSZA 1XWBA 2RUEA 4DSQA 3ZMLA 1ON4A 5JWOB 1ERUA 2V1MA 4J56E 3APQA 5IMDA 3MAKA 2YPMA 4MMMA 4YAVA 4MDCA 3I43A 1MTCA 1F2EA 2GGTA 4LA1A 2GZZA 1FW1A 4ZIJA 5C04A 2CVDA 1G7EA 3KMOA 3TRQA 3TRPA 3ZZXA 1RQMA 1TJDA 2HI7A 3TJJA 4MK3A 2H75A 1EEJA 4KSMA 4MLYA 1BYEA 2GVPA 4OO4A 5ID2A 4H86A 2H0IA 2H72A 3ZMKA 2FY6A 4MH2A 4WR5A 2WGRA 1O6JA 4TR0A 5CRGA 1H75A 5H5RA 1GTBA 3CSJA 4TR4A 3A3TA 2OE0A 1M99A 3RHBA 3GH9A 3E0UA 1R5AA 4L8EA 1S3AA 3ME7A 3HA9A 4EVMA 3E3EA 2H8LA 5DALA 1SKWB 2LNSA 5CNWA 2G0FA 2LS5A 1TK5B 1XIYA 3N9JA 2GSRA 3CMIA 2QSIA 4GXZA 5IM9A 4ZXGA 3D4MA 4F0BA 4K2DA 4GSSA 2E7PA 1SK2A 1JLWA 3M1GA 1YEXA 3L9UA 1XOAA 2VL2C 4EO3A 1M2AA 4J57E 4BVYA 4LL1B 1U3AA 4K7NA 2YNXA 2F3MA 4PV1B 1K3YA 1PL2A 4LL4B 4JEDA 4QL9A 1E2YA 2P0GA 1U3IA 3CBUA 1ERWA 2CVKA 3GTUB 4OMVA 5HFKA 2F51A 5G1KA 1XWKA 5AISA 4XS4A 2MBTA 5ECOB 1IYIA 2YN1A 2V6KA 2H19A 4I2UA 1YY7A 4ZB9A 2B6MA 1SYRA 5HFGA 2FCHA 2V41A 4HEA2 5GSTA 1Z6MA 1BX9A 2O7KA 4BVXA 4QQ7A 1W89A 1F3AA 2QJKC 1Z6NA 1PL1A 2KOKA 4V2NA 3IC4A 4MZCA 2VD1A 1R7HA 2AUVA 3DGQA 5ELGA 3GSTA 5G1LA 4HS1A 2K6VA 1OC3A 4MA9A 3ZVJA 3ED3A 2QKEA 4NHWA 2IPAA 4TRXA 1K0NA 3QOUA 1ZOFA 1CQGA 5AIXA 3SBCA 5J5NA 4HI7A 3GKNA 2YZUA 2CX3A 3DD3A 3RAZA 6GSVA 4EXJA 5AIVA 3FKFA 3DWVA 4HQSA 3GFKA 1Q98A 4KDUA 3DKSA 2VCWA 3QCPA 3M0FA 1X0RA 3WYWA 2FNOA 4KGIA 4MPFA 1KBNA 3FR3A 4MJEA 4IQ1A 2H30A 2E75B 4YQVA 1TP9A 4MJCA 3ERGA 3GL3A 2O87A 2IFQB 4X1UA 2P31A 3QMXA 2CQ9A 4KDXA 1O73A 2YIUC 2LQOA 3D4TA 2IL3A 2YWOA 2C80A 2X8HA 1EV9A 2VUPA 3GKMA 4BL7A 1WE0A 4L5LA 2EIOA 1X9MB 1B48A 3QDNA 2RLIA 4GTUA 2WSFJ 4TKYA 5CREA 4KNDA 2H1GA 3W6GA 3GA4A 5FT3A 2BTOT 1JHBA 4RI6A 2LSTA 4TVEA 3KH9A 2ZUPA 1RW1A 4H0LB 1TW9A 5KKZC 3HZ8A 5DAKA 3KEBA 4DSSB 4EDYA 2C0DA 1GLQA 4IBPA 3EWLA 2OA7A 1YKCA 3GMFA 4IHUA 2B5EA 3FZ9A 2A2RA 1ZZYA 1AAZA 2I4AA 2JSYA 3FK8A 1T00A 1R26A 2VIMA 20GSA 1QXHA 1Z7RA 1ML6A 3K8NA 1ST9A 1WOUA 6GSYA 1TRWA 2J9HA 2QC7A 1XXUA 4FYBA 3HVVA 3G7IA 4MCUA 1K0MA 3JCML 2IFQA 3IK9A 3RPNA 5IMCA 2OE1A 5EPFA 2IJYA 3TRXA 4I7ZB 4NV2A 2AV4A 4OCEA 3J7Yk 2MMAA 1A2MA 3KMNA 1SJZA 3P8WA 1K0CA 2O89A 4Q5QA 2JU5A 1F3BA 3LEFA 5ABRA 4WKWA 4RKUJ 4H13B 2C3NA 2DC5A 1KTEA 3IK7A 1TK8B 3GNJA 4O92A 3DVWA 3TJBA 1N8JA 2C1YA 2LUSA 5D9XA 19GSA 5AN1A 2YANA 3HYPA 1FHEA 3A5WA 4TXOA 2VLUA 1I5GA 4MF7A 4V1Ap 1PMTA 3GTUA 2WULA 2B5XA 4KCAA 2HSYA 2WFCA 5DQSA 4XS4B 1AXDA 1EOHA 1O8WA 5B6MA 2L6DA 5FHIA 1QMVA 1A2JA 3F0IA 3QPMA 3ZYWA 1XFLA 1PRXA 4IVFA 2AYTA 4POMA 3TJKA 3GH6A 3UJ1A 3WGDA 2XBQA 2R3XA 3KP9A 1OC9A 1TXXA 2KHPA 3C8EA 1S5LX 1MDIA 4KUNA 3ISOA 1XWGA 2IWTA 2TRXA 1EZKA 4OFTA 2PN8A 3DIEA 1AW9A 1U87A 4Y28J 1GTIA 1ZGNA 1M2BA 1PA3A 3CSIA 5IQYA 2IMFA 2XPEA 2DMMA 1XWCA 3TJFA 4G10A 3D5JA 4HJ2A 4MJAA 3GYKA 2A4VA 1UN2A 2HFDA 4POLA 1EOGA 3D6IA 3DMLA 4V1Ag 4IL6X 4BA7A 2DIZA 1HQOA 4IJ3A 1ACVA 4NWYA 5KN0A 3F4SA 1THOA 2TIRA 5B8BA 1H4OA 22GSA 4F9ZA 1OC9B 1LU4A 1FG4A 3L9SA 1XWAA 2YJ7A 1B8XA 5L71A 1FOVA 5IMFA 3L4NA 3L0HA 1GSDA 4OGQB 2C0FA 3QFAC 1TDIA 2I3YA 1YKAA 2M46A 3GRXA 2FWFA 4O5RA 4ECCA 2CT6A 4RUVA 2JZTA 3DVXA 4ZL7A 2ON7A 5DAKB 4DSSA 4EKZA 2GQKA 5ECIB 4PXOA 4HDEA 1Y25A 4ZL9A 5G5EA 5IOXA 10GSA 4XRAA 2BMXA 3IRAA 4EL1A 3ZFBA 1O8XA 4FYCA 2OBKA 4MF5A 5GSSA 4I6XA 2LQQA 4H44B 3G9BA 3UAPA 4WF4A 2GDRA 3IE3A 5IPHA 5IMVA 1X9SB 2B5YA 3PH9A 3WGEA 1V2AA 5EVOA 4FH8A 2NVLA 3LWAA 2D2ZA 1U6TA 5IOWA 5ELAA 3C1SA 4DEJA 4GQCA 3O76A 2X8GA 2E2MA 2HE3A
chains in the Genus database with same CATH superfamily
1J1EC 2REMA 2GQLA 2IBZD 4IL6E 2WTYA 1B4PA 1YITP 5HR3A 5AVRB 3B8EB 2Q6QA 1OZHA 4LGDE 1WRYA 2EIRA 4K0NA 3AEAC 1VF2A 5CJ4A 3H79A 4X0XA 4N11A 3BD2A 4YKFA 3A2XA 1CSBA 2FYUD 4PJ0E 5DJUB 3CLQA 5CCHA 5ECLB 4TXVA 1JB0J 1HGZA 2H0GA 2VCZA 1Z3EA 1FZCB 1JY2N 2YZHA 5CRDA 2H76A 2M3EA 2GSSA 4HQZA 1FB6A 1IK7A 3F9UA 1L0LG 1A0FA 1HVVA 3CTGA 2UWJE 1QQ2A 3FR9A 3EINA 2RM6A 1SK1A 2QG4A 1SQQD 2N5BA 2OYIC 5DJMA 3LORA 1HYUA 4KSOA 4EC0A 2KNCA 2XDJA 1SENA 3IAM2 2R3SA 2PUKC 1IC2A 3N5OA 4ML6A 4W7ZA 1SD9A 3F4RA 3SWYA 4OGQD 2W6AA 3SWLA 1YEPA 3I9V2 4TXOB 3H1KD 5CYYA 3TJGA 3B5ND 2CZ2A 2P5RA 1G2CA 5INYA 2IYPA 1SL0B 3IOSA 5G31A 3ZL5A 3F4TA 5D96A 3GW6A 3D6YA 3IR4A 4TOPA 1XW6A 2B7JA 1GTAA 4HZ4A 5AW7B 1NAFA 3FWNA 2B87B 1MD4A 2C0GA 5GTHH 4K0GA 4BWSA 2RKLA 5AVWB 3HD7D 1YI2P 1G0TA 2KLXA 3AE8C 3G7JA 2PGDA 1NHOA 1M2DA 1LBKA 3L74D 1EZVE 3L70E 4H13C 2E5YA 2F9SA 4I7ZC 2WITA 3RL0B 4IJIA 1M3IA 4EYYQ 1R5PA 2QIWA 3B5NA 4YKGA 1SQPD 3TKSE 4WBJA 2LKUA 3ZIVA 3VK9A 3A5IA 5HQPA 2RMZA 2P2UA 2R0CA 4D73B 3CI9A 3M3MA 2R5GA 4IW9A 2FLSA 1BEDA 1URQC 1OKTA 3PH0A 4B86A 3RK3D 1PP9D 3G6EP 3APOA 1TRSA 2E2GA 4JZQA 2OKAA 3H1HE 3L75D 3IN6A 3Q19A 3CCSP 3V5BA 1OW7A 4MZBA 1LT9C 3L74E 1SQBE 1BE3E 4GCIA 4JBBA 2XZRA 1OKDA 1GU4A 4ZMDA 1FJKA 4IFMA 1QX8A 3KQGA 3EMPA 3H1JE 5CP1A 5IMZA 1NW2A 2YOIA 3O8ZA 1A0RP 3EQ2A 3FRCA 3FX0A 1GU5A 3M9QA 4HUAA 3RBXA 2X8CA 1BQ7A 1X9WB 3FZ5A 5ECSA 5J9BA 5D9TA 4GSNA 1ZV8A 3TK1A 3RL0C 2HPCB 4HSCX 2V6OA 3UEMA 2K18A 3T97A 4YAPA 3WT2A 4G19A 1TTZA 1XPVA 3IAS2 6GSXA 3HKRA 1USDA 5AW6B 2KUCA 3F63A 1ZCPA 4CDOA 3GV1A 3NZNA 1EZVI 1YJWP 1X5CA 2FA4A 4C7NA 5DCHA 5D73A 2O85A 2FYUK 2IZ0A 2KI7B 4JPZB 1MFZA 3NIVA 1HD2A 1NSWA 2WZ7A 2B3SA 1SP4A 2GUSA 1SL1B 1Q4JA 2PVQA 3EVIA 4CY8A 1WP0A 9GSSA 1FBMA 3KH7A 2O01H 1R5SA 2K8VA 4POKA 2WSSH 1IFPA 3OA7A 3TB2A 1PKZA 1GSFA 3EWKA 1AQXA 1BAYA 5IPGA 2E76C 5B5EH 3UARA 1PN9A 1OVNA 2VM2A 2OYHC 2E76B 3N7NA 1KILD 2WWWA 4ZKUA 1QGVA 1KQLA 3HZ4A 5KJ7D 1NTKE 5B6NA 4I8BA 4KAEA 1M3JA 2C0EA 5IO2A 3CXHH 1FU1A 5APTA 1UA5A 1NTMD 2IZ1A 3EU4A 3D70A 3PTZA 3QAGA 4PQ1A 4X4JA 3BRTB 1HNBA 3ZITA 1JTHA 2LXCB 2BEZF 2DKIA 3JC22 4L76A 3L73E 2C4JA 1LTJC 1PN0A 1M7TA 3A2AA 3HCZA 2O8VB 1T8EB 1VQ7P 3CWBD 3FW2A 3UBLA 2WSCH 3EU3A 1FDMA 1ZMAA 4MABA 4EDFA 3TNUA 1VF5D 2ZYGA 4AGSA 5DQYA 3I56P 3FYGA 1WMJA 4K5RA 2H70A 2E74C 1HTLC 1NTKK 2WJUA 2DJJA 1M7LA 4NHZA 1NVOA 1TOFA 2GQMA 1GUMA 2POHA 2MMZA 5G30A 1DH3A 7GSSA 2HSHA 1EEMA 2ITAA 3RL0g 3L75G 3TOUA 5IIZA 2JEEA 4WY4C 5E4WA 1YTZI 4U3FG 1YJ6A 5GAND 4AJ6A 1S2EA 4OH8B 1IZNB 5A4UA 1LTGC 3U5RE 3H1ID 3H4KA 3HE4A 3AEBC 3B4SA 2LJKA 2KZJA 3KP8A 1LGHB 2FYUJ 4F0CA 3I69A 3AE2C 3RK2D 1XVWA 2O01J 2QA4P 5C00A 3CWBJ 2H66A 2IMIA 2XC2A 4TR1A 3D6ZA 1JY3N 5AW0B 1KYOI 1L0LE 1TU7A 3A7OA 2VRSA 4IP6A 2JL4A 2P10A 3CCJP 4N3YB 2K9FA 2NPSA 1CI6A 2LTKA 1XCCA 2KP1A 3C1LA 3AE9C 1GD2E 3QAVA 2CA8A 1O7UA 2LR2A 1NU1D 5ECQB 2KNCB 1NM3A 2HRFA 3Q3DA 4WEYA 3PLNA 1JNMA 4ILFA 3CMEP 2K9JB 5JWRB 3KGKA 3LIDA 1U57A 3GG2A 5AVXB 1M9AA 3P8MC 4AUWA 4EUYA 1Y6EA 2I1KA 1YYCA 1W2EA 1IFNA 1YQ1A 4FYUA 2B89A 2QJKB 1VF4A 1OVRA 2VO4A 5EY6A 1OVUA 1L4AA 2FKWB 2R44A 1Z9HA 3L71D 2AAWA 1VRSD 4BVYB 5A4VA 1L0LK 2G3AA 3VWXA 2N9BA 4K2XA 2JZRA 3L72G 3SFDC 2FFDC 3FY7A 2BCCD 3TCOA 2DIYA 2WDUA 2FY8A 4EIQA 3FZ4A 3IF4A 3F3RA 1ZMEC 1PV3A 2XNDH 4IFFA 3CRUA 2L5OA 1TI3A 3C9IA 4NV5A 1OMIA 2IMKA 1K3LA 1URMA 1QUWA 1NTKJ 1ABAA 5DALB 2HFED 4H0LD 1CQHA 1FOSF 4WF5A 2N1TC 1PP9G 1F6MC 2R2JA 2GTUA 1YZXA 2FUG2 3L71J 5CRHA 5HR1A 1KILC 4OO5A 1HUCA 1SQXG 3WGXA 4BVXB 5KAFE 1FZCC 3HJPA 1KEBA 4TR1B 3Q74A 4CHSA 4Z7XA 2X64A 1GL2B 1LWUA 3A2VA 3E7KA 2WPSA 3KHUA 4DVCA 2DJ1A 1B9YC 1GL8A 3ZTLA 2KUBA 2ZYAA 1MEKA 3HDCA 2H89C 2H74A 3GX0A 4XCSA 3BJ5A 3TKRA 3NXSA 2E42A 3UVTA 1BG5A 4G9HA 2QA2A 5F0GA 2D2CB 4K7IA 3HD7A 1NWQA 1PPJD 2OQQA 2HZFA 3M06A 1G6WA 5JCWA 1N73C 2QEXP 1NJIQ 1LWUC 2YO3A 3RK2C 3WUTA 2KSJA 4OFMA 4F03A 2HPCA 1EGOA 2LNTA 2VAFA 1NHYA 1L4AB 2FFDB 3F8UA 3VPTA 3HTKB 5ECRB 1KB9E 1PGPA 2YCDA 2FYUE 3QR6A 3CL3D 4N78E 4G2EA 3F89A 2GT6A 5ECNB 3QFBC 4PGTA 1T4ZA 2JKVA 3IAOA 5KOXA 5DJLA 2MZCA 3S4RA 5J3RA 2N5FA 2V32A 1U88A 3VWUA 5KAFH 2CX4A 2L4QA 5KN1A 5D9WA 4GIFA 3SWFA 4PQHA 1G1IA 3R2QA 2R37A 1VGLA 4JF7A 2GSQA 3L75E 3GUSA 2V7QH 5APUA 5KLIB 4U3FE 1HWTC 2ES7A 4NXIA 1LTSC 3UIAA 4NMUA 2JJLA 4WWIA 5HR0A 1PGOA 3F6DA 3E9JB 3FZAA 3ME8A 3CCVP 4I2TA 3PRJA 2N1TB 1JZDA 2O1KA 1PKWA 4XIHA 3VMXA 4R4LA 1P84I 1YJNP 2Z4EA 1MUUA 3AE7C 1GP1A 1GUKA 4KX4A 4IS0A 1JLVA 2QJPB 3MP7B 2VLTA 5EL8A 1T2KC 2HRAA 4AQRD 3TKPA 2A45I 2ZCTA 4CW9A 3GSSA 1PL5A 1GRXA 1LNQA 2IN3A 2R4VA 2RIIA 3V2RA 2GT5A 1TRUA 18GSA 1HJBA 4FIWA 4PTSA 5KLVJ 3V4WA 4K9ZA 4IL6H 3P7KA 4N0ZA 1L4AD 3BBYA 1L0LD 3NFQA 1VQKP 3CSHA 3CC4P 1SQPG 1NAYA 3WUUA 4DJGA 2WS2A 2N1TD 2L4CA 2EC4A 1NTZG 1JTHB 3AEDC 2RM5A 3C7MA 3HJOA 1GSSA 1IO4A 1HJ0A 2XBIA 3GX8A 2HYXA 1JY2P 1A02F 3HVSA 1UVZA 3TDGA 3MZWB 4IGJA 3WT1A 3PGTA 3ZRDA 3A2WA 2JWDA 3G3ZA 1A2LA 5GZZB 1N7SB 3ZREA 4E8EA 5B8AA 3KDPB 5KJ7C 5L8RJ 2KLVA 2DLXA 1KILB 5J41A 2AJQB 3BVHA 3G7YA 4PX1A 1RK4A 1VQ8P 4O32A 5AW3B 1VF3A 2J23A 5E59A 3Q2YA 4X43A 4MF6A 2L6CA 2JSZA 3H8QA 2FYNC 4ID0A 3ITKA 2CV4A 1FJPA 2H1DA 3LXTA 3M9HA 4K35A 2CAQA 5A4WA 3D0ZA 3U6VA 3ZIJA 1XBSA 3AE6C 1OYJA 3AE4C 2IFNA 1QK8A 3TSIA 4KA0A 3HD5A 5ECMB 3HY2A 3RBTA 2C3QA 1EGRA 5JWQB 1XTGB 1W2BO 3W8JA 1ZRTE 3CRTA 1VF5C 2HYNA 2XV5A 4EE0A 1AQVA 2A45G 1J9BA 2WCIA 4G0KA 3F3QA 3FEUA 2Z5IA 4GRFA 1X5EA 5DVBA 3L78A 4YPCA 3CCUP 2O3JA 4BPYA 1A8LA 3L73J 5D9VA 3IXRA 4I5QA 2YKPA 4L5OA 2SPZA 1SQQE 1N7SC 1K0BA 2NTOA 1DEBA 1BCCD 4HOJA 1J1DB 1E6BA 4BWQA 3Q1MA 2DBCA 4JR6A 2KS1B 5GAPD 3OR5A 4RO0A 4XRDA 3M8NA 5AW2B 3ZLPA 2FGXA 4Q5FA 1GNWA 3CXHE 3H1LE 3KIJA 3O6QB 4WXTA 2ZNMA 1ZXGA 3VP9A 3H1IJ 2CZ3A 1JZRA 2GZPA 5HR2A 1GULA 2Y0CA 5F05A 3C73A 3LG6A 1PX7A 1JZOA 1MKMA 1SJIA 2YWMA 1N7SA 1H0TA 1G7OA 4OD7A 1EDLA 3VPQA 2H6XA 4KE3A 3CD6P 2C9NY 1O81A 2JZSA 1FZFA 1EP8A 4FO5A 3EURA 2ZT9D 4GSTA 1J0FA 1AQWA 1FVKA 4D6TE 1EZVG 2ALBA 1LT9A 1LTJB 3C71A 4GF0A 2MMOA 3LXZA 2KXPB 4HJGH 2XNXA 4PURA 3DXBA 2YP6A 2AHEA 2Y9YA 3GL5A 4ZB8A 3MGNA 5ECPB 5G5FA 3UIWA 1GSQA 5APQA 1FB0A 2C3TA 2NRGA 1T3JA 1IYHA 3HE5A 2ON5A 5DCGA 5CCGC 1AJYA 1VQOP 1V98A 3Q5PA 2H1AA 2W6JH 1YF1A 1S3DA 1OAZA 2WZ9A 2AEJA 3NOFA 1F37A 1SQVK 1YQ3C 5APVA 1GDTA 1S9KD 3DRNA 5IMAA 3OJAB 3CCMP 1P84E 1PQNA 2PU9C 4TN8A 1YF0A 1K04A 1FAVA 2CVBA 1YTZT 3H1JG 5EFWB 2X4AA 3G4SP 3CCRP 2YXQB 1USBA 4RJTA 4JR4A 1QFNA 2FYZA 2OACA 3EYTA 1W4VA 1SQXK 4I2LC 5APYA 2AB6A 3ZVJD 5BRTA 1MD3A 1K8AQ 5TJHA 1B4QA 3CWBE 4LC1A 2VD0A 1VDFA 1SFCD 1E79H 2NPSD 5HFIA 1SQPE 3HTKA 1PGQA 3F5HA 1ILOA 4TR3A 1KYOH 1NTZE 1YDKA 2MYGA 1GSUA 1X79B 4ZILA 1M0UA 5A5KA 2KP2A 1O85A 1XVQA 1DSBA 2A2PA 3L71E 4XFJA 4PUAA 3PJSK 2GLRA 3UBKA 4V2LA 2HRNA 3S9FA 1TU8A 3KTBA 4PD4H 1SK0A 4K3AA 2VL3A 2MMNA 4ECBA 8GSSA 3IC8A 3L70J 1JY3O 4YQMA 1N8RQ 3P2AA 2VL2A 1ZYPA 3ZDMA 3H1JJ 1SD8A 4MH3A 2RN0A 1IFJA 2LJAA 1AVOA 2OYIB 1MV8A 4IFDK 5F06A 2EIQA 4OFNA 3FHKA 3II6A 3GN3A 2BJXA 3LSZA 3HRNA 3IHQA 3VFIA 3TKSA 3MYDA 4DT0A 3AEGC 5LNKe 1K0AA 3TUEA 4YH2A 4JU5A 4AF2A 2V2GA 4CY6A 1XW5A 3LW9A 3CXHI 1ERVA 1PD21 2OGUA 3VWWA 4J2FA 2LRNA 4ISDA 4MJBA 2H6ZA 4WETA 4KDYA 3Q5SA 4LMWA 3CQFA 1PIXA 2Z5HA 1ZR2A 2PP6A 1M57D 2H1BA 4ICYA 1DE1A 1VQNP 2H43A 1OC8A 3I6AA 3DEXA 1DE2A 1BCCE 3BCIA 1NO4A 2M3BA 1BJXA 2K3RA 3H1JD 4Q5NA 4K5SA 4PUFC 1S9KE 2IBZI 5JCGA 2PMTA 4E8HA 2R5BA 4ZKPA 4POBA 5LD0A 3L70D 3V4QA 5AW5B 1R4WA 4XHMA 4KCEA 1XOBA 1J08A 2IYOA 4A5PA 4Z2RA 1T3BA 3PR8A 5APSA 1FS0E 4BRYB 1KILE 2DJ3A 1KB9D 4PNFA 4WBRD 3H1HD 3US3A 2QJPC 4M3LA 2VLVA 3C8VA 1TKDB 3A5TA 1KNGA 4EOTA 2N5AA 2HNLA 3P32A 1BE3D 3RK3B 1TI1A 3LW5H 2C0WA 4WVZA 2Z9SA 4PJ0H 2DJKA 1X22A 2QM7A 3VURA 4L73A 1N73B 4K1FA 3KCMA 4OCFA 5H5QA 1S3RA 2FD3A 1Q82Q 2I1UA 5KOWA 1LTAC 1NTMK 4HJMA 4P3YB 5LCZA 3VLNA 6GSUA 2H0HA 1FDIA 4IQAA 3P90A 4TW5A 4L0WA 3FXDA 1SQVD 5H2FH 3EC3A 1G1JA 2PWJA 5KLVG 2XHFA 1AIUA 4IELA 1X5DA 3M91A 1FC2C 3E1RA 3Q5RA 1ZL9A 2FWHA 2HT9A 1JFUA 5JCUA 1L4AC 1JOCA 1JO5A 4FQUA 1T1VA 4F2IA 4WR4A 1T4YA 5KN3A 14GSA 2L5LA 1J2JB 1I9DA 1W5CE 2X99A 4ML1A 3I5CA 1KB9I 5D8IA 1OWAA 5ENUA 2DJ2A 3EMXA 1LP1B 3GHAA 3CTFA 1HGVA 2MBSA 1SFCC 2VCVA 1GSEA 4K8MA 3GF3A 1PX6A 2I81A 4Z2TA 2WRTA 3RL0D 1T8ZA 3CWBG 4MP4A 2DSAA 1EC5A 1ZYNA 1F9MA 1GTUA 5CAXA 1DBYA 3HJMA 1S72P 3AE5C 3KD0A 4IP1A 2LRTA 2H6YA 2WVRA 1WJKA 2OADA 1LTBC 1K3OA 3L72E 3GMAA 3GHGB 12GSA 3CX5I 4EI2A 2R6KA 2WPVB 1PSQA 2W27A 1FOHA 3LYKA 5F07A 3S1KA 1GLPA 3BCKA 5AVTB 1K0DA 5CCGD 4XS6A 2JADA 1A02J 5F8BA 1OFCX 2WMMA 5ECHB 4W80A 2B9BA 1VF1A 2FA8A 3LQ7A 1G2CB 3ERWA 3D21A 1FVJA 2DJ0A 3MIWA 3CYNA 4I97A 1OW8A 1N2AA 1NTKD 3A0HE 2K9YA 3NMDA 3GURA 2YXRB 5FWGA 2WSEJ 1URQB 3FR6A 3QH9A 3UMAA 3KXOA 3VI5A 3MIXA 2IBZE 1SL2B 1ZRTD 1B9XC 5ECKB 11GSA 3L73D 3H25A 1M90Q 2B1LA 3BCCD 3R2PA 4MPGA 4OWFA 4G0LA 5AVUB 4KH7A 2DMLA 1KYOD 4XTSA 3PHLA 1KQFB 1TU3F 2NZ2A 4XE5B 1THXA 3M9KA 3DYRA 3RDWA 3A3YB 1YJ9P 4F82A 1Q90D 4K7OA 1M1JC 1UC7A 2TRCP 5GTHE 1WWJA 2QGVA 3CCEP 2ZT9B 3H1IG 3TF5A 2NDOA 4MZWA 5AW8B 1ERTA 4XS1A 2A06E 2LKMA 4UB8E 1M1KQ 3MUDA 1NTZK 2LJRA 4O5QA 4WY4A 3V2PA 3FXEA 2B88A 2M72A 3QAWA 3CC7P 1S3JA 1ZYEA 3AEFC 2C9LY 1XZOA 4EF0A 1M1JA 1WIKA 2IIYA 1C72A 1BDCA 3AECC 1EP7A 3VP8A 4L75A 4N78D 3IDVA 1GSYA 5KJ7A 1XW9A 3KJYA 4WBAA 4Q5RA 3LYPA 2R5DA 3LJRA 2IMDA 3H1NA 5IO0A 1GUHA 1EQ7A 3AY8A 2L5GB 3K5BA 4ECIA 1NKNA 4HZ2A 3CCLP 3D22A 1A24A 3GKXA 3LGCA 2ZFCA 1SKSB 2A4HA 1SYXA 2WT7B 1K0OA 4RQXA 1LT1A 1ZP0C 4N30A 4BIKA 1DEEG 4IKHA 2PERA 3LW5J 2PRRA 3IA1A 1EWXA 2WSEH 1RF1A 2I9HA 3H1KJ 1N7SD 4KW6A 3HUSA 1X9VA 2PVOC 1SU9A 4EDZA 2L91A 2HLSA 2BCCE 4XA4A 1JUNA 3CXGA 2P58A 2P67A 2DKHA 4NAXA 1L0NK 4LLRA 1J1EB 1SQPJ 5KAIH 5D93A 2XPDA 4R4MA 3JSVC 2OYHB 4NPBA 2C8UA 1DUGA 1DIPA 4GWRA 1QVGO 3C1RA 1NTZJ 5H5SA 1USEA 1KFMA 5C39A 1TK0B 4U3FJ 3IPZA 1Q2NA 3MWHA 1RF1C 3L35A 4JBZA 4ACSA 2KYVA 2K37A 3OAKA 3V1WA 2Q7CA 2VCTA 1V58A 5KN2A 1V40A 4DSRA 1PPJG 3Q6OA 3IV4A 2OJLA 4GLTA 1KFNA 1ZR4A 1HNCA 1SJ6A 1GZLA 3H1KG 3ERFA 2GZYA 2HZEB 4ZBAA 2CAIA 1NTZD 2FWEA 3AEEC 2OBIA 1R5LA 2DW3A 1LJRA 13GSA 2NPBA 1FZAA 1KMIZ 2FHEA 1WPIA 1SKRB 2OTKE 1EV4A 1S3CA 4NPFX 2WB9A 1Z7PA 3H32A 1SS1A 4DZOA 2OE3A 1NTME 3KZQA 2YJHA 4ULXA 2P5QA 3RBZA 4RQRA 3G9RA 2H88C 4YQUA 2V4HA 2LV3A 1WRGA 1SQVJ 1GL2D 6GSSA 2YV9A 3EE2A 2IDBA 3M0AA 2L57A 3L9VA 3EFGA 5B7CA 2WT7A 5DDLA 4H0LC 3VI7A 4N6JA 4PV1D 4KJMA 3IBHA 2H73A 2B87A 4N10A 1M8OB 4W7YA 2V7QJ 1MDJA 16GSA 1ZW0A 3MNGA 3WU2E 4HH2A 1OXZA 1RF1B 4I1LA 3VWVA 3HD7C 4O7HA 4IN0A 2OARA 1FDOA 3HUSB 1GNEA 1P84H 3A0BE 1AFOA 5CCGA 3J7Yb 1V9WA 5COHA 3B5NB 2IBZG 6GSWA 2P7JA 2PGTA 4ZL8A 1V57A 3KTLA 1KB9H 4OWYA 2JP3A 3HE4B 3APSA 4D73A 5J9CA 3ZFLA 1BE3G 3VMAA 3TOTA 6GSTA 2IPPA 3PINA 1VPCA 1CZQA 3TGUG 1DD4A 3HXSA 2VCXA 2GM4A 2LRCA 1KYOE 1L0NJ 3BOAA 4UB6E 1PP9J 3H93A 3FGAD 2AEMA 3GKKA 4PQIA 1CI6B 3EFFK 3L74G 3KM6A 2QVAA 4V2MA 1T7PB 5KLVD 1GH2A 1AUCA 1PGTA 2E0QA 3TGZA 2M5AB 2K8SA 3TKQA 2HXKA 3BRVB 2HZEA 2WSCJ 1PGJA 3TNUB 2M80A 2YWIA 1HNAA 17GSA 3L73G 2KIKA 4K6XA 1K05A 1EXJA 1YQ4C 4ZBDA 3H1KE 2FYNB 1HBWA 2RUFA 3G71P 3H32B 1MDKA 5G2ZA 3D71A 1NOHA 2F8FA 1YIJP 3P7XA 4L0UA 3T97B 2H71A 4ZB6A 3RPPA 1A8YA 1RE4A 4LMVA 5CRWA 2E75C 3Q18A 1FE6A 1ZYQB 1VF5B 1AC1A 4JRRA 5BMUA 2JACA 1L0LJ 4QL7A 1EZVD 2PAJA 5CCHC 3O3TA 3TKSC 3H1LJ 4D6TG 1S5LE 1SQQG 3QD9A 5GTIE 3EPTA 2GSTA 2GS3A 3H1IE 3O6TA 3M9JA 1NKZB 3IFMA 2WQYC 2IMEA 1JZWA 3UL3A 2ZAEB 2B7KA 2H01A 2E74B 1PFOA 5AGYA 4RESB 4D6TD 3RHCA 1OE7A 3GHGC 3MDKA 1FO5A 1OX3A 3PPUA 1FAAA 2W83C 3UOMA 2VL9A 3HUSC 2LEGA 1M9BA 1U7MA 1GWCA 1X8YA 1Y8AA 2YWNA 1NTMJ 1GK4A 3F6FA 2NBSA 4GQFA 1PPJE 1KQGB 4AJ7A 5KEJA 3WD6A 4ZBBA 3IHGA 2JO1A 4KT0J 2FWGA 2YV7A 5DBQA 3LFLA 3W67A 4HU9A 4H44D 4LLHA 1IFDA 4BXLA 2L59A 4RI7A 5ID2B 3WUVA 3UVHA 2VCQA 3GIXA 2PBJA 4KF9A 4N0VA 4PD4I 4KB3A 4ECJA 2W8ZA 4PNGA 1Z5YE 5B5EE 2QJYC 4GOFA 5GTIH 1EXIA 3HVXA 3KXDA 4OGQC 4C7NB 5KLIC 1OE8A 2G2QA 1BDDA 1L2PA 1LTTC 2CK3H 2E5TA 2Q1KA 1TRVA 1PZQA 2B1KA 1BCCG 4JE1A 1A23A 2PPTA 5E79E 3VTPC 2F8AA 5J4UA 2MKVA 2Q5UA 3AE3C 2QA1A 2A2SA 1G6YA 4JYCA 3W8SA 1JEKA 3H6PA 4HU7A 2JR8A 4AJ8A 5CO3A 1NTMG 4GOEA 2KLUA 2VM1A 2CPSA 4U7JA 3HHVA 1CW5A 2VOCA 3MSZA 1XWBA 2ZXEB 2RUEA 4DSQA 1Q86Q 3ZMLA 3IR9A 1ON4A 1SVFA 5JWOB 2P1JA 2WPRA 1K9MQ 2IFMA 1ERUA 2V1MA 1KQSO 4J56E 3KPEA 1JY3P 3APQA 5IMDA 3MAKA 1RF0C 2YPMA 4MMMA 4YAVA 4MDCA 3I43A 2KP8A 1MTCA 2X49A 3KZIE 2Y0DA 3L70G 4TT3H 4DOJA 1F2EA 2GGTA 4LA1A 2K1AA 3FMWA 2GZZA 1URQD 1FW1A 4ZIJA 5C04A 2KOGA 2CVDA 4O9BA 1G7EA 1RE3A 1VQ5P 3KMOA 1WT6A 2YNYA 3TRQA 1GW3A 2HODA 3TRPA 3SFEC 3CX5E 3ZZXA 3LIEA 1SQXD 1RQMA 2MJZA 3PP5A 1TJDA 2HI7A 1GTWA 3TJJA 4MK3A 2H75A 2FFDA 4YXDC 1EEJA 4KSMA 4MLYA 2J58A 2K9JA 1BYEA 2GVPA 4YXWH 2HSMA 4OO4A 5ID2A 4H86A 3VOPA 2H0IA 2H72A 3ZMKA 2FY6A 1JY2O 1KC8Q 3A0BH 3CC2P 1RE3C 4MH2A 4WR5A 1VQLP 2H8PD 1OW6A 3SWKA 2E75D 1SQBK 2WGRA 2GUVA 1O6JA 2FXPA 4TR0A 5KAIE 5CRGA 2N9YB 1H75A 5H5RA 1GTBA 3CSJA 4TR4A 3GLMA 3A3TA 2OE0A 1IJDB 5AW4B 1RH5B 4Z1MH 1M99A 3RHBA 3GH9A 2H7HA 5DJTB 1KILA 2YMYA 3E0UA 1R5AA 4L8EA 1S3AA 2ZYDA 3HVNA 1EDKA 3ME7A 4Y99B 1SQVE 3U1AA 1M56D 3HA9A 4EVMA 3E3EA 2H8LA 5DALA 2FXMA 1SKWB 3TGUD 5AVQB 3TYYA 3H1LD 2NPSB 1NU1G 2LNSA 4O5UA 5CNWA 2G0FA 2LS5A 2AXTE 1XIYA 3N9JA 1TK5B 1AVYA 2GSRA 2QSIA 3CMIA 4GXZA 5IM9A 2ZXXA 4ZXGA 2KSEA 2AEFA 3D4MA 4F0BA 4K2DA 1BCCJ 2E76D 1XG8A 4GSSA 2E7PA 4EIPA 1SK2A 1JLWA 1QVFO 1VQ6P 1JCDA 3M1GA 2XKMA 2HODB 3U1CA 1YEXA 2W90A 2WSFH 3JCUE 1H88A 3VMZA 2HRKA 3L9UA 1XOAA 3MD0A 2VL2C 4EO3A 1M2AA 4J57E 3CMAP 2M5AA 4BVYA 4LL1B 1U3AA 4K7NA 2YNXA 2OTJP 2ZVOB 4PD4D 1NTKG 2FBWC 2F3MA 4PV1B 1K3YA 1PL2A 4LL4B 4JEDA 5APWA 5K5GB 4QL9A 1E2YA 2P0GA 4G0IA 1U3IA 3CBUA 3MTUE 1ERWA 2CVKA 3GTUB 4OMVA 5HFKA 2F51A 5APXA 5G1KA 2FYUG 4NPDA 1NHLA 4NPEA 4JYBA 1XWKA 4XS4A 2MBTA 3E1IA 5AISA 5ECOB 2C0XA 2M0BA 1IYIA 2YN1A 2V6KA 3VMYA 2R3CA 2H19A 1QLED 1YY7A 4I2UA 1PFIA 1AA0A 3I55P 1VQPP 4ZB9A 2B6MA 4EIJA 1AQTA 1SYRA 5HFGA 2FCHA 2V41A 4HEA2 3TDKA 5GSTA 1FZGA 2A06D 1Z6MA 3M0DC 2QJYB 2UZ8A 1BX9A 1BE3J 2O7KA 4BVXA 3U59A 4QQ7A 5AVZB 1W89A 1F3AA 4BL7B 2QJKC 1Z6NA 3TGUJ 1PL1A 2KOKA 4V2NA 3IC4A 4MZCA 1GL2A 1LWUB 2PFXA 1R7HA 2VD1A 1L0NG 2AUVA 2GA1A 2QE7H 3L72D 3DGQA 3R4YA 2WPQA 5ELGA 3GSTA 4H44C 5G1LA 1H89A 4HS1A 2K6VA 1FZBA 1OC3A 4MA9A 2BEQD 2YO2A 1RQUA 3ZVJA 2K88A 3USSA 3ED3A 2QKEA 4NHWA 2IPAA 4TRXA 3HD7B 1K0NA 3QOUA 4MNNA 1ZOFA 1CQGA 5AIXA 5TISH 1RQVA 1EDIA 1GL2C 4IOIH 3SBCA 5J5NA 1SQQK 2Y9ZA 4HI7A 3GKNA 3L75J 1KTMA 2YZUA 2BCCG 2CX3A 4PV1C 4HYTB 3DD3A 3RAZA 6GSVA 3CX5D 5AIVA 4EXJA 3FKFA 2G8YA 2R0PA 1BGYE 3DWVA 4HQSA 2O01N 1Q98A 3GFKA 4KDUA 3DKSA 2VCWA 1NU1J 3QCPA 3M0FA 1KORA 1X0RA 4OVNF 3WYWA 2HG5D 2FNOA 4KGIA 4MPFA 4Z2UA 1KBNA 3FR3A 4GT1A 3H1LG 3JCUH 4MJEA 3W68A 1GW4A 1KD1Q 2H30A 2E75B 4IQ1A 4YQVA 1S4XA 1LT9B 3OW2O 1TP9A 4MJCA 3ERGA 3GL3A 2O87A 2IFQB 4X1UA 2N1TA 3R3EA 4U3FD 4C46A 2P31A 4L74A 3QMXA 2CQ9A 4KDXA 1O73A 3V2QA 2YIUC 2LQOA 3D4TA 2IL3A 2YWOA 2C80A 3HE5B 2X8HA 1BGYD 1EV9A 2VUPA 3GKMA 3B5NC 1T3UA 1DX7A 4BL7A 1WE0A 4USSA 4L5LA 2EIOA 1X9MB 1AQ5A 1B48A 3BATA 3QDNA 1RHZB 2A06G 2RLIA 5BVZA 4GTUA 2WSFJ 2R32A 3KYQA 4TKYA 5CREA 4KNDA 3B71A 2H1GA 4JQ0D 3W6GA 3GA4A 5FT3A 2BASA 2BTOT 1JHBA 4RI6A 1UIIA 3CCQP 1YHQP 1PP9E 1U7JA 2JWAA 2W6BA 2LSTA 3BASA 4TVEA 3KH9A 3A0HH 2ZUPA 1RW1A 4H0LB 1TW9A 3SSUA 5KKZC 3HZ8A 5DAKA 3KEBA 4DSSB 4EDYA 5B66E 2JDIH 2C0DA 1GLQA 2QRXA 2HLOA 4IBPA 1KN7A 3EWLA 1UIXA 4AYCA 3S9OA 1HF9A 2R0GA 2OA7A 1YKCA 3GMFA 5CCHD 4IHUA 3FWLA 3VN0A 1SFCA 2B5EA 3FZ9A 2A2RA 1ZZYA 1AAZA 5AVVB 2KZIA 2I4AA 2JSYA 1GMJA 3FK8A 1T00A 1R26A 3O6QA 2VIMA 20GSA 1D7MA 2IX7C 1QXHA 1Z7RA 1ML6A 3K8NA 1ST9A 1WOUA 6GSYA 1RE4C 1QL2A 1TRWA 2J9HA 2QC7A 2YKOA 3CX5H 1XXUA 4FYBA 2OTLP 3HVVA 3G7IA 4MCUA 1SLQA 1K0MA 3JCML 4ASWA 5BU8B 2IFQA 4GKGA 1NU1E 3IK9A 3RPNA 3WMM0 2ZT9C 5IMCA 2OE1A 1VQ9P 5EPFA 2BCCJ 1LTJA 2IJYA 3TRXA 4I7ZB 4NV2A 2AXCA 2Q3EA 1FOSE 2OYOA 4PD4E 2J5UA 5CJ0A 4H13D 3MHVA 2AV4A 4OCEA 3J7Yk 2MMAA 1A2MA 3KMNA 1QL1A 2FXOA 5AVYB 1SJZA 1Y9BA 3P8WA 1T2KD 4GODA 1K0CA 1JM0A 2YIUB 2O89A 2XU6A 1L0ND 2Q3IA 2JU5A 4Q5QA 1F3BA 3LEFA 3RK2B 2Q9IA 1E5WA 2ZVNB 2A45H 5E79H 1QEXA 5ABRA 2KS1A 4WKWA 5CBNA 1IK9A 1N2DC 4RKUJ 4I6MC 1K73Q 4H13B 1SQXE 1IFMA 2C3NA 1N86A 5M1BA 2DC5A 1KTEA 3IK7A 1TK8B 3GNJA 4O92A 3DVWA 3TJBA 4WB4A 1N8JA 2C1YA 4GDOA 2LUSA 1JCCA 2AXTH 5D9XA 1H0TB 19GSA 1VQ4P 5AN1A 1BGYG 3H1HJ 4BWNA 2YANA 2O1JA 3HYPA 1FHEA 1Q7YQ 3A5WA 4TXOA 2VLUA 1I5GA 4MF7A 4V1Ap 1PMTA 3GTUA 3L71G 3L36A 2B5XA 2WULA 4KCAA 2HSYA 2WFCA 5DQSA 4XS4B 1SQXJ 1AXDA 2NPSC 1EOHA 1S1CX 1AV1A 1O8WA 5B6MA 3GHGA 2L6DA 1MZ9A 3L74J 1QMVA 5FHIA 1L0NE 1A2JA 3F0IA 3QPMA 3ZYWA 1XFLA 1PRXA 2D2CC 4IVFA 5B66H 2AYTA 1GK6A 4POMA 3TJKA 4TLFA 4Y99C 3GH6A 2I1JA 3QWOC 1BSNA 1J1DC 1XTCC 3KZIH 3UJ1A 3WGDA 2XBQA 2R3XA 3KP9A 5AVSB 1OC9A 1TXXA 3BCCG 2KHPA 1NH4A 1P84D 3C8EA 1S5LX 1JMMA 3N4XA 2OYIA 1Y47A 1MDIA 2KK7A 3V2NA 4KUNA 1LTIC 3ISOA 2E74D 1XWGA 1X0TA 1S5LH 2IWTA 1MFTA 4CPGA 2TRXA 1SQBJ 1EZKA 2E43A 3TGUE 4OFTA 1RY3A 1T6AA 1NYHA 2PN8A 1LP1A 1FZEA 3DIEA 4ZNCA 1AW9A 1JMBA 2Y0EA 4D6TJ 1U87A 4Y28J 1GTIA 1VQMP 1ZGNA 2QM8A 1M2BA 1PA3A 3CSIA 5CMZA 2J59M 2RH0A 5IQYA 3L4FA 1ZN5A 2IMFA 2XPEA 2HR3A 2DMMA 1XWCA 3RK3C 3TJFA 4G10A 3P8CD 3D5JA 4HJ2A 4MJAA 1ZLLA 1IFIA 5KTBA 3GYKA 2A4VA 1SQBG 3RGUA 1RF0A 1UN2A 2HFDA 4POLA 1EOGA 4DCKA 3D6IA 1YBKA 1M1JB 3DMLA 4V1Ag 4IL6X 4BA7A 2DIZA 1HQOA 1EDJA 4IJ3A 1ACVA 1BSHA 4UB6H 4MN4C 1ZOYC 4C7RA 3ABVC 4NWYA 5KN0A 1WMKA 3F4SA 1URQA 5TISE 3CPWO 5KLVE 2M8RA 1SQBD 3L37A 1THOA 3NTNA 5AW9B 3AE1C 3V6IA 2TIRA 5B8BA 1H4OA 2YMKA 3GF7A 2CPBA 22GSA 1N73A 4F9ZA 2LXBA 1KZUB 1OC9B 1LU4A 1FG4A 3L9SA 3RK3E 3M9BA 1XWAA 4KHXA 4UB8H 1NGMB 2YJ7A 1B8XA 1BGYJ 3H1HG 4WY4D 5L71A 1FOVA 1SQVG 5IMFA 4HKZH 3L4NA 2ZJSE 3WU2H 3L0HA 3BCCE 1GSDA 1FZCA 1OIPA 1N7LA 4OGQB 1OVVA 2C0FA 3QFAC 1TDIA 4ASVA 2I3YA 1YKAA 2M46A 5KLVK 1HH0A 2I8DA 4QMAA 2OYHA 3GRXA 2D2CD 4YTPC 2FWFA 4O5RA 4ECCA 2YKQA 2CT6A 1KV4A 4RUVA 2JZTA 4WY4B 5KKZB 3DVXA 4ZL7A 1Z56A 1LJ2A 2ON7A 5DAKB 1SQQJ 4DSSA 4EKZA 4A7PA 1QGKB 2GQKA 1Q81Q 4BRYA 1H8AA 5ECIB 4PXOA 4HDEA 4HB1A 1Y25A 4ZL9A 3BCCJ 5G5EA 5H2FE 5CHXA 2KB7P 5IOXA 10GSA 4XRAA 2BMXA 3IRAA 1SFCB 4EL1A 3ZFBA 1R8EA 1O8XA 3CXHD 4FYCA 2OBKA 3MUDC 4MF5A 5GSSA 1NU1K 4I6XA 2LQQA 4H44B 1VL2A 3VYIA 3G9BA 3UAPA 4WF4A 3P8CE 2GDRA 3IE3A 5IPHA 5IMVA 1X9SB 2B5YA 3PH9A 3WGEA 1V2AA 5EVOA 4FH8A 2NVLA 3LWAA 2D2ZA 1U6TA 5IOWA 5ELAA 3C1SA 1SQPK 3M0DA 4DEJA 5BU5A 5CBOA 5AW1B 4GQCA 3O76A 3L72J 1DD3A 2X8GA 2E2MA 2HE3A
chains in the Genus database with same CATH topology
2REMA 2GQLA 5HR3A 1B4PA 1WRYA 2EIRA 4K0NA 3AEAC 1VF2A 4X0XA 3H79A 4N11A 3BD2A 4YKFA 3A2XA 5ECLB 4TXVA 1JB0J 2H0GA 2VCZA 1Z3EA 2YZHA 5CRDA 2H76A 2GSSA 4HQZA 1FB6A 1IK7A 3F9UA 1A0FA 3CTGA 1QQ2A 3FR9A 3EINA 2RM6A 1SK1A 2N5BA 5DJMA 4EC0A 3LORA 1HYUA 4KSOA 1SENA 3IAM2 2PUKC 3N5OA 4ML6A 1SD9A 3F4RA 4OGQD 3SWLA 1YEPA 3I9V2 4TXOB 5CYYA 3TJGA 2CZ2A 2P5RA 5INYA 1SL0B 3IOSA 5G31A 3ZL5A 3F4TA 5D96A 3D6YA 3IR4A 4TOPA 1XW6A 2B7JA 1GTAA 4HZ4A 1MD4A 2C0GA 4K0GA 4BWSA 1G0TA 2KLXA 3AE8C 3G7JA 1NHOA 1M2DA 1LBKA 4H13C 2F9SA 4I7ZC 4IJIA 1R5PA 2QIWA 4YKGA 3TKSE 4WBJA 2LKUA 3ZIVA 3VK9A 3A5IA 5HQPA 2R0CA 4D73B 3M3MA 2R5GA 4IW9A 2FLSA 1BEDA 1OKTA 3APOA 1TRSA 2E2GA 4JZQA 2OKAA 3IN6A 3Q19A 1OW7A 4MZBA 4GCIA 4JBBA 1OKDA 3EMPA 5IMZA 5CP1A 1NW2A 2YOIA 1A0RP 3FRCA 4HUAA 2X8CA 1BQ7A 1X9WB 3FZ5A 5ECSA 5J9BA 5D9TA 4GSNA 2V6OA 3UEMA 2K18A 4YAPA 3WT2A 4G19A 1TTZA 1XPVA 3IAS2 6GSXA 3HKRA 2KUCA 3F63A 1ZCPA 4CDOA 3GV1A 3NZNA 1X5CA 2FA4A 5DCHA 5D73A 2O85A 3NIVA 1HD2A 1NSWA 2B3SA 1SL1B 1Q4JA 2PVQA 3EVIA 4CY8A 1WP0A 9GSSA 3KH7A 4POKA 2K8VA 3TB2A 1PKZA 1GSFA 3EWKA 1AQXA 1BAYA 5IPGA 2E76C 3UARA 1PN9A 1OVNA 2VM2A 2E76B 1QGVA 3HZ4A 5B6NA 4I8BA 4KAEA 5IO2A 2C0EA 1UA5A 3EU4A 3D70A 3QAGA 4PQ1A 4X4JA 1HNBA 3ZITA 2BEZF 2DKIA 2C4JA 1PN0A 1M7TA 3HCZA 2O8VB 1T8EB 3FW2A 3UBLA 3EU3A 1ZMAA 4MABA 1VF5D 4AGSA 5DQYA 3FYGA 1WMJA 4K5RA 2H70A 2E74C 2WJUA 2DJJA 4NHZA 1TOFA 2GQMA 1GUMA 2MMZA 5G30A 7GSSA 2HSHA 1EEMA 3RL0g 3TOUA 5IIZA 5E4WA 1YJ6A 5GAND 4AJ6A 5A4UA 3U5RE 3H4KA 3AEBC 2LJKA 3KP8A 4F0CA 3I69A 3AE2C 1XVWA 2O01J 5C00A 2H66A 2IMIA 2XC2A 4TR1A 3D6ZA 1TU7A 4IP6A 2JL4A 2P10A 2K9FA 2LTKA 1XCCA 2KP1A 3AE9C 3QAVA 2CA8A 1O7UA 5ECQB 1NM3A 2HRFA 3Q3DA 4WEYA 4ILFA 5JWRB 3KGKA 1U57A 1M9AA 4EUYA 1Y6EA 1YQ1A 4FYUA 5EY6A 1VF4A 2VO4A 1Z9HA 2AAWA 1VRSD 4BVYB 5A4VA 2G3AA 3VWXA 4K2XA 2JZRA 3SFDC 3FY7A 3TCOA 2DIYA 2WDUA 4EIQA 3FZ4A 3F3RA 1ZMEC 1PV3A 3CRUA 2L5OA 1TI3A 4NV5A 1OMIA 2IMKA 1K3LA 1URMA 1QUWA 1ABAA 5DALB 4H0LD 1CQHA 4WF5A 1F6MC 2R2JA 2GTUA 1YZXA 2FUG2 5CRHA 5HR1A 4OO5A 3WGXA 4BVXB 3HJPA 1KEBA 4TR1B 3Q74A 4CHSA 4Z7XA 2X64A 3A2VA 4DVCA 2DJ1A 1B9YC 1GL8A 3ZTLA 1MEKA 3HDCA 2H89C 2H74A 3GX0A 4XCSA 3BJ5A 3TKRA 3UVTA 1BG5A 4G9HA 2QA2A 5F0GA 2D2CB 4K7IA 2OQQA 2HZFA 1G6WA 5JCWA 4OFMA 4F03A 1EGOA 2LNTA 2VAFA 1NHYA 3F8UA 3VPTA 5ECRB 2YCDA 3QR6A 4G2EA 2GT6A 5ECNB 3QFBC 4PGTA 1T4ZA 3IAOA 5KOXA 5DJLA 2MZCA 5J3RA 2N5FA 2V32A 1U88A 3VWUA 2CX4A 2L4QA 5KN1A 5D9WA 4PQHA 3R2QA 2R37A 1VGLA 2GSQA 3GUSA 2ES7A 4NXIA 4NMUA 5HR0A 3F6DA 3E9JB 3FZAA 3ME8A 4I2TA 1JZDA 1PKWA 4XIHA 4R4LA 3AE7C 1GP1A 1GUKA 4KX4A 4IS0A 1JLVA 5EL8A 2VLTA 2HRAA 3TKPA 2ZCTA 4CW9A 3GSSA 1PL5A 1GRXA 2IN3A 2RIIA 2R4VA 2GT5A 1TRUA 18GSA 4FIWA 4PTSA 4K9ZA 4N0ZA 3BBYA 3CSHA 2WS2A 2L4CA 2EC4A 3AEDC 2RM5A 3C7MA 3HJOA 1GSSA 1HJ0A 2XBIA 3GX8A 2HYXA 3HVSA 1UVZA 3TDGA 4IGJA 3WT1A 3PGTA 3ZRDA 3A2WA 1A2LA 5GZZB 3ZREA 4E8EA 5B8AA 5L8RJ 2DLXA 5J41A 2AJQB 3G7YA 4PX1A 1RK4A 4O32A 1VF3A 2J23A 5E59A 3Q2YA 4X43A 4MF6A 2L6CA 2JSZA 3H8QA 2FYNC 4ID0A 2CV4A 2H1DA 3LXTA 2CAQA 5A4WA 3D0ZA 3U6VA 3ZIJA 1XBSA 3AE6C 1OYJA 3AE4C 1QK8A 4KA0A 3HD5A 5ECMB 3HY2A 3RBTA 2C3QA 1EGRA 5JWQB 3W8JA 1ZRTE 3CRTA 1VF5C 4EE0A 1AQVA 1J9BA 4G0KA 2WCIA 3F3QA 3FEUA 4GRFA 1X5EA 5DVBA 3L78A 4BPYA 1A8LA 5D9VA 3IXRA 4I5QA 4L5OA 1K0BA 2NTOA 4HOJA 1E6BA 4BWQA 3Q1MA 2DBCA 4JR6A 5GAPD 3OR5A 4XRDA 3M8NA 3ZLPA 2FGXA 4Q5FA 1GNWA 3KIJA 4WXTA 2ZNMA 2GZPA 2CZ3A 5HR2A 1JZRA 1GULA 5F05A 3C73A 3LG6A 1PX7A 1JZOA 1MKMA 1SJIA 2YWMA 1G7OA 4OD7A 3VPQA 2H6XA 4KE3A 1O81A 2JZSA 1EP8A 4FO5A 3EURA 2ZT9D 4GSTA 1J0FA 1AQWA 1FVKA 2ALBA 3C71A 4GF0A 2MMOA 3LXZA 4PURA 3DXBA 2YP6A 2AHEA 3GL5A 4ZB8A 5ECPB 5G5FA 3UIWA 1GSQA 1FB0A 2C3TA 1IYHA 2ON5A 5DCGA 1AJYA 1V98A 3Q5PA 2H1AA 1YF1A 1S3DA 1OAZA 2WZ9A 3NOFA 1F37A 1YQ3C 3DRNA 5IMAA 1PQNA 2PU9C 4TN8A 1YF0A 1K04A 2CVBA 2X4AA 1USBA 4JR4A 1QFNA 2OACA 3EYTA 1W4VA 2AB6A 3ZVJD 5BRTA 1MD3A 1B4QA 2VD0A 5HFIA 1ILOA 4TR3A 1YDKA 2MYGA 1GSUA 5A5KA 4ZILA 1M0UA 2KP2A 1O85A 1XVQA 1DSBA 2A2PA 4XFJA 4PUAA 2GLRA 3UBKA 4V2LA 2HRNA 3S9FA 1TU8A 3KTBA 1SK0A 2VL3A 2MMNA 4ECBA 8GSSA 3IC8A 4YQMA 3P2AA 2VL2A 1ZYPA 1SD8A 4MH3A 2LJAA 5F06A 4OFNA 2EIQA 3FHKA 3GN3A 2BJXA 3LSZA 3IHQA 3VFIA 3TKSA 3MYDA 3AEGC 5LNKe 1K0AA 3TUEA 4YH2A 4JU5A 4AF2A 2V2GA 4CY6A 1XW5A 3LW9A 1ERVA 3VWWA 1PD21 4J2FA 2LRNA 4ISDA 4MJBA 2H6ZA 4WETA 4KDYA 3Q5SA 4LMWA 1PIXA 2H1BA 4ICYA 1DE1A 1OC8A 3I6AA 3DEXA 1DE2A 3BCIA 1BJXA 4Q5NA 4K5SA 4PUFC 5JCGA 2PMTA 4E8HA 4POBA 5LD0A 1R4WA 4XHMA 4KCEA 1XOBA 1J08A 4A5PA 4Z2RA 1T3BA 3PR8A 1KILE 2DJ3A 4PNFA 4WBRD 3US3A 2QJPC 2VLVA 3C8VA 1TKDB 1KNGA 2N5AA 2HNLA 1TI1A 2Z9SA 2DJKA 3VURA 4K1FA 3KCMA 4OCFA 5H5QA 2FD3A 2I1UA 5KOWA 4P3YB 4HJMA 5LCZA 3VLNA 6GSUA 2H0HA 1FDIA 4IQAA 3P90A 4TW5A 4L0WA 3EC3A 2XHFA 2PWJA 1AIUA 4IELA 1X5DA 3Q5RA 1ZL9A 2FWHA 2HT9A 1JFUA 5JCUA 4FQUA 1T1VA 4F2IA 4WR4A 1T4YA 5KN3A 14GSA 2L5LA 1I9DA 4ML1A 2X99A 5D8IA 5ENUA 2DJ2A 3EMXA 3GHAA 3CTFA 2MBSA 2VCVA 1GSEA 4K8MA 3GF3A 1PX6A 2I81A 4Z2TA 2WRTA 4MP4A 5CAXA 2DSAA 1ZYNA 1DBYA 1F9MA 1GTUA 3HJMA 3AE5C 3KD0A 4IP1A 2LRTA 2H6YA 1WJKA 2OADA 1K3OA 3GMAA 12GSA 2R6KA 2WPVB 1PSQA 1FOHA 3LYKA 5F07A 1GLPA 3BCKA 1K0DA 4XS6A 2JADA 5F8BA 5ECHB 1VF1A 2FA8A 3LQ7A 3ERWA 3D21A 1FVJA 2DJ0A 3CYNA 4I97A 1OW8A 1N2AA 2K9YA 3GURA 5FWGA 2WSEJ 3FR6A 3UMAA 3KXOA 3VI5A 3MIXA 1SL2B 1B9XC 5ECKB 11GSA 3H25A 2B1LA 4MPGA 4G0LA 4KH7A 2DMLA 4XTSA 1KQFB 1TU3F 2NZ2A 1THXA 3M9KA 3RDWA 3DYRA 4F82A 1Q90D 4K7OA 1UC7A 2TRCP 1WWJA 2QGVA 2ZT9B 2NDOA 4MZWA 4XS1A 1ERTA 2LJRA 4O5QA 2M72A 3QAWA 1ZYEA 3AEFC 1XZOA 4EF0A 1WIKA 2IIYA 1C72A 3AECC 1EP7A 3IDVA 1GSYA 1XW9A 3KJYA 4Q5RA 3LYPA 3LJRA 2IMDA 3H1NA 5IO0A 1GUHA 3AY8A 4ECIA 4HZ2A 3D22A 1A24A 3GKXA 3LGCA 1SKSB 2A4HA 1SYXA 1K0OA 4RQXA 1ZP0C 4N30A 4IKHA 2PERA 3LW5J 3IA1A 1EWXA 2I9HA 4KW6A 2PVOC 1SU9A 4EDZA 2HLSA 3CXGA 2DKHA 4NAXA 4LLRA 5D93A 2XPDA 4R4MA 4NPBA 2C8UA 1DUGA 1DIPA 4GWRA 3C1RA 5H5SA 1TK0B 3IPZA 3MWHA 4ACSA 3V1WA 2VCTA 1V58A 5KN2A 1V40A 4DSRA 3Q6OA 3IV4A 2OJLA 4GLTA 1HNCA 1SJ6A 3ERFA 2GZYA 2HZEB 4ZBAA 2CAIA 2FWEA 3AEEC 2OBIA 1LJRA 13GSA 2NPBA 1KMIZ 2FHEA 1WPIA 1SKRB 1S3CA 1EV4A 2WB9A 1Z7PA 3KZQA 2OE3A 2YJHA 4ULXA 2P5QA 4RQRA 3G9RA 2H88C 4YQUA 2LV3A 6GSSA 2YV9A 3EE2A 2IDBA 2L57A 3L9VA 5B7CA 5DDLA 4H0LC 3VI7A 4PV1D 3IBHA 2H73A 4N10A 2V7QJ 1MDJA 16GSA 3MNGA 3VWVA 4O7HA 4IN0A 1FDOA 1GNEA 3J7Yb 1V9WA 5COHA 6GSWA 2PGTA 4ZL8A 1V57A 3KTLA 4OWYA 2JP3A 3APSA 4D73A 5J9CA 3ZFLA 3TOTA 6GSTA 3PINA 1DD4A 3HXSA 2VCXA 2LRCA 3BOAA 3H93A 3FGAD 3GKKA 4PQIA 3KM6A 4V2MA 1T7PB 1GH2A 1AUCA 1PGTA 2E0QA 3TGZA 2K8SA 3TKQA 2HXKA 2HZEA 2WSCJ 2M80A 2YWIA 1HNAA 17GSA 4K6XA 1K05A 1EXJA 1YQ4C 4ZBDA 2RUFA 5G2ZA 1MDKA 3D71A 2F8FA 3P7XA 4L0UA 4ZB6A 3T97B 2H71A 3RPPA 1A8YA 4LMVA 5CRWA 2E75C 3Q18A 1ZYQB 1VF5B 1AC1A 4JRRA 5BMUA 2JACA 4QL7A 3O3TA 3TKSC 3QD9A 3EPTA 2GSTA 2GS3A 3O6TA 3M9JA 2WQYC 2IMEA 1JZWA 3UL3A 2H01A 2B7KA 2E74B 5AGYA 3RHCA 1OE7A 3MDKA 1FO5A 3PPUA 1FAAA 3UOMA 2VL9A 2LEGA 1M9BA 1GWCA 2YWNA 3F6FA 4GQFA 2NBSA 1KQGB 4AJ7A 5KEJA 3WD6A 4ZBBA 3IHGA 2JO1A 4KT0J 2FWGA 2YV7A 5DBQA 3LFLA 4HU9A 4H44D 5ID2B 2L59A 4RI7A 3UVHA 2VCQA 3GIXA 2PBJA 4KF9A 4N0VA 4KB3A 4ECJA 4PNGA 1Z5YE 2QJYC 1EXIA 3HVXA 4OGQC 1OE8A 5KLIC 2G2QA 1TRVA 2B1KA 4JE1A 1A23A 2PPTA 5J4UA 2F8AA 2MKVA 3AE3C 2QA1A 2A2SA 1G6YA 3W8SA 4HU7A 4AJ8A 5CO3A 2VM1A 4U7JA 3HHVA 2VOCA 3MSZA 1XWBA 2RUEA 4DSQA 3ZMLA 1ON4A 5JWOB 1ERUA 2V1MA 4J56E 3APQA 5IMDA 3MAKA 2YPMA 4MMMA 4YAVA 4MDCA 3I43A 1MTCA 2X49A 4TT3H 1F2EA 2GGTA 4LA1A 3FMWA 2GZZA 1FW1A 4ZIJA 5C04A 2CVDA 1G7EA 3KMOA 3TRQA 3TRPA 3SFEC 3ZZXA 1RQMA 1TJDA 2HI7A 3TJJA 4MK3A 2H75A 4YXDC 4MLYA 1EEJA 4KSMA 1BYEA 2GVPA 2HSMA 4OO4A 5ID2A 4H86A 2H0IA 2H72A 3ZMKA 2FY6A 4MH2A 4WR5A 1OW6A 2E75D 2WGRA 1O6JA 2FXPA 4TR0A 5CRGA 1H75A 5H5RA 1GTBA 3CSJA 4TR4A 3GLMA 3A3TA 2OE0A 4Z1MH 1M99A 3RHBA 3GH9A 4L8EA 1R5AA 3E0UA 1S3AA 3ME7A 3HA9A 4EVMA 3E3EA 2H8LA 5DALA 1SKWB 2LNSA 4O5UA 5CNWA 2G0FA 2LS5A 1TK5B 1XIYA 3N9JA 2GSRA 3CMIA 2QSIA 4GXZA 5IM9A 4ZXGA 3D4MA 4F0BA 4K2DA 2E76D 4GSSA 2E7PA 4EIPA 1SK2A 1JLWA 3M1GA 1YEXA 3L9UA 2HRKA 1XOAA 2VL2C 4EO3A 1M2AA 4J57E 4BVYA 4LL1B 1U3AA 4K7NA 2YNXA 2FBWC 2F3MA 4PV1B 1K3YA 1PL2A 4LL4B 4JEDA 4QL9A 1E2YA 2P0GA 4G0IA 1U3IA 3CBUA 1ERWA 2CVKA 3GTUB 4OMVA 5HFKA 2F51A 5G1KA 1XWKA 5AISA 4XS4A 2MBTA 5ECOB 1IYIA 2YN1A 2V6KA 2H19A 4I2UA 1YY7A 4ZB9A 2B6MA 1SYRA 5HFGA 2FCHA 2V41A 4HEA2 5GSTA 1Z6MA 2UZ8A 1BX9A 2O7KA 4BVXA 4QQ7A 1W89A 1F3AA 4BL7B 2QJKC 1Z6NA 1PL1A 2KOKA 4V2NA 3IC4A 4MZCA 2VD1A 1R7HA 2AUVA 3DGQA 3R4YA 5ELGA 3GSTA 4H44C 5G1LA 4HS1A 2K6VA 1OC3A 4MA9A 2BEQD 1RQUA 3ZVJA 3ED3A 2QKEA 4NHWA 2IPAA 4TRXA 1K0NA 3QOUA 4MNNA 1ZOFA 1CQGA 5AIXA 1RQVA 3SBCA 5J5NA 4HI7A 3GKNA 1KTMA 2YZUA 2CX3A 4PV1C 3DD3A 3RAZA 6GSVA 4EXJA 5AIVA 3FKFA 2G8YA 2R0PA 3DWVA 4HQSA 3GFKA 1Q98A 4KDUA 3DKSA 2VCWA 3QCPA 3M0FA 1KORA 1X0RA 3WYWA 2FNOA 4KGIA 4MPFA 4Z2UA 1KBNA 3FR3A 4MJEA 4IQ1A 2H30A 2E75B 4YQVA 1TP9A 4MJCA 3ERGA 3GL3A 2O87A 2IFQB 4X1UA 3R3EA 2P31A 3QMXA 2CQ9A 4KDXA 1O73A 2YIUC 2LQOA 3D4TA 2IL3A 2YWOA 2C80A 2X8HA 1EV9A 2VUPA 3GKMA 4BL7A 1WE0A 4USSA 4L5LA 2EIOA 1X9MB 1B48A 3QDNA 2RLIA 4GTUA 2WSFJ 4TKYA 5CREA 4KNDA 3B71A 2H1GA 3W6GA 3GA4A 5FT3A 2BTOT 1JHBA 4RI6A 2LSTA 4TVEA 3KH9A 2ZUPA 1RW1A 4H0LB 1TW9A 5KKZC 3HZ8A 5DAKA 3KEBA 4DSSB 4EDYA 2C0DA 1GLQA 4IBPA 3EWLA 1UIXA 3S9OA 1HF9A 2R0GA 2OA7A 1YKCA 3GMFA 4IHUA 2B5EA 3FZ9A 2A2RA 1ZZYA 1AAZA 2I4AA 2JSYA 1GMJA 3FK8A 1T00A 1R26A 3O6QA 2VIMA 20GSA 1QXHA 1Z7RA 1ML6A 3K8NA 1ST9A 1WOUA 6GSYA 1TRWA 2J9HA 2QC7A 1XXUA 4FYBA 3HVVA 3G7IA 4MCUA 1K0MA 3JCML 2IFQA 3IK9A 3RPNA 2ZT9C 5IMCA 2OE1A 5EPFA 2IJYA 3TRXA 4I7ZB 4NV2A 2J5UA 2AV4A 4H13D 4OCEA 3J7Yk 2MMAA 1A2MA 3KMNA 1SJZA 1Y9BA 3P8WA 1K0CA 2O89A 4Q5QA 2JU5A 1F3BA 3LEFA 5ABRA 4WKWA 4RKUJ 4H13B 2C3NA 5M1BA 2DC5A 1KTEA 3IK7A 1TK8B 3GNJA 4O92A 3DVWA 3TJBA 1N8JA 2C1YA 4GDOA 2LUSA 5D9XA 19GSA 5AN1A 2YANA 3HYPA 1FHEA 3A5WA 4TXOA 2VLUA 1I5GA 4MF7A 4V1Ap 1PMTA 3GTUA 2WULA 2B5XA 4KCAA 2HSYA 2WFCA 5DQSA 4XS4B 1AXDA 1EOHA 1S1CX 1O8WA 5B6MA 2L6DA 5FHIA 1QMVA 1A2JA 3F0IA 3QPMA 3ZYWA 1XFLA 1PRXA 2D2CC 4IVFA 2AYTA 4POMA 3TJKA 3GH6A 3UJ1A 3WGDA 2XBQA 2R3XA 3KP9A 1OC9A 1TXXA 2KHPA 3C8EA 1S5LX 1MDIA 4KUNA 3ISOA 2E74D 1XWGA 2IWTA 2TRXA 1EZKA 4OFTA 1NYHA 2PN8A 3DIEA 1AW9A 1U87A 4Y28J 1GTIA 1ZGNA 1M2BA 1PA3A 3CSIA 5IQYA 2IMFA 2XPEA 2DMMA 1XWCA 3TJFA 4G10A 3D5JA 4HJ2A 4MJAA 3GYKA 2A4VA 1UN2A 2HFDA 4POLA 1EOGA 3D6IA 3DMLA 4V1Ag 4IL6X 4BA7A 2DIZA 1HQOA 4IJ3A 1ACVA 1ZOYC 3ABVC 4NWYA 5KN0A 1WMKA 3F4SA 1THOA 3AE1C 2TIRA 5B8BA 1H4OA 2YMKA 3GF7A 22GSA 4F9ZA 1OC9B 1LU4A 1FG4A 3L9SA 3RK3E 1XWAA 2YJ7A 1NGMB 1B8XA 5L71A 1FOVA 5IMFA 3L4NA 3L0HA 1GSDA 4OGQB 2C0FA 3QFAC 1TDIA 2I3YA 1YKAA 2M46A 3GRXA 2D2CD 4YTPC 2FWFA 4O5RA 4ECCA 2CT6A 4RUVA 2JZTA 3DVXA 4ZL7A 2ON7A 5DAKB 4DSSA 4EKZA 2GQKA 5ECIB 4PXOA 4HDEA 1Y25A 4ZL9A 5G5EA 5IOXA 10GSA 4XRAA 2BMXA 3IRAA 4EL1A 3ZFBA 1R8EA 1O8XA 4FYCA 2OBKA 4MF5A 5GSSA 4I6XA 2LQQA 4H44B 1VL2A 3G9BA 3UAPA 4WF4A 2GDRA 3IE3A 5IPHA 5IMVA 1X9SB 2B5YA 3PH9A 3WGEA 1V2AA 5EVOA 4FH8A 2NVLA 3LWAA 2D2ZA 1U6TA 5IOWA 5ELAA 3C1SA 4DEJA 4GQCA 3O76A 1DD3A 2X8GA 2E2MA 2HE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2REM A;  2GQL A;  5HR3 A;  1B4P A;  1WRY A;  2EIR A;  4K0N A;  4X0X A;  1VF2 A;  3H79 A;  4N11 A;  3BD2 A;  3A2X A;  5ECL B;  4TXV A;  1JB0 J;  2H0G A;  2VCZ A;  1Z3E A;  2YZH A;  5CRD A;  2H76 A;  2GSS A;  4HQZ A;  1FB6 A;  3F9U A;  1A0F A;  3CTG A;  1QQ2 A;  3FR9 A;  3EIN A;  2RM6 A;  1SK1 A;  2N5B A;  5DJM A;  4EC0 A;  3LOR A;  1HYU A;  4KSO A;  1SEN A;  3IAM 2;  2PUK C;  3N5O A;  4ML6 A;  1SD9 A;  3F4R A;  3SWL A;  1YEP A;  3I9V 2;  4TXO B;  5CYY A;  3TJG A;  2CZ2 A;  2P5R A;  5INY A;  1SL0 B;  3IOS A;  5G31 A;  3ZL5 A;  3F4T A;  5D96 A;  3IR4 A;  4TOP A;  1XW6 A;  2B7J A;  1GTA A;  4HZ4 A;  1MD4 A;  2C0G A;  4K0G A;  4BWS A;  1G0T A;  2KLX A;  3G7J A;  1NHO A;  1M2D A;  1LBK A;  2F9S A;  4IJI A;  1R5P A;  2QIW A;  3TKS E;  4WBJ A;  2LKU A;  3ZIV A;  3VK9 A;  5HQP A;  4D73 B;  3M3M A;  2R5G A;  4IW9 A;  2FLS A;  1BED A;  1OKT A;  3APO A;  1TRS A;  2E2G A;  4JZQ A;  2OKA A;  3Q19 A;  4MZB A;  4GCI A;  4JBB A;  1OKD A;  3EMP A;  5IMZ A;  5CP1 A;  1NW2 A;  2YOI A;  1A0R P;  3FRC A;  4HUA A;  2X8C A;  1BQ7 A;  1X9W B;  3FZ5 A;  5ECS A;  5J9B A;  5D9T A;  4GSN A;  2V6O A;  3UEM A;  2K18 A;  4YAP A;  3WT2 A;  4G19 A;  1TTZ A;  1XPV A;  3IAS 2;  6GSX A;  3HKR A;  2KUC A;  3F63 A;  1ZCP A;  4CDO A;  3GV1 A;  3NZN A;  1X5C A;  2FA4 A;  5DCH A;  5D73 A;  2O85 A;  3NIV A;  1HD2 A;  1NSW A;  2B3S A;  1SL1 B;  1Q4J A;  2PVQ A;  3EVI A;  1WP0 A;  9GSS A;  3KH7 A;  4POK A;  2K8V A;  3TB2 A;  1PKZ A;  1GSF A;  1AQX A;  1BAY A;  5IPG A;  3UAR A;  1PN9 A;  1OVN A;  2VM2 A;  2E76 B;  1QGV A;  3HZ4 A;  5B6N A;  4I8B A;  4KAE A;  5IO2 A;  2C0E A;  1UA5 A;  3EU4 A;  3QAG A;  4PQ1 A;  1HNB A;  3ZIT A;  2C4J A;  1M7T A;  3HCZ A;  2O8V B;  1T8E B;  3FW2 A;  3UBL A;  3EU3 A;  1ZMA A;  4MAB A;  4AGS A;  5DQY A;  3FYG A;  1WMJ A;  2H70 A;  2WJU A;  2DJJ A;  4NHZ A;  1TOF A;  2GQM A;  1GUM A;  2MMZ A;  5G30 A;  7GSS A;  2HSH A;  1EEM A;  3TOU A;  5IIZ A;  5E4W A;  1YJ6 A;  5GAN D;  4AJ6 A;  5A4U A;  3U5R E;  3H4K A;  2LJK A;  3KP8 A;  4F0C A;  3I69 A;  1XVW A;  2O01 J;  5C00 A;  2H66 A;  2IMI A;  2XC2 A;  4TR1 A;  1TU7 A;  4IP6 A;  2JL4 A;  2K9F A;  2LTK A;  1XCC A;  2KP1 A;  3QAV A;  2CA8 A;  1O7U A;  5ECQ B;  1NM3 A;  2HRF A;  4WEY A;  4ILF A;  5JWR B;  3KGK A;  1M9A A;  4EUY A;  1Y6E A;  1YQ1 A;  4FYU A;  5EY6 A;  1VF4 A;  2VO4 A;  1Z9H A;  2AAW A;  1VRS D;  5A4V A;  3VWX A;  2JZR A;  3FY7 A;  3TCO A;  2DIY A;  2WDU A;  3FZ4 A;  3F3R A;  3CRU A;  2L5O A;  1TI3 A;  4NV5 A;  2IMK A;  1URM A;  1K3L A;  1QUW A;  1ABA A;  5DAL B;  1CQH A;  4WF5 A;  1F6M C;  2R2J A;  2GTU A;  1YZX A;  2FUG 2;  5CRH A;  5HR1 A;  4OO5 A;  3WGX A;  3HJP A;  1KEB A;  4TR1 B;  3Q74 A;  4CHS A;  4Z7X A;  2X64 A;  3A2V A;  4DVC A;  2DJ1 A;  1B9Y C;  1GL8 A;  3ZTL A;  1MEK A;  3HDC A;  2H74 A;  3GX0 A;  4XCS A;  3BJ5 A;  3TKR A;  3UVT A;  1BG5 A;  4G9H A;  5F0G A;  2D2C B;  4K7I A;  2HZF A;  1G6W A;  5JCW A;  4OFM A;  4F03 A;  1EGO A;  2LNT A;  2VAF A;  1NHY A;  3F8U A;  3VPT A;  5ECR B;  2YCD A;  3QR6 A;  4G2E A;  2GT6 A;  5ECN B;  3QFB C;  4PGT A;  1T4Z A;  5DJL A;  2MZC A;  5J3R A;  2N5F A;  2V32 A;  1U88 A;  3VWU A;  2CX4 A;  2L4Q A;  5KN1 A;  5D9W A;  4PQH A;  3R2Q A;  2R37 A;  1VGL A;  2GSQ A;  3GUS A;  2ES7 A;  4NXI A;  4NMU A;  5HR0 A;  3F6D A;  3E9J B;  3FZA A;  3ME8 A;  4I2T A;  1JZD A;  1PKW A;  4XIH A;  1GP1 A;  1GUK A;  4KX4 A;  4IS0 A;  1JLV A;  5EL8 A;  2VLT A;  3TKP A;  2ZCT A;  4CW9 A;  3GSS A;  1GRX A;  2IN3 A;  2RII A;  2R4V A;  2GT5 A;  1TRU A;  18GS A;  4FIW A;  4K9Z A;  4N0Z A;  3BBY A;  3CSH A;  2WS2 A;  2L4C A;  2EC4 A;  2RM5 A;  3C7M A;  3HJO A;  1GSS A;  2XBI A;  3GX8 A;  2HYX A;  3HVS A;  1UVZ A;  3TDG A;  4IGJ A;  3WT1 A;  3PGT A;  3ZRD A;  3A2W A;  1A2L A;  5GZZ B;  3ZRE A;  4E8E A;  5B8A A;  5L8R J;  2DLX A;  5J41 A;  2AJQ B;  3G7Y A;  4PX1 A;  1RK4 A;  4O32 A;  1VF3 A;  2J23 A;  5E59 A;  4X43 A;  4MF6 A;  2L6C A;  2JSZ A;  3H8Q A;  2FYN C;  4ID0 A;  2CV4 A;  2H1D A;  3LXT A;  2CAQ A;  5A4W A;  3D0Z A;  3U6V A;  3ZIJ A;  1XBS A;  1OYJ A;  1QK8 A;  4KA0 A;  3HD5 A;  5ECM B;  3HY2 A;  3RBT A;  2C3Q A;  1EGR A;  5JWQ B;  3W8J A;  1ZRT E;  3CRT A;  4EE0 A;  1AQV A;  1J9B A;  2WCI A;  3F3Q A;  3FEU A;  4GRF A;  1X5E A;  5DVB A;  3L78 A;  4BPY A;  1A8L A;  5D9V A;  3IXR A;  4I5Q A;  4L5O A;  1K0B A;  2NTO A;  4HOJ A;  1E6B A;  4BWQ A;  2DBC A;  4JR6 A;  5GAP D;  3OR5 A;  4XRD A;  3M8N A;  3ZLP A;  2FGX A;  4Q5F A;  1GNW A;  3KIJ A;  4WXT A;  2ZNM A;  2GZP A;  2CZ3 A;  5HR2 A;  1JZR A;  1GUL A;  5F05 A;  3C73 A;  3LG6 A;  1PX7 A;  1JZO A;  1SJI A;  2YWM A;  1G7O A;  4OD7 A;  3VPQ A;  2H6X A;  4KE3 A;  1O81 A;  2JZS A;  1EP8 A;  4FO5 A;  3EUR A;  4GST A;  1J0F A;  1AQW A;  1FVK A;  2ALB A;  3C71 A;  4GF0 A;  2MMO A;  3LXZ A;  4PUR A;  3DXB A;  2YP6 A;  2AHE A;  3GL5 A;  4ZB8 A;  5ECP B;  5G5F A;  3UIW A;  1GSQ A;  1FB0 A;  2C3T A;  1IYH A;  2ON5 A;  5DCG A;  1V98 A;  2H1A A;  1YF1 A;  1S3D A;  1OAZ A;  2WZ9 A;  3NOF A;  1F37 A;  3DRN A;  5IMA A;  1PQN A;  2PU9 C;  4TN8 A;  1YF0 A;  2CVB A;  1USB A;  4JR4 A;  1QFN A;  2OAC A;  3EYT A;  1W4V A;  2AB6 A;  3ZVJ D;  1MD3 A;  1B4Q A;  2VD0 A;  5HFI A;  1ILO A;  4TR3 A;  1YDK A;  2MYG A;  1GSU A;  5A5K A;  4ZIL A;  1M0U A;  2KP2 A;  1O85 A;  1XVQ A;  1DSB A;  4PUA A;  2GLR A;  3UBK A;  4V2L A;  2HRN A;  3S9F A;  1TU8 A;  3KTB A;  1SK0 A;  2VL3 A;  2MMN A;  4ECB A;  8GSS A;  4YQM A;  3P2A A;  2VL2 A;  1SD8 A;  4MH3 A;  2LJA A;  5F06 A;  2EIQ A;  4OFN A;  3FHK A;  3GN3 A;  2BJX A;  3LSZ A;  3IHQ A;  3VFI A;  3TKS A;  5LNK e;  1K0A A;  3TUE A;  4YH2 A;  4JU5 A;  4AF2 A;  2V2G A;  1XW5 A;  1ERV A;  3VWW A;  1PD2 1;  4J2F A;  2LRN A;  4ISD A;  4MJB A;  2H6Z A;  4WET A;  4KDY A;  4LMW A;  2H1B A;  1DE1 A;  1OC8 A;  3I6A A;  3DEX A;  1DE2 A;  3BCI A;  1BJX A;  4Q5N A;  4PUF C;  5JCG A;  2PMT A;  4E8H A;  4POB A;  5LD0 A;  1R4W A;  4XHM A;  4KCE A;  1XOB A;  1J08 A;  1T3B A;  3PR8 A;  2DJ3 A;  4PNF A;  4WBR D;  3US3 A;  2QJP C;  2VLV A;  3C8V A;  1TKD B;  1KNG A;  2N5A A;  2HNL A;  1TI1 A;  2Z9S A;  2DJK A;  3VUR A;  4K1F A;  3KCM A;  4OCF A;  5H5Q A;  2FD3 A;  2I1U A;  4P3Y B;  4HJM A;  5LCZ A;  3VLN A;  6GSU A;  2H0H A;  4IQA A;  3P90 A;  4TW5 A;  4L0W A;  3EC3 A;  2XHF A;  2PWJ A;  1AIU A;  4IEL A;  1X5D A;  1ZL9 A;  2FWH A;  2HT9 A;  1JFU A;  5JCU A;  1T1V A;  4F2I A;  4WR4 A;  1T4Y A;  5KN3 A;  14GS A;  2L5L A;  1I9D A;  4ML1 A;  2X99 A;  5D8I A;  5ENU A;  2DJ2 A;  3EMX A;  3GHA A;  3CTF A;  2MBS A;  2VCV A;  1GSE A;  4K8M A;  1PX6 A;  2I81 A;  2WRT A;  4MP4 A;  5CAX A;  2DSA A;  1DBY A;  1F9M A;  1GTU A;  3HJM A;  3KD0 A;  4IP1 A;  2LRT A;  2H6Y A;  1WJK A;  2OAD A;  1K3O A;  12GS A;  2R6K A;  2WPV B;  1PSQ A;  3LYK A;  5F07 A;  1GLP A;  3BCK A;  1K0D A;  4XS6 A;  2JAD A;  5F8B A;  5ECH B;  1VF1 A;  2FA8 A;  3LQ7 A;  3ERW A;  3D21 A;  1FVJ A;  2DJ0 A;  3CYN A;  4I97 A;  1N2A A;  2K9Y A;  3GUR A;  5FWG A;  2WSE J;  3FR6 A;  3UMA A;  3KXO A;  3VI5 A;  1SL2 B;  1B9X C;  5ECK B;  11GS A;  2B1L A;  4MPG A;  4KH7 A;  2DML A;  4XTS A;  1THX A;  3M9K A;  3RDW A;  3DYR A;  4F82 A;  1Q90 D;  4K7O A;  1UC7 A;  2TRC P;  1WWJ A;  2QGV A;  2ZT9 B;  2NDO A;  4MZW A;  4XS1 A;  1ERT A;  2LJR A;  2M72 A;  3QAW A;  1ZYE A;  1XZO A;  4EF0 A;  1WIK A;  2IIY A;  1C72 A;  1EP7 A;  3IDV A;  1GSY A;  1XW9 A;  3KJY A;  4Q5R A;  3LYP A;  3LJR A;  2IMD A;  3H1N A;  5IO0 A;  1GUH A;  3AY8 A;  4ECI A;  4HZ2 A;  3D22 A;  1A24 A;  3GKX A;  3LGC A;  1SKS B;  1SYX A;  1K0O A;  4RQX A;  4N30 A;  4IKH A;  2PER A;  3LW5 J;  3IA1 A;  1EWX A;  2I9H A;  4KW6 A;  2PVO C;  1SU9 A;  4EDZ A;  2HLS A;  3CXG A;  4NAX A;  4LLR A;  5D93 A;  2XPD A;  4NPB A;  2C8U A;  1DUG A;  4GWR A;  3C1R A;  5H5S A;  1TK0 B;  3IPZ A;  3MWH A;  4ACS A;  3V1W A;  2VCT A;  1V58 A;  5KN2 A;  1V40 A;  4DSR A;  3Q6O A;  3IV4 A;  2OJL A;  4GLT A;  1HNC A;  1SJ6 A;  3ERF A;  2GZY A;  2HZE B;  4ZBA A;  2CAI A;  2FWE A;  2OBI A;  1LJR A;  13GS A;  2NPB A;  2FHE A;  1WPI A;  1SKR B;  1S3C A;  1EV4 A;  2WB9 A;  1Z7P A;  3KZQ A;  2OE3 A;  2YJH A;  4ULX A;  2P5Q A;  4RQR A;  4YQU A;  2LV3 A;  6GSS A;  2YV9 A;  3EE2 A;  2L57 A;  3L9V A;  5B7C A;  5DDL A;  3VI7 A;  3IBH A;  2H73 A;  4N10 A;  1MDJ A;  16GS A;  3MNG A;  3VWV A;  4O7H A;  4IN0 A;  1GNE A;  3J7Y b;  1V9W A;  5COH A;  6GSW A;  2PGT A;  4ZL8 A;  1V57 A;  3KTL A;  4OWY A;  3APS A;  4D73 A;  5J9C A;  3ZFL A;  3TOT A;  6GST A;  3PIN A;  3HXS A;  2VCX A;  2LRC A;  3BOA A;  3H93 A;  3GKK A;  4PQI A;  3KM6 A;  4V2M A;  1T7P B;  1GH2 A;  1AUC A;  1PGT A;  2E0Q A;  3TGZ A;  2K8S A;  3TKQ A;  2HXK A;  2HZE A;  2WSC J;  2M80 A;  2YWI A;  1HNA A;  17GS A;  4K6X A;  4ZBD A;  2RUF A;  5G2Z A;  1MDK A;  2F8F A;  3P7X A;  4L0U A;  4ZB6 A;  2H71 A;  3RPP A;  1A8Y A;  4LMV A;  5CRW A;  3Q18 A;  1ZYQ B;  1VF5 B;  1AC1 A;  4JRR A;  2JAC A;  4QL7 A;  3O3T A;  3TKS C;  3QD9 A;  2GST A;  2GS3 A;  3O6T A;  3M9J A;  2IME A;  1JZW A;  3UL3 A;  2H01 A;  2B7K A;  2E74 B;  5AGY A;  3RHC A;  1OE7 A;  3MDK A;  1FO5 A;  1FAA A;  3UOM A;  2VL9 A;  2LEG A;  1M9B A;  1GWC A;  2YWN A;  3F6F A;  4GQF A;  2NBS A;  4AJ7 A;  5KEJ A;  3WD6 A;  4ZBB A;  4KT0 J;  2FWG A;  2YV7 A;  5DBQ A;  3LFL A;  4HU9 A;  5ID2 B;  2L59 A;  4RI7 A;  3UVH A;  2VCQ A;  3GIX A;  2PBJ A;  4N0V A;  4KB3 A;  4ECJ A;  4PNG A;  1Z5Y E;  2QJY C;  3HVX A;  1OE8 A;  5KLI C;  2G2Q A;  1TRV A;  2B1K A;  4JE1 A;  1A23 A;  2PPT A;  5J4U A;  2F8A A;  2A2S A;  1G6Y A;  3W8S A;  4HU7 A;  4AJ8 A;  5CO3 A;  2VM1 A;  3HHV A;  2VOC A;  3MSZ A;  1XWB A;  2RUE A;  4DSQ A;  3ZML A;  1ON4 A;  5JWO B;  1ERU A;  2V1M A;  4J56 E;  3APQ A;  5IMD A;  3MAK A;  2YPM A;  4MMM A;  4YAV A;  4MDC A;  3I43 A;  1MTC A;  1F2E A;  2GGT A;  4LA1 A;  2GZZ A;  1FW1 A;  4ZIJ A;  5C04 A;  2CVD A;  1G7E A;  3KMO A;  3TRQ A;  3TRP A;  3ZZX A;  1RQM A;  1TJD A;  2HI7 A;  3TJJ A;  4MK3 A;  2H75 A;  1EEJ A;  4KSM A;  4MLY A;  1BYE A;  2GVP A;  4OO4 A;  5ID2 A;  4H86 A;  2H0I A;  2H72 A;  3ZMK A;  2FY6 A;  4MH2 A;  4WR5 A;  2WGR A;  1O6J A;  4TR0 A;  5CRG A;  1H75 A;  5H5R A;  1GTB A;  3CSJ A;  4TR4 A;  3A3T A;  2OE0 A;  1M99 A;  3RHB A;  3GH9 A;  3E0U A;  1R5A A;  4L8E A;  1S3A A;  3ME7 A;  3HA9 A;  4EVM A;  3E3E A;  2H8L A;  5DAL A;  1SKW B;  2LNS A;  5CNW A;  2G0F A;  2LS5 A;  1TK5 B;  1XIY A;  3N9J A;  2GSR A;  3CMI A;  2QSI A;  4GXZ A;  5IM9 A;  4ZXG A;  3D4M A;  4F0B A;  4K2D A;  4GSS A;  2E7P A;  1SK2 A;  1JLW A;  3M1G A;  1YEX A;  3L9U A;  1XOA A;  2VL2 C;  4EO3 A;  1M2A A;  4J57 E;  4BVY A;  4LL1 B;  1U3A A;  4K7N A;  2YNX A;  2F3M A;  4PV1 B;  1K3Y A;  1PL2 A;  4LL4 B;  4JED A;  4QL9 A;  1E2Y A;  2P0G A;  1U3I A;  3CBU A;  1ERW A;  2CVK A;  3GTU B;  4OMV A;  5HFK A;  2F51 A;  5G1K A;  1XWK A;  5AIS A;  4XS4 A;  2MBT A;  5ECO B;  1IYI A;  2YN1 A;  2V6K A;  2H19 A;  4I2U A;  1YY7 A;  4ZB9 A;  2B6M A;  1SYR A;  5HFG A;  2FCH A;  2V41 A;  4HEA 2;  5GST A;  1Z6M A;  1BX9 A;  2O7K A;  4BVX A;  4QQ7 A;  1W89 A;  1F3A A;  2QJK C;  1Z6N A;  1PL1 A;  2KOK A;  4V2N A;  3IC4 A;  4MZC A;  2VD1 A;  1R7H A;  2AUV A;  3DGQ A;  5ELG A;  3GST A;  5G1L A;  4HS1 A;  2K6V A;  1OC3 A;  4MA9 A;  3ZVJ A;  3ED3 A;  2QKE A;  4NHW A;  2IPA A;  4TRX A;  1K0N A;  3QOU A;  1ZOF A;  1CQG A;  5AIX A;  3SBC A;  5J5N A;  4HI7 A;  3GKN A;  2YZU A;  2CX3 A;  3DD3 A;  3RAZ A;  6GSV A;  4EXJ A;  5AIV A;  3FKF A;  3DWV A;  4HQS A;  3GFK A;  1Q98 A;  4KDU A;  3DKS A;  2VCW A;  3QCP A;  3M0F A;  1X0R A;  3WYW A;  2FNO A;  4KGI A;  4MPF A;  1KBN A;  3FR3 A;  4MJE A;  4IQ1 A;  2H30 A;  2E75 B;  4YQV A;  1TP9 A;  4MJC A;  3ERG A;  3GL3 A;  2O87 A;  2IFQ B;  4X1U A;  2P31 A;  3QMX A;  2CQ9 A;  4KDX A;  1O73 A;  2YIU C;  2LQO A;  3D4T A;  2IL3 A;  2YWO A;  2C80 A;  2X8H A;  1EV9 A;  2VUP A;  3GKM A;  4BL7 A;  1WE0 A;  4L5L A;  2EIO A;  1X9M B;  1B48 A;  3QDN A;  2RLI A;  4GTU A;  2WSF J;  4TKY A;  5CRE A;  4KND A;  2H1G A;  3W6G A;  3GA4 A;  5FT3 A;  2BTO T;  1JHB A;  4RI6 A;  2LST A;  4TVE A;  3KH9 A;  2ZUP A;  1RW1 A;  4H0L B;  1TW9 A;  5KKZ C;  3HZ8 A;  5DAK A;  3KEB A;  4DSS B;  4EDY A;  2C0D A;  1GLQ A;  4IBP A;  3EWL A;  2OA7 A;  1YKC A;  3GMF A;  4IHU A;  2B5E A;  3FZ9 A;  2A2R A;  1ZZY A;  1AAZ A;  2I4A A;  2JSY A;  3FK8 A;  1T00 A;  1R26 A;  2VIM A;  20GS A;  1QXH A;  1Z7R A;  1ML6 A;  3K8N A;  1ST9 A;  1WOU A;  6GSY A;  1TRW A;  2J9H A;  2QC7 A;  1XXU A;  4FYB A;  3HVV A;  3G7I A;  4MCU A;  1K0M A;  3JCM L;  2IFQ A;  3IK9 A;  3RPN A;  5IMC A;  2OE1 A;  5EPF A;  2IJY A;  3TRX A;  4I7Z B;  4NV2 A;  2AV4 A;  4OCE A;  3J7Y k;  2MMA A;  1A2M A;  3KMN A;  1SJZ A;  3P8W A;  1K0C A;  2O89 A;  4Q5Q A;  2JU5 A;  1F3B A;  3LEF A;  5ABR A;  4WKW A;  4RKU J;  4H13 B;  2C3N A;  2DC5 A;  1KTE A;  3IK7 A;  1TK8 B;  3GNJ A;  4O92 A;  3DVW A;  3TJB A;  1N8J A;  2C1Y A;  2LUS A;  5D9X A;  19GS A;  5AN1 A;  2YAN A;  3HYP A;  1FHE A;  3A5W A;  4TXO A;  2VLU A;  1I5G A;  4MF7 A;  4V1A p;  1PMT A;  3GTU A;  2WUL A;  2B5X A;  4KCA A;  2HSY A;  2WFC A;  5DQS A;  4XS4 B;  1AXD A;  1EOH A;  1O8W A;  5B6M A;  2L6D A;  5FHI A;  1QMV A;  1A2J A;  3F0I A;  3QPM A;  3ZYW A;  1XFL A;  1PRX A;  4IVF A;  2AYT A;  4POM A;  3TJK A;  3GH6 A;  3UJ1 A;  3WGD A;  2XBQ A;  2R3X A;  3KP9 A;  1OC9 A;  1TXX A;  2KHP A;  3C8E A;  1S5L X;  1MDI A;  4KUN A;  3ISO A;  1XWG A;  2IWT A;  2TRX A;  1EZK A;  4OFT A;  2PN8 A;  3DIE A;  1AW9 A;  1U87 A;  4Y28 J;  1GTI A;  1ZGN A;  1M2B A;  1PA3 A;  3CSI A;  5IQY A;  2IMF A;  2XPE A;  2DMM A;  1XWC A;  3TJF A;  4G10 A;  3D5J A;  4HJ2 A;  4MJA A;  3GYK A;  2A4V A;  1UN2 A;  2HFD A;  4POL A;  1EOG A;  3D6I A;  3DML A;  4V1A g;  4IL6 X;  4BA7 A;  2DIZ A;  1HQO A;  4IJ3 A;  1ACV A;  4NWY A;  5KN0 A;  3F4S A;  1THO A;  2TIR A;  5B8B A;  1H4O A;  22GS A;  4F9Z A;  1OC9 B;  1LU4 A;  1FG4 A;  3L9S A;  1XWA A;  2YJ7 A;  1B8X A;  5L71 A;  1FOV A;  5IMF A;  3L4N A;  3L0H A;  1GSD A;  4OGQ B;  2C0F A;  3QFA C;  1TDI A;  2I3Y A;  1YKA A;  2M46 A;  3GRX A;  2FWF A;  4O5R A;  4ECC A;  2CT6 A;  4RUV A;  2JZT A;  3DVX A;  4ZL7 A;  2ON7 A;  5DAK B;  4DSS A;  4EKZ A;  2GQK A;  5ECI B;  4PXO A;  4HDE A;  1Y25 A;  4ZL9 A;  5G5E A;  5IOX A;  10GS A;  4XRA A;  2BMX A;  3IRA A;  4EL1 A;  3ZFB A;  1O8X A;  4FYC A;  2OBK A;  4MF5 A;  5GSS A;  4I6X A;  2LQQ A;  4H44 B;  3G9B A;  3UAP A;  4WF4 A;  2GDR A;  3IE3 A;  5IPH A;  5IMV A;  1X9S B;  2B5Y A;  3PH9 A;  3WGE A;  1V2A A;  5EVO A;  4FH8 A;  2NVL A;  3LWA A;  2D2Z A;  1U6T A;  5IOW A;  5ELA A;  3C1S A;  4DEJ A;  4GQC A;  3O76 A;  2X8G A;  2E2M A;  2HE3 A; 
#chains in the Genus database with same CATH topology
 1J1E C;  2REM A;  2GQL A;  2IBZ D;  4IL6 E;  2WTY A;  1B4P A;  1YIT P;  5HR3 A;  5AVR B;  3B8E B;  2Q6Q A;  1OZH A;  4LGD E;  1WRY A;  2EIR A;  4K0N A;  3AEA C;  1VF2 A;  5CJ4 A;  3H79 A;  4X0X A;  4N11 A;  3BD2 A;  4YKF A;  3A2X A;  1CSB A;  2FYU D;  4PJ0 E;  5DJU B;  3CLQ A;  5CCH A;  5ECL B;  4TXV A;  1JB0 J;  1HGZ A;  2H0G A;  2VCZ A;  1Z3E A;  1FZC B;  1JY2 N;  2YZH A;  5CRD A;  2H76 A;  2M3E A;  2GSS A;  4HQZ A;  1FB6 A;  1IK7 A;  3F9U A;  1L0L G;  1A0F A;  1HVV A;  3CTG A;  2UWJ E;  1QQ2 A;  3FR9 A;  3EIN A;  2RM6 A;  1SK1 A;  2QG4 A;  1SQQ D;  2N5B A;  2OYI C;  5DJM A;  3LOR A;  1HYU A;  4KSO A;  4EC0 A;  2KNC A;  2XDJ A;  1SEN A;  3IAM 2;  2R3S A;  2PUK C;  1IC2 A;  3N5O A;  4ML6 A;  4W7Z A;  1SD9 A;  3F4R A;  3SWY A;  4OGQ D;  2W6A A;  3SWL A;  1YEP A;  3I9V 2;  4TXO B;  3H1K D;  5CYY A;  3TJG A;  3B5N D;  2CZ2 A;  2P5R A;  1G2C A;  5INY A;  2IYP A;  1SL0 B;  3IOS A;  5G31 A;  3ZL5 A;  3F4T A;  5D96 A;  3GW6 A;  3D6Y A;  3IR4 A;  4TOP A;  1XW6 A;  2B7J A;  1GTA A;  4HZ4 A;  5AW7 B;  1NAF A;  3FWN A;  2B87 B;  1MD4 A;  2C0G A;  5GTH H;  4K0G A;  4BWS A;  2RKL A;  5AVW B;  3HD7 D;  1YI2 P;  1G0T A;  2KLX A;  3AE8 C;  3G7J A;  2PGD A;  1NHO A;  1M2D A;  1LBK A;  3L74 D;  1EZV E;  3L70 E;  4H13 C;  2E5Y A;  2F9S A;  4I7Z C;  2WIT A;  3RL0 B;  4IJI A;  1M3I A;  4EYY Q;  1R5P A;  2QIW A;  3B5N A;  4YKG A;  1SQP D;  3TKS E;  4WBJ A;  2LKU A;  3ZIV A;  3VK9 A;  3A5I A;  5HQP A;  2RMZ A;  2P2U A;  2R0C A;  4D73 B;  3CI9 A;  3M3M A;  2R5G A;  4IW9 A;  2FLS A;  1BED A;  1URQ C;  1OKT A;  3PH0 A;  4B86 A;  3RK3 D;  1PP9 D;  3G6E P;  3APO A;  1TRS A;  2E2G A;  4JZQ A;  2OKA A;  3H1H E;  3L75 D;  3IN6 A;  3Q19 A;  3CCS P;  3V5B A;  1OW7 A;  4MZB A;  1LT9 C;  3L74 E;  1SQB E;  1BE3 E;  4GCI A;  4JBB A;  2XZR A;  1OKD A;  1GU4 A;  4ZMD A;  1FJK A;  4IFM A;  1QX8 A;  3KQG A;  3EMP A;  3H1J E;  5CP1 A;  5IMZ A;  1NW2 A;  2YOI A;  3O8Z A;  1A0R P;  3EQ2 A;  3FRC A;  3FX0 A;  1GU5 A;  3M9Q A;  4HUA A;  3RBX A;  2X8C A;  1BQ7 A;  1X9W B;  3FZ5 A;  5ECS A;  5J9B A;  5D9T A;  4GSN A;  1ZV8 A;  3TK1 A;  3RL0 C;  2HPC B;  4HSC X;  2V6O A;  3UEM A;  2K18 A;  3T97 A;  4YAP A;  3WT2 A;  4G19 A;  1TTZ A;  1XPV A;  3IAS 2;  6GSX A;  3HKR A;  1USD A;  5AW6 B;  2KUC A;  3F63 A;  1ZCP A;  4CDO A;  3GV1 A;  3NZN A;  1EZV I;  1YJW P;  1X5C A;  2FA4 A;  4C7N A;  5DCH A;  5D73 A;  2O85 A;  2FYU K;  2IZ0 A;  2KI7 B;  4JPZ B;  1MFZ A;  3NIV A;  1HD2 A;  1NSW A;  2WZ7 A;  2B3S A;  1SP4 A;  2GUS A;  1SL1 B;  1Q4J A;  2PVQ A;  3EVI A;  4CY8 A;  1WP0 A;  9GSS A;  1FBM A;  3KH7 A;  2O01 H;  1R5S A;  2K8V A;  4POK A;  2WSS H;  1IFP A;  3OA7 A;  3TB2 A;  1PKZ A;  1GSF A;  3EWK A;  1AQX A;  1BAY A;  5IPG A;  2E76 C;  5B5E H;  3UAR A;  1PN9 A;  1OVN A;  2VM2 A;  2OYH C;  2E76 B;  3N7N A;  1KIL D;  2WWW A;  4ZKU A;  1QGV A;  1KQL A;  3HZ4 A;  5KJ7 D;  1NTK E;  5B6N A;  4I8B A;  4KAE A;  1M3J A;  2C0E A;  5IO2 A;  3CXH H;  1FU1 A;  5APT A;  1UA5 A;  1NTM D;  2IZ1 A;  3EU4 A;  3D70 A;  3PTZ A;  3QAG A;  4PQ1 A;  4X4J A;  3BRT B;  1HNB A;  3ZIT A;  1JTH A;  2LXC B;  2BEZ F;  2DKI A;  3JC2 2;  4L76 A;  3L73 E;  2C4J A;  1LTJ C;  1PN0 A;  1M7T A;  3A2A A;  3HCZ A;  2O8V B;  1T8E B;  1VQ7 P;  3CWB D;  3FW2 A;  3UBL A;  2WSC H;  3EU3 A;  1FDM A;  1ZMA A;  4MAB A;  4EDF A;  3TNU A;  1VF5 D;  2ZYG A;  4AGS A;  5DQY A;  3I56 P;  3FYG A;  1WMJ A;  4K5R A;  2H70 A;  2E74 C;  1HTL C;  1NTK K;  2WJU A;  2DJJ A;  1M7L A;  4NHZ A;  1NVO A;  1TOF A;  2GQM A;  1GUM A;  2POH A;  2MMZ A;  5G30 A;  1DH3 A;  7GSS A;  2HSH A;  1EEM A;  2ITA A;  3RL0 g;  3L75 G;  3TOU A;  5IIZ A;  2JEE A;  4WY4 C;  5E4W A;  1YTZ I;  4U3F G;  1YJ6 A;  5GAN D;  4AJ6 A;  1S2E A;  4OH8 B;  1IZN B;  5A4U A;  1LTG C;  3U5R E;  3H1I D;  3H4K A;  3HE4 A;  3AEB C;  3B4S A;  2LJK A;  2KZJ A;  3KP8 A;  1LGH B;  2FYU J;  4F0C A;  3I69 A;  3AE2 C;  3RK2 D;  1XVW A;  2O01 J;  2QA4 P;  5C00 A;  3CWB J;  2H66 A;  2IMI A;  2XC2 A;  4TR1 A;  3D6Z A;  1JY3 N;  5AW0 B;  1KYO I;  1L0L E;  1TU7 A;  3A7O A;  2VRS A;  4IP6 A;  2JL4 A;  2P10 A;  3CCJ P;  4N3Y B;  2K9F A;  2NPS A;  1CI6 A;  2LTK A;  1XCC A;  2KP1 A;  3C1L A;  3AE9 C;  1GD2 E;  3QAV A;  2CA8 A;  1O7U A;  2LR2 A;  1NU1 D;  5ECQ B;  2KNC B;  1NM3 A;  2HRF A;  3Q3D A;  4WEY A;  3PLN A;  1JNM A;  4ILF A;  3CME P;  2K9J B;  5JWR B;  3KGK A;  3LID A;  1U57 A;  3GG2 A;  5AVX B;  1M9A A;  3P8M C;  4AUW A;  4EUY A;  1Y6E A;  2I1K A;  1YYC A;  1W2E A;  1IFN A;  1YQ1 A;  4FYU A;  2B89 A;  2QJK B;  1VF4 A;  1OVR A;  2VO4 A;  5EY6 A;  1OVU A;  1L4A A;  2FKW B;  2R44 A;  1Z9H A;  3L71 D;  2AAW A;  1VRS D;  4BVY B;  5A4V A;  1L0L K;  2G3A A;  3VWX A;  2N9B A;  4K2X A;  2JZR A;  3L72 G;  3SFD C;  2FFD C;  3FY7 A;  2BCC D;  3TCO A;  2DIY A;  2WDU A;  2FY8 A;  4EIQ A;  3FZ4 A;  3IF4 A;  3F3R A;  1ZME C;  1PV3 A;  2XND H;  4IFF A;  3CRU A;  2L5O A;  1TI3 A;  3C9I A;  4NV5 A;  1OMI A;  2IMK A;  1K3L A;  1URM A;  1QUW A;  1NTK J;  1ABA A;  5DAL B;  2HFE D;  4H0L D;  1CQH A;  1FOS F;  4WF5 A;  2N1T C;  1PP9 G;  1F6M C;  2R2J A;  2GTU A;  1YZX A;  2FUG 2;  3L71 J;  5CRH A;  5HR1 A;  1KIL C;  4OO5 A;  1HUC A;  1SQX G;  3WGX A;  4BVX B;  5KAF E;  1FZC C;  3HJP A;  1KEB A;  4TR1 B;  3Q74 A;  4CHS A;  4Z7X A;  2X64 A;  1GL2 B;  1LWU A;  3A2V A;  3E7K A;  2WPS A;  3KHU A;  4DVC A;  2DJ1 A;  1B9Y C;  1GL8 A;  3ZTL A;  2KUB A;  2ZYA A;  1MEK A;  3HDC A;  2H89 C;  2H74 A;  3GX0 A;  4XCS A;  3BJ5 A;  3TKR A;  3NXS A;  2E42 A;  3UVT A;  1BG5 A;  4G9H A;  2QA2 A;  5F0G A;  2D2C B;  4K7I A;  3HD7 A;  1NWQ A;  1PPJ D;  2OQQ A;  2HZF A;  3M06 A;  1G6W A;  5JCW A;  1N73 C;  2QEX P;  1NJI Q;  1LWU C;  2YO3 A;  3RK2 C;  3WUT A;  2KSJ A;  4OFM A;  4F03 A;  2HPC A;  1EGO A;  2LNT A;  2VAF A;  1NHY A;  1L4A B;  2FFD B;  3F8U A;  3VPT A;  3HTK B;  5ECR B;  1KB9 E;  1PGP A;  2YCD A;  2FYU E;  3QR6 A;  3CL3 D;  4N78 E;  4G2E A;  3F89 A;  2GT6 A;  5ECN B;  3QFB C;  4PGT A;  1T4Z A;  2JKV A;  3IAO A;  5KOX A;  5DJL A;  2MZC A;  3S4R A;  5J3R A;  2N5F A;  2V32 A;  1U88 A;  3VWU A;  5KAF H;  2CX4 A;  2L4Q A;  5KN1 A;  5D9W A;  4GIF A;  3SWF A;  4PQH A;  1G1I A;  3R2Q A;  2R37 A;  1VGL A;  4JF7 A;  2GSQ A;  3L75 E;  3GUS A;  2V7Q H;  5APU A;  5KLI B;  4U3F E;  1HWT C;  2ES7 A;  4NXI A;  1LTS C;  3UIA A;  4NMU A;  2JJL A;  4WWI A;  5HR0 A;  1PGO A;  3F6D A;  3E9J B;  3FZA A;  3ME8 A;  3CCV P;  4I2T A;  3PRJ A;  2N1T B;  1JZD A;  2O1K A;  1PKW A;  4XIH A;  3VMX A;  4R4L A;  1P84 I;  1YJN P;  2Z4E A;  1MUU A;  3AE7 C;  1GP1 A;  1GUK A;  4KX4 A;  4IS0 A;  1JLV A;  2QJP B;  3MP7 B;  2VLT A;  5EL8 A;  1T2K C;  2HRA A;  4AQR D;  3TKP A;  2A45 I;  2ZCT A;  4CW9 A;  3GSS A;  1PL5 A;  1GRX A;  1LNQ A;  2IN3 A;  2R4V A;  2RII A;  3V2R A;  2GT5 A;  1TRU A;  18GS A;  1HJB A;  4FIW A;  4PTS A;  5KLV J;  3V4W A;  4K9Z A;  4IL6 H;  3P7K A;  4N0Z A;  1L4A D;  3BBY A;  1L0L D;  3NFQ A;  1VQK P;  3CSH A;  3CC4 P;  1SQP G;  1NAY A;  3WUU A;  4DJG A;  2WS2 A;  2N1T D;  2L4C A;  2EC4 A;  1NTZ G;  1JTH B;  3AED C;  2RM5 A;  3C7M A;  3HJO A;  1GSS A;  1IO4 A;  1HJ0 A;  2XBI A;  3GX8 A;  2HYX A;  1JY2 P;  1A02 F;  3HVS A;  1UVZ A;  3TDG A;  3MZW B;  4IGJ A;  3WT1 A;  3PGT A;  3ZRD A;  3A2W A;  2JWD A;  3G3Z A;  1A2L A;  5GZZ B;  1N7S B;  3ZRE A;  4E8E A;  5B8A A;  3KDP B;  5KJ7 C;  5L8R J;  2KLV A;  2DLX A;  1KIL B;  5J41 A;  2AJQ B;  3BVH A;  3G7Y A;  4PX1 A;  1RK4 A;  1VQ8 P;  4O32 A;  5AW3 B;  1VF3 A;  2J23 A;  5E59 A;  3Q2Y A;  4X43 A;  4MF6 A;  2L6C A;  2JSZ A;  3H8Q A;  2FYN C;  4ID0 A;  3ITK A;  2CV4 A;  1FJP A;  2H1D A;  3LXT A;  3M9H A;  4K35 A;  2CAQ A;  5A4W A;  3D0Z A;  3U6V A;  3ZIJ A;  1XBS A;  3AE6 C;  1OYJ A;  3AE4 C;  2IFN A;  1QK8 A;  3TSI A;  4KA0 A;  3HD5 A;  5ECM B;  3HY2 A;  3RBT A;  2C3Q A;  1EGR A;  5JWQ B;  1XTG B;  1W2B O;  3W8J A;  1ZRT E;  3CRT A;  1VF5 C;  2HYN A;  2XV5 A;  4EE0 A;  1AQV A;  2A45 G;  1J9B A;  2WCI A;  4G0K A;  3F3Q A;  3FEU A;  2Z5I A;  4GRF A;  1X5E A;  5DVB A;  3L78 A;  4YPC A;  3CCU P;  2O3J A;  4BPY A;  1A8L A;  3L73 J;  5D9V A;  3IXR A;  4I5Q A;  2YKP A;  4L5O A;  2SPZ A;  1SQQ E;  1N7S C;  1K0B A;  2NTO A;  1DEB A;  1BCC D;  4HOJ A;  1J1D B;  1E6B A;  4BWQ A;  3Q1M A;  2DBC A;  4JR6 A;  2KS1 B;  5GAP D;  3OR5