2QSIA

Crystal structure of putative hydrogenase expression/formation protein hupg from rhodopseudomonas palustris cga009
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
PTLVDEATVDDFIAHSGKIVVLFFRGDAVRFPEAADLAVVLPELINAFPGRLVAAEVAAEAERGLMARFGVAVCPSLAVVQPERTLGVIAKIQDWSSYLAQIGAMLAEVDQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative hydrogenase expression/formation protein hupG
publication title Structure of putative hydrogenase expression/formation protein hupG from Rhodopseudomonas palustris CGA009.
rcsb
source organism Rhodopseudomonas palustris
total genus 23
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07449 HyaE Hydrogenase-1 expression protein HyaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2qsiA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2qsiA01
4OO4A 1PQNA 1GSSA 2CX3A 2YV9A 3RPPA 1Z6MA 2AJQB 2YZUA 22GSA 1G7OA 4JZQA 3EU4A 4MZCA 3TRPA 5FHIA 1LU4A 4N0VA 4RUVA 1EOHA 3GKKA 2X8HA 3ERWA 1SJZA 3I9V2 2PUKC 2L57A 5CRHA 1IYIA 1ERWA 2VLTA 4TN8A 5G31A 3MWHA 1HNCA 2ALBA 2JU5A 1FVKA 4IS0A 2PPTA 3RBTA 3F4TA 2QGVA 1C72A 1GTIA 5G1KA 2L5LA 2K8SA 2VL9A 2R2JA 1NW2A 1YQ1A 4ISDA 2NPBA 1SD9A 2WSEJ 1JLWA 3QR6A 2ZNMA 1H4OA 3MNGA 2P0GA 1WJKA 4YAVA 3GRXA 2B5EA 3A5WA 1EGRA 2WB9A 4YH2A 4MF6A 2R5GA 4XS4B 4OFMA 4KH7A 4IJIA 1GTAA 2H0IA 5F8BA 1GL8A 2E2MA 4K9ZA 4WR4A 3IE3A 4NV2A 1EP8A 3PR8A 1JZWA 6GSXA 3GN3A 1O8WA 3LG6A 3ZFBA 1Z3EA 3GX8A 4PV1B 3QDNA 5IMDA 1V9WA 1AAZA 1WRYA 2GT6A 5CRDA 1K3LA 2O89A 2B7JA 1K3OA 2OBKA 4L0UA 3EMXA 2HYXA 1XVQA 3LYPA 2XC2A 2QKEA 4MJBA 4WETA 5DAKA 1KEBA 1M0UA 1OE7A 3P7XA 4GRFA 2MZCA 2FYNC 4YQUA 1QUWA 2R3XA 1X9SB 3EVIA 3C1SA 2WSFJ 2VCVA 4MF7A 2YWOA 3A3TA 4XS6A 2KP1A 4POLA 2JACA 3EMPA 11GSA 3LEFA 3ZVJD 2ON7A 4ZB9A 1PKWA 5KLIC 4PNFA 3M0FA 3FK8A 1PKZA 2WULA 1XWAA 2H76A 2X8GA 4ILFA 1RK4A 4HQSA 2LUSA 2CAIA 1HNBA 1T4YA 3RHCA 1AIUA 2LRNA 2E7PA 2H1DA 2LKUA 1PX6A 4OO5A 3GA4A 1THXA 4OCEA 4TR4A 9GSSA 1T4ZA 1XWBA 1WWJA 3CSHA 2V1MA 3EC3A 1GWCA 2VAFA 4NHZA 1S3AA 5IMFA 4ZBDA 3LFLA 2B1KA 5KEJA 4K6XA 4KDXA 1ZOFA 6GSSA 2PWJA 1MD4A 4XS1A 2HLSA 2C0DA 3M1GA 3UEMA 2M46A 5ID2B 2G0FA 5F06A 4K7IA 4WF5A 2QJKC 3OR5A 1WOUA 3FZ9A 2WDUA 2FCHA 20GSA 1PL1A 4IBPA 1SD8A 3C71A 1EEJA 2LNTA 2R6KA 2FUG2 2WPVB 1AQWA 1GSDA 4TOPA 4GQFA 3BCIA 1ILOA 1K3YA 3VPTA 3VI7A 4F9ZA 2P5QA 3FY7A 3SWLA 4MPFA 3LW5J 3GUSA 1TRWA 4LL4B 1X0RA 3F9UA 1GH2A 5E4WA 2O7KA 4KGIA 1ON4A 5ECNB 5C00A 3DXBA 5IMCA 1VF4A 1JZOA 4MK3A 2ZT9B 4H0LB 4V2MA 2CVKA 2C80A 3ISOA 1O6JA 2MBSA 3KZQA 3R2QA 4G9HA 1FAAA 4HU9A 2R37A 4ZB6A 1O73A 5GSTA 7GSSA 1UN2A 1XCCA 1GNWA 2C4JA 2MMZA 1A8YA 2D2CB 2OJLA 3KJYA 2N5FA 1USBA 5A4VA 5HFKA 4GF0A 2VLUA 2DIZA 4BVXA 3IA1A 5LD0A 2YANA 3TRXA 4MH3A 5CREA 5F07A 1AC1A 2BTOT 4X43A 5DDLA 3HKRA 2QJYC 4D73B 4KDYA 1BG5A 1BQ7A 3G7YA 2KOKA 4POKA 5IM9A 1T8EB 3HDCA 3KH7A 2HI7A 4EF0A 3TJBA 5ECPB 4LMVA 5B6NA 4KSOA 4YAPA 1A0RP 3HD5A 1RW1A 2HSYA 2B5XA 2H8LA 1TRSA 3D21A 3J7Yb 1OE8A 5CNWA 2LJRA 3GFKA 5ELAA 3AY8A 2X8CA 2RUFA 5D96A 2X99A 5GAND 4EXJA 1M2DA 1WE0A 2FLSA 4X1UA 4NAXA 4I7ZB 4J56E 4L5OA 4OMVA 3K8NA 4KT0J 5GSSA 2VL2A 1W4VA 3UAPA 3KP9A 1UC7A 3VK9A 3UOMA 3HXSA 1T7PB 3EWLA 3F0IA 2IFQB 2B5YA 3H1NA 3I43A 2WSCJ 1K0DA 2Z9SA 1XOBA 1GUHA 1FVJA 3VURA 1QK8A 3D0ZA 2LJKA 5H5SA 3UL3A 2RIIA 3IK9A 5AIVA 1YKCA 2XPEA 4HUAA 4MPGA 3CTFA 1TP9A 4V1Ag 3TJJA 3FZ4A 3WT1A 1NM3A 2FWHA 1SK0A 2A2SA 2EIQA 4QL7A 2VUPA 1F6MC 4CW9A 6GSYA 1X5EA 3FKFA 5DJMA 2GQKA 4MP4A 1N2AA 1TKDB 1SK2A 4TR1B 2PMTA 4I2TA 5F05A 3VWWA 2FGXA 3BD2A 4GSTA 1B9XC 4MF5A 1X9WB 3C8EA 2XBIA 2J9HA 2N5BA 4DSRA 2HRFA 3CTGA 1O81A 3BJ5A 1TDIA 14GSA 2H66A 1MDKA 3I6AA 1XWCA 4ULXA 4K7NA 3DGQA 5IIZA 3IAS2 3HJPA 5IQYA 1J9BA 5ELGA 2DBCA 4Z7XA 1XVWA 2KHPA 5ECOB 1ZCPA 4IVFA 5IOXA 1FW1A 1VGLA 2AHEA 5ECRB 4O32A 2H6YA 4F03A 1TJDA 2IMDA 4BA7A 2DSAA 3APOA 5G30A 3VFIA 4TKYA 2H0GA 2GQLA 1TTZA 1OC9A 5G1LA 1B9YC 1Y6EA 1T3BA 3C1RA 1Q90D 4LLRA 3F4SA 1R5PA 5F0GA 4GTUA 1PGTA 1Z5YE 3GX0A 1YEXA 2ES7A 5HR2A 5ECSA 6GSTA 4H86A 3RPNA 4CHSA 3W6GA 5B6MA 2H30A 2GS3A 4ML1A 4NPBA 4EKZA 2GSQA 1EZKA 2L59A 1K0AA 3KP8A 3GIXA 2IWTA 1MD3A 5LNKe 3GURA 1OYJA 4I97A 5D9WA 3DRNA 1SKRB 1M9BA 3QAGA 5D9TA 1GUKA 2C0GA 1ML6A 3UVHA 5A5KA 5DCHA 4WF4A 2I9HA 2I3YA 1SL2B 2CA8A 3M8NA 2GLRA 1K0CA 3M9KA 2D2ZA 4PX1A 4K0NA 2TRXA 4J2FA 1Z9HA 2HSHA 3A2XA 3DKSA 1SJ6A 1DBYA 2DJ3A 1NSWA 1G0TA 1F2EA 1HD2A 4K2DA 4KDUA 1TK8B 2LQOA 1TRVA 1FHEA 2WJUA 1S5LX 4V2LA 1ZYEA 2WS2A 3DWVA 2LS5A 2L4CA 4WEYA 1M7TA 3H8QA 3UARA 3GTUA 1MEKA 1FB0A 3TUEA 4Q5NA 4MJAA 2L6CA 3O6TA 2C0FA 3TJKA 2XPDA 2JZRA 3P90A 4G2EA 3LSZA 3E9JB 3IK7A 4EE0A 4X0XA 1Z6NA 4JR4A 4MZBA 5EY6A 4HS1A 3GSSA 1V57A 3ERFA 1J08A 3GYKA 4ZBAA 4GSSA 3F6FA 2DJKA 2EC4A 2VCQA 3FZAA 2MYGA 2V2GA 1ERTA 4FYCA 4FYUA 1V2AA 3M9JA 3SBCA 5HR1A 2OA7A 1VF3A 2VL3A 2M72A 4KCAA 4DSSA 5DALB 1GTUA 3A2WA 4OCFA 16GSA 2DMLA 1WP0A 2JZTA 1DUGA 1V58A 4XRDA 2QIWA 4N30A 1M99A 3TRQA 3ZL5A 2HRNA 3UVTA 2H75A 4ZIJA 1S3CA 3LGCA 3L4NA 4V2NA 1A8LA 5JCGA 3DMLA 4IJ3A 3ZZXA 2PERA 4HQZA 1YF1A 4RKUJ 2HZFA 4MMMA 5COHA 1ABAA 2I1UA 1URMA 2PN8A 4MCUA 1TU7A 3C8VA 3WGDA 2DLXA 4BVYA 4TR3A 4Q5FA 1ZGNA 4MH2A 4TRXA 1B48A 3WT2A 4IW9A 2LQQA 3CXGA 3GMFA 4PGTA 1ST9A 1R7HA 1PD21 1V98A 2OACA 1MDIA 4OFTA 1X5CA 1OKDA 3KH9A 4BPYA 3GKXA 4MDCA 2HFDA 3TCOA 2FD3A 4EO3A 5EL8A 1B8XA 3QD9A 1Z7PA 5ABRA 2GT5A 4N0ZA 1U88A 1GNEA 4OWYA 3TKPA 3RDWA 1JZDA 5IO0A 1PL2A 4OD7A 5L71A 4IKHA 1SKWB 1ZMAA 4HDEA 4AGSA 4PUAA 1YZXA 1OC3A 3HVXA 2J23A 3DIEA 6GSVA 4GXZA 4CDOA 3G7IA 3VI5A 3EURA 4YQMA 3FR3A 1TK0B 3UBKA 1UVZA 3GH9A 2YWMA 3TKRA 2VLVA 5KN2A 1I9DA 4ZILA 1AW9A 4MLYA 17GSA 4KB3A 2FNOA 2MBTA 1CQHA 4XS4A 4BL7A 2LRCA 1JLVA 3V1WA 4BWSA 4TVEA 4E8EA 4IP1A 2E75B 2FA4A 1DE1A 3TJGA 2B3SA 4P3YB 1UA5A 2DMMA 1BYEA 3Q74A 1F37A 1PA3A 3D4TA 3BCKA 5AIXA 3KMNA 13GSA 3PGTA 2A2RA 3QAVA 4IELA 3F3RA 3FZ5A 2FY6A 1U6TA 4O5RA 2GZPA 4K0GA 1DE2A 5ECIB 2HZEA 5J3RA 2GSSA 4ML6A 2O85A 5HFIA 1SK1A 4ECIA 1F3AA 3GNJA 3BOAA 2C8UA 2BJXA 3H4KA 1GSUA 3VWUA 3HCZA 1PSQA 3Q6OA 6GSWA 4TXOB 3KEBA 3TDGA 2I81A 5HR0A 4NXIA 3W8JA 2YJHA 5EVOA 1U3IA 1O8XA 1EV4A 6GSUA 3HVVA 2CAQA 3NIVA 2GDRA 5IO2A 3ZIJA 5CO3A 1MTCA 4I8BA 1EV9A 2H72A 5IOWA 3HY2A 4JR6A 1ZYQB 4L5LA 1R4WA 3CBUA 5IMZA 1OC8A 5D93A 1XZOA 1YY7A 3QMXA 4MZWA 5D9VA 5J4UA 1NHOA 4XRAA 2VD1A 2H6XA 5ECHB 3KMOA 1JFUA 4ECJA 2TIRA 1XIYA 5KN3A 1GUMA 3LQ7A 3IOSA 5JCWA 3N5OA 3TOTA 2CX4A 2PVQA 4G10A 2VCWA 3F4RA 2QC7A 2F8AA 3WYWA 3J7Yk 4Y28J 1DSBA 3ZLPA 2TRCP 4OGQB 1EP7A 2FA8A 2ZCTA 5ID2A 4Q5RA 1BJXA 3EU3A 2LJAA 4IQ1A 2ON5A 2GVPA 2QSIA 3LXTA 3M3MA 5LCZA 3KCMA 2OE1A 2NBSA 3NZNA 5FT3A 5J9BA 1GLPA 3FHKA 4TXVA 2NTOA 2M80A 3RAZA 5AN1A 2DJ0A 1GSFA 5G5EA 1EEMA 3FRCA 18GSA 3FW2A 2YN1A 1X5DA 1MDJA 1T1VA 2PU9C 4MJCA 5CP1A 3L9VA 2KLXA 2H74A 4GLTA 3IHQA 2L6DA 3IR4A 1J0FA 4PQ1A 4KX4A 2P5RA 4Q5QA 5A4WA 2LRTA 2XBQA 5ECKB 2MMNA 2VD0A 4L8EA 4RQXA 3L9SA 5HFGA 3IRAA 4AF2A 1Q98A 2ZUPA 4KUNA 4XHMA 1AQXA 5JCUA 2GSTA 3WGEA 3U6VA 1E6BA 3JCML 3N9JA 2O8VB 4K7OA 1XXUA 1SYRA 4EC0A 4HI7A 1THOA 1QFNA 3QCPA 1FO5A 3Q18A 4WKWA 1QXHA 1XWGA 1TU8A 1QMVA 4GQCA 5B8BA 4I6XA 2V6KA 1IYHA 4IP6A 3DEXA 5KN0A 4FIWA 5GAPD 1WMJA 1PRXA 1AUCA 2CZ2A 3IV4A 3GHAA 2YIUC 2YZHA 2C3QA 2IMKA 5H5RA 3HVSA 2YOIA 4MABA 4XCSA 2PGTA 5HR3A 3DVXA 1KBNA 5J9CA 1SENA 3TB2A 4RI7A 1O7UA 5DAKB 2LEGA 1JB0J 4TW5A 3US3A 4L0WA 5G5FA 1SJIA 1YJ6A 2V32A 3U5RE 2IMFA 3G7JA 3FR9A 4KE3A 3KGKA 4ECBA 1GSEA 3TKSA 3IC4A 1X9MB 2K6VA 2O87A 1T00A 2HE3A 4MJEA 5JWRB 3WGXA 4WXTA 2K18A 2VCXA 1TRUA 1XOAA 2R4VA 2O01J 2V41A 3EE2A 1HYUA 3HJMA 3A2VA 4WBJA 2IFQA 2AB6A 4EL1A 3TKSE 2E0QA 4IGJA 2YWNA 4LL1B 2VCZA 8GSSA 3VPQA 2H71A 1G7EA 3QPMA 2DJ2A 3NOFA 4PUFC 2OKAA 2JADA 4N11A 2V6OA 2AV4A 4ZXGA 1Q4JA 1K0NA 5DCGA 2YNXA 2L5OA 3CYNA 1Z7RA 1A2MA 4MA9A 1A0FA 2F51A 2VO4A 3FEUA 4EUYA 4JBBA 4JEDA 4ZL7A 5J41A 4TR1A 1TXXA 3D6IA 5FWGA 2WRTA 2CZ3A 1YF0A 3G9BA 4IL6X 5AGYA 2FWEA 3GKMA 1PMTA 3HJOA 4HEA2 3ERGA 1YKAA 2E74B 4JE1A 4AJ7A 5DBQA 3EINA 2EIRA 2AAWA 4O92A 5D9XA 1K0MA 3P8WA 1U87A 2GQMA 2H01A 2H6ZA 2NVLA 1GRXA 3Q19A 4WR5A 4FH8A 3ED3A 5CRWA 5KN1A 4TR0A 2OADA 4IN0A 2RUEA 3C7MA 2JL4A 3IAM2 1VF5B 4PQIA 4GCIA 2HZEB 4ID0A 1ZRTE 1XW6A 1I5GA 3KTLA 5IMVA 2VL2C 4G19A 3QFBC 3O76A 1QGVA 3HZ4A 2GZYA 1YDKA 1H75A 3CRTA 5JWOB 5DQYA 4LA1A 1RQMA 2IIYA 1SU9A 5ECLB 1N8JA 4HOJA 1ERVA 1OVNA 5IPHA 1SYXA 4HU7A 1U3AA 1ZZYA 2HT9A 2E2GA 4IHUA 2MMAA 1A2LA 2BMXA 2MMOA 4FYBA 4JU5A 3ZIVA 2LSTA 2FWFA 4NHWA 1ERUA 1ACVA 5CYYA 3W8SA 2JSYA 1A24A 4F2IA 2JZSA 2C3NA 3GSTA 4XIHA 4PNGA 1TW9A 2E76B 2NDOA 1EOGA 3UJ1A 4H44B 2F3MA 3MSZA 1A2JA 2VM2A 3F63A 3FR6A 2C0EA 4K8MA 4BWQA 3C73A 1M9AA 5H5QA 1G6YA 4QQ7A 2C1YA 3HHVA 2WZ9A 1EGOA 2H1GA 3DD3A 2YCDA 1OKTA 4KSMA 2WGRA 3KM6A 2GSRA 1KTEA 1G6WA 3ZMLA 3O3TA 4HZ4A 4ZB8A 3QOUA 3RHBA 4QL9A 2AUVA 1B4QA 2KUCA 1JHBA 4I2UA 1A23A 3GV1A 5ENUA 2KP2A 4ZBBA 3ZFLA 4ACSA 3P2AA 4NMUA 3VWXA 3IDVA 2K9FA 4J57E 4DEJA 1KNGA 3UBLA 2CT6A 4KAEA 3EYTA 4V1Ap 2IN3A 3S9FA 3KXOA 2WCIA 2H1AA 5DQSA 3ME8A 2B7KA 1TI1A 3GL3A 1BX9A 3MDKA 3APQA 3H79A 2LTKA 3TKSC 5DALA 4NWYA 2AYTA 2IJYA 2LNSA 1TOFA 4HJMA 4I5QA 3TJFA 5A4UA 4EDYA 2H70A 3GKNA 4EVMA 4GSNA 1AXDA 5D8IA 1GP1A 5D73A 3ZYWA 2IL3A 2B1LA 4EDZA 3CSIA 1W89A 3VWVA 3PH9A 1K0BA 4ZL8A 5KKZC 2X64A 3BBYA 19GSA 4WBRD 1V40A 2XHFA 1PX7A 3H93A 4H13B 1TK5B 5JWQB 1YEPA 4NV5A 1WIKA 2N5AA 5GZZB 1VF1A 3CSJA 4IQAA 1OC9B 2DJ1A 1VF2A 5CAXA 1CQGA 3ZVJA 3D5JA 3TOUA 3ZMKA 3IPZA 1K0OA 1NHYA 2OBIA 2YP6A 5EPFA 4ZL9A 4E8HA 5IPGA 2G2QA 1SL0B 1BEDA 1GTBA 2VOCA 1GLQA 4PXOA 2HNLA 2H1BA 5DJLA 2YWIA 5E59A 1M2BA 2F8FA 4KA0A 4POMA 5CRGA 3KIJA 1JZRA 3KD0A 1EWXA 2WFCA 3GH6A 2CV4A 1F3BA 4KW6A 1AQVA 2IMIA 4AJ8A 2K8VA 4AJ6A 1Y25A 2RM5A 3HA9A 2DJJA 2FHEA 2B6MA 2RLIA 12GSA 1PN9A 4K1FA 5L8RJ 3HZ8A 3L78A 2DC5A 3L0HA 1HNAA 5J5NA 2GGTA 3LJRA 4N10A 3D22A 5C04A 3LORA 4LMWA 4ECCA 2K9YA 2FWGA 2QJPC 1LJRA 3FYGA 2PBJA 2F9SA 4F82A 2HXKA 2VM1A 2H73A 2YJ7A 1LBKA 5G2ZA 3ZTLA 1R26A 1WPIA 1HQOA 2CVBA 3UMAA 1VRSD 2DIYA 5B7CA 2JSZA 1XW5A 4HJ2A 4HZ2A 3PINA 3E3EA 3GTUB 4DVCA 4F0BA 3MAKA 1O85A 5INYA 2CVDA 2A4VA 1GULA 3ZREA 3IXRA 3VLNA 5ECMB 1XPVA 5IMAA 1FOVA 4TXOA 2VCTA 2LV3A 2I4AA 1TI3A 4DSQA 3WD6A 1M2AA 1S3DA 1SL1B 1GSYA 3LWAA 1XWKA 2IMEA 4FO5A 5HQPA 1OAZA 1SKSB 2GTUA 4D73A 3D4MA 2VIMA 3L9UA 3LXZA 3GL5A 1XFLA 1GSQA 3APSA 3F8UA 5DVBA 3QFAC 2H19A 3DYRA 3F6DA 1QQ2A 2YPMA 4F0CA 4JRRA 4PQHA 3CRUA 10GSA 4DSSB 5B8AA 2P31A 1R5AA 3CMIA 2RM6A 1XW9A 3ZITA 2CQ9A 2L4QA 3ME7A 3E0UA 3TGZA 2GZZA 4RQRA 1FB6A 4PURA 4XTSA 3LYKA 1ZL9A 4RI6A 4GWRA 3UIWA 1BAYA 3F3QA 2REMA 2OE3A 5ECQB 1XBSA 4YQVA 4OFNA 2OE0A 4KCEA 3I69A 2PVOC 4POBA 3KTBA 2EIOA 1F9MA 3QAWA 4KNDA 1B4PA 3DVWA 2YV7A 3TKQA 5AISA 2H0HA 1E2YA 3IBHA 2C3TA 4O7HA 3HYPA 1FG4A 3ZRDA 2IPAA
chains in the Genus database with same CATH superfamily
2JO1A 3P8CE 3GW6A 4OO4A 3AE8C 1PQNA 1GSSA 3KYQA 2CPBA 3L73E 2CX3A 1EQ7A 4YXDC 2YV9A 3RPPA 2FKWB 1Z6MA 2AJQB 2WQYC 2YZUA 3JC22 4PD4I 22GSA 4N6JA 4WB4A 3NFQA 1G7OA 4JZQA 3CWBG 4BRYB 3EU4A 4MZCA 5BU5A 3TRPA 5TISE 5FHIA 1SFCA 1LU4A 4N0VA 4RUVA 3AE9C 1LGHB 5KLVJ 2POHA 3H1JE 4PV1C 1EOHA 3GKKA 1AQTA 3H1ID 2X8HA 3ERWA 1SJZA 5KOXA 3I9V2 1N7SA 2L57A 2PUKC 5CRHA 2AXCA 3NXSA 4YPCA 4L74A 1IYIA 3L74E 1ERWA 2Q3EA 1BCCG 2VLTA 4TN8A 5G31A 1KD1Q 3MWHA 1HNCA 2ALBA 3CX5H 3L37A 2JU5A 4K5SA 4G0LA 1T8ZA 1R5SA 1FVKA 1L0LK 4XE5B 2PFXA 4IS0A 2PPTA 3RBTA 3F4TA 2QGVA 4L75A 3Q5RA 1C72A 1GTIA 1VQ4P 5G1KA 3FXDA 2L5LA 2WZ7A 1HGZA 2K8SA 2VL9A 3D70A 1NW2A 2R2JA 4IFDK 1YQ1A 3N7NA 4ISDA 2NPBA 1SD9A 2WSEJ 1JLWA 2N1TA 2C0WA 4WVZA 3QR6A 2ZNMA 1H4OA 3MNGA 2P0GA 1IJDB 1VDFA 1WJKA 4YAVA 3GRXA 1ZR4A 1PFOA 3V2RA 1W2BO 1OFCX 2B5EA 1KQSO 4BIKA 1H88A 3A5WA 4X4JA 1EGRA 2AEFA 3M9BA 1S4XA 2WB9A 1EDIA 4YH2A 1VPCA 2R5GA 4MF6A 4XS4B 3AEDC 2OTLP 4OFMA 3G3ZA 4BL7B 4KH7A 2HYNA 2M5AB 1GZLA 1BDCA 4IJIA 1FZCA 1GTAA 2H0IA 3HRNA 5F8BA 1LTTC 1KQFB 3CX5E 4KHXA 4O5QA 2QEXP 2E2MA 4K9ZA 1GL8A 4WR4A 2K37A 3IE3A 2KLUA 2JR8A 4NV2A 1EP8A 2OQQA 3H1KD 3PR8A 1JZWA 4AUWA 2W6AA 6GSXA 3GN3A 1O8WA 2IDBA 3LG6A 3ZFBA 2ZAEB 1Z3EA 3GX8A 5C39A 1NU1J 4PV1B 1VQ7P 3QDNA 5KTBA 1J1EC 5IMDA 1V9WA 1AAZA 3CCQP 2IBZD 1WRYA 2GT6A 5CRDA 1K3LA 2O89A 2B7JA 1LT9A 1K3OA 2OBKA 4L0UA 5BRTA 1CZQA 1L0LD 1WMKA 3OAKA 1XVQA 2HYXA 3EMXA 3LYPA 2IFMA 2XC2A 2QKEA 3L71E 1PZQA 3G71P 4MJBA 4WETA 1KEBA 5DAKA 1M0UA 1ZV8A 1OE7A 3OA7A 4PTSA 5KJ7A 2XDJA 3P7XA 4GRFA 2MZCA 4PJ0H 1KB9I 2FYNC 1URQA 4YQUA 1QUWA 2R3XA 1X9SB 2Z5IA 1NTME 1YI2P 3EVIA 2KSJA 3C1SA 1KB9H 1SQPK 2WSFJ 1FZEA 2N9YB 2FXMA 2VCVA 4MF7A 2YWOA 3TGUJ 2GUSA 3A3TA 1SQPG 2HG5D 3MUDA 4XS6A 2KP1A 4POLA 2JACA 3MIXA 3EMPA 11GSA 3LEFA 1MKMA 2O3JA 3ZVJD 2WVRA 2NZ2A 2ON7A 2A06E 1ZOYC 4ZB9A 1PKWA 3KDPB 5KLIC 1EXJA 4DT0A 1Z56A 3H1HD 1RQUA 4PNFA 3M0FA 2V4HA 3FK8A 1PKZA 2WULA 1LWUA 1XWAA 2IX7C 2WPSA 2H76A 2X8GA 4ILFA 1RK4A 4HQSA 2LUSA 1YJNP 2CAIA 1KC8Q 1HNBA 1T4YA 5APWA 3RHCA 1AIUA 2LRNA 3RK3E 2E7PA 2H1DA 2LKUA 1PX6A 1NTKE 4OO5A 2YO2A 1KMIZ 5CCHC 2CK3H 3PPUA 3GA4A 3VP9A 1THXA 4OCEA 1AQ5A 2BCCJ 1T4ZA 4TR4A 9GSSA 1XWBA 1WWJA 4PJ0E 3CSHA 2V1MA 1E79H 2ZT9C 3EC3A 4H0LC 1GWCA 2VAFA 2FYUG 4NHZA 1S3AA 3TSIA 5IMFA 1KB9E 1NTZE 4ZBDA 1J1EB 3LFLA 4JYBA 2B1KA 5KEJA 4K6XA 4KDXA 1ZOFA 6GSSA 1S1CX 3CLQA 1PPJG 3GLMA 2B87B 4YTPC 3NTNA 1SQVJ 2D2CC 2PWJA 5AVVB 1MD4A 4XS1A 2HLSA 2C0DA 2HSMA 3M1GA 3UEMA 2M46A 3S1KA 2P2UA 5ID2B 2G0FA 3MZWB 1EZVD 1SQPD 5F06A 4EIQA 3HE4A 4W7YA 3B4SA 1JY2N 1CI6A 4K7IA 4WF5A 1OVUA 2QJKC 3OR5A 1WOUA 2QM7A 2OTKE 3O6QB 1LTJA 3FZ9A 2WDUA 2FY8A 2V7QJ 2FCHA 2E75D 2E42A 4YKGA 2ZYGA 20GSA 3A3YB 2L5GB 3AE3C 1PL1A 4IBPA 2C9NY 1SD8A 1BE3D 3C71A 4MN4C 5KLIB 1EEJA 2YKQA 2HPCA 2LNTA 1NO4A 1JOCA 2R6KA 4IFFA 3V4QA 1UIIA 2WPVB 3H1IE 1BGYD 1SLQA 3W67A 5CJ4A 2KI7B 1H89A 1AQWA 1GSDA 4TOPA 4KJMA 4GQFA 3BCIA 1ILOA 1K3YA 3VPTA 2ITAA 3VI7A 4F9ZA 3TNUA 2P5QA 3FY7A 3SWLA 4MPFA 3LW5J 3GUSA 1TRWA 3VYIA 3L73G 1PP9J 4LL4B 1J1DB 5BU8B 1P84D 1X0RA 3PJSK 2K9JA 3F9UA 1RF1C 1GH2A 5E4WA 2O7KA 4KGIA 1ON4A 5ECNB 5C00A 1PV3A 3FMWA 3DXBA 1USEA 5IMCA 1VF4A 1YQ3C 1VQLP 1JZOA 4MK3A 2ZT9B 4H0LB 4V2MA 2CVKA 3BASA 2IBZI 2C80A 3ISOA 1O6JA 2MBSA 1L2PA 3KZQA 3H1JG 3R2QA 1KFNA 4G9HA 1FAAA 3CD6P 4HU9A 2C0XA 1BDDA 2R37A 3WUUA 1O73A 4ZB6A 3ITKA 3L74G 5GSTA 7GSSA 1VQ6P 1UN2A 3BRTB 1W2EA 3H1LJ 1XCCA 2KS1A 2Q6QA 1GNWA 2C4JA 2MMZA 1A8YA 2D2CB 1AV1A 2OJLA 4I7ZC 3KJYA 2AXTE 2N5FA 1USBA 5A4VA 1SQQJ 5HFKA 1NGMB 5AVQB 2Q5UA 1FU1A 4GF0A 2A45G 3HD7C 1JY3N 2XNDH 2VLUA 3S4RA 3S9OA 2DIZA 4BVXA 3IA1A 2XKMA 5LD0A 2YANA 1KYOI 4HB1A 4I6MC 4MH3A 5CREA 5F07A 3TRXA 5AW3B 1AC1A 1AJYA 2BTOT 4X43A 5DDLA 2KUBA 3BCCJ 2Y9ZA 1KYOH 3HKRA 2QJYC 4NPFX 4EIJA 2OYIA 3RK2C 3H1KE 4D73B 2FFDC 1Y9BA 4KDYA 1BG5A 2QA2A 1BQ7A 4O5UA 3G7YA 1L4AD 1S2EA 2KOKA 4POKA 5IM9A 1T8EB 1SFCC 3HDCA 1JUNA 3KH7A 2HI7A 4EF0A 2IBZE 1OVVA 4IFMA 3TJBA 5ECPB 4CY8A 1N7SC 4LMVA 1WT6A 1L0LE 1IFMA 3AEEC 5B6NA 1M7LA 4KSOA 2WWWA 3AEAC 1RF1B 4YAPA 1A0RP 2H8PD 3HD5A 3IF4A 2ZXEB 4IL6H 2P7JA 1HTLC 2QG4A 1RW1A 2HSYA 2B5XA 2H8LA 1PGPA 1TRSA 4OGQD 2FYZA 4ZKUA 3D21A 3J7Yb 1OE8A 4ASVA 5CNWA 1KQGB 2LJRA 3GFKA 1M1JA 5ELAA 3AY8A 2IYOA 2O1KA 2RUFA 2IFNA 2X8CA 5D96A 3PHLA 2X99A 5GAND 3N4XA 4WY4C 4EXJA 3GG2A 1BCCJ 1XG8A 1M2DA 1WE0A 2FLSA 2ZVNB 4X1UA 4NAXA 4I7ZB 4J56E 2KXPB 4L5OA 4OMVA 3K8NA 4KT0J 5GSSA 2VL2A 3H1HE 1JY2O 1W4VA 3UAPA 3KP9A 2X49A 1UC7A 1ZXGA 3VK9A 3HD7B 3R2PA 1YBKA 3PP5A 1QVFO 3UOMA 3HXSA 1T7PB 1NTMG 3EWLA 3F0IA 2IFQB 2B5YA 3H1NA 1OWAA 3I43A 2WSCJ 1K0DA 4PD4D 2Z9SA 5APTA 1XOBA 2RKLA 1GUHA 3Q1MA 1FVJA 3VURA 3L35A 1QK8A 2QJYB 3D0ZA 3RK2B 3SFDC 2LJKA 5H5SA 2FFDB 1RE3A 2NPSC 3UL3A 2RIIA 1QL2A 3IK9A 1YKCA 5AIVA 1SFCB 2XPEA 1Q7YQ 4HUAA 4MPGA 3CTFA 3B5NA 1TP9A 4V1Ag 3TJJA 1RHZB 1R8EA 1BSHA 3FZ4A 1N7SB 2K1AA 2N1TD 1P84I 3WT1A 2J59M 1NM3A 2FWHA 1SK0A 2A2SA 2EIQA 1GMJA 1P84H 1FJKA 1NTKG 4C7NA 4QL7A 1EC5A 1SQVK 4ZMDA 4D6TJ 2VUPA 1EZVE 1SQPE 1F6MC 4CW9A 4Z2UA 6GSYA 1X5EA 3FKFA 5DJMA 1JCCA 3CCVP 1G2CB 5K5GB 2GQKA 3VN0A 4MP4A 1RF0C 4WBAA 1N2AA 4JYCA 1TKDB 1SK2A 4TR1B 1DEBA 2PMTA 4I2TA 1NTZG 3TGUD 1LP1A 5F05A 3VWWA 3RK3C 2FGXA 3AE4C 4WY4B 5AW0B 3BD2A 4GSTA 1B9XC 2KYVA 4MF5A 1X9WB 2KOGA 3C8EA 2XBIA 1BE3E 1SVFA 2J9HA 2N5BA 4DSRA 2HRFA 3CTGA 1JY3O 1O81A 3HE5A 1OW7A 3BJ5A 1X8YA 1X22A 1TDIA 5TJHA 1BGYE 14GSA 2H66A 1MDKA 3I6AA 1XWCA 4ULXA 3MD0A 1NOHA 4K7NA 1GL2A 3DGQA 5IIZA 2I1KA 3IAS2 3HJPA 4GOEA 5IQYA 1J9BA 1KILA 5CCGD 5ELGA 2DBCA 2FBWC 3QH9A 4Z7XA 1P84E 1XVWA 2KHPA 5ECOB 1T2KC 1ZCPA 4IVFA 2BCCD 1FJPA 1FW1A 1PGOA 1VGLA 5IOXA 1QLED 1JTHA 5KJ7D 2AHEA 2NPSB 1FBMA 5ECRB 1HJBA 1URQD 2YXQB 1GD2E 2H6YA 4O32A 4F03A 1TJDA 4EDFA 2IMDA 4BA7A 1PL5A 3H32A 2DSAA 1W5CE 3APOA 5G30A 3VFIA 2P1JA 5BVZA 2RMZA 4TKYA 5KAFH 4XA4A 2H0GA 2GQLA 1TTZA 1OC9A 5G1LA 1A02F 1DX7A 1SQVD 1B9YC 1Y6EA 2QA4P 1T3BA 1L4AA 1GW4A 2FUG2 3C1RA 1Q90D 4LLRA 3IR9A 3F4SA 1R5PA 2JEEA 1M3JA 5F0GA 3A5IA 4GTUA 1PGTA 1Z5YE 3GX0A 1SQQK 1YEXA 2ES7A 1HVVA 5HR2A 5ECSA 3GF3A 6GSTA 4H86A 3RPNA 4CHSA 3W6GA 5B6MA 2H30A 2GS3A 4ML1A 4NPBA 3RK3B 4EKZA 2HODB 2GSQA 1EZKA 2L59A 1K0AA 3KP8A 3GIXA 2IWTA 2A45H 1MD3A 2JWDA 1LNQA 2N9BA 5LNKe 2GUVA 3GURA 2WPRA 3CC4P 3B8EB 3A5TA 2GM4A 2H7HA 1OYJA 4I97A 1M8OB 1GU4A 3DRNA 5D9WA 1USDA 1SKRB 1CSBA 1GK4A 4KF9A 1M9BA 1FZGA 2QE7H 3QAGA 5D9TA 1GUKA 5KAFE 2C0GA 1H0TA 1PP9D 3C1LA 1ML6A 3I56P 3UVHA 5A5KA 5DCHA 4PD4H 4WF4A 2I9HA 3BATA 2I3YA 1SL2B 2CA8A 5H2FH 3M8NA 2GLRA 1K0CA 3M9KA 2D2ZA 4PX1A 3H1KG 1K04A 2OYHA 4K0NA 2TRXA 4J2FA 3L72G 1Z9HA 2HSHA 3A2XA 1N73B 2LXBA 3DKSA 1SJ6A 1K9MQ 1DBYA 2DKHA 2DJ3A 1NSWA 1G0TA 1KTMA 1F2EA 1HD2A 3II6A 1SQXJ 4EI2A 3OW2O 2IBZG 4K2DA 4KDUA 1TK8B 2LQOA 1AVOA 1TRVA 2AEMA 1FHEA 1L0LG 2WJUA 1S5LX 4V2LA 1ZYEA 2JWAA 3V2PA 2WS2A 3M0DA 1LTIC 3FWNA 4W7ZA 3DWVA 2LS5A 2JJLA 4Z1MH 1SQQD 2L4CA 4WEYA 2LR2A 1M7TA 1ZYNA 1S72P 3H8QA 3UARA 1EXIA 2E74D 3GTUA 1MEKA 1FB0A 3TUEA 4PD4E 2WMMA 4JBZA 2KNCA 4Q5NA 1X0TA 2X4AA 4MJAA 1NKZB 2L6CA 2QA1A 3O6TA 5H2FE 2C0FA 1SQBJ 3TJKA 2XPDA 2HFED 2JZRA 3P90A 4G2EA 3LSZA 3E9JB 2Y0EA 3IK7A 4TT3H 4EYYQ 3CCEP 3H1HG 4EE0A 5GTIH 4X0XA 4GOFA 1Z6NA 5B66H 4JR4A 2IYPA 4MZBA 5EY6A 4HS1A 3GSSA 1NH4A 2KK7A 2PGDA 1VF5D 5AVZB 1V57A 3ERFA 1J08A 3GYKA 4ZBAA 1QGKB 5AW1B 4GSSA 3FWLA 3F6FA 4DJGA 2DJKA 3V2QA 2EC4A 1RE4A 3L72D 1DD4A 2IZ1A 2VCQA 3FZAA 2VRSA 2MYGA 1PGJA 2V2GA 1ERTA 4FYCA 1A02J 4FYUA 5CCGA 2UWJE 1V2AA 3M9JA 3SBCA 5HR1A 2OA7A 1VF3A 2VL3A 3TGUE 2M72A 4KCAA 2YO3A 4DSSA 1GTUA 3A2WA 5DALB 1SS1A 4OCFA 3L75J 2HRAA 16GSA 2R0PA 2DMLA 5APQA 4XFJA 3RL0g 1WP0A 2JZTA 1DUGA 1V58A 4XRDA 2QIWA 2ZYAA 1UIXA 3A0BH 4N30A 5AVXB 1M99A 3TRQA 3ZL5A 5GTIE 2HRNA 3UVTA 5B66E 1ZYPA 1EZVG 4NPEA 2H75A 3CC7P 4ZIJA 1S3CA 3EFFK 3LGCA 1OW8A 3L4NA 4V2NA 1KYOD 1IFJA 1A8LA 5JCGA 2V7QH 3DMLA 4IJ3A 4RESB 2XNXA 2R3SA 3ZZXA 2PERA 4HQZA 1YF1A 4RKUJ 2HZFA 4MMMA 3CCLP 5COHA 1ABAA 3ABVC 3PRJA 1URMA 1MV8A 5AVSB 3VP8A 1BE3G 2I1UA 2E76D 2PN8A 3T97B 1TU7A 3C8VA 3WGDA 2DLXA 4H44D 2UZ8A 4BVYA 3L71J 4TR3A 3JSVC 4Q5FA 4GDOA 1ZGNA 1BGYG 4MH2A 4TRXA 1B48A 2B9BA 3WT2A 1GTWA 5AVRB 4IW9A 2HR3A 2E75C 3F89A 4Z2RA 3WMM0 2ZFCA 1XTGB 1NTMJ 2LQQA 3CXGA 1FOHA 3GMFA 2FXPA 1ST9A 4PGTA 1R7HA 1SQVE 1PD21 1V98A 2FXOA 4BRYA 2OACA 1Y8AA 2OYOA 1MDIA 3A0BE 1X5CA 4OFTA 1OKDA 3KH9A 4C7RA 4D6TD 4BPYA 3GKXA 4MDCA 2LKMA 2HFDA 3TCOA 2FD3A 4EO3A 5EL8A 1B8XA 3E7KA 3QD9A 5APXA 1Z7PA 2HLOA 1VQPP 2ZJSE 5ABRA 2GT5A 4OH8B 1U88A 4N0ZA 1GNEA 4OWYA 2OGUA 3TKPA 3KHUA 3RDWA 5AVTB 1JZDA 4ICYA 5IO0A 1PL2A 4OD7A 5L71A 4IKHA 3CXHD 1SKWB 1ZMAA 1GU5A 2FYNB 1IO4A 4HDEA 4AGSA 1JEKA 4PUAA 1YZXA 1OC3A 2YKOA 1YTZI 2AEJA 3HVXA 1KZUB 2J23A 3GHGC 1IZNB 3B5ND 5AW7B 1IFDA 3DIEA 4GXZA 1KORA 6GSVA 2Q1KA 4CDOA 1PP9E 3G7IA 3VI5A 3EURA 4YQMA 3FR3A 2IPPA 1TK0B 3D6YA 1OXZA 5AVWB 4O9BA 3UBKA 2G3AA 1UVZA 3GH9A 1Q81Q 1YHQP 4DOJA 5EFWB 2YWMA 3AEFC 3AEBC 3TKRA 1RH5B 5KLVK 4BWNA 3CPWO 2VLVA 5CCHD 1FAVA 1I9DA 5KN2A 4ZILA 1AW9A 4MLYA 17GSA 1LTAC 4KB3A 2FNOA 2MBTA 1CQHA 4XS4A 4BL7A 2KB7P 2LRCA 3KXDA 3L70J 1JLVA 3V1WA 4BWSA 2M5AA 4TVEA 4DCKA 4E8EA 4IP1A 2E75B 2FA4A 1DE1A 1MFTA 3TJGA 2B3SA 5AW2B 4HJGH 4P3YB 1UA5A 4U3FD 2DMMA 1BYEA 3FX0A 4U7JA 3Q74A 3U1AA 1F37A 1PA3A 3D4TA 1IFIA 3BCKA 5AIXA 3KMNA 2H43A 13GSA 3PGTA 2A2RA 3QAVA 1SQQE 4IELA 3F3RA 3FZ5A 2P67A 2FY6A 1U6TA 4O5RA 2GZPA 4K0GA 1DE2A 1N86A 5ECIB 1OW6A 3WUVA 2HZEA 5J3RA 2GSSA 1GL2D 4ML6A 2O85A 5HFIA 1SK1A 3A7OA 4ECIA 1TU3F 1F3AA 3H1IJ 3GNJA 1KILD 3CMAP 1FOSF 3BOAA 3V2NA 2C8UA 5DJUB 2BJXA 3HUSC 1OVRA 3H4KA 1GSUA 1AFOA 3VWUA 3HCZA 1L0NJ 3F5HA 1PSQA 3AE6C 4OGQC 2I8DA 1LT1A 5AVUB 3Q6OA 6GSWA 1SQBK 4TXOB 3R4YA 1PGQA 3KEBA 4H13D 2QJKB 3TDGA 2I81A 5HR0A 3HTKB 4NXIA 3AE5C 3GHGB 4HKZH 3W8JA 2YJHA 5EVOA 1U3IA 2QVAA 2WSCH 1EV4A 1O8XA 6GSUA 1FDIA 1M1KQ 2R5DA 3HVVA 2CAQA 3NIVA 3L72E 5B5EH 2GDRA 5IO2A 5KLVD 2WT7B 3MHVA 3ZIJA 4NPDA 2ZYDA 1ZLLA 3A2AA 2B88A 5CO3A 1MTCA 4I8BA 1EV9A 2H72A 2A4HA 1NU1K 5IOWA 3HY2A 4JR6A 4N78D 1ZYQB 4L5LA 1R4WA 3TK1A 3CBUA 5IMZA 1OC8A 2Z4EA 5D93A 3D6ZA 1XZOA 1YY7A 3QMXA 4MZWA 5D9VA 5J4UA 3CQFA 1NHOA 4XRAA 2VD1A 1IFPA 3CWBJ 2H6XA 5ECHB 3KMOA 4AYCA 1J2JB 1Y47A 1JFUA 4ECJA 2TIRA 1XIYA 5KN3A 1GUMA 3LQ7A 2K3RA 3IOSA 1YYCA 3H1KJ 5JCWA 3N5OA 3TOTA 3M06A 1KYOE 2CX4A 2PVQA 2N1TC 5KAIH 3MIWA 3GF7A 3IHGA 4G10A 4GIFA 2XZRA 3TGUG 2VCWA 3F4RA 3IN6A 2QC7A 3HD7D 3CXHI 3RL0C 3VOPA 5B5EE 3HUSB 1T3UA 2F8AA 3WYWA 3J7Yk 2B87A 1SQBD 4Y28J 1DSBA 3CXHH 1HGVA 3ZLPA 2TRCP 4OGQB 1EP7A 2FA8A 2ZCTA 5ID2A 4Q5RA 2PRRA 1BJXA 3EU3A 3AEGC 2G8YA 2LJAA 4IQ1A 5AVYB 2QRXA 2ON5A 2GVPA 3EQ2A 2QSIA 3CCRP 3I5CA 1FZCC 4I1LA 3LXTA 3VMZA 3O6QA 3M3MA 4IL6E 5LCZA 4L76A 3KCMA 2OE1A 1NKNA 1PN0A 2NBSA 3NZNA 5FT3A 5J9BA 1VQ9P 1GLPA 3FHKA 1NU1D 4TXVA 2BCCG 4D6TE 3W68A 2NTOA 2M80A 3Q3DA 4I2LC 3RAZA 5AN1A 2DJ0A 3RBXA 1GSFA 5CJ0A 5G5EA 5APVA 1EEMA 3GMAA 1LT9C 1G1IA 3L75D 18GSA 3FRCA 3FW2A 2YN1A 2O01N 2E5YA 1MDJA 1T1VA 1X5DA 3Q5PA 2PU9C 4MJCA 5CP1A 3L9VA 2KLXA 2H74A 4ASWA 4GLTA 3IHQA 3CXHE 2L6DA 3IR4A 4PQ1A 5CCHA 4KX4A 1J0FA 1SQVG 5KJ7C 2XV5A 2P5RA 3L4FA 4Q5QA 1URQC 5A4WA 2LRTA 1KFMA 2XBQA 3CCMP 5ECKB 3MUDC 2MMNA 2VD0A 2N1TB 4L8EA 4RQXA 3L9SA 1OZHA 5HFGA 4M3LA 3IRAA 4AF2A 1ZRTD 3PLNA 3RL0B 1Q98A 2ZUPA 2Q9IA 2YMKA 2WSSH 4KUNA 4XHMA 1U7JA 1ZR2A 1AQXA 2IZ0A 5JCUA 2GSTA 1DD3A 3AE2C 1MZ9A 1S9KD 3WGEA 3U6VA 1E6BA 3JCML 3N9JA 1LWUC 3M0AA 2O8VB 4K7OA 1YQ4C 3IFMA 1XXUA 1SYRA 1ZP0C 4EC0A 3Q2YA 4HI7A 2CPSA 1THOA 1QFNA 5APSA 1SQPJ 3KQGA 3QCPA 3O8ZA 1FZCB 3WUTA 1FO5A 3Q18A 4WKWA 1QXHA 1PP9G 2W27A 4U3FE 1TU8A 1XWGA 1QMVA 1X79B 4GQCA 5B8BA 4I6XA 2V6KA 3A0HH 1IYHA 4IP6A 1SP4A 2PP6A 3DEXA 5KN0A 1OIPA 2BASA 4FIWA 5GAPD 1WMJA 1PRXA 1AUCA 2CZ2A 3IV4A 1EDJA 3GHAA 2YIUC 2YZHA 2C3QA 4RJTA 2IMKA 3KPEA 5H5RA 3HVSA 2YOIA 1KILE 1LT9B 4MABA 4XCSA 2PGTA 3FXEA 3ZDMA 5HR3A 3DVXA 1KBNA 5J9CA 1SENA 3TB2A 1O7UA 2W83C 4RI7A 5DAKB 2LEGA 1JB0J 4TW5A 3US3A 4L0WA 1RF1A 3R3EA 5G5FA 4JPZB 1SJIA 1YJ6A 2V32A 1L0NK 3U5RE 1FC2C 2IMFA 2FYUJ 5E79H 3FR9A 3G7JA 1URQB 4KE3A 1WRGA 3KGKA 4ECBA 1SQQG 2WSEH 1GSEA 3TKSA 5APYA 1NJIQ 1D7MA 2R44A 1JM0A 2SPZA 3IC4A 1RY3A 1LTJC 3VMYA 1X9MB 1S3RA 2J58A 2K6VA 2O87A 1T00A 2HE3A 3A0HE 2M3EA 4MJEA 5KLVE 1FZBA 5JWRB 3BCCG 3WGXA 4WXTA 2K18A 1R5LA 2VCXA 1TRUA 1MUUA 2P58A 5CBNA 3KZIH 3MP7B 1XOAA 1EDLA 2R4VA 2J5UA 1LWUB 1GW3A 4N78E 2O01J 3EFGA 2V41A 2E74C 3L70D 3EE2A 3HD7A 1HYUA 4HH2A 3WU2H 3HJMA 3A2VA 4WBJA 2IFQA 4WWIA 2AB6A 1QVGO 1HBWA 4EL1A 3TKSE 3EPTA 2E0QA 4UB6H 4IGJA 2YWNA 2R3CA 4LGDE 4LL1B 4G0KA 2VCZA 1AA0A 8GSSA 1PIXA 3VPQA 5E79E 3BRVB 3G9RA 2FFDA 2H71A 1G7EA 3QPMA 3B71A 2DJ2A 3NOFA 4PUFC 1HH0A 2YIUB 1VQ8P 2OKAA 2JADA 1K73Q 1VF5C 4N11A 3H1LD 3L73J 4GODA 1U7MA 2V6OA 2AV4A 4ZXGA 1Q4JA 1K0NA 3CX5I 1L0ND 1SQBE 5DCGA 2M0BA 2YNXA 2L5OA 1VQNP 1Z7RA 3CYNA 1A2MA 4MA9A 3KZIE 1GK6A 1A0FA 2F51A 1NAYA 2VO4A 2WSFH 1NWQA 3FEUA 3HE4B 1M90Q 4EUYA 4JBBA 4JEDA 4ZL7A 3H1JJ 3V5BA 1CI6B 3WU2E 1G2CA 5J41A 3SFEC 3BCCD 4TR1A 4HYTB 1LTJB 1JO5A 1TXXA 3D6IA 3L74J 5FWGA 4UB6E 2WRTA 2LXCB 2CZ3A 4WY4A 1YF0A 3G9BA 4IL6X 2OYIC 5AGYA 2FWEA 1NU1E 1AVYA 3GKMA 1YJ9P 1PMTA 1H8AA 2QM8A 2MKVA 2W8ZA 2YNYA 2E43A 2HPCB 3HJOA 3U1CA 2JDIH 2RN0A 4HEA2 3ERGA 1YKAA 4PV1D 2KLVA 1N7LA 2YKPA 4Y99C 2E74B 4JE1A 4AJ7A 3TNUB 1HUCA 5DBQA 3L75E 3EINA 2EIRA 3C9IA 2AAWA 4CPGA 4O92A 1YJWP 5D9XA 1K0MA 3P8WA 3CWBD 1U87A 2K9JB 1FS0E 2GQMA 2H01A 2H6ZA 2NVLA 2E76C 1GRXA 2W90A 5AW5B 3Q19A 4H44C 4WR5A 4FH8A 3ED3A 5CRWA 5KN1A 2NPSA 4D6TG 4TR0A 2NRGA 3V6IA 2OADA 4IN0A 1M1JC 1XTCC 2RUEA 3AE7C 3C7MA 2JL4A 4Z2TA 1BCCD 2O1JA 3IAM2 1VF5B 3IAOA 4PQIA 4GCIA 2HZEB 4ID0A 1ZRTE 1XW6A 1PFIA 3SWFA 3CI9A 2KS1B 1I5GA 3KTLA 5IMVA 2Y9YA 1S9KE 2VL2C 4G19A 3QFBC 3O76A 1QGVA 3P8MC 4LLHA 3RBZA 3HZ4A 2R5BA 2GZYA 1YDKA 4MCUA 1H75A 4K35A 3CRTA 5JWOB 4BVXB 5DQYA 5AW8B 1RF0A 4IOIH 4A5PA 4LA1A 3M9QA 1RQMA 2BCCE 2IIYA 1SU9A 5ECLB 1N8JA 4HOJA 1ERVA 1OVNA 2HODA 5IPHA 1S3JA 1X9VA 1SYXA 1BSNA 4HU7A 1DEEG 1U3AA 1ZZYA 2OYIB 2KZIA 2HT9A 1RE3C 2E2GA 1KQLA 4IHUA 2MMAA 1A2LA 2L91A 2BMXA 3LW5H 2MMOA 1Q2NA 3B5NC 2E5TA 4Y99B 4FYBA 4JU5A 1K8AQ 4EIPA 1YITP 3ZIVA 4OVNF 2LSTA 2FWFA 4NHWA 1ERUA 1GDTA 3SWKA 1FDMA 1ACVA 5CYYA 3VMAA 4MNNA 3W8SA 2JSYA 1KN7A 1A24A 4F2IA 2JZSA 2C3NA 4U3FG 3GSTA 4XIHA 1J1DC 4YXWH 3EWKA 4PNGA 1TW9A 2E76B 2NDOA 4EOTA 1EOGA 2C9LY 3UJ1A 4H44B 2F3MA 3MSZA 1FDOA 1A2JA 1RQVA 2FYUK 3RGUA 2VM2A 1N73A 3LIEA 4OWFA 1M1JB 2WPQA 3F63A 2BEQD 3FR6A 2C0EA 4K8MA 5CBOA 1ZW0A 1E5WA 4BWQA 3FGAD 3C73A 1M9AA 5H5QA 5M1BA 1G6YA 4QQ7A 1NTKJ 2C1YA 3HHVA 1QL1A 2WITA 3TYYA 2WZ9A 1EGOA 2H1GA 3DD3A 3U59A 2YCDA 4BXLA 4K3AA 1HJ0A 2GA1A 1OKTA 4KSMA 4L73A 3L70E 2WGRA 1GL2C 3KM6A 2GSRA 1KTEA 1NTZJ 1G6WA 3O3TA 4HZ4A 3ZMLA 4ZB8A 3QOUA 3RHBA 1KILC 2KSEA 2RH0A 4QL9A 2AUVA 3P32A 1B4QA 2DW3A 1VL2A 5AW6B 3CL3D 2KUCA 1JHBA 4I2UA 1VQ5P 1A23A 3GV1A 5ENUA 3CCUP 2KP2A 5KLVG 4ZBBA 3ZFLA 2XU6A 4H13C 4ACSA 3SSUA 3P2AA 4NMUA 3VTPC 3IDVA 3VWXA 2K9FA 2ZT9D 4H0LD 4J57E 4DEJA 2AXTH 1KNGA 3B5NB 2BEZF 3UBLA 3H1LE 1SQXK 2CT6A 4KAEA 1FZAA 1SQXG 4UB8H 3EYTA 4C46A 2R32A 1L0NE 1L4AC 2IN3A 4V1Ap 3S9FA 4C7NB 1OMIA 1U57A 3KXOA 2D2CD 2WCIA 2H1AA 5DQSA 3ME8A 2W6BA 2FYUD 4GKGA 1FZFA 2B7KA 1TI1A 3GL3A 1BX9A 3MDKA 1NYHA 3APQA 3LW9A 3BCCE 3H79A 3H25A 1LP1B 1ZMEC 1LTBC 2LTKA 3TKSC 3K5BA 5DALA 3SWYA 4NWYA 1PPJD 2AYTA 2IJYA 2LNSA 1TOFA 4YKFA 1VQOP 4USSA 4HJMA 1SQBG 4I5QA 3TJFA 3HE5B 1VQMP 5A4UA 2JP3A 4EDYA 2H70A 3GKNA 1NHLA 4EVMA 2MJZA 4GSNA 1AXDA 5D8IA 1GP1A 5D73A 3ZYWA 5DJTB 2IL3A 1N2DC 2B1LA 1GL2B 1IK9A 3AE1C 1N8RQ 4EDZA 1KILB 3CSIA 4UB8E 1LJ2A 3CMEP 1W89A 3VWVA 4TLFA 3CWBE 3PH9A 1K0BA 4ZL8A 5KKZC 2X64A 3BBYA 19GSA 1JTHB 4WBRD 1V40A 2XHFA 1S5LH 1PX7A 2OYHC 3H93A 1EDKA 1NU1G 4JQ0D 3T97A 4K5RA 4H13B 3UIAA 1SQXD 5JWQB 1TK5B 1YEPA 3P8CD 4NV5A 1WIKA 3H32B 2KIKA 1BCCE 1Q86Q 4W80A 2N5AA 2ZXXA 3L73D 5GZZB 3OJAB 1VF1A 3CSJA 2R0CA 4IQAA 2KP8A 1OC9B 3L75G 2DJ1A 3AECC 1VF2A 5CAXA 2R0GA 1L4AB 1CQGA 3ZVJA 4AQRD 5CMZA 3D5JA 1JY2P 3TOUA 3M0DC 3ZMKA 2WTYA 3IPZA 1K0OA 1NHYA 2OBIA 3L72J 1VQKP 2YP6A 5EPFA 3V4WA 4ZL9A 3H1JD 4E8HA 2M3BA 1QX8A 4ZKPA 5IPGA 4ZNCA 1OX3A 2G2QA 1SL0B 1BEDA 3E1RA 1GTBA 2VOCA 2KZJA 1GLQA 3L74D 2Z5HA 4PXOA 2HNLA 4QMAA 2H1BA 5DJLA 2YWIA 5E59A 1M2BA 2F8FA 1L0LJ 4KA0A 4POMA 5CRGA 3KIJA 1JZRA 3KD0A 1EWXA 2WFCA 1DIPA 3GH6A 1S5LE 1F3BA 2CV4A 4KW6A 3RK2D 2HRKA 1EZVI 3L71G 3CCJP 1AQVA 2IMIA 1SFCD 3BVHA 4AJ8A 2K8VA 4AJ6A 1Y25A 1H0TB 1NTMK 2RM5A 2DJJA 2FHEA 2B6MA 2RLIA 3HA9A 12GSA 1PN9A 5BMUA 4K1FA 5L8RJ 1N7SD 3HZ8A 3L78A 1RE4C 2DC5A 3L0HA 3PH0A 1HNAA 5KKZB 5J5NA 2GGTA 3LJRA 4N10A 1FOSE 3MTUE 3D22A 2OYHB 5C04A 3LORA 1K05A 3H1HJ 4LMWA 4ECCA 2K9YA 5KAIE 2FWGA 1T3JA 2QJPC 5CCGC 1LJRA 5AW4B 4HSCX 3FYGA 2A06G 3E1IA 3I55P 1YIJP 5APUA 2PBJA 2H89C 3G4SP 2F9SA 4F82A 2HXKA 1JCDA 2VM1A 3MYDA 2B89A 2H73A 3HVNA 2YJ7A 1LBKA 3CX5D 4WY4D 5G2ZA 1M3IA 3ZTLA 1R26A 2Q7CA 1WPIA 4CY6A 4FQUA 4RO0A 1HQOA 2CVBA 1HWTC 3UMAA 1VRSD 1JY3P 3M91A 1IFNA 2DIYA 1NTKK 5B7CA 1LTSC 3RL0D 2JSZA 3M9HA 1QEXA 1HF9A 3H6PA 1XW5A 4HJ2A 3LIDA 4HZ2A 3PINA 3G6EP 3VMXA 3TF5A 3E3EA 3GTUB 4DVCA 4F0BA 2P10A 2OTJP 5GTHH 4JF7A 5AW9B 1ZN5A 3MAKA 2I1JA 1NTZK 3TDKA 1O85A 1YTZT 2KNCB 5INYA 2CVDA 3CC2P 1NVOA 2OARA 2A4VA 1GULA 3ZREA 3IXRA 2YMYA 3VLNA 5ECMB 3L71D 3JCUH 1XPVA 4R4LA 5IMAA 3MGNA 4B86A 1KV4A 1FOVA 4TXOA 3PTZA 2VCTA 2LV3A 2NPSD 2I4AA 1JNMA 2O01H 5KOWA 1TI3A 4DSQA 2YXRB 1NTMD 3WD6A 1M2AA 2K88A 1S3DA 1SL1B 1GSYA 3HTKA 3LWAA 2Y0DA 3GHGA 1XWKA 1LTGC 4R4MA 1JMMA 3L70G 2IMEA 4FO5A 5HQPA 4N3YB 1JMBA 1FE6A 1Q82Q 2Q3IA 4DZOA 1G1JA 1OAZA 3Q5SA 1SKSB 2GTUA 4D73A 3D4MA 2VIMA 3L9UA 3LXZA 3GL5A 1CW5A 1XFLA 1GSQA 3APSA 2WT7A 3F8UA 1BE3J 5DVBA 3QFAC 2A06D 3USSA 2FYUE 2H19A 2A2PA 3L36A 4LC1A 3DYRA 3F6DA 1QQ2A 2YPMA 2QJPB 4F0CA 1BGYJ 2JKVA 3CRUA 4JRRA 4PQHA 1DH3A 10GSA 5GTHE 1M57D 2Y0CA 4DSSB 5B8AA 1N73C 2P31A 1R5AA 1PPJE 3H1LG 3H1IG 2M8RA 3RK3D 3CMIA 2RM6A 1XW9A 1NTKD 5CHXA 3ZITA 1T6AA 3JCUE 2CQ9A 2L4QA 1NAFA 3ME7A 4K2XA 3QWOC 3E0UA 3TGZA 2PAJA 1L0NG 2GZZA 4RQRA 1FB6A 5TISH 4PURA 4XTSA 4U3FJ 1IK7A 3LYKA 1ZL9A 4RI6A 4GWRA 3UIWA 1BAYA 3F3QA 1MFZA 2REMA 1KB9D 3P7KA 2OE3A 1NTZD 3D71A 4G0IA 5ECQB 1XBSA 2W6JH 3IC8A 3NMDA 1M56D 4OFNA 4YQVA 4A7PA 2OE0A 2ZVOB 4KCEA 3I69A 2PVOC 4POBA 4GT1A 3KTBA 2EIOA 1F9MA 3HUSA 3QAWA 4KNDA 1B4PA 3DVWA 2YV7A 3TKQA 3CCSP 1T2KD 2DKIA 5AISA 2A45I 2H88C 2H0HA 1E2YA 3IBHA 2C3TA 4O7HA 1IC2A 3HYPA 1FG4A 4BVYB 1SQXE 3ZRDA 2IPAA
chains in the Genus database with same CATH topology
2JO1A 4OO4A 3AE8C 1PQNA 1GSSA 2CX3A 4YXDC 2YV9A 3RPPA 1Z6MA 2AJQB 2WQYC 2YZUA 22GSA 1G7OA 4JZQA 3EU4A 4MZCA 3TRPA 5FHIA 1LU4A 4N0VA 4RUVA 3AE9C 4PV1C 1EOHA 3GKKA 2X8HA 3ERWA 5KOXA 1SJZA 3I9V2 2PUKC 2L57A 5CRHA 1IYIA 1ERWA 2VLTA 4TN8A 5G31A 3MWHA 1HNCA 2ALBA 2JU5A 4K5SA 4G0LA 1FVKA 4IS0A 2PPTA 3RBTA 3F4TA 2QGVA 3Q5RA 1C72A 1GTIA 5G1KA 2L5LA 2K8SA 2VL9A 3D70A 1NW2A 2R2JA 1YQ1A 4ISDA 2NPBA 1SD9A 2WSEJ 1JLWA 3QR6A 2ZNMA 1H4OA 3MNGA 2P0GA 1WJKA 4YAVA 3GRXA 2B5EA 3A5WA 4X4JA 1EGRA 2WB9A 4YH2A 4MF6A 2R5GA 4XS4B 3AEDC 4OFMA 4BL7B 4KH7A 4IJIA 1GTAA 2H0IA 5F8BA 1KQFB 4O5QA 1GL8A 2E2MA 4K9ZA 4WR4A 3IE3A 4NV2A 1EP8A 2OQQA 3PR8A 1JZWA 6GSXA 3GN3A 1O8WA 2IDBA 3LG6A 3ZFBA 1Z3EA 3GX8A 4PV1B 3QDNA 5IMDA 1V9WA 1AAZA 1WRYA 2GT6A 5CRDA 1K3LA 2O89A 2B7JA 1K3OA 2OBKA 4L0UA 5BRTA 1WMKA 3EMXA 2HYXA 1XVQA 3LYPA 2XC2A 2QKEA 4MJBA 4WETA 5DAKA 1KEBA 1M0UA 1OE7A 4PTSA 3P7XA 4GRFA 2MZCA 2FYNC 4YQUA 1QUWA 2R3XA 1X9SB 3EVIA 3C1SA 2WSFJ 2VCVA 4MF7A 2YWOA 3A3TA 4XS6A 2KP1A 4POLA 2JACA 3MIXA 3EMPA 11GSA 3LEFA 1MKMA 3ZVJD 2ON7A 2NZ2A 1ZOYC 4ZB9A 1PKWA 5KLIC 1EXJA 1RQUA 4PNFA 3M0FA 3FK8A 1PKZA 2WULA 1XWAA 2H76A 2X8GA 4ILFA 1RK4A 4HQSA 2LUSA 2CAIA 1HNBA 1T4YA 3RHCA 1AIUA 2LRNA 3RK3E 2E7PA 2H1DA 2LKUA 1PX6A 4OO5A 1KMIZ 3PPUA 3GA4A 1THXA 4OCEA 4TR4A 9GSSA 1T4ZA 1XWBA 1WWJA 3CSHA 2V1MA 2ZT9C 3EC3A 4H0LC 1GWCA 2VAFA 4NHZA 1S3AA 5IMFA 4ZBDA 3LFLA 2B1KA 5KEJA 4K6XA 4KDXA 1ZOFA 6GSSA 1S1CX 3GLMA 4YTPC 2D2CC 2PWJA 1MD4A 4XS1A 2HLSA 2C0DA 2HSMA 3M1GA 3UEMA 2M46A 5ID2B 2G0FA 5F06A 4EIQA 4K7IA 4WF5A 2QJKC 3OR5A 1WOUA 3FZ9A 2WDUA 2V7QJ 2FCHA 2E75D 4YKGA 20GSA 3AE3C 1PL1A 4IBPA 1SD8A 3C71A 1EEJA 2LNTA 2R6KA 2FUG2 2WPVB 1AQWA 1GSDA 4TOPA 4GQFA 3BCIA 1ILOA 1K3YA 3VPTA 3VI7A 4F9ZA 2P5QA 3FY7A 3SWLA 4MPFA 3LW5J 3GUSA 1TRWA 4LL4B 1X0RA 3F9UA 1GH2A 5E4WA 2O7KA 4KGIA 1ON4A 5ECNB 5C00A 1PV3A 3FMWA 3DXBA 5IMCA 1VF4A 1YQ3C 1JZOA 4MK3A 2ZT9B 4H0LB 4V2MA 2CVKA 2C80A 3ISOA 1O6JA 2MBSA 3KZQA 3R2QA 4G9HA 1FAAA 4HU9A 2R37A 4ZB6A 1O73A 5GSTA 7GSSA 1UN2A 1XCCA 1GNWA 2C4JA 2MMZA 1A8YA 2D2CB 2OJLA 4I7ZC 3KJYA 2N5FA 1USBA 5A4VA 5HFKA 1NGMB 4GF0A 2VLUA 3S9OA 2DIZA 4BVXA 3IA1A 5LD0A 2YANA 3TRXA 4MH3A 5CREA 5F07A 1AC1A 1AJYA 2BTOT 4X43A 5DDLA 3HKRA 2QJYC 4D73B 1Y9BA 4KDYA 1BG5A 2QA2A 1BQ7A 4O5UA 3G7YA 2KOKA 4POKA 5IM9A 1T8EB 3HDCA 3KH7A 2HI7A 4EF0A 3TJBA 5ECPB 4CY8A 4LMVA 3AEEC 5B6NA 4KSOA 3AEAC 4YAPA 1A0RP 3HD5A 1RW1A 2HSYA 2B5XA 2H8LA 1TRSA 4OGQD 3D21A 3J7Yb 1OE8A 5CNWA 1KQGB 2LJRA 3GFKA 5ELAA 3AY8A 2X8CA 2RUFA 5D96A 2X99A 5GAND 4EXJA 1M2DA 1WE0A 2FLSA 4X1UA 4NAXA 4I7ZB 4J56E 4L5OA 4OMVA 3K8NA 4KT0J 5GSSA 2VL2A 1W4VA 3UAPA 3KP9A 2X49A 1UC7A 3VK9A 3UOMA 3HXSA 1T7PB 3EWLA 3F0IA 2IFQB 2B5YA 3H1NA 3I43A 2WSCJ 1K0DA 2Z9SA 1XOBA 1GUHA 3Q1MA 1FVJA 3VURA 1QK8A 3D0ZA 3SFDC 2LJKA 5H5SA 3UL3A 2RIIA 3IK9A 1YKCA 5AIVA 2XPEA 4HUAA 4MPGA 3CTFA 1TP9A 4V1Ag 3TJJA 1R8EA 3FZ4A 3WT1A 1NM3A 2FWHA 1SK0A 2A2SA 2EIQA 1GMJA 4QL7A 2VUPA 1F6MC 4CW9A 4Z2UA 6GSYA 1X5EA 3FKFA 5DJMA 2GQKA 4MP4A 1N2AA 1TKDB 1SK2A 4TR1B 2PMTA 4I2TA 5F05A 3VWWA 2FGXA 3AE4C 3BD2A 4GSTA 1B9XC 4MF5A 1X9WB 3C8EA 2XBIA 2J9HA 2N5BA 4DSRA 2HRFA 3CTGA 1O81A 1OW7A 3BJ5A 1TDIA 14GSA 2H66A 1MDKA 3I6AA 1XWCA 4ULXA 4K7NA 3DGQA 5IIZA 3IAS2 3HJPA 5IQYA 1J9BA 5ELGA 2DBCA 2FBWC 4Z7XA 1XVWA 2KHPA 5ECOB 1ZCPA 4IVFA 5IOXA 1FW1A 1VGLA 2AHEA 5ECRB 4O32A 2H6YA 4F03A 1TJDA 2IMDA 4BA7A 1PL5A 2DSAA 3APOA 5G30A 3VFIA 4TKYA 2H0GA 2GQLA 1TTZA 1OC9A 5G1LA 1B9YC 1Y6EA 1T3BA 3C1RA 1Q90D 4LLRA 3F4SA 1R5PA 5F0GA 3A5IA 4GTUA 1PGTA 1Z5YE 3GX0A 1YEXA 2ES7A 5HR2A 5ECSA 3GF3A 6GSTA 4H86A 3RPNA 4CHSA 3W6GA 5B6MA 2H30A 2GS3A 4ML1A 4NPBA 4EKZA 2GSQA 1EZKA 2L59A 1K0AA 3KP8A 3GIXA 2IWTA 1MD3A 5LNKe 3GURA 1OYJA 4I97A 5D9WA 3DRNA 1SKRB 4KF9A 1M9BA 3QAGA 5D9TA 1GUKA 2C0GA 1ML6A 3UVHA 5A5KA 5DCHA 4WF4A 2I9HA 2I3YA 1SL2B 2CA8A 3M8NA 2GLRA 1K0CA 3M9KA 2D2ZA 4PX1A 1K04A 4K0NA 2TRXA 4J2FA 1Z9HA 2HSHA 3A2XA 3DKSA 1SJ6A 1DBYA 2DKHA 2DJ3A 1NSWA 1G0TA 1KTMA 1F2EA 1HD2A 4K2DA 4KDUA 1TK8B 2LQOA 1TRVA 1FHEA 2WJUA 1S5LX 4V2LA 1ZYEA 2WS2A 3DWVA 2LS5A 4Z1MH 2L4CA 4WEYA 1M7TA 1ZYNA 3H8QA 3UARA 1EXIA 2E74D 3GTUA 1MEKA 1FB0A 3TUEA 4Q5NA 2X4AA 4MJAA 2L6CA 2QA1A 3O6TA 2C0FA 3TJKA 2XPDA 2JZRA 3P90A 4G2EA 3LSZA 3E9JB 3IK7A 4TT3H 4EE0A 4X0XA 1Z6NA 4JR4A 4MZBA 5EY6A 4HS1A 3GSSA 1VF5D 1V57A 3ERFA 1J08A 3GYKA 4ZBAA 4GSSA 3F6FA 2DJKA 2EC4A 1DD4A 2VCQA 3FZAA 2MYGA 2V2GA 1ERTA 4FYCA 4FYUA 1V2AA 3M9JA 3SBCA 5HR1A 2OA7A 1VF3A 2VL3A 2M72A 4KCAA 4DSSA 1GTUA 3A2WA 5DALB 4OCFA 2HRAA 16GSA 2R0PA 2DMLA 4XFJA 3RL0g 1WP0A 2JZTA 1DUGA 1V58A 4XRDA 2QIWA 1UIXA 4N30A 1M99A 3TRQA 3ZL5A 2HRNA 3UVTA 1ZYPA 2H75A 4ZIJA 1S3CA 3LGCA 1OW8A 3L4NA 4V2NA 1A8LA 5JCGA 3DMLA 4IJ3A 3ZZXA 2PERA 4HQZA 1YF1A 4RKUJ 2HZFA 4MMMA 5COHA 1ABAA 3ABVC 2I1UA 1URMA 2PN8A 4MCUA 2E76D 3T97B 1TU7A 3C8VA 3WGDA 2DLXA 4H44D 2UZ8A 4BVYA 4TR3A 4Q5FA 4GDOA 1ZGNA 4MH2A 4TRXA 1B48A 3WT2A 4IW9A 2E75C 4Z2RA 3GMFA 2LQQA 3CXGA 1FOHA 2FXPA 1ST9A 4PGTA 1R7HA 1PD21 1V98A 2OACA 1MDIA 4OFTA 1X5CA 1OKDA 3KH9A 4BPYA 3GKXA 4MDCA 2HFDA 3TCOA 2FD3A 4EO3A 5EL8A 1B8XA 3QD9A 1Z7PA 5ABRA 2GT5A 4N0ZA 1U88A 1GNEA 4OWYA 3TKPA 3RDWA 1JZDA 4ICYA 5IO0A 1PL2A 4OD7A 5L71A 4IKHA 1SKWB 1ZMAA 4HDEA 4AGSA 4PUAA 1YZXA 1OC3A 3HVXA 2J23A 3DIEA 6GSVA 4GXZA 1KORA 4CDOA 3G7IA 3VI5A 3EURA 4YQMA 3FR3A 1TK0B 3D6YA 3UBKA 2G3AA 1UVZA 3GH9A 2YWMA 3AEFC 3AEBC 3TKRA 2VLVA 5KN2A 1I9DA 4ZILA 1AW9A 4MLYA 17GSA 4KB3A 2FNOA 2MBTA 1CQHA 4XS4A 4BL7A 2LRCA 1JLVA 3V1WA 4BWSA 4TVEA 4E8EA 4IP1A 2E75B 2FA4A 1DE1A 3TJGA 2B3SA 4P3YB 1UA5A 2DMMA 1BYEA 4U7JA 3Q74A 1F37A 1PA3A 3D4TA 3BCKA 5AIXA 3KMNA 13GSA 3PGTA 2A2RA 3QAVA 4IELA 3F3RA 3FZ5A 2FY6A 1U6TA 4O5RA 2GZPA 4K0GA 1DE2A 5ECIB 1OW6A 2HZEA 5J3RA 2GSSA 4ML6A 2O85A 5HFIA 1SK1A 4ECIA 1TU3F 1F3AA 3GNJA 3BOAA 2C8UA 2BJXA 3H4KA 1GSUA 3VWUA 3HCZA 1PSQA 3AE6C 4OGQC 3Q6OA 6GSWA 4TXOB 3R4YA 3KEBA 4H13D 3TDGA 2I81A 5HR0A 4NXIA 3AE5C 3W8JA 2YJHA 5EVOA 1U3IA 1O8XA 1EV4A 6GSUA 1FDIA 3HVVA 2CAQA 3NIVA 2GDRA 5IO2A 3ZIJA 5CO3A 1MTCA 4I8BA 1EV9A 2H72A 2A4HA 5IOWA 3HY2A 4JR6A 1ZYQB 4L5LA 1R4WA 3CBUA 5IMZA 1OC8A 5D93A 3D6ZA 1XZOA 1YY7A 3QMXA 4MZWA 5D9VA 5J4UA 1NHOA 4XRAA 2VD1A 2H6XA 5ECHB 3KMOA 1JFUA 4ECJA 2TIRA 1XIYA 5KN3A 1GUMA 3LQ7A 3IOSA 5JCWA 3N5OA 3TOTA 2CX4A 2PVQA 3GF7A 3IHGA 4G10A 2VCWA 3F4RA 3IN6A 2QC7A 2F8AA 3WYWA 3J7Yk 4Y28J 1DSBA 3ZLPA 2TRCP 4OGQB 1EP7A 2FA8A 2ZCTA 5ID2A 4Q5RA 1BJXA 3EU3A 3AEGC 2G8YA 2LJAA 4IQ1A 2ON5A 2GVPA 2QSIA 3LXTA 3O6QA 3M3MA 5LCZA 3KCMA 2OE1A 1PN0A 2NBSA 3NZNA 5FT3A 5J9BA 1GLPA 3FHKA 4TXVA 2NTOA 2M80A 3Q3DA 3RAZA 5AN1A 2DJ0A 1GSFA 5G5EA 1EEMA 3GMAA 3FRCA 18GSA 3FW2A 2YN1A 1X5DA 1MDJA 1T1VA 2PU9C 3Q5PA 4MJCA 5CP1A 3L9VA 2KLXA 2H74A 4GLTA 3IHQA 2L6DA 3IR4A 1J0FA 4PQ1A 4KX4A 2P5RA 4Q5QA 5A4WA 2LRTA 2XBQA 5ECKB 2MMNA 2VD0A 4L8EA 4RQXA 3L9SA 5HFGA 3IRAA 4AF2A 1Q98A 2ZUPA 2YMKA 4KUNA 4XHMA 1AQXA 5JCUA 2GSTA 1DD3A 3AE2C 3WGEA 3U6VA 1E6BA 3JCML 3N9JA 2O8VB 4K7OA 1YQ4C 1XXUA 1SYRA 1ZP0C 4EC0A 3Q2YA 4HI7A 1THOA 1QFNA 3QCPA 1FO5A 3Q18A 4WKWA 1QXHA 1XWGA 1TU8A 1QMVA 4GQCA 5B8BA 4I6XA 2V6KA 1IYHA 4IP6A 3DEXA 5KN0A 4FIWA 5GAPD 1WMJA 1PRXA 1AUCA 2CZ2A 3IV4A 3GHAA 2YIUC 2YZHA 2C3QA 2IMKA 5H5RA 3HVSA 2YOIA 1KILE 4MABA 4XCSA 2PGTA 5HR3A 3DVXA 1KBNA 5J9CA 1SENA 3TB2A 1O7UA 4RI7A 5DAKB 2LEGA 1JB0J 4TW5A 3US3A 4L0WA 3R3EA 5G5FA 1SJIA 1YJ6A 2V32A 3U5RE 2IMFA 3G7JA 3FR9A 4KE3A 3KGKA 4ECBA 1GSEA 3TKSA 3IC4A 1X9MB 2K6VA 2O87A 1T00A 2HE3A 4MJEA 5JWRB 3WGXA 4WXTA 2K18A 2VCXA 1TRUA 1XOAA 2R4VA 2J5UA 2O01J 2V41A 2E74C 3EE2A 1HYUA 3HJMA 3A2VA 4WBJA 2IFQA 2AB6A 4EL1A 3TKSE 3EPTA 2E0QA 4IGJA 2YWNA 4LL1B 4G0KA 2VCZA 8GSSA 1PIXA 3VPQA 3G9RA 2H71A 1G7EA 3QPMA 3B71A 2DJ2A 3NOFA 4PUFC 2OKAA 2JADA 4N11A 1VF5C 2V6OA 2AV4A 4ZXGA 1Q4JA 1K0NA 5DCGA 2YNXA 2L5OA 3CYNA 1Z7RA 1A2MA 4MA9A 1A0FA 2F51A 2VO4A 3FEUA 4EUYA 4JBBA 4JEDA 4ZL7A 5J41A 3SFEC 4TR1A 1TXXA 3D6IA 5FWGA 2WRTA 2CZ3A 1YF0A 3G9BA 4IL6X 5AGYA 2FWEA 3GKMA 1PMTA 2MKVA 3HJOA 4HEA2 3ERGA 1YKAA 4PV1D 2E74B 4JE1A 4AJ7A 5DBQA 3EINA 2EIRA 2AAWA 4O92A 5D9XA 1K0MA 3P8WA 1U87A 2GQMA 2H01A 2H6ZA 2NVLA 2E76C 1GRXA 3Q19A 4H44C 4WR5A 4FH8A 3ED3A 5CRWA 5KN1A 4TR0A 2OADA 4IN0A 2RUEA 3AE7C 3C7MA 2JL4A 4Z2TA 3IAM2 1VF5B 3IAOA 4PQIA 4GCIA 2HZEB 4ID0A 1ZRTE 1XW6A 1I5GA 3KTLA 5IMVA 2VL2C 4G19A 3QFBC 3O76A 1QGVA 3HZ4A 2GZYA 1YDKA 1H75A 3CRTA 5JWOB 4BVXB 5DQYA 4A5PA 4LA1A 1RQMA 2IIYA 1SU9A 5ECLB 1N8JA 4HOJA 1ERVA 1OVNA 5IPHA 1SYXA 4HU7A 1U3AA 1ZZYA 2HT9A 2E2GA 4IHUA 2MMAA 1A2LA 2BMXA 2MMOA 4FYBA 4JU5A 4EIPA 3ZIVA 2LSTA 2FWFA 4NHWA 1ERUA 1ACVA 5CYYA 4MNNA 3W8SA 2JSYA 1A24A 4F2IA 2JZSA 2C3NA 3GSTA 4XIHA 3EWKA 4PNGA 1TW9A 2E76B 2NDOA 1EOGA 3UJ1A 4H44B 2F3MA 3MSZA 1FDOA 1A2JA 1RQVA 2VM2A 3F63A 2BEQD 3FR6A 2C0EA 4K8MA 4BWQA 3FGAD 3C73A 1M9AA 5H5QA 5M1BA 1G6YA 4QQ7A 2C1YA 3HHVA 2WZ9A 1EGOA 2H1GA 3DD3A 2YCDA 1HJ0A 1OKTA 4KSMA 2WGRA 3KM6A 2GSRA 1KTEA 1G6WA 3ZMLA 3O3TA 4HZ4A 4ZB8A 3QOUA 3RHBA 4QL9A 2AUVA 1B4QA 1VL2A 2KUCA 1JHBA 4I2UA 1A23A 3GV1A 5ENUA 2KP2A 4ZBBA 3ZFLA 4H13C 4ACSA 3P2AA 4NMUA 3VWXA 3IDVA 2K9FA 2ZT9D 4H0LD 4J57E 4DEJA 1KNGA 2BEZF 3UBLA 2CT6A 4KAEA 3EYTA 4V1Ap 2IN3A 3S9FA 1OMIA 1U57A 3KXOA 2D2CD 2WCIA 2H1AA 5DQSA 3ME8A 2B7KA 1TI1A 3GL3A 1BX9A 3MDKA 1NYHA 3APQA 3LW9A 3H79A 3H25A 1ZMEC 2LTKA 3TKSC 5DALA 4NWYA 2AYTA 2IJYA 2LNSA 1TOFA 4YKFA 4USSA 4HJMA 4I5QA 3TJFA 5A4UA 2JP3A 4EDYA 2H70A 3GKNA 4EVMA 4GSNA 1AXDA 5D8IA 1GP1A 5D73A 3ZYWA 2IL3A 2B1LA 3AE1C 4EDZA 3CSIA 1W89A 3VWVA 3PH9A 1K0BA 4ZL8A 5KKZC 2X64A 3BBYA 19GSA 4WBRD 1V40A 2XHFA 1PX7A 3H93A 4K5RA 4H13B 1TK5B 5JWQB 1YEPA 4NV5A 1WIKA 2N5AA 5GZZB 1VF1A 3CSJA 2R0CA 4IQAA 1OC9B 2DJ1A 3AECC 1VF2A 5CAXA 2R0GA 1CQGA 3ZVJA 3D5JA 3TOUA 3ZMKA 3IPZA 1K0OA 1NHYA 2OBIA 2YP6A 5EPFA 4ZL9A 4E8HA 5IPGA 2G2QA 1SL0B 1BEDA 1GTBA 2VOCA 1GLQA 4PXOA 2HNLA 2H1BA 5DJLA 2YWIA 5E59A 1M2BA 2F8FA 4KA0A 4POMA 5CRGA 3KIJA 3KD0A 1JZRA 1EWXA 2WFCA 1DIPA 3GH6A 2CV4A 1F3BA 4KW6A 2HRKA 1AQVA 2IMIA 4AJ8A 2K8VA 4AJ6A 1Y25A 2RM5A 3HA9A 5BMUA 2DJJA 2FHEA 2B6MA 2RLIA 12GSA 1PN9A 4K1FA 5L8RJ 3HZ8A 3L78A 2DC5A 3L0HA 1HNAA 5J5NA 2GGTA 3LJRA 4N10A 3D22A 5C04A 3LORA 1K05A 4LMWA 4ECCA 2K9YA 2FWGA 2QJPC 1LJRA 3FYGA 2PBJA 2H89C 2F9SA 4F82A 2HXKA 2VM1A 3MYDA 2H73A 2YJ7A 1LBKA 5G2ZA 3ZTLA 1R26A 1WPIA 4CY6A 4FQUA 1HQOA 2CVBA 3UMAA 1VRSD 2DIYA 5B7CA 2JSZA 1HF9A 1XW5A 4HJ2A 4HZ2A 3PINA 3E3EA 3GTUB 4DVCA 4F0BA 2P10A 3MAKA 1O85A 5INYA 2CVDA 2A4VA 1GULA 3ZREA 3IXRA 3VLNA 5ECMB 1XPVA 4R4LA 5IMAA 1FOVA 4TXOA 2VCTA 2LV3A 2I4AA 5KOWA 1TI3A 4DSQA 3WD6A 1M2AA 1S3DA 1SL1B 1GSYA 3LWAA 1XWKA 4R4MA 2IMEA 4FO5A 5HQPA 1OAZA 3Q5SA 1SKSB 2GTUA 4D73A 3D4MA 2VIMA 3L9UA 3LXZA 3GL5A 1XFLA 1GSQA 3APSA 3F8UA 5DVBA 3QFAC 2H19A 2A2PA 3DYRA 3F6DA 1QQ2A 2YPMA 4F0CA 4JRRA 4PQHA 3CRUA 10GSA 4DSSB 5B8AA 2P31A 1R5AA 3CMIA 2RM6A 1XW9A 3ZITA 2CQ9A 2L4QA 3ME7A 4K2XA 3E0UA 3TGZA 2GZZA 4RQRA 1FB6A 4PURA 4XTSA 1IK7A 3LYKA 1ZL9A 4RI6A 4GWRA 3UIWA 1BAYA 3F3QA 2REMA 2OE3A 3D71A 4G0IA 5ECQB 1XBSA 3IC8A 4YQVA 4OFNA 2OE0A 4KCEA 3I69A 2PVOC 4POBA 3KTBA 2EIOA 1F9MA 3QAWA 4KNDA 1B4PA 3DVWA 2YV7A 3TKQA 2DKIA 5AISA 2H88C 2H0HA 1E2YA 3IBHA 2C3TA 4O7HA 3HYPA 1FG4A 4BVYB 3ZRDA 2IPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO4 A;  1PQN A;  1GSS A;  2CX3 A;  2YV9 A;  3RPP A;  1Z6M A;  2AJQ B;  2YZU A;  22GS A;  1G7O A;  4JZQ A;  3EU4 A;  4MZC A;  3TRP A;  5FHI A;  1LU4 A;  4N0V A;  4RUV A;  1EOH A;  3GKK A;  2X8H A;  3ERW A;  1SJZ A;  3I9V 2;  2PUK C;  2L57 A;  5CRH A;  1IYI A;  1ERW A;  2VLT A;  4TN8 A;  5G31 A;  3MWH A;  1HNC A;  2ALB A;  2JU5 A;  1FVK A;  4IS0 A;  2PPT A;  3RBT A;  3F4T A;  2QGV A;  1C72 A;  1GTI A;  5G1K A;  2L5L A;  2K8S A;  2VL9 A;  2R2J A;  1NW2 A;  1YQ1 A;  4ISD A;  2NPB A;  1SD9 A;  2WSE J;  1JLW A;  3QR6 A;  2ZNM A;  1H4O A;  3MNG A;  2P0G A;  1WJK A;  4YAV A;  3GRX A;  2B5E A;  3A5W A;  1EGR A;  2WB9 A;  4YH2 A;  4MF6 A;  2R5G A;  4XS4 B;  4OFM A;  4KH7 A;  4IJI A;  1GTA A;  2H0I A;  5F8B A;  1GL8 A;  2E2M A;  4K9Z A;  4WR4 A;  3IE3 A;  4NV2 A;  1EP8 A;  3PR8 A;  1JZW A;  6GSX A;  3GN3 A;  1O8W A;  3LG6 A;  3ZFB A;  1Z3E A;  3GX8 A;  4PV1 B;  3QDN A;  5IMD A;  1V9W A;  1AAZ A;  1WRY A;  2GT6 A;  5CRD A;  1K3L A;  2O89 A;  2B7J A;  1K3O A;  2OBK A;  4L0U A;  3EMX A;  2HYX A;  1XVQ A;  3LYP A;  2XC2 A;  2QKE A;  4MJB A;  4WET A;  5DAK A;  1KEB A;  1M0U A;  1OE7 A;  3P7X A;  4GRF A;  2MZC A;  2FYN C;  4YQU A;  1QUW A;  2R3X A;  1X9S B;  3EVI A;  3C1S A;  2WSF J;  2VCV A;  4MF7 A;  2YWO A;  3A3T A;  4XS6 A;  2KP1 A;  4POL A;  2JAC A;  3EMP A;  11GS A;  3LEF A;  3ZVJ D;  2ON7 A;  4ZB9 A;  1PKW A;  5KLI C;  4PNF A;  3M0F A;  3FK8 A;  1PKZ A;  2WUL A;  1XWA A;  2H76 A;  2X8G A;  4ILF A;  1RK4 A;  4HQS A;  2LUS A;  2CAI A;  1HNB A;  1T4Y A;  3RHC A;  1AIU A;  2LRN A;  2E7P A;  2H1D A;  2LKU A;  1PX6 A;  4OO5 A;  3GA4 A;  1THX A;  4OCE A;  4TR4 A;  9GSS A;  1T4Z A;  1XWB A;  1WWJ A;  3CSH A;  2V1M A;  3EC3 A;  1GWC A;  2VAF A;  4NHZ A;  1S3A A;  5IMF A;  4ZBD A;  3LFL A;  2B1K A;  5KEJ A;  4K6X A;  4KDX A;  1ZOF A;  6GSS A;  2PWJ A;  1MD4 A;  4XS1 A;  2HLS A;  2C0D A;  3M1G A;  3UEM A;  2M46 A;  5ID2 B;  2G0F A;  5F06 A;  4K7I A;  4WF5 A;  2QJK C;  3OR5 A;  1WOU A;  3FZ9 A;  2WDU A;  2FCH A;  20GS A;  1PL1 A;  4IBP A;  1SD8 A;  3C71 A;  1EEJ A;  2LNT A;  2R6K A;  2FUG 2;  2WPV B;  1AQW A;  1GSD A;  4TOP A;  4GQF A;  3BCI A;  1ILO A;  1K3Y A;  3VPT A;  3VI7 A;  4F9Z A;  2P5Q A;  3FY7 A;  3SWL A;  4MPF A;  3LW5 J;  3GUS A;  1TRW A;  4LL4 B;  1X0R A;  3F9U A;  1GH2 A;  5E4W A;  2O7K A;  4KGI A;  1ON4 A;  5ECN B;  5C00 A;  3DXB A;  5IMC A;  1VF4 A;  1JZO A;  4MK3 A;  2ZT9 B;  4H0L B;  4V2M A;  2CVK A;  2C80 A;  3ISO A;  1O6J A;  2MBS A;  3KZQ A;  3R2Q A;  4G9H A;  1FAA A;  4HU9 A;  2R37 A;  4ZB6 A;  1O73 A;  5GST A;  7GSS A;  1UN2 A;  1XCC A;  1GNW A;  2C4J A;  2MMZ A;  1A8Y A;  2D2C B;  2OJL A;  3KJY A;  2N5F A;  1USB A;  5A4V A;  5HFK A;  4GF0 A;  2VLU A;  2DIZ A;  4BVX A;  3IA1 A;  5LD0 A;  2YAN A;  3TRX A;  4MH3 A;  5CRE A;  5F07 A;  1AC1 A;  2BTO T;  4X43 A;  5DDL A;  3HKR A;  2QJY C;  4D73 B;  4KDY A;  1BG5 A;  1BQ7 A;  3G7Y A;  2KOK A;  4POK A;  5IM9 A;  1T8E B;  3HDC A;  3KH7 A;  2HI7 A;  4EF0 A;  3TJB A;  5ECP B;  4LMV A;  5B6N A;  4KSO A;  4YAP A;  1A0R P;  3HD5 A;  1RW1 A;  2HSY A;  2B5X A;  2H8L A;  1TRS A;  3D21 A;  3J7Y b;  1OE8 A;  5CNW A;  2LJR A;  3GFK A;  5ELA A;  3AY8 A;  2X8C A;  2RUF A;  5D96 A;  2X99 A;  5GAN D;  4EXJ A;  1M2D A;  1WE0 A;  2FLS A;  4X1U A;  4NAX A;  4I7Z B;  4J56 E;  4L5O A;  4OMV A;  3K8N A;  4KT0 J;  5GSS A;  2VL2 A;  1W4V A;  3UAP A;  3KP9 A;  1UC7 A;  3VK9 A;  3UOM A;  3HXS A;  1T7P B;  3EWL A;  3F0I A;  2IFQ B;  2B5Y A;  3H1N A;  3I43 A;  2WSC J;  1K0D A;  2Z9S A;  1XOB A;  1GUH A;  1FVJ A;  3VUR A;  1QK8 A;  3D0Z A;  2LJK A;  5H5S A;  3UL3 A;  2RII A;  3IK9 A;  5AIV A;  1YKC A;  2XPE A;  4HUA A;  4MPG A;  3CTF A;  1TP9 A;  4V1A g;  3TJJ A;  3FZ4 A;  3WT1 A;  1NM3 A;  2FWH A;  1SK0 A;  2A2S A;  2EIQ A;  4QL7 A;  2VUP A;  1F6M C;  4CW9 A;  6GSY A;  1X5E A;  3FKF A;  5DJM A;  2GQK A;  4MP4 A;  1N2A A;  1TKD B;  1SK2 A;  4TR1 B;  2PMT A;  4I2T A;  5F05 A;  3VWW A;  2FGX A;  3BD2 A;  4GST A;  1B9X C;  4MF5 A;  1X9W B;  3C8E A;  2XBI A;  2J9H A;  2N5B A;  4DSR A;  2HRF A;  3CTG A;  1O81 A;  3BJ5 A;  1TDI A;  14GS A;  2H66 A;  1MDK A;  3I6A A;  1XWC A;  4ULX A;  4K7N A;  3DGQ A;  5IIZ A;  3IAS 2;  3HJP A;  5IQY A;  1J9B A;  5ELG A;  2DBC A;  4Z7X A;  1XVW A;  2KHP A;  5ECO B;  1ZCP A;  4IVF A;  5IOX A;  1FW1 A;  1VGL A;  2AHE A;  5ECR B;  4O32 A;  2H6Y A;  4F03 A;  1TJD A;  2IMD A;  4BA7 A;  2DSA A;  3APO A;  5G30 A;  3VFI A;  4TKY A;  2H0G A;  2GQL A;  1TTZ A;  1OC9 A;  5G1L A;  1B9Y C;  1Y6E A;  1T3B A;  3C1R A;  1Q90 D;  4LLR A;  3F4S A;  1R5P A;  5F0G A;  4GTU A;  1PGT A;  1Z5Y E;  3GX0 A;  1YEX A;  2ES7 A;  5HR2 A;  5ECS A;  6GST A;  4H86 A;  3RPN A;  4CHS A;  3W6G A;  5B6M A;  2H30 A;  2GS3 A;  4ML1 A;  4NPB A;  4EKZ A;  2GSQ A;  1EZK A;  2L59 A;  1K0A A;  3KP8 A;  3GIX A;  2IWT A;  1MD3 A;  5LNK e;  3GUR A;  1OYJ A;  4I97 A;  5D9W A;  3DRN A;  1SKR B;  1M9B A;  3QAG A;  5D9T A;  1GUK A;  2C0G A;  1ML6 A;  3UVH A;  5A5K A;  5DCH A;  4WF4 A;  2I9H A;  2I3Y A;  1SL2 B;  2CA8 A;  3M8N A;  2GLR A;  1K0C A;  3M9K A;  2D2Z A;  4PX1 A;  4K0N A;  2TRX A;  4J2F A;  1Z9H A;  2HSH A;  3A2X A;  3DKS A;  1SJ6 A;  1DBY A;  2DJ3 A;  1NSW A;  1G0T A;  1F2E A;  1HD2 A;  4K2D A;  4KDU A;  1TK8 B;  2LQO A;  1TRV A;  1FHE A;  2WJU A;  1S5L X;  4V2L A;  1ZYE A;  2WS2 A;  3DWV A;  2LS5 A;  2L4C A;  4WEY A;  1M7T A;  3H8Q A;  3UAR A;  3GTU A;  1MEK A;  1FB0 A;  3TUE A;  4Q5N A;  4MJA A;  2L6C A;  3O6T A;  2C0F A;  3TJK A;  2XPD A;  2JZR A;  3P90 A;  4G2E A;  3LSZ A;  3E9J B;  3IK7 A;  4EE0 A;  4X0X A;  1Z6N A;  4JR4 A;  4MZB A;  5EY6 A;  4HS1 A;  3GSS A;  1V57 A;  3ERF A;  1J08 A;  3GYK A;  4ZBA A;  4GSS A;  3F6F A;  2DJK A;  2EC4 A;  2VCQ A;  3FZA A;  2MYG A;  2V2G A;  1ERT A;  4FYC A;  4FYU A;  1V2A A;  3M9J A;  3SBC A;  5HR1 A;  2OA7 A;  1VF3 A;  2VL3 A;  2M72 A;  4KCA A;  4DSS A;  5DAL B;  1GTU A;  3A2W A;  4OCF A;  16GS A;  2DML A;  1WP0 A;  2JZT A;  1DUG A;  1V58 A;  4XRD A;  2QIW A;  4N30 A;  1M99 A;  3TRQ A;  3ZL5 A;  2HRN A;  3UVT A;  2H75 A;  4ZIJ A;  1S3C A;  3LGC A;  3L4N A;  4V2N A;  1A8L A;  5JCG A;  3DML A;  4IJ3 A;  3ZZX A;  2PER A;  4HQZ A;  1YF1 A;  4RKU J;  2HZF A;  4MMM A;  5COH A;  1ABA A;  2I1U A;  1URM A;  2PN8 A;  4MCU A;  1TU7 A;  3C8V A;  3WGD A;  2DLX A;  4BVY A;  4TR3 A;  4Q5F A;  1ZGN A;  4MH2 A;  4TRX A;  1B48 A;  3WT2 A;  4IW9 A;  2LQQ A;  3CXG A;  3GMF A;  4PGT A;  1ST9 A;  1R7H A;  1PD2 1;  1V98 A;  2OAC A;  1MDI A;  4OFT A;  1X5C A;  1OKD A;  3KH9 A;  4BPY A;  3GKX A;  4MDC A;  2HFD A;  3TCO A;  2FD3 A;  4EO3 A;  5EL8 A;  1B8X A;  3QD9 A;  1Z7P A;  5ABR A;  2GT5 A;  4N0Z A;  1U88 A;  1GNE A;  4OWY A;  3TKP A;  3RDW A;  1JZD A;  5IO0 A;  1PL2 A;  4OD7 A;  5L71 A;  4IKH A;  1SKW B;  1ZMA A;  4HDE A;  4AGS A;  4PUA A;  1YZX A;  1OC3 A;  3HVX A;  2J23 A;  3DIE A;  6GSV A;  4GXZ A;  4CDO A;  3G7I A;  3VI5 A;  3EUR A;  4YQM A;  3FR3 A;  1TK0 B;  3UBK A;  1UVZ A;  3GH9 A;  2YWM A;  3TKR A;  2VLV A;  5KN2 A;  1I9D A;  4ZIL A;  1AW9 A;  4MLY A;  17GS A;  4KB3 A;  2FNO A;  2MBT A;  1CQH A;  4XS4 A;  4BL7 A;  2LRC A;  1JLV A;  3V1W A;  4BWS A;  4TVE A;  4E8E A;  4IP1 A;  2E75 B;  2FA4 A;  1DE1 A;  3TJG A;  2B3S A;  4P3Y B;  1UA5 A;  2DMM A;  1BYE A;  3Q74 A;  1F37 A;  1PA3 A;  3D4T A;  3BCK A;  5AIX A;  3KMN A;  13GS A;  3PGT A;  2A2R A;  3QAV A;  4IEL A;  3F3R A;  3FZ5 A;  2FY6 A;  1U6T A;  4O5R A;  2GZP A;  4K0G A;  1DE2 A;  5ECI B;  2HZE A;  5J3R A;  2GSS A;  4ML6 A;  2O85 A;  5HFI A;  1SK1 A;  4ECI A;  1F3A A;  3GNJ A;  3BOA A;  2C8U A;  2BJX A;  3H4K A;  1GSU A;  3VWU A;  3HCZ A;  1PSQ A;  3Q6O A;  6GSW A;  4TXO B;  3KEB A;  3TDG A;  2I81 A;  5HR0 A;  4NXI A;  3W8J A;  2YJH A;  5EVO A;  1U3I A;  1O8X A;  1EV4 A;  6GSU A;  3HVV A;  2CAQ A;  3NIV A;  2GDR A;  5IO2 A;  3ZIJ A;  5CO3 A;  1MTC A;  4I8B A;  1EV9 A;  2H72 A;  5IOW A;  3HY2 A;  4JR6 A;  1ZYQ B;  4L5L A;  1R4W A;  3CBU A;  5IMZ A;  1OC8 A;  5D93 A;  1XZO A;  1YY7 A;  3QMX A;  4MZW A;  5D9V A;  5J4U A;  1NHO A;  4XRA A;  2VD1 A;  2H6X A;  5ECH B;  3KMO A;  1JFU A;  4ECJ A;  2TIR A;  1XIY A;  5KN3 A;  1GUM A;  3LQ7 A;  3IOS A;  5JCW A;  3N5O A;  3TOT A;  2CX4 A;  2PVQ A;  4G10 A;  2VCW A;  3F4R A;  2QC7 A;  2F8A A;  3WYW A;  3J7Y k;  4Y28 J;  1DSB A;  3ZLP A;  2TRC P;  4OGQ B;  1EP7 A;  2FA8 A;  2ZCT A;  5ID2 A;  4Q5R A;  1BJX A;  3EU3 A;  2LJA A;  4IQ1 A;  2ON5 A;  2GVP A;  2QSI A;  3LXT A;  3M3M A;  5LCZ A;  3KCM A;  2OE1 A;  2NBS A;  3NZN A;  5FT3 A;  5J9B A;  1GLP A;  3FHK A;  4TXV A;  2NTO A;  2M80 A;  3RAZ A;  5AN1 A;  2DJ0 A;  1GSF A;  5G5E A;  1EEM A;  3FRC A;  18GS A;  3FW2 A;  2YN1 A;  1X5D A;  1MDJ A;  1T1V A;  2PU9 C;  4MJC A;  5CP1 A;  3L9V A;  2KLX A;  2H74 A;  4GLT A;  3IHQ A;  2L6D A;  3IR4 A;  1J0F A;  4PQ1 A;  4KX4 A;  2P5R A;  4Q5Q A;  5A4W A;  2LRT A;  2XBQ A;  5ECK B;  2MMN A;  2VD0 A;  4L8E A;  4RQX A;  3L9S A;  5HFG A;  3IRA A;  4AF2 A;  1Q98 A;  2ZUP A;  4KUN A;  4XHM A;  1AQX A;  5JCU A;  2GST A;  3WGE A;  3U6V A;  1E6B A;  3JCM L;  3N9J A;  2O8V B;  4K7O A;  1XXU A;  1SYR A;  4EC0 A;  4HI7 A;  1THO A;  1QFN A;  3QCP A;  1FO5 A;  3Q18 A;  4WKW A;  1QXH A;  1XWG A;  1TU8 A;  1QMV A;  4GQC A;  5B8B A;  4I6X A;  2V6K A;  1IYH A;  4IP6 A;  3DEX A;  5KN0 A;  4FIW A;  5GAP D;  1WMJ A;  1PRX A;  1AUC A;  2CZ2 A;  3IV4 A;  3GHA A;  2YIU C;  2YZH A;  2C3Q A;  2IMK A;  5H5R A;  3HVS A;  2YOI A;  4MAB A;  4XCS A;  2PGT A;  5HR3 A;  3DVX A;  1KBN A;  5J9C A;  1SEN A;  3TB2 A;  4RI7 A;  1O7U A;  5DAK B;  2LEG A;  1JB0 J;  4TW5 A;  3US3 A;  4L0W A;  5G5F A;  1SJI A;  1YJ6 A;  2V32 A;  3U5R E;  2IMF A;  3G7J A;  3FR9 A;  4KE3 A;  3KGK A;  4ECB A;  1GSE A;  3TKS A;  3IC4 A;  1X9M B;  2K6V A;  2O87 A;  1T00 A;  2HE3 A;  4MJE A;  5JWR B;  3WGX A;  4WXT A;  2K18 A;  2VCX A;  1TRU A;  1XOA A;  2R4V A;  2O01 J;  2V41 A;  3EE2 A;  1HYU A;  3HJM A;  3A2V A;  4WBJ A;  2IFQ A;  2AB6 A;  4EL1 A;  3TKS E;  2E0Q A;  4IGJ A;  2YWN A;  4LL1 B;  2VCZ A;  8GSS A;  3VPQ A;  2H71 A;  1G7E A;  3QPM A;  2DJ2 A;  3NOF A;  4PUF C;  2OKA A;  2JAD A;  4N11 A;  2V6O A;  2AV4 A;  4ZXG A;  1Q4J A;  1K0N A;  5DCG A;  2YNX A;  2L5O A;  3CYN A;  1Z7R A;  1A2M A;  4MA9 A;  1A0F A;  2F51 A;  2VO4 A;  3FEU A;  4EUY A;  4JBB A;  4JED A;  4ZL7 A;  5J41 A;  4TR1 A;  1TXX A;  3D6I A;  5FWG A;  2WRT A;  2CZ3 A;  1YF0 A;  3G9B A;  4IL6 X;  5AGY A;  2FWE A;  3GKM A;  1PMT A;  3HJO A;  4HEA 2;  3ERG A;  1YKA A;  2E74 B;  4JE1 A;  4AJ7 A;  5DBQ A;  3EIN A;  2EIR A;  2AAW A;  4O92 A;  5D9X A;  1K0M A;  3P8W A;  1U87 A;  2GQM A;  2H01 A;  2H6Z A;  2NVL A;  1GRX A;  3Q19 A;  4WR5 A;  4FH8 A;  3ED3 A;  5CRW A;  5KN1 A;  4TR0 A;  2OAD A;  4IN0 A;  2RUE A;  3C7M A;  2JL4 A;  3IAM 2;  1VF5 B;  4PQI A;  4GCI A;  2HZE B;  4ID0 A;  1ZRT E;  1XW6 A;  1I5G A;  3KTL A;  5IMV A;  2VL2 C;  4G19 A;  3QFB C;  3O76 A;  1QGV A;  3HZ4 A;  2GZY A;  1YDK A;  1H75 A;  3CRT A;  5JWO B;  5DQY A;  4LA1 A;  1RQM A;  2IIY A;  1SU9 A;  5ECL B;  1N8J A;  4HOJ A;  1ERV A;  1OVN A;  5IPH A;  1SYX A;  4HU7 A;  1U3A A;  1ZZY A;  2HT9 A;  2E2G A;  4IHU A;  2MMA A;  1A2L A;  2BMX A;  2MMO A;  4FYB A;  4JU5 A;  3ZIV A;  2LST A;  2FWF A;  4NHW A;  1ERU A;  1ACV A;  5CYY A;  3W8S A;  2JSY A;  1A24 A;  4F2I A;  2JZS A;  2C3N A;  3GST A;  4XIH A;  4PNG A;  1TW9 A;  2E76 B;  2NDO A;  1EOG A;  3UJ1 A;  4H44 B;  2F3M A;  3MSZ A;  1A2J A;  2VM2 A;  3F63 A;  3FR6 A;  2C0E A;  4K8M A;  4BWQ A;  3C73 A;  1M9A A;  5H5Q A;  1G6Y A;  4QQ7 A;  2C1Y A;  3HHV A;  2WZ9 A;  1EGO A;  2H1G A;  3DD3 A;  2YCD A;  1OKT A;  4KSM A;  2WGR A;  3KM6 A;  2GSR A;  1KTE A;  1G6W A;  3ZML A;  3O3T A;  4HZ4 A;  4ZB8 A;  3QOU A;  3RHB A;  4QL9 A;  2AUV A;  1B4Q A;  2KUC A;  1JHB A;  4I2U A;  1A23 A;  3GV1 A;  5ENU A;  2KP2 A;  4ZBB A;  3ZFL A;  4ACS A;  3P2A A;  4NMU A;  3VWX A;  3IDV A;  2K9F A;  4J57 E;  4DEJ A;  1KNG A;  3UBL A;  2CT6 A;  4KAE A;  3EYT A;  4V1A p;  2IN3 A;  3S9F A;  3KXO A;  2WCI A;  2H1A A;  5DQS A;  3ME8 A;  2B7K A;  1TI1 A;  3GL3 A;  1BX9 A;  3MDK A;  3APQ A;  3H79 A;  2LTK A;  3TKS C;  5DAL A;  4NWY A;  2AYT A;  2IJY A;  2LNS A;  1TOF A;  4HJM A;  4I5Q A;  3TJF A;  5A4U A;  4EDY A;  2H70 A;  3GKN A;  4EVM A;  4GSN A;  1AXD A;  5D8I A;  1GP1 A;  5D73 A;  3ZYW A;  2IL3 A;  2B1L A;  4EDZ A;  3CSI A;  1W89 A;  3VWV A;  3PH9 A;  1K0B A;  4ZL8 A;  5KKZ C;  2X64 A;  3BBY A;  19GS A;  4WBR D;  1V40 A;  2XHF A;  1PX7 A;  3H93 A;  4H13 B;  1TK5 B;  5JWQ B;  1YEP A;  4NV5 A;  1WIK A;  2N5A A;  5GZZ B;  1VF1 A;  3CSJ A;  4IQA A;  1OC9 B;  2DJ1 A;  1VF2 A;  5CAX A;  1CQG A;  3ZVJ A;  3D5J A;  3TOU A;  3ZMK A;  3IPZ A;  1K0O A;  1NHY A;  2OBI A;  2YP6 A;  5EPF A;  4ZL9 A;  4E8H A;  5IPG A;  2G2Q A;  1SL0 B;  1BED A;  1GTB A;  2VOC A;  1GLQ A;  4PXO A;  2HNL A;  2H1B A;  5DJL A;  2YWI A;  5E59 A;  1M2B A;  2F8F A;  4KA0 A;  4POM A;  5CRG A;  3KIJ A;  1JZR A;  3KD0 A;  1EWX A;  2WFC A;  3GH6 A;  2CV4 A;  1F3B A;  4KW6 A;  1AQV A;  2IMI A;  4AJ8 A;  2K8V A;  4AJ6 A;  1Y25 A;  2RM5 A;  3HA9 A;  2DJJ A;  2FHE A;  2B6M A;  2RLI A;  12GS A;  1PN9 A;  4K1F A;  5L8R J;  3HZ8 A;  3L78 A;  2DC5 A;  3L0H A;  1HNA A;  5J5N A;  2GGT A;  3LJR A;  4N10 A;  3D22 A;  5C04 A;  3LOR A;  4LMW A;  4ECC A;  2K9Y A;  2FWG A;  2QJP C;  1LJR A;  3FYG A;  2PBJ A;  2F9S A;  4F82 A;  2HXK A;  2VM1 A;  2H73 A;  2YJ7 A;  1LBK A;  5G2Z A;  3ZTL A;  1R26 A;  1WPI A;  1HQO A;  2CVB A;  3UMA A;  1VRS D;  2DIY A;  5B7C A;  2JSZ A;  1XW5 A;  4HJ2 A;  4HZ2 A;  3PIN A;  3E3E A;  3GTU B;  4DVC A;  4F0B A;  3MAK A;  1O85 A;  5INY A;  2CVD A;  2A4V A;  1GUL A;  3ZRE A;  3IXR A;  3VLN A;  5ECM B;  1XPV A;  5IMA A;  1FOV A;  4TXO A;  2VCT A;  2LV3 A;  2I4A A;  1TI3 A;  4DSQ A;  3WD6 A;  1M2A A;  1S3D A;  1SL1 B;  1GSY A;  3LWA A;  1XWK A;  2IME A;  4FO5 A;  5HQP A;  1OAZ A;  1SKS B;  2GTU A;  4D73 A;  3D4M A;  2VIM A;  3L9U A;  3LXZ A;  3GL5 A;  1XFL A;  1GSQ A;  3APS A;  3F8U A;  5DVB A;  3QFA C;  2H19 A;  3DYR A;  3F6D A;  1QQ2 A;  2YPM A;  4F0C A;  4JRR A;  4PQH A;  3CRU A;  10GS A;  4DSS B;  5B8A A;  2P31 A;  1R5A A;  3CMI A;  2RM6 A;  1XW9 A;  3ZIT A;  2CQ9 A;  2L4Q A;  3ME7 A;  3E0U A;  3TGZ A;  2GZZ A;  4RQR A;  1FB6 A;  4PUR A;  4XTS A;  3LYK A;  1ZL9 A;  4RI6 A;  4GWR A;  3UIW A;  1BAY A;  3F3Q A;  2REM A;  2OE3 A;  5ECQ B;  1XBS A;  4YQV A;  4OFN A;  2OE0 A;  4KCE A;  3I69 A;  2PVO C;  4POB A;  3KTB A;  2EIO A;  1F9M A;  3QAW A;  4KND A;  1B4P A;  3DVW A;  2YV7 A;  3TKQ A;  5AIS A;  2H0H A;  1E2Y A;  3IBH A;  2C3T A;  4O7H A;  3HYP A;  1FG4 A;  3ZRD A;  2IPA A; 
#chains in the Genus database with same CATH topology
 2JO1 A;  3P8C E;  3GW6 A;  4OO4 A;  3AE8 C;  1PQN A;  1GSS A;  3KYQ A;  2CPB A;  3L73 E;  2CX3 A;  1EQ7 A;  4YXD C;  2YV9 A;  3RPP A;  2FKW B;  1Z6M A;  2AJQ B;  2WQY C;  2YZU A;  3JC2 2;  4PD4 I;  22GS A;  4N6J A;  4WB4 A;  3NFQ A;  1G7O A;  4JZQ A;  3CWB G;  4BRY B;  3EU4 A;  4MZC A;  5BU5 A;  3TRP A;  5TIS E;  5FHI A;  1SFC A;  1LU4 A;  4N0V A;  4RUV A;  3AE9 C;  1LGH B;  5KLV J;  2POH A;  3H1J E;  4PV1 C;  1EOH A;  3GKK A;  1AQT A;  3H1I D;  2X8H A;  3ERW A;  1SJZ A;  5KOX A;  3I9V 2;  1N7S A;  2L57 A;  2PUK C;  5CRH A;  2AXC A;  3NXS A;  4YPC A;  4L74 A;  1IYI A;  3L74 E;  1ERW A;  2Q3E A;  1BCC G;  2VLT A;  4TN8 A;  5G31 A;  1KD1 Q;  3MWH A;  1HNC A;  2ALB A;  3CX5 H;  3L37 A;  2JU5 A;  4K5S A;  4G0L A;  1T8Z A;  1R5S A;  1FVK A;  1L0L K;  4XE5 B;  2PFX A;  4IS0 A;  2PPT A;  3RBT A;  3F4T A;  2QGV A;  4L75 A;  3Q5R A;  1C72 A;  1GTI A;  1VQ4 P;  5G1K A;  3FXD A;  2L5L A;  2WZ7 A;  1HGZ A;  2K8S A;  2VL9 A;  3D70 A;  1NW2 A;  2R2J A;  4IFD K;  1YQ1 A;  3N7N A;  4ISD A;  2NPB A;  1SD9 A;  2WSE J;  1JLW A;  2N1T A;  2C0W A;  4WVZ A;  3QR6 A;  2ZNM A;  1H4O A;  3MNG A;  2P0G A;  1IJD B;  1VDF A;  1WJK A;  4YAV A;  3GRX A;  1ZR4 A;  1PFO A;  3V2R A;  1W2B O;  1OFC X;  2B5E A;  1KQS O;  4BIK A;  1H88 A;  3A5W A;  4X4J A;  1EGR A;  2AEF A;  3M9B A;  1S4X A;  2WB9 A;  1EDI A;  4YH2 A;  1VPC A;  2R5G A;  4MF6 A;  4XS4 B;  3AED C;  2OTL P;  4OFM A;  3G3Z A;  4BL7 B;  4KH7 A;  2HYN A;  2M5A B;  1GZL A;  1BDC A;  4IJI A;  1FZC A;  1GTA A;  2H0I A;  3HRN A;  5F8B A;  1LTT C;  1KQF B;  3CX5 E;  4KHX A;  4O5Q A;  2QEX P;  2E2M A;  4K9Z A;  1GL8 A;  4WR4 A;  2K37 A;  3IE3 A;  2KLU A;  2JR8 A;  4NV2 A;  1EP8 A;  2OQQ A;  3H1K D;  3PR8 A;  1JZW A;  4AUW A;  2W6A A;  6GSX A;  3GN3 A;  1O8W A;  2IDB A;  3LG6 A;  3ZFB A;  2ZAE B;  1Z3E A;  3GX8 A;  5C39 A;  1NU1 J;  4PV1 B;  1VQ7 P;  3QDN A;  5KTB A;  1J1E C;  5IMD A;  1V9W A;  1AAZ A;  3CCQ P;  2IBZ D;  1WRY A;  2GT6 A;  5CRD A;  1K3L A;  2O89 A;  2B7J A;  1LT9 A;  1K3O A;  2OBK A;  4L0U A;  5BRT A;  1CZQ A;  1L0L D;  1WMK A;  3OAK A;  1XVQ A;  2HYX A;  3EMX A;  3LYP A;  2IFM A;  2XC2 A;  2QKE A;  3L71 E;  1PZQ A;  3G71 P;  4MJB A;  4WET A;  1KEB A;  5DAK A;  1M0U A;  1ZV8 A;  1OE7 A;  3OA7 A;  4PTS A;  5KJ7 A;  2XDJ A;  3P7X A;  4GRF A;  2MZC A;  4PJ0 H;  1KB9 I;  2FYN C;  1URQ A;  4YQU A;  1QUW A;  2R3X A;  1X9S B;  2Z5I A;  1NTM E;  1YI2 P;  3EVI A;  2KSJ A;  3C1S A;  1KB9 H;  1SQP K;  2WSF J;  1FZE A;  2N9Y B;  2FXM A;  2VCV A;  4MF7 A;  2YWO A;  3TGU J;  2GUS A;  3A3T A;  1SQP G;  2HG5 D;  3MUD A;  4XS6 A;  2KP1 A;  4POL A;  2JAC A;  3MIX A;  3EMP A;  11GS A;  3LEF A;  1MKM A;  2O3J A;  3ZVJ D;  2WVR A;  2NZ2 A;  2ON7 A;  2A06 E;  1ZOY C;  4ZB9 A;  1PKW A;  3KDP B;  5KLI C;  1EXJ A;  4DT0 A;  1Z56 A;  3H1H D;  1RQU A;  4PNF A;  3M0F A;  2V4H A;  3FK8 A;  1PKZ A;  2WUL A;  1LWU A;  1XWA A;  2IX7 C;  2WPS A;  2H76 A;  2X8G A;  4ILF A;  1RK4 A;  4HQS A;  2LUS A;  1YJN P;  2CAI A;  1KC8 Q;  1HNB A;  1T4Y A;  5APW A;  3RHC A;  1AIU A;  2LRN A;  3RK3 E;  2E7P A;  2H1D A;  2LKU A;  1PX6 A;  1NTK E;  4OO5 A;  2YO2 A;  1KMI Z;  5CCH C;  2CK3 H;  3PPU A;  3GA4 A;  3VP9 A;  1THX A;  4OCE A;  1AQ5 A;  2BCC J;  1T4Z A;  4TR4 A;  9GSS A;  1XWB A;  1WWJ A;  4PJ0 E;  3CSH A;  2V1M A;  1E79 H;  2ZT9 C;  3EC3 A;  4H0L C;  1GWC A;  2VAF A;  2FYU G;  4NHZ A;  1S3A A;  3TSI A;  5IMF A;  1KB9 E;  1NTZ E;  4ZBD A;  1J1E B;  3LFL A;  4JYB A;  2B1K A;  5KEJ A;  4K6X A;  4KDX A;  1ZOF A;  6GSS A;  1S1C X;  3CLQ A;  1PPJ G;  3GLM A;  2B87 B;  4YTP C;  3NTN A;  1SQV J;  2D2C C;  2PWJ A;  5AVV B;  1MD4 A;  4XS1 A;  2HLS A;  2C0D A;  2HSM A;  3M1G A;  3UEM A;  2M46 A;  3S1K A;  2P2U A;  5ID2 B;  2G0F A;  3MZW B;  1EZV D;  1SQP D;  5F06 A;  4EIQ A;  3HE4 A;  4W7Y A;  3B4S A;  1JY2 N;  1CI6 A;  4K7I A;  4WF5 A;  1OVU A;  2QJK C;  3OR5 A;  1WOU A;  2QM7 A;  2OTK E;  3O6Q B;  1LTJ A;  3FZ9 A;  2WDU A;  2FY8 A;  2V7Q J;  2FCH A;  2E75 D;  2E42 A;  4YKG A;  2ZYG A;  20GS A;  3A3Y B;  2L5G B;  3AE3 C;  1PL1 A;  4IBP A;  2C9N Y;  1SD8 A;  1BE3 D;  3C71 A;  4MN4 C;  5KLI B;  1EEJ A;  2YKQ A;  2HPC A;  2LNT A;  1NO4 A;  1JOC A;  2R6K A;  4IFF A;  3V4Q A;  1UII A;  2WPV B;  3H1I E;  1BGY D;  1SLQ A;  3W67 A;  5CJ4 A;  2KI7 B;  1H89 A;  1AQW A;  1GSD A;  4TOP A;  4KJM A;  4GQF A;  3BCI A;  1ILO A;  1K3Y A;  3VPT A;  2ITA A;  3VI7 A;  4F9Z A;  3TNU A;  2P5Q A;  3FY7 A;  3SWL A;  4MPF A;  3LW5 J;  3GUS A;  1TRW A;  3VYI A;  3L73 G;  1PP9 J;  4LL4 B;  1J1D B;  5BU8 B;  1P84 D;  1X0R A;  3PJS K;  2K9J A;  3F9U A;  1RF1 C;  1GH2 A;  5E4W A;  2O7K A;  4KGI A;  1ON4 A;  5ECN B;  5C00 A;  1PV3 A;  3FMW A;  3DXB A;  1USE A;  5IMC A;  1VF4 A;  1YQ3 C;  1VQL P;  1JZO A;  4MK3 A;  2ZT9 B;  4H0L B;  4V2M A;  2CVK A;  3BAS A;  2IBZ I;  2C80 A;  3ISO A;  1O6J A;  2MBS A;  1L2P A;  3KZQ A;  3H1J G;  3R2Q A;  1KFN A;  4G9H A;  1FAA A;  3CD6 P;  4HU9 A;  2C0X A;  1BDD A;  2R37 A;  3WUU A;  1O73 A;  4ZB6 A;  3ITK A;  3L74 G;  5GST A;  7GSS A;  1VQ6 P;  1UN2 A;  3BRT B;  1W2E A;  3H1L J;  1XCC A;  2KS1 A;  2Q6Q A;  1GNW A;  2C4J A;  2MMZ A;  1A8Y A;  2D2C B;  1AV1 A;  2OJL A;  4I7Z C;  3KJY A;  2AXT E;  2N5F A;  1USB A;  5A4V A;  1SQQ J;  5HFK A;  1NGM B;  5AVQ B;  2Q5U A;  1FU1 A;  4GF0 A;  2A45 G;  3HD7 C;  1JY3 N;  2XND H;  2VLU A;  3S4R A;  3S9O A;  2DIZ A;  4BVX A;  3IA1 A;  2XKM A;  5LD0 A;  2YAN A;  1KYO I;  4HB1 A;  4I6M C;  4MH3 A;  5CRE A;  5F07 A;  3TRX A;  5AW3 B;  1AC1 A;  1AJY A;  2BTO T;  4X43 A;  5DDL A;  2KUB A;  3BCC J;  2Y9Z A;  1KYO H;  3HKR A;  2QJY C;  4NPF X;  4EIJ A;  2OYI A;  3RK2 C;  3H1K E;  4D73 B;  2FFD C;  1Y9B A;  4KDY A;  1BG5 A;  2QA2 A;  1BQ7 A;  4O5U A;  3G7Y A;  1L4A D;  1S2E A;  2KOK A;  4POK A;  5IM9 A;  1T8E B;  1SFC C;  3HDC A;  1JUN A;  3KH7 A;  2HI7 A;  4EF0 A;  2IBZ E;  1OVV A;  4IFM A;  3TJB A;  5ECP B;  4CY8 A;  1N7S C;  4LMV A;  1WT6 A;  1L0L E;  1IFM A;  3AEE C;  5B6N A;  1M7L A;  4KSO A;  2WWW A;  3AEA C;  1RF1 B;  4YAP A;  1A0R P;  2H8P D;  3HD5 A;  3IF4 A;  2ZXE B;  4IL6 H;  2P7J A;  1HTL C;  2QG4 A;  1RW1 A;  2HSY A;  2B5X A;  2H8L A;  1PGP A;  1TRS A;  4OGQ D;  2FYZ A;  4ZKU A;  3D21 A;  3J7Y b;  1OE8 A;  4ASV A;  5CNW A;  1KQG B;  2LJR A;  3GFK A;  1M1J A;  5ELA A;  3AY8 A;  2IYO A;  2O1K A;  2RUF A;  2IFN A;  2X8C A;  5D96 A;  3PHL A;  2X99 A;  5GAN D;  3N4X A;  4WY4 C;  4EXJ A;  3GG2 A;  1BCC J;  1XG8 A;  1M2D A;  1WE0 A;  2FLS A;  2ZVN B;  4X1U A;  4NAX A;  4I7Z B;  4J56 E;  2KXP B;  4L5O A;  4OMV A;  3K8N A;  4KT0 J;  5GSS A;  2VL2 A;  3H1H E;  1JY2 O;  1W4V A;  3UAP A;  3KP9 A;  2X49 A;  1UC7 A;  1ZXG A;  3VK9 A;  3HD7 B;  3R2P A;  1YBK A;  3PP5 A;  1QVF O;  3UOM A;  3HXS A;  1T7P B;  1NTM G;  3EWL A;  3F0I A;  2IFQ B;  2B5Y A;  3H1N A;  1OWA A;  3I43 A;  2WSC J;  1K0D A;  4PD4 D;  2Z9S A;  5APT A;  1XOB A;  2RKL A;  1GUH A;  3Q1M A;  1FVJ A;  3VUR A;  3L35 A;  1QK8 A;  2QJY B;  3D0Z A;  3RK2 B;  3SFD C;  2LJK A;  5H5S A;  2FFD B;  1RE3 A;  2NPS C;  3UL3 A;  2RII A;  1QL2 A;  3IK9 A;  1YKC A;  5AIV A;  1SFC B;  2XPE A;  1Q7Y Q;  4HUA A;  4MPG A;  3CTF A;  3B5N A;  1TP9 A;  4V1A g;  3TJJ A;  1RHZ B;  1R8E A;  1BSH A;  3FZ4 A;  1N7S B;  2K1A A;  2N1T D;  1P84 I;  3WT1 A;  2J59 M;  1NM3 A;  2FWH A;  1SK0 A;  2A2S A;  2EIQ A;  1GMJ A;  1P84 H;  1FJK A;  1NTK G;  4C7N A;  4QL7 A;  1EC5 A;  1SQV K;  4ZMD A;  4D6T J;  2VUP A;  1EZV E;  1SQP E;  1F6M C;  4CW9 A;  4Z2U A;  6GSY A;  1X5E A;  3FKF A;  5DJM A;  1JCC A;  3CCV P;  1G2C B;  5K5G B;  2GQK A;  3VN0 A;  4MP4 A;  1RF0 C;  4WBA A;  1N2A A;  4JYC A;  1TKD B;  1SK2 A;  4TR1 B;  1DEB A;  2PMT A;  4I2T A;  1NTZ G;  3TGU D;  1LP1 A;  5F05 A;  3VWW A;  3RK3 C;  2FGX A;  3AE4 C;  4WY4 B;  5AW0 B;  3BD2 A;  4GST A;  1B9X C;  2KYV A;  4MF5 A;  1X9W B;  2KOG A;  3C8E A;  2XBI A;  1BE3 E;  1SVF A;  2J9H A;  2N5B A;  4DSR A;  2HRF A;  3CTG A;  1JY3 O;  1O81 A;  3HE5 A;  1OW7 A;  3BJ5 A;  1X8Y A;  1X22 A;  1TDI A;  5TJH A;  1BGY E;  14GS A;  2H66 A;  1MDK A;  3I6A A;  1XWC A;  4ULX A;  3MD0 A;  1NOH A;  4K7N A;  1GL2 A;  3DGQ A;  5IIZ A;  2I1K A;  3IAS 2;  3HJP A;  4GOE A;  5IQY A;  1J9B A;  1KIL A;  5CCG D;  5ELG A;  2DBC A;  2F