4I2LC

New hiv entry inhibitor mtsft/t23 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
41
structure length
41
Chain Sequence
QQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein/antiviral protein
molecule keywords GP41
publication title Potent antiviral activity of the novel HIV entry inhibitor MTSFT
rcsb
total genus 18
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2012-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4i2lC00
2WPQA 5AVYB 4AYCA 1JNMA 1CI6A 1X8YA 3NXSA 1G2CB 2H7HA 3MD0A 5AW8B 3T97A 2KP8A 3TK1A 1GK4A 5AVRB 2JJLA 1MV8A 3HE5B 3VMYA 1S9KD 2N9BA 1IO4A 1HUCA 2E43A 2YO3A 2ZXEB 2Q7CA 2W27A 4HYTB 4KHXA 3V4QA 5AW6B 2R5BA 5APYA 4C46A 2YNYA 1H88A 4GKGA 3VYIA 1A02J 4AUWA 3KDPB 3P7KA 2R5DA 5APUA 5AVQB 4C7NA 4B86A 1OXZA 1YYCA 2XU6A 2WT7A 3NFQA 5APVA 2YO2A 1GD2E 3L36A 1NWQA 3V5BA 3A7OA 3M9BA 1H89A 1MUUA 1HBWA 3VMXA 1JUNA 1GU5A 5AVZB 3B8EB 2ZFCA 5AVUB 1OWAA 3OAKA 5AVSB 4I2LC 5AW7B 3I5CA 3M9HA 2W6AA 3M91A 1T2KC 1FOSE 2Q5UA 3M0DA 1HJBA 2E42A 5AVVB 3TNUB 1CZQA 2WWWA 5AW0B 4JYCA 3VN0A 1CI6B 5AW1B 3SWFA 5AVTB 5APXA 3IR9A 3MGNA 2C9NY 2IPPA 3NMDA 1FAVA 5AW4B 3VMZA 5AVWB 3M06A 5AVXB 2R3CA 2Z5IA 4RESB 1CSBA 3A3YB 4GT1A 3O8ZA 5AW5B 4C7NB 2WPSA 2R32A 3HE4A 3TYYA 2QM7A 3UIAA 2WT7B 3V4WA 1MFZA 5AW2B 1SLQA 2P67A 5APTA 1S9KE 3VTPC 2C9LY 5APWA 1GK6A 4XE5B 1T2KD 1GTWA 3LIEA 1J2JB 3A5TA 5AW3B 4M3LA 3HE5A 2Z5HA 3A2AA 2QM8A 5CMZA 2WPRA 3KQGA 3P32A 1KQLA 5APSA 3P8MC 1DH3A 2XV5A 2VRSA 2Q3IA 5AW9B 1SP4A 4DZOA 3L37A 1H8AA 3L35A 1HWTC 5APQA 2XZRA 2WTYA 2P2UA 4I6MC 3NTNA 1NAFA 4JYBA 4LC1A 1GZLA 2BASA 1GU4A 3M0AA 1A02F 1FOSF 4AQRD 4EOTA 3HTKA 3HE4B 3TNUA 3LIDA 2P7JA
chains in the Genus database with same CATH superfamily
1CW5A 4IFDK 3L75J 1HGVA 3TK1A 2QJKB 3L70E 2PAJA 1VQMP 2IZ0A 2OQQA 5AW6B 1L4AB 2Q3EA 1Q2NA 2WZ7A 2QRXA 1JY2O 2JWDA 2E75B 2JEEA 3RL0B 3I5CA 3L4FA 5GTIE 3TNUB 3KHUA 2FYNB 1K9MQ 1SQQK 5APXA 2O1KA 1OIPA 1OVVA 1X0TA 3NMDA 1FAVA 3BCCD 3WUTA 4OGQD 3CCQP 1Q90D 1JCDA 3EQ2A 3L73G 2QM7A 3CX5H 1NTMJ 1LTGC 2P67A 3IN6A 3L71G 4Y99C 2ZYDA 3A5TA 2IZ1A 2H88C 3L73J 4C7RA 1S1CX 2CPSA 1DH3A 1KILB 2OYHB 1DD3A 1QEXA 1M1JC 2IDBA 3L37A 2BEZF 4YPCA 3CXHI 4IOIH 3Q2YA 1LTAC 4U7JA 2IBZI 2OYIA 1LTTC 1T8ZA 2IFMA 3PP5A 1URQD 2P10A 1N73C 3KZIH 3H1KD 2KNCB 5KLIC 1SQPG 3HRNA 1XTCC 2FYUG 2QVAA 2OTKE 2FFDA 4I7ZB 2NRGA 3Q3DA 1WMKA 1U7JA 4RJTA 2KYVA 3JCUE 5AVSB 2GA1A 5AW7B 5K5GB 3CCVP 1ZMEC 3HTKB 2W83C 3VN0A 1BCCE 3T97B 3GF7A 1K05A 1KZUB 2AEFA 2R3CA 3A3YB 4GT1A 3HUSA 3S4RA 2R32A 2ZVNB 3AE8C 2M0BA 5TISE 1T2KD 1SFCA 2HODA 2CK3H 1KQFB 1FDOA 4TT3H 3MIWA 1LTSC 1FJPA 1KQLA 4H44D 1PV3A 2E76B 2Q3IA 2KI7B 1H8AA 3EWKA 3AEEC 3L75D 3CD6P 1SQPK 1SQVG 3LIDA 5KJ7D 1GDTA 3WMM0 1Q86Q 2LXBA 2NPSB 3NXSA 1G2CB 2O01H 2WMMA 1SQBG 1NTZE 3H1HG 2Y0EA 2YO3A 2FYZA 2W27A 4KHXA 3MTUE 3CC2P 1LJ2A 2HYNA 1S5LX 2ZXXA 2KB7P 3MUDA 2E74C 5B66E 4K3AA 2OTLP 4U3FJ 1LTIC 2OYOA 1S4XA 1R5LA 3IR9A 3RK3E 2KSEA 3R2PA 4DT0A 1NTMD 1SQXK 1W2BO 5KAIH 1QL2A 1VF5D 4DCKA 3B5ND 1S5LE 2FXPA 3L74J 4IL6X 4H13D 1MFZA 1G1IA 3L73D 3LIEA 1J2JB 2OYIC 3AECC 4M3LA 3HE5A 3L71D 2K9YA 1Y47A 3L74E 2I8DA 1NTZK 1RHZB 1JTHB 1N86A 3ABVC 2Y0DA 1LWUB 3H1JG 1G1JA 2KSJA 2FFDC 1Q81Q 1SQBK 3F89A 1GZLA 2KS1A 3M0AA 3TF5A 3CL3D 2K88A 3FXEA 2JR8A 4IL6E 2KP8A 2P7JA 1KORA 5GTHH 2D2CC 1LT1A 2Q9IA 1IO4A 1X22A 1KYOH 2AXTH 2POHA 2H8PD 1FDIA 4GKGA 3CCSP 3AE6C 2FYUD 1HJ0A 1KMIZ 2A06E 1GD2E 1HVVA 1P84H 3MZWB 1M7LA 1BE3G 4PD4I 4N3YB 3HUSC 1H0TA 1L0LG 3G3ZA 4D6TG 3OAKA 1N7SA 4PD4E 1CZQA 4R4LA 1PGPA 1ZRTD 3SWFA 3IF4A 5KLVE 3JC22 5KAFE 4UB8H 2RKLA 1KTMA 1NGMB 4RO0A 4GODA 5KKZC 5AW5B 2M5AA 3RGUA 2QEXP 2GUVA 3GW6A 2JDIH 2Y0CA 1YBKA 1IK7A 2WSEH 4BXLA 5B5EH 5GTIH 1VQPP 3MHVA 3L72G 1VQ5P 1SFCB 3G71P 2I1KA 3Q5SA 1NTKG 3BCCJ 1KQSO 1U7MA 3NTNA 2FY8A 3CMEP 2IFNA 3K5BA 1AQTA 2B87B 3AE9C 3CMAP 3MUDC 1LT9A 3HD7D 3BCCE 3A0BE 1L0NG 1AA0A 3VMYA 3GLMA 1PP9G 1E5WA 1YYCA 3SWKA 3S9OA 2ZT9D 2ZAEB 4PV1D 3H1LG 5AVZB 1GL2D 4U3FD 1M1JA 3CXHH 1Q7YQ 3H32B 2XNXA 2O1JA 3MGNA 3RK2B 3C9IA 1S2EA 2XNDH 1RQVA 3CCUP 4C7NB 1J1DC 1YJWP 1IJDB 3HE4A 1LTJA 1BGYG 1N73A 4W7ZA 3H1KE 4XE5B 1AQ5A 3H1IJ 2Z5HA 5CMZA 3KQGA 5CCHD 1T3JA 1L4AD 2M8RA 2J59M 3QWOC 1FDMA 4HB1A 2E75D 3H25A 1KV4A 2P2UA 1KYOI 3G9RA 3RL0D 2B9BA 4ZKUA 2DW3A 3PHLA 5DJUB 2W6JH 1SQQJ 4WBAA 1Y9BA 1URQA 5TISH 1N7SC 2JJLA 1ZXGA 1USDA 3ITKA 1EDIA 2KXPB 1VQOP 4JQ0D 5AVQB 3TGUG 1NU1K 2IYPA 4L73A 3D6ZA 2QJPB 2ZFCA 3N7NA 1BE3D 1L0LD 3M91A 3TGUJ 1IFMA 1KILD 3D71A 1H0TB 1D7MA 5AVTB 3SWYA 3E1RA 3L75E 1FBMA 4WY4C 1OVRA 5E79H 3WUUA 2Z5IA 3EFGA 3AE2C 1K73Q 4IFMA 3VTPC 2CPBA 2O01N 1EDJA 2L5GB 3Q5PA 1QVFO 2V7QH 1LT9C 5B66H 2YXQB 1IFPA 2WSFJ 3L72D 1N2DC 1FE6A 2QJYC 2R3SA 1NTKD 4JYBA 1RF1A 2J58A 4BRYA 5EFWB 1FZAA 1KD1Q 1VL2A 5KJ7A 1LNQA 1VQ4P 1NKNA 4IFFA 3FXDA 2FXMA 1DD4A 1NTME 1DEEG 3L71J 1YITP 1BSHA 1PGOA 1MKMA 2ITAA 4AUWA 1HH0A 2IBZG 3L73E 2PP6A 4OGQC 1PP9D 5APVA 3CCJP 3L71E 3A7OA 1H89A 3USSA 1HBWA 1EZVD 1LTJC 1YTZT 3OW2O 4Y99B 4Z1MH 1GW3A 1FZCA 1CI6B 2E76D 4ZKPA 4I1LA 2C9NY 1M1JB 4UB6E 4EIJA 3VMZA 4CPGA 2LKMA 1SQPJ 3O6QA 1DX7A 2FYUJ 3H1ID 1YTZI 3PH0A 2Q6QA 1JB0J 2NPSD 1BGYD 2W6BA 3S1KA 3CPWO 1Z56A 4NPFX 2FYUE 3FWLA 1N73B 1URQC 1QLED 1NTMK 4PD4H 5KLIB 2WSCH 1LTBC 1GMJA 5KAFH 3L35A 1PGJA 1HWTC 2XZRA 3WUVA 1MFTA 5DJTB 1OW7A 1SQQD 2K9JA 1GU4A 1SQXG 1ZRTE 4EOTA 3SSUA 1PPJG 1YIJP 1P84D 2N1TA 1GK4A 1MV8A 2E43A 3WU2E 1H88A 1N7LA 3RL0g 1KB9D 1NTZG 1YJ9P 3E7KA 3Q1MA 3TGUD 1ZR4A 4PJ0E 1OWAA 1NVOA 3F5HA 1HF9A 4EYYQ 2W6AA 1T2KC 2E42A 1SQVJ 3I55P 2BCCG 3A0BH 4H44C 1SQBJ 3BVHA 5AW4B 3H1HJ 1PFIA 2IYOA 4R4MA 1E79H 3AE4C 1FZFA 3GHGA 3UIAA 3V4WA 1RF1C 3D6YA 2H43A 3A0HH 4OVNF 2O3JA 1LP1A 1IC2A 2WITA 5KJ7C 1W2EA 1KFMA 3P32A 1SVFA 1JY3P 1YI2P 5TJHA 1YHQP 2RH0A 1GW4A 1HTLC 2YMKA 4U3FE 5APQA 1BDCA 1VQ8P 1NAFA 1Q82Q 3LW5H 3SFEC 1A02F 3IAOA 1FOSF 3V2NA 3RBXA 4GDOA 2HLOA 1M8OB 3D70A 3HD7A 2E74B 1WT6A 1J1EC 1ZLLA 5H2FE 1QVGO 1FZCC 2YNYA 1KN7A 3CXHD 1X79B 2WSSH 1EXIA 1USEA 2WT7A 1VF5C 2W8ZA 3B5NC 2IBZD 3H1JJ 3L36A 3M9BA 1JUNA 1GU5A 2WVRA 1GL2A 1KQGB 5AVUB 4H13C 1DIPA 1RE3A 4H0LC 2OYIB 2Q5UA 1NO4A 1ZV8A 3KZIE 1SFCD 1SQPD 2LR2A 4WB4A 3RBZA 3GF3A 4XFJA 2ZYAA 2J5UA 1ZR2A 2FFDB 4LLHA 1FZBA 5CCGD 2Z4EA 5APWA 1VQLP 3O6QB 1GTWA 3U59A 1BE3J 1RQUA 2D2CB 1L0LJ 4W80A 4N78D 5C39A 4D6TJ 5CCHA 2YKOA 1L4AA 2N1TC 5APSA 3AEAC 2XV5A 2KIKA 2VRSA 1BE3E 1VQ9P 3GMAA 1L0LE 2PFXA 1M57D 3AE5C 1KILE 3HUSB 3IFMA 1SQXD 3TNUA 2QG4A 1T3UA 2HODB 4WY4A 3RK2D 1VQNP 1PPJD 3KPEA 1RE4A 2R5BA 4DOJA 2FKWB 1S72P 1NJIQ 4B86A 1JM0A 2O01J 2YIUC 2G3AA 3L72J 2B89A 1JY2P 5KKZB 1NTKJ 2XKMA 1SQVD 3SFDC 3GHGC 1QGKB 2BEQD 3M0DA 1SQBD 3H1HD 2WWWA 1KILA 3L72E 2OYHA 5KLVK 1NTKE 1AVYA 2Q1KA 1AV1A 3AEFC 1K04A 2BCCD 3CWBG 3AE3C 2P1JA 1L0NJ 2RMZA 2OTJP 2PGDA 1PP9J 2WPSA 1YQ3C 3PTZA 3CX5D 1NU1G 2XDJA 2KNCA 3H1LJ 1EZVI 3HD7C 1JMMA 1UIXA 1M90Q 1IZNB 4L74A 1PP9E 1BSNA 1SP4A 4DZOA 1EZVE 3RK3C 2L91A 1L2PA 2PRRA 2ZT9C 3JCUH 4PV1C 4AQRD 3HTKA 1MUUA 1GL2C 5AVYB 1JNMA 1AJYA 1BGYJ 2H7HA 3T97A 1RE3C 3HE5B 2QA4P 1HUCA 3H1IE 3PRJA 1OZHA 4HYTB 3BATA 3H1JD 2QE7H 2HR3A 2KK7A 1OXZA 1BGYE 3BRTB 2YO2A 1J1DB 1SS1A 3JSVC 2A45I 3U1CA 1LGHB 1RF0A 2KS1B 5BU5A 2QJKC 2YKPA 5CCHC 1L4AC 1SQQE 4L76A 3L70G 3M06A 3WU2H 1UIIA 2E75C 2K3RA 1WRGA 1P84E 3B71A 3L75G 3RL0C 4EI2A 2C9LY 4D6TD 2NPSA 1GK6A 1G2CA 3L70J 3VOPA 2FYNC 1N7SB 1KB9E 4UB8E 2K37A 3TGUE 2AXCA 1RE4C 2W90A 2AEJA 1EXJA 2WTYA 1DEBA 2WSEJ 3KYQA 1K8AQ 4ASWA 1NH4A 1EQ7A 2OARA 2M5AB 3FX0A 4Y28J 3CCEP 2WPQA 1X8YA 1KC8Q 3M0DC 5B5EE 2N9BA 1KILC 1VQKP 2OYHC 5CBOA 3V6IA 4YXWH 1NKZB 1NTMG 3P7KA 4WY4B 1S5LH 2JO1A 3AE1C 2JWAA 3V2PA 4GIFA 5M1BA 2QIWA 4GOFA 2MKVA 1JOCA 1L0ND 1JTHA 5KTBA 1Y8AA 1LT9B 2V4HA 1LWUA 4BWNA 2IPPA 4ZMDA 2FBWC 3R4YA 5H2FH 4I7ZC 4NPEA 3CWBD 1RY3A 2QJYB 2N9YB 3V2RA 3H1LD 3P8CD 4IL6H 2B88A 1EC5A 1TU3F 2ZVOB 3CXHE 1NU1D 3U1AA 3CC7P 3P8MC 5L8RJ 2IBZE 3B5NA 1JO5A 1FZEA 1IFIA 1BCCG 4OH8B 4YTPC 4WVZA 4OGQB 2H89C 1ZOYC 4WWIA 3CCMP 2YXRB 1EDLA 1BCCJ 1SQPE 3HE4B 2QSIA 1LTJB 1VQ6P 1BDDA 1RF0C 1IK9A 1R5SA 3G4SP 4TLFA 3VMAA 3MD0A 2NZ2A 3VP8A 1S9KD 2E76C 2YKQA 1JEKA 1KFNA 1W5CE 1U57A 2KZIA 3KDPB 1KYOD 2R5DA 4K35A 1X9VA 2FXOA 2E5TA 4N78E 4I2LC 5CJ4A 2NPSC 1IFDA 1SQXJ 4ASVA 1HJBA 1URQB 4QMAA 3TDKA 3QH9A 4EDFA 3W67A 3C1LA 3II6A 1QX8A 1OW8A 1SQXE 5BVZA 3L70D 2RN0A 2B87A 2HG5D 5CCGA 1JCCA 3Q5RA 1NTZJ 1PPJE 2HPCA 2E74D 5AW3B 3V2QA 2FYUK 3A2AA 1OW6A 4ZNCA 1ZW0A 1FS0E 2I1JA 1SQVE 2BCCJ 2ZJSE 5E79E 2V7QJ 2LXCB 4LC1A 1OFCX 4O9BA 1QL1A 1SQBE 2M3EA 3H1HE 1FU1A 5BU8B 4HKZH 4U3FG 3H32A 2BCCE 1YJNP 1AFOA 5AW8B 2SPZA 2ZYGA 3G6EP 3CCLP 3CX5I 4JBZA 1S3JA 4W7YA 1LWUC 1R8EA 3V4QA 1PIXA 4H44B 3FGAD 3L74G 3VYIA 1NYHA 4HJGH 4C7NA 3CX5E 3AE7C 1FC2C 3V5BA 3GG2A 1ZN5A 2Y9ZA 3AEGC 1RF1B 3C8VA 4BRYB 2D2CD 1MZ9A 1FJKA 3M9HA 2Y9YA 5AW0B 4JYCA 4H0LD 4JF7A 1ZP0C 2MJZA 1M1KQ 1VPCA 5CHXA 1NAYA 2KZJA 1SQVK 5AVXB 3O8ZA 4N6JA 2IX7C 1OVUA 1SLQA 2A06G 3EFFK 3BRVB 1YQ4C 4DJGA 3H1JE 1NOHA 1VDFA 1J1EB 3BASA 3PJSK 5CBNA 1FZCB 2A45H 2N1TD 5AW9B 2K1AA 5KLVG 3MP7B 1JMBA 1BCCD 3ZDMA 1VF5B 2M3BA 3B5NB 2WSCJ 4L75A 5KLVJ 2G8YA 4H13B 4AYCA 2JKVA 2GM4A 3OA7A 4KT0J 4H0LB 1M56D 5AVRB 3CLQA 1SFCC 1KB9H 4A7PA 1XTGB 5APYA 4C46A 4D6TE 5APUA 4OWFA 3NFQA 2KLVA 1NWQA 3VMXA 3W68A 2K9JB 5CCGC 4KJMA 3BCCG 2N1TB 2WPVB 1HGZA 4GOEA 1JY3N 5AVWB 1NTZD 2C0WA 3TYYA 1AVOA 2HFED 5AW2B 5APTA 3VP9A 1PGQA 4XA4A 2WSFH 3TSIA 2QM8A 1JY3O 2WQYC 1FZGA 2KLUA 3AEDC 3RK2C 2HPCB 2YMYA 1OMIA 2OGUA 1L0LK 1T6AA 3H6PA 4I6MC 2YIUB 3CWBJ 3RK3D 2BASA 3I56P 1L0NE 1EDKA 1EZVG 3A0HE 1OX3A 3GHGB 1CI6A 3H1KG 3B4SA 1LP1B 3CWBE 2KOGA 3LW5J 1NU1J 2ZXEB 2Q7CA 4HH2A 2JP3A 5KAIE 3CI9A 2E5YA 3H1LE 4UB6H 4RKUJ 3P8CE 1A02J 3H1KJ 3CC4P 3AEBC 2XU6A 3L74D 3H1IG 1PL5A 3E1IA 1NU1E 2P58A 3B8EB 3N4XA 3KXDA 1N8RQ 1NHLA 1N7SD 4JPZB 1FOSE 5AVVB 1NTKK 5AW1B 1PZQA 3HD7B 3FWNA 1IFNA 4LGDE 4NPDA 3OJAB 1IFJA 5CJ0A 4MN4C 2A45G 2R44A 4RESB 3RK3B 1CSBA 2QJPC 4YXDC 1SQQG 2WT7B 5GTHE 2ZT9B 1S9KE 1L0NK 4PV1B 1GL2B 2A06D 1KYOE 2WPRA 2AXTE 1P84I 2C0XA 4WY4D 3PLNA 4PD4D 3CCRP 2KUBA 1RH5B 2AEMA 3M9QA 5KLVD 1KB9I 1VQ7P 2UWJE 2GUSA 4PJ0H 1JY2N
chains in the Genus database with same CATH topology
1RF0C 1CW5A 4IFDK 1IK9A 1HGVA 3HD7A 1LT9A 3HD7D 3MD0A 3TK1A 1WT6A 3VP8A 1J1EC 1S9KD 1ZLLA 3VMYA 2PAJA 1FZCC 2YKQA 5AW6B 1L4AB 1KFNA 2YNYA 3KDPB 1X79B 2WZ7A 1E5WA 2R5DA 1X9VA 1YYCA 1JY2O 2WT7A 3B5NC 3L36A 3M9BA 2JEEA 4N78E 1JUNA 1GU5A 5AVZB 1GL2A 3RL0B 1GL2D 5AVUB 4I2LC 5CJ4A 2NPSC 3I5CA 3L4FA 1IFDA 1M1JA 1RE3A 2OYIB 2Q5UA 1HJBA 1NO4A 3TNUB 3H32B 1ZV8A 2XNXA 2O1JA 1SFCD 1SQQK 1URQB 5APXA 4WB4A 3MGNA 3RK2B 2O1KA 3NMDA 1FAVA 3C9IA 3II6A 1ZR2A 5BVZA 2FFDB 4LLHA 1FZBA 2HG5D 1J1DC 1JCDA 3EQ2A 1IJDB 3HE4A 4C7NB 5CCGA 2QM7A 1JCCA 1LTJA 5CCGD 1LTGC 2Z4EA 1N73A 2P67A 4W7ZA 5APWA 4XE5B 4Y99C 2HPCA 1AQ5A 1GTWA 3A5TA 3U59A 5AW3B 3V2QA 2FYUK 2Z5HA 3A2AA 4N78D 4W80A 5CMZA 5CCHA 3KQGA 2YKOA 5CCHD 1T3JA 4C7RA 1L4AA 2N1TC 1L4AD 2CPSA 5APSA 2M8RA 1KILB 1DH3A 2OYHB 2XV5A 2VRSA 1M1JC 2J59M 2I1JA 3L37A 1FDMA 2P2UA 1LTAC 4LC1A 4O9BA 1QL1A 3RL0D 4ZKUA 1FU1A 5BU8B 3HUSB 3IFMA 2OYIA 1LTTC 3TNUA 3H32A 1T8ZA 2IFMA 4WBAA 3PP5A 1AFOA 1URQA 1N7SC 1URQD 1T3UA 5AW8B 1N73C 2HODB 4WY4A 3RK2D 2JJLA 3HRNA 1XTCC 3KPEA 4W7YA 1LWUC 3V4QA 1RE4A 2R5BA 4DOJA 3VYIA 2FFDA 2FKWB 5AVQB 4C7NA 4B86A 1JY2P 1NU1K 3V5BA 1ZN5A 2KYVA 2XKMA 1RF1B 2ZFCA 3N7NA 3GHGC 5AVSB 1MZ9A 1FJKA 5AW7B 3M9HA 3M91A 3M0DA 3HTKB 2WWWA 1KILA 1IFMA 1KILD 4JYCA 5AW0B 3VN0A 5KLVK 2OYHA 5AVTB 3SWYA 4JF7A 2MJZA 1VPCA 1FBMA 1KZUB 5CHXA 2P1JA 4WY4C 1SQVK 2R3CA 5AVXB 2Z5IA 3A3YB 4GT1A 3EFGA 3HUSA 3O8ZA 4N6JA 2IX7C 2WPSA 2R32A 4IFMA 1SLQA 3VTPC 2CPBA 3BRVB 1T2KD 1SFCA 2HODA 2XDJA 2L5GB 1NOHA 1VDFA 3HD7C 1LT9C 1JMMA 3MIWA 1LTSC 1FJPA 1J1EB 1KQLA 3BASA 1FZCB 2A45H 2N1TD 2Q3IA 5AW9B 1SP4A 4DZOA 1H8AA 1N2DC 3RK3C 4JYBA 2M3BA 1RF1A 3B5NB 2J58A 1SQPK 1FZAA 4AQRD 3HTKA 5KJ7A 1MUUA 3LIDA 1GL2C 5KJ7D 1GDTA 3WMM0 5AVYB 4AYCA 1JNMA 2GM4A 3OA7A 2NPSB 3NXSA 1G2CB 1NKNA 4IFFA 2H7HA 2FXMA 2O01H 3T97A 1RE3C 5AVRB 3HE5B 3CLQA 1HUCA 2YO3A 1SFCC 2FYZA 2W27A 3BATA 3MTUE 4HYTB 4KHXA 1XTGB 5APYA 4C46A 4AUWA 1HH0A 2HYNA 5APUA 1OXZA 2PP6A 3NFQA 3BRTB 5APVA 2YO2A 2KLVA 1NWQA 3A7OA 1H89A 1J1DB 3VMXA 1HBWA 2A45I 3U1CA 5CCGC 1LGHB 1LTJC 1RF0A 2KB7P 1YTZT 3MUDA 4Y99B 5BU5A 1GW3A 1FZCA 1CI6B 1LTIC 2YKPA 5CCHC 4ZKPA 2N1TB 3IR9A 1L4AC 4I1LA 2C9NY 1HGZA 3R2PA 1M1JB 1JY3N 4EIJA 3VMZA 1SQXK 5AVWB 2LKMA 3M06A 1QL2A 3B5ND 2C0WA 1DX7A 1YTZI 1WRGA 3TYYA 1MFZA 2HFED 5AW2B 3RL0C 2C9LY 5APTA 2NPSA 1G1IA 1GK6A 2NPSD 1G2CA 3VP9A 3LIEA 4XA4A 1J2JB 2OYIC 2W6BA 2WSFH 3TSIA 4M3LA 3HE5A 3VOPA 1Z56A 2QM8A 1JY3O 1N7SB 1FZGA 1N73B 1URQC 1NTMK 1NTZK 3RK2C 2HPCB 2WSCH 1JTHB 1N86A 1LTBC 2YMYA 1LWUB 1G1JA 1RE4C 3L35A 1HWTC 1L0LK 3H6PA 2XZRA 2KSJA 2FFDC 2WTYA 4I6MC 1DEBA 1SQBK 3KYQA 3RK3D 1GZLA 2BASA 1NH4A 1GU4A 1EQ7A 2OARA 3M0AA 3CL3D 4EOTA 3GHGB 2KP8A 2P7JA 2WPQA 1CI6A 1X8YA 2N1TA 1GK4A 3M0DC 2Q9IA 1MV8A 2KOGA 1IO4A 2N9BA 1KILC 2OYHC 2E43A 2ZXEB 2Q7CA 4HH2A 3CI9A 2POHA 2H8PD 3P8CE 1A02J 1H88A 4GKGA 1NKZB 1N7LA 3P7KA 4WY4B 2XU6A 1GD2E 1HVVA 1M7LA 3V2PA 3E1IA 4N3YB 3HUSC 3G3ZA 4GIFA 3B8EB 1ZR4A 1OWAA 3OAKA 3N4XA 1NHLA 1JOCA 1N7SA 2W6AA 1N7SD 1T2KC 1FOSE 2E42A 5AVVB 1CZQA 1JTHA 1NTKK 5KTBA 5AW1B 3SWFA 3HD7B 1LT9B 1IFNA 1LWUA 4LGDE 2IPPA 3BVHA 5AW4B 3OJAB 1IFJA 5CJ0A 1PFIA 2A45G 4RESB 1RY3A 3RK3B 1FZFA 1CSBA 5AW5B 3V2RA 2WT7B 3GHGA 3P8CD 3UIAA 3V4WA 2GUVA 1RF1C 1S9KE 2H43A 1L0NK 1GL2B 1IC2A 2WITA 5KJ7C 1W2EA 2WSEH 2WPRA 1KFMA 3U1AA 3P32A 1SVFA 1JY3P 2C0XA 3P8MC 3B5NA 1JO5A 1FZEA 1SFCB 1IFIA 4WY4D 2I1KA 1GW4A 4OH8B 1HTLC 5APQA 3M9QA 3NTNA 1NAFA 3LW5H 2IFNA 1A02F 2GUSA 1FOSF 1JY2N 3HE4B 3V2NA 1LTJB 2HLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPQ A;  5AVY B;  4AYC A;  1JNM A;  1CI6 A;  1X8Y A;  3NXS A;  1G2C B;  2H7H A;  3MD0 A;  5AW8 B;  3T97 A;  2KP8 A;  3TK1 A;  1GK4 A;  5AVR B;  2JJL A;  1MV8 A;  3HE5 B;  3VMY A;  1S9K D;  2N9B A;  1IO4 A;  1HUC A;  2E43 A;  2YO3 A;  2ZXE B;  2Q7C A;  2W27 A;  4HYT B;  4KHX A;  3V4Q A;  5AW6 B;  2R5B A;  5APY A;  4C46 A;  2YNY A;  1H88 A;  4GKG A;  3VYI A;  1A02 J;  4AUW A;  3KDP B;  3P7K A;  2R5D A;  5APU A;  5AVQ B;  4C7N A;  4B86 A;  1OXZ A;  1YYC A;  2XU6 A;  2WT7 A;  3NFQ A;  5APV A;  2YO2 A;  1GD2 E;  3L36 A;  1NWQ A;  3V5B A;  3A7O A;  3M9B A;  1H89 A;  1MUU A;  1HBW A;  3VMX A;  1JUN A;  1GU5 A;  5AVZ B;  3B8E B;  2ZFC A;  5AVU B;  1OWA A;  3OAK A;  5AVS B;  4I2L C;  5AW7 B;  3I5C A;  3M9H A;  2W6A A;  3M91 A;  1T2K C;  1FOS E;  2Q5U A;  3M0D A;  1HJB A;  2E42 A;  5AVV B;  3TNU B;  1CZQ A;  2WWW A;  5AW0 B;  4JYC A;  3VN0 A;  1CI6 B;  5AW1 B;  3SWF A;  5AVT B;  5APX A;  3IR9 A;  3MGN A;  2C9N Y;  2IPP A;  3NMD A;  1FAV A;  5AW4 B;  3VMZ A;  5AVW B;  3M06 A;  5AVX B;  2R3C A;  2Z5I A;  4RES B;  1CSB A;  3A3Y B;  4GT1 A;  3O8Z A;  5AW5 B;  4C7N B;  2WPS A;  2R32 A;  3HE4 A;  3TYY A;  2QM7 A;  3UIA A;  2WT7 B;  3V4W A;  1MFZ A;  5AW2 B;  1SLQ A;  2P67 A;  5APT A;  1S9K E;  3VTP C;  2C9L Y;  5APW A;  1GK6 A;  4XE5 B;  1T2K D;  1GTW A;  3LIE A;  1J2J B;  3A5T A;  5AW3 B;  4M3L A;  3HE5 A;  2Z5H A;  3A2A A;  2QM8 A;  5CMZ A;  2WPR A;  3KQG A;  3P32 A;  1KQL A;  5APS A;  3P8M C;  1DH3 A;  2XV5 A;  2VRS A;  2Q3I A;  5AW9 B;  1SP4 A;  4DZO A;  3L37 A;  1H8A A;  3L35 A;  1HWT C;  5APQ A;  2XZR A;  2WTY A;  2P2U A;  4I6M C;  3NTN A;  1NAF A;  4JYB A;  4LC1 A;  1GZL A;  2BAS A;  1GU4 A;  3M0A A;  1A02 F;  1FOS F;  4AQR D;  4EOT A;  3HTK A;  3HE4 B;  3TNU A;  3LID A;  2P7J A; 
#chains in the Genus database with same CATH topology
 1CW5 A;  4IFD K;  3L75 J;  1HGV A;  3TK1 A;  2QJK B;  3L70 E;  2PAJ A;  1VQM P;  2IZ0 A;  2OQQ A;  5AW6 B;  1L4A B;  2Q3E A;  1Q2N A;  2WZ7 A;  2QRX A;  1JY2 O;  2JWD A;  2E75 B;  2JEE A;  3RL0 B;  3I5C A;  3L4F A;  5GTI E;  3TNU B;  3KHU A;  2FYN B;  1K9M Q;  1SQQ K;  5APX A;  2O1K A;  1OIP A;  1OVV A;  1X0T A;  3NMD A;  1FAV A;  3BCC D;  3WUT A;  4OGQ D;  3CCQ P;  1Q90 D;  1JCD A;  3EQ2 A;  3L73 G;  2QM7 A;  3CX5 H;  1NTM J;  1LTG C;  2P67 A;  3IN6 A;  3L71 G;  4Y99 C;  2ZYD A;  3A5T A;  2IZ1 A;  2H88 C;  3L73 J;  4C7R A;  1S1C X;  2CPS A;  1DH3 A;  1KIL B;  2OYH B;  1DD3 A;  1QEX A;  1M1J C;  2IDB A;  3L37 A;  2BEZ F;  4YPC A;  3CXH I;  4IOI H;  3Q2Y A;  1LTA C;  4U7J A;  2IBZ I;  2OYI A;  1LTT C;  1T8Z A;  2IFM A;  3PP5 A;  1URQ D;  2P10 A;  1N73 C;  3KZI H;  3H1K D;  2KNC B;  5KLI C;  1SQP G;  3HRN A;  1XTC C;  2FYU G;  2QVA A;  2OTK E;  2FFD A;  4I7Z B;  2NRG A;  3Q3D A;  1WMK A;  1U7J A;  4RJT A;  2KYV A;  3JCU E;  5AVS B;  2GA1 A;  5AW7 B;  5K5G B;  3CCV P;  1ZME C;  3HTK B;  2W83 C;  3VN0 A;  1BCC E;  3T97 B;  3GF7 A;  1K05 A;  1KZU B;  2AEF A;  2R3C A;  3A3Y B;  4GT1 A;  3HUS A;  3S4R A;  2R32 A;  2ZVN B;  3AE8 C;  2M0B A;  5TIS E;  1T2K D;  1SFC A;  2HOD A;  2CK3 H;  1KQF B;  1FDO A;  4TT3 H;  3MIW A;  1LTS C;  1FJP A;  1KQL A;  4H44 D;  1PV3 A;  2E76 B;  2Q3I A;  2KI7 B;  1H8A A;  3EWK A;  3AEE C;  3L75 D;  3CD6 P;  1SQP K;  1SQV G;  3LID A;  5KJ7 D;  1GDT A;  3WMM 0;  1Q86 Q;  2LXB A;  2NPS B;  3NXS A;  1G2C B;  2O01 H;  2WMM A;  1SQB G;  1NTZ E;  3H1H G;  2Y0E A;  2YO3 A;  2FYZ A;  2W27 A;  4KHX A;  3MTU E;  3CC2 P;  1LJ2 A;  2HYN A;  1S5L X;  2ZXX A;  2KB7 P;  3MUD A;  2E74 C;  5B66 E;  4K3A A;  2OTL P;  4U3F J;  1LTI C;  2OYO A;  1S4X A;  1R5L A;  3IR9 A;  3RK3 E;  2KSE A;  3R2P A;  4DT0 A;  1NTM D;  1SQX K;  1W2B O;  5KAI H;  1QL2 A;  1VF5 D;  4DCK A;  3B5N D;  1S5L E;  2FXP A;  3L74 J;  4IL6 X;  4H13 D;  1MFZ A;  1G1I A;  3L73 D;  3LIE A;  1J2J B;  2OYI C;  3AEC C;  4M3L A;  3HE5 A;  3L71 D;  2K9Y A;  1Y47 A;  3L74 E;  2I8D A;  1NTZ K;  1RHZ B;  1JTH B;  1N86 A;  3ABV C;  2Y0D A;  1LWU B;  3H1J G;  1G1J A;  2KSJ A;  2FFD C;  1Q81 Q;  1SQB K;  3F89 A;  1GZL A;  2KS1 A;  3M0A A;  3TF5 A;  3CL3 D;  2K88 A;  3FXE A;  2JR8 A;  4IL6 E;  2KP8 A;  2P7J A;  1KOR A;  5GTH H;  2D2C C;  1LT1 A;  2Q9I A;  1IO4 A;  1X22 A;  1KYO H;  2AXT H;  2POH A;  2H8P D;  1FDI A;  4GKG A;  3CCS P;  3AE6 C;  2FYU D;  1HJ0 A;  1KMI Z;  2A06 E;  1GD2 E;  1HVV A;  1P84 H;  3MZW B;  1M7L A;  1BE3 G;  4PD4 I;  4N3Y B;  3HUS C;  1H0T A;  1L0L G;  3G3Z A;  4D6T G;  3OAK A;  1N7S A;  4PD4 E;  1CZQ A;  4R4L A;  1PGP A;  1ZRT D;  3SWF A;  3IF4 A;  5KLV E;  3JC2 2;  5KAF E;  4UB8 H;  2RKL A;  1KTM A;  1NGM B;  4RO0 A;  4GOD A;  5KKZ C;  5AW5 B;  2M5A A;  3RGU A;  2QEX P;  2GUV A;  3GW6 A;  2JDI H;  2Y0C A;  1YBK A;  1IK7 A;  2WSE H;  4BXL A;  5B5E H;  5GTI H;  1VQP P;  3MHV A;  3L72 G;  1VQ5 P;  1SFC B;  3G71 P;  2I1K A;  3Q5S A;  1NTK G;  3BCC J;  1KQS O;  1U7M A;  3NTN A;  2FY8 A;  3CME P;  2IFN A;  3K5B A;  1AQT A;  2B87 B;  3AE9 C;  3CMA P;  3MUD C;  1LT9 A;  3HD7 D;  3BCC E;  3A0B E;  1L0N G;  1AA0 A;  3VMY A;  3GLM A;  1PP9 G;  1E5W A;  1YYC A;  3SWK A;  3S9O A;  2ZT9 D;  2ZAE B;  4PV1 D;  3H1L G;  5AVZ B;  1GL2 D;  4U3F D;  1M1J A;  3CXH H;  1Q7Y Q;  3H32 B;  2XNX A;  2O1J A;  3MGN A;  3RK2 B;  3C9I A;  1S2E A;  2XND H;  1RQV A;  3CCU P;  4C7N B;  1J1D C;  1YJW P;  1IJD B;  3HE4 A;  1LTJ A;  1BGY G;  1N73 A;  4W7Z A;  3H1K E;  4XE5 B;  1AQ5 A;  3H1I J;  2Z5H A;  5CMZ A;  3KQG A;  5CCH D;  1T3J A;  1L4A D;  2M8R A;  2J59 M;  3QWO C;  1FDM A;  4HB1 A;  2E75 D;  3H25 A;  1KV4 A;  2P2U A;  1KYO I;  3G9R A;  3RL0 D;  2B9B A;  4ZKU A;  2DW3 A;  3PHL A;  5DJU B;  2W6J H;  1SQQ J;  4WBA A;  1Y9B A;  1URQ A;  5TIS H;  1N7S C;  2JJL A;  1ZXG A;  1USD A;  3ITK A;  1EDI A;  2KXP B;  1VQO P;  4JQ0 D;  5AVQ B;  3TGU G;  1NU1 K;  2IYP A;  4L73 A;  3D6Z A;  2QJP B;  2ZFC A;  3N7N A;  1BE3 D;  1L0L D;  3M91 A;  3TGU J;  1IFM A;  1KIL D;  3D71 A;  1H0T B;  1D7M A;  5AVT B;  3SWY A;  3E1R A;  3L75 E;  1FBM A;  4WY4 C;  1OVR A;  5E79 H;  3WUU A;  2Z5I A;  3EFG A;  3AE2 C;  1K73 Q;  4IFM A;  3VTP C;  2CPB A;  2O01 N;  1EDJ A;  2L5G B;  3Q5P A;  1QVF O;  2V7Q H;  1LT9 C;  5B66 H;  2YXQ B;  1IFP A;  2WSF J;  3L72 D;  1N2D C;  1FE6 A;  2QJY C;  2R3S A;  1NTK D;  4JYB A;  1RF1 A;  2J58 A;  4BRY A;  5EFW B;  1FZA A;  1KD1 Q;  1VL2 A;  5KJ7 A;  1LNQ A;  1VQ4 P;  1NKN A;  4IFF A;  3FXD A;  2FXM A;  1DD4 A;  1NTM E;  1DEE G;  3L71 J;  1YIT P;  1BSH A;  1PGO A;  1MKM A;  2ITA A;  4AUW A;  1HH0 A;  2IBZ G;  3L73 E;  2PP6 A;  4OGQ C;  1PP9 D;  5APV A;  3CCJ P;  3L71 E;  3A7O A;  1H89 A;  3USS A;  1HBW A;  1EZV D;  1LTJ C;  1YTZ T;  3OW2 O;  4Y99 B;  4Z1M H;  1GW3 A;  1FZC A;  1CI6 B;  2E76 D;  4ZKP A;  4I1L A;  2C9N Y;  1M1J B;  4UB6 E;  4EIJ A;  3VMZ A;  4CPG A;  2LKM A;  1SQP J;  3O6Q A;  1DX7 A;  2FYU J;  3H1I D;  1YTZ I;  3PH0 A;  2Q6Q A;  1JB0 J;  2NPS D;  1BGY D;  2W6B A;  3S1K A;  3CPW O;  1Z56 A;  4NPF X;  2FYU E;  3FWL A;  1N73 B;  1URQ C;  1QLE D;  1NTM K;  4PD4 H;  5KLI B;  2WSC H;  1LTB C;  1GMJ A;  5KAF H;  3L35 A;  1PGJ A;  1HWT C;  2XZR A;  3WUV A;  1MFT A;  5DJT B;  1OW7 A;  1SQQ D;  2K9J A;  1GU4 A;  1SQX G;  1ZRT E;  4EOT A;  3SSU A;  1PPJ G;  1YIJ P;  1P84 D;  2N1T A;  1GK4 A;  1MV8 A;  2E43 A;  3WU2 E;  1H88 A;  1N7L A;  3RL0 g;  1KB9 D;  1NTZ G;  1YJ9 P;  3E7K A;  3Q1M A;  3TGU D;  1ZR4 A;  4PJ0 E;  1OWA A;  1NVO A;  3F5H A;  1HF9 A;  4EYY Q;  2W6A A;  1T2K C;  2E42 A;  1SQV J;  3I55 P;  2BCC G;  3A0B H;  4H44 C;  1SQB J;  3BVH A;  5AW4 B;  3H1H J;  1PFI A;  2IYO A;  4R4M A;  1E79 H;  3AE4 C;  1FZF A;  3GHG A;  3UIA A;  3V4W A;  1RF1 C;  3D6Y A;  2H43 A;  3A0H H;  4OVN F;  2O3J A;  1LP1 A;  1IC2 A;  2WIT A;  5KJ7 C;  1W2E A;  1KFM A;  3P32 A;  1SVF A;  1JY3 P;  1YI2 P;  5TJH A;  1YHQ P;  2RH0 A;  1GW4 A;  1HTL C;  2YMK A;  4U3F E;  5APQ A;  1BDC A;  1VQ8 P;  1NAF A;  1Q82 Q;  3LW5 H;  3SFE C;  1A02 F;  3IAO A;  1FOS F;  3V2N A;  3RBX A;  4GDO A;  2HLO A;  1M8O B;  3D70 A;  3HD7 A;  2E74 B;  1WT6 A;  1J1E C;  1ZLL A;  5H2F E;  1QVG O;  1FZC C;  2YNY A;  1KN7 A;  3CXH D;  1X79 B;  2WSS H;  1EXI A;  1USE A;  2WT7 A;  1VF5 C;  2W8Z A;  3B5N C;  2IBZ D;  3H1J J;  3L36 A;  3M9B A;  1JUN A;  1GU5 A;  2WVR A;  1GL2 A;  1KQG B;  5AVU B;  4H13 C;  1DIP A;  1RE3 A;  4H0L C;  2OYI B;  2Q5U A;  1NO4 A;  1ZV8 A;  3KZI E;  1SFC D;  1SQP D;  2LR2 A;  4WB4 A;  3RBZ A;  3GF3 A;  4XFJ A;  2ZYA A;  2J5U A;  1ZR2 A;  2FFD B;  4LLH A;  1FZB A;  5CCG D;  2Z4E A;  5APW A;  1VQL P;  3O6Q B;  1GTW A;  3U59 A;  1BE3 J;  1RQU A;  2D2C B;  1L0L J;  4W80 A;  4N78 D;  5C39 A;  4D6T J;  5CCH A;  2YKO A;  1L4A A;  2N1T C;  5APS A;  3AEA C;  2XV5 A;  2KIK A;  2VRS A;  1BE3 E;  1VQ9 P;  3GMA A;  1L0L E;  2PFX A;  1M57 D;  3AE5 C;  1KIL E;  3HUS B;  3IFM A;  1SQX D;  3TNU A;  2QG4 A;  1T3U A;  2HOD B;  4WY4 A;  3RK2 D;  1VQN P;  1PPJ D;  3KPE A;  1RE4 A;  2R5B A;  4DOJ A;  2FKW B;  1S72 P;  1NJI Q;  4B86 A;  1JM0 A;  2O01 J;  2YIU C;  2G3A A;  3L72 J;  2B89 A;  1JY2 P;  5KKZ B;  1NTK J;  2XKM A;  1SQV D;  3SFD C;  3GHG C;  1QGK B;  2BEQ D;  3M0D A;  1SQB D;  3H1H D;  2WWW A;  1KIL A;  3L72 E;  2OYH A;  5KLV K;  1NTK E;  1AVY A;  2Q1K A;  1AV1 A;  3AEF C;  1K04 A;  2BCC D;  3CWB G;  3AE3 C;  2P1J A;  1L0N J;  2RMZ A;  2OTJ P;  2PGD A;  1PP9 J;  2WPS A;  1YQ3 C;  3PTZ A;  3CX5 D;  1NU1 G;  2XDJ A;  2KNC A;  3H1L J;  1EZV I;  3HD7 C;  1JMM A;  1UIX A;  1M90 Q;  1IZN B;  4L74 A;  1PP9 E;  1BSN A;  1SP4 A;  4DZO A;  1EZV E;  3RK3 C;  2L91 A;  1L2P A;  2PRR A;  2ZT9 C;  3JCU H;  4PV1 C;  4AQR D;  3HTK A;  1MUU A;  1GL2 C;  5AVY B;  1JNM A;  1AJY A;  1BGY J;  2H7H A;  3T97 A;  1RE3 C;  3HE5 B;  2QA4 P;  1HUC A;  3H1I E;  3PRJ A;  1OZH A;  4HYT B;  3BAT A;  3H1J D;  2QE7 H;  2HR3 A;  2KK7 A;  1OXZ A;  1BGY E;  3BRT B;  2YO2 A;  1J1D B;  1SS1 A;  3JSV C;  2A45 I;  3U1C A;  1LGH B;  1RF0 A;  2KS1 B;  5BU5 A;  2QJK C;  2YKP A;  5CCH C;  1L4A C;  1SQQ E;  4L76 A;  3L70 G;  3M06 A;  3WU2 H;  1UII A;  2E75 C;  2K3R A;  1WRG A;  1P84 E;  3B71 A;  3L75 G;  3RL0 C;  4EI2 A;  2C9L Y;  4D6T D;  2NPS A;  1GK6 A;  1G2C A;  3L70 J;  3VOP A;  2FYN C;  1N7S B;  1KB9 E;  4UB8 E;  2K37 A;  3TGU E;  2AXC A;  1RE4 C;  2W90 A;  2AEJ A;  1EXJ A;  2WTY A;  1DEB A;  2WSE J;  3KYQ A;  1K8A Q;  4ASW A;  1NH4 A;  1EQ7 A;  2OAR A;  2M5A B;  3FX0 A;  4Y28 J;  3CCE P;  2WPQ A;  1X8Y A;  1KC8 Q;  3M0D C;  5B5E E;  2N9B A;  1KIL C;  1VQK P;  2OYH C;  5CBO A;  3V6I A;  4YXW H;  1NKZ B;  1NTM G;  3P7K A;  4WY4 B;  1S5L H;  2JO1 A;  3AE1 C;  2JWA A;  3V2P A;  4GIF A;  5M1B A;  2QIW A;  4GOF A;  2MKV A;  1JOC A;  1L0N D;  1JTH A;  5KTB A;  1Y8A A;  1LT9 B;  2V4H A;  1LWU A;  4BWN A;  2IPP A;  4ZMD A;  2FBW C;  3R4Y A;  5H2F H;  4I7Z C;  4NPE A;  3CWB D;  1RY3 A;  2QJY B;  2N9Y B;  3V2R A;  3H1L D;  3P8C D;  4IL6 H;  2B88 A;  1EC5 A;  1TU3 F;  2ZVO B;  3CXH E;  1NU1 D;  3U1A A;  3CC7 P;  3P8M C;  5L8R J;  2IBZ E;  3B5N A;  1JO5 A;  1FZE A;  1IFI A;  1BCC G;  4OH8 B;  4YTP C;  4WVZ A;  4OGQ B;  2H89 C;  1ZOY C;  4WWI A;  3CCM P;  2YXR B;  1EDL A;  1BCC J;  1SQP E;  3HE4 B;  2QSI A;  1LTJ B;  1VQ6 P;  1BDD A;  1RF0 C;  1IK9 A;  1R5S A;  3G4S P;  4TLF A;  3VMA A;  3MD0 A;  2NZ2 A;  3VP8 A;  1S9K D;  2E76 C;  2YKQ A;  1JEK A;  1KFN A;  1W5C E;  1U57 A;  2KZI A;  3KDP B;  1KYO D;  2R5D A;  4K35 A;  1X9V A;  2FXO A;  2E5T A;  4N78 E;  4I2L C;  5CJ4 A;  2NPS C;  1IFD A;  1SQX J;  4ASV A;  1HJB A;  1URQ B;  4QMA A;  3TDK A;  3QH9 A;  4EDF A;  3W67 A;  3C1L A;  3II6 A;  1QX8 A;  1OW8 A;  1SQX E;  5BVZ A;  3L70 D;  2RN0 A;  2B87 A;  2HG5 D;  5CCG A;  1JCC A;  3Q5R A;  1NTZ J;  1PPJ E;  2HPC A;  2E74 D;  5AW3 B;  3V2Q A;  2FYU K;  3A2A A;  1OW6 A;  4ZNC A;  1ZW0 A;  1FS0 E;  2I1J A;  1SQV E;  2BCC J;  2ZJS E;  5E79 E;  2V7Q J;  2LXC B;  4LC1 A;  1OFC X;  4O9B A;  1QL1 A;  1SQB E;  2M3E A;  3H1H E;  1FU1 A;  5BU8 B;  4HKZ H;  4U3F G;  3H32 A;  2BCC E;  1YJN P;  1AFO A;  5AW8 B;  2SPZ A;  2ZYG A;  3G6E P;  3CCL P;  3CX5 I;  4JBZ A;  1S3J A;  4W7Y A;  1LWU C;  1R8E A;  3V4Q A;  1PIX A;  4H44 B;  3FGA D;  3L74 G;  3VYI A;  1NYH A;  4HJG H;  4C7N A;  3CX5 E;  3AE7 C;  1FC2 C;  3V5B A;  3GG2 A;  1ZN5 A;  2Y9Z A;  3AEG C;  1RF1 B;  3C8V A;  4BRY B;  2D2C D;  1MZ9 A;  1FJK A;  3M9H A;  2Y9Y A;  5AW0 B;  4JYC A;  4H0L D;  4JF7 A;  1ZP0 C;  2MJZ A;  1M1K Q;  1VPC A;  5CHX A;  1NAY A;  2KZJ A;  1SQV K;  5AVX B;  3O8Z A;  4N6J A;  2IX7 C;  1OVU A;  1SLQ A;  2A06 G;  3EFF K;  3BRV B;  1YQ4 C;  4DJG A;  3H1J E;  1NOH A;  1VDF A;  1J1E B;  3BAS A;  3PJS K;  5CBN A;  1FZC B;  2A45 H;  2N1T D;  5AW9 B;  2K1A A;  5KLV G;  3MP7 B;  1JMB A;  1BCC D;  3ZDM A;  1VF5 B;  2M3B A;  3B5N B;  2WSC J;  4L75 A;  5KLV J;  2G8Y A;  4H13 B;  4AYC A;  2JKV A;  2GM4 A;  3OA7 A;  4KT0 J;  4H0L B;  1M56 D;  5AVR B;  3CLQ A;  1SFC C;  1KB9 H;  4A7P A;  1XTG B;  5APY A;  4C46 A;  4D6T E;  5APU A;  4OWF A;  3NFQ A;  2KLV A;  1NWQ A;  3VMX A;  3W68 A;  2K9J B;  5CCG C;  4KJM A;  3BCC G;  2N1T B;  2WPV B;  1HGZ A;  4GOE A;  1JY3 N;  5AVW B;  1NTZ D;  2C0W A;  3TYY A;  1AVO A;  2HFE D;  5AW2 B;  5APT A;  3VP9 A;  1PGQ A;  4XA4 A;  2WSF H;  3TSI A;  2QM8 A;  1JY3 O;  2WQY C;  1FZG A;  2KLU A;  3AED C;  3RK2 C;  2HPC B;  2YMY A;  1OMI A;  2OGU A;  1L0L K;  1T6A A;  3H6P A;  4I6M C;  2YIU B;  3CWB J;  3RK3 D;  2BAS A;  3I56 P;  1L0N E;  1EDK A;  1EZV G;  3A0H E;  1OX3 A;  3GHG B;  1CI6 A;  3H1K G;  3B4S A;  1LP1 B;  3CWB E;  2KOG A;  3LW5 J;  1NU1 J;  2ZXE B;  2Q7C A;  4HH2 A;  2JP3 A;  5KAI E;  3CI9 A;  2E5Y A;  3H1L E;  4UB6 H;  4RKU J;  3P8C E;  1A02 J;  3H1K J;  3CC4 P;  3AEB C;  2XU6 A;  3L74 D;  3H1I G;  1PL5 A;  3E1I A;  1NU1 E;  2P58 A;  3B8E B;  3N4X A;  3KXD A;  1N8R Q;  1NHL A;  1N7S D;  4JPZ B;  1FOS E;  5AVV B;  1NTK K;  5AW1 B;  1PZQ A;  3HD7 B;  3FWN A;  1IFN A;  4LGD E;  4NPD A;  3OJA B;  1IFJ A;  5CJ0 A;  4MN4 C;  2A45 G;  2R44 A;  4RES B;  3RK3 B;  1CSB A;  2QJP C;  4YXD C;  1SQQ G;  2WT7 B;  5GTH E;  2ZT9 B;  1S9K E;  1L0N K;  4PV1 B;  1GL2 B;  2A06 D;  1KYO E;  2WPR A;  2AXT E;  1P84 I;  2C0X A;  4WY4 D;  3PLN A;  4PD4 D;  3CCR P;  2KUB A;  1RH5 B;  2AEM A;  3M9Q A;  5KLV D;  1KB9 I;  1VQ7 P;  2UWJ E;  2GUS A;  4PJ0 H;  1JY2 N; 
#chains in the Genus database with same CATH homology
 1RF0 C;  1CW5 A;  4IFD K;  1IK9 A;  1HGV A;  3HD7 A;  1LT9 A;  3HD7 D;  3MD0 A;  3TK1 A;  1WT6 A;  3VP8 A;  1J1E C;  1S9K D;  1ZLL A;  3VMY A;  2PAJ A;  1FZC C;  2YKQ A;  5AW6 B;  1L4A B;  1KFN A;  2YNY A;  3KDP B;  1X79 B;  2WZ7 A;  1E5W A;  2R5D A;  1X9V A;  1YYC A;  1JY2 O;  2WT7 A;  3B5N C;  3L36 A;  3M9B A;  2JEE A;  4N78 E;  1JUN A;  1GU5 A;  5AVZ B;  1GL2 A;  3RL0 B;  1GL2 D;  5AVU B;  4I2L C;  5CJ4 A;  2NPS C;  3I5C A;  3L4F A;  1IFD A;  1M1J A;  1RE3 A;  2OYI B;  2Q5U A;  1HJB A;  1NO4 A;  3TNU B;  3H32 B;  1ZV8 A;  2XNX A;  2O1J A;  1SFC D;  1SQQ K;  1URQ B;  5APX A;  4WB4 A;  3MGN A;  3RK2 B;  2O1K A;  3NMD A;  1FAV A;  3C9I A;  3II6 A;  1ZR2 A;  5BVZ A;  2FFD B;  4LLH A;  1FZB A;  2HG5 D;  1J1D C;  1JCD A;  3EQ2 A;  1IJD B;  3HE4 A;  4C7N B;  5CCG A;  2QM7 A;  1JCC A;  1LTJ A;  5CCG D;  1LTG C;  2Z4E A;  1N73 A;  2P67 A;  4W7Z A;  5APW A;  4XE5 B;  4Y99 C;  2HPC A;  1AQ5 A;  1GTW A;  3A5T A;  3U59 A;  5AW3 B;  3V2Q A;  2FYU K;  2Z5H A;  3A2A A;  4N78 D;  4W80 A;  5CMZ A;  5CCH A;  3KQG A;  2YKO A;  5CCH D;  1T3J A;  4C7R A;  1L4A A;  2N1T C;  1L4A D;  2CPS A;  5APS A;  2M8R A;  1KIL B;  1DH3 A;  2OYH B;  2XV5 A;  2VRS A;  1M1J C;  2J59 M;  2I1J A;  3L37 A;  1FDM A;  2P2U A;  1LTA C;  4LC1 A;  4O9B A;  1QL1 A;  3RL0 D;  4ZKU A;  1FU1 A;  5BU8 B;  3HUS B;  3IFM A;  2OYI A;  1LTT C;  3TNU A;  3H32 A;  1T8Z A;  2IFM A;  4WBA A;  3PP5 A;  1AFO A;  1URQ A;  1N7S C;  1URQ D;  1T3U A;  5AW8 B;  1N73 C;  2HOD B;  4WY4 A;  3RK2 D;  2JJL A;  3HRN A;  1XTC C;  3KPE A;  4W7Y A;  1LWU C;  3V4Q A;  1RE4 A;  2R5B A;  4DOJ A;  3VYI A;  2FFD A;  2FKW B;  5AVQ B;  4C7N A;  4B86 A;  1JY2 P;  1NU1 K;  3V5B A;  1ZN5 A;  2KYV A;  2XKM A;  1RF1 B;  2ZFC A;  3N7N A;  3GHG C;  5AVS B;  1MZ9 A;  1FJK A;  5AW7 B;  3M9H A;  3M91 A;  3M0D A;  3HTK B;  2WWW A;  1KIL A;  1IFM A;  1KIL D;  4JYC A;  5AW0 B;  3VN0 A;  5KLV K;  2OYH A;  5AVT B;  3SWY A;  4JF7 A;  2MJZ A;  1VPC A;  1FBM A;  1KZU B;  5CHX A;  2P1J A;  4WY4 C;  1SQV K;  2R3C A;  5AVX B;  2Z5I A;  3A3Y B;  4GT1 A;  3EFG A;  3HUS A;  3O8Z A;  4N6J A;  2IX7 C;  2WPS A;  2R32 A;  4IFM A;  1SLQ A;  3VTP C;  2CPB A;  3BRV B;  1T2K D;  1SFC A;  2HOD A;  2XDJ A;  2L5G B;  1NOH A;  1VDF A;  3HD7 C;  1LT9 C;  1JMM A;  3MIW A;  1LTS C;  1FJP A;  1J1E B;  1KQL A;  3BAS A;  1FZC B;  2A45 H;  2N1T D;  2Q3I A;  5AW9 B;  1SP4 A;  4DZO A;  1H8A A;  1N2D C;  3RK3 C;  4JYB A;  2M3B A;  1RF1 A;  3B5N B;  2J58 A;  1SQP K;  1FZA A;  4AQR D;  3HTK A;  5KJ7 A;  1MUU A;  3LID A;  1GL2 C;  5KJ7 D;  1GDT A;  3WMM 0;  5AVY B;  4AYC A;  1JNM A;  2GM4 A;  3OA7 A;  2NPS B;  3NXS A;  1G2C B;  1NKN A;  4IFF A;  2H7H A;  2FXM A;  2O01 H;  3T97 A;  1RE3 C;  5AVR B;  3HE5 B;  3CLQ A;  1HUC A;  2YO3 A;  1SFC C;  2FYZ A;  2W27 A;  3BAT A;  3MTU E;  4HYT B;  4KHX A;  1XTG B;  5APY A;  4C46 A;  4AUW A;  1HH0 A;  2HYN A;  5APU A;  1OXZ A;  2PP6 A;  3NFQ A;  3BRT B;  5APV A;  2YO2 A;  2KLV A;  1NWQ A;  3A7O A;  1H89 A;  1J1D B;  3VMX A;  1HBW A;  2A45 I;  3U1C A;  5CCG C;  1LGH B;  1LTJ C;  1RF0 A;  2KB7 P;  1YTZ T;  3MUD A;  4Y99 B;  5BU5 A;  1GW3 A;  1FZC A;  1CI6 B;  1LTI C;  2YKP A;  5CCH C;  4ZKP A;  2N1T B;  3IR9 A;  1L4A C;  4I1L A;  2C9N Y;  1HGZ A;  3R2P A;  1M1J B;  1JY3 N;  4EIJ A;  3VMZ A;  1SQX K;  5AVW B;  2LKM A;  3M06 A;  1QL2 A;  3B5N D;  2C0W A;  1DX7 A;  1YTZ I;  1WRG A;  3TYY A;  1MFZ A;  2HFE D;  5AW2 B;  3RL0 C;  2C9L Y;  5APT A;  2NPS A;  1G1I A;  1GK6 A;  2NPS D;  1G2C A;  3VP9 A;  3LIE A;  4XA4 A;  1J2J B;  2OYI C;  2W6B A;  2WSF H;  3TSI A;  4M3L A;  3HE5 A;  3VOP A;  1Z56 A;  2QM8 A;  1JY3 O;  1N7S B;  1FZG A;  1N73 B;  1URQ C;  1NTM K;  1NTZ K;  3RK2 C;  2HPC B;  2WSC H;  1JTH B;  1N86 A;  1LTB C;  2YMY A;  1LWU B;  1G1J A;  1RE4 C;  3L35 A;  1HWT C;  1L0L K;  3H6P A;  2XZR A;  2KSJ A;  2FFD C;  2WTY A;  4I6M C;  1DEB A;  1SQB K;  3KYQ A;  3RK3 D;  1GZL A;  2BAS A;  1NH4 A;  1GU4 A;  1EQ7 A;  2OAR A;  3M0A A;  3CL3 D;  4EOT A;  3GHG B;  2KP8 A;  2P7J A;  2WPQ A;  1CI6 A;  1X8Y A;  2N1T A;  1GK4 A;  3M0D C;  2Q9I A;  1MV8 A;  2KOG A;  1IO4 A;  2N9B A;  1KIL C;  2OYH C;  2E43 A;  2ZXE B;  2Q7C A;  4HH2 A;  3CI9 A;  2POH A;  2H8P D;  3P8C E;  1A02 J;  1H88 A;  4GKG A;  1NKZ B;  1N7L A;  3P7K A;  4WY4 B;  2XU6 A;  1GD2 E;  1HVV A;  1M7L A;  3V2P A;  3E1I A;  4N3Y B;  3HUS C;  3G3Z A;  4GIF A;  3B8E B;  1ZR4 A;  1OWA A;  3OAK A;  3N4X A;  1NHL A;  1JOC A;  1N7S A;  2W6A A;  1N7S D;  1T2K C;  1FOS E;  2E42 A;  5AVV B;  1CZQ A;  1JTH A;  1NTK K;  5KTB A;  5AW1 B;  3SWF A;  3HD7 B;  1LT9 B;  1IFN A;  1LWU A;  4LGD E;  2IPP A;  3BVH A;  5AW4 B;  3OJA B;  1IFJ A;  5CJ0 A;  1PFI A;  2A45 G;  4RES B;  1RY3 A;  3RK3 B;  1FZF A;  1CSB A;  5AW5 B;  3V2R A;  2WT7 B;  3GHG A;  3P8C D;  3UIA A;  3V4W A;  2GUV A;  1RF1 C;  1S9K E;  2H43 A;  1L0N K;  1GL2 B;  1IC2 A;  2WIT A;  5KJ7 C;  1W2E A;  2WSE H;  2WPR A;  1KFM A;  3U1A A;  3P32 A;  1SVF A;  1JY3 P;  2C0X A;  3P8M C;  3B5N A;  1JO5 A;  1FZE A;  1SFC B;  1IFI A;  4WY4 D;  2I1K A;  1GW4 A;  4OH8 B;  1HTL C;  5APQ A;  3M9Q A;  3NTN A;  1NAF A;  3LW5 H;  2IFN A;  1A02 F;  2GUS A;  1FOS F;  1JY2 N;  3HE4 B;  3V2N A;  1LTJ B;  2HLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...