4I2LC

New hiv entry inhibitor mtsft/t23 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
41
structure length
41
Chain Sequence
QQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GP41
publication title Potent antiviral activity of the novel HIV entry inhibitor MTSFT
rcsb
molecule tags Viral protein/antiviral protein
total genus 18
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2012-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4i2lC00
2YNYA 3HE5A 3IR9A 2R5BA 5AW4B 3OAKA 3LIDA 1GU5A 2Z5HA 5APQA 3M0AA 4C46A 3V4WA 1JNMA 2E42A 2W27A 3KQGA 3L36A 2QM7A 5AW8B 5APWA 3MGNA 1SLQA 5AW3B 1CI6B 2R32A 1HBWA 4M3LA 4AQRD 1J2JB 4KHXA 2WWWA 3VMYA 4C7NB 4EOTA 1S9KE 1JUNA 3P7KA 4I6MC 3L37A 2N9BA 5AVQB 1MFZA 1GK6A 3L35A 1A02J 5AVRB 1GD2E 1CI6A 3NTNA 3SWFA 5AVXB 2WPQA 3VN0A 4DZOA 3M06A 3TNUA 4C7NA 1OXZA 5AW5B 3B8EB 3M9BA 5APTA 5AW2B 1H8AA 1HJBA 3A2AA 3V4QA 1CSBA 5AVWB 2P2UA 4JYCA 3I5CA 3UIAA 1SP4A 5AVSB 2E43A 3TNUB 5AW1B 1G2CB 2KP8A 1NAFA 3NXSA 2WT7A 1A02F 4AUWA 2Z5IA 1FAVA 5AVVB 3VTPC 1S9KD 2H7HA 3MD0A 2P7JA 3VMXA 2C9NY 3HE4B 1IO4A 4XE5B 5AW0B 1T2KC 5APYA 2WPRA 2R3CA 2XZRA 4JYBA 1FOSF 3TYYA 2WT7B 2W6AA 3V5BA 5AVUB 4RESB 5APUA 3A5TA 1T2KD 3O8ZA 1MUUA 2XU6A 3HTKA 2BASA 2Q7CA 3HE4A 3P32A 1OWAA 3A7OA 2Q5UA 1GK4A 1CZQA 2VRSA 1YYCA 5AW6B 3T97A 2ZXEB 4B86A 4AYCA 3M91A 3A3YB 4LC1A 5AVYB 2ZFCA 2C9LY 3M9HA 3P8MC 1MV8A 2YO2A 4GT1A 1GZLA 5APXA 1KQLA 2IPPA 2WTYA 2QM8A 2WPSA 2XV5A 1FOSE 3KDPB 3M0DA 2JJLA 1X8YA 3VMZA 1H89A 5AW9B 4I2LC 3HE5B 5AVZB 5AVTB 5CMZA 3NFQA 4HYTB 1HWTC 2Q3IA 5AW7B 3NMDA 1NWQA 2R5DA 3LIEA 1DH3A 3TK1A 1GTWA 4GKGA 2P67A 1GU4A 5APSA 1H88A 3VYIA 1HUCA 5APVA 2YO3A
chains in the Genus database with same CATH superfamily
3H25A 3AEDC 1HGZA 3EQ2A 3OAKA 1MKMA 4OVNF 2E42A 3L71G 1N73A 4ZKPA 4ASWA 3S4RA 3R2PA 2WWWA 1EZVI 2OYHA 2L91A 3P7KA 3L37A 2GM4A 3CWBJ 1OW7A 5CCHD 1K05A 2NPSC 1SQPG 1BCCD 4U7JA 1WT6A 2YXQB 2O1KA 1Q82Q 1FE6A 3L74D 2UWJE 2OYIA 2FYUK 1FBMA 1KYOI 2Z5IA 1OVRA 1KB9E 4RO0A 2Y0DA 1Q90D 2FXOA 4PV1D 2W6AA 3P8CD 1J1DB 1T2KD 3E1IA 2E5TA 2RKLA 3HE4A 2IZ0A 1PP9G 1PL5A 4W7YA 2V4HA 5M1BA 1DD3A 4GOEA 1GZLA 1BGYJ 3L73J 4ZKUA 2IPPA 1ZR4A 1JY2P 1NTZG 4H13C 2A45G 2K9JB 2O01J 4W7ZA 1RF1C 2K3RA 1TU3F 2N1TB 2HFED 3BVHA 3G9RA 1NTME 2JO1A 3JC22 2O3JA 3G71P 1NJIQ 1YI2P 2POHA 2HYNA 2KZJA 1GU5A 2AXCA 1W5CE 2HG5D 4YXDC 1YQ3C 3H1JG 4O9BA 4U3FE 2Q6QA 1PGQA 4HJGH 4C7NA 2E5YA 1MFTA 3MHVA 3RK2D 2FXPA 2KP8A 1EDKA 2IZ1A 3RK3B 1URQD 1ZN5A 1ZR2A 3C9IA 3QH9A 4C7RA 1L0NE 1LTJA 2WQYC 2QSIA 3KPEA 2M0BA 3CMEP 1HTLC 1PZQA 4Y99C 3H1LE 2WSSH 1MV8A 3FGAD 1VL2A 1FZGA 1AQTA 1KB9D 3CL3D 1DEEG 2HODB 3H1HE 1L4AB 3HD7C 1J1EC 5AVZB 1RF0C 1GL2C 4H44C 1KV4A 5CJ4A 1DH3A 1RF1A 1QVFO 2GUVA 4OGQD 3SWKA 3RK3E 4HB1A 2XNXA 1OFCX 1QEXA 2B9BA 1BCCG 4TT3H 3EWKA 1WMKA 1S9KE 1LTBC 3L71E 3PHLA 1MFZA 4H0LC 1NTMD 2A45I 1ZRTE 3H1KJ 1Q81Q 2OYHB 3U1CA 1SQPE 2AEFA 3VP9A 2W90A 2FYNC 3V6IA 3Q3DA 3MZWB 1FAVA 2P7JA 2RMZA 4U3FD 2OYIB 4HH2A 1FJKA 5AW0B 2LXBA 2XZRA 3H32A 3D6YA 2B87A 2Y0CA 3BCCJ 1J1DC 2ZXXA 1ZXGA 2ZFCA 3R4YA 3VP8A 4I7ZB 3FXEA 1PP9E 1LWUB 1L0ND 3CLQA 2WITA 3CCQP 2XDJA 3VMZA 5AW9B 5CMZA 1S5LH 3HD7A 1RF0A 1NTZE 1GL2A 3TF5A 1UIXA 4DOJA 3H1LD 1FZBA 1IFPA 2N1TC 3VYIA 2YO3A 3MP7B 3OA7A 2QJKB 3B4SA 4K3AA 5KAFH 1Q2NA 1PPJG 3H1HD 3CXHH 1VQMP 4IL6X 3TGUJ 1N86A 2I1JA 1VQ4P 3H1JE 5AVRB 3A0BE 3NTNA 2WPQA 1RE3A 3B8EB 2O01N 3RK3D 1SQQG 2QRXA 3V4QA 1DIPA 1Q7YQ 1FS0E 3IF4A 1OZHA 1NAFA 1YBKA 1S9KD 2ITAA 3L71D 2WSEH 1EQ7A 4LGDE 1Y9BA 3JSVC 1VQLP 2E76D 1ZRTD 2KSEA 2IX7C 1KYOH 4R4MA 5H2FE 1SQPD 1LTJB 3L75J 4Y28J 3M91A 1SQBJ 1DD4A 5KLVJ 1HH0A 2W6BA 3AEAC 2ZVOB 1KILE 2H88C 1LP1A 3MTUE 1YJ9P 3RL0g 3L70J 1SQBK 5KKZB 4DJGA 1L4AC 4L75A 1SQXJ 4IOIH 3A0HH 1HUCA 5APVA 3GLMA 2O1JA 1CW5A 2N1TA 4C46A 1PP9D 2E75B 2K37A 3L36A 1RF1B 4WY4C 1HJ0A 1PFIA 2ZVNB 1OVUA 1NH4A 2M8RA 4KHXA 4N78E 3G6EP 2HLOA 1NTZD 1JY2N 4WB4A 5APTA 1H8AA 1VQ8P 2OTLP 5AVWB 3H1IJ 1BE3J 3PRJA 5AW1B 4Z1MH 1KZUB 2QA4P 3BASA 1A02F 5CCGC 4IFDK 3H1JD 1G1JA 2WSEJ 2G3AA 2ZYGA 3HRNA 3HTKA 3P32A 3A7OA 1SQVG 3KZIE 3RGUA 2OGUA 2XKMA 3AEGC 1YYCA 3WUVA 5AW6B 1L0NG 3WMM0 3A3YB 4MN4C 5AVYB 2WMMA 2B87B 1JEKA 2WVRA 2AXTH 1S4XA 3HUSC 1AJYA 2WTYA 1IFDA 4Y99B 3B5NA 3II6A 1M7LA 1NTKJ 1LWUC 5B5EH 2KXPB 4EDFA 4HYTB 2M5AB 1NGMB 4CPGA 3L72G 2HODA 2KZIA 2R5DA 1L4AA 1JY2O 3V2NA 4I1LA 1JOCA 1NTKK 2IYOA 2IYPA 3VMAA 3SFDC 5AW3B 1CI6B 4H44B 1N7SA 1FZCA 4TLFA 4WY4A 1PPJE 4UB8H 1W2BO 1FDIA 2D2CB 1KFMA 2M3EA 3W68A 4NPEA 2NPSD 4WWIA 1ZOYC 5E79E 3CWBG 2Y0EA 3S1KA 3SFEC 4H0LB 3PLNA 1SQQE 4PJ0E 4N78D 3MD0A 2FYUJ 5CCGA 1PGPA 4XFJA 2YMYA 2R3CA 2FYNB 4UB6E 4JQ0D 5AVUB 5APUA 1YQ4C 2Q7CA 4AYCA 2HPCA 1LTJC 5B66H 4BWNA 3CCVP 4ASVA 3FXDA 2WPSA 2AEJA 3KDPB 1VPCA 3HUSA 1AFOA 3HE5B 5DJUB 2SPZA 1BGYG 4H13D 5DJTB 1N7LA 1LWUA 5AW7B 1VF5B 1NWQA 1LP1B 3TK1A 1GU4A 5KKZC 2LR2A 2YNYA 1SQPK 1KN7A 3CI9A 3CX5E 2YKQA 1R5LA 1N2DC 4IL6E 5H2FH 4IFFA 3VMYA 4D6TJ 2E75C 1K73Q 1JO5A 1ZMEC 3L35A 2W83C 1U57A 2ZAEB 3RL0C 3M9QA 1NKNA 3TSIA 1YTZI 1OXZA 2WSCH 2IFNA 2Q9IA 2Q1KA 1CSBA 3I5CA 1LTTC 5AVSB 3Q5RA 1M90Q 2H89C 1USEA 1PPJD 3AE7C 2IBZG 5APYA 2B89A 4JYBA 4N6JA 2GUSA 1NTZK 1OWAA 3T97A 4B86A 2BCCE 1HVVA 1SQVE 3HTKB 1SQQD 4GT1A 2JEEA 3AE4C 3CC4P 1X8YA 3PP5A 1AVOA 3G4SP 3HD7D 1VQPP 1IK7A 1GL2D 3B5NB 4GKGA 4H44D 4ZNCA 3W67A 1AVYA 3C8VA 3U1AA 3L72E 1KFNA 3M0AA 3CCLP 4PD4I 1XTCC 1NYHA 1L0LJ 3I55P 1RY3A 2K88A 1JMMA 1VQOP 1N7SB 5AVXB 1FZCB 4DZOA 1YTZT 4WY4B 5GTHE 4WVZA 2D2CC 2A06G 1L0LK 1PGOA 1HJBA 2WSCJ 3BATA 2P2UA 4JYCA 5GTIE 3CX5D 3ZDMA 2P1JA 2OARA 3CWBE 4JPZB 2FBWC 2NRGA 1XTGB 2H7HA 2C9NY 1LJ2A 2ZT9C 1JCDA 1RE3C 3JCUH 5KAIE 5KLIC 3Q1MA 1AV1A 1U7MA 2M3BA 4EYYQ 3EFFK 1GK4A 3GHGA 5TISH 1R8EA 1QGKB 4LC1A 1BCCJ 2H43A 3GG2A 1OVVA 1NU1D 4IFMA 4PD4E 1VQ5P 3L74J 2HPCB 2IBZI 1PGJA 2E74B 3H6PA 2Q3IA 2Z4EA 4EIJA 3LIEA 5CBOA 3HUSB 1BGYE 5CJ0A 3L73E 2BCCD 1EDJA 1SQVD 1VF5C 1VQ6P 2N1TD 2M5AA 1LT1A 2QM7A 2QJPC 5AW8B 4K35A 3CCMP 4EOTA 1KB9H 1S5LX 1A02J 1M8OB 1GD2E 1CI6A 2W8ZA 1QL1A 5AW5B 3TGUG 1EC5A 2JKVA 3L72D 1RH5B 1U7JA 3AE9C 3FWLA 1P84D 3F5HA 2QIWA 1OMIA 4AUWA 2QG4A 1RQVA 4XE5B 2I1KA 1LTAC 3CC7P 1SFCC 2L5GB 1NKZB 3N4XA 5KJ7C 1MUUA 1EXJA 2IBZE 2K9YA 3AECC 1T8ZA 2JWAA 4KJMA 2QJYB 2YXRB 3CWBD 1AQ5A 1RQUA 3GF3A 3T97B 1KORA 1SQBG 5BU5A 5KLVG 1H89A 4R4LA 5AVTB 2FYZA 1L4AD 3L70G 1FDMA 2KUBA 3HE5A 5AW4B 1EXIA 3U59A 3B5NC 1SQXG 1ZW0A 2P10A 2W27A 3GW6A 4L74A 1SLQA 4PD4D 1ZLLA 1HBWA 1SQQK 1J2JB 4WY4D 1ZV8A 1Z56A 1S72P 4OWFA 1BGYD 3EFGA 3L73D 2CK3H 1N7SC 3O6QB 5AW2B 2I8DA 3A2AA 1FZCC 1FZEA 2N9YB 2JDIH 2MJZA 2A06E 4PV1B 2RH0A 3RL0B 3VMXA 2PAJA 3H1IG 1BE3G 5CCGD 1NAYA 5TJHA 3AEBC 1KD1Q 1ZP0C 4BRYB 1SFCA 3FX0A 1K04A 2ZYDA 5KJ7A 1NU1G 3D6ZA 1JY3P 3AEFC 2H8PD 4RJTA 3CD6P 1S3JA 2HR3A 1NTMJ 3M9HA 3GHGB 3V2QA 2QEXP 1BSHA 2BCCG 1NTMK 1YJNP 2IBZD 4U3FJ 4NPFX 2E74C 1GW3A 2R5BA 2GA1A 3ABVC 2R32A 4M3LA 1IFNA 3FWNA 2XNDH 3E7KA 1K8AQ 3RK2B 1L0NJ 1M56D 1H0TB 1IJDB 2JR8A 1UIIA 1IZNB 1BSNA 3TGUE 1G2CB 1L0NK 2OQQA 3H1LJ 2IFMA 1QVGO 3H1HJ 4L73A 2FYUG 3CX5I 3C1LA 1OIPA 2ZT9B 4GODA 3CXHI 5KLIB 2A06D 2A45H 2YKOA 3PTZA 2QJYC 1KILC 3Q2YA 2C0XA 2QM8A 2XV5A 3H1KD 4OGQB 1JTHB 3L75E 5CHXA 1LT9B 1M1JA 3WU2E 1SQBE 3L71J 5KLVE 3Q5SA 3A0BH 4KT0J 2DW3A 1K9MQ 1G1IA 2JJLA 1E79H 2P58A 3L70E 3AE2C 3CC2P 1SQPJ 3CCRP 1T3JA 2KOGA 2C0WA 1SQXE 1S5LE 2CPBA 3L73G 5CCHC 3BCCD 2PFXA 2E75D 1GK6A 3SWFA 2KLVA 5BU8B 1YITP 2QJPB 4GDOA 3M06A 4D6TG 1S1CX 4DCKA 2QE7H 4YTPC 3RL0D 2KI7B 5KAFE 1IFMA 2LXCB 1SP4A 3CXHE 3AE8C 3K5BA 3NXSA 4WBAA 5AVVB 3VTPC 1WRGA 1KMIZ 1EDIA 4PV1C 2KNCA 1T2KC 1PP9J 1JCCA 2WPRA 3TYYA 4QMAA 1GDTA 2XU6A 3H1IE 3B71A 1BE3E 3MUDC 1EZVE 3AE3C 1YHQP 4JF7A 3CCJP 1FC2C 3D71A 1P84I 3TGUD 2Q3EA 1NTZJ 1MZ9A 1DEBA 2AEMA 3P8MC 1NU1E 1SFCB 3IFMA 3M0DC 1LTSC 3V2PA 1T6AA 1KILA 2BEZF 3GHGC 2K1AA 2MKVA 1NO4A 1KYOE 2FY8A 1NVOA 1FZAA 1VQ7P 3H1JJ 2R3SA 1AA0A 2NPSA 5APQA 1JNMA 1PIXA 2CPSA 1NTKE 1QLED 3TDKA 5EFWB 3L75D 4I6MC 5AVQB 5BVZA 5CCHA 3KYQA 1SQBD 3A0HE 1EDLA 5KLVD 1L0LG 1KQGB 3TNUA 1VQNP 2R44A 2W6JH 3RK2C 2KK7A 3KZIH 2D2CD 3L70D 3RBXA 1URQC 1P84E 1X79B 2E76B 2WT7A 1SQXD 4A7PA 3O6QA 3KHUA 1IO4A 2ZT9D 4H0LD 4RESB 1Q86Q 2FFDB 2KS1B 3O8ZA 2BEQD 3AEEC 3F89A 1KQFB 3MUDA 2FYUE 3CXHD 3H1KG 2KSJA 1USDA 1OW8A 3KXDA 2YO2A 5APXA 4BRYA 3RBZA 4RKUJ 4GIFA 3V2RA 3M0DA 1X22A 1N8RQ 4I2LC 5CBNA 1X0TA 5K5GB 1BDCA 3H1ID 1BE3D 1EZVD 2KYVA 1T3UA 2RN0A 4OGQC 2YIUB 4XA4A 3L74G 1N73B 1GW4A 1LT9C 1QL2A 1BDDA 2J5UA 3LIDA 3D70A 2AXTE 1M1JB 3BCCG 1M1KQ 1JY3N 5E79H 5APWA 3MGNA 1VF5D 3ITKA 2QVAA 2KLUA 1NHLA 1RHZB 3VOPA 5B5EE 4PJ0H 4EI2A 1IK9A 3CCSP 2ZYAA 1KYOD 3AE1C 3I56P 1R5SA 2PRRA 3VN0A 4GOFA 4UB6H 2ZJSE 1RE4C 1Y47A 3S9OA 3BRVB 3AE5C 4D6TE 4W80A 3OJAB 3WU2H 1NTKD 2FKWB 1H0TA 1L2PA 1QX8A 1URQA 2B88A 2LKMA 4UB8E 3HE4B 1VQKP 2WZ7A 2PGDA 1G2CA 1Y8AA 1FOSF 1SS1A 2BASA 1SFCD 2KNCB 5KJ7D 2ZXEB 2G8YA 3CCUP 4YXWH 2C9LY 1LGHB 1E5WA 4HKZH 5KTBA 1KTMA 1JY3O 1KQLA 2YKPA 3CX5H 4IL6H 1FOSE 1FDOA 3LW5H 2WSFH 2V7QH 3OW2O 3IAOA 2J59M 3MIWA 1IC2A 3WUUA 3G3ZA 1KILB 3PJSK 1LTIC 1JTHA 2FYUD 5B66E 3QWOC 2KB7P 1LT9A 3L75G 4N3YB 1KC8Q 3KQGA 3SWYA 1JMBA 1VQ9P 3B5ND 1X9VA 2J58A 5C39A 4AQRD 3CMAP 4C7NB 2NPSB 1PV3A 1SQQJ 1FJPA 5L8RJ 3RK3C 2FXMA 4ZMDA 1VDFA 2JP3A 2Y9YA 1NOHA 1L0LE 1RE4A 3UIAA 1N7SD 2E43A 1JB0J 4NPDA 3TNUB 3WUTA 2WPVB 3CCEP 1SVFA 2E76C 1HGVA 1W2EA 3GF7A 2WT7B 3V5BA 4LLHA 1YJWP 1JM0A 4BXLA 5KLVK 1KQSO 4D6TD 2FFDC 2NZ2A 3CPWO 3E1RA 4H13B 2K9JA 1EZVG 3H1KE 4JBZA 1SQXK 1FZFA 1YIJP 1P84H 1NTMG 2KIKA 2JWDA 1HF9A 3LW5J 2WSFJ 1HWTC 2V7QJ 3NMDA 4L76A 1BCCE 2OYOA 3USSA 1H88A 1DX7A 5GTHH 3IR9A 2YIUC 1N73C 2Z5HA 3IN6A 2E74D 3L74E 3V4WA 1FU1A 4U3FG 1D7MA 5GTIH 4OH8B 3SSUA 2Y9ZA 1M1JC 2OYHC 2OTJP 3BCCE 1JUNA 2N9BA 1LNQA 1LTGC 5KAIH 2YMKA 1NTKG 1NU1J 3P8CE 2OYIC 3M9BA 1NU1K 1GMJA 3H32B 2BCCJ 1SQVJ 2IDBA 4PD4H 4YPCA 1URQB 4I7ZC 3H1LG 3A5TA 3L4FA 1M57D 2Q5UA 1IFJA 1CZQA 1S2EA 2PP6A 2VRSA 1L0LD 1SQVK 3H1HG 2FFDA 2KS1A 1KB9I 3BRTB 3HD7B 3JCUE 1J1EB 1GL2B 3N7NA 3L72J 1KILD 2O01H 3Q5PA 4DT0A 1IFIA 2QJKC 3NFQA 3AE6C 5TISE 3GMAA 3PH0A 1GTWA 2P67A 5APSA 1OX3A 1OW6A 2OTKE
chains in the Genus database with same CATH topology
2O1JA 1CW5A 2NPSA 1HGZA 3EQ2A 3OAKA 2N1TA 5APQA 4C46A 2N1TD 1JNMA 2E42A 2CPSA 3L36A 2QM7A 1RF1B 5AW8B 4WY4C 1N73A 1PFIA 4ZKPA 1NH4A 2M8RA 2WWWA 3R2PA 4KHXA 4EOTA 4N78E 2OYHA 3P7KA 4I6MC 3L37A 5AVQB 2GM4A 5BVZA 2HLOA 5CCHA 1A02J 5CCHD 3KYQA 2NPSC 1CI6A 1JY2N 1GD2E 1QL1A 1WT6A 3TNUA 5AW5B 2O1KA 4WB4A 5APTA 1H8AA 3RK2C 5AVWB 2OYIA 2FYUK 1URQC 1FBMA 5AW1B 1KZUB 1X79B 3BASA 2WT7A 1A02F 4AUWA 2Z5IA 5CCGC 4IFDK 1IO4A 4XE5B 1G1JA 2I1KA 1LTAC 1SFCC 2L5GB 2W6AA 3P8CD 1NKZB 4RESB 3N4XA 3HRNA 1J1DB 2FFDB 5KJ7C 3E1IA 3O8ZA 1MUUA 3HTKA 1T2KD 3HE4A 3P32A 3A7OA 2XKMA 1T8ZA 1YYCA 5AW6B 3MUDA 4W7YA 3WMM0 3A3YB 5AVYB 2KSJA 2YO2A 1GZLA 5APXA 1AQ5A 4GIFA 4ZKUA 2IPPA 3HUSC 1ZR4A 2WTYA 1IFDA 3V2RA 4Y99B 1JY2P 3M0DA 3B5NA 3II6A 1M7LA 5BU5A 1H89A 4I2LC 1LWUC 5AVTB 2A45G 4W7ZA 4HYTB 1RF1C 2N1TB 2HFED 2KYVA 2FYZA 1T3UA 4XA4A 2HODA 3BVHA 2R5DA 1N73B 1L4AA 1L4AD 1GW4A 1JY2O 2POHA 3V2NA 1FDMA 2HYNA 1LT9C 1QL2A 3HE5A 4I1LA 1JOCA 5AW4B 1GU5A 3LIDA 1NTKK 1M1JB 3U59A 3B5NC 1JY3N 2W27A 2HG5D 5APWA 3MGNA 1SLQA 5AW3B 1CI6B 1ZLLA 1HBWA 1N7SA 1SQQK 1FZCA 1J2JB 4O9BA 4WY4A 4WY4D 1NHLA 3VOPA 1IK9A 1ZV8A 1KFMA 1Z56A 3VN0A 4C7NA 2NPSD 3EFGA 1RE4C 1N7SC 5AW2B 3BRVB 3A2AA 1FZCC 1FZEA 4W80A 3OJAB 2MJZA 3RK2D 2FKWB 2KP8A 1URQA 3RL0B 3RK3B 1URQD 1ZN5A 4N78D 2LKMA 3MD0A 1ZR2A 3C9IA 3VMXA 2PAJA 3HE4B 2WZ7A 4C7RA 5CCGA 5CCGD 1LTJA 2YMYA 1G2CA 2R3CA 1FOSF 3KPEA 5AVUB 5APUA 1HTLC 2BASA 2Q7CA 1SFCA 1SFCD 4Y99C 5KJ7A 1JY3P 5KJ7D 2ZXEB 2H8PD 4AYCA 2HPCA 2C9LY 3M9HA 1LTJC 1LGHB 1MV8A 1E5WA 1FZGA 3GHGB 5KTBA 3CL3D 1JY3O 1KQLA 2HODB 2YKPA 3V2QA 1L4AB 2WPSA 1FOSE 3KDPB 3HD7C 1VPCA 1J1EC 3LW5H 2WSFH 3HUSA 1AFOA 3HE5B 1RF0C 5AVZB 1GL2C 2J59M 1NTMK 3MIWA 1IC2A 1N7LA 1LWUA 5AW7B 5CJ4A 1NWQA 3G3ZA 1DH3A 3TK1A 1RF1A 1KILB 1GU4A 2GUVA 1LTIC 1JTHA 1GW3A 2YNYA 1SQPK 2R5BA 2KB7P 2XNXA 1LT9A 4N3YB 3KQGA 3CI9A 3SWYA 2YKQA 1N2DC 2R32A 4M3LA 3B5ND 1X9VA 2J58A 4IFFA 4AQRD 3VMYA 4C7NB 2NPSB 1S9KE 1LTBC 1IFNA 1JO5A 1MFZA 3L35A 1FJPA 2A45I 3RK2B 3RL0C 3M9QA 3RK3C 1NKNA 2FXMA 3TSIA 1YTZI 1OXZA 2WSCH 1IJDB 1VDFA 2IFNA 2Q9IA 2OYHB 1NOHA 3U1CA 1CSBA 3VP9A 1RE4A 3I5CA 3UIAA 1N7SD 1LTTC 5AVSB 2E43A 3TNUB 1G2CB 1L0NK 1FAVA 2P7JA 1SVFA 2OYIB 4HH2A 1FJKA 1HGVA 5AW0B 5APYA 2IFMA 1W2EA 2XZRA 4JYBA 2WT7B 4N6JA 3H32A 3V5BA 4LLHA 2GUSA 1NTZK 1OWAA 5KLVK 3T97A 1J1DC 4B86A 2FFDC 2ZFCA 1HVVA 2A45H 2YKOA 3HTKB 3VP8A 4GT1A 2JEEA 1KILC 1LWUB 3CLQA 2C0XA 2QM8A 2WITA 2XV5A 1SQXK 2XDJA 1FZFA 1X8YA 3VMZA 1JTHB 5AW9B 3PP5A 5CMZA 3HD7A 3HD7D 5CHXA 1HWTC 1LT9B 1M1JA 1RF0A 1GL2A 1GL2D 3NMDA 4DOJA 3B5NB 4GKGA 1H88A 1DX7A 1FZBA 3U1AA 2N1TC 3VYIA 1G1IA 2YO3A 2JJLA 3IR9A 3OA7A 1KFNA 1N73C 2Z5HA 3M0AA 3V4WA 1FU1A 1XTCC 4OH8B 1T3JA 1M1JC 2KOGA 2C0WA 2OYHC 2CPBA 5CCHC 1JUNA 1N86A 1RY3A 1JMMA 2I1JA 2N9BA 1GK6A 5AVRB 1LTGC 1N7SB 3NTNA 3SWFA 5AVXB 2KLVA 5BU8B 1FZCB 2WPQA 1YTZT 4DZOA 4WY4B 3M06A 3P8CE 1RE3A 3B8EB 1L0LK 2OYIC 3M9BA 3RL0D 3RK3D 1HJBA 3V4QA 3BATA 2P2UA 4JYCA 1IFMA 1SP4A 1NAFA 1NU1K 3NXSA 2P1JA 2OARA 3H32B 1S9KD 4WBAA 5AVVB 3VTPC 1WRGA 1XTGB 2H7HA 2C9NY 2WSEH 1JCDA 1RE3C 1EQ7A 4LGDE 1T2KC 1JCCA 2WPRA 1URQB 3TYYA 1GDTA 3A5TA 3L4FA 2M3BA 2XU6A 2IX7C 4JF7A 2Q5UA 1GK4A 1CZQA 1IFJA 2VRSA 2PP6A 1LTJB 3GHGA 1SQVK 3M91A 4LC1A 5CJ0A 1MZ9A 1DEBA 2H43A 1HH0A 2FFDA 3P8MC 2W6BA 1SFCB 3BRTB 3HD7B 1J1EB 3IFMA 3M0DC 1GL2B 1LTSC 4IFMA 3V2PA 3N7NA 3MTUE 1KILA 2HPCB 1KILD 2O01H 3GHGC 1IFIA 1SQBK 1NO4A 3NFQA 1L4AC 3H6PA 2Q3IA 2Z4EA 4EIJA 1FZAA 3LIEA 1GTWA 2P67A 5APSA 3HUSB 1HUCA 5APVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNY A;  3HE5 A;  3IR9 A;  2R5B A;  5AW4 B;  3OAK A;  3LID A;  1GU5 A;  2Z5H A;  5APQ A;  3M0A A;  4C46 A;  3V4W A;  1JNM A;  2E42 A;  2W27 A;  3KQG A;  3L36 A;  2QM7 A;  5AW8 B;  5APW A;  3MGN A;  1SLQ A;  5AW3 B;  1CI6 B;  2R32 A;  1HBW A;  4M3L A;  4AQR D;  1J2J B;  4KHX A;  2WWW A;  3VMY A;  4C7N B;  4EOT A;  1S9K E;  1JUN A;  3P7K A;  4I6M C;  3L37 A;  2N9B A;  5AVQ B;  1MFZ A;  1GK6 A;  3L35 A;  1A02 J;  5AVR B;  1GD2 E;  1CI6 A;  3NTN A;  3SWF A;  5AVX B;  2WPQ A;  3VN0 A;  4DZO A;  3M06 A;  3TNU A;  4C7N A;  1OXZ A;  5AW5 B;  3B8E B;  3M9B A;  5APT A;  5AW2 B;  1H8A A;  1HJB A;  3A2A A;  3V4Q A;  1CSB A;  5AVW B;  2P2U A;  4JYC A;  3I5C A;  3UIA A;  1SP4 A;  5AVS B;  2E43 A;  3TNU B;  5AW1 B;  1G2C B;  2KP8 A;  1NAF A;  3NXS A;  2WT7 A;  1A02 F;  4AUW A;  2Z5I A;  1FAV A;  5AVV B;  3VTP C;  1S9K D;  2H7H A;  3MD0 A;  2P7J A;  3VMX A;  2C9N Y;  3HE4 B;  1IO4 A;  4XE5 B;  5AW0 B;  1T2K C;  5APY A;  2WPR A;  2R3C A;  2XZR A;  4JYB A;  1FOS F;  3TYY A;  2WT7 B;  2W6A A;  3V5B A;  5AVU B;  4RES B;  5APU A;  3A5T A;  1T2K D;  3O8Z A;  1MUU A;  2XU6 A;  3HTK A;  2BAS A;  2Q7C A;  3HE4 A;  3P32 A;  1OWA A;  3A7O A;  2Q5U A;  1GK4 A;  1CZQ A;  2VRS A;  1YYC A;  5AW6 B;  3T97 A;  2ZXE B;  4B86 A;  4AYC A;  3M91 A;  3A3Y B;  4LC1 A;  5AVY B;  2ZFC A;  2C9L Y;  3M9H A;  3P8M C;  1MV8 A;  2YO2 A;  4GT1 A;  1GZL A;  5APX A;  1KQL A;  2IPP A;  2WTY A;  2QM8 A;  2WPS A;  2XV5 A;  1FOS E;  3KDP B;  3M0D A;  2JJL A;  1X8Y A;  3VMZ A;  1H89 A;  5AW9 B;  4I2L C;  3HE5 B;  5AVZ B;  5AVT B;  5CMZ A;  3NFQ A;  4HYT B;  1HWT C;  2Q3I A;  5AW7 B;  3NMD A;  1NWQ A;  2R5D A;  3LIE A;  1DH3 A;  3TK1 A;  1GTW A;  4GKG A;  2P67 A;  1GU4 A;  5APS A;  1H88 A;  3VYI A;  1HUC A;  5APV A;  2YO3 A; 
#chains in the Genus database with same CATH topology
 3H25 A;  3AED C;  1HGZ A;  3EQ2 A;  3OAK A;  1MKM A;  4OVN F;  2E42 A;  3L71 G;  1N73 A;  4ZKP A;  4ASW A;  3S4R A;  3R2P A;  2WWW A;  1EZV I;  2OYH A;  2L91 A;  3P7K A;  3L37 A;  2GM4 A;  3CWB J;  1OW7 A;  5CCH D;  1K05 A;  2NPS C;  1SQP G;  1BCC D;  4U7J A;  1WT6 A;  2YXQ B;  2O1K A;  1Q82 Q;  1FE6 A;  3L74 D;  2UWJ E;  2OYI A;  2FYU K;  1FBM A;  1KYO I;  2Z5I A;  1OVR A;  1KB9 E;  4RO0 A;  2Y0D A;  1Q90 D;  2FXO A;  4PV1 D;  2W6A A;  3P8C D;  1J1D B;  1T2K D;  3E1I A;  2E5T A;  2RKL A;  3HE4 A;  2IZ0 A;  1PP9 G;  1PL5 A;  4W7Y A;  2V4H A;  5M1B A;  1DD3 A;  4GOE A;  1GZL A;  1BGY J;  3L73 J;  4ZKU A;  2IPP A;  1ZR4 A;  1JY2 P;  1NTZ G;  4H13 C;  2A45 G;  2K9J B;  2O01 J;  4W7Z A;  1RF1 C;  2K3R A;  1TU3 F;  2N1T B;  2HFE D;  3BVH A;  3G9R A;  1NTM E;  2JO1 A;  3JC2 2;  2O3J A;  3G71 P;  1NJI Q;  1YI2 P;  2POH A;  2HYN A;  2KZJ A;  1GU5 A;  2AXC A;  1W5C E;  2HG5 D;  4YXD C;  1YQ3 C;  3H1J G;  4O9B A;  4U3F E;  2Q6Q A;  1PGQ A;  4HJG H;  4C7N A;  2E5Y A;  1MFT A;  3MHV A;  3RK2 D;  2FXP A;  2KP8 A;  1EDK A;  2IZ1 A;  3RK3 B;  1URQ D;  1ZN5 A;  1ZR2 A;  3C9I A;  3QH9 A;  4C7R A;  1L0N E;  1LTJ A;  2WQY C;  2QSI A;  3KPE A;  2M0B A;  3CME P;  1HTL C;  1PZQ A;  4Y99 C;  3H1L E;  2WSS H;  1MV8 A;  3FGA D;  1VL2 A;  1FZG A;  1AQT A;  1KB9 D;  3CL3 D;  1DEE G;  2HOD B;  3H1H E;  1L4A B;  3HD7 C;  1J1E C;  5AVZ B;  1RF0 C;  1GL2 C;  4H44 C;  1KV4 A;  5CJ4 A;  1DH3 A;  1RF1 A;  1QVF O;  2GUV A;  4OGQ D;  3SWK A;  3RK3 E;  4HB1 A;  2XNX A;  1OFC X;  1QEX A;  2B9B A;  1BCC G;  4TT3 H;  3EWK A;  1WMK A;  1S9K E;  1LTB C;  3L71 E;  3PHL A;  1MFZ A;  4H0L C;  1NTM D;  2A45 I;  1ZRT E;  3H1K J;  1Q81 Q;  2OYH B;  3U1C A;  1SQP E;  2AEF A;  3VP9 A;  2W90 A;  2FYN C;  3V6I A;  3Q3D A;  3MZW B;  1FAV A;  2P7J A;  2RMZ A;  4U3F D;  2OYI B;  4HH2 A;  1FJK A;  5AW0 B;  2LXB A;  2XZR A;  3H32 A;  3D6Y A;  2B87 A;  2Y0C A;  3BCC J;  1J1D C;  2ZXX A;  1ZXG A;  2ZFC A;  3R4Y A;  3VP8 A;  4I7Z B;  3FXE A;  1PP9 E;  1LWU B;  1L0N D;  3CLQ A;  2WIT A;  3CCQ P;  2XDJ A;  3VMZ A;  5AW9 B;  5CMZ A;  1S5L H;  3HD7 A;  1RF0 A;  1NTZ E;  1GL2 A;  3TF5 A;  1UIX A;  4DOJ A;  3H1L D;  1FZB A;  1IFP A;  2N1T C;  3VYI A;  2YO3 A;  3MP7 B;  3OA7 A;  2QJK B;  3B4S A;  4K3A A;  5KAF H;  1Q2N A;  1PPJ G;  3H1H D;  3CXH H;  1VQM P;  4IL6 X;  3TGU J;  1N86 A;  2I1J A;  1VQ4 P;  3H1J E;  5AVR B;  3A0B E;  3NTN A;  2WPQ A;  1RE3 A;  3B8E B;  2O01 N;  3RK3 D;  1SQQ G;  2QRX A;  3V4Q A;  1DIP A;  1Q7Y Q;  1FS0 E;  3IF4 A;  1OZH A;  1NAF A;  1YBK A;  1S9K D;  2ITA A;  3L71 D;  2WSE H;  1EQ7 A;  4LGD E;  1Y9B A;  3JSV C;  1VQL P;  2E76 D;  1ZRT D;  2KSE A;  2IX7 C;  1KYO H;  4R4M A;  5H2F E;  1SQP D;  1LTJ B;  3L75 J;  4Y28 J;  3M91 A;  1SQB J;  1DD4 A;  5KLV J;  1HH0 A;  2W6B A;  3AEA C;  2ZVO B;  1KIL E;  2H88 C;  1LP1 A;  3MTU E;  1YJ9 P;  3RL0 g;  3L70 J;  1SQB K;  5KKZ B;  4DJG A;  1L4A C;  4L75 A;  1SQX J;  4IOI H;  3A0H H;  1HUC A;  5APV A;  3GLM A;  2O1J A;  1CW5 A;  2N1T A;  4C46 A;  1PP9 D;  2E75 B;  2K37 A;  3L36 A;  1RF1 B;  4WY4 C;  1HJ0 A;  1PFI A;  2ZVN B;  1OVU A;  1NH4 A;  2M8R A;  4KHX A;  4N78 E;  3G6E P;  2HLO A;  1NTZ D;  1JY2 N;  4WB4 A;  5APT A;  1H8A A;  1VQ8 P;  2OTL P;  5AVW B;  3H1I J;  1BE3 J;  3PRJ A;  5AW1 B;  4Z1M H;  1KZU B;  2QA4 P;  3BAS A;  1A02 F;  5CCG C;  4IFD K;  3H1J D;  1G1J A;  2WSE J;  2G3A A;  2ZYG A;  3HRN A;  3HTK A;  3P32 A;  3A7O A;  1SQV G;  3KZI E;  3RGU A;  2OGU A;  2XKM A;  3AEG C;  1YYC A;  3WUV A;  5AW6 B;  1L0N G;  3WMM 0;  3A3Y B;  4MN4 C;  5AVY B;  2WMM A;  2B87 B;  1JEK A;  2WVR A;  2AXT H;  1S4X A;  3HUS C;  1AJY A;  2WTY A;  1IFD A;  4Y99 B;  3B5N A;  3II6 A;  1M7L A;  1NTK J;  1LWU C;  5B5E H;  2KXP B;  4EDF A;  4HYT B;  2M5A B;  1NGM B;  4CPG A;  3L72 G;  2HOD A;  2KZI A;  2R5D A;  1L4A A;  1JY2 O;  3V2N A;  4I1L A;  1JOC A;  1NTK K;  2IYO A;  2IYP A;  3VMA A;  3SFD C;  5AW3 B;  1CI6 B;  4H44 B;  1N7S A;  1FZC A;  4TLF A;  4WY4 A;  1PPJ E;  4UB8 H;  1W2B O;  1FDI A;  2D2C B;  1KFM A;  2M3E A;  3W68 A;  4NPE A;  2NPS D;  4WWI A;  1ZOY C;  5E79 E;  3CWB G;  2Y0E A;  3S1K A;  3SFE C;  4H0L B;  3PLN A;  1SQQ E;  4PJ0 E;  4N78 D;  3MD0 A;  2FYU J;  5CCG A;  1PGP A;  4XFJ A;  2YMY A;  2R3C A;  2FYN B;  4UB6 E;  4JQ0 D;  5AVU B;  5APU A;  1YQ4 C;  2Q7C A;  4AYC A;  2HPC A;  1LTJ C;  5B66 H;  4BWN A;  3CCV P;  4ASV A;  3FXD A;  2WPS A;  2AEJ A;  3KDP B;  1VPC A;  3HUS A;  1AFO A;  3HE5 B;  5DJU B;  2SPZ A;  1BGY G;  4H13 D;  5DJT B;  1N7L A;  1LWU A;  5AW7 B;  1VF5 B;  1NWQ A;  1LP1 B;  3TK1 A;  1GU4 A;  5KKZ C;  2LR2 A;  2YNY A;  1SQP K;  1KN7 A;  3CI9 A;  3CX5 E;  2YKQ A;  1R5L A;  1N2D C;  4IL6 E;  5H2F H;  4IFF A;  3VMY A;  4D6T J;  2E75 C;  1K73 Q;  1JO5 A;  1ZME C;  3L35 A;  2W83 C;  1U57 A;  2ZAE B;  3RL0 C;  3M9Q A;  1NKN A;  3TSI A;  1YTZ I;  1OXZ A;  2WSC H;  2IFN A;  2Q9I A;  2Q1K A;  1CSB A;  3I5C A;  1LTT C;  5AVS B;  3Q5R A;  1M90 Q;  2H89 C;  1USE A;  1PPJ D;  3AE7 C;  2IBZ G;  5APY A;  2B89 A;  4JYB A;  4N6J A;  2GUS A;  1NTZ K;  1OWA A;  3T97 A;  4B86 A;  2BCC E;  1HVV A;  1SQV E;  3HTK B;  1SQQ D;  4GT1 A;  2JEE A;  3AE4 C;  3CC4 P;  1X8Y A;  3PP5 A;  1AVO A;  3G4S P;  3HD7 D;  1VQP P;  1IK7 A;  1GL2 D;  3B5N B;  4GKG A;  4H44 D;  4ZNC A;  3W67 A;  1AVY A;  3C8V A;  3U1A A;  3L72 E;  1KFN A;  3M0A A;  3CCL P;  4PD4 I;  1XTC C;  1NYH A;  1L0L J;  3I55 P;  1RY3 A;  2K88 A;  1JMM A;  1VQO P;  1N7S B;  5AVX B;  1FZC B;  4DZO A;  1YTZ T;  4WY4 B;  5GTH E;  4WVZ A;  2D2C C;  2A06 G;  1L0L K;  1PGO A;  1HJB A;  2WSC J;  3BAT A;  2P2U A;  4JYC A;  5GTI E;  3CX5 D;  3ZDM A;  2P1J A;  2OAR A;  3CWB E;  4JPZ B;  2FBW C;  2NRG A;  1XTG B;  2H7H A;  2C9N Y;  1LJ2 A;  2ZT9 C;  1JCD A;  1RE3 C;  3JCU H;  5KAI E;  5KLI C;  3Q1M A;  1AV1 A;  1U7M A;  2M3B A;  4EYY Q;  3EFF K;  1GK4 A;  3GHG A;  5TIS H;  1R8E A;  1QGK B;  4LC1 A;  1BCC J;  2H43 A;  3GG2 A;  1OVV A;  1NU1 D;  4IFM A;  4PD4 E;  1VQ5 P;  3L74 J;  2HPC B;  2IBZ I;  1PGJ A;  2E74 B;  3H6P A;  2Q3I A;  2Z4E A;  4EIJ A;  3LIE A;  5CBO A;  3HUS B;  1BGY E;  5CJ0 A;  3L73 E;  2BCC D;  1EDJ A;  1SQV D;  1VF5 C;  1VQ6 P;  2N1T D;  2M5A A;  1LT1 A;  2QM7 A;  2QJP C;  5AW8 B;  4K35 A;  3CCM P;  4EOT A;  1KB9 H;  1S5L X;  1A02 J;  1M8O B;  1GD2 E;  1CI6 A;  2W8Z A;  1QL1 A;  5AW5 B;  3TGU G;  1EC5 A;  2JKV A;  3L72 D;  1RH5 B;  1U7J A;  3AE9 C;  3FWL A;  1P84 D;  3F5H A;  2QIW A;  1OMI A;  4AUW A;  2QG4 A;  1RQV A;  4XE5 B;  2I1K A;  1LTA C;  3CC7 P;  1SFC C;  2L5G B;  1NKZ B;  3N4X A;  5KJ7 C;  1MUU A;  1EXJ A;  2IBZ E;  2K9Y A;  3AEC C;  1T8Z A;  2JWA A;  4KJM A;  2QJY B;  2YXR B;  3CWB D;  1AQ5 A;  1RQU A;  3GF3 A;  3T97 B;  1KOR A;  1SQB G;  5BU5 A;  5KLV G;  1H89 A;  4R4L A;  5AVT B;  2FYZ A;  1L4A D;  3L70 G;  1FDM A;  2KUB A;  3HE5 A;  5AW4 B;  1EXI A;  3U59 A;  3B5N C;  1SQX G;  1ZW0 A;  2P10 A;  2W27 A;  3GW6 A;  4L74 A;  1SLQ A;  4PD4 D;  1ZLL A;  1HBW A;  1SQQ K;  1J2J B;  4WY4 D;  1ZV8 A;  1Z56 A;  1S72 P;  4OWF A;  1BGY D;  3EFG A;  3L73 D;  2CK3 H;  1N7S C;  3O6Q B;  5AW2 B;  2I8D A;  3A2A A;  1FZC C;  1FZE A;  2N9Y B;  2JDI H;  2MJZ A;  2A06 E;  4PV1 B;  2RH0 A;  3RL0 B;  3VMX A;  2PAJ A;  3H1I G;  1BE3 G;  5CCG D;  1NAY A;  5TJH A;  3AEB C;  1KD1 Q;  1ZP0 C;  4BRY B;  1SFC A;  3FX0 A;  1K04 A;  2ZYD A;  5KJ7 A;  1NU1 G;  3D6Z A;  1JY3 P;  3AEF C;  2H8P D;  4RJT A;  3CD6 P;  1S3J A;  2HR3 A;  1NTM J;  3M9H A;  3GHG B;  3V2Q A;  2QEX P;  1BSH A;  2BCC G;  1NTM K;  1YJN P;  2IBZ D;  4U3F J;  4NPF X;  2E74 C;  1GW3 A;  2R5B A;  2GA1 A;  3ABV C;  2R32 A;  4M3L A;  1IFN A;  3FWN A;  2XND H;  3E7K A;  1K8A Q;  3RK2 B;  1L0N J;  1M56 D;  1H0T B;  1IJD B;  2JR8 A;  1UII A;  1IZN B;  1BSN A;  3TGU E;  1G2C B;  1L0N K;  2OQQ A;  3H1L J;  2IFM A;  1QVG O;  3H1H J;  4L73 A;  2FYU G;  3CX5 I;  3C1L A;  1OIP A;  2ZT9 B;  4GOD A;  3CXH I;  5KLI B;  2A06 D;  2A45 H;  2YKO A;  3PTZ A;  2QJY C;  1KIL C;  3Q2Y A;  2C0X A;  2QM8 A;  2XV5 A;  3H1K D;  4OGQ B;  1JTH B;  3L75 E;  5CHX A;  1LT9 B;  1M1J A;  3WU2 E;  1SQB E;  3L71 J;  5KLV E;  3Q5S A;  3A0B H;  4KT0 J;  2DW3 A;  1K9M Q;  1G1I A;  2JJL A;  1E79 H;  2P58 A;  3L70 E;  3AE2 C;  3CC2 P;  1SQP J;  3CCR P;  1T3J A;  2KOG A;  2C0W A;  1SQX E;  1S5L E;  2CPB A;  3L73 G;  5CCH C;  3BCC D;  2PFX A;  2E75 D;  1GK6 A;  3SWF A;  2KLV A;  5BU8 B;  1YIT P;  2QJP B;  4GDO A;  3M06 A;  4D6T G;  1S1C X;  4DCK A;  2QE7 H;  4YTP C;  3RL0 D;  2KI7 B;  5KAF E;  1IFM A;  2LXC B;  1SP4 A;  3CXH E;  3AE8 C;  3K5B A;  3NXS A;  4WBA A;  5AVV B;  3VTP C;  1WRG A;  1KMI Z;  1EDI A;  4PV1 C;  2KNC A;  1T2K C;  1PP9 J;  1JCC A;  2WPR A;  3TYY A;  4QMA A;  1GDT A;  2XU6 A;  3H1I E;  3B71 A;  1BE3 E;  3MUD C;  1EZV E;  3AE3 C;  1YHQ P;  4JF7 A;  3CCJ P;  1FC2 C;  3D71 A;  1P84 I;  3TGU D;  2Q3E A;  1NTZ J;  1MZ9 A;  1DEB A;  2AEM A;  3P8M C;  1NU1 E;  1SFC B;  3IFM A;  3M0D C;  1LTS C;  3V2P A;  1T6A A;  1KIL A;  2BEZ F;  3GHG C;  2K1A A;  2MKV A;  1NO4 A;  1KYO E;  2FY8 A;  1NVO A;  1FZA A;  1VQ7 P;  3H1J J;  2R3S A;  1AA0 A;  2NPS A;  5APQ A;  1JNM A;  1PIX A;  2CPS A;  1NTK E;  1QLE D;  3TDK A;  5EFW B;  3L75 D;  4I6M C;  5AVQ B;  5BVZ A;  5CCH A;  3KYQ A;  1SQB D;  3A0H E;  1EDL A;  5KLV D;  1L0L G;  1KQG B;  3TNU A;  1VQN P;  2R44 A;  2W6J H;  3RK2 C;  2KK7 A;  3KZI H;  2D2C D;  3L70 D;  3RBX A;  1URQ C;  1P84 E;  1X79 B;  2E76 B;  2WT7 A;  1SQX D;  4A7P A;  3O6Q A;  3KHU A;  1IO4 A;  2ZT9 D;  4H0L D;  4RES B;  1Q86 Q;  2FFD B;  2KS1 B;  3O8Z A;  2BEQ D;  3AEE C;  3F89 A;  1KQF B;  3MUD A;  2FYU E;  3CXH D;  3H1K G;  2KSJ A;  1USD A;  1OW8 A;  3KXD A;  2YO2 A;  5APX A;  4BRY A;  3RBZ A;  4RKU J;  4GIF A;  3V2R A;  3M0D A;  1X22 A;  1N8R Q;  4I2L C;  5CBN A;  1X0T A;  5K5G B;  1BDC A;  3H1I D;  1BE3 D;  1EZV D;  2KYV A;  1T3U A;  2RN0 A;  4OGQ C;  2YIU B;  4XA4 A;  3L74 G;  1N73 B;  1GW4 A;  1LT9 C;  1QL2 A;  1BDD A;  2J5U A;  3LID A;  3D70 A;  2AXT E;  1M1J B;  3BCC G;  1M1K Q;  1JY3 N;  5E79 H;  5APW A;  3MGN A;  1VF5 D;  3ITK A;  2QVA A;  2KLU A;  1NHL A;  1RHZ B;  3VOP A;  5B5E E;  4PJ0 H;  4EI2 A;  1IK9 A;  3CCS P;  2ZYA A;  1KYO D;  3AE1 C;  3I56 P;  1R5S A;  2PRR A;  3VN0 A;  4GOF A;  4UB6 H;  2ZJS E;  1RE4 C;  1Y47 A;  3S9O A;  3BRV B;  3AE5 C;  4D6T E;  4W80 A;  3OJA B;  3WU2 H;  1NTK D;  2FKW B;  1H0T A;  1L2P A;  1QX8 A;  1URQ A;  2B88 A;  2LKM A;  4UB8 E;  3HE4 B;  1VQK P;  2WZ7 A;  2PGD A;  1G2C A;  1Y8A A;  1FOS F;  1SS1 A;  2BAS A;  1SFC D;  2KNC B;  5KJ7 D;  2ZXE B;  2G8Y A;  3CCU P;  4YXW H;  2C9L Y;  1LGH B;  1E5W A;  4HKZ H;  5KTB A;  1KTM A;  1JY3 O;  1KQL A;  2YKP A;  3CX5 H;  4IL6 H;  1FOS E;  1FDO A;  3LW5 H;  2WSF H;  2V7Q H;  3OW2 O;  3IAO A;  2J59 M;  3MIW A;  1IC2 A;  3WUU A;  3G3Z A;  1KIL B;  3PJS K;  1LTI C;  1JTH A;  2FYU D;  5B66 E;  3QWO C;  2KB7 P;  1LT9 A;  3L75 G;  4N3Y B;  1KC8 Q;  3KQG A;  3SWY A;  1JMB A;  1VQ9 P;  3B5N D;  1X9V A;  2J58 A;  5C39 A;  4AQR D;  3CMA P;  4C7N B;  2NPS B;  1PV3 A;  1SQQ J;  1FJP A;  5L8R J;  3RK3 C;  2FXM A;  4ZMD A;  1VDF A;  2JP3 A;  2Y9Y A;  1NOH A;  1L0L E;  1RE4 A;  3UIA A;  1N7S D;  2E43 A;  1JB0 J;  4NPD A;  3TNU B;  3WUT A;  2WPV B;  3CCE P;  1SVF A;  2E76 C;  1HGV A;  1W2E A;  3GF7 A;  2WT7 B;  3V5B A;  4LLH A;  1YJW P;  1JM0 A;  4BXL A;  5KLV K;  1KQS O;  4D6T D;  2FFD C;  2NZ2 A;  3CPW O;  3E1R A;  4H13 B;  2K9J A;  1EZV G;  3H1K E;  4JBZ A;  1SQX K;  1FZF A;  1YIJ P;  1P84 H;  1NTM G;  2KIK A;  2JWD A;  1HF9 A;  3LW5 J;  2WSF J;  1HWT C;  2V7Q J;  3NMD A;  4L76 A;  1BCC E;  2OYO A;  3USS A;  1H88 A;  1DX7 A;  5GTH H;  3IR9 A;  2YIU C;  1N73 C;  2Z5H A;  3IN6 A;  2E74 D;  3L74 E;  3V4W A;  1FU1 A;  4U3F G;  1D7M A;  5GTI H;  4OH8 B;  3SSU A;  2Y9Z A;  1M1J C;  2OYH C;  2OTJ P;  3BCC E;  1JUN A;  2N9B A;  1LNQ A;  1LTG C;  5KAI H;  2YMK A;  1NTK G;  1NU1 J;  3P8C E;  2OYI C;  3M9B A;  1NU1 K;  1GMJ A;  3H32 B;  2BCC J;  1SQV J;  2IDB A;  4PD4 H;  4YPC A;  1URQ B;  4I7Z C;  3H1L G;  3A5T A;  3L4F A;  1M57 D;  2Q5U A;  1IFJ A;  1CZQ A;  1S2E A;  2PP6 A;  2VRS A;  1L0L D;  1SQV K;  3H1H G;  2FFD A;  2KS1 A;  1KB9 I;  3BRT B;  3HD7 B;  3JCU E;  1J1E B;  1GL2 B;  3N7N A;  3L72 J;  1KIL D;  2O01 H;  3Q5P A;  4DT0 A;  1IFI A;  2QJK C;  3NFQ A;  3AE6 C;  5TIS E;  3GMA A;  3PH0 A;  1GTW A;  2P67 A;  5APS A;  1OX3 A;  1OW6 A;  2OTK E; 
#chains in the Genus database with same CATH homology
 2O1J A;  1CW5 A;  2NPS A;  1HGZ A;  3EQ2 A;  3OAK A;  2N1T A;  5APQ A;  4C46 A;  2N1T D;  1JNM A;  2E42 A;  2CPS A;  3L36 A;  2QM7 A;  1RF1 B;  5AW8 B;  4WY4 C;  1N73 A;  1PFI A;  4ZKP A;  1NH4 A;  2M8R A;  2WWW A;  3R2P A;  4KHX A;  4EOT A;  4N78 E;  2OYH A;  3P7K A;  4I6M C;  3L37 A;  5AVQ B;  2GM4 A;  5BVZ A;  2HLO A;  5CCH A;  1A02 J;  5CCH D;  3KYQ A;  2NPS C;  1CI6 A;  1JY2 N;  1GD2 E;  1QL1 A;  1WT6 A;  3TNU A;  5AW5 B;  2O1K A;  4WB4 A;  5APT A;  1H8A A;  3RK2 C;  5AVW B;  2OYI A;  2FYU K;  1URQ C;  1FBM A;  5AW1 B;  1KZU B;  1X79 B;  3BAS A;  2WT7 A;  1A02 F;  4AUW A;  2Z5I A;  5CCG C;  4IFD K;  1IO4 A;  4XE5 B;  1G1J A;  2I1K A;  1LTA C;  1SFC C;  2L5G B;  2W6A A;  3P8C D;  1NKZ B;  4RES B;  3N4X A;  3HRN A;  1J1D B;  2FFD B;  5KJ7 C;  3E1I A;  3O8Z A;  1MUU A;  3HTK A;  1T2K D;  3HE4 A;  3P32 A;  3A7O A;  2XKM A;  1T8Z A;  1YYC A;  5AW6 B;  3MUD A;  4W7Y A;  3WMM 0;  3A3Y B;  5AVY B;  2KSJ A;  2YO2 A;  1GZL A;  5APX A;  1AQ5 A;  4GIF A;  4ZKU A;  2IPP A;  3HUS C;  1ZR4 A;  2WTY A;  1IFD A;  3V2R A;  4Y99 B;  1JY2 P;  3M0D A;  3B5N A;  3II6 A;  1M7L A;  5BU5 A;  1H89 A;  4I2L C;  1LWU C;  5AVT B;  2A45 G;  4W7Z A;  4HYT B;  1RF1 C;  2N1T B;  2HFE D;  2KYV A;  2FYZ A;  1T3U A;  4XA4 A;  2HOD A;  3BVH A;  2R5D A;  1N73 B;  1L4A A;  1L4A D;  1GW4 A;  1JY2 O;  2POH A;  3V2N A;  1FDM A;  2HYN A;  1LT9 C;  1QL2 A;  3HE5 A;  4I1L A;  1JOC A;  5AW4 B;  1GU5 A;  3LID A;  1NTK K;  1M1J B;  3U59 A;  3B5N C;  1JY3 N;  2W27 A;  2HG5 D;  5APW A;  3MGN A;  1SLQ A;  5AW3 B;  1CI6 B;  1ZLL A;  1HBW A;  1N7S A;  1SQQ K;  1FZC A;  1J2J B;  4O9B A;  4WY4 A;  4WY4 D;  1NHL A;  3VOP A;  1IK9 A;  1ZV8 A;  1KFM A;  1Z56 A;  3VN0 A;  4C7N A;  2NPS D;  3EFG A;  1RE4 C;  1N7S C;  5AW2 B;  3BRV B;  3A2A A;  1FZC C;  1FZE A;  4W80 A;  3OJA B;  2MJZ A;  3RK2 D;  2FKW B;  2KP8 A;  1URQ A;  3RL0 B;  3RK3 B;  1URQ D;  1ZN5 A;  4N78 D;  2LKM A;  3MD0 A;  1ZR2 A;  3C9I A;  3VMX A;  2PAJ A;  3HE4 B;  2WZ7 A;  4C7R A;  5CCG A;  5CCG D;  1LTJ A;  2YMY A;  1G2C A;  2R3C A;  1FOS F;  3KPE A;  5AVU B;  5APU A;  1HTL C;  2BAS A;  2Q7C A;  1SFC A;  1SFC D;  4Y99 C;  5KJ7 A;  1JY3 P;  5KJ7 D;  2ZXE B;  2H8P D;  4AYC A;  2HPC A;  2C9L Y;  3M9H A;  1LTJ C;  1LGH B;  1MV8 A;  1E5W A;  1FZG A;  3GHG B;  5KTB A;  3CL3 D;  1JY3 O;  1KQL A;  2HOD B;  2YKP A;  3V2Q A;  1L4A B;  2WPS A;  1FOS E;  3KDP B;  3HD7 C;  1VPC A;  1J1E C;  3LW5 H;  2WSF H;  3HUS A;  1AFO A;  3HE5 B;  1RF0 C;  5AVZ B;  1GL2 C;  2J59 M;  1NTM K;  3MIW A;  1IC2 A;  1N7L A;  1LWU A;  5AW7 B;  5CJ4 A;  1NWQ A;  3G3Z A;  1DH3 A;  3TK1 A;  1RF1 A;  1KIL B;  1GU4 A;  2GUV A;  1LTI C;  1JTH A;  1GW3 A;  2YNY A;  1SQP K;  2R5B A;  2KB7 P;  2XNX A;  1LT9 A;  4N3Y B;  3KQG A;  3CI9 A;  3SWY A;  2YKQ A;  1N2D C;  2R32 A;  4M3L A;  3B5N D;  1X9V A;  2J58 A;  4IFF A;  4AQR D;  3VMY A;  4C7N B;  2NPS B;  1S9K E;  1LTB C;  1IFN A;  1JO5 A;  1MFZ A;  3L35 A;  1FJP A;  2A45 I;  3RK2 B;  3RL0 C;  3M9Q A;  3RK3 C;  1NKN A;  2FXM A;  3TSI A;  1YTZ I;  1OXZ A;  2WSC H;  1IJD B;  1VDF A;  2IFN A;  2Q9I A;  2OYH B;  1NOH A;  3U1C A;  1CSB A;  3VP9 A;  1RE4 A;  3I5C A;  3UIA A;  1N7S D;  1LTT C;  5AVS B;  2E43 A;  3TNU B;  1G2C B;  1L0N K;  1FAV A;  2P7J A;  1SVF A;  2OYI B;  4HH2 A;  1FJK A;  1HGV A;  5AW0 B;  5APY A;  2IFM A;  1W2E A;  2XZR A;  4JYB A;  2WT7 B;  4N6J A;  3H32 A;  3V5B A;  4LLH A;  2GUS A;  1NTZ K;  1OWA A;  5KLV K;  3T97 A;  1J1D C;  4B86 A;  2FFD C;  2ZFC A;  1HVV A;  2A45 H;  2YKO A;  3HTK B;  3VP8 A;  4GT1 A;  2JEE A;  1KIL C;  1LWU B;  3CLQ A;  2C0X A;  2QM8 A;  2WIT A;  2XV5 A;  1SQX K;  2XDJ A;  1FZF A;  1X8Y A;  3VMZ A;  1JTH B;  5AW9 B;  3PP5 A;  5CMZ A;  3HD7 A;  3HD7 D;  5CHX A;  1HWT C;  1LT9 B;  1M1J A;  1RF0 A;  1GL2 A;  1GL2 D;  3NMD A;  4DOJ A;  3B5N B;  4GKG A;  1H88 A;  1DX7 A;  1FZB A;  3U1A A;  2N1T C;  3VYI A;  1G1I A;  2YO3 A;  2JJL A;  3IR9 A;  3OA7 A;  1KFN A;  1N73 C;  2Z5H A;  3M0A A;  3V4W A;  1FU1 A;  1XTC C;  4OH8 B;  1T3J A;  1M1J C;  2KOG A;  2C0W A;  2OYH C;  2CPB A;  5CCH C;  1JUN A;  1N86 A;  1RY3 A;  1JMM A;  2I1J A;  2N9B A;  1GK6 A;  5AVR B;  1LTG C;  1N7S B;  3NTN A;  3SWF A;  5AVX B;  2KLV A;  5BU8 B;  1FZC B;  2WPQ A;  1YTZ T;  4DZO A;  4WY4 B;  3M06 A;  3P8C E;  1RE3 A;  3B8E B;  1L0L K;  2OYI C;  3M9B A;  3RL0 D;  3RK3 D;  1HJB A;  3V4Q A;  3BAT A;  2P2U A;  4JYC A;  1IFM A;  1SP4 A;  1NAF A;  1NU1 K;  3NXS A;  2P1J A;  2OAR A;  3H32 B;  1S9K D;  4WBA A;  5AVV B;  3VTP C;  1WRG A;  1XTG B;  2H7H A;  2C9N Y;  2WSE H;  1JCD A;  1RE3 C;  1EQ7 A;  4LGD E;  1T2K C;  1JCC A;  2WPR A;  1URQ B;  3TYY A;  1GDT A;  3A5T A;  3L4F A;  2M3B A;  2XU6 A;  2IX7 C;  4JF7 A;  2Q5U A;  1GK4 A;  1CZQ A;  1IFJ A;  2VRS A;  2PP6 A;  1LTJ B;  3GHG A;  1SQV K;  3M91 A;  4LC1 A;  5CJ0 A;  1MZ9 A;  1DEB A;  2H43 A;  1HH0 A;  2FFD A;  3P8M C;  2W6B A;  1SFC B;  3BRT B;  3HD7 B;  1J1E B;  3IFM A;  3M0D C;  1GL2 B;  1LTS C;  4IFM A;  3V2P A;  3N7N A;  3MTU E;  1KIL A;  2HPC B;  1KIL D;  2O01 H;  3GHG C;  1IFI A;  1SQB K;  1NO4 A;  3NFQ A;  1L4A C;  3H6P A;  2Q3I A;  2Z4E A;  4EIJ A;  1FZA A;  3LIE A;  1GTW A;  2P67 A;  5APS A;  3HUS B;  1HUC A;  5APV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...