4I2LC

New hiv entry inhibitor mtsft/t23 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
41
structure length
41
Chain Sequence
QQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Potent antiviral activity of the novel HIV entry inhibitor MTSFT
rcsb
molecule tags Viral protein/antiviral protein
molecule keywords GP41
total genus 18
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2012-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4i2lC00
2YO3A 4AUWA 1MUUA 5AW3B 3HE4A 2XZRA 3L36A 3VMXA 1CSBA 3TYYA 3M0DA 2WT7B 1CI6A 1JNMA 3A5TA 1HUCA 2W6AA 2QM8A 5APWA 5AVXB 2R32A 3A2AA 4AYCA 3HE5B 1GK4A 1S9KE 3LIEA 3O8ZA 1OWAA 4JYBA 1NWQA 5APSA 3P32A 1GD2E 1FAVA 3B8EB 5AVRB 2QM7A 3A3YB 2JJLA 2WTYA 1HWTC 1NAFA 4C7NB 2R5DA 3TNUA 3L37A 1SLQA 2XV5A 5AW6B 4C46A 1JUNA 3I5CA 1IO4A 5APTA 2C9LY 4I6MC 2YO2A 3MGNA 5AVQB 3TNUB 1DH3A 1A02J 3M0AA 1YYCA 2R5BA 5APUA 1H88A 1OXZA 3VTPC 1H8AA 4AQRD 2Z5HA 3HE5A 3P7KA 1GZLA 2KP8A 3NMDA 2Q5UA 5AVWB 4EOTA 4B86A 2Z5IA 3TK1A 1GU4A 2XU6A 2VRSA 1HBWA 3MD0A 3V4QA 2N9BA 4RESB 1GU5A 4C7NA 5AW5B 3M9BA 1X8YA 2IPPA 3A7OA 3IR9A 3NXSA 1T2KC 1KQLA 4I2LC 4DZOA 2E42A 2P7JA 3VYIA 1SP4A 2WPQA 5CMZA 3VMYA 3HTKA 3OAKA 1T2KD 3KDPB 5AVZB 3KQGA 1MFZA 5APVA 3HE4B 2Q3IA 5AVUB 3T97A 4HYTB 5AW0B 4JYCA 5AVSB 2WWWA 1J2JB 2WPSA 5AW4B 2Q7CA 2W27A 5APQA 3UIAA 4M3LA 5AVYB 2P67A 3V4WA 2R3CA 3V5BA 2ZXEB 5AW7B 3M91A 1FOSE 3L35A 2ZFCA 5APXA 5APYA 2C9NY 3VN0A 1HJBA 1FOSF 1H89A 4XE5B 2BASA 2E43A 2P2UA 1GK6A 3NFQA 3P8MC 1S9KD 5AVVB 3LIDA 1CZQA 2YNYA 5AVTB 1G2CB 5AW2B 3SWFA 5AW9B 2WPRA 1A02F 1GTWA 2H7HA 3M9HA 1MV8A 3M06A 3VMZA 1CI6B 4GT1A 2WT7A 5AW8B 4KHXA 4GKGA 4LC1A 5AW1B 3NTNA
chains in the Genus database with same CATH superfamily
2YO3A 5KLVK 3L72D 1JOCA 1RY3A 1SQPE 1SQBD 1ZXGA 2WSEH 2IX7C 4Y99B 4YTPC 1X22A 1PL5A 5CBOA 1G1IA 2ZVOB 1URQD 3B71A 1NKNA 4I1LA 1NU1J 1OFCX 3BCCD 3H1IE 2JWAA 2KLVA 2QJYC 4IL6E 2QEXP 1JNMA 4D6TG 3WU2E 2FFDA 2KIKA 1LTGC 3H1HD 1Z56A 3CWBD 4H44D 3RL0g 5KAIH 5KKZC 1YQ4C 3ZDMA 3PJSK 1HUCA 2OARA 5APWA 4N6JA 5L8RJ 2LXBA 1SQXG 1S5LE 1DD3A 2D2CC 3H1ID 4MN4C 3S4RA 1M1JA 5CCHD 4AYCA 3HE5B 2Q3EA 3CCJP 1LJ2A 3LIEA 2MKVA 4H0LC 1SFCD 2FYUK 1KYOE 1E79H 1JMMA 3P32A 1LTTC 2GUVA 1Q90D 3HD7C 2NZ2A 3WMM0 1IK7A 3H1LG 1CW5A 4U3FE 4NPDA 1J1DB 4ASVA 1M1JC 3KZIH 3FXDA 4BRYA 1SQPK 1IJDB 3D70A 1BE3G 1EZVG 1SLQA 1HJ0A 3FWLA 5AW6B 3TF5A 1Q2NA 4N78D 2HFED 2NPSB 2Q1KA 5H2FH 1SQVD 3I55P 2M0BA 2QVAA 1M8OB 1NTKE 1EC5A 2CPBA 4I6MC 2WSFH 2YO2A 2BCCJ 3HUSA 3WUUA 4UB8H 4YXDC 5B5EH 2IZ1A 2I1KA 1K8AQ 5EFWB 3B5NB 5K5GB 1NTME 1GD2E 5CCGA 5AVQB 2YMKA 5DJUB 1LP1A 1NTMG 1KC8Q 1A02J 1JCCA 3WUVA 1ZMEC 1VQ6P 1KYOH 1L4AA 2XDJA 2B89A 1L0NK 1GDTA 2XNXA 3RL0C 1N7LA 1XTCC 1FDIA 1L0LE 1BDDA 1QLED 2SPZA 5APUA 1H88A 1H8AA 4AQRD 3KYQA 3P7KA 3CCQP 2IZ0A 2ZVNB 3L73E 1J1DC 5BU5A 2O1JA 2KOGA 1PP9D 5H2FE 3RK3C 1LT9C 1QEXA 1MFTA 2E5YA 3AE7C 4B86A 1NGMB 1KTMA 1N73C 1GU4A 2AEJA 3L75G 1X9VA 4PV1D 1URQA 2JR8A 1LTJA 2N9BA 2Q6QA 4RESB 4UB8E 4PD4D 3CX5H 3SSUA 4EIJA 1SQQK 1SQQE 3M9BA 3FWNA 2M5AB 1X8YA 2Y0DA 2FY8A 3RGUA 1J1EB 3L75J 1L0LK 5KLVD 2K1AA 5TJHA 2ZT9B 3G9RA 4D6TJ 3L70G 1SQVK 4GOFA 1EXJA 2W83C 2B87B 4IL6H 3EFGA 1SQPG 3WU2H 1EDIA 2KNCB 5M1BA 4EI2A 3A0BH 4OWFA 2P7JA 3T97B 3H1IG 3O6QA 5CCHA 1FZCB 2OYIA 1JO5A 1KN7A 1N73A 1RE4C 3L70J 2QE7H 3AECC 3OAKA 1T2KD 5E79H 1YJWP 3SFEC 3PLNA 3KQGA 3M0DC 2MJZA 4GOEA 1GMJA 5GTIE 1BCCJ 2FXOA 3R2PA 1NTKJ 3BCCG 1Y47A 3L74E 4R4LA 2WWWA 2WPSA 4KT0J 2Q7CA 1PZQA 2W27A 1GW3A 3PHLA 1U7MA 4M3LA 1QL1A 3V4WA 4ZMDA 1Q81Q 1HF9A 2A06G 2R44A 3EFFK 2OYHB 3L4FA 2PP6A 5AW7B 1MZ9A 1OW8A 2AEFA 4WB4A 4JYCA 1K9MQ 2E76C 2WQYC 1YITP 3GG2A 1BGYE 4YXWH 4UB6E 1T6AA 4XE5B 1FDMA 5E79E 2WZ7A 1LT9A 1NTMJ 3G3ZA 4IFMA 2P2UA 1LWUA 3FGAD 3NFQA 1NOHA 5GTIH 1SQBG 2QRXA 3TGUG 3SWFA 2RN0A 3C9IA 5DJTB 3P8CD 2E74D 2L5GB 3L71E 2YXRB 1IFIA 1IFJA 1VPCA 3M06A 3N7NA 2FFDB 1J1EC 4WVZA 3H25A 4DT0A 1OVUA 3Q1MA 4AUWA 1GL2D 1MUUA 3CL3D 3TGUJ 3V6IA 3HE4A 1YI2P 2OTJP 2ZYDA 1EZVI 4PD4I 1LTJC 2Q9IA 3WUTA 1BGYD 3GHGA 3M0DA 4WY4D 2ZYGA 2Y0CA 1CI6A 1NTMD 1PGJA 2FYUE 2WT7B 5KLIC 1N73B 2GM4A 1L4AC 3CX5E 3RL0D 2W6AA 2N1TC 1OW6A 3RK2C 2ZT9D 4IFDK 4KJMA 2JP3A 1KB9D 2R32A 3H1KE 2FYUG 1ZV8A 2WSSH 3A2AA 1R5LA 3JCUE 2FYZA 1LTIC 1JTHB 1OWAA 1L0NJ 2ZT9C 3O8ZA 2IBZE 5APSA 1IZNB 2N1TD 2QJPC 2KZIA 2XNDH 1SQXK 2G3AA 2GA1A 2YKQA 3PP5A 3MZWB 1FAVA 1SS1A 3A0BE 3AEEC 3RBXA 1IFMA 2H88C 3BRVB 3CCRP 1QVFO 1AQ5A 2PAJA 2QM7A 4WY4C 2HODB 2WTYA 4C7NB 1EDKA 2J5UA 2R5DA 1JY2O 3L70D 2XV5A 1GL2C 1JUNA 3PTZA 3CCEP 2A45I 1EXIA 4JBZA 2BEQD 3RK3B 2C9LY 3B5NC 3MGNA 3VMAA 2LKMA 3GHGC 4DOJA 1Q86Q 1RF0A 2RKLA 2WPVB 2E74C 4NPFX 3JCUH 3CCMP 3H1HG 3M9QA 3TDKA 1YJNP 3GMAA 1ZLLA 1PPJE 3HRNA 1OX3A 3H32A 1SQVE 2LXCB 4U7JA 3OW2O 3OA7A 4W7YA 1OVVA 2A06E 1M1JB 1URQB 1BGYJ 4UB6H 3HE5A 1VQKP 2C0XA 1QGKB 1QX8A 2KP8A 2YIUC 3H1JE 1NHLA 1PGPA 4XFJA 4JQ0D 1JEKA 2B88A 4JF7A 4NPEA 3U1CA 1NYHA 2FXPA 2Y0EA 4HH2A 3S1KA 1S72P 1FJKA 2A06D 2YMYA 2VRSA 4WWIA 4EYYQ 2IYOA 3CMAP 2B87A 2DW3A 1JY3P 1AJYA 1SFCB 3PH0A 4K3AA 4DCKA 3W68A 3V2QA 1AQTA 4L76A 2E5TA 1FZFA 2WVRA 1KORA 1VQPP 3RL0B 2KZJA 1JY2N 3NXSA 1T2KC 4A7PA 3HUSB 2KS1B 4I7ZB 1NJIQ 1L0NE 1ZRTE 1YTZI 1FZAA 4PD4E 1KQLA 3AE8C 4DZOA 3BVHA 2A45H 2L91A 1FZCC 3L71J 3H6PA 1VQOP 1NTMK 3AE2C 2I8DA 1UIIA 2O01H 3EQ2A 3H1JG 1DEBA 2FYNC 3H1LJ 3K5BA 1VQ9P 2OGUA 5KAFH 2HPCA 3L73D 1KILB 2WSCJ 3B5ND 2QJKB 2KB7P 3VYIA 2A45G 2YKOA 1XTGB 2KK7A 1PPJG 1J2JB 3L73G 4HYTB 2N1TA 3BRTB 1LGHB 3L74G 3MUDC 1ZW0A 3UIAA 2BCCE 4PV1C 3CPWO 3A0HH 1SQXD 2P1JA 1M1KQ 1ZP0C 1LT9B 1YTZT 2FFDC 1JY2P 1LWUB 1S1CX 1X0TA 3II6A 3L35A 4TLFA 4QMAA 4WBAA 1VL2A 3Q5RA 2ZFCA 2YIUB 4W7ZA 1EDJA 1H0TA 2M5AA 4RJTA 1FJPA 1NH4A 3VN0A 3TSIA 2ZJSE 1HJBA 1RF1A 3L72J 2ZAEB 3CX5I 4H13B 3H1HJ 5KAFE 2Z4EA 1NU1K 3G71P 1SQBE 1NTZK 2KLUA 3P8MC 3L70E 1ZR2A 1RF1C 2KNCA 1VQ5P 3RK2D 2D2CB 4U3FD 1RE3C 1KFNA 2ZYAA 4YPCA 5AW9B 3G6EP 3CXHI 2IBZG 1W2BO 3SWKA 1L4AD 1BGYG 3M9HA 2WT7A 1CI6B 1VF5B 1TU3F 2XKMA 4U3FG 4KHXA 3D6ZA 1KMIZ 5AW1B 1S9KD 4IL6X 1R5SA 1SQQJ 2PGDA 2IFNA 4Y28J 3CC7P 3ABVC 2AXTE 4HB1A 1G2CA 1PV3A 2XZRA 1VDFA 2J58A 2Y9ZA 4U3FJ 4EDFA 3TGUD 3H1LD 1M57D 3CX5D 3A5TA 2IBZI 3HD7D 1IFPA 2IYPA 1LNQA 2QM8A 1N2DC 1SFCC 5AVXB 1U7JA 1NTKD 1NU1G 2HYNA 4H0LD 2OYIB 1VQNP 4D6TE 1QVGO 1BSNA 1GK4A 2BCCD 5BVZA 3VMXA 4RKUJ 3S9OA 1FS0E 3L71G 4JYBA 2CPSA 1N7SA 1S2EA 4GODA 4K35A 4PD4H 1NTZG 1L0LJ 3MP7B 3V2RA 3CXHD 1G1JA 1SQXJ 3H1JD 4LLHA 1NTKG 1NU1D 2E76D 1RQVA 3B8EB 3BCCJ 4OGQB 5AVRB 1RF0C 3V2NA 3P8CE 3A3YB 1HWTC 1NAFA 1NAYA 1YIJP 4N3YB 3F89A 1URQC 2J59M 3USSA 1FC2C 4C46A 3N4XA 1OZHA 2WSFJ 3H32B 3I5CA 3L73J 3MUDA 5GTHH 4OH8B 1KB9E 2IDBA 3H1KD 3L74J 5APTA 3CMEP 2E74B 1M90Q 5AVSB 2GUSA 3GHGB 4ZKPA 1N8RQ 1NVOA 3A0HE 3AE5C 3GF3A 1BCCD 3GW6A 3RBZA 3TNUB 1SQQD 5B66H 3F5HA 4L73A 1ZOYC 5CCGD 3CCUP 1K73Q 2W8ZA 3M0AA 2WMMA 3BCCE 1YYCA 3R4YA 2NPSD 3Q3DA 2R5BA 1OXZA 1AVOA 1D7MA 1HGZA 5C39A 3VTPC 2O01J 1P84D 2B9BA 4DJGA 1GZLA 1NTZE 3MIWA 4L75A 4ZNCA 1SFCA 2Q5UA 2KSEA 1JTHA 3NMDA 4JPZB 2KSJA 1JCDA 1T3JA 5GTHE 1LTAC 5KKZB 1K04A 4EOTA 1VQ8P 2ITAA 1KB9H 1JMBA 2Z5IA 3V2PA 2K9JB 1HBWA 2YKPA 3B4SA 3MD0A 3V4QA 1HGVA 1BE3D 4C7NA 1SQPJ 5B66E 4IOIH 4Y99C 1EZVE 3Q2YA 3GF7A 3RK2B 1KILC 3RK3D 1DIPA 2IPPA 1IK9A 2FXMA 2AXTH 2CK3H 1M56D 5KJ7C 1FZBA 1FBMA 1N7SD 2W6BA 3H1LE 3Q5SA 2HPCB 4H13D 1IFNA 4I2LC 3CC4P 1SQVG 1Q82Q 1AFOA 2E42A 2H89C 1BCCG 2WSEJ 1HTLC 4PJ0H 5KTBA 3AEGC 1X79B 4XA4A 5CMZA 3MTUE 1S5LX 1YJ9P 3AEFC 1DD4A 2FKWB 1PIXA 2O1KA 1KILE 1WMKA 1MFZA 2RH0A 1L0LG 2V7QH 5APVA 3H1IJ 5AVUB 1H0TB 4LGDE 3AE4C 3AE6C 5APQA 1L0LD 2P10A 1E5WA 3ITKA 2P67A 4PV1B 5AVYB 1AA0A 2LR2A 3HTKB 3SWYA 3AE9C 1JB0J 2P58A 3V5BA 1VF5C 3C1LA 1FOSE 2BEZF 1W5CE 1PGOA 2WITA 4WY4B 3CWBE 1KB9I 3CCVP 1OMIA 1M7LA 1S4XA 1SQBJ 4ASWA 2AEMA 1YHQP 2BCCG 2C9NY 2Y9YA 1AV1A 1USDA 1QL2A 1W2EA 4C7RA 1GL2B 2FYNB 5KLVG 1BE3E 4HKZH 1H89A 2BASA 2E75D 2KS1A 1MKMA 2HR3A 2KXPB 3CI9A 2E43A 5CJ0A 1GK6A 2AXCA 5CCHC 1OIPA 1USEA 2D2CD 2KUBA 2QJKC 3LIDA 3PRJA 5AVVB 1G2CB 5AW2B 3W67A 4TT3H 2WPRA 4BRYB 1A02F 1GTWA 1PFIA 1EDLA 1MV8A 5TISE 1OW7A 3IF4A 4H44C 1NO4A 3VMZA 1YBKA 4H0LB 1KILA 1JY3O 1IFDA 4GKGA 4LC1A 2H8PD 3LW5H 3IN6A 3D6YA 5AW3B 1S3JA 2FBWC 2H43A 1PPJD 1NTKK 3L36A 5CHXA 2QG4A 1CSBA 1KFMA 1AVYA 2N1TB 3KHUA 3U59A 3HUSC 3TYYA 4BXLA 3B5NA 4OGQC 3CC2P 1P84H 2WSCH 3HD7A 1LP1B 5CBNA 3TGUE 1RHZB 1T8ZA 1SQBK 1ZR4A 1VQ4P 3JC22 3RK3E 2K3RA 1EZVD 1FE6A 3H1JJ 2K37A 1JM0A 4L74A 1KV4A 3QWOC 1SQVJ 1S9KE 3D71A 3L72E 1NWQA 3CD6P 2G8YA 2W6JH 1NU1E 2OTLP 3U1AA 3KPEA 4PJ0E 2FYUJ 2QJYB 3IFMA 1KZUB 1T3UA 1KQSO 1BDCA 2JJLA 4OGQD 1LTJB 1HVVA 1P84E 5KJ7A 1VQ7P 1LT1A 3TNUA 3L37A 2N9YB 1U57A 3OJAB 1PP9J 4BWNA 3G4SP 3CCSP 3VP9A 3CXHH 3SFDC 2PRRA 1IO4A 1OVRA 2YXQB 1FZEA 2IFMA 2M3BA 2JO1A 2O01N 2ZXXA 3CCLP 5KLVE 1NKZB 3FXEA 3GLMA 2M8RA 2OYOA 3H1HE 1PP9G 2K88A 1DH3A 3O6QB 3CWBG 2NPSA 2HLOA 4O9BA 4GIFA 3L75D 5KLVJ 3VP8A 2E75C 2K9JA 4CPGA 2M3EA 2Z5HA 1RE3A 2OTKE 3VOPA 1K05A 3EWKA 1PP9E 5AVWB 1N7SB 1KYOD 1L4AB 1SQQG 2IBZD 3E1RA 3CXHE 1KQFB 2OYHC 1VF5D 2K9YA 5KLIB 3TK1A 1FU1A 2XU6A 4IFFA 2JDIH 3L75E 5KAIE 3IAOA 3JSVC 1EQ7A 3QH9A 5TISH 1GU5A 5AW5B 1BCCE 1R8EA 3AEBC 3H1KG 3A7OA 1RH5B 3IR9A 1N86A 1RF1B 2R3SA 2KYVA 3MHVA 1FZGA 2W90A 3AE1C 3C8VA 3AEAC 3CLQA 1DX7A 2JWDA 1PGQA 3AE3C 1WT6A 4W80A 4N78E 3H1KJ 1NTZJ 1WRGA 3FX0A 2HG5D 3L74D 3KZIE 4I7ZC 1SP4A 1LTSC 2WPQA 4H13C 1Q7YQ 1VQLP 3VMYA 1N7SC 3HTKA 2O3JA 3KDPB 3L71D 1L0NG 5KJ7D 1VQMP 5AVZB 1NTZD 1KYOI 1BE3J 1KILD 1P84I 4WY4A 1Y8AA 1BSHA 3HE4B 2Q3IA 3LW5J 2I1JA 3T97A 2C0WA 2PFXA 5AW0B 5AW4B 2UWJE 5B5EE 2V7QJ 1FZCA 4D6TD 2E75B 2POHA 1GL2A 1GW4A 3Q5PA 1RE4A 1ZN5A 1KD1Q 4GDOA 5CJ4A 1L0ND 1KQGB 1ZRTD 2R3CA 2ZXEB 4H44B 4OVNF 2QA4P 1LTBC 2RMZA 2OQQA 3E1IA 3E7KA 3BATA 3M91A 4HJGH 1L2PA 4R4MA 3BASA 5APXA 5APYA 2E76B 2KI7B 1JY3N 2FYUD 1FOSF 2QJPB 3AEDC 1IC2A 1LWUC 1SVFA 2NRGA 2V4HA 1SQXE 1Y9BA 2NPSC 2OYHA 1YQ3C 4ZKUA 3CWBJ 1SQPD 1CZQA 2YNYA 5CCGC 5AVTB 4Z1MH 1FDOA 1S5LH 3I56P 2OYIC 1DEEG 1RQUA 2H7HA 1UIXA 2QSIA 3KXDA 2HODA 2JEEA 3L72G 2JKVA 4GT1A 2QIWA 5AW8B 3HD7B 4RO0A 1HH0A 5BU8B 3NTNA
chains in the Genus database with same CATH topology
2YO3A 5KLVK 1JOCA 1RY3A 2WSEH 4Y99B 2IX7C 1G1IA 1URQD 1NKNA 4I1LA 2KLVA 1JO5A 1JNMA 2FFDA 1LTGC 1Z56A 1HUCA 2OARA 5APWA 4N6JA 5CCHD 1M1JA 4AYCA 3HE5B 3LIEA 1SFCD 2FYUK 1JMMA 3P32A 1LTTC 2GUVA 3HD7C 3WMM0 1CW5A 1J1DB 1M1JC 1SQPK 1IJDB 1SLQA 5AW6B 4N78D 2HFED 2NPSB 2CPBA 4I6MC 2WSFH 2YO2A 3HUSA 2I1KA 3B5NB 5CCGA 5AVQB 1A02J 1JCCA 1L4AA 2XDJA 1L0NK 1GDTA 2XNXA 1N7LA 1XTCC 5APUA 1H88A 1H8AA 4AQRD 3KYQA 3P7KA 1J1DC 5BU5A 2O1JA 2KOGA 3RK3C 5KJ7A 1LT9C 4B86A 1N73C 1GU4A 1X9VA 1URQA 1LTJA 2N9BA 4RESB 4EIJA 1SQQK 3M9BA 1X8YA 1J1EB 1L0LK 1SQVK 3EFGA 2P7JA 5CCHA 1FZCB 1RE4C 3OAKA 1T2KD 3KQGA 3M0DC 2MJZA 3R2PA 2WWWA 2WPSA 2Q7CA 2W27A 1GW3A 4M3LA 1QL1A 3V4WA 2OYHB 3L4FA 2PP6A 5AW7B 1MZ9A 4WB4A 4XE5B 1FDMA 2WZ7A 1LT9A 3G3ZA 4IFMA 2P2UA 1LWUA 3NFQA 1NOHA 3SWFA 3C9IA 3P8CD 3N7NA 2L5GB 1IFIA 1IFJA 1VPCA 3M06A 2FFDB 1J1EC 4AUWA 1GL2D 1MUUA 3CL3D 3HE4A 1LTJC 2Q9IA 3GHGA 3M0DA 4WY4D 2WT7B 1CI6A 1N73B 2GM4A 1L4AC 3RL0D 2W6AA 2N1TC 3RK2C 4IFDK 2R32A 3A2AA 1ZV8A 2FYZA 1LTIC 1JTHB 1OWAA 3O8ZA 5APSA 2N1TD 3PP5A 3RL0C 1SQXK 2YKQA 1FAVA 1AQ5A 1IFMA 3BRVB 2PAJA 2QM7A 4WY4C 2HODB 2WTYA 4C7NB 2R5DA 1JY2O 2XV5A 1GL2C 1JUNA 2A45I 3RK3B 2C9LY 3B5NC 3MGNA 2LKMA 3GHGC 4DOJA 1RF0A 3M9QA 1ZLLA 3HRNA 3H32A 3OA7A 4W7YA 1M1JB 1URQB 3HE5A 2C0XA 2KP8A 1NHLA 4JF7A 3U1CA 4HH2A 1FJKA 2YMYA 2VRSA 1JY3P 1SFCB 3V2QA 1FZFA 3RL0B 1JY2N 3NXSA 1T2KC 3HUSB 1YTZI 1FZAA 1KQLA 4DZOA 3BVHA 1FZCC 2A45H 3H6PA 1NTMK 2O01H 3EQ2A 1DEBA 2HPCA 1KILB 3B5ND 2KB7P 3VYIA 2A45G 2YKOA 1XTGB 4HYTB 4JYCA 1J2JB 5AVSB 2N1TA 3BRTB 1LGHB 3UIAA 2P1JA 1LT9B 1YTZT 2FFDC 1JY2P 1LWUB 3II6A 3L35A 4WBAA 2ZFCA 4W7ZA 1FJPA 1NH4A 3VN0A 3TSIA 1HJBA 1RF1A 2Z4EA 1NU1K 1NTZK 3P8MC 1ZR2A 1RF1C 3RK2D 1RE3C 1KFNA 5AW9B 1L4AD 3M9HA 2WT7A 1CI6B 2XKMA 4KHXA 1S9KD 5AW1B 2IFNA 1G2CA 2XZRA 1VDFA 2J58A 3A5TA 3HD7D 2QM8A 1N2DC 1SFCC 5AVXB 2HYNA 2OYIB 1GK4A 5BVZA 4JYBA 2CPSA 1N7SA 3V2RA 5CJ4A 1G1JA 4LLHA 1GD2E 3B8EB 5AVRB 3V2NA 1RF0C 3P8CE 3A3YB 1HWTC 1NAFA 4N3YB 1URQC 2J59M 4C46A 3N4XA 3H32B 3I5CA 3MUDA 4OH8B 5APTA 2GUSA 3GHGB 4ZKPA 3TNUB 5CCGD 3M0AA 1YYCA 2NPSD 2R5BA 1OXZA 1HGZA 3VTPC 1GZLA 3MIWA 1SFCA 2Q5UA 3NMDA 1JTHA 2KSJA 1JCDA 1T3JA 4EOTA 1LTAC 2Z5IA 3V2PA 1HBWA 2YKPA 3MD0A 3V4QA 1HGVA 4C7NA 4Y99C 3RK2B 1KILC 3RK3D 2IPPA 1IK9A 2FXMA 5KJ7C 1FZBA 1FBMA 1N7SD 2W6BA 2HPCB 1IFNA 4I2LC 1AFOA 2E42A 5KTBA 1HTLC 1X79B 4XA4A 5CMZA 3MTUE 2FKWB 2O1KA 1MFZA 5APVA 5AVUB 4LGDE 5APQA 1RF1B 1E5WA 5AVYB 2P67A 3HTKB 3SWYA 3V5BA 1FOSE 2WITA 4WY4B 1M7LA 2C9NY 4C7RA 1QL2A 1W2EA 1GL2B 1H89A 2BASA 3CI9A 2E43A 5CJ0A 1GK6A 5CCHC 5AVVB 3LIDA 1G2CB 5AW2B 2WPRA 1A02F 1GTWA 1PFIA 1MV8A 3VMZA 1NO4A 1KILA 1IFDA 1JY3O 4GKGA 4LC1A 2H8PD 3LW5H 5AW3B 2H43A 1NTKK 3L36A 5CHXA 3U59A 1CSBA 1KFMA 2N1TB 3VMXA 2OYIA 3HUSC 3TYYA 3B5NA 2WSCH 3HD7A 1T8ZA 1SQBK 1ZR4A 1S9KE 1NWQA 3U1AA 3KPEA 3IFMA 1KZUB 1T3UA 2JJLA 1LTJB 1HVVA 3TNUA 3L37A 3OJAB 3VP9A 1IO4A 1FZEA 2IFMA 2M3BA 1NKZB 2M8RA 1DH3A 2NPSA 2HLOA 4O9BA 4GIFA 3VP8A 2Z5HA 1RE3A 3VOPA 5AVWB 1N7SB 1L4AB 2OYHC 3TK1A 1FU1A 2XU6A 4IFFA 1EQ7A 1GU5A 5AW5B 3A7OA 3IR9A 1N86A 2KYVA 1FZGA 3CLQA 1DX7A 1WT6A 4W80A 4N78E 1WRGA 2HG5D 1SP4A 1LTSC 2WPQA 3VMYA 1N7SC 3HTKA 3KDPB 5KJ7D 5AVZB 1KILD 4WY4A 3HE4B 2Q3IA 2I1JA 3T97A 2C0WA 5AW0B 5AW4B 1FZCA 2POHA 1GL2A 1GW4A 1N73A 1RE4A 1ZN5A 2R3CA 2ZXEB 1LTBC 3M91A 3E1IA 3BATA 3BASA 5APXA 5APYA 1JY3N 1FOSF 1IC2A 1LWUC 1SVFA 2OYHA 2NPSC 4ZKUA 1CZQA 2YNYA 5CCGC 5AVTB 2OYIC 2H7HA 2HODA 2JEEA 4GT1A 5AW8B 3HD7B 1HH0A 5BU8B 3NTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YO3 A;  4AUW A;  1MUU A;  5AW3 B;  3HE4 A;  2XZR A;  3L36 A;  3VMX A;  1CSB A;  3TYY A;  3M0D A;  2WT7 B;  1CI6 A;  1JNM A;  3A5T A;  1HUC A;  2W6A A;  2QM8 A;  5APW A;  5AVX B;  2R32 A;  3A2A A;  4AYC A;  3HE5 B;  1GK4 A;  1S9K E;  3LIE A;  3O8Z A;  1OWA A;  4JYB A;  1NWQ A;  5APS A;  3P32 A;  1GD2 E;  1FAV A;  3B8E B;  5AVR B;  2QM7 A;  3A3Y B;  2JJL A;  2WTY A;  1HWT C;  1NAF A;  4C7N B;  2R5D A;  3TNU A;  3L37 A;  1SLQ A;  2XV5 A;  5AW6 B;  4C46 A;  1JUN A;  3I5C A;  1IO4 A;  5APT A;  2C9L Y;  4I6M C;  2YO2 A;  3MGN A;  5AVQ B;  3TNU B;  1DH3 A;  1A02 J;  3M0A A;  1YYC A;  2R5B A;  5APU A;  1H88 A;  1OXZ A;  3VTP C;  1H8A A;  4AQR D;  2Z5H A;  3HE5 A;  3P7K A;  1GZL A;  2KP8 A;  3NMD A;  2Q5U A;  5AVW B;  4EOT A;  4B86 A;  2Z5I A;  3TK1 A;  1GU4 A;  2XU6 A;  2VRS A;  1HBW A;  3MD0 A;  3V4Q A;  2N9B A;  4RES B;  1GU5 A;  4C7N A;  5AW5 B;  3M9B A;  1X8Y A;  2IPP A;  3A7O A;  3IR9 A;  3NXS A;  1T2K C;  1KQL A;  4I2L C;  4DZO A;  2E42 A;  2P7J A;  3VYI A;  1SP4 A;  2WPQ A;  5CMZ A;  3VMY A;  3HTK A;  3OAK A;  1T2K D;  3KDP B;  5AVZ B;  3KQG A;  1MFZ A;  5APV A;  3HE4 B;  2Q3I A;  5AVU B;  3T97 A;  4HYT B;  5AW0 B;  4JYC A;  5AVS B;  2WWW A;  1J2J B;  2WPS A;  5AW4 B;  2Q7C A;  2W27 A;  5APQ A;  3UIA A;  4M3L A;  5AVY B;  2P67 A;  3V4W A;  2R3C A;  3V5B A;  2ZXE B;  5AW7 B;  3M91 A;  1FOS E;  3L35 A;  2ZFC A;  5APX A;  5APY A;  2C9N Y;  3VN0 A;  1HJB A;  1FOS F;  1H89 A;  4XE5 B;  2BAS A;  2E43 A;  2P2U A;  1GK6 A;  3NFQ A;  3P8M C;  1S9K D;  5AVV B;  3LID A;  1CZQ A;  2YNY A;  5AVT B;  1G2C B;  5AW2 B;  3SWF A;  5AW9 B;  2WPR A;  1A02 F;  1GTW A;  2H7H A;  3M9H A;  1MV8 A;  3M06 A;  3VMZ A;  1CI6 B;  4GT1 A;  2WT7 A;  5AW8 B;  4KHX A;  4GKG A;  4LC1 A;  5AW1 B;  3NTN A; 
#chains in the Genus database with same CATH topology
 2YO3 A;  5KLV K;  3L72 D;  1JOC A;  1RY3 A;  1SQP E;  1SQB D;  1ZXG A;  2WSE H;  2IX7 C;  4Y99 B;  4YTP C;  1X22 A;  1PL5 A;  5CBO A;  1G1I A;  2ZVO B;  1URQ D;  3B71 A;  1NKN A;  4I1L A;  1NU1 J;  1OFC X;  3BCC D;  3H1I E;  2JWA A;  2KLV A;  2QJY C;  4IL6 E;  2QEX P;  1JNM A;  4D6T G;  3WU2 E;  2FFD A;  2KIK A;  1LTG C;  3H1H D;  1Z56 A;  3CWB D;  4H44 D;  3RL0 g;  5KAI H;  5KKZ C;  1YQ4 C;  3ZDM A;  3PJS K;  1HUC A;  2OAR A;  5APW A;  4N6J A;  5L8R J;  2LXB A;  1SQX G;  1S5L E;  1DD3 A;  2D2C C;  3H1I D;  4MN4 C;  3S4R A;  1M1J A;  5CCH D;  4AYC A;  3HE5 B;  2Q3E A;  3CCJ P;  1LJ2 A;  3LIE A;  2MKV A;  4H0L C;  1SFC D;  2FYU K;  1KYO E;  1E79 H;  1JMM A;  3P32 A;  1LTT C;  2GUV A;  1Q90 D;  3HD7 C;  2NZ2 A;  3WMM 0;  1IK7 A;  3H1L G;  1CW5 A;  4U3F E;  4NPD A;  1J1D B;  4ASV A;  1M1J C;  3KZI H;  3FXD A;  4BRY A;  1SQP K;  1IJD B;  3D70 A;  1BE3 G;  1EZV G;  1SLQ A;  1HJ0 A;  3FWL A;  5AW6 B;  3TF5 A;  1Q2N A;  4N78 D;  2HFE D;  2NPS B;  2Q1K A;  5H2F H;  1SQV D;  3I55 P;  2M0B A;  2QVA A;  1M8O B;  1NTK E;  1EC5 A;  2CPB A;  4I6M C;  2WSF H;  2YO2 A;  2BCC J;  3HUS A;  3WUU A;  4UB8 H;  4YXD C;  5B5E H;  2IZ1 A;  2I1K A;  1K8A Q;  5EFW B;  3B5N B;  5K5G B;  1NTM E;  1GD2 E;  5CCG A;  5AVQ B;  2YMK A;  5DJU B;  1LP1 A;  1NTM G;  1KC8 Q;  1A02 J;  1JCC A;  3WUV A;  1ZME C;  1VQ6 P;  1KYO H;  1L4A A;  2XDJ A;  2B89 A;  1L0N K;  1GDT A;  2XNX A;  3RL0 C;  1N7L A;  1XTC C;  1FDI A;  1L0L E;  1BDD A;  1QLE D;  2SPZ A;  5APU A;  1H88 A;  1H8A A;  4AQR D;  3KYQ A;  3P7K A;  3CCQ P;  2IZ0 A;  2ZVN B;  3L73 E;  1J1D C;  5BU5 A;  2O1J A;  2KOG A;  1PP9 D;  5H2F E;  3RK3 C;  1LT9 C;  1QEX A;  1MFT A;  2E5Y A;  3AE7 C;  4B86 A;  1NGM B;  1KTM A;  1N73 C;  1GU4 A;  2AEJ A;  3L75 G;  1X9V A;  4PV1 D;  1URQ A;  2JR8 A;  1LTJ A;  2N9B A;  2Q6Q A;  4RES B;  4UB8 E;  4PD4 D;  3CX5 H;  3SSU A;  4EIJ A;  1SQQ K;  1SQQ E;  3M9B A;  3FWN A;  2M5A B;  1X8Y A;  2Y0D A;  2FY8 A;  3RGU A;  1J1E B;  3L75 J;  1L0L K;  5KLV D;  2K1A A;  5TJH A;  2ZT9 B;  3G9R A;  4D6T J;  3L70 G;  1SQV K;  4GOF A;  1EXJ A;  2W83 C;  2B87 B;  4IL6 H;  3EFG A;  1SQP G;  3WU2 H;  1EDI A;  2KNC B;  5M1B A;  4EI2 A;  3A0B H;  4OWF A;  2P7J A;  3T97 B;  3H1I G;  3O6Q A;  5CCH A;  1FZC B;  2OYI A;  1JO5 A;  1KN7 A;  1N73 A;  1RE4 C;  3L70 J;  2QE7 H;  3AEC C;  3OAK A;  1T2K D;  5E79 H;  1YJW P;  3SFE C;  3PLN A;  3KQG A;  3M0D C;  2MJZ A;  4GOE A;  1GMJ A;  5GTI E;  1BCC J;  2FXO A;  3R2P A;  1NTK J;  3BCC G;  1Y47 A;  3L74 E;  4R4L A;  2WWW A;  2WPS A;  4KT0 J;  2Q7C A;  1PZQ A;  2W27 A;  1GW3 A;  3PHL A;  1U7M A;  4M3L A;  1QL1 A;  3V4W A;  4ZMD A;  1Q81 Q;  1HF9 A;  2A06 G;  2R44 A;  3EFF K;  2OYH B;  3L4F A;  2PP6 A;  5AW7 B;  1MZ9 A;  1OW8 A;  2AEF A;  4WB4 A;  4JYC A;  1K9M Q;  2E76 C;  2WQY C;  1YIT P;  3GG2 A;  1BGY E;  4YXW H;  4UB6 E;  1T6A A;  4XE5 B;  1FDM A;  5E79 E;  2WZ7 A;  1LT9 A;  1NTM J;  3G3Z A;  4IFM A;  2P2U A;  1LWU A;  3FGA D;  3NFQ A;  1NOH A;  5GTI H;  1SQB G;  2QRX A;  3TGU G;  3SWF A;  2RN0 A;  3C9I A;  5DJT B;  3P8C D;  2E74 D;  2L5G B;  3L71 E;  2YXR B;  1IFI A;  1IFJ A;  1VPC A;  3M06 A;  3N7N A;  2FFD B;  1J1E C;  4WVZ A;  3H25 A;  4DT0 A;  1OVU A;  3Q1M A;  4AUW A;  1GL2 D;  1MUU A;  3CL3 D;  3TGU J;  3V6I A;  3HE4 A;  1YI2 P;  2OTJ P;  2ZYD A;  1EZV I;  4PD4 I;  1LTJ C;  2Q9I A;  3WUT A;  1BGY D;  3GHG A;  3M0D A;  4WY4 D;  2ZYG A;  2Y0C A;  1CI6 A;  1NTM D;  1PGJ A;  2FYU E;  2WT7 B;  5KLI C;  1N73 B;  2GM4 A;  1L4A C;  3CX5 E;  3RL0 D;  2W6A A;  2N1T C;  1OW6 A;  3RK2 C;  2ZT9 D;  4IFD K;  4KJM A;  2JP3 A;  1KB9 D;  2R32 A;  3H1K E;  2FYU G;  1ZV8 A;  2WSS H;  3A2A A;  1R5L A;  3JCU E;  2FYZ A;  1LTI C;  1JTH B;  1OWA A;  1L0N J;  2ZT9 C;  3O8Z A;  2IBZ E;  5APS A;  1IZN B;  2N1T D;  2QJP C;  2KZI A;  2XND H;  1SQX K;  2G3A A;  2GA1 A;  2YKQ A;  3PP5 A;  3MZW B;  1FAV A;  1SS1 A;  3A0B E;  3AEE C;  3RBX A;  1IFM A;  2H88 C;  3BRV B;  3CCR P;  1QVF O;  1AQ5 A;  2PAJ A;  2QM7 A;  4WY4 C;  2HOD B;  2WTY A;  4C7N B;  1EDK A;  2J5U A;  2R5D A;  1JY2 O;  3L70 D;  2XV5 A;  1GL2 C;  1JUN A;  3PTZ A;  3CCE P;  2A45 I;  1EXI A;  4JBZ A;  2BEQ D;  3RK3 B;  2C9L Y;  3B5N C;  3MGN A;  3VMA A;  2LKM A;  3GHG C;  4DOJ A;  1Q86 Q;  1RF0 A;  2RKL A;  2WPV B;  2E74 C;  4NPF X;  3JCU H;  3CCM P;  3H1H G;  3M9Q A;  3TDK A;  1YJN P;  3GMA A;  1ZLL A;  1PPJ E;  3HRN A;  1OX3 A;  3H32 A;  1SQV E;  2LXC B;  4U7J A;  3OW2 O;  3OA7 A;  4W7Y A;  1OVV A;  2A06 E;  1M1J B;  1URQ B;  1BGY J;  4UB6 H;  3HE5 A;  1VQK P;  2C0X A;  1QGK B;  1QX8 A;  2KP8 A;  2YIU C;  3H1J E;  1NHL A;  1PGP A;  4XFJ A;  4JQ0 D;  1JEK A;  2B88 A;  4JF7 A;  4NPE A;  3U1C A;  1NYH A;  2FXP A;  2Y0E A;  4HH2 A;  3S1K A;  1S72 P;  1FJK A;  2A06 D;  2YMY A;  2VRS A;  4WWI A;  4EYY Q;  2IYO A;  3CMA P;  2B87 A;  2DW3 A;  1JY3 P;  1AJY A;  1SFC B;  3PH0 A;  4K3A A;  4DCK A;  3W68 A;  3V2Q A;  1AQT A;  4L76 A;  2E5T A;  1FZF A;  2WVR A;  1KOR A;  1VQP P;  3RL0 B;  2KZJ A;  1JY2 N;  3NXS A;  1T2K C;  4A7P A;  3HUS B;  2KS1 B;  4I7Z B;  1NJI Q;  1L0N E;  1ZRT E;  1YTZ I;  1FZA A;  4PD4 E;  1KQL A;  3AE8 C;  4DZO A;  3BVH A;  2A45 H;  2L91 A;  1FZC C;  3L71 J;  3H6P A;  1VQO P;  1NTM K;  3AE2 C;  2I8D A;  1UII A;  2O01 H;  3EQ2 A;  3H1J G;  1DEB A;  2FYN C;  3H1L J;  3K5B A;  1VQ9 P;  2OGU A;  5KAF H;  2HPC A;  3L73 D;  1KIL B;  2WSC J;  3B5N D;  2QJK B;  2KB7 P;  3VYI A;  2A45 G;  2YKO A;  1XTG B;  2KK7 A;  1PPJ G;  1J2J B;  3L73 G;  4HYT B;  2N1T A;  3BRT B;  1LGH B;  3L74 G;  3MUD C;  1ZW0 A;  3UIA A;  2BCC E;  4PV1 C;  3CPW O;  3A0H H;  1SQX D;  2P1J A;  1M1K Q;  1ZP0 C;  1LT9 B;  1YTZ T;  2FFD C;  1JY2 P;  1LWU B;  1S1C X;  1X0T A;  3II6 A;  3L35 A;  4TLF A;  4QMA A;  4WBA A;  1VL2 A;  3Q5R A;  2ZFC A;  2YIU B;  4W7Z A;  1EDJ A;  1H0T A;  2M5A A;  4RJT A;  1FJP A;  1NH4 A;  3VN0 A;  3TSI A;  2ZJS E;  1HJB A;  1RF1 A;  3L72 J;  2ZAE B;  3CX5 I;  4H13 B;  3H1H J;  5KAF E;  2Z4E A;  1NU1 K;  3G71 P;  1SQB E;  1NTZ K;  2KLU A;  3P8M C;  3L70 E;  1ZR2 A;  1RF1 C;  2KNC A;  1VQ5 P;  3RK2 D;  2D2C B;  4U3F D;  1RE3 C;  1KFN A;  2ZYA A;  4YPC A;  5AW9 B;  3G6E P;  3CXH I;  2IBZ G;  1W2B O;  3SWK A;  1L4A D;  1BGY G;  3M9H A;  2WT7 A;  1CI6 B;  1VF5 B;  1TU3 F;  2XKM A;  4U3F G;  4KHX A;  3D6Z A;  1KMI Z;  5AW1 B;  1S9K D;  4IL6 X;  1R5S A;  1SQQ J;  2PGD A;  2IFN A;  4Y28 J;  3CC7 P;  3ABV C;  2AXT E;  4HB1 A;  1G2C A;  1PV3 A;  2XZR A;  1VDF A;  2J58 A;  2Y9Z A;  4U3F J;  4EDF A;  3TGU D;  3H1L D;  1M57 D;  3CX5 D;  3A5T A;  2IBZ I;  3HD7 D;  1IFP A;  2IYP A;  1LNQ A;  2QM8 A;  1N2D C;  1SFC C;  5AVX B;  1U7J A;  1NTK D;  1NU1 G;  2HYN A;  4H0L D;  2OYI B;  1VQN P;  4D6T E;  1QVG O;  1BSN A;  1GK4 A;  2BCC D;  5BVZ A;  3VMX A;  4RKU J;  3S9O A;  1FS0 E;  3L71 G;  4JYB A;  2CPS A;  1N7S A;  1S2E A;  4GOD A;  4K35 A;  4PD4 H;  1NTZ G;  1L0L J;  3MP7 B;  3V2R A;  3CXH D;  1G1J A;  1SQX J;  3H1J D;  4LLH A;  1NTK G;  1NU1 D;  2E76 D;  1RQV A;  3B8E B;  3BCC J;  4OGQ B;  5AVR B;  1RF0 C;  3V2N A;  3P8C E;  3A3Y B;  1HWT C;  1NAF A;  1NAY A;  1YIJ P;  4N3Y B;  3F89 A;  1URQ C;  2J59 M;  3USS A;  1FC2 C;  4C46 A;  3N4X A;  1OZH A;  2WSF J;  3H32 B;  3I5C A;  3L73 J;  3MUD A;  5GTH H;  4OH8 B;  1KB9 E;  2IDB A;  3H1K D;  3L74 J;  5APT A;  3CME P;  2E74 B;  1M90 Q;  5AVS B;  2GUS A;  3GHG B;  4ZKP A;  1N8R Q;  1NVO A;  3A0H E;  3AE5 C;  3GF3 A;  1BCC D;  3GW6 A;  3RBZ A;  3TNU B;  1SQQ D;  5B66 H;  3F5H A;  4L73 A;  1ZOY C;  5CCG D;  3CCU P;  1K73 Q;  2W8Z A;  3M0A A;  2WMM A;  3BCC E;  1YYC A;  3R4Y A;  2NPS D;  3Q3D A;  2R5B A;  1OXZ A;  1AVO A;  1D7M A;  1HGZ A;  5C39 A;  3VTP C;  2O01 J;  1P84 D;  2B9B A;  4DJG A;  1GZL A;  1NTZ E;  3MIW A;  4L75 A;  4ZNC A;  1SFC A;  2Q5U A;  2KSE A;  1JTH A;  3NMD A;  4JPZ B;  2KSJ A;  1JCD A;  1T3J A;  5GTH E;  1LTA C;  5KKZ B;  1K04 A;  4EOT A;  1VQ8 P;  2ITA A;  1KB9 H;  1JMB A;  2Z5I A;  3V2P A;  2K9J B;  1HBW A;  2YKP A;  3B4S A;  3MD0 A;  3V4Q A;  1HGV A;  1BE3 D;  4C7N A;  1SQP J;  5B66 E;  4IOI H;  4Y99 C;  1EZV E;  3Q2Y A;  3GF7 A;  3RK2 B;  1KIL C;  3RK3 D;  1DIP A;  2IPP A;  1IK9 A;  2FXM A;  2AXT H;  2CK3 H;  1M56 D;  5KJ7 C;  1FZB A;  1FBM A;  1N7S D;  2W6B A;  3H1L E;  3Q5S A;  2HPC B;  4H13 D;  1IFN A;  4I2L C;  3CC4 P;  1SQV G;  1Q82 Q;  1AFO A;  2E42 A;  2H89 C;  1BCC G;  2WSE J;  1HTL C;  4PJ0 H;  5KTB A;  3AEG C;  1X79 B;  4XA4 A;  5CMZ A;  3MTU E;  1S5L X;  1YJ9 P;  3AEF C;  1DD4 A;  2FKW B;  1PIX A;  2O1K A;  1KIL E;  1WMK A;  1MFZ A;  2RH0 A;  1L0L G;  2V7Q H;  5APV A;  3H1I J;  5AVU B;  1H0T B;  4LGD E;  3AE4 C;  3AE6 C;  5APQ A;  1L0L D;  2P10 A;  1E5W A;  3ITK A;  2P67 A;  4PV1 B;  5AVY B;  1AA0 A;  2LR2 A;  3HTK B;  3SWY A;  3AE9 C;  1JB0 J;  2P58 A;  3V5B A;  1VF5 C;  3C1L A;  1FOS E;  2BEZ F;  1W5C E;  1PGO A;  2WIT A;  4WY4 B;  3CWB E;  1KB9 I;  3CCV P;  1OMI A;  1M7L A;  1S4X A;  1SQB J;  4ASW A;  2AEM A;  1YHQ P;  2BCC G;  2C9N Y;  2Y9Y A;  1AV1 A;  1USD A;  1QL2 A;  1W2E A;  4C7R A;  1GL2 B;  2FYN B;  5KLV G;  1BE3 E;  4HKZ H;  1H89 A;  2BAS A;  2E75 D;  2KS1 A;  1MKM A;  2HR3 A;  2KXP B;  3CI9 A;  2E43 A;  5CJ0 A;  1GK6 A;  2AXC A;  5CCH C;  1OIP A;  1USE A;  2D2C D;  2KUB A;  2QJK C;  3LID A;  3PRJ A;  5AVV B;  1G2C B;  5AW2 B;  3W67 A;  4TT3 H;  2WPR A;  4BRY B;  1A02 F;  1GTW A;  1PFI A;  1EDL A;  1MV8 A;  5TIS E;  1OW7 A;  3IF4 A;  4H44 C;  1NO4 A;  3VMZ A;  1YBK A;  4H0L B;  1KIL A;  1JY3 O;  1IFD A;  4GKG A;  4LC1 A;  2H8P D;  3LW5 H;  3IN6 A;  3D6Y A;  5AW3 B;  1S3J A;  2FBW C;  2H43 A;  1PPJ D;  1NTK K;  3L36 A;  5CHX A;  2QG4 A;  1CSB A;  1KFM A;  1AVY A;  2N1T B;  3KHU A;  3U59 A;  3HUS C;  3TYY A;  4BXL A;  3B5N A;  4OGQ C;  3CC2 P;  1P84 H;  2WSC H;  3HD7 A;  1LP1 B;  5CBN A;  3TGU E;  1RHZ B;  1T8Z A;  1SQB K;  1ZR4 A;  1VQ4 P;  3JC2 2;  3RK3 E;  2K3R A;  1EZV D;  1FE6 A;  3H1J J;  2K37 A;  1JM0 A;  4L74 A;  1KV4 A;  3QWO C;  1SQV J;  1S9K E;  3D71 A;  3L72 E;  1NWQ A;  3CD6 P;  2G8Y A;  2W6J H;  1NU1 E;  2OTL P;  3U1A A;  3KPE A;  4PJ0 E;  2FYU J;  2QJY B;  3IFM A;  1KZU B;  1T3U A;  1KQS O;  1BDC A;  2JJL A;  4OGQ D;  1LTJ B;  1HVV A;  1P84 E;  5KJ7 A;  1VQ7 P;  1LT1 A;  3TNU A;  3L37 A;  2N9Y B;  1U57 A;  3OJA B;  1PP9 J;  4BWN A;  3G4S P;  3CCS P;  3VP9 A;  3CXH H;  3SFD C;  2PRR A;  1IO4 A;  1OVR A;  2YXQ B;  1FZE A;  2IFM A;  2M3B A;  2JO1 A;  2O01 N;  2ZXX A;  3CCL P;  5KLV E;  1NKZ B;  3FXE A;  3GLM A;  2M8R A;  2OYO A;  3H1H E;  1PP9 G;  2K88 A;  1DH3 A;  3O6Q B;  3CWB G;  2NPS A;  2HLO A;  4O9B A;  4GIF A;  3L75 D;  5KLV J;  3VP8 A;  2E75 C;  2K9J A;  4CPG A;  2M3E A;  2Z5H A;  1RE3 A;  2OTK E;  3VOP A;  1K05 A;  3EWK A;  1PP9 E;  5AVW B;  1N7S B;  1KYO D;  1L4A B;  1SQQ G;  2IBZ D;  3E1R A;  3CXH E;  1KQF B;  2OYH C;  1VF5 D;  2K9Y A;  5KLI B;  3TK1 A;  1FU1 A;  2XU6 A;  4IFF A;  2JDI H;  3L75 E;  5KAI E;  3IAO A;  3JSV C;  1EQ7 A;  3QH9 A;  5TIS H;  1GU5 A;  5AW5 B;  1BCC E;  1R8E A;  3AEB C;  3H1K G;  3A7O A;  1RH5 B;  3IR9 A;  1N86 A;  1RF1 B;  2R3S A;  2KYV A;  3MHV A;  1FZG A;  2W90 A;  3AE1 C;  3C8V A;  3AEA C;  3CLQ A;  1DX7 A;  2JWD A;  1PGQ A;  3AE3 C;  1WT6 A;  4W80 A;  4N78 E;  3H1K J;  1NTZ J;  1WRG A;  3FX0 A;  2HG5 D;  3L74 D;  3KZI E;  4I7Z C;  1SP4 A;  1LTS C;  2WPQ A;  4H13 C;  1Q7Y Q;  1VQL P;  3VMY A;  1N7S C;  3HTK A;  2O3J A;  3KDP B;  3L71 D;  1L0N G;  5KJ7 D;  1VQM P;  5AVZ B;  1NTZ D;  1KYO I;  1BE3 J;  1KIL D;  1P84 I;  4WY4 A;  1Y8A A;  1BSH A;  3HE4 B;  2Q3I A;  3LW5 J;  2I1J A;  3T97 A;  2C0W A;  2PFX A;  5AW0 B;  5AW4 B;  2UWJ E;  5B5E E;  2V7Q J;  1FZC A;  4D6T D;  2E75 B;  2POH A;  1GL2 A;  1GW4 A;  3Q5P A;  1RE4 A;  1ZN5 A;  1KD1 Q;  4GDO A;  5CJ4 A;  1L0N D;  1KQG B;  1ZRT D;  2R3C A;  2ZXE B;  4H44 B;  4OVN F;  2QA4 P;  1LTB C;  2RMZ A;  2OQQ A;  3E1I A;  3E7K A;  3BAT A;  3M91 A;  4HJG H;  1L2P A;  4R4M A;  3BAS A;  5APX A;  5APY A;  2E76 B;  2KI7 B;  1JY3 N;  2FYU D;  1FOS F;  2QJP B;  3AED C;  1IC2 A;  1LWU C;  1SVF A;  2NRG A;  2V4H A;  1SQX E;  1Y9B A;  2NPS C;  2OYH A;  1YQ3 C;  4ZKU A;  3CWB J;  1SQP D;  1CZQ A;  2YNY A;  5CCG C;  5AVT B;  4Z1M H;  1FDO A;  1S5L H;  3I56 P;  2OYI C;  1DEE G;  1RQU A;  2H7H A;  1UIX A;  2QSI A;  3KXD A;  2HOD A;  2JEE A;  3L72 G;  2JKV A;  4GT1 A;  2QIW A;  5AW8 B;  3HD7 B;  4RO0 A;  1HH0 A;  5BU8 B;  3NTN A; 
#chains in the Genus database with same CATH homology
 2YO3 A;  5KLV K;  1JOC A;  1RY3 A;  2WSE H;  4Y99 B;  2IX7 C;  1G1I A;  1URQ D;  1NKN A;  4I1L A;  2KLV A;  1JO5 A;  1JNM A;  2FFD A;  1LTG C;  1Z56 A;  1HUC A;  2OAR A;  5APW A;  4N6J A;  5CCH D;  1M1J A;  4AYC A;  3HE5 B;  3LIE A;  1SFC D;  2FYU K;  1JMM A;  3P32 A;  1LTT C;  2GUV A;  3HD7 C;  3WMM 0;  1CW5 A;  1J1D B;  1M1J C;  1SQP K;  1IJD B;  1SLQ A;  5AW6 B;  4N78 D;  2HFE D;  2NPS B;  2CPB A;  4I6M C;  2WSF H;  2YO2 A;  3HUS A;  2I1K A;  3B5N B;  5CCG A;  5AVQ B;  1A02 J;  1JCC A;  1L4A A;  2XDJ A;  1L0N K;  1GDT A;  2XNX A;  1N7L A;  1XTC C;  5APU A;  1H88 A;  1H8A A;  4AQR D;  3KYQ A;  3P7K A;  1J1D C;  5BU5 A;  2O1J A;  2KOG A;  3RK3 C;  5KJ7 A;  1LT9 C;  4B86 A;  1N73 C;  1GU4 A;  1X9V A;  1URQ A;  1LTJ A;  2N9B A;  4RES B;  4EIJ A;  1SQQ K;  3M9B A;  1X8Y A;  1J1E B;  1L0L K;  1SQV K;  3EFG A;  2P7J A;  5CCH A;  1FZC B;  1RE4 C;  3OAK A;  1T2K D;  3KQG A;  3M0D C;  2MJZ A;  3R2P A;  2WWW A;  2WPS A;  2Q7C A;  2W27 A;  1GW3 A;  4M3L A;  1QL1 A;  3V4W A;  2OYH B;  3L4F A;  2PP6 A;  5AW7 B;  1MZ9 A;  4WB4 A;  4XE5 B;  1FDM A;  2WZ7 A;  1LT9 A;  3G3Z A;  4IFM A;  2P2U A;  1LWU A;  3NFQ A;  1NOH A;  3SWF A;  3C9I A;  3P8C D;  3N7N A;  2L5G B;  1IFI A;  1IFJ A;  1VPC A;  3M06 A;  2FFD B;  1J1E C;  4AUW A;  1GL2 D;  1MUU A;  3CL3 D;  3HE4 A;  1LTJ C;  2Q9I A;  3GHG A;  3M0D A;  4WY4 D;  2WT7 B;  1CI6 A;  1N73 B;  2GM4 A;  1L4A C;  3RL0 D;  2W6A A;  2N1T C;  3RK2 C;  4IFD K;  2R32 A;  3A2A A;  1ZV8 A;  2FYZ A;  1LTI C;  1JTH B;  1OWA A;  3O8Z A;  5APS A;  2N1T D;  3PP5 A;  3RL0 C;  1SQX K;  2YKQ A;  1FAV A;  1AQ5 A;  1IFM A;  3BRV B;  2PAJ A;  2QM7 A;  4WY4 C;  2HOD B;  2WTY A;  4C7N B;  2R5D A;  1JY2 O;  2XV5 A;  1GL2 C;  1JUN A;  2A45 I;  3RK3 B;  2C9L Y;  3B5N C;  3MGN A;  2LKM A;  3GHG C;  4DOJ A;  1RF0 A;  3M9Q A;  1ZLL A;  3HRN A;  3H32 A;  3OA7 A;  4W7Y A;  1M1J B;  1URQ B;  3HE5 A;  2C0X A;  2KP8 A;  1NHL A;  4JF7 A;  3U1C A;  4HH2 A;  1FJK A;  2YMY A;  2VRS A;  1JY3 P;  1SFC B;  3V2Q A;  1FZF A;  3RL0 B;  1JY2 N;  3NXS A;  1T2K C;  3HUS B;  1YTZ I;  1FZA A;  1KQL A;  4DZO A;  3BVH A;  1FZC C;  2A45 H;  3H6P A;  1NTM K;  2O01 H;  3EQ2 A;  1DEB A;  2HPC A;  1KIL B;  3B5N D;  2KB7 P;  3VYI A;  2A45 G;  2YKO A;  1XTG B;  4HYT B;  4JYC A;  1J2J B;  5AVS B;  2N1T A;  3BRT B;  1LGH B;  3UIA A;  2P1J A;  1LT9 B;  1YTZ T;  2FFD C;  1JY2 P;  1LWU B;  3II6 A;  3L35 A;  4WBA A;  2ZFC A;  4W7Z A;  1FJP A;  1NH4 A;  3VN0 A;  3TSI A;  1HJB A;  1RF1 A;  2Z4E A;  1NU1 K;  1NTZ K;  3P8M C;  1ZR2 A;  1RF1 C;  3RK2 D;  1RE3 C;  1KFN A;  5AW9 B;  1L4A D;  3M9H A;  2WT7 A;  1CI6 B;  2XKM A;  4KHX A;  1S9K D;  5AW1 B;  2IFN A;  1G2C A;  2XZR A;  1VDF A;  2J58 A;  3A5T A;  3HD7 D;  2QM8 A;  1N2D C;  1SFC C;  5AVX B;  2HYN A;  2OYI B;  1GK4 A;  5BVZ A;  4JYB A;  2CPS A;  1N7S A;  3V2R A;  5CJ4 A;  1G1J A;  4LLH A;  1GD2 E;  3B8E B;  5AVR B;  3V2N A;  1RF0 C;  3P8C E;  3A3Y B;  1HWT C;  1NAF A;  4N3Y B;  1URQ C;  2J59 M;  4C46 A;  3N4X A;  3H32 B;  3I5C A;  3MUD A;  4OH8 B;  5APT A;  2GUS A;  3GHG B;  4ZKP A;  3TNU B;  5CCG D;  3M0A A;  1YYC A;  2NPS D;  2R5B A;  1OXZ A;  1HGZ A;  3VTP C;  1GZL A;  3MIW A;  1SFC A;  2Q5U A;  3NMD A;  1JTH A;  2KSJ A;  1JCD A;  1T3J A;  4EOT A;  1LTA C;  2Z5I A;  3V2P A;  1HBW A;  2YKP A;  3MD0 A;  3V4Q A;  1HGV A;  4C7N A;  4Y99 C;  3RK2 B;  1KIL C;  3RK3 D;  2IPP A;  1IK9 A;  2FXM A;  5KJ7 C;  1FZB A;  1FBM A;  1N7S D;  2W6B A;  2HPC B;  1IFN A;  4I2L C;  1AFO A;  2E42 A;  5KTB A;  1HTL C;  1X79 B;  4XA4 A;  5CMZ A;  3MTU E;  2FKW B;  2O1K A;  1MFZ A;  5APV A;  5AVU B;  4LGD E;  5APQ A;  1RF1 B;  1E5W A;  5AVY B;  2P67 A;  3HTK B;  3SWY A;  3V5B A;  1FOS E;  2WIT A;  4WY4 B;  1M7L A;  2C9N Y;  4C7R A;  1QL2 A;  1W2E A;  1GL2 B;  1H89 A;  2BAS A;  3CI9 A;  2E43 A;  5CJ0 A;  1GK6 A;  5CCH C;  5AVV B;  3LID A;  1G2C B;  5AW2 B;  2WPR A;  1A02 F;  1GTW A;  1PFI A;  1MV8 A;  3VMZ A;  1NO4 A;  1KIL A;  1IFD A;  1JY3 O;  4GKG A;  4LC1 A;  2H8P D;  3LW5 H;  5AW3 B;  2H43 A;  1NTK K;  3L36 A;  5CHX A;  3U59 A;  1CSB A;  1KFM A;  2N1T B;  3VMX A;  2OYI A;  3HUS C;  3TYY A;  3B5N A;  2WSC H;  3HD7 A;  1T8Z A;  1SQB K;  1ZR4 A;  1S9K E;  1NWQ A;  3U1A A;  3KPE A;  3IFM A;  1KZU B;  1T3U A;  2JJL A;  1LTJ B;  1HVV A;  3TNU A;  3L37 A;  3OJA B;  3VP9 A;  1IO4 A;  1FZE A;  2IFM A;  2M3B A;  1NKZ B;  2M8R A;  1DH3 A;  2NPS A;  2HLO A;  4O9B A;  4GIF A;  3VP8 A;  2Z5H A;  1RE3 A;  3VOP A;  5AVW B;  1N7S B;  1L4A B;  2OYH C;  3TK1 A;  1FU1 A;  2XU6 A;  4IFF A;  1EQ7 A;  1GU5 A;  5AW5 B;  3A7O A;  3IR9 A;  1N86 A;  2KYV A;  1FZG A;  3CLQ A;  1DX7 A;  1WT6 A;  4W80 A;  4N78 E;  1WRG A;  2HG5 D;  1SP4 A;  1LTS C;  2WPQ A;  3VMY A;  1N7S C;  3HTK A;  3KDP B;  5KJ7 D;  5AVZ B;  1KIL D;  4WY4 A;  3HE4 B;  2Q3I A;  2I1J A;  3T97 A;  2C0W A;  5AW0 B;  5AW4 B;  1FZC A;  2POH A;  1GL2 A;  1GW4 A;  1N73 A;  1RE4 A;  1ZN5 A;  2R3C A;  2ZXE B;  1LTB C;  3M91 A;  3E1I A;  3BAT A;  3BAS A;  5APX A;  5APY A;  1JY3 N;  1FOS F;  1IC2 A;  1LWU C;  1SVF A;  2OYH A;  2NPS C;  4ZKU A;  1CZQ A;  2YNY A;  5CCG C;  5AVT B;  2OYI C;  2H7H A;  2HOD A;  2JEE A;  4GT1 A;  5AW8 B;  3HD7 B;  1HH0 A;  5BU8 B;  3NTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...