2Y9ZA

Chromatin remodeling factor isw1a(del_atpase) in dna complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
287
structure length
287
Chain Sequence
RSSTPSHPRMPKPHVFHSHQLQPPQLKVLYEKERMWTAKKTGYVPTMDDVKAAYGDISDEEEKKQKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDATKDRMKKED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Mechanism of the Chromatin Remodelling Factor Isw1A
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)
total genus 70
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09110 HAND HAND
A PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9zA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9zA04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2y9zA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 2y9zA03
4DW6A 1MNMC 3BTIA 4AC0A 5J3LA 1X2MA 1IJWC 3ZQGA 1VI0A 3HKZN 1FTTA 3WHBA 4XICA 2LVSA 2R5YA 3S16J 2JK3A 2L7FP 3OSFA 2XGDA 3MVPA 2L9RA 2MGQA 4JYKA 5FJ8J 3TP3A 5EDNA 4RBOA 3TEDA 3BG9A 2YU9J 2M0CA 2W48A 4OVNF 1I3QJ 1GT0C 2WAQN 2DJNA 4JP0A 1YRNB 4MIMA 1HF0A 1DU6A 1B72B 3PO3J 2ID3A 2MW8A 2JA7J 2NVQJ 2L0KA 4IEJA 1RR7A 1NTCA 4V2FA 2HOTA 1ZQ3P 4IHVA 3GTQJ 1IGNA 1JTYA 5K7ZA 2H1KA 3LSPA 2CJJA 5E3NA 3JREA 2VUMJ 4D5FA 1W0TA 1JGGA 2NS7A 5FKMA 1QPIA 1F36A 3BR3A 3JRIA 5C4JJ 3F0CA 2PMZN 4BBRJ 3UKGA 2EZIA 1ZTRA 2HXIA 3GTLJ 2X6OA 2I10A 1I50J 2L7ZA 4Y52J 2P81A 3HDDA 3C2BA 4XIDA 2Y30A 1JT6A 4EEFG 9ANTA 1RPWA 4L5EA 1SFOJ 1MH3A 3IH4A 4UUSB 2R5YB 1ZR2A 1UHSA 1P7IA 1Z77A 2DA2A 4C3IJ 3K7AJ 2O9LA 4DZJA 2OF7A 1MBHA 2JN6A 1UMQA 2XGEA 2R5ZB 2YS9A 2B63J 2DA7A 3GTGJ 4MFEA 3OSGA 1RETA 5F0CA 2NS8A 2KDZA 2DTZA 2DMQA 1W0UA 3DCFA 1D5YA 1CQTA 4NDLA 5FLMJ 1RKTA 4JQ0D 1IDZA 4D7NA 4XRSG 5GPAA 3SJMA 2IAIA 2XPVA 1GUUA 1OCPA 1IRZA 3SFIA 3LSGA 5K7FA 1TWAJ 2CQXA 2HOAA 2HYJA 3GTMJ 2ME0A 5F04A 2O8KA 5IP9J 2EZKA 3GTJJ 1ZKGA 4M3FA 1LE8B 2NVXJ 4BKXA 3Q0WA 3G1OA 1TC3C 1FTZA 3OOUA 3JRAA 3FKIJ 5IYDJ 2Y31A 1BJZA 3BTLA 5IOYA 5DTDA 1K61A 2M2EA 2HXOA 1AU7A 5FKNA 4AYBN 5F08A 2N8GA 2O7OA 1TWHJ 5C4XJ 4M6VA 2X48A 5F0HA 4UUSA 2DA1A 1MBEA 4G12A 3S17J 4I76A 1F43A 5C3EJ 3BR6A 5FKLA 3IH2A 3JR9A 1ZGWA 5M5XJ 1JT0A 1X2NA 3OIOA 2CUFA 3Q0UA 1HLVA 3M4OJ 3I4MJ 1QVTA 1LE8A 2NVTJ 3ZQIA 1JUPA 2YUSA 4A3LJ 2TRTA 1PUFB 4AUXA 2LD5A 2E2IJ 3JRFA 2X9DA 1OFCX 2Y9YA 2JMWA 3RKQA 1AKHA 3BT9A 1XC5A 1FEXA 2LK2A 5EEAA 2JJ7A 1JKRC 2IEKA 2ID6A 3PM1A 3A01B 4C2MJ 2XGCA 4MLOA 4HNVA 1JJ8C 3GTOJ 2Y9ZA 1LFUP 4UUTA 2K9NA 4QIWN 1AHDP 4DYCA 4M3GA 2FX0A 2E2HJ 1DU0A 5GP9A 2CU7A 1JKQC 4MFDA 4A93J 4DCKA 1T56A 1Q1VA 3SDGA 4M3EA 4C3JJ 2ECBA 2E2JJ 5EYRA 4IHYA 2XRLA 3Q3SA 2XSDC 3S1RJ 3PO2J 3CQZJ 4X1EA 2WB1N 4DZPA 1MSEC 2DA3A 4IHWA 5EGOA 3GTPJ 2DA4A 1WI3A 5E3MA 3IV5A 3S1QJ 3HOUJ 5JLWA 1Y1WJ 5E3LA 3S1NJ 1Y1VJ 4IHXA 1WH5A 3MKLA 3B6AA 4JX6A 4DYRA 1E3OC 2CRGA 4A3BJ 3WHCA 1PUFA 1ZR4A 3CDLA 2LFBA 3VPRA 5M5YJ 4FISA 4V2GA 5M5WJ 3TW6A 1B72A 2XB0X 1XS9A 1RKWA 2VKVA 4W1UA 2LP0A 3TW7A 1O4XA 1ITYA 3BR5A 4A3GJ 3FISA 1MBKA 2K9QA 3HGGA 4Y7NJ 1OCTC 4ABZA 1NK2P 2COBA 2LY9A 3FK6A 3GBGA 1GV2A 5F1JA 1YRNA 1IG7A 5FKKA 2JA6J 1JTXA 4BXXJ 1JUMA 5F27A 2TCTA 1QVUA 3A02A 3NAUA 5EZGA 2DMPA 2OPTA 2KT0A 3S2DJ 2E1OA 3FIWA 1JJ6C 3BR1A 1IV6A 3QPLA 2XB5A 5IP7J 1GVDA 1S7EA 2LR8A 1SANA 3FK7A 5EGOB 1MBJA 3HOXJ 4A3KJ 1U9OA 4C3HJ 2GM4A 4XRMA 3G1LA 1QRYA 4B4CA 1ETVA 3DEWA 3A01A 5DS9A 3BG5A 2ZB9A 1P7JA 1FIPA 3L1PA 2GBYA 3BQZA 2DMTA 3O8HA 3Q0VA 3S2HJ 3HB9A 3RZDJ 3BG3A 3HOYJ 1HDDC 3GTKJ 2QF7A 1R9TJ 2H8RA 4A3JJ 2R92J 3H3VK 4JX5A 3G1MA 1BA5A 1WGXA 3B6CA 2Y0SN 1TWFJ 1VNDA 1ZK8A 2CQQA 5F0FA 1MSFC 5M3MJ 2AHQA 2FJ1A 5J1YA 1ENHA 4D7MA 3ZQFA 4B3AA 1APLC 1BW5A 4FTHA 2R7ZJ 1K83J 5IOZA 3S15J 4GFBA 5EF6A 4XK4A 2G0EA 2EH3A 5C44J 3CMYA 3NARA 2WV1A 3RQIA 4QSHA 1H89C 4J19A 5EG0A 3ZQCA 2VPRA 3A03A 3HBLA 2LLKA 1IDYA 2E19A 2VI6A 2GLOA 2MSYA 3S14J 1JKOC 1H88C 3LNQA 2K9SA 3IH3A 1FJLA 1JUSA 1A6IA 4LOCA 3BQYA 3K2AA 3W6VA 3BTJA 4BY7J 4S0HB 4A3IJ 1MBGA 2NVYJ 4D5CA 2AO9A 2M8GX 1G2HA 5EG0B 1VF9A 4BY1J 3S1MJ 1GV5A 5GPCA 4QTRA 2M34A 2DMNA 2R0QC 5FLVA 1TWGJ 2ELKA 2VKEA 1OJLA 1MBFA 3JRGA 5K7HA 2D5VA 3O8GA 2JA8J 3CCYA 2NOGA 5IYBJ 1U78A 2ECCA 3HOVJ 2HQ5A 2EZLA 3QPSA 2EBIA 1HOMA 1TWCJ 3JRBA 2XPUA 3HGYA 1WCMJ 2LKXA 2XPWA 5IYCJ 1JKPC 2HDDA 4MO7A 3JRHA 4X6AJ 5J1UA 4A69C 2LTPA 1HCRA 3ZQHA 3ZOBA 2DA5A 2K40A 5J1RA 3D1NI 1BL0A 1AKHB 4FE4A 1ETYA 4A3MJ 1ETWA 2JA5J 1ETXA 1HDPA 1BW6A 2Y2ZA 4JX4A 2CUEA 3LOCA 3LSJA 3I4NJ 1ETOA 5JLXA 4XRSA 3TP0A 1MH4A 4CYCA 1EF4A 1B8IA 1T33A 1B8IB 1NK3P 3JRCA 2FQ4A 1UG2A 2JWTA 3QQAA 5M3FJ 2R5ZA 1U9NA 4W97A 3H0GJ 1FIAA 2MG4A 1A5JA 1H8AC 1WPKA 5IPAA 2IBDA 2HOSA 4B1RA 2FD5A 1IUFA 3ZQLA 3HOZJ 2EQRA 5BNGA 5IP6A 1LFBA 3M3YJ 2QCOA 2R93J 1ETKA 1X58A 4CYCB 2EZHA 3MN2A 3RZOJ 1Z0XA 2RAEA 4A3DJ 3HM5A 1U8BA 4BBSJ 3BR0A 4A3EJ 4RDUA 2DA6A 1IC8A 4FE7A 2DMUA 1GDTA 3LSRA 4FCYA 4JPZB 1VFCA 5EZHA 3HEFA 1ETQA 4A3FJ 2L7MP 1WH7A 3E7LA 1ORKA 5FKOA 1I6HJ 4M3DA 3HOWJ 2M9HA 3BR2A 4M3BA 2HI3A 1POGA 1XG1A 5E3OA 5HODA 2ME6A 4I6ZA 3BTCA 4DYQA 3JRDA 4A3CJ 2DN0A 1RESA
chains in the Genus database with same CATH superfamily
1FBQA 2C6YA 1T6SA 4P5OA 3C7AA 2NXNB 3BTIA 5J3LA 1N86A 3ADOA 3SEQA 3U2RA 4CYDA 5E18F 3E6BA 3WHBA 2LKSA 1N1EA 2LVSA 1XCBA 2Y0CA 2ZNZA 3QP6A 5CQEA 2FBHA 3ZGYA 1SQPJ 3K69A 5AVUB 3W2AA 2P67A 1LP1A 4UB8H 2NS0A 2XGDA 5EDNA 1ZRTD 3TP3A 5GTIH 2F48A 3BG9A 3EPZA 3DU5A 4DOZA 3TSIA 1KB9H 5E1ZB 4FGWA 4Y4RA 4XBFA 3L72G 4ZKPA 1USDA 1DU6A 1DD3A 5CVJA 1BM9A 4FASD 1B72B 1YJQA 2HTSA 3HZJA 3LSIA 3CCSI 2ID3A 1K79A 5A9RA 1TU3F 3L72D 2MW8A 1NU1G 3WU2E 2NVQJ 2I1KA 2L0KA 2HFED 1NTCA 4V2FA 1FJKA 2F5EA 1ZQ3P 1GTWA 1UJ8A 3PLRA 3BWGA 1NU1D 1LJ9A 2DOEA 2H1KA 3S4RA 1MMGA 5ILVA 1OW7A 2M4GA 1LTGC 3KYDB 4YELA 4KJZA 2A45I 1G4DA 1KZHA 2KLOA 4F93B 1BE3E 3DV8A 4G9YA 2Z33A 4Y99B 1N75A 3ZN1A 4RESB 4M74A 1AOYA 2WPQA 2LF8A 1H8AA 3RL0B 4UV8A 2O1KA 1VQNI 5AW5B 1RE3C 1IRFA 5FROA 1SMTA 3U21A 1KQGB 4PD4D 3M07A 4EMSA 3CZ6A 4O5VA 5FWNA 1T3UA 4E12A 1FZGA 3OYHA 2E36A 3B5NB 3KXDA 1YJNI 2M8RA 3W68A 2X6OA 2I10A 4U7BA 3FWEA 4HG2A 2K5CA 4A5NA 2BCCJ 4Y52J 5M1BA 1XGNA 2P81A 5E17F 2KYVA 2Q3IA 4I7ZB 1ZLJA 4UY8I 3AEBC 1FC2C 2V9KA 4PGHA 4DYDA 5E1XA 3WE2A 1GW4A 2Y30A 3DP7A 4A0YA 3MZ8A 4M6YA 4EEFG 1DIPA 2O01N 2VT2A 4RM3A 2H89C 2M87A 1P4WA 5J40A 2BBYA 3W67A 3KEOA 3TO7A 4BWNA 2FUG2 2L9NA 4KT5C 4CZCA 2Z16A 1ZR2A 2O9LA 4IOAF 3DBLB 1U3EM 2Q5UA 3K7AJ 3F89A 4N6JA 4TLFA 5KTBA 2R5BA 2OF7A 4QWQA 1MBHA 1B6AA 3L2WA 1JMBA 4C30A 2HEOA 1W7PB 3GTGJ 3KQGA 1Q1HA 5DJTB 4L0YB 1ZLKA 4M73A 1AA0A 4RS8A 2K3PA 5F0CA 4U87A 4UB6E 2NS8A 3REOA 2X1CA 2DMQA 3ZCOA 2KDZA 1FT9A 1KORA 2RH0A 2DPDA 2ESHA 2ETHA 4PFOA 3SZTA 3TO9A 2D2CC 2JP3A 4NDLA 5FLMJ 1RKTA 2EJRA 1HH0A 1ZGAA 1KB9D 3FXUA 2QGUA 1ZMEC 2DOFA 1IUYA 2LOOA 4AUWA 4CCMA 2F5VA 1ZREA 2X6XA 1FP1D 1GL2D 5CHXA 1QEXA 1X0VA 4M9ZA 2HYJA 2FFDC 1OISA 1MDMB 2EZKA 1H88A 4M3FA 4PJ0H 3L73J 2FYUE 1KQSO 1SC7A 2V6CA 2K88A 4EI2A 1R5ID 1UHMA 2IFMA 2RKHA 4EJVA 1RQUA 3I4PA 3QAHA 1VQ6P 2DK5A 3EQLF 1PPJD 3JRAA 1IFMA 2ZXIA 2H94A 4MTDA 4X0GA 4UNOA 5JE8A 2OARA 1FMVA 3R60A 3H32A 4IOIH 3ZWAA 3ELKA 4IZZA 1NO4A 2Y31A 3TNUA 3EFGA 1BJZA 2GXGA 3BTLA 3C2GA 2A6TA 4FT8A 4NC8A 5H6QA 3PQJA 5IOYA 2D45A 1K61A 1PGNA 4BXFA 3JC22 3OS0A 5JFRA 2XAUA 5HOOA 2OYHB 5F08A 1KILC 3SWKA 2CGPA 5D5XB 2YNYA 2OTLP 4PV1C 3F6OA 3S3OA 4M6VA 2X48A 4WX9A 1A31A 3IP4B 5AVWB 4CCKA 1PGPA 5DD4A 4OM8A 3TGUG 3Q9SA 3CC7P 4BNCA 4I76A 2CV2A 3I53A 5C3EJ 1YJ9I 1KFMA 1NTMD 2WPRA 4EJWA 3IRQA 3TNUB 3S8PA 1X2NA 3OIOA 4QPQA 3PJSK 1X1AA 2V6EA 5IT3A 4ZYHA 3OS2A 2I76A 3TGUE 3H1HD 3OYDA 4G7OF 1AVYA 5APUA 2P7CB 1LE8A 2B9SA 2TRTA 4H44B 2EFOA 4R79A 2Y9YA 2DI3A 1XMKA 4S04A 2EFPA 3BT9A 4HSTA 3J81K 2UXNA 5H2FE 1GK6A 2IXSA 1J5YA 1R1TA 1L0NK 1DUXC 2WWYA 5B5EC 3ZHBA 4M9XA 2JJ7A 3I3LA 3SHFA 4YFNF 5B3SH 4C7NA 3VEPA 2VPLA 3KEYA 4JYCA 1S9KD 1X4PA 3B02A 3LAJA 1VQ6I 2KS1A 4PFPA 2YKPA 4ZYEA 1SQQE 1XTGB 3FXKA 5EEHA 4B47A 3T97A 3KZYA 4C2UA 3MUDA 4O6JA 4AIHA 4K35A 1RE3A 4MLOA 4HNVA 2KRHA 1W7PA 4GDFA 2WPSA 3A1YA 4BQOA 1JTHA 1KONA 2AEJA 2K9NA 4QIWN 5AONA 4B3IA 1IFJA 3L73G 3FMRA 2AEMA 4M3GA 5KKZC 2FYZA 2WSCJ 1T38A 1UFMA 1M75A 1MNEA 2BYVE 2D2CD 4YFKF 4WWCA 3MD0A 2ZO4A 4B09A 1WDMA 4PUSA 1JKQC 1XDSA 5HVQC 2IX7C 2V1DA 1ZRTE 3F21A 1RR8C 4U0VA 3GXOA 2JTVA 1P84H 4WWIA 4YIIA 1YJNP 3HADA 2HKOA 2HDHA 1NTMG 2HNHA 5KAIC 1Q1VA 1O7FA 3P7NA 3SDGA 2ECBA 3KFWX 1PIXA 5GTHH 5EYRA 5J8FA 2NPSB 1O3RA 1OVUA 4IHYA 1Y8RB 2XRLA 2VKHA 3D5SC 1W5SA 1KILD 1G2CB 3L75J 1YI2I 2K86A 2WB1N 1ZOYC 2QQ9A 3M8EA 5EGOA 4P55A 3GTPJ 2XNDH 4D6TE 2HU9A 4HF1A 3KP6A 3WE3A 5JLWA 1G3WA 1OCOH 3HOUJ 2DW4A 2JPCA 2VXDA 1VQ7I 4L0ZB 1KILA 4ZMDA 4B86A 5E3LA 2KSJA 1EKEA 5J4VA 3S1NJ 1Z6TA 2BASA 1P84E 2DT5A 4JX6A 2ZFUA 1VPCA 5AW4B 1FBMA 3OYJA 3ZDMA 5KAFH 2E74B 2VN2A 2VQGA 4D3SA 3LQRA 5JR3A 4PJ0C 1A35A 1ZR4A 4XR6A 3ZQQA 1URQA 1NG7A 2V4HA 4TT3H 3RL0g 3JCUH 1BJAA 3BZCA 4IFDK 1XGOA 3PJGA 1N7SC 3W2WA 2CV1A 1YBKA 1W4MA 4BJ6C 2M3AA 3C8VA 3MHVA 1XS9A 1SFCC 3EWKA 1BIBA 2K3FA 2E42A 1MGTA 2IBZE 4XLHA 3JSPA 3TOAA 5ICGA 3TW7A 1BSNA 3KZIH 3BR5A 3LMMA 3GHYA 3PUBA 2K9QA 3HGGA 2KP8A 1LP1B 2H27A 3FWLA 5KAFE 4MNUA 5CCGD 4ABZA 2A69F 5C39A 4ENNA 5LLQA 3FK6A 2A06G 2DK8A 1K7AA 4ON0A 3M9QA 2PMUA 4C46A 1KU2A 4N0BA 3ADPA 1P84I 3ASNH 1IN4A 1JUMA 3K70D 4KNYA 3RIRA 2YX7A 4O9BA 1ZG3A 4E7KA 3GHGC 5KLIC 3A02A 3EUHA 2IGKA 3RCOA 4G8XA 2B89A 1G3YA 2OPTA 3CCRI 3S2DJ 1IRGA 4W80A 3D6ZA 3QYFA 3CMEI 3C7DB 2O1JA 5AVVB 1JJ6C 3AEEC 1OCRH 4FQGA 3NFQA 3QPLA 3RPUD 2VQLA 1S7EA 3RKWA 1SANA 3CWBG 2EIJH 1UELB 5KVRA 3M91A 1V5GA 2GM4A 1SQVD 2E74D 1F9NA 2BVLA 1QRYA 3V8KA 4XRMA 3HD7B 1ETVA 2L9SA 3H92A 3NQOA 1FIPA 1WJCA 1EDJA 1UB9A 3BPVA 1MNDA 1Y6IA 5LFAA 2DU9A 2YSRA 6PAXA 1ERDA 4E13A 1ON1A 1N7SA 2OUMA 4RB1A 1NAFA 3W6JB 1FC3A 3GW2A 4MHGA 1QGKB 5AIPA 4ZDOA 4FHTA 2ZSHB 1NTZG 3GG2A 2NPSD 3L74J 3HE4A 3IAM2 4KT6A 2H8RA 2R92J 2UZKA 2GA1A 1R71A 4PZDA 1YRLA 2GXBA 1JI8A 5BVZA 1JNMA 3B6CA 2W90A 2WADA 2N1TA 2IZ1A 1NTKJ 4H44C 3LW5J 1S5LH 1VQ5P 2P6SA 4PK4A 3OYFA 1PP9J 4MQ9F 4XONA 2FJ1A 1WJFA 1ENHA 3CCMP 2KFDA 1FOXA 3AEGC 1OVRA 2O3FA 2B0LA 3F8BA 3WTXC 2XV5A 1WSUA 3B8EB 4FTHA 2L3DA 1K83J 2JJLA 3V2RA 1FDMA 3FXRA 4HF0A 1FBSA 2ADUA 1M1JC 2HZTA 3P9IA 5B66E 1SD4A 1MIJA 1DD4A 3NWTA 1S5LE 3DFGA 3N4MA 2HVSA 3CMYA 4HNUA 1GD2E 2JSCA 2H7HA 3RQIA 2R7TA 3CI9A 1TLHB 2GOXB 1VDFA 3F5HA 4BRYB 3CCQP 3CCQI 3ZQCA 1K04A 2XKPA 2VPRA 5E79E 3D6YA 2BXZA 1GW3A 3HBLA 4CGZA 2EINH 4I01A 1IDYA 4XOTA 1P84D 2E19A 3BP8A 3CJNA 2D3TA 3CXHE 4LLGF 2E5NA 3AG1H 1N2DC 3VP9A 4M6XA 3HUSC 2IS2A 2L7KA 4Z2YA 1HSTA 2K9SA 5CLSA 3CPWO 3CCVP 4RGSA 4PD4E 3B5NA 2XAFA 1RIOH 1SQQD 2R7XA 2EV0A 4CH7A 3CWBJ 2COMA 1Z1DA 3IRRA 2QQAA 4D5CA 2AO9A 1XMXA 2STTA 1G2HA 4OQYA 5MGBA 4ZDLA 1VF5D 5HLGA 2DT7B 2HS5A 2V7FA 1GV5A 1SFUA 2R44A 1VQPI 3O8ZA 2X1DA 2IBZD 5HDNA 3F6VA 1TWGJ 1OJLA 3K1MA 4R4MA 3F8FA 5HLIA 2W83C 2W7NA 5FLXK 4U3FJ 4EVIA 3OV8A 5IYBJ 1U78A 2ECCA 4EGZA 3CTAA 3UNGC 3HOVJ 3OYGA 2EZLA 2C0XA 4KUGA 4PD4H 2HR3A 3ZMTA 1HOMA 4HDVA 1S72P 1A6QA 3CLQA 4G6DA 2UUZA 1IO4A 1Q90D 2F5FA 3WFJA 3S1KA 1KN7A 2KIMA 1WCMJ 1L0LJ 3CL3D 3I56P 5IYCJ 2LMDA 2KSEA 1JKPC 3MFKA 3MKYB 2JUGA 2R5DA 1NTKG 1DH3A 5J1UA 4XLPF 2JA2A 4UB8C 4CPGA 3AAFA 1Y56A 2CPBA 3L75E 1X0XA 2LY2A 4E7JA 1GVJA 2DA5A 5J1RA 4YG2F 4FETA 2JVHA 3JAMK 1YONA 2JZYA 5DYMA 4D1QA 4A3MJ 4GIFA 2P8TA 2FBIA 2CVZA 2DODA 2IGMA 5DUKA 3KIOA 2FYUK 4HRIA 3I4NJ 5CKTA 2K1AA 3LSKA 3TP0A 2KP6A 3TYYA 4JBAA 1EF4A 1B8IA 1S4XA 4L9VA 1NK3P 5FRNA 3CCRP 4L18B 2JWTA 1UG2A 5M3FJ 2STWA 1B4AA 2P2UA 1U9NA 1FIAA 1R6RA 1A5JA 2F5CA 1H8AC 1WPKA 3VMXA 4HZFA 1SQXJ 4ZZDA 2X51A 3H25A 4DJAA 2F2EA 5GADJ 2LNBA 2W24A 4B1RA 4L5JA 2HOSA 1RH5B 3R6SA 3IKTA 5GTIE 3NWSA 1ZG1A 1NHLA 3L71G 2DLLA 3WS7A 1R5LA 3OIQA 4RGRA 2LC2A 5BNGA 5DJUB 4KUMA 1LWUC 2IBZG 3A0HE 3OR1C 4B43A 1EZVE 2PX9A 1TQIA 1W7PD 5BOXA 1I36A 2NVUB 2EB7A 3I59B 5APXA 4YXDC 2X6YA 3A3YB 2Z3YA 2R7DA 1P4AA 3VWBA 1U7JA 2O01J 3L70E 3MN2A 2VOOA 4EYYQ 1ULYA 1YFHA 3L70D 1UCRA 2HYGD 3ABLH 3FXEA 1U8BA 1MW7A 4A3EJ 2DQLA 5FB2A 3G6EI 2KIUA 1CF7A 2GF2A 1L0NE 1TW3A 5DDGA 2HTJA 1HBXG 4F7ZA 3MZWB 2FKWB 2IDBA 2A5YB 2FFDA 3DBRB 2CMPA 4FCYA 5L3CA 4I09A 5EZHA 3ML6A 3L72J 4CA0A 2L7MP 4A3FJ 1T98A 5ICCA 1W36C 2QSGX 4PJLA 1V55H 2NPSC 3CX5D 2OBPA 1Y8AA 1BDDA 2EA4A 2FMYA 1IFDA 2W6AA 3PHLA 2BHYA 1NU1J 1LJ8A 3HOWJ 1MV8A 3GEZA 4M3BA 2HI3A 4YCAA 2O01H 3VN0A 1QHGA 5DCFA 5ICEA 2H6CA 5HODA 3WTYC 4D3FA 5GAHJ 3GLMA 2D1VA 2ELHA 3KYLA 1PPJG 1GU4A 3KLOA 3HRNA 2Y0SA 4DT0A 4WF2A 1EJ9A 5AYVA 5KLVE 1QZEA 1MNMC 4RGUA 1S5LX 5TGTA 1VF5B 2JPBA 3ZMUA 3GLLA 1X2MA 3EUAA 3FMSA 1L0OC 3P9CA 1D7MA 4EV0A 1FTTA 3OYLA 3KP3A 3K4JA 3KHUA 4HOBA 3T1BA 3ZP5A 2R5YA 4ZZLA 1VQOP 1AWCA 3OBBA 1NTKD 3K4MA 1YJWP 1K4TA 2R7SA 3OSFA 2L9RA 4ENJA 2YU9J 4IHSA 1CI6A 4K2EA 3TEDA 2K9MA 2W6JH 4WY4D 2JQ7A 2QJYC 1T39A 4OVNF 2HOEA 5APTA 5K5GB 2OZ6A 2DJNA 2X1EA 4JP0A 1VQPP 2WV0A 2NNYA 2ZAEB 4GT1A 4P1WA 3GO5A 2JA7J 1RR7A 1NG6A 1R4MB 1SQVK 5BS6A 4OIOF 1USEA 1WKMA 3QU6A 3DTIA 1KFNA 3BASA 3LSPA 3M8JA 4B8XA 2IFNA 5LEJA 4PD4I 1GZLA 4D5FA 2PFXA 2EILH 1LWUA 1UAAA 1JGGA 1ZLLA 2M30A 3S3NA 2QJYB 1PL5A 1B9NA 3FXOA 1SAUA 1LUJB 1ZELA 2LSOA 5LHIA 3DBHB 3KP5A 1R49A 4HB1A 1PP8F 3PIPF 1QVGO 3ZWBA 1DX7A 3F0CA 1N1GA 3UKGA 1BR2A 3E5XA 2O5RA 3HRMA 3VODA 2M3EA 3AE1C 2F6CA 3GTLJ 2V7QH 2IBZI 1TZLA 2XVCA 2ITAA 3H1JJ 1I1SA 4IKFA 1JY2P 4I2OA 2HG5D 3B4SA 3CKYA 1RF0A 3DU6A 3RK3D 3PTZA 5CVVA 1L0LK 3H2ZA 1HW1A 2W8ZA 3L7WA 9ANTA 2OQGA 2P5KA 1UIIA 3TDKA 3RGUA 1FZCA 4Y99C 2M0MA 4XL9A 3SQNA 5GAEJ 2E43A 3HOSA 4NC6A 1LTTC 2FYUG 3VP8A 1U8RA 1T2KD 3K4NA 2QLZA 3V7CA 4L74A 2W25A 3FXJA 4B3XA 2R5YB 3DLAA 1DPUA 1P7IA 1Z77A 1OWAA 4RGXA 2K02A 1T0FC 3RDIA 4JQFA 4BRYA 4Y17A 1XSVA 4MFEA 5KLVK 3ESWB 1M1JA 2AXCA 3R4KA 2V4JC 4CSWA 4ZYGA 2OFPA 1S3JA 4NB5A 1D5YA 2FRHA 2XF5A 5B5EE 3PFYA 5GAGJ 1CQTA 3TF5A 4OIQF 2RVCA 4JQ0D 3VYTB 3W3CA 4D7NA 1IDZA 2OTLI 4YEJA 2IAIA 4IL6H 1NTMJ 4LG3A 2V79A 4W7YA 1GUUA 4M3LA 1OCPA 1IRZA 1HC8A 5JI6A 3SFIA 4D3DA 2XGXA 4BH9A 5D5WB 3MD2A 1R22A 4LG0B 2CQXA 3CC7I 1SQBJ 2L54A 5F04A 1TW2A 5IP9J 4IL6E 2BV6A 3CLOA 1S7OA 1ZKGA 2MH2A 2KXPB 2R3CA 2XZRA 1TL8A 4ASVA 3Q0WA 1X1DA 3GCMA 4CXFA 4C7NB 1TC3C 1FTZA 3OOUA 4WCGA 1NKZB 2KZJA 2RDPA 2OYIB 1SQVE 1JY3O 3M9BA 3H36A 1SLQA 3HE4B 1QZYA 1PGJA 2Y75A 2M2EA 1FP2A 2HXOA 4HV5A 1EC5A 5A9TA 2BY0A 1AV1A 3O2PE 4BUPA 2N8GA 1OYWA 3BC8A 4LLLA 1XGSA 3ZRGA 5DD8A 5C4XJ 3FWNA 1JY2O 3A0HH 2LXCB 5KAIE 3U1CA 3KLNA 1GHCA 4WY4A 2G9WA 3BOQA 3SDBA 5F0HA 1BDCA 4AU7A 4KFCA 4UUSA 2QG4A 4QPOA 4UXNA 4MEXF 4ASWA 5E8IA 3PEFA 1A36A 1SMYF 5L3DA 5IY5H 4PJJA 5GTHE 2QSFX 3JR9A 1ZGWA 3IH2A 3N4XA 3VMZA 4RLQA 1HJBA 1UZCA 4HEA2 4P96A 4R1NA 2N1TB 2DO7A 1X3ZB 2RNJA 3KZIC 4XE5B 1AVOA 3ZQIA 4K3AA 1JUPA 2GWRA 2V1XA 1MMAA 3PDUA 2R7FA 4PJ0E 2X9DA 1OFCX 4NQWA 4PDKA 4NQWB 1YI2P 3DKXA 2XDVA 1XC5A 4OH8B 2DOAA 2FSWA 1FEXA 2VJIA 5K5OA 1I27A 3BJ6A 4E6KG 3DFUA 2YXRB 2XSJC 4GXOA 3CXHI 5HLTA 3PM1A 1M76A 3EUHC 2VASA 1V5EA 3L75G 1YITP 1R8EA 1FDIA 1BE3J 2DDAA 4EZBA 3RSNA 4C2MJ 2LBFB 1STZA 4A12A 1RQVA 5HDGA 1RY3A 3ABVC 3QWOC 2Q3EA 2QWWA 3GTOJ 4LFUA 3CXHD 1GL2B 3ROUA 4MN4C 3KEQA 3G17A 2WMMA 3L09A 4WXDA 2LY1A 1QQIA 2R4GA 3GF7A 2FX0A 3QOPA 2PJPA 3HKZA 2E2HJ 3E3VA 1DU0A 1JCDA 1SFCA 2DYSH 3VDXA 5GP9A 1HGVA 2X0LA 4PJNA 4KDPA 5CYVA 4WXHA 2C9LY 5A9SB 1USTA 2CSOA 3U1DA 1SEUA 3KX2A 3FGAD 1S7AA 1REPC 3M06A 2KIFA 2VKDA 4RM2A 1F4KA 1X9VA 1TNSA 3OL4A 4M3EA 4C3JJ 3AE8C 3AE6C 1NH3A 2E2JJ 3OAKA 2ZVOB 1PP7U 2KQRA 3P8MC 2XSDC 3S1RJ 1R4NB 3PO2J 3A2AA 4DZPA 5J4YA 1BGYE 5HS9A 1VQ4I 4L9NA 2WT7B 3MP7B 1PFIA 2M0BA 1WRJA 3DPUA 1A04A 3PLNA 2WAFA 4GBJA 2QBYA 2MABA 1LWUB 3ZPLA 2EW2A 2W00A 1NWQA 1HKQA 5CVIA 2BXYA 2PFBA 3RI4A 1JXSA 3IAOA 1X3WB 2CRGA 4ZYDA 4A3BJ 1FZCB 3WHCA 1HSJA 3V4WA 1XCVA 4OMZA 1C0WA 3HSEA 4V2GA 5D5UB 1Z05A 1VQ5I 3BCAA 4ZYAA 4XN0A 2VJ4A 2OTKE 3WU2H 4IRIA 3JTGA 2N9YB 2XB0X 1HXDA 4AQRD 2KLVA 2HGCA 2V9VA 2W84A 4MQVA 2WSSH 1YW8A 3CCEP 2E75B 1G1IA 1LJ2A 1LSJA 2Z4EA 1ITYA 2J5UA 3L73E 3BZKA 3SSUA 1WJEA 1YJ9P 4XLCA 4OL9A 2FF4A 1SQQK 3J80K 5LEKA 1BE3G 3C1DA 4DGWB 1NK2P 1K78A 2K37A 3KDPB 4LLHA 4YXWH 2LXBA 3JW4A 1QBJA 1MMSA 1HBWA 3HRSA 5KCMA 2EV5A 1GV2A 3L74D 5B66C 4S3MA 5FKKA 1WMKA 2Y69H 3R0JA 4PV1B 1JTXA 1NTZJ 3K5BA 3L74E 3L74G 3OYKA 1JOCA 3CCMI 2ZMEA 1LT9B 1OMIA 3WTWC 1XTAA 3JSVC 2VC1A 3IKVA 3J7AY 5EZGA 5ED4A 1XSXA 1YIJI 2E75D 1L0ND 2HDCA 1E3PA 1PP9D 2E1OA 2Z2SB 5AVTB 1FZPB 4PZJA 4M71A 3OYBA 2NAZA 3I0TA 5HNHA 3GFJA 3K4KA 1SQPE 1NGMB 3BR1A 4J01A 1VL2A 2MD0A 2POHA 4UHTA 1S1CX 2M3BA 3M0DC 3TKYA 1PJRA 2LR8A 1FOYA 2W57A 3RYRA 3CMAI 4KMFA 1VQ9P 1U9OA 1I39A 2Y48A 4C3HJ 5J6XA 1IN8A 4B4CA 1NU1K 5FLXZ 1N7SD 3H1IE 1G3SA 1O3QA 1W5TA 5AIQA 1LT9C 2QQ8A 1K6OA 1IF1A 1WP4A 4C2TA 2CYYA 3K4LA 1J9IA 4U7DA 3O8HA 3Q0VA 4D6TJ 3S2HJ 1IFPA 1KILB 1EH8A 1T08B 1WVRA 1N7SB 5A9SA 3RZDJ 1MJ9A 2XRNA 3C7CB 5AW3B 5CBNA 2ELJA 3BG3A 1LPQA 3GX4X 1Z9CA 2H6BA 3QOEA 3EDPA 3HOYJ 2VQCA 1HDDC 2QF7A 4E21A 4GDOA 3E6DA 4BAYA 1FS0E 5EJCA 4BS9A 4LGWA 3P9KA 3OYNA 3I9V2 2MKVA 1WJAA 1EDLA 2LG4A 4XSZF 1KQ8A 1VQ8I 1SQQJ 3CC4P 3WU1B 5F0FA 4EDFA 3M0AA 2WT7A 1MSFC 2AHQA 3KPEA 3G6EP 2ZJ2A 5ILUA 3NTNA 4UB8E 2ZYAA 1ZW0A 3NMDA 4A7PA 3ZGKA 4B3AA 2X6WA 1IFNA 2QSIA 3J7ZI 3VSKA 2GZWA 1NTZK 2C9NY 2FE3A 4XLNF 3WGIA 2BEZF 2PMHA 4KITB 1J1EC 5BU8B 1PVEA 4GFBA 1HVVA 1ODDA 1M2WA 5AW6B 1VQ7P 2JUCA 1RF1B 4U3FG 4XK4A 2LF7A 2ZSIB 3HSFA 3OOPA 5D6FA 4E7HA 1R00A 3IUOA 2UXXA 2E76B 3OA7A 1JY3P 2G0EA 2EH3A 3Q3CA 2F5DA 2QYOA 2WV1A 4QSHA 1L0LD 3LA7A 4J19A 5BQTA 2AXTH 4DBQA 4MGRA 2KS1B 1LTJA 1L0LG 2O61A 3RPUA 1QGPA 2P4WA 3HTUA 3HN2A 4KUEA 1FZBA 1RZ4A 1TTYA 3E1RA 4NC7A 5GTIC 2MSYA 3S14J 2VT3A 1UG0A 1H88C 5FD5A 3LNQA 4I1LA 1LEAA 4XOPA 2H43A 2QVAA 4H0LD 3A0HC 2BY2A 2E76D 3K2AA 4IM7A 4OGQB 2MC4A 2Q0OA 4A3IJ 4E7SA 2NVYJ 2E75C 5EG0B 4BY1J 4RB2C 1J2JB 4N3YB 3S1MJ 1YQ4C 2KIKA 3NXSA 1OCZH 5GPCA 3BCBA 2AQEA 1WFXA 4I98B 4Y3OA 5FLVA 3H1KG 3K70C 3N7NA 5TJJA 4ETSA 2PN6A 3W6KB 1R5SA 1P2FA 3SZGA 2IP2A 1L4AD 3L36A 4AWXB 3GMEA 3HGYA 3CMEP 3OJAB 2A6HF 3MKWB 3GUDA 3OWTA 3S9OA 3SWYA 1FOSE 4CCJA 2EFNA 2Q2EA 3UIAA 2L5QA 1SQQG 1GXPA 1G6NA 2LTPA 4CCNA 2BW3B 2LKPA 1HCRA 3H0DA 2CQKA 2E7WA 3I55P 1Y39A 4LITA 3A0BC 3L70J 3D1NI 2VLAA 2PBIA 4YFXF 2O03A 3C7JA 1ZP0C 2DFIA 2VE9A 2E5YA 1JY3N 1T3JA 1HDPA 3QWLA 2Y2ZA 1KQLA 2WAQA 3FX3A 4BGDA 3G4SP 3K4CA 4GODA 4JX4A 1PGQA 2CUEA 1M56D 1AJYA 3M1CA 2VC0A 3S32A 1ETOA 2PP6A 1V3FA 4XRSA 3HPGA 2OD5A 2QJPC 1N73B 5LRRA 3HRUA 3MIWA 3CP8A 1F12A 4B44A 2ZT9C 2FQ4A 3L72E 2HYNA 3RK2D 2E71A 2PRRA 2XKMA 3CX5E 4BQNA 3H1HG 1QMGA 2CG4A 4CZZA 1FU1A 1YS6A 2YXQB 3L2UA 1YE9A 1O57A 2V1NA 3I56I 3CUOA 4A2UA 3HOZJ 1S9KE 3ONQA 5IP6A 1LFBA 4ZTJA 1IL0A 1IXSB 2ZXHA 5D5VB 3RBZA 5D4SA 3CMMA 3PJRA 1EDKA 2FYNB 2M8EA 4J0FA 1IN7A 4IF4A 4ZKUA 3Q9VA 1F5TA 4IVNA 3RKYA 4BJ5C 5K5RA 1HKTA 1EV7A 1EVZA 3KYQA 3A7OA 1HQCA 3HM5A 1NKNA 3CX5H 3HUSA 3WGHA 3BR0A 2DA6A 1IC8A 1OLTA 4LIVA 4FE7A 3ZN0A 3CD6I 3H1KJ 3MUDC 3JCUE 1WWXA 2WQYC 4XN3A 1E3HA 1KQ9A 2A45H 3LFUA 4E4HA 1KYOH 3Q5PA 1B59A 2GIZA 5IT9K 1FPQA 3HEFA 2DCEA 3H1LJ 1ORKA 4ANJA 5JHUA 5FKOA 1MUUA 4IHTA 3CCJI 5H20A 1FMWA 2OCEA 2QJPB 1N73C 4Q4ZF 1I6HJ 1TT0A 2Q1KA 2F4IA 3J81Z 3HG9A 3F3SA 4TV7A 3I64A 1KV4A 1N25A 1XG1A 2CH0A 4BHPA 1U7MA 4ZTFA 2ZNYA 1FY7A 1RESA 4IRHA 1U5TA 1KQ0A 4II3A 1LEBA 1SD5A 3H1ID 4BEHA 2K4JA 3F72A 4CHUA 2VXZA 4AC0A 1SQBG 1O3TA 1IJWC 3L70G 3ZQGA 1ZG5A 2K9YA 1VI0A 2PQ8A 1QLED 5E1WA 1KYOE 5AW1B 5B1BH 1KA8A 3QRFF 2KI7B 1VQMP 2W4SA 2VONA 1HW5A 4XICA 1V5FA 5BMZA 3J7AO 1RUNA 4GOFA 4H0LB 3S16J 2PJRB 1VQ4P 5APVA 3H1JD 3BCCE 3PH0A 3K6JA 1R23A 5DCMB 4M72A 3BCCD 3PSIA 2M0CA 2XAQA 2MLKA 3LA2A 5KHDA 1OW6A 2W48A 3D5LA 2XHKA 1GT0C 5D8LB 1M7LA 2CWEA 3WUTA 4PGGA 1YRNB 4MIMA 3V4GA 3K2ZA 3PO3J 3GF3A 4DOJA 4B48A 3D71A 1J75A 3LSMA 4AD9A 4IEJA 1FSEA 3V2PA 2BZTA 5HWSA 4ZH4F 1WZ2A 1JTYA 2EA2A 2E34A 1OKRA 2ZJSE 4IL6C 5E3NA 3F23A 2VUMJ 2L01A 3CDHA 3LWFA 3ABUA 4J00A 2QJKB 4WBAA 3CF5F 3DF8A 4EJUA 4Y13A 1W0TA 3HDHA 1KYOI 2DFHA 3CJTB 3RK3C 3ZR8X 5CVRA 4IQJA 1BCCJ 4ESJA 4CDGA 1F36A 1B9MA 3BR3A 5FFXA 1SVLA 5TRDA 4OIPF 5C4JJ 4EQQA 2XIGA 3CF2A 4ASNA 3QH9A 4BBRJ 2HXIA 1ZTRA 1KC8Q 1BI1A 1YVEI 4Q5SF 2Z5UA 1IZNB 1WPQA 1I50J 2A68F 2L7ZA 3HDDA 1PZQA 2E7XA 1OYIA 1SQBD 3C2BA 4NPFX 1MZ9A 3D5RC 4XIDA 3WODF 2FFDB 3V42A 1NU1E 1JT6A 3CDIA 3JSOA 1D1BA 2QVOA 4R8HA 5GTHC 1YG2A 3FBIB 1MH3A 1LFPA 3AG3H 4OOIA 3VOEA 1U2WA 2OYIA 3GZ5A 1UHSA 2M45A 2PMZA 4C3IJ 3AEAC 4DZJA 3WGGA 3BCCG 3KZIE 3CCLP 2FOWA 2JN6A 1UMQA 2XGEA 1LDJA 2M5WA 1K78B 2WWWA 5E79H 2BEOA 2YS9A 3RBXA 1K9MQ 2DA7A 3COAC 1TNTA 2KMUA 3ABMH 1FYMA 4IPAA 3D70A 3HTSB 1VQLP 4OU0A 2DTZA 4H13D 3QODA 4BJTA 3E6CC 1EZVD 3CCJP 5AW7B 4BACA 2X85A 2FEZA 5GPAA 1EZVG 2WB1A 3B73A 1BSHA 1W1WE 1WHUA 3CX5I 2Q7CA 2XPVA 3KETA 4OAYA 2EIMH 2EK5A 1RHZB 3ABTA 2WC2A 3LSGA 5K7FA 4DBRA 3BPXA 3W6ZA 1YO5C 5H2FC 2E1CA 2CW7A 2HOAA 3GTMJ 2R7UA 2FXOA 2XDJA 2ME0A 2IRFG 3R61A 2DAOA 2O8KA 4HX8A 4IX7A 2IS1A 2EIKH 3PNVA 1LE8B 2NVXJ 1Y47A 1Q82Q 2I5UA 3G1OA 4RAFA 2HQRA 3G9RA 1FX7A 1Y8QB 3SFDC 4BYYA 2K27A 3T5XA 3ITKA 2XV4S 5IYDJ 3EFFK 3O6QB 3H1LG 4IFMA 4I7HA 1PV3A 1AU7A 5FKNA 3LIDA 4AYBN 1J2XA 2BY1A 3EUKL 2QM7A 3VMAA 4KICA 1BE3D 3USSA 5LBQA 2QYTA 1HTLC 2YKOA 3CUQC 2OZUA 2E35A 2RN0A 3CESA 2ZFCA 1JTHB 5FGMA 3H3UA 5TISH 2CUZA 2JKVA 2HPCA 3IF4A 3V2NA 1OXZA 4OAZA 1K6YA 2VQHA 4G12A 4DIQA 1XPXA 3S17J 3SFZA 3IHUA 1DLIA 2HDWA 1N78A 1ZV8A 2JO1A 1P92A 4HW0A 2L91A 4E7LA 1QL1A 5FKLA 1FBUA 3ZMVA 1Q2NA 2NPSA 3L4FA 1OCCH 5M5XJ 3O6QA 1M1KQ 2QBYB 1AFOA 2VBXA 2BOLA 3Q0UA 1HLVA 2HPMA 3CCUP 3M4OJ 1KGSA 5CMZA 3I4MJ 3SXYA 1QVTA 2HZDA 2Y0MA 1D5VA 2YUSA 4KMUX 2EV6A 1RUOA 4A3LJ 4HAMA 1PUFB 4B3HA 3GMAA 2UWMA 3P32A 4ZNCA 2LD5A 2E2IJ 1ZXGA 3MMYB 5A2QZ 3Q5FA 2Y0EA 2ZYGA 4AYCA 3SYTA 1AKHA 3VOPA 3VYSB 3O3KA 4KIFA 2FNPA 2D1HA 2O8XA 1LDKB 2KRCA 5AVZB 1XD7A 2LK2A 1FOSF 3RJPA 1JKRC 3W2VA 3LQQA 2J59M 1FNNA 2IEKA 2ID6A 5FO5A 5CCGA 1RI7A 1SS1A 3H35A 2HODB 2D2CB 2E1NA 3HHGA 5A2QK 3FXDA 2Z99A 3PNYA 2IYPA 3L35A 1M90Q 3HJEA 1R58A 3GFLA 1IJDB 3CXHH 2KHMA 1MKMA 1R5GA 4L5IA 1SQBE 2Y9ZA 1LFUP 5KLVG 3GFIA 4EJOA 1GL2A 1HJ0A 3ZWCA 2NRGA 1KB9E 3I5CA 2ZYDA 3L6DA 1HKSA 1EH7A 4UVAA 1XDUA 3B5ND 3L37A 2CU7A 1SD7A 1S2EA 4KISA 1FZAA 2EFWA 3GFMA 1ZRCA 1OVVA 2E74C 4A93J 4F92B 2WSCH 4WY4B 3FR7A 3FKJA 4DCKA 3AE5C 2RC4A 4KJMA 1T56A 3QHAA 3WU0A 3HUSB 4IRGA 1WRGA 1K05A 3OW2O 3CCLI 2BY3A 3Q5SA 4NUBA 2ZT9B 1ZN5A 2RN7A 4OQZA 2UWJE 2F4MB 3CQZJ 4X1EA 5AVQB 4ENMA 2N1TD 3MGNA 3DEUA 2DA3A 2DFFA 1MMNA 3E6MA 2P5LC 3M9AA 1WI3A 3IV5A 3S1QJ 2RKLA 3L71J 1M1EB 1H0TB 2GA2A 3AL0B 1NTZD 1HW2A 2DW3A 1Y1WJ 1X0TA 1BGYG 1NTZE 3RPQA 1VTNC 3FXLA 4IHXA 1WH5A 3DTEA 3MKLA 1L0NJ 1BGYD 3MWMA 1NTKK 4JK1X 1S6LA 4HF2A 2E5ZA 5F64A 1PUFA 4CCLA 3GWZA 4EM0B 3CDLA 3SWFA 2LFBA 4BEHB 5JVGF 5M5YJ 1SFEA 2KJCA 3H1HE 4MEYF 2ZXWH 5LRSA 5M5WJ 3N05A 3HUGA 1B72A 4PZCA 2MD5A 1LTSC 1RKWA 3IWZA 1EVYA 2HKXA 4A6DA 3U59A 1VQNP 2NOJB 2VKVA 1GXQA 2NYXA 4W1UA 1MDMA 3P8CD 2LP0A 3KP4A 1O4XA 2W6BA 4HX7A 4KN4X 3U1KA 1M1JB 5J47A 3DWLE 4D6TD 4ZC3A 2QEXI 4Y7NJ 2P10A 1KD1Q 1OCTC 1E2XA 3IAS2 2OQRA 4RAYA 3R4YA 2LKMA 2QM3A 4A5MA 1JUNA 1QO0D 2LY9A 3BLYA 3GBGA 2XKOA 4UB6H 3ZMDA 5F1JA 1EXJA 1IG7A 1BIAA 1MMDA 5ERIA 5KLVJ 1FZFA 3K6GA 4BXXJ 3CCSP 3L00A 1BR1A 5F27A 2FXAA 2VRSA 2WITA 2TCTA 3E0JB 3NAUA 5LGNA 3G71I 3BATA 3A4CA 3FHZA 4U0WA 4H0EA 2J58A 1VQ8P 4O3MA 2OC6A 3FIWA 2AXTE 3MKZA 4UVBA 3PQKA 2BGCA 1IV6A 3OYCA 2OJED 4BE2A 1L4AA 1BC8C 2BCCG 2HQNA 3FDYA 3FK7A 5EGOB 2F4OB 3AE7C 3HOXJ 3RYPA 4A3KJ 3VYIA 2E1MC 3RKXA 3AE3C 1F0YA 3G1LA 4PCQA 1OYYA 1EQ7A 1K8AQ 2IVMA 2E76C 1YQ3C 1BR4A 3A01A 3HD7A 3P5JA 5DS9A 3WTTC 4LB5A 3HYIA 3OL3A 3CO7C 2A05A 2GBYA 3VB2A 2ZFWA 3AE9C 2DMTA 1XN7A 5B1AH 5FRMA 1IC2A 4HQMA 1R36A 3HD7D 3F8CA 2M1BA 2WTYA 1G3TA 4AIKA 1URQB 4I6MC 3A0BH 1RE4A 3FMQA 3TDUC 3GTKJ 2QIWA 1S72I 3H3VK 5APWA 4W7ZA 2HPCB 3CC2I 3BJOA 1BG6A 3H1JG 1BOBA 1YIOA 2IYOA 1H9TA 1F17A 2EPFA 2ZMEC 4G7HF 2OYOA 2CQQA 3KP2A 3H1LE 4WVZA 1KTMA 2Q2EB 3K96A 4PV1D 5M3MJ 1Z3YA 2KPMA 4D7MA 3Q1MA 3ZQFA 2M7BA 2FYUJ 1DP3A 3LW5H 2G3AA 3A0BE 5D8KB 2R7OA 2JWAA 5KJ7A 2PEXA 1OR7A 2CFXA 1NVOA 1ZRDA 1OPCA 4HYTB 5EF6A 3HE5A 2W85A 3IFMA 3CCVI 4IQ4A 2BVMA 2VBZA 4QMAA 1PPJE 2IW5A 3CUQB 2ZT9D 2ZVNB 1GMJA 1JO5A 3TL4X 3AFHA 3JTHA 4U3FE 3TBIA 3RQ4A 5EG0A 4HX4A 1LNQA 2MC3A 2OTJI 4LD5A 1VQLI 2UYYA 3LSTA 2LLKA 2VI6A 2M5AA 2GLOA 1L2PA 1J0RA 2CQ7A 3AG2H 2YIUC 2IGNA 3IH3A 2ZXEB 2P5VA 4XMYA 3TGNA 1FJLA 4I2LC 1VQMI 1W5CE 4LOCA 3CD6P 3WG9A 4BY7J 5APQA 2P58A 1LTJC 3M0DA 2WBMA 3TGUJ 5CBOA 1NTME 2RQQA 4JOMA 4XRFA 3ZW8A 1I6XA 2N1TC 5TJHA 3AG4H 1LNWA 2DT6A 4F91B 1JGSA 2M34A 4RAGA 2R0QC 3GF2A 4JBZA 3KPHA 5IT9Z 4HNTA 2CV0A 1MBFA 1SVMA 1URQC 4H13C 4DNCA 3K9TA 5DCMA 1WJ5A 1XTCC 5JHFA 5K7HA 2D5VA 3KZZA 4DJGA 4HA8A 1TBXA 3JCUC 2NOGA 1X8YA 1HF9A 4AVZA 1JDJA 2EWNA 2P7VB 2RV8A 3MZHA 3A2KA 4WY4C 3QPSA 3L71E 4QLCU 1KMIZ 4GCVA 3T0YA 3T8RA 4I7ZC 4LK1F 2E5TA 1TWCJ 2ZMEB 1LT9A 4YIFA 1J7KA 2XPWA 2NZ2A 1MJBA 3IC7A 2HDDA 2GQQA 2GUVA 5DUIA 1H0MA 1S29A 4A69C 3WTUC 4GYIA 3CWBE 2K85A 1URQD 5AVXB 2BCCE 2IS4A 1WDLA 1VQOI 2K40A 1YQAA 3PSFA 5HS7A 3WTZA 2IPQX 4G94A 4N4OB 2DXIA 4KYWA 3U1AA 4N9IA 3C2HA 2QZ8A 2MFZA 4L73A 3BRVB 3H1KD 1YB4A 3BZ6A 5E8GA 5DM6F 2HYFA 3BJAA 1JEKA 1FZEA 2A06D 3LOCA 1J09A 1M8OB 2Q6QA 4U7JA 4XLAA 1RF1A 4I0AA 4BE0A 1Y0NA 2TDXA 3AKZA 1DPRA 2JT1A 2ZJQF 2FNAA 3VYUB 1MH4A 2M7AA 1D0ZA 3DPTA 1D8KA 2R7RA 2WPVB 3PIOF 1T33A 1BCCG 3AEFC 5LGUA 4XLFA 5H6RA 1SFXA 5JVTA 2YU3A 3H0GJ 2MG4A 2ZBKA 1L0LE 4IO9F 3G71P 3G0OA 4CUGA 5L3GA 4GRIA 1I3AA 1ONVA 2IBDA 3M7GA 4DLLA 4CCOA 1IUFA 4C9YA 1YX3A 2QM8A 1AA7A 4NNJA 1EDIA 2EQRA 1T8IA 3H1IJ 1FOKA 3RK2B 1F14A 1B1BA 3M3YJ 2WSEJ 3S2WA 2R93J 1ETKA 4YIRX 1EA3A 2PJRA 1SFKA 2HQAA 3IR9A 3TQNA 5CVUA 3C18A 3LSHA 3GYHX 3KCCA 3H6PA 5AW2B 2QEXP 3MCZA 1EZVI 2EZHA 1NHAA 2V9PA 2K3RA 3ZMZA 4ZJZA 3DXJF 4GOEA 1Z0XA 3BRTB 3K10A 2QENA 3GZ6A 4BBSJ 2JEEA 3RK3E 3D0SA 1ZARA 4DZOA 1Z67A 4N4NB 3VSLA 4IXAA 1JB0J 1Q86Q 1QNTA 3BCCJ 2OAZA 4B3JA 3LSRA 3VYRB 4YRVA 1RF0C 1SQXE 4J0EA 2OA4A 4JPZB 3EYIA 1VFCA 4N78D 4R4LA 1SFCB 3DOJA 5AW8B 1Q81Q 1ETQA 2QA4P 2R7WA 2JSPA 3FF5A 3BG7A 3V7SA 1OW8A 4HLYA 1UHWA 4HYEA 3ERED 2W27A 4H0LC 5CJ4A 2M9HA 2IJLA 4RB0A 3K1NA 1YLFA 5E3OA 4V19K 1VPDA 1DEEG 3KP7A 1YHQI 3R0AA 1OIPA 4I6ZA 4DYQA 2QUFA 3FM3A 3F8MA 2BW3A 4A3CJ 1GK4A 2JR8A 1VZ0A 1O7LA 4DW6A 1TT5B 2IPPA 2WA0A 1BCCD 4R1HA 3CUQA 1IN5A 2ZJRF 4I02A 1HUCA 4HV6A 1BCCE 3HKZN 4GO1A 1WDKA 1SQXK 3X2QH 2YO2A 1U6GA 1YX5A 5H2FH 2A45G 1K73Q 2CQNA 1PUEE 2G7UA 3Q5RA 2JK3A 3C9IA 1X1BA 4EGYA 2WSFJ 1X22A 1QA6A 4EIJA 3H1CA 2L7FP 2KISA 2LR2A 2B88A 2Z5HA 3SFEC 4JYKA 3MVPA 5FJ8J 2I8DA 2MGQA 2XAJA 4D0PA 4RBOA 1U5TB 2M4KA 2HPIA 3OYEA 2RMZA 1R1VA 5EFWB 1I3QJ 4RJTA 3O6BB 4KIGA 2WAQN 4IJAA 3FZVA 1J1EB 1HF0A 3LL7A 2XF6A 1Z56A 2XAHA 3TMOA 1ZYRF 2FA5A 2MA3A 1V54H 4ZDPA 3ZMSA 2HOTA 4IHVA 4H44D 1YW7A 3GTQJ 2OYHA 2OTJP 3OYMA 1IGNA 2K7LA 2RREA 5D6EA 5K7ZA 1N77A 3ZXSA 1FE6A 4LC1A 4NPDA 3LFKA 2CJJA 2DBBA 1I5ZA 3JREA 1X1CA 1PYVA 1MZBA 3OY9A 2KL4A 5TISC 3AE4C 3D1LA 4OMYA 5HLHA 2NS7A 3RK3B 1IW7F 5FKMA 2XC7A 1U5TC 3HPHA 5ICFA 1OX3A 1QPIA 4E70A 1S8NA 1VQ9I 4N78E 2V7QJ 3CMAP 1NTKE 3WTVC 3JRIA 4P9FA 3H1KE 3NRVA 1E5WA 2PMZN 3J80Z 2A07F 2EZIA 2KKOA 1LTIC 1SQPG 4Q47A 2O3JA 3EETA 2LBFA 4LK0F 1SQPD 1MJAA 4F55A 3MAJA 3P7KA 2OYIC 5DEQA 3WUVA 1PP9E 1MD0A 2WSFH 2XASA 5E20A 2XROA 2SPZA 1LTJB 1RE4C 1T2KA 1YJWI 3IN6A 2KUBA 2UV1A 3RL0D 2ZC2A 1RPWA 4L5EA 1ZGJA 1SFOJ 5BU5A 1WQ2A 2H09A 2QKLB 4D6TG 4UUSB 3IH4A 3Q3DA 2MBFA 2OGUA 3HOTA 2O0YA 3WTSC 3BG6A 2HODA 2FXMA 3F9KA 3S3MA 5AW9B 2DA2A 1DGWY 2RQPA 4HQEA 1N73A 5CCGC 3WUUA 4KHXA 3I71A 4XLEA 2WTBA 2K9JB 2R5ZB 1DDNA 2QE7H 2Z5IA 2B63J 1O3SA 4XFJA 2PGDA 3OSGA 2ICWG 1YYCA 1RETA 1F1ZA 1NYHA 4AM3A 2CO5A 3L2VA 2P6TA 1OR7C 1ZAOA 1W0UA 3DCFA 3HWRA 4LGDE 3RL0C 1SVFA 3HE5B 1Z82A 2QSHX 4C7RA 2YMYA 2KB7P 2QJKC 4XRSG 2CW0F 3L2QA 3SJMA 1X3UA 1D0YA 3JAMZ 5KNLA 1FYLA 3PP5A 3WU2C 2NNNA 3CP2A 2BCCD 4HH2A 4KT0J 3T97B 3RTRA 2VODA 1TWAJ 5F6FA 2B9BA 4S05A 2YPRA 3BDDA 1QX8A 2YMKA 3GTJJ 3RK2C 3FM5A 3H5RA 1E17A 2M5AB 1ON2A 2BHZA 3CJRB 3F3XA 1G59A 2A6EF 4OGQD 2K9LA 4KN7X 4BKXA 1XGMA 2R7QA 1M57D 3G3ZA 5KK1A 1TP4A 2CS3A 1FOWA 2FOKA 4XKVA 5APYA 2XNXA 5B66H 1YHQP 1X1PA 3TDZC 1M66A 1KS9A 1L0NG 3FKIJ 2XAGA 4AIDA 1H0TA 4U0YA 3E7KA 5DTDA 2KDOA 3OYIA 3M8FA 3A5TA 3KYCB 2DDBA 2QQBA 2IT0A 4MTEA 1KU7A 1KYZA 2OQQA 2RNGA 3I58A 5J8CA 2O7OA 1TWHJ 3EYYA 3HRTA 5L3BA 1HGZA 2L02A 2H8PD 3BVHA 3SZPA 2YR2A 3PIDA 2ESNA 3G73A 2ZKZA 1LTBC 2VIXA 2DA1A 1MBEA 2E1MB 4U88A 1F43A 4BE1A 1XX5A 1W2EA 2KZGA 1H89A 4FX0A 3BR6A 4LMYA 3HSRA 2KNCA 5HNFA 1JT0A 5CPRB 1Z7LA 1P9QC 4XKWA 4NBQA 2CUFA 1BOAA 1WJDA 4L76A 3QYEA 2FQ3A 3H9QA 2GAUA 2HFHA 2KIQA 3V8LA 2NVTJ 3L73D 4BU2A 4AUXA 5EEGA 2P4QA 2X58A 3NEUA 3JRFA 3HIFA 2C0WA 3EGOA 3II6A 2JMWA 3RKQA 2R3SA 4UB6C 1L3LA 3GLXA 2O6GE 1OZHA 2FBWC 2XU6A 1IK7A 1N7LA 2OV7A 5EEAA 1XB4A 2W1OA 4GYGA 4RAZA 1DQUA 1LSOA 2OCCH 5FFZA 3A01B 1LGHB 3LA3A 1T0FA 2KJBA 3I59A 3K1PA 2FYNC 2XGCA 3DPLC 1WT6A 2W82A 2JWDA 2L5GB 3BROA 4UV9A 2NRAC 1T95A 1GU5A 2L2OA 1IV8A 2A06E 5L3FA 5CJ9A 1JJ8C 3RQSA 1BGYJ 2VBYA 5L3EA 1NTMK 1YW9A 4EM2A 1LB2A 4OWRB 1PDNC 3QP5A 2R7VA 4UUTA 3HUGB 2MJZA 2LRDA 4D9JA 1AHDP 1L4AC 2DPUA 2XUBA 1E79H 4DYCA 2QRXA 3F8NA 3CCEI 3C3WA 4L75A 4WXCA 4ITVA 1PGOA 1R7JA 3BY6A 3H1HJ 3R2PA 4MFDA 2V26A 3PRJA 2Q8KA 3E5UA 1KILE 2GUSA 2AXTC 1T6AA 2VBWA 3OS1A 4DQ2A 1CZQA 1AQ5A 1QU3A 5L8RJ 3KE2A 1VQKP 4RLFA 4RO0A 1QPMA 1LQ1A 3AECC 4Y15A 4CO8A 3ZQ7A 4WB4A 2AEFA 3PFIA 2KNCB 5LGTA 1D1AA 4LLNA 3OMYA 5BPIA 3Q3SA 1SAXA 2IZ0A 5CCHA 1RNLA 4LIUA 4XKBA 1G2CA 1MSEC 2CK3H 1E0EA 2X4HA 3DKWA 5FD6A 4IHWA 2DA4A 5E3MA 3H32B 3MQ0A 5KLVD 1IZ1A 1HA8A 5LHGA 1TQPA 1IAWA 4HDUA 1X19A 4XNFA 2CPSA 1JM0A 1Y1VJ 3FXQA 1RRJA 3HTKA 1BN5A 1QZZA 4NHJA 3B6AA 3WMM0 5HDKA 4M9SA 4ESBA 4GWKA 5CQGA 3VTPC 1G8XA 4DYRA 1E3OC 1YJ8A 4I0BA 4Q48A 5D4RA 1Z7UA 1W36D 2MYSA 4XSXF 4PSWA 2DFEA 4GKGA 4P9UA 3FR8A 3VPRA 3V6IA 1DEBA 4FISA 4XA4A 2E60A 3IWFA 3OIPA 3IL2A 1LVKA 3HHHA 3TW6A 5LD2C 3LAPA 2MH9A 3L2CA 1FDOA 3VMYA 1YOVB 1KU9A 2IS6A 2LDUA 5AVSB 4BHBA 3AEDC 4UVCA 3J7YJ 3QSGA 4BDYA 1BI0A 2N9BA 1RF1C 2CUJA 1ZRFA 4Z6YA 1QHHD 4A3GJ 2KK7A 3MEXA 3FISA 1MBKA 4HBLA 4AYBA 4BQQA 1IXCA 2DTRA 1FYKA 2WZ7A 5AW0B 4LJZF 4EOTA 2COBA 3L75D 3CCUI 1SQBK 4BXLA 3P8CE 1YRNA 3I83A 1R5HA 2R32A 5F1RA 1CF7B 2JA6J 2IA2A 1YITI 2J5PA 5B5EH 1D0XA 2A61A 1CW5A 1G1JA 1J1DB 4JF7A 1QVUA 4KIBA 4F3QA 2IA0A 4Y33A 3GHGB 5KLIB 3QU3A 1W2BO 4RMNA 1M67A 2DMPA 2OYHC 2OU2A 2KT0A 3V7RA 4A0XA 2FXPA 1FWZA 2QA4I 2AS5F 1AQTA 2PAJA 2K9JA 4Y28J 1BBYA 1USSA 3N97A 4GWGA 3CC2P 2FYUD 1P6RA 3V4QA 3DTKA 2XB5A 5IP7J 1L4AB 2KOGA 1GVDA 4HSRA 2LREA 1ZH5A 1W5CC 1LKXA 4XORA 1MBJA 4GGGA 4A0ZA 4II2A 4NPEA 3DLLF 4HPQA 1IO2A 2VL8A 3WFIA 3DEWA 4H4KC 1Z91A 3BG5A 3UR3C 2P0WA 1IFIA 2ZB9A 1KU3A 1P7JA 2VJJA 3L1PA 2KLUA 2Q9IA 3ULKA 3BQZA 2B7EA 3QYBA 4Z1MH 1TXGA 4ENKA 3HB9A 4XQFA 3E97A 1TQMA 2B87B 2YKQA 5KAIH 3ISPA 2WTEA 2AXLA 1R9TJ 2Q1ZB 4A3JJ 1SP4A 4L9TA 3FHNA 2GIVA 4JX5A 4EM1A 3G1MA 3I55I 1WGXA 1BA5A 2BE5F 2I1JA 2ISYA 3E5QA 2Y0SN 4AVPA 5DM7F 1TWFJ 1IN6A 1VNDA 3FBNB 1ZK8A 2HVRA 2KZIA 4BL0B 1GLNA 1J1DC 1P4XA 2K4BA 4CICA 3G4SI 2FMLA 1MFTA 1YTZI 3TGUD 2H1LA 4L9JA 3M9HA 5J1YA 1JE8A 3AE2C 1JHHA 1APLC 4HJGH 3MTUE 2ZJPF 1CSBA 1ZHFA 1A02J 1BW5A 1ZCJA 5AVRB 5KAFC 1ACIA 2FBKA 2WY7Q 2GXAA 2R7ZJ 2HVQA 3H5AA 1X79B 5IOZA 4E7ZA 2Z1DA 1KB9I 3S15J 1SQVJ 1BC7C 1DP7P 1JHFA 1EXIA 2QKMB 2LH9A 4WK8F 3I54A 2A3SA 1SQPK 3OYAA 4RB3C 1VQKI 3HD7C 3SEZA 4IL6X 3TK1A 3H5NA 5C44J 5BPDA 3NARA 2VJ5A 4G6QA 1H9GA 3L2RA 1H89C 4A6EA 5AVYB 2I9PA 3DQVC 3PUFA 4IFFA 3A03A 2WAEA 3FXMA 2PLAA 4OIRF 3GVAA 1FZCC 2ISZA 2P1JA 4RA2A 2EFQA 1MFZA 1JY2N 1JKOC 3VFZA 1UIXA 1V4RA 3B71A 1JUSA 1A6IA 1Z21A 2A5WA 2KZVA 2L9VA 2L4MA 3ASOH 3BQYA 3MZYA 3W6VA 1PP9G 3HL2A 3DEEA 3BTJA 4G6TB 4S0HB 5K1YA 2PI0A 3TO6A 3CTVA 1NH4A 2RGVA 3G2BA 1MBGA 5LHHA 1LT1A 2M8GX 3HXLA 1VF9A 1N8RQ 2WSEH 3GHGA 1DGRM 3ECOA 4QTRA 1NOHA 2B87A 2DMNA 4OWFA 1XMAA 3QPTA 2IGOA 2LYCA 4XKCA 2ELKA 2VKEA 4UUVA 4XM3A 3JRGA 4PZEA 1CI6B 3B5NC 3E1IA 3ULQB 3IQDB 1Z6RA 3PL8A 3S93A 3H3ZA 5DV5A 1JCCA 1SVOA 3O8GA 2JA8J 3CCYA 2H8WA 2HQ5A 5APSA 4OGQC 2EBIA 2Z9OA 4AIJA 1XSDA 2MLGA 3Q2YA 3PNTA 3V2QA 1Y0UA 5HS8A 3E1SA 3K4BA 4LG0A 1S9HA 3JRBA 2PLYA 2XPUA 4N9HA 2LKXA 4ESFA 1D1CA 1KYOD 3FX0A 3H1IG 5CCHD 2ZCWA 1RC9A 4MO7A 2YIUB 3JRHA 3CC4I 4X6AJ 1SFCD 1Q7YQ 3L9FA 3L71D 3H1LD 4IOCF 5KJ7D 4PSXA 1YTYA 2VE8A 3ZQHA 4E7IA 2IA1A 3ZOBA 1QL2A 4PJMA 1BL0A 3WG7H 1FAVA 3C1LA 4JYBA 1AKHB 4FE4A 1ETYA 1YS7A 1ETWA 2FU4A 2VOPA 3ABKH 2JA5J 2JDIH 1KQFB 1ETXA 3V5BA 1FJPA 1BW6A 3M1EA 1HWTC 1FSHA 3CWBD 4RKUJ 3ECHA 1J59A 1A02F 1Z3XA 3HC7A 3LSJA 1SQVG 3H9GA 1S5LC 3HTKB 5JLXA 1JMMA 2YO3A 2L4AA 2HWVA 3F22A 4CYCA 2DJIA 3CO6C 3V8JA 1B8IB 3JRCA 4BDZA 1NJIQ 2JRMA 3QQAA 4HLXA 3ERMA 5E79C 4BXUA 4W97A 2R5ZA 3GW6A 1IXRC 4U3FD 3CJQB 5CCHC 2CFOA 3T8TA 5IPAA 1U0JA 1IK9A 4G7ZF 3MOGA 2FY8A 4BQAA 2ACJA 1GL2C 1QVFO 1X4OA 5CJ0A 5KJ7C 2FD5A 1LVAA 1ZN2A 2DYRH 4BHCA 3ZQLA 4LB6B 1YTZT 2BEQD 4HKZH 5ILSA 1D3YA 2J5OA 2D2WA 2VB6A 4YTPC 2QCOA 1X58A 4CYCB 3AL0C 2G8YA 3LIEA 1D8JA 1KYWA 2GOMA 4I99C 3RZOJ 4KA4A 1LTAC 2YX4A 3K0LA 5TISE 2RAEA 1NAYA 2AQFA 1BI3A 1R1UA 4A3DJ 1VF5C 1KZUB 2P7JA 3I5UA 1T2KC 4RDUA 1IRXA 2PG4A 1FLIA 4F52A 3OR2C 1OQYA 2DMUA 4EJTA 1GDTA 2Y0DA 2HLOA 1I1GA 3TOBA 1YYVA 2WY8Q 1U57A 5K5QA 1K4SA 1YIJP 4EATA 4FX4A 1T8ZA 2G7HA 2ZXJA 3H1JE 2ZXXA 4H13B 1Y9BA 1WH7A 4OINF 3E7LA 2V1UA 2WVRA 3W6UA 1CGPA 3DKYA 3QPHA 1SQXG 1DLJA 3H9JA 2CW8A 4KUHA 2H88C 2DQRA 3EQ2A 4M3DA 5KKZB 1LDDA 3GZNB 3BR2A 1SQXD 1POGA 1SD6A 2JVGA 3ZW9A 1BI2A 2ME6A 4YPCA 3BTCA 2KRFA 3JRDA 2JRTA 1EH6A 2XF7A 3U9GA 2DN0A 1WI9A 1WJBA
chains in the Genus database with same CATH topology
4DW6A 3C7AA 5AYVA 1MNMC 3BTIA 4AC0A 5J3LA 1X2MA 1IJWC 3ADOA 3ZQGA 1VI0A 3HKZN 1FTTA 1WDKA 3WHBA 1N1EA 4XICA 2LVSA 2R5YA 3S16J 2JK3A 3OBBA 3ZGYA 2L7FP 3K6JA 3OSFA 2XGDA 3MVPA 2L9RA 2MGQA 4JYKA 5FJ8J 3TP3A 5EDNA 4RBOA 3TEDA 3BG9A 2YU9J 2M0CA 2W48A 4OVNF 1I3QJ 1GT0C 4FGWA 2WAQN 2DJNA 4JP0A 1YRNB 4MIMA 1HF0A 1DU6A 1B72B 3PO3J 1YJQA 2ID3A 5A9RA 2MW8A 2JA7J 2NVQJ 2L0KA 4IEJA 1RR7A 1NTCA 4V2FA 2HOTA 1ZQ3P 4IHVA 3GTQJ 5HWSA 1IGNA 3PLRA 1JTYA 5K7ZA 2H1KA 3LSPA 2CJJA 5E3NA 3JREA 2VUMJ 4D5FA 1W0TA 3HDHA 1JGGA 2NS7A 5FKMA 1QPIA 1F36A 3BR3A 3JRIA 3ZWBA 5FWNA 5C4JJ 3F0CA 1N1GA 2PMZN 4BBRJ 3UKGA 4E12A 2EZIA 1ZTRA 2HXIA 3GTLJ 1YVEI 2X6OA 2I10A 1WPQA 1I50J 2L7ZA 4Y52J 2P81A 3HDDA 3C2BA 3CKYA 4XIDA 4DYDA 2Y30A 3H2ZA 1JT6A 4EEFG 2W8ZA 9ANTA 1RPWA 4L5EA 1SFOJ 1MH3A 3IH4A 4UUSB 2R5YB 1ZR2A 1UHSA 1P7IA 1Z77A 2DA2A 4C3IJ 3K7AJ 2O9LA 4DZJA 2OF7A 1MBHA 2WTBA 2JN6A 1UMQA 2XGEA 2R5ZB 2YS9A 2B63J 2DA7A 3GTGJ 2PGDA 4MFEA 3OSGA 1RETA 5F0CA 2NS8A 2KDZA 2DTZA 2DMQA 2OFPA 1W0UA 3DCFA 3HWRA 1D5YA 1CQTA 1Z82A 4NDLA 5FLMJ 1RKTA 4JQ0D 1IDZA 4D7NA 4XRSG 5GPAA 3SJMA 2IAIA 2XPVA 1GUUA 1OCPA 1IRZA 4D3DA 3SFIA 3LSGA 5K7FA 3W6ZA 1TWAJ 2CQXA 1X0VA 2HOAA 2HYJA 3GTMJ 2ME0A 5F04A 2O8KA 5IP9J 2EZKA 3GTJJ 1ZKGA 4M3FA 1LE8B 2NVXJ 4BKXA 3Q0WA 3G1OA 1TC3C 1FTZA 3OOUA 3JRAA 5JE8A 3ZWAA 1M66A 1KS9A 3FKIJ 5IYDJ 2Y31A 1BJZA 3BTLA 5IOYA 5DTDA 1PGJA 1K61A 2M2EA 1PGNA 2HXOA 1AU7A 5FKNA 4AYBN 5A9TA 5F08A 2N8GA 2O7OA 1TWHJ 2QYTA 5C4XJ 3FWNA 4M6VA 2X48A 3PIDA 2JKVA 5F0HA 1PGPA 4OM8A 4UUSA 2DA1A 1MBEA 4G12A 3PEFA 3S17J 4I76A 1F43A 5C3EJ 1DLIA 3BR6A 5FKLA 3IH2A 3JR9A 1ZGWA 5M5XJ 1JT0A 1X2NA 3OIOA 2CUFA 4R1NA 3Q0UA 1HLVA 3M4OJ 3I4MJ 1QVTA 1LE8A 2NVTJ 3ZQIA 1JUPA 2YUSA 4A3LJ 4B3HA 2TRTA 1PUFB 4AUXA 3PDUA 2LD5A 2E2IJ 2P4QA 2X58A 3JRFA 2X9DA 1OFCX 2Y9YA 2JMWA 3RKQA 2ZYGA 3EGOA 1AKHA 3BT9A 1XC5A 1FEXA 3ZHBA 2LK2A 5EEAA 2JJ7A 1JKRC 3DFUA 2IEKA 2ID6A 1LSOA 3PM1A 1M76A 3A01B 4EZBA 4C2MJ 2XGCA 2IYPA 4MLOA 4HNVA 3RQSA 1JJ8C 3GTOJ 2Y9ZA 1LFUP 4UUTA 2K9NA 4QIWN 1AHDP 3ZWCA 4B3IA 3G17A 4DYCA 4M3GA 2ZYDA 2FX0A 1PGOA 3L6DA 2E2HJ 1M75A 1DU0A 5GP9A 1WDMA 2CU7A 1JKQC 4MFDA 5A9SB 4A93J 3FR7A 3HADA 4DCKA 2HDHA 1T56A 3QHAA 1Q1VA 3SDGA 4M3EA 4C3JJ 2ECBA 2E2JJ 5EYRA 4IHYA 4OQZA 2XRLA 3Q3SA 2XSDC 3S1RJ 3PO2J 3CQZJ 4X1EA 2IZ0A 2WB1N 4DZPA 1MSEC 2DA3A 4IHWA 5EGOA 3GTPJ 2DA4A 1WI3A 5E3MA 3IV5A 3S1QJ 3HOUJ 5JLWA 1Y1WJ 5E3LA 4GBJA 3S1NJ 1Y1VJ 4IHXA 1WH5A 3MKLA 3B6AA 2EW2A 4JX6A 4GWKA 4DYRA 1E3OC 1YJ8A 2CRGA 4A3BJ 4D3SA 3WHCA 1PUFA 1ZR4A 3CDLA 2LFBA 3FR8A 3VPRA 5M5YJ 4FISA 4V2GA 5M5WJ 3PJGA 3TW6A 1B72A 4PZCA 2XB0X 1XS9A 1RKWA 1EVYA 3QSGA 2VKVA 4W1UA 1LSJA 2LP0A 3TW7A 1O4XA 1ITYA 3BR5A 4A3GJ 3GHYA 3FISA 1MBKA 4OL9A 2K9QA 3HGGA 4Y7NJ 1OCTC 4ABZA 1NK2P 2COBA 2LY9A 3FK6A 3GBGA 1GV2A 5F1JA 1YRNA 3I83A 1IG7A 4S3MA 5FKKA 2JA6J 3ADPA 1JTXA 4BXXJ 1JUMA 5F27A 2TCTA 1QVUA 3A02A 3NAUA 5EZGA 1M67A 2DMPA 2OPTA 2KT0A 3S2DJ 2E1OA 3FIWA 3C7DB 1JJ6C 4GWGA 3BR1A 1IV6A 3QPLA 2XB5A 5IP7J 1GVDA 1S7EA 2LR8A 1SANA 3FK7A 5EGOB 1MBJA 3HOXJ 4A3KJ 1U9OA 4C3HJ 2GM4A 4XRMA 3G1LA 1QRYA 4B4CA 1F0YA 3WFIA 1ETVA 3DEWA 3A01A 5DS9A 3BG5A 2ZB9A 1P7JA 1FIPA 3L1PA 2GBYA 3ULKA 1WP4A 3BQZA 2DMTA 3O8HA 3Q0VA 1TXGA 3S2HJ 4E13A 5A9SA 3HB9A 3RZDJ 3C7CB 3BG3A 3HOYJ 1HDDC 3GTKJ 2QF7A 4E21A 1R9TJ 2H8RA 4A3JJ 2R92J 3H3VK 4JX5A 4PZDA 3G1MA 1BA5A 1WGXA 1YRLA 1BG6A 3B6CA 2Y0SN 2W90A 2IYOA 2IZ1A 1TWFJ 1VNDA 1ZK8A 1F17A 2CQQA 5F0FA 3K96A 1MSFC 5M3MJ 2AHQA 2FJ1A 5J1YA 1ENHA 4D7MA 2ZYAA 3ZQFA 4B3AA 1APLC 1BW5A 1ZCJA 4FTHA 2R7ZJ 1K83J 5IOZA 3S15J 4GFBA 5EF6A 1M2WA 4XK4A 2G0EA 2EH3A 3Q3CA 5C44J 3CMYA 3NARA 2WV1A 3RQIA 4QSHA 1H89C 4J19A 5EG0A 3ZQCA 2I9PA 2VPRA 3A03A 2UYYA 3HBLA 2LLKA 1IDYA 3HN2A 4KUEA 2E19A 2VI6A 2D3TA 2PLAA 2GLOA 2MSYA 3S14J 1JKOC 1H88C 3LNQA 2K9SA 3IH3A 1FJLA 1JUSA 1A6IA 4LOCA 3BQYA 3K2AA 3W6VA 4IM7A 3BTJA 4BY7J 4S0HB 3CTVA 4A3IJ 1MBGA 2NVYJ 4D5CA 2AO9A 2M8GX 1G2HA 5EG0B 4OQYA 1VF9A 4BY1J 3ZW8A 5MGBA 3S1MJ 1GV5A 5GPCA 4QTRA 2M34A 2DMNA 2R0QC 5FLVA 1TWGJ 2ELKA 2VKEA 1OJLA 1MBFA 3JRGA 4PZEA 3IQDB 5K7HA 2D5VA 3O8GA 2JA8J 3CCYA 2NOGA 5IYBJ 1U78A 2ECCA 3HOVJ 1JDJA 2HQ5A 2EZLA 4KUGA 3QPSA 2EBIA 1HOMA 1TWCJ 3JRBA 3WFJA 2XPUA 3HGYA 1WCMJ 2LKXA 2XPWA 5IYCJ 1JKPC 2HDDA 4MO7A 3JRHA 4X6AJ 5J1UA 4A69C 2LTPA 1HCRA 3ZQHA 1WDLA 3ZOBA 1X0XA 2DA5A 2K40A 5J1RA 3D1NI 1BL0A 1AKHB 1YONA 4FE4A 1ETYA 4A3MJ 1ETWA 2JA5J 2CVZA 1ETXA 1HDPA 1YB4A 1BW6A 2Y2ZA 4JX4A 1PGQA 2CUEA 3LOCA 3LSJA 3I4NJ 1ETOA 5JLXA 4XRSA 3TP0A 1MH4A 4CYCA 1EF4A 1B8IA 1F12A 1T33A 1B8IB 1NK3P 3JRCA 2FQ4A 1UG2A 2JWTA 3QQAA 5M3FJ 2R5ZA 1U9NA 4W97A 3H0GJ 1FIAA 2MG4A 1A5JA 1H8AC 1WPKA 3G0OA 5IPAA 1QMGA 3MOGA 2IBDA 2HOSA 4B1RA 4DLLA 2FD5A 1IUFA 3ZQLA 3HOZJ 3WS7A 2EQRA 5BNGA 5IP6A 1LFBA 1IL0A 1F14A 3M3YJ 1I36A 2QCOA 2R93J 1ETKA 1X58A 4CYCB 4J0FA 2EZHA 3MN2A 3RZOJ 1EVZA 1Z0XA 2RAEA 4A3DJ 3HM5A 1U8BA 4BBSJ 3BR0A 4A3EJ 4RDUA 2DA6A 1IC8A 2GF2A 4FE7A 2DMUA 1GDTA 4B3JA 3LSRA 4FCYA 4J0EA 4JPZB 1VFCA 5EZHA 3DOJA 3HEFA 1ETQA 4A3FJ 2L7MP 1WH7A 3E7LA 1ORKA 3W6UA 5FKOA 1DLJA 4KUHA 1I6HJ 4M3DA 1LJ8A 3F3SA 3HOWJ 2M9HA 3BR2A 4M3BA 2HI3A 1POGA 1XG1A 5E3OA 4YCAA 3ZW9A 1VPDA 4D3FA 5HODA 2ME6A 4I6ZA 3BTCA 4DYQA 3JRDA 4A3CJ 2DN0A 1RESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DW6 A;  1MNM C;  3BTI A;  4AC0 A;  5J3L A;  1X2M A;  1IJW C;  3ZQG A;  1VI0 A;  3HKZ N;  1FTT A;  3WHB A;  4XIC A;  2LVS A;  2R5Y A;  3S16 J;  2JK3 A;  2L7F P;  3OSF A;  2XGD A;  3MVP A;  2L9R A;  2MGQ A;  4JYK A;  5FJ8 J;  3TP3 A;  5EDN A;  4RBO A;  3TED A;  3BG9 A;  2YU9 J;  2M0C A;  2W48 A;  4OVN F;  1I3Q J;  1GT0 C;  2WAQ N;  2DJN A;  4JP0 A;  1YRN B;  4MIM A;  1HF0 A;  1DU6 A;  1B72 B;  3PO3 J;  2ID3 A;  2MW8 A;  2JA7 J;  2NVQ J;  2L0K A;  4IEJ A;  1RR7 A;  1NTC A;  4V2F A;  2HOT A;  1ZQ3 P;  4IHV A;  3GTQ J;  1IGN A;  1JTY A;  5K7Z A;  2H1K A;  3LSP A;  2CJJ A;  5E3N A;  3JRE A;  2VUM J;  4D5F A;  1W0T A;  1JGG A;  2NS7 A;  5FKM A;  1QPI A;  1F36 A;  3BR3 A;  3JRI A;  5C4J J;  3F0C A;  2PMZ N;  4BBR J;  3UKG A;  2EZI A;  1ZTR A;  2HXI A;  3GTL J;  2X6O A;  2I10 A;  1I50 J;  2L7Z A;  4Y52 J;  2P81 A;  3HDD A;  3C2B A;  4XID A;  2Y30 A;  1JT6 A;  4EEF G;  9ANT A;  1RPW A;  4L5E A;  1SFO J;  1MH3 A;  3IH4 A;  4UUS B;  2R5Y B;  1ZR2 A;  1UHS A;  1P7I A;  1Z77 A;  2DA2 A;  4C3I J;  3K7A J;  2O9L A;  4DZJ A;  2OF7 A;  1MBH A;  2JN6 A;  1UMQ A;  2XGE A;  2R5Z B;  2YS9 A;  2B63 J;  2DA7 A;  3GTG J;  4MFE A;  3OSG A;  1RET A;  5F0C A;  2NS8 A;  2KDZ A;  2DTZ A;  2DMQ A;  1W0U A;  3DCF A;  1D5Y A;  1CQT A;  4NDL A;  5FLM J;  1RKT A;  4JQ0 D;  1IDZ A;  4D7N A;  4XRS G;  5GPA A;  3SJM A;  2IAI A;  2XPV A;  1GUU A;  1OCP A;  1IRZ A;  3SFI A;  3LSG A;  5K7F A;  1TWA J;  2CQX A;  2HOA A;  2HYJ A;  3GTM J;  2ME0 A;  5F04 A;  2O8K A;  5IP9 J;  2EZK A;  3GTJ J;  1ZKG A;  4M3F A;  1LE8 B;  2NVX J;  4BKX A;  3Q0W A;  3G1O A;  1TC3 C;  1FTZ A;  3OOU A;  3JRA A;  3FKI J;  5IYD J;  2Y31 A;  1BJZ A;  3BTL A;  5IOY A;  5DTD A;  1K61 A;  2M2E A;  2HXO A;  1AU7 A;  5FKN A;  4AYB N;  5F08 A;  2N8G A;  2O7O A;  1TWH J;  5C4X J;  4M6V A;  2X48 A;  5F0H A;  4UUS A;  2DA1 A;  1MBE A;  4G12 A;  3S17 J;  4I76 A;  1F43 A;  5C3E J;  3BR6 A;  5FKL A;  3IH2 A;  3JR9 A;  1ZGW A;  5M5X J;  1JT0 A;  1X2N A;  3OIO A;  2CUF A;  3Q0U A;  1HLV A;  3M4O J;  3I4M J;  1QVT A;  1LE8 A;  2NVT J;  3ZQI A;  1JUP A;  2YUS A;  4A3L J;  2TRT A;  1PUF B;  4AUX A;  2LD5 A;  2E2I J;  3JRF A;  2X9D A;  1OFC X;  2Y9Y A;  2JMW A;  3RKQ A;  1AKH A;  3BT9 A;  1XC5 A;  1FEX A;  2LK2 A;  5EEA A;  2JJ7 A;  1JKR C;  2IEK A;  2ID6 A;  3PM1 A;  3A01 B;  4C2M J;  2XGC A;  4MLO A;  4HNV A;  1JJ8 C;  3GTO J;  2Y9Z A;  1LFU P;  4UUT A;  2K9N A;  4QIW N;  1AHD P;  4DYC A;  4M3G A;  2FX0 A;  2E2H J;  1DU0 A;  5GP9 A;  2CU7 A;  1JKQ C;  4MFD A;  4A93 J;  4DCK A;  1T56 A;  1Q1V A;  3SDG A;  4M3E A;  4C3J J;  2ECB A;  2E2J J;  5EYR A;  4IHY A;  2XRL A;  3Q3S A;  2XSD C;  3S1R J;  3PO2 J;  3CQZ J;  4X1E A;  2WB1 N;  4DZP A;  1MSE C;  2DA3 A;  4IHW A;  5EGO A;  3GTP J;  2DA4 A;  1WI3 A;  5E3M A;  3IV5 A;  3S1Q J;  3HOU J;  5JLW A;  1Y1W J;  5E3L A;  3S1N J;  1Y1V J;  4IHX A;  1WH5 A;  3MKL A;  3B6A A;  4JX6 A;  4DYR A;  1E3O C;  2CRG A;  4A3B J;  3WHC A;  1PUF A;  1ZR4 A;  3CDL A;  2LFB A;  3VPR A;  5M5Y J;  4FIS A;  4V2G A;  5M5W J;  3TW6 A;  1B72 A;  2XB0 X;  1XS9 A;  1RKW A;  2VKV A;  4W1U A;  2LP0 A;  3TW7 A;  1O4X A;  1ITY A;  3BR5 A;  4A3G J;  3FIS A;  1MBK A;  2K9Q A;  3HGG A;  4Y7N J;  1OCT C;  4ABZ A;  1NK2 P;  2COB A;  2LY9 A;  3FK6 A;  3GBG A;  1GV2 A;  5F1J A;  1YRN A;  1IG7 A;  5FKK A;  2JA6 J;  1JTX A;  4BXX J;  1JUM A;  5F27 A;  2TCT A;  1QVU A;  3A02 A;  3NAU A;  5EZG A;  2DMP A;  2OPT A;  2KT0 A;  3S2D J;  2E1O A;  3FIW A;  1JJ6 C;  3BR1 A;  1IV6 A;  3QPL A;  2XB5 A;  5IP7 J;  1GVD A;  1S7E A;  2LR8 A;  1SAN A;  3FK7 A;  5EGO B;  1MBJ A;  3HOX J;  4A3K J;  1U9O A;  4C3H J;  2GM4 A;  4XRM A;  3G1L A;  1QRY A;  4B4C A;  1ETV A;  3DEW A;  3A01 A;  5DS9 A;  3BG5 A;  2ZB9 A;  1P7J A;  1FIP A;  3L1P A;  2GBY A;  3BQZ A;  2DMT A;  3O8H A;  3Q0V A;  3S2H J;  3HB9 A;  3RZD J;  3BG3 A;  3HOY J;  1HDD C;  3GTK J;  2QF7 A;  1R9T J;  2H8R A;  4A3J J;  2R92 J;  3H3V K;  4JX5 A;  3G1M A;  1BA5 A;  1WGX A;  3B6C A;  2Y0S N;  1TWF J;  1VND A;  1ZK8 A;  2CQQ A;  5F0F A;  1MSF C;  5M3M J;  2AHQ A;  2FJ1 A;  5J1Y A;  1ENH A;  4D7M A;  3ZQF A;  4B3A A;  1APL C;  1BW5 A;  4FTH A;  2R7Z J;  1K83 J;  5IOZ A;  3S15 J;  4GFB A;  5EF6 A;  4XK4 A;  2G0E A;  2EH3 A;  5C44 J;  3CMY A;  3NAR A;  2WV1 A;  3RQI A;  4QSH A;  1H89 C;  4J19 A;  5EG0 A;  3ZQC A;  2VPR A;  3A03 A;  3HBL A;  2LLK A;  1IDY A;  2E19 A;  2VI6 A;  2GLO A;  2MSY A;  3S14 J;  1JKO C;  1H88 C;  3LNQ A;  2K9S A;  3IH3 A;  1FJL A;  1JUS A;  1A6I A;  4LOC A;  3BQY A;  3K2A A;  3W6V A;  3BTJ A;  4BY7 J;  4S0H B;  4A3I J;  1MBG A;  2NVY J;  4D5C A;  2AO9 A;  2M8G X;  1G2H A;  5EG0 B;  1VF9 A;  4BY1 J;  3S1M J;  1GV5 A;  5GPC A;  4QTR A;  2M34 A;  2DMN A;  2R0Q C;  5FLV A;  1TWG J;  2ELK A;  2VKE A;  1OJL A;  1MBF A;  3JRG A;  5K7H A;  2D5V A;  3O8G A;  2JA8 J;  3CCY A;  2NOG A;  5IYB J;  1U78 A;  2ECC A;  3HOV J;  2HQ5 A;  2EZL A;  3QPS A;  2EBI A;  1HOM A;  1TWC J;  3JRB A;  2XPU A;  3HGY A;  1WCM J;  2LKX A;  2XPW A;  5IYC J;  1JKP C;  2HDD A;  4MO7 A;  3JRH A;  4X6A J;  5J1U A;  4A69 C;  2LTP A;  1HCR A;  3ZQH A;  3ZOB A;  2DA5 A;  2K40 A;  5J1R A;  3D1N I;  1BL0 A;  1AKH B;  4FE4 A;  1ETY A;  4A3M J;  1ETW A;  2JA5 J;  1ETX A;  1HDP A;  1BW6 A;  2Y2Z A;  4JX4 A;  2CUE A;  3LOC A;  3LSJ A;  3I4N J;  1ETO A;  5JLX A;  4XRS A;  3TP0 A;  1MH4 A;  4CYC A;  1EF4 A;  1B8I A;  1T33 A;  1B8I B;  1NK3 P;  3JRC A;  2FQ4 A;  1UG2 A;  2JWT A;  3QQA A;  5M3F J;  2R5Z A;  1U9N A;  4W97 A;  3H0G J;  1FIA A;  2MG4 A;  1A5J A;  1H8A C;  1WPK A;  5IPA A;  2IBD A;  2HOS A;  4B1R A;  2FD5 A;  1IUF A;  3ZQL A;  3HOZ J;  2EQR A;  5BNG A;  5IP6 A;  1LFB A;  3M3Y J;  2QCO A;  2R93 J;  1ETK A;  1X58 A;  4CYC B;  2EZH A;  3MN2 A;  3RZO J;  1Z0X A;  2RAE A;  4A3D J;  3HM5 A;  1U8B A;  4BBS J;  3BR0 A;  4A3E J;  4RDU A;  2DA6 A;  1IC8 A;  4FE7 A;  2DMU A;  1GDT A;  3LSR A;  4FCY A;  4JPZ B;  1VFC A;  5EZH A;  3HEF A;  1ETQ A;  4A3F J;  2L7M P;  1WH7 A;  3E7L A;  1ORK A;  5FKO A;  1I6H J;  4M3D A;  3HOW J;  2M9H A;  3BR2 A;  4M3B A;  2HI3 A;  1POG A;  1XG1 A;  5E3O A;  5HOD A;  2ME6 A;  4I6Z A;  3BTC A;  4DYQ A;  3JRD A;  4A3C J;  2DN0 A;  1RES A; 
#chains in the Genus database with same CATH topology
 1FBQ A;  2C6Y A;  1T6S A;  4P5O A;  3C7A A;  2NXN B;  3BTI A;  5J3L A;  1N86 A;  3ADO A;  3SEQ A;  3U2R A;  4CYD A;  5E18 F;  3E6B A;  3WHB A;  2LKS A;  1N1E A;  2LVS A;  1XCB A;  2Y0C A;  2ZNZ A;  3QP6 A;  5CQE A;  2FBH A;  3ZGY A;  1SQP J;  3K69 A;  5AVU B;  3W2A A;  2P67 A;  1LP1 A;  4UB8 H;  2NS0 A;  2XGD A;  5EDN A;  1ZRT D;  3TP3 A;  5GTI H;  2F48 A;  3BG9 A;  3EPZ A;  3DU5 A;  4DOZ A;  3TSI A;  1KB9 H;  5E1Z B;  4FGW A;  4Y4R A;  4XBF A;  3L72 G;  4ZKP A;  1USD A;  1DU6 A;  1DD3 A;  5CVJ A;  1BM9 A;  4FAS D;  1B72 B;  1YJQ A;  2HTS A;  3HZJ A;  3LSI A;  3CCS I;  2ID3 A;  1K79 A;  5A9R A;  1TU3 F;  3L72 D;  2MW8 A;  1NU1 G;  3WU2 E;  2NVQ J;  2I1K A;  2L0K A;  2HFE D;  1NTC A;  4V2F A;  1FJK A;  2F5E A;  1ZQ3 P;  1GTW A;  1UJ8 A;  3PLR A;  3BWG A;  1NU1 D;  1LJ9 A;  2DOE A;  2H1K A;  3S4R A;  1MMG A;  5ILV A;  1OW7 A;  2M4G A;  1LTG C;  3KYD B;  4YEL A;  4KJZ A;  2A45 I;  1G4D A;  1KZH A;  2KLO A;  4F93 B;  1BE3 E;  3DV8 A;  4G9Y A;  2Z33 A;  4Y99 B;  1N75 A;  3ZN1 A;  4RES B;  4M74 A;  1AOY A;  2WPQ A;  2LF8 A;  1H8A A;  3RL0 B;  4UV8 A;  2O1K A;  1VQN I;  5AW5 B;  1RE3 C;  1IRF A;  5FRO A;  1SMT A;  3U21 A;  1KQG B;  4PD4 D;  3M07 A;  4EMS A;  3CZ6 A;  4O5V A;  5FWN A;  1T3U A;  4E12 A;  1FZG A;  3OYH A;  2E36 A;  3B5N B;  3KXD A;  1YJN I;  2M8R A;  3W68 A;  2X6O A;  2I10 A;  4U7B A;  3FWE A;  4HG2 A;  2K5C A;  4A5N A;  2BCC J;  4Y52 J;  5M1B A;  1XGN A;  2P81 A;  5E17 F;  2KYV A;  2Q3I A;  4I7Z B;  1ZLJ A;  4UY8 I;  3AEB C;  1FC2 C;  2V9K A;  4PGH A;  4DYD A;  5E1X A;  3WE2 A;  1GW4 A;  2Y30 A;  3DP7 A;  4A0Y A;  3MZ8 A;  4M6Y A;  4EEF G;  1DIP A;  2O01 N;  2VT2 A;  4RM3 A;  2H89 C;  2M87 A;  1P4W A;  5J40 A;  2BBY A;  3W67 A;  3KEO A;  3TO7 A;  4BWN A;  2FUG 2;  2L9N A;  4KT5 C;  4CZC A;  2Z16 A;  1ZR2 A;  2O9L A;  4IOA F;  3DBL B;  1U3E M;  2Q5U A;  3K7A J;  3F89 A;  4N6J A;  4TLF A;  5KTB A;  2R5B A;  2OF7 A;  4QWQ A;  1MBH A;  1B6A A;  3L2W A;  1JMB A;  4C30 A;  2HEO A;  1W7P B;  3GTG J;  3KQG A;  1Q1H A;  5DJT B;  4L0Y B;  1ZLK A;  4M73 A;  1AA0 A;  4RS8 A;  2K3P A;  5F0C A;  4U87 A;  4UB6 E;  2NS8 A;  3REO A;  2X1C A;  2DMQ A;  3ZCO A;  2KDZ A;  1FT9 A;  1KOR A;  2RH0 A;  2DPD A;  2ESH A;  2ETH A;  4PFO A;  3SZT A;  3TO9 A;  2D2C C;  2JP3 A;  4NDL A;  5FLM J;  1RKT A;  2EJR A;  1HH0 A;  1ZGA A;  1KB9 D;  3FXU A;  2QGU A;  1ZME C;  2DOF A;  1IUY A;  2LOO A;  4AUW A;  4CCM A;  2F5V A;  1ZRE A;  2X6X A;  1FP1 D;  1GL2 D;  5CHX A;  1QEX A;  1X0V A;  4M9Z A;  2HYJ A;  2FFD C;  1OIS A;  1MDM B;  2EZK A;  1H88 A;  4M3F A;  4PJ0 H;  3L73 J;  2FYU E;  1KQS O;  1SC7 A;  2V6C A;  2K88 A;  4EI2 A;  1R5I D;  1UHM A;  2IFM A;  2RKH A;  4EJV A;  1RQU A;  3I4P A;  3QAH A;  1VQ6 P;  2DK5 A;  3EQL F;  1PPJ D;  3JRA A;  1IFM A;  2ZXI A;  2H94 A;  4MTD A;  4X0G A;  4UNO A;  5JE8 A;  2OAR A;  1FMV A;  3R60 A;  3H32 A;  4IOI H;  3ZWA A;  3ELK A;  4IZZ A;  1NO4 A;  2Y31 A;  3TNU A;  3EFG A;  1BJZ A;  2GXG A;  3BTL A;  3C2G A;  2A6T A;  4FT8 A;  4NC8 A;  5H6Q A;  3PQJ A;  5IOY A;  2D45 A;  1K61 A;  1PGN A;  4BXF A;  3JC2 2;  3OS0 A;  5JFR A;  2XAU A;  5HOO A;  2OYH B;  5F08 A;  1KIL C;  3SWK A;  2CGP A;  5D5X B;  2YNY A;  2OTL P;  4PV1 C;  3F6O A;  3S3O A;  4M6V A;  2X48 A;  4WX9 A;  1A31 A;  3IP4 B;  5AVW B;  4CCK A;  1PGP A;  5DD4 A;  4OM8 A;  3TGU G;  3Q9S A;  3CC7 P;  4BNC A;  4I76 A;  2CV2 A;  3I53 A;  5C3E J;  1YJ9 I;  1KFM A;  1NTM D;  2WPR A;  4EJW A;  3IRQ A;  3TNU B;  3S8P A;  1X2N A;  3OIO A;  4QPQ A;  3PJS K;  1X1A A;  2V6E A;  5IT3 A;  4ZYH A;  3OS2 A;  2I76 A;  3TGU E;  3H1H D;  3OYD A;  4G7O F;  1AVY A;  5APU A;  2P7C B;  1LE8 A;  2B9S A;  2TRT A;  4H44 B;  2EFO A;  4R79 A;  2Y9Y A;  2DI3 A;  1XMK A;  4S04 A;  2EFP A;  3BT9 A;  4HST A;  3J81 K;  2UXN A;  5H2F E;  1GK6 A;  2IXS A;  1J5Y A;  1R1T A;  1L0N K;  1DUX C;  2WWY A;  5B5E C;  3ZHB A;  4M9X A;  2JJ7 A;  3I3L A;  3SHF A;  4YFN F;  5B3S H;  4C7N A;  3VEP A;  2VPL A;  3KEY A;  4JYC A;  1S9K D;  1X4P A;  3B02 A;  3LAJ A;  1VQ6 I;  2KS1 A;  4PFP A;  2YKP A;  4ZYE A;  1SQQ E;  1XTG B;  3FXK A;  5EEH A;  4B47 A;  3T97 A;  3KZY A;  4C2U A;  3MUD A;  4O6J A;  4AIH A;  4K35 A;  1RE3 A;  4MLO A;  4HNV A;  2KRH A;  1W7P A;  4GDF A;  2WPS A;  3A1Y A;  4BQO A;  1JTH A;  1KON A;  2AEJ A;  2K9N A;  4QIW N;  5AON A;  4B3I A;  1IFJ A;  3L73 G;  3FMR A;  2AEM A;  4M3G A;  5KKZ C;  2FYZ A;  2WSC J;  1T38 A;  1UFM A;  1M75 A;  1MNE A;  2BYV E;  2D2C D;  4YFK F;  4WWC A;  3MD0 A;  2ZO4 A;  4B09 A;  1WDM A;  4PUS A;  1JKQ C;  1XDS A;  5HVQ C;  2IX7 C;  2V1D A;  1ZRT E;  3F21 A;  1RR8 C;  4U0V A;  3GXO A;  2JTV A;  1P84 H;  4WWI A;  4YII A;  1YJN P;  3HAD A;  2HKO A;  2HDH A;  1NTM G;  2HNH A;  5KAI C;  1Q1V A;  1O7F A;  3P7N A;  3SDG A;  2ECB A;  3KFW X;  1PIX A;  5GTH H;  5EYR A;  5J8F A;  2NPS B;  1O3R A;  1OVU A;  4IHY A;  1Y8R B;  2XRL A;  2VKH A;  3D5S C;  1W5S A;  1KIL D;  1G2C B;  3L75 J;  1YI2 I;  2K86 A;  2WB1 N;  1ZOY C;  2QQ9 A;  3M8E A;  5EGO A;  4P55 A;  3GTP J;  2XND H;  4D6T E;  2HU9 A;  4HF1 A;  3KP6 A;  3WE3 A;  5JLW A;  1G3W A;  1OCO H;  3HOU J;  2DW4 A;  2JPC A;  2VXD A;  1VQ7 I;  4L0Z B;  1KIL A;  4ZMD A;  4B86 A;  5E3L A;  2KSJ A;  1EKE A;  5J4V A;  3S1N J;  1Z6T A;  2BAS A;  1P84 E;  2DT5 A;  4JX6 A;  2ZFU A;  1VPC A;  5AW4 B;  1FBM A;  3OYJ A;  3ZDM A;  5KAF H;  2E74 B;  2VN2 A;  2VQG A;  4D3S A;  3LQR A;  5JR3 A;  4PJ0 C;  1A35 A;  1ZR4 A;  4XR6 A;  3ZQQ A;  1URQ A;  1NG7 A;  2V4H A;  4TT3 H;  3RL0 g;  3JCU H;  1BJA A;  3BZC A;  4IFD K;  1XGO A;  3PJG A;  1N7S C;  3W2W A;  2CV1 A;  1YBK A;  1W4M A;  4BJ6 C;  2M3A A;  3C8V A;  3MHV A;  1XS9 A;  1SFC C;  3EWK A;  1BIB A;  2K3F A;  2E42 A;  1MGT A;  2IBZ E;  4XLH A;  3JSP A;  3TOA A;  5ICG A;  3TW7 A;  1BSN A;  3KZI H;  3BR5 A;  3LMM A;  3GHY A;  3PUB A;  2K9Q A;  3HGG A;  2KP8 A;  1LP1 B;  2H27 A;  3FWL A;  5KAF E;  4MNU A;  5CCG D;  4ABZ A;  2A69 F;  5C39 A;  4ENN A;  5LLQ A;  3FK6 A;  2A06 G;  2DK8 A;  1K7A A;  4ON0 A;  3M9Q A;  2PMU A;  4C46 A;  1KU2 A;  4N0B A;  3ADP A;  1P84 I;  3ASN H;  1IN4 A;  1JUM A;  3K70 D;  4KNY A;  3RIR A;  2YX7 A;  4O9B A;  1ZG3 A;  4E7K A;  3GHG C;  5KLI C;  3A02 A;  3EUH A;  2IGK A;  3RCO A;  4G8X A;  2B89 A;  1G3Y A;  2OPT A;  3CCR I;  3S2D J;  1IRG A;  4W80 A;  3D6Z A;  3QYF A;  3CME I;  3C7D B;  2O1J A;  5AVV B;  1JJ6 C;  3AEE C;  1OCR H;  4FQG A;  3NFQ A;  3QPL A;  3RPU D;  2VQL A;  1S7E A;  3RKW A;  1SAN A;  3CWB G;  2EIJ H;  1UEL B;  5KVR A;  3M91 A;  1V5G A;  2GM4 A;  1SQV D;  2E74 D;  1F9N A;  2BVL A;  1QRY A;  3V8K A;  4XRM A;  3HD7 B;  1ETV A;  2L9S A;  3H92 A;  3NQO A;  1FIP A;  1WJC A;  1EDJ A;  1UB9 A;  3BPV A;  1MND A;  1Y6I A;  5LFA A;  2DU9 A;  2YSR A;  6PAX A;  1ERD A;  4E13 A;  1ON1 A;  1N7S A;  2OUM A;  4RB1 A;  1NAF A;  3W6J B;  1FC3 A;  3GW2 A;  4MHG A;  1QGK B;  5AIP A;  4ZDO A;  4FHT A;  2ZSH B;  1NTZ G;  3GG2 A;  2NPS D;  3L74 J;  3HE4 A;  3IAM 2;  4KT6 A;  2H8R A;  2R92 J;  2UZK A;  2GA1 A;  1R71 A;  4PZD A;  1YRL A;  2GXB A;  1JI8 A;  5BVZ A;  1JNM A;  3B6C A;  2W90 A;  2WAD A;  2N1T A;  2IZ1 A;  1NTK J;  4H44 C;  3LW5 J;  1S5L H;  1VQ5 P;  2P6S A;  4PK4 A;  3OYF A;  1PP9 J;  4MQ9 F;  4XON A;  2FJ1 A;  1WJF A;  1ENH A;  3CCM P;  2KFD A;  1FOX A;  3AEG C;  1OVR A;  2O3F A;  2B0L A;  3F8B A;  3WTX C;  2XV5 A;  1WSU A;  3B8E B;  4FTH A;  2L3D A;  1K83 J;  2JJL A;  3V2R A;  1FDM A;  3FXR A;  4HF0 A;  1FBS A;  2ADU A;  1M1J C;  2HZT A;  3P9I A;  5B66 E;  1SD4 A;  1MIJ A;  1DD4 A;  3NWT A;  1S5L E;  3DFG A;  3N4M A;  2HVS A;  3CMY A;  4HNU A;  1GD2 E;  2JSC A;  2H7H A;  3RQI A;  2R7T A;  3CI9 A;  1TLH B;  2GOX B;  1VDF A;  3F5H A;  4BRY B;  3CCQ P;  3CCQ I;  3ZQC A;  1K04 A;  2XKP A;  2VPR A;  5E79 E;  3D6Y A;  2BXZ A;  1GW3 A;  3HBL A;  4CGZ A;  2EIN H;  4I01 A;  1IDY A;  4XOT A;  1P84 D;  2E19 A;  3BP8 A;  3CJN A;  2D3T A;  3CXH E;  4LLG F;  2E5N A;  3AG1 H;  1N2D C;  3VP9 A;  4M6X A;  3HUS C;  2IS2 A;  2L7K A;  4Z2Y A;  1HST A;  2K9S A;  5CLS A;  3CPW O;  3CCV P;  4RGS A;  4PD4 E;  3B5N A;  2XAF A;  1RIO H;  1SQQ D;  2R7X A;  2EV0 A;  4CH7 A;  3CWB J;  2COM A;  1Z1D A;  3IRR A;  2QQA A;  4D5C A;  2AO9 A;  1XMX A;  2STT A;  1G2H A;  4OQY A;  5MGB A;  4ZDL A;  1VF5 D;  5HLG A;  2DT7 B;  2HS5 A;  2V7F A;  1GV5 A;  1SFU A;  2R44 A;  1VQP I;  3O8Z A;  2X1D A;  2IBZ D;  5HDN A;  3F6V A;  1TWG J;  1OJL A;  3K1M A;  4R4M A;  3F8F A;  5HLI A;  2W83 C;  2W7N A;  5FLX K;  4U3F J;  4EVI A;  3OV8 A;  5IYB J;  1U78 A;  2ECC A;  4EGZ A;  3CTA A;  3UNG C;  3HOV J;  3OYG A;  2EZL A;  2C0X A;  4KUG A;  4PD4 H;  2HR3 A;  3ZMT A;  1HOM A;  4HDV A;  1S72 P;  1A6Q A;  3CLQ A;  4G6D A;  2UUZ A;  1IO4 A;  1Q90 D;  2F5F A;  3WFJ A;  3S1K A;  1KN7 A;  2KIM A;  1WCM J;  1L0L J;  3CL3 D;  3I56 P;  5IYC J;  2LMD A;  2KSE A;  1JKP C;  3MFK A;  3MKY B;  2JUG A;  2R5D A;  1NTK G;  1DH3 A;  5J1U A;  4XLP F;  2JA2 A;  4UB8 C;  4CPG A;  3AAF A;  1Y56 A;  2CPB A;  3L75 E;  1X0X A;  2LY2 A;  4E7J A;  1GVJ A;  2DA5 A;  5J1R A;  4YG2 F;  4FET A;  2JVH A;  3JAM K;  1YON A;  2JZY A;  5DYM A;  4D1Q A;  4A3M J;  4GIF A;  2P8T A;  2FBI A;  2CVZ A;  2DOD A;  2IGM A;  5DUK A;  3KIO A;  2FYU K;  4HRI A;  3I4N J;  5CKT A;  2K1A A;  3LSK A;  3TP0 A;  2KP6 A;  3TYY A;  4JBA A;  1EF4 A;  1B8I A;  1S4X A;  4L9V A;  1NK3 P;  5FRN A;  3CCR P;  4L18 B;  2JWT A;  1UG2 A;  5M3F J;  2STW A;  1B4A A;  2P2U A;  1U9N A;  1FIA A;  1R6R A;  1A5J A;  2F5C A;  1H8A C;  1WPK A;  3VMX A;  4HZF A;  1SQX J;  4ZZD A;  2X51 A;  3H25 A;  4DJA A;  2F2E A;  5GAD J;  2LNB A;  2W24 A;  4B1R A;  4L5J A;  2HOS A;  1RH5 B;  3R6S A;  3IKT A;  5GTI E;  3NWS A;  1ZG1 A;  1NHL A;  3L71 G;  2DLL A;  3WS7 A;  1R5L A;  3OIQ A;  4RGR A;  2LC2 A;  5BNG A;  5DJU B;  4KUM A;  1LWU C;  2IBZ G;  3A0H E;  3OR1 C;  4B43 A;  1EZV E;  2PX9 A;  1TQI A;  1W7P D;  5BOX A;  1I36 A;  2NVU B;  2EB7 A;  3I59 B;  5APX A;  4YXD C;  2X6Y A;  3A3Y B;  2Z3Y A;  2R7D A;  1P4A A;  3VWB A;  1U7J A;  2O01 J;  3L70 E;  3MN2 A;  2VOO A;  4EYY Q;  1ULY A;  1YFH A;  3L70 D;  1UCR A;  2HYG D;  3ABL H;  3FXE A;  1U8B A;  1MW7 A;  4A3E J;  2DQL A;  5FB2 A;  3G6E I;  2KIU A;  1CF7 A;  2GF2 A;  1L0N E;  1TW3 A;  5DDG A;  2HTJ A;  1HBX G;  4F7Z A;  3MZW B;  2FKW B;  2IDB A;  2A5Y B;  2FFD A;  3DBR B;  2CMP A;  4FCY A;  5L3C A;  4I09 A;  5EZH A;  3ML6 A;  3L72 J;  4CA0 A;  2L7M P;  4A3F J;  1T98 A;  5ICC A;  1W36 C;  2QSG X;  4PJL A;  1V55 H;  2NPS C;  3CX5 D;  2OBP A;  1Y8A A;  1BDD A;  2EA4 A;  2FMY A;  1IFD A;  2W6A A;  3PHL A;  2BHY A;  1NU1 J;  1LJ8 A;  3HOW J;  1MV8 A;  3GEZ A;  4M3B A;  2HI3 A;  4YCA A;  2O01 H;  3VN0 A;  1QHG A;  5DCF A;  5ICE A;  2H6C A;  5HOD A;  3WTY C;  4D3F A;  5GAH J;  3GLM A;  2D1V A;  2ELH A;  3KYL A;  1PPJ G;  1GU4 A;  3KLO A;  3HRN A;  2Y0S A;  4DT0 A;  4WF2 A;  1EJ9 A;  5AYV A;  5KLV E;  1QZE A;  1MNM C;  4RGU A;  1S5L X;  5TGT A;  1VF5 B;  2JPB A;  3ZMU A;  3GLL A;  1X2M A;  3EUA A;  3FMS A;  1L0O C;  3P9C A;  1D7M A;  4EV0 A;  1FTT A;  3OYL A;  3KP3 A;  3K4J A;  3KHU A;  4HOB A;  3T1B A;  3ZP5 A;  2R5Y A;  4ZZL A;  1VQO P;  1AWC A;  3OBB A;  1NTK D;  3K4M A;  1YJW P;  1K4T A;  2R7S A;  3OSF A;  2L9R A;  4ENJ A;  2YU9 J;  4IHS A;  1CI6 A;  4K2E A;  3TED A;  2K9M A;  2W6J H;  4WY4 D;  2JQ7 A;  2QJY C;  1T39 A;  4OVN F;  2HOE A;  5APT A;  5K5G B;  2OZ6 A;  2DJN A;  2X1E A;  4JP0 A;  1VQP P;  2WV0 A;  2NNY A;  2ZAE B;  4GT1 A;  4P1W A;  3GO5 A;  2JA7 J;  1RR7 A;  1NG6 A;  1R4M B;  1SQV K;  5BS6 A;  4OIO F;  1USE A;  1WKM A;  3QU6 A;  3DTI A;  1KFN A;  3BAS A;  3LSP A;  3M8J A;  4B8X A;  2IFN A;  5LEJ A;  4PD4 I;  1GZL A;  4D5F A;  2PFX A;  2EIL H;  1LWU A;  1UAA A;  1JGG A;  1ZLL A;  2M30 A;  3S3N A;  2QJY B;  1PL5 A;  1B9N A;  3FXO A;  1SAU A;  1LUJ B;  1ZEL A;  2LSO A;  5LHI A;  3DBH B;  3KP5 A;  1R49 A;  4HB1 A;  1PP8 F;  3PIP F;  1QVG O;  3ZWB A;  1DX7 A;  3F0C A;  1N1G A;  3UKG A;  1BR2 A;  3E5X A;  2O5R A;  3HRM A;  3VOD A;  2M3E A;  3AE1 C;  2F6C A;  3GTL J;  2V7Q H;  2IBZ I;  1TZL A;  2XVC A;  2ITA A;  3H1J J;  1I1S A;  4IKF A;  1JY2 P;  4I2O A;  2HG5 D;  3B4S A;  3CKY A;  1RF0 A;  3DU6 A;  3RK3 D;  3PTZ A;  5CVV A;  1L0L K;  3H2Z A;  1HW1 A;  2W8Z A;  3L7W A;  9ANT A;  2OQG A;  2P5K A;  1UII A;  3TDK A;  3RGU A;  1FZC A;  4Y99 C;  2M0M A;  4XL9 A;  3SQN A;  5GAE J;  2E43 A;  3HOS A;  4NC6 A;  1LTT C;  2FYU G;  3VP8 A;  1U8R A;  1T2K D;  3K4N A;  2QLZ A;  3V7C A;  4L74 A;  2W25 A;  3FXJ A;  4B3X A;  2R5Y B;  3DLA A;  1DPU A;  1P7I A;  1Z77 A;  1OWA A;  4RGX A;  2K02 A;  1T0F C;  3RDI A;  4JQF A;  4BRY A;  4Y17 A;  1XSV A;  4MFE A;  5KLV K;  3ESW B;  1M1J A;  2AXC A;  3R4K A;  2V4J C;  4CSW A;  4ZYG A;  2OFP A;  1S3J A;  4NB5 A;  1D5Y A;  2FRH A;  2XF5 A;  5B5E E;  3PFY A;  5GAG J;  1CQT A;  3TF5 A;  4OIQ F;  2RVC A;  4JQ0 D;  3VYT B;  3W3C A;  4D7N A;  1IDZ A;  2OTL I;  4YEJ A;  2IAI A;  4IL6 H;  1NTM J;  4LG3 A;  2V79 A;  4W7Y A;  1GUU A;  4M3L A;  1OCP A;  1IRZ A;  1HC8 A;  5JI6 A;  3SFI A;  4D3D A;  2XGX A;  4BH9 A;  5D5W B;  3MD2 A;  1R22 A;  4LG0 B;  2CQX A;  3CC7 I;  1SQB J;  2L54 A;  5F04 A;  1TW2 A;  5IP9 J;  4IL6 E;  2BV6 A;  3CLO A;  1S7O A;  1ZKG A;  2MH2 A;  2KXP B;  2R3C A;  2XZR A;  1TL8 A;  4ASV A;  3Q0W A;  1X1D A;  3GCM A;  4CXF A;  4C7N B;  1TC3 C;  1FTZ A;  3OOU A;  4WCG A;  1NKZ B;  2KZJ A;  2RDP A;  2OYI B;  1SQV E;  1JY3 O;  3M9B A;  3H36 A;  1SLQ A;  3HE4 B;  1QZY A;  1PGJ A;  2Y75 A;  2M2E A;  1FP2 A;  2HXO A;  4HV5 A;  1EC5 A;  5A9T A;  2BY0 A;  1AV1 A;  3O2P E;  4BUP A;  2N8G A;  1OYW A;  3BC8 A;  4LLL A;  1XGS A;  3ZRG A;  5DD8 A;  5C4X J;  3FWN A;  1JY2 O;  3A0H H;  2LXC B;  5KAI E;  3U1C A;  3KLN A;  1GHC A;  4WY4 A;  2G9W A;  3BOQ A;  3SDB A;  5F0H A;  1BDC A;  4AU7 A;  4KFC A;  4UUS A;  2QG4 A;  4QPO A;  4UXN A;  4MEX F;  4ASW A;  5E8I A;  3PEF A;  1A36 A;  1SMY F;  5L3D A;  5IY5 H;  4PJJ A;  5GTH E;  2QSF X;  3JR9 A;  1ZGW A;  3IH2 A;  3N4X A;  3VMZ A;  4RLQ A;  1HJB A;  1UZC A;  4HEA 2;  4P96 A;  4R1N A;  2N1T B;  2DO7 A;  1X3Z B;  2RNJ A;  3KZI C;  4XE5 B;  1AVO A;  3ZQI A;  4K3A A;  1JUP A;  2GWR A;  2V1X A;  1MMA A;  3PDU A;  2R7F A;  4PJ0 E;  2X9D A;  1OFC X;  4NQW A;  4PDK A;  4NQW B;  1YI2 P;  3DKX A;  2XDV A;  1XC5 A;  4OH8 B;  2DOA A;  2FSW A;  1FEX A;  2VJI A;  5K5O A;  1I27 A;  3BJ6 A;  4E6K G;  3DFU A;  2YXR B;  2XSJ C;  4GXO A;  3CXH I;  5HLT A;  3PM1 A;  1M76 A;  3EUH C;  2VAS A;  1V5E A;  3L75 G;  1YIT P;  1R8E A;  1FDI A;  1BE3 J;  2DDA A;  4EZB A;  3RSN A;  4C2M J;  2LBF B;  1STZ A;  4A12 A;  1RQV A;  5HDG A;  1RY3 A;  3ABV C;  3QWO C;  2Q3E A;  2QWW A;  3GTO J;  4LFU A;  3CXH D;  1GL2 B;  3ROU A;  4MN4 C;  3KEQ A;  3G17 A;  2WMM A;  3L09 A;  4WXD A;  2LY1 A;  1QQI A;  2R4G A;  3GF7 A;  2FX0 A;  3QOP A;  2PJP A;  3HKZ A;  2E2H J;  3E3V A;  1DU0 A;  1JCD A;  1SFC A;  2DYS H;  3VDX A;  5GP9 A;  1HGV A;  2X0L A;  4PJN A;  4KDP A;  5CYV A;  4WXH A;  2C9L Y;  5A9S B;  1UST A;  2CSO A;  3U1D A;  1SEU A;  3KX2 A;  3FGA D;  1S7A A;  1REP C;  3M06 A;  2KIF A;  2VKD A;  4RM2 A;  1F4K A;  1X9V A;  1TNS A;  3OL4 A;  4M3E A;  4C3J J;  3AE8 C;  3AE6 C;  1NH3 A;  2E2J J;  3OAK A;  2ZVO B;  1PP7 U;  2KQR A;  3P8M C;  2XSD C;  3S1R J;  1R4N B;  3PO2 J;  3A2A A;  4DZP A;  5J4Y A;  1BGY E;  5HS9 A;  1VQ4 I;  4L9N A;  2WT7 B;  3MP7 B;  1PFI A;  2M0B A;  1WRJ A;  3DPU A;  1A04 A;  3PLN A;  2WAF A;  4GBJ A;  2QBY A;  2MAB A;  1LWU B;  3ZPL A;  2EW2 A;  2W00 A;  1NWQ A;  1HKQ A;  5CVI A;  2BXY A;  2PFB A;  3RI4 A;  1JXS A;  3IAO A;  1X3W B;  2CRG A;  4ZYD A;  4A3B J;  1FZC B;  3WHC A;  1HSJ A;  3V4W A;  1XCV A;  4OMZ A;  1C0W A;  3HSE A;  4V2G A;  5D5U B;  1Z05 A;  1VQ5 I;  3BCA A;  4ZYA A;  4XN0 A;  2VJ4 A;  2OTK E;  3WU2 H;  4IRI A;  3JTG A;  2N9Y B;  2XB0 X;  1HXD A;  4AQR D;  2KLV A;  2HGC A;  2V9V A;  2W84 A;  4MQV A;  2WSS H;  1YW8 A;  3CCE P;  2E75 B;  1G1I A;  1LJ2 A;  1LSJ A;  2Z4E A;  1ITY A;  2J5U A;  3L73 E;  3BZK A;  3SSU A;  1WJE A;  1YJ9 P;  4XLC A;  4OL9 A;  2FF4 A;  1SQQ K;  3J80 K;  5LEK A;  1BE3 G;  3C1D A;  4DGW B;  1NK2 P;  1K78 A;  2K37 A;  3KDP B;  4LLH A;  4YXW H;  2LXB A;  3JW4 A;  1QBJ A;  1MMS A;  1HBW A;  3HRS A;  5KCM A;  2EV5 A;  1GV2 A;  3L74 D;  5B66 C;  4S3M A;  5FKK A;  1WMK A;  2Y69 H;  3R0J A;  4PV1 B;  1JTX A;  1NTZ J;  3K5B A;  3L74 E;  3L74 G;  3OYK A;  1JOC A;  3CCM I;  2ZME A;  1LT9 B;  1OMI A;  3WTW C;  1XTA A;  3JSV C;  2VC1 A;  3IKV A;  3J7A Y;  5EZG A;  5ED4 A;  1XSX A;  1YIJ I;  2E75 D;  1L0N D;  2HDC A;  1E3P A;  1PP9 D;  2E1O A;  2Z2S B;  5AVT B;  1FZP B;  4PZJ A;  4M71 A;  3OYB A;  2NAZ A;  3I0T A;  5HNH A;  3GFJ A;  3K4K A;  1SQP E;  1NGM B;  3BR1 A;  4J01 A;  1VL2 A;  2MD0 A;  2POH A;  4UHT A;  1S1C X;  2M3B A;  3M0D C;  3TKY A;  1PJR A;  2LR8 A;  1FOY A;  2W57 A;  3RYR A;  3CMA I;  4KMF A;  1VQ9 P;  1U9O A;  1I39 A;  2Y48 A;  4C3H J;  5J6X A;  1IN8 A;  4B4C A;  1NU1 K;  5FLX Z;  1N7S D;  3H1I E;  1G3S A;  1O3Q A;  1W5T A;  5AIQ A;  1LT9 C;  2QQ8 A;  1K6O A;  1IF1 A;  1WP4 A;  4C2T A;  2CYY A;  3K4L A;  1J9I A;  4U7D A;  3O8H A;  3Q0V A;  4D6T J;  3S2H J;  1IFP A;  1KIL B;  1EH8 A;  1T08 B;  1WVR A;  1N7S B;  5A9S A;  3RZD J;  1MJ9 A;  2XRN A;  3C7C B;  5AW3 B;  5CBN A;  2ELJ A;  3BG3 A;  1LPQ A;  3GX4 X;  1Z9C A;  2H6B A;  3QOE A;  3EDP A;  3HOY J;  2VQC A;  1HDD C;  2QF7 A;  4E21 A;  4GDO A;  3E6D A;  4BAY A;  1FS0 E;  5EJC A;  4BS9 A;  4LGW A;  3P9K A;  3OYN A;  3I9V 2;  2MKV A;  1WJA A;  1EDL A;  2LG4 A;  4XSZ F;  1KQ8 A;  1VQ8 I;  1SQQ J;  3CC4 P;  3WU1 B;  5F0F A;  4EDF A;  3M0A A;  2WT7 A;  1MSF C;  2AHQ A;  3KPE A;  3G6E P;  2ZJ2 A;  5ILU A;  3NTN A;  4UB8 E;  2ZYA A;  1ZW0 A;  3NMD A;  4A7P A;  3ZGK A;  4B3A A;  2X6W A;  1IFN A;  2QSI A;  3J7Z I;  3VSK A;  2GZW A;  1NTZ K;  2C9N Y;  2FE3 A;  4XLN F;  3WGI A;  2BEZ F;  2PMH A;  4KIT B;  1J1E C;  5BU8 B;  1PVE A;  4GFB A;  1HVV A;  1ODD A;  1M2W A;  5AW6 B;  1VQ7 P;  2JUC A;  1RF1 B;  4U3F G;  4XK4 A;  2LF7 A;  2ZSI B;  3HSF A;  3OOP A;  5D6F A;  4E7H A;  1R00 A;  3IUO A;  2UXX A;  2E76 B;  3OA7 A;  1JY3 P;  2G0E A;  2EH3 A;  3Q3C A;  2F5D A;  2QYO A;  2WV1 A;  4QSH A;  1L0L D;  3LA7 A;  4J19 A;  5BQT A;  2AXT H;  4DBQ A;  4MGR A;  2KS1 B;  1LTJ A;  1L0L G;  2O61 A;  3RPU A;  1QGP A;  2P4W A;  3HTU A;  3HN2 A;  4KUE A;  1FZB A;  1RZ4 A;  1TTY A;  3E1R A;  4NC7 A;  5GTI C;  2MSY A;  3S14 J;  2VT3 A;  1UG0 A;  1H88 C;  5FD5 A;  3LNQ A;  4I1L A;  1LEA A;  4XOP A;  2H43 A;  2QVA A;  4H0L D;  3A0H C;  2BY2 A;  2E76 D;  3K2A A;  4IM7 A;  4OGQ B;  2MC4 A;  2Q0O A;  4A3I J;  4E7S A;  2NVY J;  2E75 C;  5EG0 B;  4BY1 J;  4RB2 C;  1J2J B;  4N3Y B;  3S1M J;  1YQ4 C;  2KIK A;  3NXS A;  1OCZ H;  5GPC A;  3BCB A;  2AQE A;  1WFX A;  4I98 B;  4Y3O A;  5FLV A;  3H1K G;  3K70 C;  3N7N A;  5TJJ A;  4ETS A;  2PN6 A;  3W6K B;  1R5S A;  1P2F A;  3SZG A;  2IP2 A;  1L4A D;  3L36 A;  4AWX B;  3GME A;  3HGY A;  3CME P;  3OJA B;  2A6H F;  3MKW B;  3GUD A;  3OWT A;  3S9O A;  3SWY A;  1FOS E;  4CCJ A;  2EFN A;  2Q2E A;  3UIA A;  2L5Q A;  1SQQ G;  1GXP A;  1G6N A;  2LTP A;  4CCN A;  2BW3 B;  2LKP A;  1HCR A;  3H0D A;  2CQK A;  2E7W A;  3I55 P;  1Y39 A;  4LIT A;  3A0B C;  3L70 J;  3D1N I;  2VLA A;  2PBI A;  4YFX F;  2O03 A;  3C7J A;  1ZP0 C;  2DFI A;  2VE9 A;  2E5Y A;  1JY3 N;  1T3J A;  1HDP A;  3QWL A;  2Y2Z A;  1KQL A;  2WAQ A;  3FX3 A;  4BGD A;  3G4S P;  3K4C A;  4GOD A;  4JX4 A;  1PGQ A;  2CUE A;  1M56 D;  1AJY A;  3M1C A;  2VC0 A;  3S32 A;  1ETO A;  2PP6 A;  1V3F A;  4XRS A;  3HPG A;  2OD5 A;  2QJP C;  1N73 B;  5LRR A;  3HRU A;  3MIW A;  3CP8 A;  1F12 A;  4B44 A;  2ZT9 C;  2FQ4 A;  3L72 E;  2HYN A;  3RK2 D;  2E71 A;  2PRR A;  2XKM A;  3CX5 E;  4BQN A;  3H1H G;  1QMG A;  2CG4 A;  4CZZ A;  1FU1 A;  1YS6 A;  2YXQ B;  3L2U A;  1YE9 A;  1O57 A;  2V1N A;  3I56 I;  3CUO A;  4A2U A;  3HOZ J;  1S9K E;  3ONQ A;  5IP6 A;  1LFB A;  4ZTJ A;  1IL0 A;  1IXS B;  2ZXH A;  5D5V B;  3RBZ A;  5D4S A;  3CMM A;  3PJR A;  1EDK A;  2FYN B;  2M8E A;  4J0F A;  1IN7 A;  4IF4 A;  4ZKU A;  3Q9V A;  1F5T A;  4IVN A;  3RKY A;  4BJ5 C;  5K5R A;  1HKT A;  1EV7 A;  1EVZ A;  3KYQ A;  3A7O A;  1HQC A;  3HM5 A;  1NKN A;  3CX5 H;  3HUS A;  3WGH A;  3BR0 A;  2DA6 A;  1IC8 A;  1OLT A;  4LIV A;  4FE7 A;  3ZN0 A;  3CD6 I;  3H1K J;  3MUD C;  3JCU E;  1WWX A;  2WQY C;  4XN3 A;  1E3H A;  1KQ9 A;  2A45 H;  3LFU A;  4E4H A;  1KYO H;  3Q5P A;  1B59 A;  2GIZ A;  5IT9 K;  1FPQ A;  3HEF A;  2DCE A;  3H1L J;  1ORK A;  4ANJ A;  5JHU A;  5FKO A;  1MUU A;  4IHT A;  3CCJ I;  5H20 A;  1FMW A;  2OCE A;  2QJP B;  1N73 C;  4Q4Z F;  1I6H J;  1TT0 A;  2Q1K A;  2F4I A;  3J81 Z;  3HG9 A;  3F3S A;  4TV7 A;  3I64 A;  1KV4 A;  1N25 A;  1XG1 A;  2CH0 A;  4BHP A;  1U7M A;  4ZTF A;  2ZNY A;  1FY7 A;  1RES A;  4IRH A;  1U5T A;  1KQ0 A;  4II3 A;  1LEB A;  1SD5 A;  3H1I D;  4BEH A;  2K4J A;  3F72 A;  4CHU A;  2VXZ A;  4AC0 A;  1SQB G;  1O3T A;  1IJW C;  3L70 G;  3ZQG A;  1ZG5 A;  2K9Y A;  1VI0 A;  2PQ8 A;  1QLE D;  5E1W A;  1KYO E;  5AW1 B;  5B1B H;  1KA8 A;  3QRF F;  2KI7 B;  1VQM P;  2W4S A;  2VON A;  1HW5 A;  4XIC A;  1V5F A;  5BMZ A;  3J7A O;  1RUN A;  4GOF A;  4H0L B;  3S16 J;  2PJR B;  1VQ4 P;  5APV A;  3H1J D;  3BCC E;  3PH0 A;  3K6J A;  1R23 A;  5DCM B;  4M72 A;  3BCC D;  3PSI A;  2M0C A;  2XAQ A;  2MLK A;  3LA2 A;  5KHD A;  1OW6 A;  2W48 A;  3D5L A;  2XHK A;  1GT0 C;  5D8L B;  1M7L A;  2CWE A;  3WUT A;  4PGG A;  1YRN B;  4MIM A;  3V4G A;  3K2Z A;  3PO3 J;  3GF3 A;  4DOJ A;  4B48 A;  3D71 A;  1J75 A;  3LSM A;  4AD9 A;  4IEJ A;  1FSE A;  3V2P A;  2BZT A;  5HWS A;  4ZH4 F;  1WZ2 A;  1JTY A;  2EA2 A;  2E34 A;  1OKR A;  2ZJS E;  4IL6 C;  5E3N A;  3F23 A;  2VUM J;  2L01 A;  3CDH A;  3LWF A;  3ABU A;  4J00 A;  2QJK B;  4WBA A;  3CF5 F;  3DF8 A;  4EJU A;  4Y13 A;  1W0T A;  3HDH A;  1KYO I;  2DFH A;  3CJT B;  3RK3 C;  3ZR8 X;  5CVR A;  4IQJ A;  1BCC J;  4ESJ A;  4CDG A;  1F36 A;  1B9M A;  3BR3 A;  5FFX A;  1SVL A;  5TRD A;  4OIP F;  5C4J J;  4EQQ A;  2XIG A;  3CF2 A;  4ASN A;  3QH9 A;  4BBR J;  2HXI A;  1ZTR A;  1KC8 Q;  1BI1 A;  1YVE I;  4Q5S F;  2Z5U A;  1IZN B;  1WPQ A;  1I50 J;  2A68 F;  2L7Z A;  3HDD A;  1PZQ A;  2E7X A;  1OYI A;  1SQB D;  3C2B A;  4NPF X;  1MZ9 A;  3D5R C;  4XID A;  3WOD F;  2FFD B;  3V42 A;  1NU1 E;  1JT6 A;  3CDI A;  3JSO A;  1D1B A;  2QVO A;  4R8H A;  5GTH C;  1YG2 A;  3FBI B;  1MH3 A;  1LFP A;  3AG3 H;  4OOI A;  3VOE A;  1U2W A;  2OYI A;  3GZ5 A;  1UHS A;  2M45 A;  2PMZ A;  4C3I J;  3AEA C;  4DZJ A;  3WGG A;  3BCC G;  3KZI E;  3CCL P;  2FOW A;  2JN6 A;  1UMQ A;  2XGE A;  1LDJ A;  2M5W A;  1K78 B;  2WWW A;  5E79 H;  2BEO A;  2YS9 A;  3RBX A;  1K9M Q;  2DA7 A;  3COA C;  1TNT A;  2KMU A;  3ABM H;  1FYM A;  4IPA A;  3D70 A;  3HTS B;  1VQL P;  4OU0 A;  2DTZ A;  4H13 D;  3QOD A;  4BJT A;  3E6C C;  1EZV D;  3CCJ P;  5AW7 B;  4BAC A;  2X85 A;  2FEZ A;  5GPA A;  1EZV G;  2WB1 A;  3B73 A;  1BSH A;  1W1W E;  1WHU A;  3CX5 I;  2Q7C A;  2XPV A;  3KET A;  4OAY A;  2EIM H;  2EK5 A;  1RHZ B;  3ABT A;  2WC2 A;  3LSG A;  5K7F A;  4DBR A;  3BPX A;  3W6Z A;  1YO5 C;  5H2F C;  2E1C A;  2CW7 A;  2HOA A;  3GTM J;  2R7U A;  2FXO A;  2XDJ A;  2ME0 A;  2IRF G;  3R61 A;  2DAO A;  2O8K A;  4HX8 A;  4IX7 A;  2IS1 A;  2EIK H;  3PNV A;  1LE8 B;  2NVX J;  1Y47 A;  1Q82 Q;  2I5U A;  3G1O A;  4RAF A;  2HQR A;  3G9R A;  1FX7 A;  1Y8Q B;  3SFD C;  4BYY A;  2K27 A;  3T5X A;  3ITK A;  2XV4 S;  5IYD J;  3EFF K;  3O6Q B;  3H1L G;  4IFM A;  4I7H A;  1PV3 A;  1AU7 A;  5FKN A;  3LID A;  4AYB N;  1J2X A;  2BY1 A;  3EUK L;  2QM7 A;  3VMA A;  4KIC A;  1BE3 D;  3USS A;  5LBQ A;  2QYT A;  1HTL C;  2YKO A;  3CUQ C;  2OZU A;  2E35 A;  2RN0 A;  3CES A;  2ZFC A;  1JTH B;  5FGM A;  3H3U A;  5TIS H;  2CUZ A;  2JKV A;  2HPC A;  3IF4 A;  3V2N A;  1OXZ A;  4OAZ A;  1K6Y A;  2VQH A;  4G12 A;  4DIQ A;  1XPX A;  3S17 J;  3SFZ A;  3IHU A;  1DLI A;  2HDW A;  1N78 A;  1ZV8 A;  2JO1 A;  1P92 A;  4HW0 A;  2L91 A;  4E7L A;  1QL1 A;  5FKL A;  1FBU A;  3ZMV A;  1Q2N A;  2NPS A;  3L4F A;  1OCC H;  5M5X J;  3O6Q A;  1M1K Q;  2QBY B;  1AFO A;  2VBX A;  2BOL A;  3Q0U A;  1HLV A;  2HPM A;  3CCU P;  3M4O J;  1KGS A;  5CMZ A;  3I4M J;  3SXY A;  1QVT A;  2HZD A;  2Y0M A;  1D5V A;  2YUS A;  4KMU X;  2EV6 A;  1RUO A;  4A3L J;  4HAM A;  1PUF B;  4B3H A;  3GMA A;  2UWM A;  3P32 A;  4ZNC A;  2LD5 A;  2E2I J;  1ZXG A;  3MMY B;  5A2Q Z;  3Q5F A;  2Y0E A;  2ZYG A;  4AYC A;  3SYT A;  1AKH A;  3VOP A;  3VYS B;  3O3K A;  4KIF A;  2FNP A;  2D1H A;  2O8X A;  1LDK B;  2KRC A;  5AVZ B;  1XD7 A;  2LK2 A;  1FOS F;  3RJP A;  1JKR C;  3W2V A;  3LQQ A;  2J59 M;  1FNN A;  2IEK A;  2ID6 A;  5FO5 A;  5CCG A;  1RI7 A;  1SS1 A;  3H35 A;  2HOD B;  2D2C B;  2E1N A;  3HHG A;  5A2Q K;  3FXD A;  2Z99 A;  3PNY A;  2IYP A;  3L35 A;  1M90 Q;  3HJE A;  1R58 A;  3GFL A;  1IJD B;  3CXH H;  2KHM A;  1MKM A;  1R5G A;  4L5I A;  1SQB E;  2Y9Z A;  1LFU P;  5KLV G;  3GFI A;  4EJO A;  1GL2 A;  1HJ0 A;  3ZWC A;  2NRG A;  1KB9 E;  3I5C A;  2ZYD A;  3L6D A;  1HKS A;  1EH7 A;  4UVA A;  1XDU A;  3B5N D;  3L37 A;  2CU7 A;  1SD7 A;  1S2E A;  4KIS A;  1FZA A;  2EFW A;  3GFM A;  1ZRC A;  1OVV A;  2E74 C;  4A93 J;  4F92 B;  2WSC H;  4WY4 B;  3FR7 A;  3FKJ A;  4DCK A;  3AE5 C;  2RC4 A;  4KJM A;  1T56 A;  3QHA A;  3WU0 A;  3HUS B;  4IRG A;  1WRG A;  1K05 A;  3OW2 O;  3CCL I;  2BY3 A;  3Q5S A;  4NUB A;  2ZT9 B;  1ZN5 A;  2RN7 A;  4OQZ A;  2UWJ E;  2F4M B;  3CQZ J;  4X1E A;  5AVQ B;  4ENM A;  2N1T D;  3MGN A;  3DEU A;  2DA3 A;  2DFF A;  1MMN A;  3E6M A;  2P5L C;  3M9A A;  1WI3 A;  3IV5 A;  3S1Q J;  2RKL A;  3L71 J;  1M1E B;  1H0T B;  2GA2 A;  3AL0 B;  1NTZ D;  1HW2 A;  2DW3 A;  1Y1W J;  1X0T A;  1BGY G;  1NTZ E;  3RPQ A;  1VTN C;  3FXL A;  4IHX A;  1WH5 A;  3DTE A;  3MKL A;  1L0N J;  1BGY D;  3MWM A;  1NTK K;  4JK1 X;  1S6L A;  4HF2 A;  2E5Z A;  5F64 A;  1PUF A;  4CCL A;  3GWZ A;  4EM0 B;  3CDL A;  3SWF A;  2LFB A;  4BEH B;  5JVG F;  5M5Y J;  1SFE A;  2KJC A;  3H1H E;  4MEY F;  2ZXW H;  5LRS A;  5M5W J;  3N05 A;  3HUG A;  1B72 A;  4PZC A;  2MD5 A;  1LTS C;  1RKW A;  3IWZ A;  1EVY A;  2HKX A;  4A6D A;  3U59 A;  1VQN P;  2NOJ B;  2VKV A;  1GXQ A;  2NYX A;  4W1U A;  1MDM A;  3P8C D;  2LP0 A;  3KP4 A;  1O4X A;  2W6B A;  4HX7 A;  4KN4 X;  3U1K A;  1M1J B;  5J47 A;  3DWL E;  4D6T D;  4ZC3 A;  2QEX I;  4Y7N J;  2P10 A;  1KD1 Q;  1OCT C;  1E2X A;  3IAS 2;  2OQR A;  4RAY A;  3R4Y A;  2LKM A;  2QM3 A;  4A5M A;  1JUN A;  1QO0 D;  2LY9 A;  3BLY A;  3GBG A;  2XKO A;  4UB6 H;  3ZMD A;  5F1J A;  1EXJ A;  1IG7 A;  1BIA A;  1MMD A;  5ERI A;  5KLV J;  1FZF A;  3K6G A;  4BXX J;  3CCS P;  3L00 A;  1BR1 A;  5F27 A;  2FXA A;  2VRS A;  2WIT A;  2TCT A;  3E0J B;  3NAU A;  5LGN A;  3G71 I;  3BAT A;  3A4C A;  3FHZ A;  4U0W A;  4H0E A;  2J58 A;  1VQ8 P;  4O3M A;  2OC6 A;  3FIW A;  2AXT E;  3MKZ A;  4UVB A;  3PQK A;  2BGC A;  1IV6 A;  3OYC A;  2OJE D;  4BE2 A;  1L4A A;  1BC8 C;  2BCC G;  2HQN A;  3FDY A;  3FK7 A;  5EGO B;  2F4O B;  3AE7 C;  3HOX J;  3RYP A;  4A3K J;  3VYI A;  2E1M C;  3RKX A;  3AE3 C;  1F0Y A;  3G1L A;  4PCQ A;  1OYY A;  1EQ7 A;  1K8A Q;  2IVM A;  2E76 C;  1YQ3 C;  1BR4 A;  3A01 A;  3HD7 A;  3P5J A;  5DS9 A;  3WTT C;  4LB5 A;  3HYI A;  3OL3 A;  3CO7 C;  2A05 A;  2GBY A;  3VB2 A;  2ZFW A;  3AE9 C;  2DMT A;  1XN7 A;  5B1A H;  5FRM A;  1IC2 A;  4HQM A;  1R36 A;  3HD7 D;  3F8C A;  2M1B A;  2WTY A;  1G3T A;  4AIK A;  1URQ B;  4I6M C;  3A0B H;  1RE4 A;  3FMQ A;  3TDU C;  3GTK J;  2QIW A;  1S72 I;  3H3V K;  5APW A;  4W7Z A;  2HPC B;  3CC2 I;  3BJO A;  1BG6 A;  3H1J G;  1BOB A;  1YIO A;  2IYO A;  1H9T A;  1F17 A;  2EPF A;  2ZME C;  4G7H F;  2OYO A;  2CQQ A;  3KP2 A;  3H1L E;  4WVZ A;  1KTM A;  2Q2E B;  3K96 A;  4PV1 D;  5M3M J;  1Z3Y A;  2KPM A;  4D7M A;  3Q1M A;  3ZQF A;  2M7B A;  2FYU J;  1DP3 A;  3LW5 H;  2G3A A;  3A0B E;  5D8K B;  2R7O A;  2JWA A;  5KJ7 A;  2PEX A;  1OR7 A;  2CFX A;  1NVO A;  1ZRD A;  1OPC A;  4HYT B;  5EF6 A;  3HE5 A;  2W85 A;  3IFM A;  3CCV I;  4IQ4 A;  2BVM A;  2VBZ A;  4QMA A;  1PPJ E;  2IW5 A;  3CUQ B;  2ZT9 D;  2ZVN B;  1GMJ A;  1JO5 A;  3TL4 X;  3AFH A;  3JTH A;  4U3F E;  3TBI A;  3RQ4 A;  5EG0 A;  4HX4 A;  1LNQ A;  2MC3 A;  2OTJ I;  4LD5 A;  1VQL I;  2UYY A;  3LST A;  2LLK A;  2VI6 A;  2M5A A;  2GLO A;  1L2P A;  1J0R A;  2CQ7 A;  3AG2 H;  2YIU C;  2IGN A;  3IH3 A;  2ZXE B;  2P5V A;  4XMY A;  3TGN A;  1FJL A;  4I2L C;  1VQM I;  1W5C E;  4LOC A;  3CD6 P;  3WG9 A;  4BY7 J;  5APQ A;  2P58 A;  1LTJ C;  3M0D A;  2WBM A;  3TGU J;  5CBO A;  1NTM E;  2RQQ A;  4JOM A;  4XRF A;  3ZW8 A;  1I6X A;  2N1T C;  5TJH A;  3AG4 H;  1LNW A;  2DT6 A;  4F91 B;  1JGS A;  2M34 A;  4RAG A;  2R0Q C;  3GF2 A;  4JBZ A;  3KPH A;  5IT9 Z;  4HNT A;  2CV0 A;  1MBF A;  1SVM A;  1URQ C;  4H13 C;  4DNC A;  3K9T A;  5DCM A;  1WJ5 A;  1XTC C;  5JHF A;  5K7H A;  2D5V A;  3KZZ A;  4DJG A;  4HA8 A;  1TBX A;  3JCU C;  2NOG A;  1X8Y A;  1HF9 A;  4AVZ A;  1JDJ A;  2EWN A;  2P7V B;  2RV8 A;  3MZH A;  3A2K A;  4WY4 C;  3QPS A;  3L71 E;  4QLC U;  1KMI Z;  4GCV A;  3T0Y A;  3T8R A;  4I7Z C;  4LK1 F;  2E5T A;  1TWC J;  2ZME B;  1LT9 A;  4YIF A;  1J7K A;  2XPW A;  2NZ2 A;  1MJB A;  3IC7 A;  2HDD A;  2GQQ A;  2GUV A;  5DUI A;  1H0M A;  1S29 A;  4A69 C;  3WTU C;  4GYI A;  3CWB E;  2K85 A;  1URQ D;  5AVX B;  2BCC E;  2IS4 A;  1WDL A;  1VQO I;  2K40 A;  1YQA A;  3PSF A;  5HS7 A;  3WTZ A;  2IPQ X;  4G94 A;  4N4O B;  2DXI A;  4KYW A;  3U1A A;  4N9I A;  3C2H A;  2QZ8 A;  2MFZ A;  4L73 A;  3BRV B;  3H1K D;  1YB4 A;  3BZ6 A;  5E8G A;  5DM6 F;  2HYF A;  3BJA A;  1JEK A;  1FZE A;  2A06 D;  3LOC A;  1J09 A;  1M8O B;  2Q6Q A;  4U7J A;  4XLA A;  1RF1 A;  4I0A A;  4BE0 A;  1Y0N A;  2TDX A;  3AKZ A;  1DPR A;  2JT1 A;  2ZJQ F;  2FNA A;  3VYU B;  1MH4 A;  2M7A A;  1D0Z A;  3DPT A;  1D8K A;  2R7R A;  2WPV B;  3PIO F;  1T33 A;  1BCC G;  3AEF C;  5LGU A;  4XLF A;  5H6R A;  1SFX A;  5JVT A;  2YU3 A;  3H0G J;  2MG4 A;  2ZBK A;  1L0L E;  4IO9 F;  3G71 P;  3G0O A;  4CUG A;  5L3G A;  4GRI A;  1I3A A;  1ONV A;  2IBD A;  3M7G A;  4DLL A;  4CCO A;  1IUF A;  4C9Y A;  1YX3 A;  2QM8 A;  1AA7 A;  4NNJ A;  1EDI A;  2EQR A;  1T8I A;  3H1I J;  1FOK A;  3RK2 B;  1F14 A;  1B1B A;  3M3Y J;  2WSE J;  3S2W A;  2R93 J;  1ETK A;  4YIR X;  1EA3 A;  2PJR A;  1SFK A;  2HQA A;  3IR9 A;  3TQN A;  5CVU A;  3C18 A;  3LSH A;  3GYH X;  3KCC A;  3H6P A;  5AW2 B;  2QEX P;  3MCZ A;  1EZV I;  2EZH A;  1NHA A;  2V9P A;  2K3R A;  3ZMZ A;  4ZJZ A;  3DXJ F;  4GOE A;  1Z0X A;  3BRT B;  3K10 A;  2QEN A;  3GZ6 A;  4BBS J;  2JEE A;  3RK3 E;  3D0S A;  1ZAR A;  4DZO A;  1Z67 A;  4N4N B;  3VSL A;  4IXA A;  1JB0 J;  1Q86 Q;  1QNT A;  3BCC J;  2OAZ A;  4B3J A;  3LSR A;  3VYR B;  4YRV A;  1RF0 C;  1SQX E;  4J0E A;  2OA4 A;  4JPZ B;  3EYI A;  1VFC A;  4N78 D;  4R4L A;  1SFC B;  3DOJ A;  5AW8 B;  1Q81 Q;  1ETQ A;  2QA4 P;  2R7W A;  2JSP A;  3FF5 A;  3BG7 A;  3V7S A;  1OW8 A;  4HLY A;  1UHW A;  4HYE A;  3ERE D;  2W27 A;  4H0L C;  5CJ4 A;  2M9H A;  2IJL A;  4RB0 A;  3K1N A;  1YLF A;  5E3O A;  4V19 K;  1VPD A;  1DEE G;  3KP7 A;  1YHQ I;  3R0A A;  1OIP A;  4I6Z A;  4DYQ A;  2QUF A;  3FM3 A;  3F8M A;  2BW3 A;  4A3C J;  1GK4 A;  2JR8 A;  1VZ0 A;  1O7L A;  4DW6 A;  1TT5 B;  2IPP A;  2WA0 A;  1BCC D;  4R1H A;  3CUQ A;  1IN5 A;  2ZJR F;  4I02 A;  1HUC A;  4HV6 A;  1BCC E;  3HKZ N;  4GO1 A;  1WDK A;  1SQX K;  3X2Q H;  2YO2 A;  1U6G A;  1YX5 A;  5H2F H;  2A45 G;  1K73 Q;  2CQN A;  1PUE E;  2G7U A;  3Q5R A;  2JK3 A;  3C9I A;  1X1B A;  4EGY A;  2WSF J;  1X22 A;  1QA6 A;  4EIJ A;  3H1C A;  2L7F P;  2KIS A;  2LR2 A;  2B88 A;  2Z5H A;  3SFE C;  4JYK A;  3MVP A;  5FJ8 J;  2I8D A;  2MGQ A;  2XAJ A;  4D0P A;  4RBO A;  1U5T B;  2M4K A;  2HPI A;  3OYE A;  2RMZ A;  1R1V A;  5EFW B;  1I3Q J;  4RJT A;  3O6B B;  4KIG A;  2WAQ N;  4IJA A;  3FZV A;  1J1E B;  1HF0 A;  3LL7 A;  2XF6 A;  1Z56 A;  2XAH A;  3TMO A;  1ZYR F;  2FA5 A;  2MA3 A;  1V54 H;  4ZDP A;  3ZMS A;  2HOT A;  4IHV A;  4H44 D;  1YW7 A;  3GTQ J;  2OYH A;  2OTJ P;  3OYM A;  1IGN A;  2K7L A;  2RRE A;  5D6E A;  5K7Z A;  1N77 A;  3ZXS A;  1FE6 A;  4LC1 A;  4NPD A;  3LFK A;  2CJJ A;  2DBB A;  1I5Z A;  3JRE A;  1X1C A;  1PYV A;  1MZB A;  3OY9 A;  2KL4 A;  5TIS C;  3AE4 C;  3D1L A;  4OMY A;  5HLH A;  2NS7 A;  3RK3 B;  1IW7 F;  5FKM A;  2XC7 A;  1U5T C;  3HPH A;  5ICF A;  1OX3 A;  1QPI A;  4E70 A;  1S8N A;  1VQ9 I;  4N78 E;  2V7Q J;  3CMA P;  1NTK E;  3WTV C;  3JRI A;  4P9F A;  3H1K E;  3NRV A;  1E5W A;  2PMZ N;  3J80 Z;  2A07 F;  2EZI A;  2KKO A;  1LTI C;  1SQP G;  4Q47 A;  2O3J A;  3EET A;  2LBF A;  4LK0 F;  1SQP D;  1MJA A;  4F55 A;  3MAJ A;  3P7K A;  2OYI C;  5DEQ A;  3WUV A;  1PP9 E;  1MD0 A;  2WSF H;  2XAS A;  5E20 A;  2XRO A;  2SPZ A;  1LTJ B;  1RE4 C;  1T2K A;  1YJW I;  3IN6 A;  2KUB A;  2UV1 A;  3RL0 D;  2ZC2 A;  1RPW A;  4L5E A;  1ZGJ A;  1SFO J;  5BU5 A;  1WQ2 A;  2H09 A;  2QKL B;  4D6T G;  4UUS B;  3IH4 A;  3Q3D A;  2MBF A;  2OGU A;  3HOT A;  2O0Y A;  3WTS C;  3BG6 A;  2HOD A;  2FXM A;  3F9K A;  3S3M A;  5AW9 B;  2DA2 A;  1DGW Y;  2RQP A;  4HQE A;  1N73 A;  5CCG C;  3WUU A;  4KHX A;  3I71 A;  4XLE A;  2WTB A;  2K9J B;  2R5Z B;  1DDN A;  2QE7 H;  2Z5I A;  2B63 J;  1O3S A;  4XFJ A;  2PGD A;  3OSG A;  2ICW G;  1YYC A;  1RET A;  1F1Z A;  1NYH A;  4AM3 A;  2CO5 A;  3L2V A;  2P6T A;  1OR7 C;  1ZAO A;  1W0U A;  3DCF A;  3HWR A;  4LGD E;  3RL0 C;  1SVF A;  3HE5 B;  1Z82 A;  2QSH X;  4C7R A;  2YMY A;  2KB7 P;  2QJK C;  4XRS G;  2CW0 F;  3L2Q A;  3SJM A;  1X3U A;  1D0Y A;  3JAM Z;  5KNL A;  1FYL A;  3PP5 A;  3WU2 C;  2NNN A;  3CP2 A;  2BCC D;  4HH2 A;  4KT0 J;  3T97 B;  3RTR A;  2VOD A;  1TWA J;  5F6F A;  2B9B A;  4S05 A;  2YPR A;  3BDD A;  1QX8 A;  2YMK A;  3GTJ J;  3RK2 C;  3FM5 A;  3H5R A;  1E17 A;  2M5A B;  1ON2 A;  2BHZ A;  3CJR B;  3F3X A;  1G59 A;  2A6E F;  4OGQ D;  2K9L A;  4KN7 X;  4BKX A;  1XGM A;  2R7Q A;  1M57 D;  3G3Z A;  5KK1 A;  1TP4 A;  2CS3 A;  1FOW A;  2FOK A;  4XKV A;  5APY A;  2XNX A;  5B66 H;  1YHQ P;  1X1P A;  3TDZ C;  1M66 A;  1KS9 A;  1L0N G;  3FKI J;  2XAG A;  4AID A;  1H0T A;  4U0Y A;  3E7K A;  5DTD A;  2KDO A;  3OYI A;  3M8F A;  3A5T A;  3KYC B;  2DDB A;  2QQB A;  2IT0 A;  4MTE A;  1KU7 A;  1KYZ A;  2OQQ A;  2RNG A;  3I58 A;  5J8C A;  2O7O A;  1TWH J;  3EYY A;  3HRT A;  5L3B A;  1HGZ A;  2L02 A;  2H8P D;  3BVH A;  3SZP A;  2YR2 A;  3PID A;  2ESN A;  3G73 A;  2ZKZ A;  1LTB C;  2VIX A;  2DA1 A;  1MBE A;  2E1M B;  4U88 A;  1F43 A;  4BE1 A;  1XX5 A;  1W2E A;  2KZG A;  1H89 A;  4FX0 A;  3BR6 A;  4LMY A;  3HSR A;  2KNC A;  5HNF A;  1JT0 A;  5CPR B;  1Z7L A;  1P9Q C;  4XKW A;  4NBQ A;  2CUF A;  1BOA A;  1WJD A;  4L76 A;  3QYE A;  2FQ3 A;  3H9Q A;  2GAU A;  2HFH A;  2KIQ A;  3V8L A;  2NVT J;  3L73 D;  4BU2 A;  4AUX A;  5EEG A;  2P4Q A;  2X58 A;  3NEU A;  3JRF A;  3HIF A;  2C0W A;  3EGO A;  3II6 A;  2JMW A;  3RKQ A;  2R3S A;  4UB6 C;  1L3L A;  3GLX A;  2O6G E;  1OZH A;  2FBW C;  2XU6 A;  1IK7 A;  1N7L A;  2OV7 A;  5EEA A;  1XB4 A;  2W1O A;  4GYG A;  4RAZ A;  1DQU A;  1LSO A;  2OCC H;  5FFZ A;  3A01 B;  1LGH B;  3LA3 A;  1T0F A;  2KJB A;  3I59 A;  3K1P A;  2FYN C;  2XGC A;  3DPL C;  1WT6 A;  2W82 A;  2JWD A;  2L5G B;  3BRO A;  4UV9 A;  2NRA C;  1T95 A;  1GU5 A;  2L2O A;  1IV8 A;  2A06 E;  5L3F A;  5CJ9 A;  1JJ8 C;  3RQS A;  1BGY J;  2VBY A;  5L3E A;  1NTM K;  1YW9 A;  4EM2 A;  1LB2 A;  4OWR B;  1PDN C;  3QP5 A;  2R7V A;  4UUT A;  3HUG B;  2MJZ A;  2LRD A;  4D9J A;  1AHD P;  1L4A C;  2DPU A;  2XUB A;  1E79 H;  4DYC A;  2QRX A;  3F8N A;  3CCE I;  3C3W A;  4L75 A;  4WXC A;  4ITV A;  1PGO A;  1R7J A;  3BY6 A;  3H1H J;  3R2P A;  4MFD A;  2V26 A;  3PRJ A;  2Q8K A;  3E5U A;  1KIL E;  2GUS A;  2AXT C;  1T6A A;  2VBW A;  3OS1 A;  4DQ2 A;  1CZQ A;  1AQ5 A;  1QU3 A;  5L8R J;  3KE2 A;  1VQK P;  4RLF A;  4RO0 A;  1QPM A;  1LQ1 A;  3AEC C;  4Y15 A;  4CO8 A;  3ZQ7 A;  4WB4 A;  2AEF A;  3PFI A;  2KNC B;  5LGT A;  1D1A A;  4LLN A;  3OMY A;  5BPI A;  3Q3S A;  1SAX A;  2IZ0 A;  5CCH A;  1RNL A;  4LIU A;  4XKB A;  1G2C A;  1MSE C;  2CK3 H;  1E0E A;  2X4H A;  3DKW A;  5FD6 A;  4IHW A;  2DA4 A;  5E3M A;  3H32 B;  3MQ0 A;  5KLV D;  1IZ1 A;  1HA8 A;  5LHG A;  1TQP A;  1IAW A;  4HDU A;  1X19 A;  4XNF A;  2CPS A;  1JM0 A;  1Y1V J;  3FXQ A;  1RRJ A;  3HTK A;  1BN5 A;  1QZZ A;  4NHJ A;  3B6A A;  3WMM 0;  5HDK A;  4M9S A;  4ESB A;  4GWK A;  5CQG A;  3VTP C;  1G8X A;  4DYR A;  1E3O C;  1YJ8 A;  4I0B A;  4Q48 A;  5D4R A;  1Z7U A;  1W36 D;  2MYS A;  4XSX F;  4PSW A;  2DFE A;  4GKG A;  4P9U A;  3FR8 A;  3VPR A;  3V6I A;  1DEB A;  4FIS A;  4XA4 A;  2E60 A;  3IWF A;  3OIP A;  3IL2 A;  1LVK A;  3HHH A;  3TW6 A;  5LD2 C;  3LAP A;  2MH9 A;  3L2C A;  1FDO A;  3VMY A;  1YOV B;  1KU9 A;  2IS6 A;  2LDU A;  5AVS B;  4BHB A;  3AED C;  4UVC A;  3J7Y J;  3QSG A;  4BDY A;  1BI0 A;  2N9B A;  1RF1 C;  2CUJ A;  1ZRF A;  4Z6Y A;  1QHH D;  4A3G J;  2KK7 A;  3MEX A;  3FIS A;  1MBK A;  4HBL A;  4AYB A;  4BQQ A;  1IXC A;  2DTR A;  1FYK A;  2WZ7 A;  5AW0 B;  4LJZ F;  4EOT A;  2COB A;  3L75 D;  3CCU I;  1SQB K;  4BXL A;  3P8C E;  1YRN A;  3I83 A;  1R5H A;  2R32 A;  5F1R A;  1CF7 B;  2JA6 J;  2IA2 A;  1YIT I;  2J5P A;  5B5E H;  1D0X A;  2A61 A;  1CW5 A;  1G1J A;  1J1D B;  4JF7 A;  1QVU A;  4KIB A;  4F3Q A;  2IA0 A;  4Y33 A;  3GHG B;  5KLI B;  3QU3 A;  1W2B O;  4RMN A;  1M67 A;  2DMP A;  2OYH C;  2OU2 A;  2KT0 A;  3V7R A;  4A0X A;  2FXP A;  1FWZ A;  2QA4 I;  2AS5 F;  1AQT A;  2PAJ A;  2K9J A;  4Y28 J;  1BBY A;  1USS A;  3N97 A;  4GWG A;  3CC2 P;  2FYU D;  1P6R A;  3V4Q A;  3DTK A;  2XB5 A;  5IP7 J;  1L4A B;  2KOG A;  1GVD A;  4HSR A;  2LRE A;  1ZH5 A;  1W5C C;  1LKX A;  4XOR A;  1MBJ A;  4GGG A;  4A0Z A;  4II2 A;  4NPE A;  3DLL F;  4HPQ A;  1IO2 A;  2VL8 A;  3WFI A;  3DEW A;  4H4K C;  1Z91 A;  3BG5 A;  3UR3 C;  2P0W A;  1IFI A;  2ZB9 A;  1KU3 A;  1P7J A;  2VJJ A;  3L1P A;  2KLU A;  2Q9I A;  3ULK A;  3BQZ A;  2B7E A;  3QYB A;  4Z1M H;  1TXG A;  4ENK A;  3HB9 A;  4XQF A;  3E97 A;  1TQM A;  2B87 B;  2YKQ A;  5KAI H;  3ISP A;  2WTE A;  2AXL A;  1R9T J;  2Q1Z B;  4A3J J;  1SP4 A;  4L9T A;  3FHN A;  2GIV A;  4JX5 A;  4EM1 A;  3G1M A;  3I55 I;  1WGX A;  1BA5 A;  2BE5 F;  2I1J A;  2ISY A;  3E5Q A;  2Y0S N;  4AVP A;  5DM7 F;  1TWF J;  1IN6 A;  1VND A;  3FBN B;  1ZK8 A;  2HVR A;  2KZI A;  4BL0 B;  1GLN A;  1J1D C;  1P4X A;  2K4B A;  4CIC A;  3G4S I;  2FML A;  1MFT A;  1YTZ I;  3TGU D;  2H1L A;  4L9J A;  3M9H A;  5J1Y A;  1JE8 A;  3AE2 C;  1JHH A;  1APL C;  4HJG H;  3MTU E;  2ZJP F;  1CSB A;  1ZHF A;  1A02 J;  1BW5 A;  1ZCJ A;  5AVR B;  5KAF C;  1ACI A;  2FBK A;  2WY7 Q;  2GXA A;  2R7Z J;  2HVQ A;  3H5A A;  1X79 B;  5IOZ A;  4E7Z A;  2Z1D A;  1KB9 I;  3S15 J;  1SQV J;  1BC7 C;  1DP7 P;  1JHF A;  1EXI A;  2QKM B;  2LH9 A;  4WK8 F;  3I54 A;  2A3S A;  1SQP K;  3OYA A;  4RB3 C;  1VQK I;  3HD7 C;  3SEZ A;  4IL6 X;  3TK1 A;  3H5N A;  5C44 J;  5BPD A;  3NAR A;  2VJ5 A;  4G6Q A;  1H9G A;  3L2R A;  1H89 C;  4A6E A;  5AVY B;  2I9P A;  3DQV C;  3PUF A;  4IFF A;  3A03 A;  2WAE A;  3FXM A;  2PLA A;  4OIR F;  3GVA A;  1FZC C;  2ISZ A;  2P1J A;  4RA2 A;  2EFQ A;  1MFZ A;  1JY2 N;  1JKO C;  3VFZ A;  1UIX A;  1V4R A;  3B71 A;  1JUS A;  1A6I A;  1Z21 A;  2A5W A;  2KZV A;  2L9V A;  2L4M A;  3ASO H;  3BQY A;  3MZY A;  3W6V A;  1PP9 G;  3HL2 A;  3DEE A;  3BTJ A;  4G6T B;  4S0H B;  5K1Y A;  2PI0 A;  3TO6 A;  3CTV A;  1NH4 A;  2RGV A;  3G2B A;  1MBG A;  5LHH A;  1LT1 A;  2M8G X;  3HXL A;  1VF9 A;  1N8R Q;  2WSE H;  3GHG A;  1DGR M;  3ECO A;  4QTR A;  1NOH A;  2B87 A;  2DMN A;  4OWF A;  1XMA A;  3QPT A;  2IGO A;  2LYC A;  4XKC A;  2ELK A;  2VKE A;  4UUV A;  4XM3 A;  3JRG A;  4PZE A;  1CI6 B;  3B5N C;  3E1I A;  3ULQ B;  3IQD B;  1Z6R A;  3PL8 A;  3S93 A;  3H3Z A;  5DV5 A;  1JCC A;  1SVO A;  3O8G A;  2JA8 J;  3CCY A;  2H8W A;  2HQ5 A;  5APS A;  4OGQ C;  2EBI A;  2Z9O A;  4AIJ A;  1XSD A;  2MLG A;  3Q2Y A;  3PNT A;  3V2Q A;  1Y0U A;  5HS8 A;  3E1S A;  3K4B A;  4LG0 A;  1S9H A;  3JRB A;  2PLY A;  2XPU A;  4N9H A;  2LKX A;  4ESF A;  1D1C A;  1KYO D;  3FX0 A;  3H1I G;  5CCH D;  2ZCW A;  1RC9 A;  4MO7 A;  2YIU B;  3JRH A;  3CC4 I;  4X6A J;  1SFC D;  1Q7Y Q;  3L9F A;  3L71 D;  3H1L D;  4IOC F;  5KJ7 D;  4PSX A;  1YTY A;  2VE8 A;  3ZQH A;  4E7I A;  2IA1 A;  3ZOB A;  1QL2 A;  4PJM A;  1BL0 A;  3WG7 H;  1FAV A;  3C1L A;  4JYB A;  1AKH B;  4FE4 A;  1ETY A;  1YS7 A;  1ETW A;  2FU4 A;  2VOP A;  3ABK H;  2JA5 J;  2JDI H;  1KQF B;  1ETX A;  3V5B A;  1FJP A;  1BW6 A;  3M1E A;  1HWT C;  1FSH A;  3CWB D;  4RKU J;  3ECH A;  1J59 A;  1A02 F;  1Z3X A;  3HC7 A;  3LSJ A;  1SQV G;  3H9G A;  1S5L C;  3HTK B;  5JLX A;  1JMM A;  2YO3 A;  2L4A A;  2HWV A;  3F22 A;  4CYC A;  2DJI A;  3CO6 C;  3V8J A;  1B8I B;  3JRC A;  4BDZ A;  1NJI Q;  2JRM A;  3QQA A;  4HLX A;  3ERM A;  5E79 C;  4BXU A;  4W97 A;  2R5Z A;  3GW6 A;  1IXR C;  4U3F D;  3CJQ B;  5CCH C;  2CFO A;  3T8T A;  5IPA A;  1U0J A;  1IK9 A;  4G7Z F;  3MOG A;  2FY8 A;  4BQA A;  2ACJ A;  1GL2 C;  1QVF O;  1X4O A;  5CJ0 A;  5KJ7 C;  2FD5 A;  1LVA A;  1ZN2 A;  2DYR H;  4BHC A;  3ZQL A;  4LB6 B;  1YTZ T;  2BEQ D;  4HKZ H;  5ILS A;  1D3Y A;  2J5O A;  2D2W A;  2VB6 A;  4YTP C;  2QCO A;  1X58 A;  4CYC B;  3AL0 C;  2G8Y A;  3LIE A;  1D8J A;  1KYW A;  2GOM A;  4I99 C;  3RZO J;  4KA4 A;  1LTA C;  2YX4 A;  3K0L A;  5TIS E;  2RAE A;  1NAY A;  2AQF A;  1BI3 A;  1R1U A;  4A3D J;  1VF5 C;  1KZU B;  2P7J A;  3I5U A;  1T2K C;  4RDU A;  1IRX A;  2PG4 A;  1FLI A;  4F52 A;  3OR2 C;  1OQY A;  2DMU A;  4EJT A;  1GDT A;  2Y0D A;  2HLO A;  1I1G A;  3TOB A;  1YYV A;  2WY8 Q;  1U57 A;  5K5Q A;  1K4S A;  1YIJ P;  4EAT A;  4FX4 A;  1T8Z A;  2G7H A;  2ZXJ A;  3H1J E;  2ZXX A;  4H13 B;  1Y9B A;  1WH7 A;  4OIN F;  3E7L A;  2V1U A;  2WVR A;  3W6U A;  1CGP A;  3DKY A;  3QPH A;  1SQX G;  1DLJ A;  3H9J A;  2CW8 A;  4KUH A;  2H88 C;  2DQR A;  3EQ2 A;  4M3D A;  5KKZ B;  1LDD A;  3GZN B;  3BR2 A;  1SQX D;  1POG A;  1SD6 A;  2JVG A;  3ZW9 A;  1BI2 A;  2ME6 A;  4YPC A;  3BTC A;  2KRF A;  3JRD A;  2JRT A;  1EH6 A;  2XF7 A;  3U9G A;  2DN0 A;  1WI9 A;  1WJB A; 
#chains in the Genus database with same CATH homology
 4DW6 A;  3C7A A;  5AYV A;  1MNM C;  3BTI A;  4AC0 A;  5J3L A;  1X2M A;  1IJW C;  3ADO A;  3ZQG A;  1VI0 A;  3HKZ N;  1FTT A;  1WDK A;  3WHB A;  1N1E A;  4XIC A;  2LVS A;  2R5Y A;  3S16 J;  2JK3 A;  3OBB A;  3ZGY A;  2L7F P;  3K6J A;  3OSF A;  2XGD A;  3MVP A;  2L9R A;  2MGQ A;  4JYK A;  5FJ8 J;  3TP3 A;  5EDN A;  4RBO A;  3TED A;  3BG9 A;  2YU9 J;  2M0C A;  2W48 A;  4OVN F;  1I3Q J;  1GT0 C;  4FGW A;  2WAQ N;  2DJN A;  4JP0 A;  1YRN B;  4MIM A;  1HF0 A;  1DU6 A;  1B72 B;  3PO3 J;  1YJQ A;  2ID3 A;  5A9R A;  2MW8 A;  2JA7 J;  2NVQ J;  2L0K A;  4IEJ A;  1RR7 A;  1NTC A;  4V2F A;  2HOT A;  1ZQ3 P;  4IHV A;  3GTQ J;  5HWS A;  1IGN A;  3PLR A;  1JTY A;  5K7Z A;  2H1K A;  3LSP A;  2CJJ A;  5E3N A;  3JRE A;  2VUM J;  4D5F A;  1W0T A;  3HDH A;  1JGG A;  2NS7 A;  5FKM A;  1QPI A;  1F36 A;  3BR3 A;  3JRI A;  3ZWB A;  5FWN A;  5C4J J;  3F0C A;  1N1G A;  2PMZ N;  4BBR J;  3UKG A;  4E12 A;  2EZI A;  1ZTR A;  2HXI A;  3GTL J;  1YVE I;  2X6O A;  2I10 A;  1WPQ A;  1I50 J;  2L7Z A;  4Y52 J;  2P81 A;  3HDD A;  3C2B A;  3CKY A;  4XID A;  4DYD A;  2Y30 A;  3H2Z A;  1JT6 A;  4EEF G;  2W8Z A;  9ANT A;  1RPW A;  4L5E A;  1SFO J;  1MH3 A;  3IH4 A;  4UUS B;  2R5Y B;  1ZR2 A;  1UHS A;  1P7I A;  1Z77 A;  2DA2 A;  4C3I J;  3K7A J;  2O9L A;  4DZJ A;  2OF7 A;  1MBH A;  2WTB A;  2JN6 A;  1UMQ A;  2XGE A;  2R5Z B;  2YS9 A;  2B63 J;  2DA7 A;  3GTG J;  2PGD A;  4MFE A;  3OSG A;  1RET A;  5F0C A;  2NS8 A;  2KDZ A;  2DTZ A;  2DMQ A;  2OFP A;  1W0U A;  3DCF A;  3HWR A;  1D5Y A;  1CQT A;  1Z82 A;  4NDL A;  5FLM J;  1RKT A;  4JQ0 D;  1IDZ A;  4D7N A;  4XRS G;  5GPA A;  3SJM A;  2IAI A;  2XPV A;  1GUU A;  1OCP A;  1IRZ A;  4D3D A;  3SFI A;  3LSG A;  5K7F A;  3W6Z A;  1TWA J;  2CQX A;  1X0V A;  2HOA A;  2HYJ A;  3GTM J;  2ME0 A;  5F04 A;  2O8K A;  5IP9 J;  2EZK A;  3GTJ J;  1ZKG A;  4M3F A;  1LE8 B;  2NVX J;  4BKX A;  3Q0W A;  3G1O A;  1TC3 C;  1FTZ A;  3OOU A;  3JRA A;  5JE8 A;  3ZWA A;  1M66 A;  1KS9 A;  3FKI J;  5IYD J;  2Y31 A;  1BJZ A;  3BTL A;  5IOY A;  5DTD A;  1PGJ A;  1K61 A;  2M2E A;  1PGN A;  2HXO A;  1AU7 A;  5FKN A;  4AYB N;  5A9T A;  5F08 A;  2N8G A;  2O7O A;  1TWH J;  2QYT A;  5C4X J;  3FWN A;  4M6V A;  2X48 A;  3PID A;  2JKV A;  5F0H A;  1PGP A;  4OM8 A;  4UUS A;  2DA1 A;  1MBE A;  4G12 A;  3PEF A;  3S17 J;  4I76 A;  1F43 A;  5C3E J;  1DLI A;  3BR6 A;  5FKL A;  3IH2 A;  3JR9 A;  1ZGW A;  5M5X J;  1JT0 A;  1X2N A;  3OIO A;  2CUF A;  4R1N A;  3Q0U A;  1HLV A;  3M4O J;  3I4M J;  1QVT A;  1LE8 A;  2NVT J;  3ZQI A;  1JUP A;  2YUS A;  4A3L J;  4B3H A;  2TRT A;  1PUF B;  4AUX A;  3PDU A;  2LD5 A;  2E2I J;  2P4Q A;  2X58 A;  3JRF A;  2X9D A;  1OFC X;  2Y9Y A;  2JMW A;  3RKQ A;  2ZYG A;  3EGO A;  1AKH A;  3BT9 A;  1XC5 A;  1FEX A;  3ZHB A;  2LK2 A;  5EEA A;  2JJ7 A;  1JKR C;  3DFU A;  2IEK A;  2ID6 A;  1LSO A;  3PM1 A;  1M76 A;  3A01 B;  4EZB A;  4C2M J;  2XGC A;  2IYP A;  4MLO A;  4HNV A;  3RQS A;  1JJ8 C;  3GTO J;  2Y9Z A;  1LFU P;  4UUT A;  2K9N A;  4QIW N;  1AHD P;  3ZWC A;  4B3I A;  3G17 A;  4DYC A;  4M3G A;  2ZYD A;  2FX0 A;  1PGO A;  3L6D A;  2E2H J;  1M75 A;  1DU0 A;  5GP9 A;  1WDM A;  2CU7 A;  1JKQ C;  4MFD A;  5A9S B;  4A93 J;  3FR7 A;  3HAD A;  4DCK A;  2HDH A;  1T56 A;  3QHA A;  1Q1V A;  3SDG A;  4M3E A;  4C3J J;  2ECB A;  2E2J J;  5EYR A;  4IHY A;  4OQZ A;  2XRL A;  3Q3S A;  2XSD C;  3S1R J;  3PO2 J;  3CQZ J;  4X1E A;  2IZ0 A;  2WB1 N;  4DZP A;  1MSE C;  2DA3 A;  4IHW A;  5EGO A;  3GTP J;  2DA4 A;  1WI3 A;  5E3M A;  3IV5 A;  3S1Q J;  3HOU J;  5JLW A;  1Y1W J;  5E3L A;  4GBJ A;  3S1N J;  1Y1V J;  4IHX A;  1WH5 A;  3MKL A;  3B6A A;  2EW2 A;  4JX6 A;  4GWK A;  4DYR A;  1E3O C;  1YJ8 A;  2CRG A;  4A3B J;  4D3S A;  3WHC A;  1PUF A;  1ZR4 A;  3CDL A;  2LFB A;  3FR8 A;  3VPR A;  5M5Y J;  4FIS A;  4V2G A;  5M5W J;  3PJG A;  3TW6 A;  1B72 A;  4PZC A;  2XB0 X;  1XS9 A;  1RKW A;  1EVY A;  3QSG A;  2VKV A;  4W1U A;  1LSJ A;  2LP0 A;  3TW7 A;  1O4X A;  1ITY A;  3BR5 A;  4A3G J;  3GHY A;  3FIS A;  1MBK A;  4OL9 A;  2K9Q A;  3HGG A;  4Y7N J;  1OCT C;  4ABZ A;  1NK2 P;  2COB A;  2LY9 A;  3FK6 A;  3GBG A;  1GV2 A;  5F1J A;  1YRN A;  3I83 A;  1IG7 A;  4S3M A;  5FKK A;  2JA6 J;  3ADP A;  1JTX A;  4BXX J;  1JUM A;  5F27 A;  2TCT A;  1QVU A;  3A02 A;  3NAU A;  5EZG A;  1M67 A;  2DMP A;  2OPT A;  2KT0 A;  3S2D J;  2E1O A;  3FIW A;  3C7D B;  1JJ6 C;  4GWG A;  3BR1 A;  1IV6 A;  3QPL A;  2XB5 A;  5IP7 J;  1GVD A;  1S7E A;  2LR8 A;  1SAN A;  3FK7 A;  5EGO B;  1MBJ A;  3HOX J;  4A3K J;  1U9O A;  4C3H J;  2GM4 A;  4XRM A;  3G1L A;  1QRY A;  4B4C A;  1F0Y A;  3WFI A;  1ETV A;  3DEW A;  3A01 A;  5DS9 A;  3BG5 A;  2ZB9 A;  1P7J A;  1FIP A;  3L1P A;  2GBY A;  3ULK A;  1WP4 A;  3BQZ A;  2DMT A;  3O8H A;  3Q0V A;  1TXG A;  3S2H J;  4E13 A;  5A9S A;  3HB9 A;  3RZD J;  3C7C B;  3BG3 A;  3HOY J;  1HDD C;  3GTK J;  2QF7 A;  4E21 A;  1R9T J;  2H8R A;  4A3J J;  2R92 J;  3H3V K;  4JX5 A;  4PZD A;  3G1M A;  1BA5 A;  1WGX A;  1YRL A;  1BG6 A;  3B6C A;  2Y0S N;  2W90 A;  2IYO A;  2IZ1 A;  1TWF J;  1VND A;  1ZK8 A;  1F17 A;  2CQQ A;  5F0F A;  3K96 A;  1MSF C;  5M3M J;  2AHQ A;  2FJ1 A;  5J1Y A;  1ENH A;  4D7M A;  2ZYA A;  3ZQF A;  4B3A A;  1APL C;  1BW5 A;  1ZCJ A;  4FTH A;  2R7Z J;  1K83 J;  5IOZ A;  3S15 J;  4GFB A;  5EF6 A;  1M2W A;  4XK4 A;  2G0E A;  2EH3 A;  3Q3C A;  5C44 J;  3CMY A;  3NAR A;  2WV1 A;  3RQI A;  4QSH A;  1H89 C;  4J19 A;  5EG0 A;  3ZQC A;  2I9P A;  2VPR A;  3A03 A;  2UYY A;  3HBL A;  2LLK A;  1IDY A;  3HN2 A;  4KUE A;  2E19 A;  2VI6 A;  2D3T A;  2PLA A;  2GLO A;  2MSY A;  3S14 J;  1JKO C;  1H88 C;  3LNQ A;  2K9S A;  3IH3 A;  1FJL A;  1JUS A;  1A6I A;  4LOC A;  3BQY A;  3K2A A;  3W6V A;  4IM7 A;  3BTJ A;  4BY7 J;  4S0H B;  3CTV A;  4A3I J;  1MBG A;  2NVY J;  4D5C A;  2AO9 A;  2M8G X;  1G2H A;  5EG0 B;  4OQY A;  1VF9 A;  4BY1 J;  3ZW8 A;  5MGB A;  3S1M J;  1GV5 A;  5GPC A;  4QTR A;  2M34 A;  2DMN A;  2R0Q C;  5FLV A;  1TWG J;  2ELK A;  2VKE A;  1OJL A;  1MBF A;  3JRG A;  4PZE A;  3IQD B;  5K7H A;  2D5V A;  3O8G A;  2JA8 J;  3CCY A;  2NOG A;  5IYB J;  1U78 A;  2ECC A;  3HOV J;  1JDJ A;  2HQ5 A;  2EZL A;  4KUG A;  3QPS A;  2EBI A;  1HOM A;  1TWC J;  3JRB A;  3WFJ A;  2XPU A;  3HGY A;  1WCM J;  2LKX A;  2XPW A;  5IYC J;  1JKP C;  2HDD A;  4MO7 A;  3JRH A;  4X6A J;  5J1U A;  4A69 C;  2LTP A;  1HCR A;  3ZQH A;  1WDL A;  3ZOB A;  1X0X A;  2DA5 A;  2K40 A;  5J1R A;  3D1N I;  1BL0 A;  1AKH B;  1YON A;  4FE4 A;  1ETY A;  4A3M J;  1ETW A;  2JA5 J;  2CVZ A;  1ETX A;  1HDP A;  1YB4 A;  1BW6 A;  2Y2Z A;  4JX4 A;  1PGQ A;  2CUE A;  3LOC A;  3LSJ A;  3I4N J;  1ETO A;  5JLX A;  4XRS A;  3TP0 A;  1MH4 A;  4CYC A;  1EF4 A;  1B8I A;  1F12 A;  1T33 A;  1B8I B;  1NK3 P;  3JRC A;  2FQ4 A;  1UG2 A;  2JWT A;  3QQA A;  5M3F J;  2R5Z A;  1U9N A;  4W97 A;  3H0G J;  1FIA A;  2MG4 A;  1A5J A;  1H8A C;  1WPK A;  3G0O A;  5IPA A;  1QMG A;  3MOG A;  2IBD A;  2HOS A;  4B1R A;  4DLL A;  2FD5 A;  1IUF A;  3ZQL A;  3HOZ J;  3WS7 A;  2EQR A;  5BNG A;  5IP6 A;  1LFB A;  1IL0 A;  1F14 A;  3M3Y J;  1I36 A;  2QCO A;  2R93 J;  1ETK A;  1X58 A;  4CYC B;  4J0F A;  2EZH A;  3MN2 A;  3RZO J;  1EVZ A;  1Z0X A;  2RAE A;  4A3D J;  3HM5 A;  1U8B A;  4BBS J;  3BR0 A;  4A3E J;  4RDU A;  2DA6 A;  1IC8 A;  2GF2 A;  4FE7 A;  2DMU A;  1GDT A;  4B3J A;  3LSR A;  4FCY A;  4J0E A;  4JPZ B;  1VFC A;  5EZH A;  3DOJ A;  3HEF A;  1ETQ A;  4A3F J;  2L7M P;  1WH7 A;  3E7L A;  1ORK A;  3W6U A;  5FKO A;  1DLJ A;  4KUH A;  1I6H J;  4M3D A;  1LJ8 A;  3F3S A;  3HOW J;  2M9H A;  3BR2 A;  4M3B A;  2HI3 A;  1POG A;  1XG1 A;  5E3O A;  4YCA A;  3ZW9 A;  1VPD A;  4D3F A;  5HOD A;  2ME6 A;  4I6Z A;  3BTC A;  4DYQ A;  3JRD A;  4A3C J;  2DN0 A;  1RES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...