2Y9ZA

Chromatin remodeling factor isw1a(del_atpase) in dna complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
287
structure length
287
Chain Sequence
b'RSSTPSHPRMPKPHVFHSHQLQPPQLKVLYEKERMWTAKKTGYVPTMDDVKAAYGDISDEEEKKQKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDATKDRMKKED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)
publication title Structure and Mechanism of the Chromatin Remodelling Factor Isw1A
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 70
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09110 HAND HAND
A PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9zA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9zA04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2y9zA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 2y9zA03
9ANTA 3Q0UA 5M5XJ 1I6HJ 3ZQFA 5C44J 1RESA 2Y9YA 3IV5A 2WB1N 2L9RA 3TEDA 2O7OA 2DMNA 1K61A 3BR2A 5EYRA 1P7JA 2NS7A 5EG0B 1MBGA 1APLC 2VI6A 1RPWA 4JQ0D 1JTXA 5J3LA 4BKXA 2R5YB 1JKQC 3BR0A 4D7NA 1OCTC 4M6VA 3GTPJ 2EH3A 3CDLA 3CCYA 4FE7A 5M3MJ 4JP0A 3HB9A 5IP7J 2E2JJ 2O8KA 4A3GJ 1TWFJ 1ZGWA 4LOCA 5K7FA 1GVDA 4M3BA 2R92J 3B6AA 2NOGA 2RAEA 5K7HA 2NVXJ 4DZPA 1BJZA 4RDUA 2VKVA 1CQTA 1EF4A 5DTDA 4C3JJ 2CQXA 3G1OA 4A3BJ 2IAIA 1RR7A 4UUSA 2K9QA 3BTLA 2WV1A 3B6CA 5IOYA 3GTKJ 1I50J 2L7MP 1AKHB 1NK3P 4UUTA 4C3HJ 2DA5A 1GUUA 2FJ1A 1F43A 4QSHA 3OIOA 5FKOA 1H89C 1MBJA 3IH3A 1G2HA 4JPZB 3VPRA 1U9NA 3LSRA 3GTLJ 1ORKA 4A3LJ 2MSYA 1VI0A 4A3EJ 2AO9A 2WAQN 3NARA 2XB5A 3BR5A 1JKOC 1IC8A 1W0UA 2DMQA 2JA5J 3SDGA 1E3OC 1H88C 3PO2J 4I6ZA 2LK2A 1IV6A 4HNVA 1JKRC 1YRNA 2YUSA 2OF7A 3GTJJ 5EDNA 3S2HJ 2OPTA 1S7EA 5FLVA 1BW5A 3JR9A 4D7MA 5JLWA 1FEXA 2ZB9A 3SJMA 2EBIA 4MO7A 3TP0A 3W6VA 1POGA 5J1RA 1ZK8A 2AHQA 2ECBA 1GT0C 5EGOA 3JRIA 2B63J 1TWHJ 2XPVA 2LKXA 3OSGA 2R0QC 3M3YJ 1WPKA 3RKQA 1GV2A 5C4JJ 4CYCB 2MGQA 2E1OA 1MNMC 2FD5A 2ID3A 3HBLA 3HGYA 2EZKA 3PO3J 2YS9A 2JWTA 1QVTA 3LSPA 1O4XA 5E3OA 2DJNA 2KT0A 2L7ZA 3L1PA 1PUFA 2ME6A 3O8GA 2JK3A 5F0CA 1ZKGA 1D5YA 2E2IJ 4BXXJ 2HXIA 3MKLA 5DS9A 1QPIA 2HXOA 1X58A 4XRSA 2YU9J 2COBA 5IPAA 3JRGA 1FIAA 4J19A 3RZDJ 2VUMJ 1QVUA 1LE8A 3BT9A 4Y7NJ 4M3GA 2NVYJ 1BW6A 2CU7A 1P7IA 1H8AC 3BR6A 2K9NA 3HDDA 2LTPA 4JX6A 3BQYA 5IP6A 5IYDJ 1IUFA 1MH4A 4IEJA 3JREA 2ME0A 4UUSB 1MH3A 3H3VK 2CUFA 4GFBA 3BR3A 1I3QJ 1ITYA 4IHXA 3BTJA 2IBDA 2NS8A 3K7AJ 2DA2A 3DEWA 2P81A 4BBRJ 4BBSJ 1RKWA 4C2MJ 4FTHA 3FKIJ 1TWAJ 3WHCA 3JRAA 3LNQA 4M3FA 5FKMA 3K2AA 4IHVA 3FISA 5FKLA 2LR8A 5J1UA 3S1MJ 3JRBA 1ZR2A 2NVQJ 2JN6A 5FKNA 2GBYA 2EZHA 1AHDP 1MBFA 4AYBN 5IYCJ 1LFUP 2GLOA 1YRNB 2HI3A 4MLOA 3HOWJ 1A5JA 2FQ4A 3S2DJ 3UKGA 1X2NA 1MSEC 4AC0A 4EEFG 1W0TA 3ZQIA 5HODA 3HOVJ 2HQ5A 4JX5A 5EGOB 4X6AJ 5C3EJ 2R5ZA 2LFBA 1JUPA 1GV5A 1WH7A 4M3EA 3GTOJ 1WH5A 5EG0A 4W1UA 2JA8J 3S1RJ 4MIMA 2LY9A 2K40A 5M3FJ 2D5VA 4A3CJ 5E3NA 1RKTA 2DA6A 5IOZA 4JX4A 1ETKA 2R7ZJ 1SANA 3O8HA 3JRFA 5GPCA 1JT6A 2FX0A 3ZQLA 2DA3A 3QPLA 4D5CA 3MVPA 2DA1A 5F0FA 4G12A 2DMPA 1X2MA 1WCMJ 3S15J 3GTMJ 2Y0SN 1UHSA 2X48A 4V2GA 3BG5A 5C4XJ 4M3DA 4XIDA 3S1QJ 4QTRA 2LD5A 1LE8B 1B72A 3OOUA 1VF9A 1BA5A 3BR1A 1FIPA 2TRTA 3QPSA 5EF6A 4XRSG 5K7ZA 5FLMJ 3FK6A 2H8RA 4A3KJ 4A3FJ 1HDDC 3GTQJ 1JTYA 2R93J 3HM5A 3S14J 1ETXA 3PM1A 1B8IA 3QQAA 3RQIA 3ZQHA 5F27A 2JMWA 3H0GJ 2CUEA 4QIWN 5M5YJ 4DW6A 2XGCA 4B1RA 3IH2A 3E7LA 3LSGA 4XRMA 4B4CA 4IHWA 5JLXA 2XSDC 4A3JJ 2O9LA 3Q3SA 3RZOJ 1JT0A 4Y52J 2JJ7A 1JKPC 2HDDA 4FE4A 2JA7J 2M34A 1RETA 1WGXA 1JGGA 2E19A 1OFCX 2JA6J 1IDYA 4MFEA 1HOMA 3WHBA 2EQRA 2L7FP 4A3DJ 2LVSA 1UG2A 3FIWA 5M5WJ 1OCPA 3G1MA 3D1NI 2CRGA 5EZHA 1BL0A 5E3MA 4FCYA 2PMZN 1HCRA 4DYQA 1TWCJ 2Y2ZA 4FISA 2LP0A 2QCOA 4DYRA 2H1KA 1MSFC 4MFDA 5IP9J 1VFCA 1K83J 5GP9A 3G1LA 3M4OJ 2ID6A 3Q0VA 2EZIA 2ELKA 2R5ZB 3HOYJ 3LOCA 3BG9A 1T33A 1FTTA 3FK7A 3IH4A 2I10A 4CYCA 3DCFA 2XRLA 2VPRA 1HLVA 1DU0A 2XPWA 1ETQA 2DA7A 4XICA 1VNDA 3CQZJ 2E2HJ 2DN0A 1ETYA 1ENHA 3HOUJ 4A93J 2M8GX 2XB0X 2W48A 1ETVA 1IRZA 3A02A 3BQZA 2XGDA 3GBGA 3A01A 3A03A 3TP3A 2MG4A 3S17J 4DZJA 3BG3A 2M2EA 2L0KA 4A69C 1B72B 1U9OA 4W97A 3GTGJ 3TW6A 4L5EA 4C3IJ 1XS9A 4BY7J 1HDPA 3BTCA 3CMYA 1XC5A 1LFBA 4A3IJ 3HEFA 4S0HB 4B3AA 1WI3A 5F08A 2R5YA 4V2FA 1U78A 3JRHA 1HF0A 1AU7A 1B8IB 5IYBJ 1T56A 2TCTA 5F1JA 1R9TJ 3HKZN 3Q0WA 4DCKA 4BY1J 1IJWC 1PUFB 2XGEA 2XPUA 1Q1VA 2M0CA 4X1EA 5F0HA 3MN2A 1IG7A 2Y30A 5J1YA 2K9SA 1TWGJ 3JRDA 3F0CA 1ZQ3P 2DMUA 3JRCA 2DMTA 1Y1VJ 4JYKA 4DYCA 2N8GA 1F36A 1MBKA 2DA4A 2X9DA 2EZLA 1UMQA 1XG1A 3I4MJ 4D5FA 2CJJA 2HOSA 2DTZA 4ABZA 2Y9ZA 3NAUA 3OSFA 1A6IA 3HGGA 2HOAA 1ZTRA 2LLKA 2VKEA 1Y1WJ 1JUMA 2ECCA 4XK4A 5F04A 1AKHA 1MBEA 2HYJA 4IHYA 3I4NJ 4RBOA 1ETWA 1NK2P 1IDZA 1U8BA 5FJ8J 3SFIA 3S1NJ 1GDTA 2X6OA 3LSJA 3S16J 1MBHA 1JJ6C 1OJLA 2G0EA 1Z0XA 2MW8A 3ZOBA 4I76A 1ETOA 1JJ8C 4NDLA 2KDZA 5EEAA 4AUXA 5EZGA 5BNGA 2Y31A 1JUSA 1FTZA 1FJLA 2M9HA 5FKKA 1IGNA 2HOTA 1SFOJ 1TC3C 5GPAA 1QRYA 2CQQA 3BTIA 1DU6A 1ZR4A 2QF7A 4OVNF 3TW7A 2NVTJ 2IEKA 4A3MJ 1Z77A 1NTCA 5E3LA 3A01B 3HOZJ 3ZQGA 3HOXJ 3ZQCA 3C2BA 2GM4A
chains in the Genus database with same CATH superfamily
9ANTA 1NH3A 3U21A 4OGQC 1QZYA 3Q0UA 4M74A 2IS2A 4C7RA 2I9PA 2UWJE 5C44J 2RN0A 3IV5A 2WT7A 3TEDA 4P9FA 1P7JA 1E79H 2KUBA 5JHUA 3HOTA 1MBGA 1QGKB 1APLC 2VI6A 1IK7A 2QJYC 1IN7A 1R5ID 1SFXA 3ECOA 3RBZA 2XIGA 3RI4A 1RPWA 4R8HA 4PUSA 2CFOA 1XN7A 2BW3B 1JTXA 3OYMA 1Z21A 2V79A 4BKXA 5HS8A 2R5YB 1JKQC 3CUQC 5DEQA 5KLIC 2HR3A 5L3EA 2ZXWH 1FZBA 1F1ZA 1PP9G 4HDVA 3UNGC 3QU6A 1VQ8I 4E13A 1W5CC 1OCTC 1VQ6I 1F17A 1P84I 4BXFA 1VQOP 1IUYA 4M6VA 4UXNA 2KIFA 3FXOA 2O6GE 2OYHC 2WA0A 3GTPJ 5E1XA 3AEFC 3S2WA 3CCYA 3FXRA 1WJCA 4CCKA 2OV7A 3BJOA 2M3EA 1OW6A 1FC2C 2ZYAA 2GZWA 1R36A 2E2JJ 2O8KA 1EZVE 4A3GJ 2C9LY 3M9AA 1R5SA 2VC1A 4UB6E 3CMEI 2P7JA 2P4QA 3MIWA 1YOVB 1TNTA 3OWTA 2IBZG 1WHUA 5AVSB 3SFEC 4ZTJA 3BG6A 4BE1A 5L3DA 2K3PA 1QZEA 3IRRA 3M0DA 1XMAA 2DOAA 2VKVA 1CQTA 5HS7A 2RN7A 5DTDA 4AM3A 1EF4A 3CJNA 1Q1HA 2CQXA 2X1EA 3O3KA 5IT9K 1BDDA 2BY3A 4OU0A 3Q5FA 1C0WA 1NU1D 1USDA 2PFBA 2WV1A 1X4PA 1J2XA 3KP7A 5JVGF 3GTKJ 1I50J 4H0LB 3M8FA 3TKYA 1YHQI 1GK4A 4O9BA 2CH0A 4M73A 1W4MA 1GL2B 3PP5A 3WTSC 4E7KA 2Q8KA 1K6YA 2DA5A 1GW3A 1I3AA 1GU5A 1SQPD 3L35A 4LGDE 4TV7A 4MN4C 2I1KA 3TQNA 1SQXG 3LAJA 1NTMK 5KKZB 1LGHB 3VPRA 1FSEA 1YO5C 1U9NA 4BDZA 4OH8B 3E1IA 1EA3A 5HLHA 3U1DA 4A3LJ 5TJJA 4ANJA 1SFCA 3BCCJ 3OAKA 2WTYA 3ZRGA 2Q5UA 2WAQN 4IRGA 3L36A 3BR5A 3L71E 4KIGA 3L2CA 1IC8A 1U7MA 4J0FA 4Y3OA 2H1LA 3L4FA 3H1JJ 4XLHA 2I1JA 3I71A 4EOTA 1E3OC 1BGYE 4D6TD 1DPRA 2FA5A 2VKHA 1PP8F 3CX5H 2E76D 5KAFE 4XLAA 3T0YA 1G8XA 2RV8A 4Y15A 4BEHB 1OQYA 1B9MA 2K7LA 1HW5A 1G59A 5L3BA 1KU2A 2HVRA 4UB6C 1GW4A 1JI8A 2VQHA 4L73A 3T97A 2YUSA 2UXXA 1KYZA 2WPVB 2OD5A 2A06D 5EDNA 1BW5A 1X3UA 1XTAA 3JR9A 4M6YA 1YW9A 1IN5A 3DKWA 4RGSA 4D7MA 2KJCA 4PFPA 2ZB9A 3OYKA 1H89A 4YG2F 2B9SA 4LIVA 1QGPA 3SJMA 2EBIA 1FWZA 3K4JA 4WXHA 5J1RA 3W6VA 3MGNA 1L4AC 5ICFA 5HVQC 4YEJA 1GT0C 5DJUB 1G2CA 2WWWA 4EI2A 4H44D 4ZDPA 1FBQA 3K2ZA 2A45I 4EYYQ 2H94A 4HAMA 1HQCA 3HXLA 4A7PA 5CVIA 1DUXC 1WDLA 3BCCE 3M3YJ 5K5GB 1IFJA 2LF8A 2ZXEB 3FXDA 2LC2A 3IAM2 2MGQA 1KQLA 1HA8A 3KYQA 4PK4A 3ZDMA 1LDJA 2PG4A 2G9WA 2EA4A 2R5DA 2E35A 1MFZA 2EZKA 5JVTA 1J09A 1VPCA 2JWTA 5LLQA 1EQ7A 3BY6A 1PP9D 1QVTA 1IN8A 3V7RA 1O4XA 3UIAA 5CVRA 1EJ9A 2Q7CA 2QWWA 2E74D 2Q9IA 1X9VA 2B9BA 5E8GA 3HZJA 1K8AQ 1D5YA 4UV9A 4ZYGA 2YU3A 3F8NA 4XR6A 4N9IA 5DUKA 3WODF 5KAFC 2HXOA 3HIFA 4XNFA 3L00A 1L0LJ 3JRGA 1QX8A 3AL0C 4IPAA 3H92A 4J19A 3U1CA 3RZDJ 1KQ0A 4CCNA 1O3TA 2PJPA 3RK2B 1HTLC 1PGOA 3Q3DA 1QBJA 4PZJA 1KFMA 1SAUA 2G7HA 3PUFA 3DBHB 1SD4A 1KQSO 4QPQA 1K73Q 1MZBA 2LTPA 1LSJA 3C18A 4G7ZF 1YX3A 4XLFA 3WGHA 1A02F 1EDLA 1IRGA 1H9TA 1SQBK 1MH4A 3VOPA 2M5WA 4R4MA 2ME0A 4UUSB 3I53A 2CUFA 2EINH 1XB4A 3EUHC 4GFBA 3VYRB 1NTZK 1U57A 1B9NA 5IY5H 2A68F 4PSWA 3S3NA 1W2EA 2F5FA 2BY2A 1EH8A 3FF5A 2UYYA 1TBXA 4ZH4F 3M1EA 1J75A 3H5AA 3PQJA 1I1SA 4KUHA 2BEQD 1UCRA 1Y0UA 2DA2A 3FXLA 4Y33A 1JHFA 3CJRB 1SVOA 3HJEA 2VJ5A 2HPMA 1SQXD 1TP4A 4UB6H 1NU1J 4F52A 1TWAJ 2VT3A 3DP7A 4GYGA 1XDSA 4KHXA 3HPHA 3MZYA 1QL1A 5APXA 1EVZA 3JC22 4ZYDA 3I59A 2R7SA 1O3QA 1RIOH 4ESBA 1KQGB 2Y0DA 3QWOC 1JMMA 1YYVA 1XD7A 2W4SA 3GFLA 1BOBA 1X1AA 4S3MA 3R60A 3KLOA 3K4KA 1SFCC 2RKLA 1ZR2A 2JN6A 1U2WA 4AD9A 1IFDA 1RI7A 3I56I 3LA3A 1SFUA 1VQLI 1A04A 2FBIA 1X22A 1BI2A 1YBKA 2DYRH 5HLIA 4ZYAA 1IXCA 1FPQA 1XGMA 3LAPA 4DQ2A 4F55A 2V6CA 1W0TA 2MH2A 2KOGA 2CO5A 3KZYA 2L54A 2Q3EA 2E5ZA 3ZQIA 1M1JC 3RL0D 3ZMDA 1TZLA 5TRDA 1KQFB 4KN4X 3R4YA 2BEOA 1KA8A 1O3RA 2LMDA 3BROA 2BHZA 2VPLA 3ZW8A 5KAFH 4ZYEA 3WU1B 1VQ9I 1X1BA 4M3EA 2HG5D 2MBFA 2R7FA 4W1UA 3ZMVA 3CMAI 2STWA 2FYUG 3AE1C 5H2FE 4MIMA 3ESWB 3VP8A 3H36A 1FMWA 2J5PA 2LY9A 1KB9D 1VDFA 1SQPE 1LFPA 3PNVA 2D5VA 1REPC 3GHGB 5ILUA 4RJTA 3KYCB 1DP7P 2QQ8A 2WITA 4JX4A 1Y8AA 3RJPA 3TGUG 3EUAA 2R7ZJ 3DXJF 3JRFA 5GPCA 3H1IG 3MD0A 3ERED 4RS8A 3I55I 2A05A 3P5JA 1U0JA 3MVPA 4H13B 1GL2C 3N4MA 2XZRA 2IXSA 4M9ZA 1WCMJ 4D6TE 2HKXA 2KNCB 2VRSA 2OAZA 2Y0SN 5AW9B 1SD6A 2M7BA 4V2GA 1MJ9A 3DTEA 4IQJA 2IS1A 1RQVA 2YO2A 3CDHA 2W6JH 1S5LX 2WAFA 5AW3B 5BPIA 3MMYB 3OOUA 3V7SA 3KP3A 2VN2A 2BY1A 1LVKA 3BR1A 3JSPA 2A06E 1M1KQ 2OYIA 1WJBA 1FP2A 2KP8A 5EF6A 5K7ZA 2E5YA 1IAWA 4J0EA 4EGZA 1RR8C 1HDDC 3GXOA 3JAMZ 3DBRB 5J4VA 2R93J 1L2PA 2KSJA 3S14J 1BR1A 1SQVJ 1MGTA 5F6FA 1W1WE 1Y56A 2V1NA 5K5RA 3MUDA 1RF1C 2Z16A 3IFMA 1I1GA 3SQNA 2R4GA 2HDHA 5H2FC 3KHUA 3M8EA 2DYSH 3FR7A 3QQAA 4XORA 2ZJQF 5FB2A 3BCAA 1JOCA 1U6GA 2WTEA 5M5YJ 3CX5I 4IKFA 3GF7A 1ON1A 4K2EA 3L75G 3K4CA 4DJAA 1PP9E 3LSTA 4XSXF 2STTA 1XSVA 3E1SA 3H1HJ 2PEXA 3S9OA 2XSDC 2Y0EA 1EV7A 2QUFA 3BPVA 1LT9A 1JT0A 2IYPA 1USSA 2GUSA 1IRFA 2QIWA 5HOOA 1UFMA 4FE4A 2JA7J 1FOYA 3I5UA 2E76C 4YXWH 1JGGA 1EDKA 1PJRA 1LEBA 3E7KA 4UB8E 4KMFA 1N7SD 4L5IA 4MFEA 4OQYA 1T0FC 1YTZT 5D8KB 2L7FP 5J40A 1UG2A 3O2PE 3FIWA 1YJNP 3G1MA 2FXOA 1D1AA 1HUCA 2G8YA 4FCYA 1CF7B 3CCSP 3G2BA 2PMZN 5KTBA 1Z9CA 1ZV8A 3O6QB 4DYQA 1WJDA 5BVZA 3CCJP 2Y2ZA 3FM5A 2F5VA 4UHTA 1FDIA 3M1CA 2KSEA 2CVZA 4E7SA 2N1TB 3HUSB 1XSDA 4H44C 4EM0B 1PGNA 4XLPF 3IUOA 2WADA 3G1LA 5LRRA 3RL0g 5CPRB 3SZPA 4E12A 5A2QK 2BHYA 1K78B 1FTTA 3BLYA 2FYUD 2XAGA 1IC2A 3D6ZA 1QEXA 3A4CA 1YFHA 3DCFA 4E6KG 2XRLA 1SQXE 2XPWA 3TGUD 5BMZA 1SD5A 3H1ID 1YE9A 3I9V2 1F14A 3QRFF 3W3CA 1VPDA 2DOFA 2E74C 1L0NG 1ONVA 3B5ND 4BXUA 5IT9Z 4IVNA 4N3YB 1ZRCA 4HZFA 3F6OA 4XLEA 2M0MA 3OS0A 2O8XA 3A02A 1TXGA 2KYVA 4UB8C 1K4TA 2X58A 1AFOA 2IS6A 3TP3A 4UVBA 2MLKA 5E1WA 5HDKA 1FE6A 2BCCJ 5H2FH 2LRDA 3S17J 1SLQA 4DZJA 3BG3A 4D3FA 2M2EA 5KAIE 1LQ1A 1U9OA 4KYWA 5FWNA 3COAC 3E3VA 1VQ7P 2DODA 3D5LA 4BU2A 3WU0A 1S3JA 1EZVI 1N73A 1S1CX 3CC7P 1HDPA 4Y17A 3SXYA 3W6UA 2K9JA 2Y0CA 4NC6A 2MLGA 3D6YA 2DFEA 4HYEA 1LJ2A 4BACA 2R7WA 5CCHD 2HYGD 2XSJC 3MKWB 1URQB 4A3IJ 2ISZA 4WF2A 1ZG1A 3ECHA 4V2FA 4CH7A 2IVMA 3JRHA 1NTKG 4N6JA 4BRYA 1UZCA 5IYBJ 4BAYA 4EGYA 1R9TJ 1LTSC 5AIPA 2OCEA 1LEAA 3M0AA 3G71P 4LJZF 3MUDC 3K70D 1PUFB 2XAHA 1MDMB 1M2WA 1KB9E 1U5TC 4ZDOA 2NAZA 1FZGA 5DCFA 3JW4A 2V4JC 2XPUA 4CA0A 3L70D 4X1EA 2UUZA 4W7ZA 4A12A 3WS7A 2Y30A 1NG6A 5J1YA 1TLHB 3OYGA 3BZKA 1K7AA 2Z4EA 1LVAA 3JRDA 2HNHA 2B0LA 2ZMEB 1T08B 2FYNB 3H9JA 2RNGA 1FZCC 3L74G 4IXAA 4RMNA 4RLQA 4NPEA 1IO2A 4DYCA 1ERDA 1OZHA 5F64A 2H89C 3HTKA 2N8GA 5FLXZ 1D8JA 2JKVA 2DA4A 3R61A 3L73J 4TLFA 3ZWBA 2ZBKA 3MZHA 1NAFA 2EZLA 2EFNA 5KAIC 2H8WA 1PFIA 3H1KD 4RAYA 4BL0B 3VOEA 1NOHA 1OWAA 1V5FA 3HUGA 3KIOA 4ABZA 2F48A 4OAZA 3NAUA 3H3UA 4G6DA 4IOCF 1LTJC 2O1KA 2M87A 3CXHD 3Q2YA 1ZTRA 2YXRB 2VKEA 2ZYGA 1RE3A 3CZ6A 1RH5B 3HE4B 1M90Q 2E71A 3KPHA 3SWFA 3G4SP 4G7OF 4PJNA 3VYSB 2ZC2A 3RL0C 1ZGAA 2X6YA 1ETWA 4L18B 1D1BA 1X1PA 1Y6IA 2VBZA 1P4AA 2D45A 2P8TA 3KCCA 4E7LA 2A3SA 2L5QA 1VTNC 3S1NJ 3V8KA 3CCJI 1HKTA 3N05A 3PJGA 3A3YB 4YXDC 1EXIA 2B89A 1OJLA 4ENNA 1SQBJ 1IF1A 2LNBA 2MW8A 1Z6RA 3IRQA 2K37A 3A1YA 1D8KA 3CLOA 5L3GA 3ZWCA 2WSSH 2VOOA 3VDXA 2RNJA 1ETOA 4RA2A 4ESJA 3HL2A 1NTZJ 2LY1A 4NDLA 4D1QA 2KDZA 5HNHA 2QZ8A 1KD1Q 5GADJ 2CQKA 4DOZA 1MKMA 5BNGA 3N97A 1LTIC 2XHKA 4U0WA 3V4WA 2BBYA 1RUOA 2WMMA 3IKTA 1SFOJ 1GK6A 3QAHA 2QYOA 2A6TA 4CDGA 5KJ7D 4BJTA 2VT2A 2FSWA 2QSFX 1ZR4A 3QWLA 4CO8A 1ZLKA 3II6A 2Z9OA 2NS0A 3M9QA 2XASA 4ENMA 1ODDA 2QQBA 1WT6A 5AW2B 3VTPC 4WY4B 1V55H 2QVAA 3HOZJ 3OL3A 2KB7P 3ZQGA 1JNMA 3J80K 1WJFA 4Y4RA 2W6AA 5B66E 3OA7A 1E3HA 3RK3B 2LREA 2WV0A 1MNEA 3DKXA 2MD5A 4DZOA 3CI9A 3OIPA 3H3ZA 4B44A 3CCEP 2B87A 5CCHA 1R5GA 3ZQFA 4LG3A 3CX5E 4ENJA 5LEKA 2D2CB 3TBIA 2L9RA 4I99C 1YI2P 1IK9A 2O7OA 1W5TA 1FBUA 3BR2A 1BE3J 2Z99A 1KQ9A 5EG0B 2N9BA 3NMDA 4ZMDA 3GO5A 3KZIE 1IXRC 3PJRA 3CC7I 1L0LK 2I76A 3J81Z 3I4PA 2X6XA 3R2PA 3VMZA 3T5XA 1W5SA 2HEOA 4D0PA 2FYUE 1NJIQ 1HW1A 2RVCA 2LY2A 2ZSIB 3DFGA 3MD2A 5KAIH 1T8ZA 1KGSA 2CUZA 4YELA 3GW2A 1ZREA 2WZ7A 4ZKUA 3TGUE 3GFIA 1OR7A 2CUJA 3CDLA 4Z6YA 2VLAA 4FE7A 3H1IE 2VC0A 1W36C 5GTHE 3PIDA 3MZ8A 3PHLA 3L74D 1HWTC 3KP5A 1OCRH 1KV4A 4A0YA 4M3BA 1YQAA 3B6AA 2E36A 3FWEA 4OIQF 2L9NA 4KIBA 1N7SC 2YIUB 3RPUA 4XKBA 3HD7B 4YIIA 5B66C 1T39A 1H0MA 5DJTB 1N75A 1NU1K 3A7OA 3QYEA 1RR7A 3B73A 2PJRB 1KB9H 1I39A 2OTKE 3NWTA 2VONA 3OYBA 3K6GA 2W83C 1FOSF 3B6CA 1VF5D 1ZYRF 2FRHA 2JUCA 2V9KA 1AA7A 1VQ6P 5AVXB 5LGUA 4ITVA 1H9GA 1BN5A 4C9YA 1NK3P 3BRVB 4GWKA 4E7ZA 3KZIC 1BI1A 1IJDB 3G4SI 3HYIA 5CVVA 1I5ZA 2WPRA 3HTSB 2FXMA 1JHHA 1MBJA 4OWFA 4D3SA 5AVRB 1G2HA 4JPZB 3HWRA 3F8BA 3CWBJ 1STZA 3TGNA 3LSHA 1ORKA 1QL2A 1KQ8A 2EA2A 4JBAA 2WAQA 4A3EJ 1DLIA 2ICWG 3BASA 3CMEP 4JYBA 2ZT9D 1XMXA 3DQVC 2V1DA 1X1DA 1NO4A 5KJ7A 2K9YA 2DMQA 2ESNA 3G6EI 3SDGA 2L4MA 2YO3A 5AONA 1SP4A 3L70E 3TF5A 5B3SH 1PV3A 2XKMA 3PO2J 3EPZA 3FKJA 4EZBA 1PP7U 5FD6A 4I6ZA 3DF8A 3U2RA 4GBJA 3B5NC 2O3FA 1YRNA 1TTYA 2DK5A 3WE3A 3ULQB 3M06A 2KPMA 2X4HA 5H6QA 5EJCA 3SYTA 2IZ1A 2POHA 2XNXA 1TU3F 1YHQP 1ZG3A 3RQ4A 5FLVA 2OC6A 4KA4A 3ZP5A 1ZCJA 2GUVA 5AW4B 1YJ8A 3CC4P 3OIQA 3O6BB 3F89A 3P9CA 3MZWB 5APVA 2FOKA 3K69A 1U3EM 3IWFA 3QODA 3TP0A 4MO7A 4ESFA 3H1KE 1POGA 4I7ZC 2ECBA 2EFOA 5D4SA 1EVYA 2NNNA 5EGOA 3EYYA 3JRIA 3NWSA 3UR3C 1HJ0A 3CXHE 3HHHA 1S4XA 1HBXG 3ULKA 3CMMA 3GG2A 1JUNA 3OSGA 4IM7A 2CYYA 2GM4A 5H6RA 2WT7B 2XC7A 3AE5C 4GCVA 5C4JJ 4OWRB 5CCHC 5JI6A 1Z05A 1SQQG 4B3IA 1KC8Q 2ID3A 2H7HA 3H1CA 3HBLA 1EDJA 2CMPA 2ZXJA 2R7UA 1E0EA 1G3WA 1NH4A 2A61A 5E79E 1JB0J 2Z2SB 4WB4A 4YRVA 4ASWA 5CJ4A 3KPEA 2PAJA 4WXDA 3Q9SA 2BOLA 2KT0A 5B66H 3K70C 3L1PA 1YLFA 2NYXA 3O8GA 1J1DB 4ETSA 2E2IJ 4L9TA 2X1CA 2GIZA 2QKLB 2ZFUA 3M9HA 1TQMA 4NHJA 4N0BA 3CO6C 4ZKPA 1QPIA 5KLVG 2YU9J 4XRSA 3GLXA 1BSHA 1DH3A 1LNWA 1VQNP 2WC2A 3KP4A 4QWQA 4ZZLA 1QVUA 1Z91A 1N1EA 2HZDA 3KZIH 2BGCA 3IKVA 3GYHX 1BW6A 2JR8A 3CESA 1PGQA 5A2QZ 1VZ0A 4V19K 4UY8I 3BR6A 2W27A 3C2HA 4GRIA 2E75B 3F8CA 2R7TA 1IUFA 4C46A 3F23A 2HLOA 3N4XA 2XAUA 2M3AA 1BJAA 2VASA 4AIKA 2OZ6A 4X0GA 3AKZA 5CBNA 2CV0A 3AE2C 3H3VK 4P55A 1GZLA 1H0TB 3QSGA 3A2AA 3K1MA 4QMAA 2RREA 3BTJA 4HQEA 5GTHH 2NS8A 5ERIA 4AIJA 1TT0A 3RPQA 1JTHB 3VEPA 4BBRJ 1RKWA 3K4BA 4C2MJ 4HDUA 4H0LD 4I01A 1HKQA 5E79C 1Q81Q 1GL2D 3MWMA 4KT0J 2EPFA 1R1VA 1LTGC 2JUGA 3K2AA 5FROA 3WTUC 4IHVA 1LDKB 5FO5A 1EKEA 5FKLA 4XKWA 1FZAA 1FOSE 3VN0A 2LR8A 4DIQA 1RF0A 3L71J 3JRBA 1W7PB 2RH0A 3IHUA 2NVQJ 5GAEJ 1PDNC 2FBKA 1UELB 1P92A 1BGYJ 2LBFB 4AQRD 1A36A 1LJ9A 3EUHA 4AYBN 5KJ7C 3L74E 1QVGO 5IYCJ 1LFUP 2GLOA 1SFKA 3L37A 3LSIA 4P1WA 1EDIA 4CXFA 1XGNA 5JFRA 2IGKA 1FSHA 1JY2P 3T97B 1E2XA 4YFNF 2L9VA 3S2DJ 3UKGA 4AIHA 4I02A 1X3ZB 1J59A 4EEFG 2P1JA 1VQPI 4KUEA 4BDYA 1GMJA 1YS6A 1PL5A 3U59A 1X79B 1CW5A 3CC4I 2AXLA 4WWCA 4KNYA 2O5RA 2M8RA 4KMUX 1SQVG 3I58A 4X6AJ 5L3FA 1G2CB 2CK3H 3TNUA 3Q1MA 4EV0A 2R5ZA 3CCVI 2LXCB 1JUPA 2JZYA 2EIKH 3QP6A 4IRHA 1DEEG 3EQ2A 2RGVA 5DM6F 4W7YA 2MD0A 3K4MA 2NVUB 4OM8A 4BXLA 2QLZA 2P4WA 3I56P 4O6JA 1HH0A 4DBQA 2OTJI 2WVRA 3TDZC 1AJYA 1Y39A 2GF2A 1VQLP 1WKMA 1BR2A 4U0VA 4E21A 1M76A 2IX7C 3O8HA 4LIUA 4UVCA 3M0DC 2FX0A 2H8PD 3HE5B 2DA3A 2CG4A 1UG0A 3QPLA 3CXHH 4D5CA 1R5LA 4MEXF 1QHGA 1T3JA 3KP6A 4RAZA 4A2UA 3L2RA 1M1JA 2P6SA 2XF6A 3LIDA 3S3OA 3WTVC 2PX9A 1X2MA 2EFQA 2XV5A 1BBYA 2Y0SA 5E8IA 5E18F 2ZO4A 2O3JA 3ITKA 1UHSA 3C1DA 3QP5A 1KB9I 3P8MC 4RGXA 1X1CA 1WRJA 3CTVA 5CBOA 2BY0A 4U87A 5C4XJ 4QTRA 5AIQA 2BZTA 2P0WA 3ASNH 1JY3P 3FXEA 4ASVA 1GTWA 1VF9A 5D5UB 1D5VA 1VQ9P 1FIPA 1VQNI 3HSRA 2MJZA 2TRTA 2SPZA 4LLHA 4PFOA 3CMAP 1N1GA 3QPSA 5IT3A 1ZG5A 1F0YA 1E5WA 2J5UA 5E79H 5AVZB 2QVOA 3RK2D 2QJKB 2H8RA 4EJWA 4RGRA 4A3KJ 4A3FJ 1RHZB 4F7ZA 3AG4H 2EIJH 4JF7A 2CW8A 3KEOA 1GVJA 1YW7A 2VBYA 1VF5C 4GDOA 2FFDB 3PM1A 3I55P 4Y99C 3ZXSA 4A5NA 4BJ5C 4F91B 5J4YA 1GL2A 2DW3A 3WE2A 1B59A 2IGNA 3S32A 3LA7A 3PSFA 1DD4A 3L9FA 5F27A 3V6IA 2M30A 2A6HF 2F6CA 4XM3A 1J1EC 4DW6A 3I0TA 4B1RA 4YIRX 3OYJA 2DPDA 1EH6A 1HBWA 2RKHA 1T3UA 4RESB 4XRMA 4B4CA 4PGGA 3J80Z 1NTMG 5JLXA 2O9LA 4A3JJ 5AW6B 4B3XA 2ZT9C 2CSOA 2GXBA 2FY8A 4P96A 3RZOJ 3ROUA 1F5TA 2JJ7A 1JKPC 2HDDA 2IBZD 1JMBA 1HVVA 1WGXA 2JVGA 2IZ0A 3EWKA 3PUBA 2V9PA 1WQ2A 1MMAA 3RKWA 4BEHA 2PI0A 1IDYA 1ZLJA 2BCCG 4PJMA 4NQWA 2A45G 1RF0C 2A69F 1TL8A 1RF1A 2E42A 1FZPB 2EQRA 2E5TA 2LVSA 2WSFH 2QA4I 5M5WJ 3BJAA 2PMZA 4PJLA 2P5KA 2L02A 4C2TA 2XUBA 4FISA 3J7AO 2LP0A 5CKTA 1OCZH 2YX7A 5CQGA 2AXCA 3H5NA 4MFDA 5IP9J 1MSFC 2IPQX 3CP8A 3KFWX 5GP9A 2J5OA 3M4OJ 2ID6A 3BRTB 3C9IA 1P84D 1Z56A 2FYUK 3HOYJ 1MMGA 4NC8A 1T33A 2K9MA 3I5CA 1IW7F 3FK7A 3CC2P 2DCEA 2Q2EA 4GXOA 4KT6A 2DOEA 1JM0A 1J2JB 5HNFA 4HB1A 1T0FA 2QENA 1SQPJ 1ACIA 4BE2A 3KEYA 4BE0A 3TYYA 4HLYA 3VYIA 3ZCOA 2JO1A 2MFZA 4EJUA 5A9RA 3OR2C 2E2HJ 5EEHA 1LWUB 3SWKA 3BZCA 1LTTC 2JSCA 1IRZA 3L73G 5AVTB 4I6MC 3FMSA 5DYMA 2PLYA 1HGZA 3ZMTA 2GA1A 2IA2A 3U9GA 4D6TJ 2ACJA 5ILVA 4LG0B 5L3CA 1BI3A 2C0XA 2MG4A 4H13D 4ENKA 3F8MA 2ZFCA 2XNDH 4DOJA 1X19A 4A69C 3K1NA 1T8IA 1FZFA 4A6EA 3Q5SA 2ZYDA 4K3AA 2OYIB 2W8ZA 4LITA 2F4MB 4C30A 2JJLA 4IFMA 4L5EA 1XPXA 1XS9A 3VYTB 1N2DC 3QPTA 3AE4C 1YX5A 3HTUA 3FM3A 4LC1A 1AQ5A 4A5MA 3ZN1A 4BQNA 1CZQA 2J58A 4HF1A 3HEFA 3DU5A 4B3AA 5TJHA 5F08A 4CZZA 2H43A 5B1AH 2EK5A 2MABA 2IRFG 2WSCJ 1PGJA 1TQPA 5F1JA 1NTZG 2Z5IA 3HKZN 4PGHA 4HF0A 1SQQE 4DCKA 2D2WA 4H0LC 1WFXA 1B4AA 1EC5A 1EXJA 2XGEA 1Q1VA 4B3JA 3H1LG 2L01A 3MN2A 1IG7A 2YNYA 1FZEA 3W67A 2P58A 1PP9J 4XA4A 1TWGJ 1FAVA 1JO5A 2E5NA 1A02J 4RB1A 1YG2A 3F0CA 4IX7A 2L7KA 4B3HA 3MP7B 1ZQ3P 5KKZC 4XONA 3JRCA 1LT9B 4JYKA 3OS2A 4DBRA 5KLVE 2E1MB 2X9DA 3H2ZA 1OXZA 4KICA 3LSKA 3GVAA 4IOAF 1G1JA 4D5FA 2CJJA 4NNJA 2KS1B 2DTZA 1S5LE 2X1DA 1ZARA 1ZAOA 3CD6P 2YKPA 3C2GA 2LLKA 1Y1WJ 2L91A 1JUMA 4AUWA 1N8RQ 2ECCA 2JSPA 4HX8A 3DKYA 1AKHA 3OYDA 2UZKA 1U5TA 2HYJA 4BGDA 3OYHA 1JCCA 4PV1D 4IHYA 3CCQI 3I4NJ 1BE3G 5EFWB 3V4QA 1YJ9P 1NK2P 1U8BA 5FJ8J 2QG4A 5B5EE 1QO0D 2DO7A 2M8EA 2X6OA 3LSJA 3G9RA 1OMIA 4G7HF 1YIJI 2LXBA 1FZCA 4II3A 2C6YA 2ZXXA 2N1TD 2R7QA 2ZAEB 4I76A 3CXHI 1M66A 4WXCA 2LKSA 3ZR8X 2A5YB 1K4SA 1W36D 4ASNA 2M5AA 2OTLI 3IWZA 3K1PA 1G4DA 1D0XA 3NQOA 2WTBA 2YKQA 4HKZH 4JBZA 3QYBA 1GLNA 1UHWA 2O03A 5D6EA 3CC2I 5EZGA 3ABUA 2QJKC 3F22A 1JUSA 3PFIA 1FTZA 1SQXJ 1BCCG 1NAYA 1LTJA 4OIOF 4O3MA 2DFIA 3D0SA 1OVRA 1PPJE 1IGNA 2KL4A 4YPCA 2ZFWA 3FXJA 4PV1B 3BTIA 1YQ3C 2HFED 4OVNF 2NVTJ 2IBZE 3J7AY 4A3MJ 3OYEA 3L72G 3GFJA 5GAHJ 1NTCA 5E3LA 2N9YB 4IL6E 3P9IA 4M3LA 5GTIE 1S5LC 2NPSB 2BYVE 3V8LA 1U8RA 1S72I 3HOXJ 3AECC 3JTGA 2HQNA 2KJBA 1JE8A 3C2BA 2W84A 3I3LA 1KZUB 5ICGA 3K6JA 2L2OA 1DQUA 1R00A 2CS3A 2KK7A 3RK2C 1RESA 3TL4X 1OYWA 3DLLF 1N73B 2WB1N 2QRXA 3KQGA 1K61A 5B5EC 5EYRA 2ZJSE 3H9GA 5LHGA 1T6SA 3CF5F 2K9JB 2WPSA 3EYIA 2WSEH 4MTEA 2H6BA 2KFDA 5D4RA 1X0VA 3K4NA 4JQ0D 4U3FG 5J3LA 1P84E 2IA0A 2C0WA 3CWBG 3BR0A 1TW3A 4PJ0E 4U7DA 3CTAA 1ZN2A 2F4OB 4D7NA 2XKPA 1BSNA 3RCOA 4AIDA 1URQD 5HS9A 1HF9A 3CJQB 3K0LA 3H1LD 2QYTA 2KZVA 1ZRFA 3GEZA 4RB3C 2OJED 2KIQA 2VXDA 3GZNB 3AE6C 4GO1A 4HX4A 3FBNB 3HRNA 2DT7B 1QQIA 2QSGX 1IFMA 3V2PA 2XAJA 3RKXA 3HB9A 2HPCA 1NVOA 4A0XA 1IRXA 1TWFJ 4HNUA 1ZGWA 2E7XA 2KKOA 3PNYA 5K7FA 4JYCA 4HRIA 3HTKB 2NVXJ 2RAEA 2ZNYA 4IL6C 3WTYC 4FETA 5GTIC 3ABTA 1BJZA 3SSUA 4RDUA 1DP3A 1DD3A 2IGOA 3G1OA 4A3BJ 3FBIB 4NPFX 3VMYA 2IAIA 3HUGB 3PEFA 2K9QA 2P7VB 1LNQA 4G94A 3WU2E 1CF7A 4A0ZA 4S05A 5A9SB 1KFNA 2KIKA 1ZRDA 1PVEA 2ISYA 5IOYA 3O6QA 1VQKP 3P8CD 1Q86Q 3H32A 1XGOA 4CCJA 3CD6I 1KORA 1X3WB 4I2OA 2QBYB 2HODB 3GX4X 2FMYA 3V2NA 3HOSA 2OA4A 4I0AA 1GUUA 3PLRA 3FHNA 1F43A 4QSHA 5FKOA 3L75D 2WPQA 4MGRA 4KIFA 3IH3A 1YJ9I 1K78A 4PJ0C 1XCVA 1Q7YQ 3GTLJ 5DCMA 5ED4A 3R0JA 4MHGA 1RQUA 1VI0A 4IFDK 3ELKA 2Q6QA 4R4LA 3W6JB 5LGTA 3MTUE 1N7SA 5C39A 2QJPB 1S5LH 4ZDLA 1KTMA 5LD2C 3REOA 2O01N 2DXIA 2OFPA 3Q5RA 4LMYA 1FDMA 2W1OA 4YFKF 1QHHD 3H0DA 2Q1KA 1S6LA 2WSCH 3BPXA 1HSJA 1Q2NA 2BASA 3Q5PA 2A5WA 2ADUA 5E20A 2IW5A 3GZ6A 3F72A 3W2AA 2LK2A 3GHGC 1Z7UA 3EDPA 4HNVA 2DTRA 4PZDA 5B5EH 1EZVG 4XE5B 2OF7A 3FX0A 4XRFA 1KZHA 3GTJJ 3PLNA 3D5SC 1NHAA 3S2HJ 3B4SA 2VL8A 1CSBA 3DWLE 2O1JA 2CQ7A 1FEXA 3IQDB 2X85A 4KJMA 3GMEA 4H13C 3BJ6A 1T98A 3HPGA 5BU8B 1ZK8A 3WU2C 2AHQA 3C1LA 2PGDA 1ZLLA 3MKYB 1HW2A 1R23A 4WY4D 2B87B 4HSTA 2XPVA 2PFXA 3PL8A 2LKXA 2OUMA 1BIBA 2QSHX 3RK3D 2R0QC 5BOXA 1V4RA 3H25A 4IHSA 4DJGA 2Z5UA 2MA3A 1FMVA 3CL3D 3DEUA 1GV2A 3M7GA 1RUNA 3GHYA 4CYCB 2FXAA 1F12A 4GOFA 3G6EP 3W6KB 2E1OA 1MNMC 4L5JA 3ML6A 3B5NA 4U3FD 3TMOA 1URQA 3I83A 1BDCA 2D2CD 4D9JA 3VWBA 2HOEA 2YS9A 5EEGA 3A2KA 1KILB 1LP1B 4IL6H 4E7HA 5GTIH 4N4OB 5E3OA 1L0ND 4CPGA 1IFNA 1FJKA 4Z2YA 4PJJA 2FYUJ 2L7ZA 2Y48A 2W90A 4HW0A 1PUFA 1MDMA 2O01H 2IA1A 2XRNA 3BZ6A 1B6AA 2JK3A 3CLQA 1ZKGA 4IHTA 4DYDA 3JCUE 3L71G 1R58A 3DBLB 1T38A 2OZUA 1JDJA 3MKLA 4HV5A 5DS9A 3FDYA 3TGUJ 2L9SA 3ADOA 1BGYG 5IPAA 2FE3A 2VIXA 3KETA 2XF5A 4I2LC 3H1IJ 1O7LA 1FIAA 1RNLA 3AG1H 4M6XA 3P7NA 5CVUA 2VUMJ 1LE8A 4ZYHA 1RZ4A 1Z6TA 3V7CA 2HFHA 2NVYJ 3ZN0A 1WRGA 3TSIA 1Y8QB 3OYCA 1P84H 3PIPF 2QJYB 4RKUJ 2V7FA 2P5VA 5AVYB 3WGGA 3HDDA 2XU6A 4PJ0H 4CCOA 4IOIH 3H6PA 4JK1X 3BQYA 3WG9A 5IP6A 5IYDJ 2DDAA 1ULYA 3WUTA 2G3AA 3CUQB 2COMA 1KYOD 5KLIB 1VL2A 1SVMA 4Y28J 5J8CA 1X0XA 1FU1A 3HD7D 5AVWB 2ZJ2A 1DGRM 4OGQB 4FX0A 2K27A 1I3QJ 3BR3A 1NTKD 2R7RA 4PV1C 5CJ9A 2HYFA 1D0YA 2FOWA 2EJRA 2I5UA 3FZVA 4GYIA 3SEQA 2J59M 3BCCG 2OYHB 2LDUA 4EIJA 1LUJB 5AW5B 3K7AJ 1ZMEC 5D8LB 2VBWA 1S2EA 1VQKI 1SC7A 3E6BA 4FTHA 3CCMI 4E7IA 1OW7A 3H1JG 2N1TC 2VODA 3HUSC 2IGMA 2PQ8A 3FR8A 4DT0A 5FKMA 1FC3A 4BHPA 1LSOA 3FISA 2VBXA 2LH9A 3WTTC 3JCUC 3MFKA 4YIFA 2ZJRF 3MOGA 3WU2H 4L9VA 5J1UA 3RYPA 3H1LE 1Y8RB 3QYFA 1ZHFA 1Q90D 4CICA 4C7NB 3HRMA 4J01A 1FY7A 4MEYF 5FKNA 3L70J 1KYWA 3TO6A 3S4RA 4AYBA 2HYNA 2EZHA 4CHUA 1YRNB 2C9NY 2EIMH 3OYIA 1PZQA 3USSA 3HOWJ 4CCMA 1FDOA 1ZXGA 2FQ4A 2M7AA 3PSIA 1X2NA 1MFTA 3BWGA 4G6QA 4AC0A 2HS5A 3WFIA 4WY4A 2H09A 4EJTA 1J0RA 1R1TA 1BG6A 2K1AA 3OMYA 5CCGD 1OCOH 4AU7A 1MJAA 2DLLA 4R1NA 5LRSA 2V1UA 5TISE 1SQPK 1K05A 1O57A 3H1KJ 1V3FA 2Q3IA 4F3QA 4JX5A 5LEJA 5EGOB 1W2BO 2KLUA 3A5TA 5MGBA 1I6XA 4KN7X 3LQQA 2DT5A 4GDFA 3P8CE 1GV5A 4F93B 1PIXA 2LR2A 3FXMA 2CW0F 3IP4B 3GTOJ 3W6ZA 2ZNZA 4LD5A 5EG0A 3LIEA 3PJSK 1S29A 3NTNA 1QZZA 1KMIZ 4A3CJ 3L75E 5BU5A 5FD5A 3WTXC 4EJVA 2YSRA 2DA6A 3KYLA 3ZHBA 3ZQQA 4XSZF 2MKVA 5GTHC 1ETKA 1IN6A 2R5BA 1SANA 1L0LG 4HX7A 3HG9A 4XL9A 1URQC 1JY2O 2OU2A 2XAQA 3ZQLA 3FMQA 2OQQA 3PIOF 3FXQA 1VQMI 4HV6A 2DA1A 3BDDA 1VQPP 4J00A 4C2UA 1JY2N 4G12A 2DMPA 1L4AB 2YXQB 1P9QC 3TDKA 3GTMJ 3KDPB 4NUBA 4XIDA 3CCVP 2E60A 1B72A 1SEUA 1KILE 4P9UA 1BA5A 3L72E 2ZMEC 3E97A 3DV8A 2FYNC 2QJPC 3F6VA 3V2RA 1G3SA 5JE8A 4HSRA 5TISC 5FLMJ 3VYUB 1DIPA 2M4GA 3LMMA 3ZPLA 1Y9BA 1R7JA 2VJJA 2OTJP 1JTYA 2PJRA 2CPBA 3JCUH 3HM5A 2YMYA 1ETXA 1BR4A 1YJQA 2R3SA 4PSXA 4OINF 3GUDA 1NU1G 2V7QH 1KN7A 2E75D 1B8IA 1QPMA 3RK3E 4O5VA 3S3MA 3W2VA 3PQKA 1USTA 4ON0A 1D1CA 1QMGA 1CI6A 4U3FE 3H1JD 4HJGH 3AL0B 4A6DA 3D5RC 1XGSA 2XGCA 2WSFJ 1SFEA 2K9LA 1YJWI 3K5BA 1LDDA 3E7LA 1NTKJ 3LSGA 1IFIA 3OOPA 1L0NE 4HG2A 1YB4A 2JWDA 3Q3SA 5AW0B 2PN6A 1WVRA 2GXGA 2R7OA 4FT8A 2QSIA 5APWA 3DU6A 1D3YA 3ADPA 2NRGA 3LW5H 6PAXA 2Z1DA 2JA6J 1OFCX 2M0BA 5BS6A 1A31A 2QM3A 2PLAA 2VE8A 4DLLA 4BH9A 1HOMA 1OIPA 1S9KD 3CCLI 3WHBA 3AG2H 5CCGA 3F3XA 1W7PD 3L74J 5DDGA 1XTCC 5AYVA 2X0LA 5FGMA 1YVEI 1TQIA 1Z3YA 2CWEA 3D1NI 2OYOA 5EZHA 2QQAA 1TNSA 2KRHA 2A06G 2K3RA 1QLED 1N7LA 4LLNA 3QOPA 1L3LA 1HCRA 1TWCJ 2FBWC 4B8XA 2UV1A 2QCOA 4B47A 1FOXA 2IBZI 3F3SA 2H1KA 1SQXK 2KIUA 1VFCA 1GHCA 1OX3A 1KYOE 1MZ9A 4WY4C 3TNUB 2L4AA 1HKSA 2GOMA 2EZIA 2LYCA 3Q0VA 3CCUP 4ZNCA 2R5ZB 2UXNA 3RK3C 1NTKE 3LOCA 3BG9A 1Z67A 3ERMA 3DLAA 3R6SA 4RB0A 2QGUA 2I10A 4CUGA 4N78D 1SFCB 3E0JB 2F4IA 3SDBA 2D2CC 3D71A 2D3TA 1OW8A 1WDMA 1ZOYC 1FBMA 1L0LD 1ETQA 2K4BA 4KDPA 1Y47A 4XICA 3C7JA 1LKXA 2QA4P 1AVYA 3JSOA 2P2UA 5AVUB 2DN0A 1K6OA 5TISH 1ETYA 1ENHA 3HOUJ 2M8GX 2W48A 3MAJA 5HWSA 2IJLA 1ETVA 3M9BA 4M9XA 2K88A 3S93A 4XN0A 1M1JB 3L6DA 2JDIH 2X6WA 3BQZA 3GBGA 1NG7A 1X8YA 5ICEA 3A01A 3A03A 1A35A 4U0YA 3CCRP 5CHXA 1D0ZA 3ZMUA 1IFPA 1V5EA 5CJ0A 1KU9A 3VSKA 4NC7A 2L0KA 4RB2C 2EV0A 5JR3A 3KE2A 4CZCA 4RM3A 4OQZA 4W97A 3MEXA 3GLMA 1HJBA 3TW6A 1OPCA 4BY7J 2F5EA 4GIFA 1R71A 1UIIA 1UHMA 1GU4A 1SQQD 3CMYA 4II2A 1NYHA 1FJPA 1LFBA 1IZNB 2XDJA 2YIUC 3HD7C 1R6RA 4BJ6C 2W82A 2BW3A 1H0TA 2JA2A 2ZSHB 3KLNA 4S0HB 2R5YA 2KZJA 2LSOA 3AEBC 2FXPA 1FP1D 2W24A 2ETHA 2Z3YA 1AU7A 1JTHA 3H1HG 1WJEA 4BS9A 3HKZA 4CCLA 2TCTA 4CGZA 3BP8A 1K79A 3Q0WA 1V54H 3FGAD 4HNTA 3ZQ7A 5APYA 3X2QH 5KLVD 3P32A 4GOEA 4G8XA 5HLGA 2XV4S 4YCAA 3BOQA 1SAXA 2YPRA 1ZELA 2X51A 4WCGA 4HYTB 4HEA2 4EQQA 2XROA 1FOKA 3ZGYA 3HDHA 4OOIA 4RAFA 4PD4D 1W7PA 3QOEA 3IN6A 1F36A 5FRNA 1MBKA 2LBFA 1UMQA 3I4MJ 3OL4A 2HOSA 1DGWY 1RF1B 1YTYA 4NQWB 1L0OC 4BHCA 3WTWC 1WZ2A 3KEQA 5H20A 3G73A 4LFUA 1OVUA 4WWIA 3OSFA 3DTIA 2Y0MA 1A6IA 3OY9A 2JWAA 2HOAA 3HSEA 3B71A 1SD7A 2DAOA 4RM2A 1T95A 5CCGC 2GAUA 2HPIA 3HHGA 1M8OB 4LK0F 5AW8B 2JP3A 3E5QA 3GLLA 4FQGA 2KRCA 3SFIA 3GW6A 1MD0A 5FLXK 2ITAA 2K85A 1JJ6C 3V5BA 3GZ5A 3VMXA 4I98B 3ZOBA 3IC7A 1BI0A 3CCUI 2FMLA 2KISA 1M75A 1H88A 2Q2EB 2E76B 2FQ3A 2DFHA 3I59B 3RKYA 5EEAA 3AE7C 1YIOA 3M07A 4AVZA 3H1JE 3HRTA 2AS5F 1FJLA 3TO7A 3DPTA 5FKKA 4DNCA 2M3BA 2XKOA 3WMM0 1FT9A 3ABKH 3SFZA 1IXSB 1K04A 3HE5A 1RC9A 4XN3A 2OBPA 1TC3C 4E70A 5GAGJ 1KYOH 2OQGA 1DU6A 1YITP 4OMZA 3CCQP 2WSEJ 4H44B 1VQOI 2D1HA 3KP2A 2EV5A 2PBIA 4Q48A 2VKDA 3ZMZA 2W7NA 2NXNB 1J1DC 4RO0A 3DTKA 1S9KE 5FFZA 3K96A 4XLNF 3RQSA 5AW7B 1SQVD 1YIJP 3HOVJ 2RQQA 2OARA 3CCRI 4M71A 2AEMA 1P6RA 5M5XJ 1I6HJ 1HXDA 2WB1A 2OTLP 2MC4A 1MMDA 2Y9YA 1P2FA 1HC8A 2W57A 3C8VA 2F5DA 1MIJA 2DMNA 5AVVB 4N4NB 2NS7A 2CV1A 3BCBA 1FX7A 3W68A 3EGOA 3RGUA 1M1EB 1OYYA 3BG7A 3DFUA 2E74B 2E75C 2HQAA 2FEZA 1J7KA 1OCCH 3DPUA 2FFDA 3H1HD 2IS4A 3ABLH 2HGCA 4L75A 1YS7A 2R32A 2WBMA 1BOAA 2AQFA 2CW7A 2PP6A 1G3YA 3GFMA 1FLIA 4N78E 5L8RJ 4BHBA 4LB6B 1SQQJ 2KRFA 1QVFO 2K86A 4Y13A 4GKGA 2EFPA 1WDKA 4GWGA 3KZZA 1PYVA 4UUVA 1S72P 2EH3A 1L0LE 3IAOA 3SFDC 4KITB 2NNYA 3C7AA 3EFGA 2B88A 2OCCH 4HA8A 5M3MJ 4JP0A 2L3DA 1LT1A 4QPOA 3AE9C 1H8AA 5IP7J 1QU3A 3ONQA 3AFHA 4JQFA 4LOCA 1R22A 2RC4A 1GVDA 2XGXA 2R92J 4M9SA 5K7HA 2NOGA 3J81K 3OBBA 2LKMA 5KLVJ 4B48A 1XTGB 4DZPA 2JPCA 1AWCA 3SEZA 4UV8A 4C3JJ 1P4WA 2JRMA 3EUKL 4UUSA 3EQLF 2YX4A 4XMYA 3BTLA 3A0HE 2BXYA 4ZC3A 1ZRTD 1BIAA 1SQBG 2L7MP 2AQEA 4DGWB 1MUUA 1AKHB 3QHAA 1U5TB 1KU7A 5CLSA 2H27A 1QA6A 1GXQA 2XAFA 4UUTA 2ZJPF 4C3HJ 4UNOA 2AXTE 5HDGA 2FJ1A 1NU1E 1XMKA 3OIOA 1H89C 1WJAA 4KUGA 4MNUA 1WSUA 1E17A 1FZCB 3LSRA 1NTMD 1G6NA 2ELHA 2DFFA 5APQA 2MSYA 1FBSA 2D1VA 3AEAC 3VB2A 2AO9A 2WY8Q 3NARA 1YONA 2XB5A 4HOBA 3VODA 2M5AB 1JKOC 4Z1MH 2B7EA 1N25A 2KP6A 1W0UA 4FGWA 3IF4A 3TOAA 3T1BA 3DEEA 4QLCU 3K4LA 2CV2A 2JA5J 3FX3A 1EH7A 4YFXF 4XOPA 1HSTA 1H88C 4LB5A 1B1BA 3OS1A 1LTJB 2BCCD 4Q5SF 5CMZA 3MKZA 4FASD 1LWUA 1IV6A 1JKRC 2KZGA 4RLFA 2GXAA 4PD4E 2WQYC 3RL0B 3TDUC 3U1KA 2FF4A 2M45A 2OPTA 1S7EA 4D3DA 2F5CA 2GWRA 5JLWA 4R79A 2LKPA 4LG0A 5E17F 4FX4A 1YITI 1AVOA 2CQNA 1WWXA 3ISPA 1MNDA 1AA0A 3E1RA 3AE3C 2PMHA 4HLXA 3A0HC 1IO4A 1NWQA 2O01J 2B63J 3WTZA 2NZ2A 4IQ4A 1TWHJ 1M7LA 2E7WA 2HVQA 2NPSD 3VMAA 5BQTA 2HTSA 2KMUA 1USEA 5KCMA 4LLLA 2ZXHA 2AXTC 4PZCA 2XF7A 1WPKA 1S8NA 3RKQA 2V4HA 3FWLA 4U7JA 2JTVA 1FOWA 2GIVA 2FD5A 1FNNA 2LG4A 1KONA 5BPDA 5KK1A 3GHGA 4L76A 3CF2A 3G0OA 1VQ4P 3HGYA 3V42A 2VJ4A 3PO3J 1Q82Q 2VQLA 1DEBA 1L0NK 1R4MB 3FMRA 4MQ9F 3E6MA 1R8EA 2V26A 3LSPA 2DJNA 4KJZA 2M1BA 2IYOA 1UB9A 2KHMA 2FFDC 1ON2A 2ME6A 1MMNA 2YMKA 5F0CA 2AEFA 2FKWB 1M57D 3L73D 3C7CB 3M8JA 4BXXJ 2HXIA 3VSLA 1G3TA 1SMYF 2P6TA 3D1LA 2KNCA 1X58A 3J7YJ 2UWMA 2COBA 2FNPA 3AEEC 3L70G 3S8PA 3TOBA 3PTZA 4PCQA 2P7CB 3G17A 2HPCB 2HU9A 5D5WB 3BT9A 3H35A 4Y7NJ 4M3GA 2QEXP 3HRSA 2CU7A 4OIRF 4Q47A 1I27A 2BVMA 3FHZA 2WWYA 1P7IA 1H8AC 4IL6X 1WMKA 2E1NA 5FFXA 2K9NA 5K1YA 4JX6A 5DUIA 2KS1A 2EILH 4L9NA 3NXSA 2FU4A 3RTRA 1WJ5A 2BVLA 5KNLA 2VE9A 4N9HA 2IP2A 4IEJA 2MH9A 2V6EA 1SQVE 3H1KG 3JREA 2VJIA 2BXZA 3LFUA 1SQBD 3ABVC 1MH3A 2VOPA 1NTKK 1R4NB 4WVZA 1ZH5A 2R7DA 2KLOA 1Y0NA 1ITYA 4IHXA 4BNCA 2IBDA 1NTZD 1ZW0A 5AW1B 3H32B 4BRYB 2Y75A 4WX9A 1YRLA 3DEWA 2P81A 4BBSJ 1R49A 3V2QA 3VP9A 3IAS2 3FKIJ 3WHCA 2F2EA 1A6QA 3H1HE 3JRAA 2DDBA 3LNQA 4M3FA 1O3SA 5B1BH 2R7XA 5DCMB 1KYOI 1RE4A 2IPPA 2E34A 1DDNA 1MMSA 3PNTA 2RDPA 1N7SB 3HN2A 3C7DB 2H88C 3AEGC 1Z1DA 3S1MJ 3A0HH 3MQ0A 4CSWA 4S04A 1G1IA 3DOJA 3V4GA 5DD8A 1NKZB 2PRRA 1NKNA 2JRTA 2E1CA 4JOMA 5ICCA 5A9TA 2DQRA 3QPHA 2IT0A 2GBYA 3L2VA 4BUPA 4AVPA 1AHDP 1JGSA 1NTMJ 4W80A 1E3PA 1MBFA 2AXTH 1Z3XA 3F9KA 3R4KA 3EETA 3PH0A 2HI3A 1N86A 4MLOA 1A5JA 2BE5F 4B86A 3S1KA 3SWYA 1F4KA 4HBLA 3G3ZA 1MSEC 1OVVA 2CFXA 1LWUC 4H0EA 4GODA 1BE3D 2R44A 3A0BE 1BM9A 2NPSA 3H5RA 3IL2A 3I54A 3R0AA 2N1TA 3HUSA 3E6DA 3Q9VA 3CCMP 5HODA 1NHLA 3GMAA 1VQ5P 2M4KA 2HQ5A 3FXUA 3GCMA 3GWZA 5C3EJ 3T8RA 3MHVA 5LGNA 5M1BA 2LFBA 1ZRTE 2EB7A 3QU3A 4R1HA 3E6CC 1DLJA 4ZZDA 1WH7A 3AG3H 1LTAC 4KFCA 2V1XA 5DM7F 2QM7A 1WH5A 3CDIA 2JA8J 3S1RJ 3PRJA 2OYIC 3GF2A 1K9MQ 4PD4H 1T2KD 2K40A 3NRVA 5M3FJ 3F21A 1BCCD 3B5NB 5E3NA 1RKTA 2MYSA 5IOZA 2DK8A 4GGGA 4KT5C 1IV8A 2VQGA 3ZMSA 3AAFA 2HVSA 1NTME 4YTPC 3NEUA 2W00A 4ZTFA 4B09A 1TW2A 4L0ZB 1JT6A 1VQ4I 2O61A 1WPQA 4OIPF 3FXKA 2XVCA 3ZGKA 2VQCA 2W85A 1IL0A 1ZN5A 3L09A 5TGTA 1KILD 1SS1A 3JSVC 3L72D 4NPDA 4I7ZB 5F0FA 1HGVA 2V7QJ 3L2QA 1NGMB 3S15J 2A6EF 3CUOA 2BCCE 1AOYA 2X48A 3BATA 3HRUA 3BG5A 4M72A 4EJOA 4M3DA 3S1QJ 2RMZA 3O8ZA 2LD5A 2E43A 3LFKA 3RYRA 1LE8B 2KI7B 4OAYA 2Z5HA 2KZIA 4MTDA 3H9QA 2ZVOB 3A0BC 3JTHA 1LB2A 2Q1ZB 4XRSG 3HSFA 3CX5D 1LT9C 2QEXI 1FYLA 3FK6A 1TT5B 4EM1A 1M56D 2P67A 4XFJA 1GD2E 1XDUA 2E1MC 3GTQJ 5KVRA 2HDCA 5J47A 3AEDC 5A9SA 2DT6A 2H6CA 3C3WA 4LK1F 4OL9A 2FNAA 4XLCA 3CWBD 3RPUD 1R1UA 3OYNA 4IF4A 5K5QA 1YJNI 3LW5J 3TK1A 4AWXB 1SMTA 4BQOA 2QBYA 3CCSI 4XBFA 4EVIA 2HODA 1VQMP 2LF7A 1X4OA 2P5LC 1GXPA 4L74A 3RQIA 3ZQHA 1YYCA 2I8DA 4OGQD 4LGWA 3ABMH 2ZCWA 2JMWA 3H0GJ 2CUEA 4QIWN 2IDBA 5APTA 3IH2A 3IR9A 4PDKA 2NRAC 3P9KA 4RAGA 4UB8H 3OYLA 1OLTA 4IHWA 3EFFK 4I1LA 2ZMEA 4Q4ZF 1PPJG 2JT1A 5KHDA 3Q3CA 4Y52J 1MW7A 2EWNA 4IZZA 3L73E 5DV5A 4KUMA 1RE4C 3WG7H 2M34A 3WFJA 3H1LJ 1RETA 3ZWAA 1F9NA 4WK8F 2WAEA 2QQ9A 5F1RA 1FS0E 2BEZF 2E19A 3LL7A 1OKRA 4NB5A 3LWFA 3HADA 2DJIA 3E5XA 3B8EB 4IJAA 3D70A 4EDFA 1J5YA 4A3DJ 2YR2A 1KS9A 3ZW9A 1LJ8A 1OCPA 2CRGA 4LLGF 5JHFA 1BL0A 5E3MA 3HE4A 2O0YA 3CO7C 4WBAA 2DBBA 3J7ZI 1SVFA 3CJTB 1IZ1A 2GOXB 1Z7LA 1BC8C 4EMSA 1UAAA 2K5CA 1BC7C 2YKOA 4DYRA 3OW2O 4ZJZA 2EW2A 1YJWP 1K83J 3SZGA 4I7HA 2BV6A 1SQBE 2ELKA 1T2KA 4XKVA 2NPSC 4GT1A 5HLTA 3OV8A 1FYMA 3RDIA 3N7NA 1VQ5I 1AQTA 3I64A 1NTZE 3IH4A 1VQ7I 3TO9A 2XDVA 4NBQA 4CYCA 5LHIA 1WI9A 1J9IA 1LTBC 3SZTA 3RSNA 2VPRA 1HLVA 2VB6A 1DU0A 1PUEE 1N73C 4IO9F 1KILA 3L75J 3CCLP 1LP1A 2DA7A 3A0BH 3DPLC 4U88A 4I0BA 2QE7H 4HH2A 2DI3A 1VNDA 3LQRA 2R7VA 2R3CA 4OMYA 3CQZJ 4CYDA 1EZVD 5D5XB 1AV1A 4A93J 2XB0X 3VFZA 2Y69H 3GF3A 2VXZA 4I09A 2ESHA 1D7MA 5E1ZB 5ILSA 3G71I 4XOTA 1BCCJ 2W6BA 2IFMA 1OISA 2XGDA 2DU9A 5DD4A 3RIRA 3NFQA 5LBQA 1XSXA 3L2UA 4XKCA 1SVLA 2RQPA 1Z82A 4G6TB 1MJBA 4EATA 4B43A 3K9TA 2KXPB 1L4AD 2ELJA 1S7AA 2QKMB 1B72B 3L2WA 3L7WA 3GTGJ 1IN4A 2JPBA 3L72J 5LFAA 3B02A 4C3IJ 4EM2A 3OJAB 1BE3E 3LA2A 2HTJA 1YW8A 4BQAA 1SQQK 2WY7Q 3BTCA 3CUQA 4HF2A 3PFYA 1XC5A 2CPSA 2P10A 1JEKA 4MQVA 4XQFA 2EFWA 2DW4A 3KXDA 3MCZA 3F5HA 2NOJB 3QH9A 1S9HA 1VQ8P 4PZEA 1WI3A 1N78A 2K4JA 4HPQA 3WUUA 1U78A 3P7KA 2MC3A 2TDXA 2OYHA 2K02A 1HF0A 1B8IB 2A45H 2PMUA 5APSA 1T56A 1RE3C 4BY1J 1YQ4C 3LSMA 1IJWC 4RGUA 2ZVNB 3L71D 5KLVK 1CI6B 2HQRA 4U3FJ 1BCCE 3KYDB 2M0CA 1BGYD 5F0HA 4E7JA 3K10A 1UJ8A 5D5VB 2FBHA 5J6XA 3W2WA 2K9SA 1PPJD 3BC8A 3M91A 2OQRA 3HC7A 1XX5A 1L0NJ 4FHTA 2HDWA 2ZKZA 2ZXIA 2DMUA 2DMTA 2W25A 3T8TA 1Y1VJ 1S7OA 5LHHA 1MV8A 1R5HA 4KISA 4C7NA 1P4XA 5K5OA 2HKOA 4BQQA 4IFFA 3HD7A 1UIXA 3V8JA 1XG1A 1JXSA 1VF5B 2V9VA 2HWVA 1RRJA 4HQMA 3FWNA 1RY3A 4Y99B 3CPWO 2G7UA 5HDNA 2Y9ZA 1V5GA 3HGGA 2L5GB 3E5UA 1LPQA 1O7FA 1QNTA 4XK4A 5F04A 1KU3A 3BCCD 1MBEA 4E4HA 5FRMA 1M67A 3OYAA 2JVHA 3KX2A 1N77A 2DPUA 1J1EB 2OGUA 4RBOA 4PD4I 2KDOA 3AE8C 2A07F 4G9YA 4TT3H 1IDZA 2HZTA 3OYFA 2IFNA 1GDTA 2GQQA 4UVAA 4K35A 3F8FA 5D6FA 3S16J 1JCDA 1SQPG 2QM8A 2ZT9B 1MBHA 3CWBE 2G0EA 2KIMA 5AVQB 3U1AA 1Z0XA 2LOOA 3CCEI 1XCBA 2DQLA 5CVJA 1X0TA 3PDUA 2K3FA 2KLVA 1JY3O 3JAMK 1JJ8C 2GA2A 1T2KC 2EV6A 3OR1C 4L0YB 1DX7A 4AUXA 1YI2I 1W5CE 2Y31A 5J8FA 3RBXA 1JY3N 2M9HA 2Q0OA 1CGPA 1I36A 1SFCD 1FYKA 4P5OA 1ZGJA 1PGPA 1YTZI 3ASOH 2JQ7A 4D6TG 1OYIA 2HOTA 2KQRA 1U7JA 5GPAA 1QRYA 3CKYA 2CQQA 1KILC 3BVHA 4IRIA 3WUVA 5CYVA 2QF7A 3CP2A 1WP4A 2FUG2 3TW7A 3WGIA 4L9JA 2CGPA 1L4AA 2FYZA 2IEKA 4BWNA 3SHFA 5CQEA 4AYCA 3A01B 1ZP0C 2JEEA 1T6AA 1SQVK 4H4KC 4BYYA 4U7BA 2Z33A 4F92B 3ZQCA 1Z77A 1DPUA 1OR7C 2AEJA 5APUA
chains in the Genus database with same CATH topology
9ANTA 3Q0UA 3K6JA 5M5XJ 1I6HJ 3ZQFA 2I9PA 5C44J 1RESA 2Y9YA 3IV5A 2WB1N 2L9RA 3TEDA 2O7OA 2DMNA 1K61A 3BR2A 5EYRA 1P7JA 2NS7A 5EG0B 1MBGA 1APLC 2VI6A 3EGOA 1RPWA 3DFUA 1X0VA 4JQ0D 1JTXA 5J3LA 4BKXA 2R5YB 1JKQC 3BR0A 4D7NA 4E13A 1OCTC 1F17A 4M6VA 2QYTA 4GWGA 1WDKA 3GTPJ 2EH3A 3CDLA 3CCYA 3C7AA 4FE7A 3PIDA 5M3MJ 4JP0A 3HB9A 5IP7J 2ZYAA 2E2JJ 2O8KA 4A3GJ 1TWFJ 1ZGWA 4LOCA 5K7FA 1GVDA 4M3BA 2R92J 2P4QA 3B6AA 2NOGA 2RAEA 5K7HA 2NVXJ 3OBBA 4DZPA 1BJZA 4RDUA 2VKVA 1CQTA 1EF4A 5DTDA 4C3JJ 2CQXA 3G1OA 4A3BJ 2IAIA 1RR7A 4UUSA 2K9QA 3PEFA 5A9SB 3BTLA 2WV1A 3B6CA 5IOYA 3GTKJ 1I50J 2L7MP 1AKHB 3QHAA 1NK3P 4GWKA 4UUTA 4C3HJ 2DA5A 1GUUA 2FJ1A 3PLRA 1F43A 4QSHA 3OIOA 5FKOA 1H89C 1MBJA 4KUGA 4D3SA 3IH3A 1G2HA 4JPZB 3VPRA 3HWRA 1U9NA 3LSRA 3GTLJ 1ORKA 4A3LJ 2MSYA 1VI0A 4A3EJ 1DLIA 2AO9A 2WAQN 3NARA 1YONA 2XB5A 3BR5A 1JKOC 1IC8A 1W0UA 4FGWA 4J0FA 2DMQA 2JA5J 2OFPA 3SDGA 1E3OC 1H88C 3PO2J 4EZBA 4GBJA 4I6ZA 2LK2A 1IV6A 4HNVA 1JKRC 1YRNA 4PZDA 2YUSA 2IZ1A 2OF7A 3GTJJ 5EDNA 3S2HJ 2OPTA 1S7EA 5FLVA 1BW5A 3JR9A 1ZCJA 4D3DA 1YJ8A 4D7MA 5JLWA 1FEXA 2ZB9A 3IQDB 3SJMA 2EBIA 4MO7A 3TP0A 3W6VA 1POGA 5J1RA 1ZK8A 2AHQA 2ECBA 1GT0C 1EVYA 2PGDA 5EGOA 3JRIA 2B63J 1TWHJ 3ULKA 2XPVA 2LKXA 3OSGA 4IM7A 1WDLA 2R0QC 3M3YJ 4PZCA 1WPKA 3RKQA 1GV2A 5C4JJ 3GHYA 4CYCB 2MGQA 1F12A 2E1OA 1MNMC 2FD5A 4B3IA 2ID3A 3I83A 3HBLA 3G0OA 3HGYA 2EZKA 3PO3J 2YS9A 2JWTA 1QVTA 3LSPA 1O4XA 5E3OA 2DJNA 2KT0A 2L7ZA 2IYOA 2W90A 3L1PA 1PUFA 2ME6A 3O8GA 2JK3A 5F0CA 1ZKGA 4DYDA 3C7CB 1D5YA 2E2IJ 4BXXJ 1JDJA 2HXIA 3MKLA 5DS9A 1QPIA 2HXOA 1X58A 4XRSA 2YU9J 2COBA 5IPAA 3ADOA 3JRGA 1FIAA 4J19A 3RZDJ 3G17A 2VUMJ 1QVUA 1LE8A 1PGOA 1N1EA 3BT9A 4Y7NJ 4M3GA 2NVYJ 1BW6A 2CU7A 1PGQA 1P7IA 1H8AC 3BR6A 2K9NA 3HDDA 2LTPA 4JX6A 1LSJA 3BQYA 5IP6A 5IYDJ 1IUFA 1MH4A 4IEJA 3JREA 2ME0A 4UUSB 1X0XA 1MH3A 3H3VK 2CUFA 4GFBA 3BR3A 1I3QJ 3QSGA 1ITYA 4IHXA 3BTJA 2IBDA 2NS8A 2UYYA 3K7AJ 4KUHA 2DA2A 3DEWA 2P81A 4BBRJ 1YRLA 4BBSJ 1RKWA 4C2MJ 4FTHA 3FKIJ 1TWAJ 3WHCA 3JRAA 3FR8A 3LNQA 4M3FA 5FKMA 3K2AA 1EVZA 1LSOA 4IHVA 3FISA 5FKLA 3HN2A 3MOGA 3C7DB 2LR8A 4S3MA 5J1UA 3S1MJ 3JRBA 3DOJA 1ZR2A 2NVQJ 2JN6A 5A9TA 5FKNA 2GBYA 2EZHA 1AHDP 1MBFA 4AYBN 5IYCJ 1LFUP 2GLOA 1YRNB 2HI3A 4MLOA 3HOWJ 1A5JA 2FQ4A 3S2DJ 3UKGA 1X2NA 1MSEC 4AC0A 3WFIA 4EEFG 1W0TA 1BG6A 4KUEA 3ZQIA 4R1NA 5HODA 3HOVJ 2HQ5A 4JX5A 5EGOB 4X6AJ 5C3EJ 2R5ZA 5MGBA 2LFBA 1JUPA 1DLJA 3ZW8A 1GV5A 1WH7A 4M3EA 3GTOJ 3W6ZA 1WH5A 5EG0A 4W1UA 2JA8J 3S1RJ 4OM8A 4MIMA 2LY9A 2K40A 5M3FJ 2D5VA 4A3CJ 5E3NA 1RKTA 2DA6A 5IOZA 4JX4A 3ZHBA 2GF2A 1ETKA 2R7ZJ 1SANA 4E21A 1M76A 3O8HA 3JRFA 5GPCA 1JT6A 2FX0A 1WPQA 3ZQLA 2DA3A 1IL0A 3QPLA 4D5CA 3MVPA 2DA1A 5F0FA 4G12A 2DMPA 1X2MA 1WCMJ 3S15J 3GTMJ 2Y0SN 1UHSA 2X48A 4V2GA 3CTVA 3BG5A 5C4XJ 4M3DA 4XIDA 3S1QJ 4QTRA 2LD5A 1LE8B 1B72A 3OOUA 1VF9A 1BA5A 3BR1A 1FIPA 2TRTA 1N1GA 3QPSA 1F0YA 5EF6A 4XRSG 5K7ZA 5JE8A 5FLMJ 3FK6A 4J0EA 2H8RA 4A3KJ 4A3FJ 1HDDC 3GTQJ 1JTYA 2R93J 5A9SA 3HM5A 3S14J 4OL9A 1ETXA 1YJQA 3PM1A 2HDHA 1B8IA 3FR7A 3QQAA 3RQIA 3ZQHA 5F27A 1QMGA 2JMWA 3H0GJ 2CUEA 4QIWN 5M5YJ 4DW6A 2XGCA 4B1RA 3IH2A 3E7LA 3LSGA 4XRMA 4B4CA 4IHWA 5JLXA 2XSDC 4A3JJ 2O9LA 3Q3SA 1YB4A 3RZOJ 1JT0A 2IYPA 4Y52J 3Q3CA 2JJ7A 1JKPC 2HDDA 4FE4A 2JA7J 3ADPA 2M34A 3WFJA 1RETA 3ZWAA 1WGXA 2IZ0A 1JGGA 2E19A 1OFCX 2JA6J 1IDYA 4MFEA 2PLAA 4OQYA 1HOMA 3HADA 4DLLA 3WHBA 2EQRA 2L7FP 4A3DJ 1KS9A 2LVSA 1LJ8A 3ZW9A 1UG2A 5AYVA 3FIWA 5M5WJ 1OCPA 3G1MA 3D1NI 2CRGA 1YVEI 5EZHA 1BL0A 5E3MA 4FCYA 2PMZN 1HCRA 4DYQA 1TWCJ 2Y2ZA 4FISA 2LP0A 2QCOA 3F3SA 4DYRA 2H1KA 1MSFC 4MFDA 5IP9J 1VFCA 2CVZA 2EW2A 1PGNA 1K83J 5GP9A 3G1LA 3M4OJ 2ID6A 3Q0VA 2EZIA 2ELKA 2R5ZB 4E12A 3HOYJ 3LOCA 3BG9A 1T33A 1FTTA 3FK7A 3IH4A 2I10A 4CYCA 3DCFA 2XRLA 2VPRA 1HLVA 1DU0A 2XPWA 2D3TA 1WDMA 1ETQA 2DA7A 4XICA 1F14A 5A9RA 1VNDA 1VPDA 3CQZJ 2E2HJ 2DN0A 1ETYA 1ENHA 3HOUJ 4A93J 2M8GX 2XB0X 2W48A 5HWSA 1ETVA 1IRZA 3A02A 1TXGA 3L6DA 2X58A 3BQZA 2XGDA 3GBGA 3A01A 3A03A 3TP3A 1Z82A 2MG4A 3S17J 4DZJA 3BG3A 4D3FA 2M2EA 2L0KA 4A69C 1B72B 1U9OA 5FWNA 4OQZA 4W97A 2ZYDA 3GTGJ 2W8ZA 3TW6A 4L5EA 4C3IJ 1XS9A 4BY7J 1HDPA 3W6UA 3BTCA 3CMYA 1XC5A 1LFBA 4A3IJ 3HEFA 4S0HB 4B3AA 1WI3A 5F08A 2R5YA 4PZEA 4V2FA 1U78A 3JRHA 1HF0A 1AU7A 1B8IB 5IYBJ 1PGJA 1T56A 2TCTA 5F1JA 1R9TJ 3HKZN 3Q0WA 4DCKA 4BY1J 1IJWC 1PUFB 1M2WA 2XGEA 2XPUA 1Q1VA 2M0CA 4YCAA 4X1EA 5F0HA 4B3JA 3MN2A 1IG7A 2Y30A 3WS7A 5J1YA 2K9SA 1TWGJ 3JRDA 3F0CA 4B3HA 3ZGYA 1ZQ3P 2DMUA 3JRCA 2DMTA 3HDHA 1Y1VJ 4JYKA 4DYCA 2N8GA 2JKVA 1F36A 1MBKA 2DA4A 2X9DA 3H2ZA 3ZWBA 2EZLA 1UMQA 1XG1A 3I4MJ 4D5FA 2CJJA 2HOSA 3FWNA 2DTZA 4ABZA 2Y9ZA 3NAUA 3OSFA 1A6IA 3HGGA 2HOAA 1ZTRA 2LLKA 2VKEA 1Y1WJ 2ZYGA 1JUMA 2ECCA 4XK4A 5F04A 1AKHA 1MBEA 2HYJA 1M67A 4IHYA 3I4NJ 4RBOA 1ETWA 1NK2P 1IDZA 1U8BA 5FJ8J 3SFIA 3S1NJ 1GDTA 2X6OA 3LSJA 3S16J 3PJGA 1MBHA 1JJ6C 1OJLA 2G0EA 1Z0XA 2MW8A 3ZOBA 4I76A 3ZWCA 1M66A 1M75A 3PDUA 1ETOA 1JJ8C 4NDLA 2KDZA 5EEAA 2WTBA 4AUXA 5EZGA 5BNGA 2Y31A 1JUSA 1FTZA 1FJLA 2M9HA 5FKKA 1I36A 1PGPA 1IGNA 2HOTA 1SFOJ 1TC3C 5GPAA 1QRYA 3CKYA 2CQQA 3BTIA 1DU6A 1ZR4A 2QF7A 4OVNF 1WP4A 3TW7A 2NVTJ 2IEKA 4A3MJ 1Z77A 1NTCA 5E3LA 3A01B 3HOZJ 3ZQGA 3K96A 3HOXJ 3RQSA 3ZQCA 3C2BA 2GM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ANT A;  3Q0U A;  5M5X J;  1I6H J;  3ZQF A;  5C44 J;  1RES A;  2Y9Y A;  3IV5 A;  2WB1 N;  2L9R A;  3TED A;  2O7O A;  2DMN A;  1K61 A;  3BR2 A;  5EYR A;  1P7J A;  2NS7 A;  5EG0 B;  1MBG A;  1APL C;  2VI6 A;  1RPW A;  4JQ0 D;  1JTX A;  5J3L A;  4BKX A;  2R5Y B;  1JKQ C;  3BR0 A;  4D7N A;  1OCT C;  4M6V A;  3GTP J;  2EH3 A;  3CDL A;  3CCY A;  4FE7 A;  5M3M J;  4JP0 A;  3HB9 A;  5IP7 J;  2E2J J;  2O8K A;  4A3G J;  1TWF J;  1ZGW A;  4LOC A;  5K7F A;  1GVD A;  4M3B A;  2R92 J;  3B6A A;  2NOG A;  2RAE A;  5K7H A;  2NVX J;  4DZP A;  1BJZ A;  4RDU A;  2VKV A;  1CQT A;  1EF4 A;  5DTD A;  4C3J J;  2CQX A;  3G1O A;  4A3B J;  2IAI A;  1RR7 A;  4UUS A;  2K9Q A;  3BTL A;  2WV1 A;  3B6C A;  5IOY A;  3GTK J;  1I50 J;  2L7M P;  1AKH B;  1NK3 P;  4UUT A;  4C3H J;  2DA5 A;  1GUU A;  2FJ1 A;  1F43 A;  4QSH A;  3OIO A;  5FKO A;  1H89 C;  1MBJ A;  3IH3 A;  1G2H A;  4JPZ B;  3VPR A;  1U9N A;  3LSR A;  3GTL J;  1ORK A;  4A3L J;  2MSY A;  1VI0 A;  4A3E J;  2AO9 A;  2WAQ N;  3NAR A;  2XB5 A;  3BR5 A;  1JKO C;  1IC8 A;  1W0U A;  2DMQ A;  2JA5 J;  3SDG A;  1E3O C;  1H88 C;  3PO2 J;  4I6Z A;  2LK2 A;  1IV6 A;  4HNV A;  1JKR C;  1YRN A;  2YUS A;  2OF7 A;  3GTJ J;  5EDN A;  3S2H J;  2OPT A;  1S7E A;  5FLV A;  1BW5 A;  3JR9 A;  4D7M A;  5JLW A;  1FEX A;  2ZB9 A;  3SJM A;  2EBI A;  4MO7 A;  3TP0 A;  3W6V A;  1POG A;  5J1R A;  1ZK8 A;  2AHQ A;  2ECB A;  1GT0 C;  5EGO A;  3JRI A;  2B63 J;  1TWH J;  2XPV A;  2LKX A;  3OSG A;  2R0Q C;  3M3Y J;  1WPK A;  3RKQ A;  1GV2 A;  5C4J J;  4CYC B;  2MGQ A;  2E1O A;  1MNM C;  2FD5 A;  2ID3 A;  3HBL A;  3HGY A;  2EZK A;  3PO3 J;  2YS9 A;  2JWT A;  1QVT A;  3LSP A;  1O4X A;  5E3O A;  2DJN A;  2KT0 A;  2L7Z A;  3L1P A;  1PUF A;  2ME6 A;  3O8G A;  2JK3 A;  5F0C A;  1ZKG A;  1D5Y A;  2E2I J;  4BXX J;  2HXI A;  3MKL A;  5DS9 A;  1QPI A;  2HXO A;  1X58 A;  4XRS A;  2YU9 J;  2COB A;  5IPA A;  3JRG A;  1FIA A;  4J19 A;  3RZD J;  2VUM J;  1QVU A;  1LE8 A;  3BT9 A;  4Y7N J;  4M3G A;  2NVY J;  1BW6 A;  2CU7 A;  1P7I A;  1H8A C;  3BR6 A;  2K9N A;  3HDD A;  2LTP A;  4JX6 A;  3BQY A;  5IP6 A;  5IYD J;  1IUF A;  1MH4 A;  4IEJ A;  3JRE A;  2ME0 A;  4UUS B;  1MH3 A;  3H3V K;  2CUF A;  4GFB A;  3BR3 A;  1I3Q J;  1ITY A;  4IHX A;  3BTJ A;  2IBD A;  2NS8 A;  3K7A J;  2DA2 A;  3DEW A;  2P81 A;  4BBR J;  4BBS J;  1RKW A;  4C2M J;  4FTH A;  3FKI J;  1TWA J;  3WHC A;  3JRA A;  3LNQ A;  4M3F A;  5FKM A;  3K2A A;  4IHV A;  3FIS A;  5FKL A;  2LR8 A;  5J1U A;  3S1M J;  3JRB A;  1ZR2 A;  2NVQ J;  2JN6 A;  5FKN A;  2GBY A;  2EZH A;  1AHD P;  1MBF A;  4AYB N;  5IYC J;  1LFU P;  2GLO A;  1YRN B;  2HI3 A;  4MLO A;  3HOW J;  1A5J A;  2FQ4 A;  3S2D J;  3UKG A;  1X2N A;  1MSE C;  4AC0 A;  4EEF G;  1W0T A;  3ZQI A;  5HOD A;  3HOV J;  2HQ5 A;  4JX5 A;  5EGO B;  4X6A J;  5C3E J;  2R5Z A;  2LFB A;  1JUP A;  1GV5 A;  1WH7 A;  4M3E A;  3GTO J;  1WH5 A;  5EG0 A;  4W1U A;  2JA8 J;  3S1R J;  4MIM A;  2LY9 A;  2K40 A;  5M3F J;  2D5V A;  4A3C J;  5E3N A;  1RKT A;  2DA6 A;  5IOZ A;  4JX4 A;  1ETK A;  2R7Z J;  1SAN A;  3O8H A;  3JRF A;  5GPC A;  1JT6 A;  2FX0 A;  3ZQL A;  2DA3 A;  3QPL A;  4D5C A;  3MVP A;  2DA1 A;  5F0F A;  4G12 A;  2DMP A;  1X2M A;  1WCM J;  3S15 J;  3GTM J;  2Y0S N;  1UHS A;  2X48 A;  4V2G A;  3BG5 A;  5C4X J;  4M3D A;  4XID A;  3S1Q J;  4QTR A;  2LD5 A;  1LE8 B;  1B72 A;  3OOU A;  1VF9 A;  1BA5 A;  3BR1 A;  1FIP A;  2TRT A;  3QPS A;  5EF6 A;  4XRS G;  5K7Z A;  5FLM J;  3FK6 A;  2H8R A;  4A3K J;  4A3F J;  1HDD C;  3GTQ J;  1JTY A;  2R93 J;  3HM5 A;  3S14 J;  1ETX A;  3PM1 A;  1B8I A;  3QQA A;  3RQI A;  3ZQH A;  5F27 A;  2JMW A;  3H0G J;  2CUE A;  4QIW N;  5M5Y J;  4DW6 A;  2XGC A;  4B1R A;  3IH2 A;  3E7L A;  3LSG A;  4XRM A;  4B4C A;  4IHW A;  5JLX A;  2XSD C;  4A3J J;  2O9L A;  3Q3S A;  3RZO J;  1JT0 A;  4Y52 J;  2JJ7 A;  1JKP C;  2HDD A;  4FE4 A;  2JA7 J;  2M34 A;  1RET A;  1WGX A;  1JGG A;  2E19 A;  1OFC X;  2JA6 J;  1IDY A;  4MFE A;  1HOM A;  3WHB A;  2EQR A;  2L7F P;  4A3D J;  2LVS A;  1UG2 A;  3FIW A;  5M5W J;  1OCP A;  3G1M A;  3D1N I;  2CRG A;  5EZH A;  1BL0 A;  5E3M A;  4FCY A;  2PMZ N;  1HCR A;  4DYQ A;  1TWC J;  2Y2Z A;  4FIS A;  2LP0 A;  2QCO A;  4DYR A;  2H1K A;  1MSF C;  4MFD A;  5IP9 J;  1VFC A;  1K83 J;  5GP9 A;  3G1L A;  3M4O J;  2ID6 A;  3Q0V A;  2EZI A;  2ELK A;  2R5Z B;  3HOY J;  3LOC A;  3BG9 A;  1T33 A;  1FTT A;  3FK7 A;  3IH4 A;  2I10 A;  4CYC A;  3DCF A;  2XRL A;  2VPR A;  1HLV A;  1DU0 A;  2XPW A;  1ETQ A;  2DA7 A;  4XIC A;  1VND A;  3CQZ J;  2E2H J;  2DN0 A;  1ETY A;  1ENH A;  3HOU J;  4A93 J;  2M8G X;  2XB0 X;  2W48 A;  1ETV A;  1IRZ A;  3A02 A;  3BQZ A;  2XGD A;  3GBG A;  3A01 A;  3A03 A;  3TP3 A;  2MG4 A;  3S17 J;  4DZJ A;  3BG3 A;  2M2E A;  2L0K A;  4A69 C;  1B72 B;  1U9O A;  4W97 A;  3GTG J;  3TW6 A;  4L5E A;  4C3I J;  1XS9 A;  4BY7 J;  1HDP A;  3BTC A;  3CMY A;  1XC5 A;  1LFB A;  4A3I J;  3HEF A;  4S0H B;  4B3A A;  1WI3 A;  5F08 A;  2R5Y A;  4V2F A;  1U78 A;  3JRH A;  1HF0 A;  1AU7 A;  1B8I B;  5IYB J;  1T56 A;  2TCT A;  5F1J A;  1R9T J;  3HKZ N;  3Q0W A;  4DCK A;  4BY1 J;  1IJW C;  1PUF B;  2XGE A;  2XPU A;  1Q1V A;  2M0C A;  4X1E A;  5F0H A;  3MN2 A;  1IG7 A;  2Y30 A;  5J1Y A;  2K9S A;  1TWG J;  3JRD A;  3F0C A;  1ZQ3 P;  2DMU A;  3JRC A;  2DMT A;  1Y1V J;  4JYK A;  4DYC A;  2N8G A;  1F36 A;  1MBK A;  2DA4 A;  2X9D A;  2EZL A;  1UMQ A;  1XG1 A;  3I4M J;  4D5F A;  2CJJ A;  2HOS A;  2DTZ A;  4ABZ A;  2Y9Z A;  3NAU A;  3OSF A;  1A6I A;  3HGG A;  2HOA A;  1ZTR A;  2LLK A;  2VKE A;  1Y1W J;  1JUM A;  2ECC A;  4XK4 A;  5F04 A;  1AKH A;  1MBE A;  2HYJ A;  4IHY A;  3I4N J;  4RBO A;  1ETW A;  1NK2 P;  1IDZ A;  1U8B A;  5FJ8 J;  3SFI A;  3S1N J;  1GDT A;  2X6O A;  3LSJ A;  3S16 J;  1MBH A;  1JJ6 C;  1OJL A;  2G0E A;  1Z0X A;  2MW8 A;  3ZOB A;  4I76 A;  1ETO A;  1JJ8 C;  4NDL A;  2KDZ A;  5EEA A;  4AUX A;  5EZG A;  5BNG A;  2Y31 A;  1JUS A;  1FTZ A;  1FJL A;  2M9H A;  5FKK A;  1IGN A;  2HOT A;  1SFO J;  1TC3 C;  5GPA A;  1QRY A;  2CQQ A;  3BTI A;  1DU6 A;  1ZR4 A;  2QF7 A;  4OVN F;  3TW7 A;  2NVT J;  2IEK A;  4A3M J;  1Z77 A;  1NTC A;  5E3L A;  3A01 B;  3HOZ J;  3ZQG A;  3HOX J;  3ZQC A;  3C2B A;  2GM4 A; 
#chains in the Genus database with same CATH topology
 9ANT A;  1NH3 A;  3U21 A;  4OGQ C;  1QZY A;  3Q0U A;  4M74 A;  2IS2 A;  4C7R A;  2I9P A;  2UWJ E;  5C44 J;  2RN0 A;  3IV5 A;  2WT7 A;  3TED A;  4P9F A;  1P7J A;  1E79 H;  2KUB A;  5JHU A;  3HOT A;  1MBG A;  1QGK B;  1APL C;  2VI6 A;  1IK7 A;  2QJY C;  1IN7 A;  1R5I D;  1SFX A;  3ECO A;  3RBZ A;  2XIG A;  3RI4 A;  1RPW A;  4R8H A;  4PUS A;  2CFO A;  1XN7 A;  2BW3 B;  1JTX A;  3OYM A;  1Z21 A;  2V79 A;  4BKX A;  5HS8 A;  2R5Y B;  1JKQ C;  3CUQ C;  5DEQ A;  5KLI C;  2HR3 A;  5L3E A;  2ZXW H;  1FZB A;  1F1Z A;  1PP9 G;  4HDV A;  3UNG C;  3QU6 A;  1VQ8 I;  4E13 A;  1W5C C;  1OCT C;  1VQ6 I;  1F17 A;  1P84 I;  4BXF A;  1VQO P;  1IUY A;  4M6V A;  4UXN A;  2KIF A;  3FXO A;  2O6G E;  2OYH C;  2WA0 A;  3GTP J;  5E1X A;  3AEF C;  3S2W A;  3CCY A;  3FXR A;  1WJC A;  4CCK A;  2OV7 A;  3BJO A;  2M3E A;  1OW6 A;  1FC2 C;  2ZYA A;  2GZW A;  1R36 A;  2E2J J;  2O8K A;  1EZV E;  4A3G J;  2C9L Y;  3M9A A;  1R5S A;  2VC1 A;  4UB6 E;  3CME I;  2P7J A;  2P4Q A;  3MIW A;  1YOV B;  1TNT A;  3OWT A;  2IBZ G;  1WHU A;  5AVS B;  3SFE C;  4ZTJ A;  3BG6 A;  4BE1 A;  5L3D A;  2K3P A;  1QZE A;  3IRR A;  3M0D A;  1XMA A;  2DOA A;  2VKV A;  1CQT A;  5HS7 A;  2RN7 A;  5DTD A;  4AM3 A;  1EF4 A;  3CJN A;  1Q1H A;  2CQX A;  2X1E A;  3O3K A;  5IT9 K;  1BDD A;  2BY3 A;  4OU0 A;  3Q5F A;  1C0W A;  1NU1 D;  1USD A;  2PFB A;  2WV1 A;  1X4P A;  1J2X A;  3KP7 A;  5JVG F;  3GTK J;  1I50 J;  4H0L B;  3M8F A;  3TKY A;  1YHQ I;  1GK4 A;  4O9B A;  2CH0 A;  4M73 A;  1W4M A;  1GL2 B;  3PP5 A;  3WTS C;  4E7K A;  2Q8K A;  1K6Y A;  2DA5 A;  1GW3 A;  1I3A A;  1GU5 A;  1SQP D;  3L35 A;  4LGD E;  4TV7 A;  4MN4 C;  2I1K A;  3TQN A;  1SQX G;  3LAJ A;  1NTM K;  5KKZ B;  1LGH B;  3VPR A;  1FSE A;  1YO5 C;  1U9N A;  4BDZ A;  4OH8 B;  3E1I A;  1EA3 A;  5HLH A;  3U1D A;  4A3L J;  5TJJ A;  4ANJ A;  1SFC A;  3BCC J;  3OAK A;  2WTY A;  3ZRG A;  2Q5U A;  2WAQ N;  4IRG A;  3L36 A;  3BR5 A;  3L71 E;  4KIG A;  3L2C A;  1IC8 A;  1U7M A;  4J0F A;  4Y3O A;  2H1L A;  3L4F A;  3H1J J;  4XLH A;  2I1J A;  3I71 A;  4EOT A;  1E3O C;  1BGY E;  4D6T D;  1DPR A;  2FA5 A;  2VKH A;  1PP8 F;  3CX5 H;  2E76 D;  5KAF E;  4XLA A;  3T0Y A;  1G8X A;  2RV8 A;  4Y15 A;  4BEH B;  1OQY A;  1B9M A;  2K7L A;  1HW5 A;  1G59 A;  5L3B A;  1KU2 A;  2HVR A;  4UB6 C;  1GW4 A;  1JI8 A;  2VQH A;  4L73 A;  3T97 A;  2YUS A;  2UXX A;  1KYZ A;  2WPV B;  2OD5 A;  2A06 D;  5EDN A;  1BW5 A;  1X3U A;  1XTA A;  3JR9 A;  4M6Y A;  1YW9 A;  1IN5 A;  3DKW A;  4RGS A;  4D7M A;  2KJC A;  4PFP A;  2ZB9 A;  3OYK A;  1H89 A;  4YG2 F;  2B9S A;  4LIV A;  1QGP A;  3SJM A;  2EBI A;  1FWZ A;  3K4J A;  4WXH A;  5J1R A;  3W6V A;  3MGN A;  1L4A C;  5ICF A;  5HVQ C;  4YEJ A;  1GT0 C;  5DJU B;  1G2C A;  2WWW A;  4EI2 A;  4H44 D;  4ZDP A;  1FBQ A;  3K2Z A;  2A45 I;  4EYY Q;  2H94 A;  4HAM A;  1HQC A;  3HXL A;  4A7P A;  5CVI A;  1DUX C;  1WDL A;  3BCC E;  3M3Y J;  5K5G B;  1IFJ A;  2LF8 A;  2ZXE B;  3FXD A;  2LC2 A;  3IAM 2;  2MGQ A;  1KQL A;  1HA8 A;  3KYQ A;  4PK4 A;  3ZDM A;  1LDJ A;  2PG4 A;  2G9W A;  2EA4 A;  2R5D A;  2E35 A;  1MFZ A;  2EZK A;  5JVT A;  1J09 A;  1VPC A;  2JWT A;  5LLQ A;  1EQ7 A;  3BY6 A;  1PP9 D;  1QVT A;  1IN8 A;  3V7R A;  1O4X A;  3UIA A;  5CVR A;  1EJ9 A;  2Q7C A;  2QWW A;  2E74 D;  2Q9I A;  1X9V A;  2B9B A;  5E8G A;  3HZJ A;  1K8A Q;  1D5Y A;  4UV9 A;  4ZYG A;  2YU3 A;  3F8N A;  4XR6 A;  4N9I A;  5DUK A;  3WOD F;  5KAF C;  2HXO A;  3HIF A;  4XNF A;  3L00 A;  1L0L J;  3JRG A;  1QX8 A;  3AL0 C;  4IPA A;  3H92 A;  4J19 A;  3U1C A;  3RZD J;  1KQ0 A;  4CCN A;  1O3T A;  2PJP A;  3RK2 B;  1HTL C;  1PGO A;  3Q3D A;  1QBJ A;  4PZJ A;  1KFM A;  1SAU A;  2G7H A;  3PUF A;  3DBH B;  1SD4 A;  1KQS O;  4QPQ A;  1K73 Q;  1MZB A;  2LTP A;  1LSJ A;  3C18 A;  4G7Z F;  1YX3 A;  4XLF A;  3WGH A;  1A02 F;  1EDL A;  1IRG A;  1H9T A;  1SQB K;  1MH4 A;  3VOP A;  2M5W A;  4R4M A;  2ME0 A;  4UUS B;  3I53 A;  2CUF A;  2EIN H;  1XB4 A;  3EUH C;  4GFB A;  3VYR B;  1NTZ K;  1U57 A;  1B9N A;  5IY5 H;  2A68 F;  4PSW A;  3S3N A;  1W2E A;  2F5F A;  2BY2 A;  1EH8 A;  3FF5 A;  2UYY A;  1TBX A;  4ZH4 F;  3M1E A;  1J75 A;  3H5A A;  3PQJ A;  1I1S A;  4KUH A;  2BEQ D;  1UCR A;  1Y0U A;  2DA2 A;  3FXL A;  4Y33 A;  1JHF A;  3CJR B;  1SVO A;  3HJE A;  2VJ5 A;  2HPM A;  1SQX D;  1TP4 A;  4UB6 H;  1NU1 J;  4F52 A;  1TWA J;  2VT3 A;  3DP7 A;  4GYG A;  1XDS A;  4KHX A;  3HPH A;  3MZY A;  1QL1 A;  5APX A;  1EVZ A;  3JC2 2;  4ZYD A;  3I59 A;  2R7S A;  1O3Q A;  1RIO H;  4ESB A;  1KQG B;  2Y0D A;  3QWO C;  1JMM A;  1YYV A;  1XD7 A;  2W4S A;  3GFL A;  1BOB A;  1X1A A;  4S3M A;  3R60 A;  3KLO A;  3K4K A;  1SFC C;  2RKL A;  1ZR2 A;  2JN6 A;  1U2W A;  4AD9 A;  1IFD A;  1RI7 A;  3I56 I;  3LA3 A;  1SFU A;  1VQL I;  1A04 A;  2FBI A;  1X22 A;  1BI2 A;  1YBK A;  2DYR H;  5HLI A;  4ZYA A;  1IXC A;  1FPQ A;  1XGM A;  3LAP A;  4DQ2 A;  4F55 A;  2V6C A;  1W0T A;  2MH2 A;  2KOG A;  2CO5 A;  3KZY A;  2L54 A;  2Q3E A;  2E5Z A;  3ZQI A;  1M1J C;  3RL0 D;  3ZMD A;  1TZL A;  5TRD A;  1KQF B;  4KN4 X;  3R4Y A;  2BEO A;  1KA8 A;  1O3R A;  2LMD A;  3BRO A;  2BHZ A;  2VPL A;  3ZW8 A;  5KAF H;  4ZYE A;  3WU1 B;  1VQ9 I;  1X1B A;  4M3E A;  2HG5 D;  2MBF A;  2R7F A;  4W1U A;  3ZMV A;  3CMA I;  2STW A;  2FYU G;  3AE1 C;  5H2F E;  4MIM A;  3ESW B;  3VP8 A;  3H36 A;  1FMW A;  2J5P A;  2LY9 A;  1KB9 D;  1VDF A;  1SQP E;  1LFP A;  3PNV A;  2D5V A;  1REP C;  3GHG B;  5ILU A;  4RJT A;  3KYC B;  1DP7 P;  2QQ8 A;  2WIT A;  4JX4 A;  1Y8A A;  3RJP A;  3TGU G;  3EUA A;  2R7Z J;  3DXJ F;  3JRF A;  5GPC A;  3H1I G;  3MD0 A;  3ERE D;  4RS8 A;  3I55 I;  2A05 A;  3P5J A;  1U0J A;  3MVP A;  4H13 B;  1GL2 C;  3N4M A;  2XZR A;  2IXS A;  4M9Z A;  1WCM J;  4D6T E;  2HKX A;  2KNC B;  2VRS A;  2OAZ A;  2Y0S N;  5AW9 B;  1SD6 A;  2M7B A;  4V2G A;  1MJ9 A;  3DTE A;  4IQJ A;  2IS1 A;  1RQV A;  2YO2 A;  3CDH A;  2W6J H;  1S5L X;  2WAF A;  5AW3 B;  5BPI A;  3MMY B;  3OOU A;  3V7S A;  3KP3 A;  2VN2 A;  2BY1 A;  1LVK A;  3BR1 A;  3JSP A;  2A06 E;  1M1K Q;  2OYI A;  1WJB A;  1FP2 A;  2KP8 A;  5EF6 A;  5K7Z A;  2E5Y A;  1IAW A;  4J0E A;  4EGZ A;  1RR8 C;  1HDD C;  3GXO A;  3JAM Z;  3DBR B;  5J4V A;  2R93 J;  1L2P A;  2KSJ A;  3S14 J;  1BR1 A;  1SQV J;  1MGT A;  5F6F A;  1W1W E;  1Y56 A;  2V1N A;  5K5R A;  3MUD A;  1RF1 C;  2Z16 A;  3IFM A;  1I1G A;  3SQN A;  2R4G A;  2HDH A;  5H2F C;  3KHU A;  3M8E A;  2DYS H;  3FR7 A;  3QQA A;  4XOR A;  2ZJQ F;  5FB2 A;  3BCA A;  1JOC A;  1U6G A;  2WTE A;  5M5Y J;  3CX5 I;  4IKF A;  3GF7 A;  1ON1 A;  4K2E A;  3L75 G;  3K4C A;  4DJA A;  1PP9 E;  3LST A;  4XSX F;  2STT A;  1XSV A;  3E1S A;  3H1H J;  2PEX A;  3S9O A;  2XSD C;  2Y0E A;  1EV7 A;  2QUF A;  3BPV A;  1LT9 A;  1JT0 A;  2IYP A;  1USS A;  2GUS A;  1IRF A;  2QIW A;  5HOO A;  1UFM A;  4FE4 A;  2JA7 J;  1FOY A;  3I5U A;  2E76 C;  4YXW H;  1JGG A;  1EDK A;  1PJR A;  1LEB A;  3E7K A;  4UB8 E;  4KMF A;  1N7S D;  4L5I A;  4MFE A;  4OQY A;  1T0F C;  1YTZ T;  5D8K B;  2L7F P;  5J40 A;  1UG2 A;  3O2P E;  3FIW A;  1YJN P;  3G1M A;  2FXO A;  1D1A A;  1HUC A;  2G8Y A;  4FCY A;  1CF7 B;  3CCS P;  3G2B A;  2PMZ N;  5KTB A;  1Z9C A;  1ZV8 A;  3O6Q B;  4DYQ A;  1WJD A;  5BVZ A;  3CCJ P;  2Y2Z A;  3FM5 A;  2F5V A;  4UHT A;  1FDI A;  3M1C A;  2KSE A;  2CVZ A;  4E7S A;  2N1T B;  3HUS B;  1XSD A;  4H44 C;  4EM0 B;  1PGN A;  4XLP F;  3IUO A;  2WAD A;  3G1L A;  5LRR A;  3RL0 g;  5CPR B;  3SZP A;  4E12 A;  5A2Q K;  2BHY A;  1K78 B;  1FTT A;  3BLY A;  2FYU D;  2XAG A;  1IC2 A;  3D6Z A;  1QEX A;  3A4C A;  1YFH A;  3DCF A;  4E6K G;  2XRL A;  1SQX E;  2XPW A;  3TGU D;  5BMZ A;  1SD5 A;  3H1I D;  1YE9 A;  3I9V 2;  1F14 A;  3QRF F;  3W3C A;  1VPD A;  2DOF A;  2E74 C;  1L0N G;  1ONV A;  3B5N D;  4BXU A;  5IT9 Z;  4IVN A;  4N3Y B;  1ZRC A;  4HZF A;  3F6O A;  4XLE A;  2M0M A;  3OS0 A;  2O8X A;  3A02 A;  1TXG A;  2KYV A;  4UB8 C;  1K4T A;  2X58 A;  1AFO A;  2IS6 A;  3TP3 A;  4UVB A;  2MLK A;  5E1W A;  5HDK A;  1FE6 A;  2BCC J;  5H2F H;  2LRD A;  3S17 J;  1SLQ A;  4DZJ A;  3BG3 A;  4D3F A;  2M2E A;  5KAI E;  1LQ1 A;  1U9O A;  4KYW A;  5FWN A;  3COA C;  3E3V A;  1VQ7 P;  2DOD A;  3D5L A;  4BU2 A;  3WU0 A;  1S3J A;  1EZV I;  1N73 A;  1S1C X;  3CC7 P;  1HDP A;  4Y17 A;  3SXY A;  3W6U A;  2K9J A;  2Y0C A;  4NC6 A;  2MLG A;  3D6Y A;  2DFE A;  4HYE A;  1LJ2 A;  4BAC A;  2R7W A;  5CCH D;  2HYG D;  2XSJ C;  3MKW B;  1URQ B;  4A3I J;  2ISZ A;  4WF2 A;  1ZG1 A;  3ECH A;  4V2F A;  4CH7 A;  2IVM A;  3JRH A;  1NTK G;  4N6J A;  4BRY A;  1UZC A;  5IYB J;  4BAY A;  4EGY A;  1R9T J;  1LTS C;  5AIP A;  2OCE A;  1LEA A;  3M0A A;  3G71 P;  4LJZ F;  3MUD C;  3K70 D;  1PUF B;  2XAH A;  1MDM B;  1M2W A;  1KB9 E;  1U5T C;  4ZDO A;  2NAZ A;  1FZG A;  5DCF A;  3JW4 A;  2V4J C;  2XPU A;  4CA0 A;  3L70 D;  4X1E A;  2UUZ A;  4W7Z A;  4A12 A;  3WS7 A;  2Y30 A;  1NG6 A;  5J1Y A;  1TLH B;  3OYG A;  3BZK A;  1K7A A;  2Z4E A;  1LVA A;  3JRD A;  2HNH A;  2B0L A;  2ZME B;  1T08 B;  2FYN B;  3H9J A;  2RNG A;  1FZC C;  3L74 G;  4IXA A;  4RMN A;  4RLQ A;  4NPE A;  1IO2 A;  4DYC A;  1ERD A;  1OZH A;  5F64 A;  2H89 C;  3HTK A;  2N8G A;  5FLX Z;  1D8J A;  2JKV A;  2DA4 A;  3R61 A;  3L73 J;  4TLF A;  3ZWB A;  2ZBK A;  3MZH A;  1NAF A;  2EZL A;  2EFN A;  5KAI C;  2H8W A;  1PFI A;  3H1K D;  4RAY A;  4BL0 B;  3VOE A;  1NOH A;  1OWA A;  1V5F A;  3HUG A;  3KIO A;  4ABZ A;  2F48 A;  4OAZ A;  3NAU A;  3H3U A;  4G6D A;  4IOC F;  1LTJ C;  2O1K A;  2M87 A;  3CXH D;  3Q2Y A;  1ZTR A;  2YXR B;  2VKE A;  2ZYG A;  1RE3 A;  3CZ6 A;  1RH5 B;  3HE4 B;  1M90 Q;  2E71 A;  3KPH A;  3SWF A;  3G4S P;  4G7O F;  4PJN A;  3VYS B;  2ZC2 A;  3RL0 C;  1ZGA A;  2X6Y A;  1ETW A;  4L18 B;  1D1B A;  1X1P A;  1Y6I A;  2VBZ A;  1P4A A;  2D45 A;  2P8T A;  3KCC A;  4E7L A;  2A3S A;  2L5Q A;  1VTN C;  3S1N J;  3V8K A;  3CCJ I;  1HKT A;  3N05 A;  3PJG A;  3A3Y B;  4YXD C;  1EXI A;  2B89 A;  1OJL A;  4ENN A;  1SQB J;  1IF1 A;  2LNB A;  2MW8 A;  1Z6R A;  3IRQ A;  2K37 A;  3A1Y A;  1D8K A;  3CLO A;  5L3G A;  3ZWC A;  2WSS H;  2VOO A;  3VDX A;  2RNJ A;  1ETO A;  4RA2 A;  4ESJ A;  3HL2 A;  1NTZ J;  2LY1 A;  4NDL A;  4D1Q A;  2KDZ A;  5HNH A;  2QZ8 A;  1KD1 Q;  5GAD J;  2CQK A;  4DOZ A;  1MKM A;  5BNG A;  3N97 A;  1LTI C;  2XHK A;  4U0W A;  3V4W A;  2BBY A;  1RUO A;  2WMM A;  3IKT A;  1SFO J;  1GK6 A;  3QAH A;  2QYO A;  2A6T A;  4CDG A;  5KJ7 D;  4BJT A;  2VT2 A;  2FSW A;  2QSF X;  1ZR4 A;  3QWL A;  4CO8 A;  1ZLK A;  3II6 A;  2Z9O A;  2NS0 A;  3M9Q A;  2XAS A;  4ENM A;  1ODD A;  2QQB A;  1WT6 A;  5AW2 B;  3VTP C;  4WY4 B;  1V55 H;  2QVA A;  3HOZ J;  3OL3 A;  2KB7 P;  3ZQG A;  1JNM A;  3J80 K;  1WJF A;  4Y4R A;  2W6A A;  5B66 E;  3OA7 A;  1E3H A;  3RK3 B;  2LRE A;  2WV0 A;  1MNE A;  3DKX A;  2MD5 A;  4DZO A;  3CI9 A;  3OIP A;  3H3Z A;  4B44 A;  3CCE P;  2B87 A;  5CCH A;  1R5G A;  3ZQF A;  4LG3 A;  3CX5 E;  4ENJ A;  5LEK A;  2D2C B;  3TBI A;  2L9R A;  4I99 C;  1YI2 P;  1IK9 A;  2O7O A;  1W5T A;  1FBU A;  3BR2 A;  1BE3 J;  2Z99 A;  1KQ9 A;  5EG0 B;  2N9B A;  3NMD A;  4ZMD A;  3GO5 A;  3KZI E;  1IXR C;  3PJR A;  3CC7 I;  1L0L K;  2I76 A;  3J81 Z;  3I4P A;  2X6X A;  3R2P A;  3VMZ A;  3T5X A;  1W5S A;  2HEO A;  4D0P A;  2FYU E;  1NJI Q;  1HW1 A;  2RVC A;  2LY2 A;  2ZSI B;  3DFG A;  3MD2 A;  5KAI H;  1T8Z A;  1KGS A;  2CUZ A;  4YEL A;  3GW2 A;  1ZRE A;  2WZ7 A;  4ZKU A;  3TGU E;  3GFI A;  1OR7 A;  2CUJ A;  3CDL A;  4Z6Y A;  2VLA A;  4FE7 A;  3H1I E;  2VC0 A;  1W36 C;  5GTH E;  3PID A;  3MZ8 A;  3PHL A;  3L74 D;  1HWT C;  3KP5 A;  1OCR H;  1KV4 A;  4A0Y A;  4M3B A;  1YQA A;  3B6A A;  2E36 A;  3FWE A;  4OIQ F;  2L9N A;  4KIB A;  1N7S C;  2YIU B;  3RPU A;  4XKB A;  3HD7 B;  4YII A;  5B66 C;  1T39 A;  1H0M A;  5DJT B;  1N75 A;  1NU1 K;  3A7O A;  3QYE A;  1RR7 A;  3B73 A;  2PJR B;  1KB9 H;  1I39 A;  2OTK E;  3NWT A;  2VON A;  3OYB A;  3K6G A;  2W83 C;  1FOS F;  3B6C A;  1VF5 D;  1ZYR F;  2FRH A;  2JUC A;  2V9K A;  1AA7 A;  1VQ6 P;  5AVX B;  5LGU A;  4ITV A;  1H9G A;  1BN5 A;  4C9Y A;  1NK3 P;  3BRV B;  4GWK A;  4E7Z A;  3KZI C;  1BI1 A;  1IJD B;  3G4S I;  3HYI A;  5CVV A;  1I5Z A;  2WPR A;  3HTS B;  2FXM A;  1JHH A;  1MBJ A;  4OWF A;  4D3S A;  5AVR B;  1G2H A;  4JPZ B;  3HWR A;  3F8B A;  3CWB J;  1STZ A;  3TGN A;  3LSH A;  1ORK A;  1QL2 A;  1KQ8 A;  2EA2 A;  4JBA A;  2WAQ A;  4A3E J;  1DLI A;  2ICW G;  3BAS A;  3CME P;  4JYB A;  2ZT9 D;  1XMX A;  3DQV C;  2V1D A;  1X1D A;  1NO4 A;  5KJ7 A;  2K9Y A;  2DMQ A;  2ESN A;  3G6E I;  3SDG A;  2L4M A;  2YO3 A;  5AON A;  1SP4 A;  3L70 E;  3TF5 A;  5B3S H;  1PV3 A;  2XKM A;  3PO2 J;  3EPZ A;  3FKJ A;  4EZB A;  1PP7 U;  5FD6 A;  4I6Z A;  3DF8 A;  3U2R A;  4GBJ A;  3B5N C;  2O3F A;  1YRN A;  1TTY A;  2DK5 A;  3WE3 A;  3ULQ B;  3M06 A;  2KPM A;  2X4H A;  5H6Q A;  5EJC A;  3SYT A;  2IZ1 A;  2POH A;  2XNX A;  1TU3 F;  1YHQ P;  1ZG3 A;  3RQ4 A;  5FLV A;  2OC6 A;  4KA4 A;  3ZP5 A;  1ZCJ A;  2GUV A;  5AW4 B;  1YJ8 A;  3CC4 P;  3OIQ A;  3O6B B;  3F89 A;  3P9C A;  3MZW B;  5APV A;  2FOK A;  3K69 A;  1U3E M;  3IWF A;  3QOD A;  3TP0 A;  4MO7 A;  4ESF A;  3H1K E;  1POG A;  4I7Z C;  2ECB A;  2EFO A;  5D4S A;  1EVY A;  2NNN A;  5EGO A;  3EYY A;  3JRI A;  3NWS A;  3UR3 C;  1HJ0 A;  3CXH E;  3HHH A;  1S4X A;  1HBX G;  3ULK A;  3CMM A;  3GG2 A;  1JUN A;  3OSG A;  4IM7 A;  2CYY A;  2GM4 A;  5H6R A;  2WT7 B;  2XC7 A;  3AE5 C;  4GCV A;  5C4J J;  4OWR B;  5CCH C;  5JI6 A;  1Z05 A;  1SQQ G;  4B3I A;  1KC8 Q;  2ID3 A;  2H7H A;  3H1C A;  3HBL A;  1EDJ A;  2CMP A;  2ZXJ A;  2R7U A;  1E0E A;  1G3W A;  1NH4 A;  2A61 A;  5E79 E;  1JB0 J;  2Z2S B;  4WB4 A;  4YRV A;  4ASW A;  5CJ4 A;  3KPE A;  2PAJ A;  4WXD A;  3Q9S A;  2BOL A;  2KT0 A;  5B66 H;  3K70 C;  3L1P A;  1YLF A;  2NYX A;  3O8G A;  1J1D B;  4ETS A;  2E2I J;  4L9T A;  2X1C A;  2GIZ A;  2QKL B;  2ZFU A;  3M9H A;  1TQM A;  4NHJ A;  4N0B A;  3CO6 C;  4ZKP A;  1QPI A;  5KLV G;  2YU9 J;  4XRS A;  3GLX A;  1BSH A;  1DH3 A;  1LNW A;  1VQN P;  2WC2 A;  3KP4 A;  4QWQ A;  4ZZL A;  1QVU A;  1Z91 A;  1N1E A;  2HZD A;  3KZI H;  2BGC A;  3IKV A;  3GYH X;  1BW6 A;  2JR8 A;  3CES A;  1PGQ A;  5A2Q Z;  1VZ0 A;  4V19 K;  4UY8 I;  3BR6 A;  2W27 A;  3C2H A;  4GRI A;  2E75 B;  3F8C A;  2R7T A;  1IUF A;  4C46 A;  3F23 A;  2HLO A;  3N4X A;  2XAU A;  2M3A A;  1BJA A;  2VAS A;  4AIK A;  2OZ6 A;  4X0G A;  3AKZ A;  5CBN A;  2CV0 A;  3AE2 C;  3H3V K;  4P55 A;  1GZL A;  1H0T B;  3QSG A;  3A2A A;  3K1M A;  4QMA A;  2RRE A;  3BTJ A;  4HQE A;  5GTH H;  2NS8 A;  5ERI A;  4AIJ A;  1TT0 A;  3RPQ A;  1JTH B;  3VEP A;  4BBR J;  1RKW A;  3K4B A;  4C2M J;  4HDU A;  4H0L D;  4I01 A;  1HKQ A;  5E79 C;  1Q81 Q;  1GL2 D;  3MWM A;  4KT0 J;  2EPF A;  1R1V A;  1LTG C;  2JUG A;  3K2A A;  5FRO A;  3WTU C;  4IHV A;  1LDK B;  5FO5 A;  1EKE A;  5FKL A;  4XKW A;  1FZA A;  1FOS E;  3VN0 A;  2LR8 A;  4DIQ A;  1RF0 A;  3L71 J;  3JRB A;  1W7P B;  2RH0 A;  3IHU A;  2NVQ J;  5GAE J;  1PDN C;  2FBK A;  1UEL B;  1P92 A;  1BGY J;  2LBF B;  4AQR D;  1A36 A;  1LJ9 A;  3EUH A;  4AYB N;  5KJ7 C;  3L74 E;  1QVG O;  5IYC J;  1LFU P;  2GLO A;  1SFK A;  3L37 A;  3LSI A;  4P1W A;  1EDI A;  4CXF A;  1XGN A;  5JFR A;  2IGK A;  1FSH A;  1JY2 P;  3T97 B;  1E2X A;  4YFN F;  2L9V A;  3S2D J;  3UKG A;  4AIH A;  4I02 A;  1X3Z B;  1J59 A;  4EEF G;  2P1J A;  1VQP I;  4KUE A;  4BDY A;  1GMJ A;  1YS6 A;  1PL5 A;  3U59 A;  1X79 B;  1CW5 A;  3CC4 I;  2AXL A;  4WWC A;  4KNY A;  2O5R A;  2M8R A;  4KMU X;  1SQV G;  3I58 A;  4X6A J;  5L3F A;  1G2C B;  2CK3 H;  3TNU A;  3Q1M A;  4EV0 A;  2R5Z A;  3CCV I;  2LXC B;  1JUP A;  2JZY A;  2EIK H;  3QP6 A;  4IRH A;  1DEE G;  3EQ2 A;  2RGV A;  5DM6 F;  4W7Y A;  2MD0 A;  3K4M A;  2NVU B;  4OM8 A;  4BXL A;  2QLZ A;  2P4W A;  3I56 P;  4O6J A;  1HH0 A;  4DBQ A;  2OTJ I;  2WVR A;  3TDZ C;  1AJY A;  1Y39 A;  2GF2 A;  1VQL P;  1WKM A;  1BR2 A;  4U0V A;  4E21 A;  1M76 A;  2IX7 C;  3O8H A;  4LIU A;  4UVC A;  3M0D C;  2FX0 A;  2H8P D;  3HE5 B;  2DA3 A;  2CG4 A;  1UG0 A;  3QPL A;  3CXH H;  4D5C A;  1R5L A;  4MEX F;  1QHG A;  1T3J A;  3KP6 A;  4RAZ A;  4A2U A;  3L2R A;  1M1J A;  2P6S A;  2XF6 A;  3LID A;  3S3O A;  3WTV C;  2PX9 A;  1X2M A;  2EFQ A;  2XV5 A;  1BBY A;  2Y0S A;  5E8I A;  5E18 F;  2ZO4 A;  2O3J A;  3ITK A;  1UHS A;  3C1D A;  3QP5 A;  1KB9 I;  3P8M C;  4RGX A;  1X1C A;  1WRJ A;  3CTV A;  5CBO A;  2BY0 A;  4U87 A;  5C4X J;  4QTR A;  5AIQ A;  2BZT A;  2P0W A;  3ASN H;  1JY3 P;  3FXE A;  4ASV A;  1GTW A;  1VF9 A;  5D5U B;  1D5V A;  1VQ9 P;  1FIP A;  1VQN I;  3HSR A;  2MJZ A;  2TRT A;  2SPZ A;  4LLH A;  4PFO A;  3CMA P;  1N1G A;  3QPS A;  5IT3 A;  1ZG5 A;  1F0Y A;  1E5W A;  2J5U A;  5E79 H;  5AVZ B;  2QVO A;  3RK2 D;  2QJK B;  2H8R A;  4EJW A;  4RGR A;  4A3K J;  4A3F J;  1RHZ B;  4F7Z A;  3AG4 H;  2EIJ H;  4JF7 A;  2CW8 A;  3KEO A;  1GVJ A;  1YW7 A;  2VBY A;  1VF5 C;  4GDO A;  2FFD B;  3PM1 A;  3I55 P;  4Y99 C;  3ZXS A;  4A5N A;  4BJ5 C;  4F91 B;  5J4Y A;  1GL2 A;  2DW3 A;  3WE2 A;  1B59 A;  2IGN A;  3S32 A;  3LA7 A;  3PSF A;  1DD4 A;  3L9F A;  5F27 A;  3V6I A;  2M30 A;  2A6H F;  2F6C A;  4XM3 A;  1J1E C;  4DW6 A;  3I0T A;  4B1R A;  4YIR X;  3OYJ A;  2DPD A;  1EH6 A;  1HBW A;  2RKH A;  1T3U A;  4RES B;  4XRM A;  4B4C A;  4PGG A;  3J80 Z;  1NTM G;  5JLX A;  2O9L A;  4A3J J;  5AW6 B;  4B3X A;  2ZT9 C;  2CSO A;  2GXB A;  2FY8 A;  4P96 A;  3RZO J;  3ROU A;  1F5T A;  2JJ7 A;  1JKP C;  2HDD A;  2IBZ D;  1JMB A;  1HVV A;  1WGX A;  2JVG A;  2IZ0 A;  3EWK A;  3PUB A;  2V9P A;  1WQ2 A;  1MMA A;  3RKW A;  4BEH A;  2PI0 A;  1IDY A;  1ZLJ A;  2BCC G;  4PJM A;  4NQW A;  2A45 G;  1RF0 C;  2A69 F;  1TL8 A;  1RF1 A;  2E42 A;  1FZP B;  2EQR A;  2E5T A;  2LVS A;  2WSF H;  2QA4 I;  5M5W J;  3BJA A;  2PMZ A;  4PJL A;  2P5K A;  2L02 A;  4C2T A;  2XUB A;  4FIS A;  3J7A O;  2LP0 A;  5CKT A;  1OCZ H;  2YX7 A;  5CQG A;  2AXC A;  3H5N A;  4MFD A;  5IP9 J;  1MSF C;  2IPQ X;  3CP8 A;  3KFW X;  5GP9 A;  2J5O A;  3M4O J;  2ID6 A;  3BRT B;  3C9I A;  1P84 D;  1Z56 A;  2FYU K;  3HOY J;  1MMG A;  4NC8 A;  1T33 A;  2K9M A;  3I5C A;  1IW7 F;  3FK7 A;  3CC2 P;  2DCE A;  2Q2E A;  4GXO A;  4KT6 A;  2DOE A;  1JM0 A;  1J2J B;  5HNF A;  4HB1 A;  1T0F A;  2QEN A;  1SQP J;  1ACI A;  4BE2 A;  3KEY A;  4BE0 A;  3TYY A;  4HLY A;  3VYI A;  3ZCO A;  2JO1 A;  2MFZ A;  4EJU A;  5A9R A;  3OR2 C;  2E2H J;  5EEH A;  1LWU B;  3SWK A;  3BZC A;  1LTT C;  2JSC A;  1IRZ A;  3L73 G;  5AVT B;  4I6M C;  3FMS A;  5DYM A;  2PLY A;  1HGZ A;  3ZMT A;  2GA1 A;  2IA2 A;  3U9G A;  4D6T J;  2ACJ A;  5ILV A;  4LG0 B;  5L3C A;  1BI3 A;  2C0X A;  2MG4 A;  4H13 D;  4ENK A;  3F8M A;  2ZFC A;  2XND H;  4DOJ A;  1X19 A;  4A69 C;  3K1N A;  1T8I A;  1FZF A;  4A6E A;  3Q5S A;  2ZYD A;  4K3A A;  2OYI B;  2W8Z A;  4LIT A;  2F4M B;  4C30 A;  2JJL A;  4IFM A;  4L5E A;  1XPX A;  1XS9 A;  3VYT B;  1N2D C;  3QPT A;  3AE4 C;  1YX5 A;  3HTU A;  3FM3 A;  4LC1 A;  1AQ5 A;  4A5M A;  3ZN1 A;  4BQN A;  1CZQ A;  2J58 A;  4HF1 A;  3HEF A;  3DU5 A;  4B3A A;  5TJH A;  5F08 A;  4CZZ A;  2H43 A;  5B1A H;  2EK5 A;  2MAB A;  2IRF G;  2WSC J;  1PGJ A;  1TQP A;  5F1J A;  1NTZ G;  2Z5I A;  3HKZ N;  4PGH A;  4HF0 A;  1SQQ E;  4DCK A;  2D2W A;  4H0L C;  1WFX A;  1B4A A;  1EC5 A;  1EXJ A;  2XGE A;  1Q1V A;  4B3J A;  3H1L G;  2L01 A;  3MN2 A;  1IG7 A;  2YNY A;  1FZE A;  3W67 A;  2P58 A;  1PP9 J;  4XA4 A;  1TWG J;  1FAV A;  1JO5 A;  2E5N A;  1A02 J;  4RB1 A;  1YG2 A;  3F0C A;  4IX7 A;  2L7K A;  4B3H A;  3MP7 B;  1ZQ3 P;  5KKZ C;  4XON A;  3JRC A;  1LT9 B;  4JYK A;  3OS2 A;  4DBR A;  5KLV E;  2E1M B;  2X9D A;  3H2Z A;  1OXZ A;  4KIC A;  3LSK A;  3GVA A;  4IOA F;  1G1J A;  4D5F A;  2CJJ A;  4NNJ A;  2KS1 B;  2DTZ A;  1S5L E;  2X1D A;  1ZAR A;  1ZAO A;  3CD6 P;  2YKP A;  3C2G A;  2LLK A;  1Y1W J;  2L91 A;  1JUM A;  4AUW A;  1N8R Q;  2ECC A;  2JSP A;  4HX8 A;  3DKY A;  1AKH A;  3OYD A;  2UZK A;  1U5T A;  2HYJ A;  4BGD A;  3OYH A;  1JCC A;  4PV1 D;  4IHY A;  3CCQ I;  3I4N J;  1BE3 G;  5EFW B;  3V4Q A;  1YJ9 P;  1NK2 P;  1U8B A;  5FJ8 J;  2QG4 A;  5B5E E;  1QO0 D;  2DO7 A;  2M8E A;  2X6O A;  3LSJ A;  3G9R A;  1OMI A;  4G7H F;  1YIJ I;  2LXB A;  1FZC A;  4II3 A;  2C6Y A;  2ZXX A;  2N1T D;  2R7Q A;  2ZAE B;  4I76 A;  3CXH I;  1M66 A;  4WXC A;  2LKS A;  3ZR8 X;  2A5Y B;  1K4S A;  1W36 D;  4ASN A;  2M5A A;  2OTL I;  3IWZ A;  3K1P A;  1G4D A;  1D0X A;  3NQO A;  2WTB A;  2YKQ A;  4HKZ H;  4JBZ A;  3QYB A;  1GLN A;  1UHW A;  2O03 A;  5D6E A;  3CC2 I;  5EZG A;  3ABU A;  2QJK C;  3F22 A;  1JUS A;  3PFI A;  1FTZ A;  1SQX J;  1BCC G;  1NAY A;  1LTJ A;  4OIO F;  4O3M A;  2DFI A;  3D0S A;  1OVR A;  1PPJ E;  1IGN A;  2KL4 A;  4YPC A;  2ZFW A;  3FXJ A;  4PV1 B;  3BTI A;  1YQ3 C;  2HFE D;  4OVN F;  2NVT J;  2IBZ E;  3J7A Y;  4A3M J;  3OYE A;  3L72 G;  3GFJ A;  5GAH J;  1NTC A;  5E3L A;  2N9Y B;  4IL6 E;  3P9I A;  4M3L A;  5GTI E;  1S5L C;  2NPS B;  2BYV E;  3V8L A;  1U8R A;  1S72 I;  3HOX J;  3AEC C;  3JTG A;  2HQN A;  2KJB A;  1JE8 A;  3C2B A;  2W84 A;  3I3L A;  1KZU B;  5ICG A;  3K6J A;  2L2O A;  1DQU A;  1R00 A;  2CS3 A;  2KK7 A;  3RK2 C;  1RES A;  3TL4 X;  1OYW A;  3DLL F;  1N73 B;  2WB1 N;  2QRX A;  3KQG A;  1K61 A;  5B5E C;  5EYR A;  2ZJS E;  3H9G A;  5LHG A;  1T6S A;  3CF5 F;  2K9J B;  2WPS A;  3EYI A;  2WSE H;  4MTE A;  2H6B A;  2KFD A;  5D4R A;  1X0V A;  3K4N A;  4JQ0 D;  4U3F G;  5J3L A;  1P84 E;  2IA0 A;  2C0W A;  3CWB G;  3BR0 A;  1TW3 A;  4PJ0 E;  4U7D A;  3CTA A;  1ZN2 A;  2F4O B;  4D7N A;  2XKP A;  1BSN A;  3RCO A;  4AID A;  1URQ D;  5HS9 A;  1HF9 A;  3CJQ B;  3K0L A;  3H1L D;  2QYT A;  2KZV A;  1ZRF A;  3GEZ A;  4RB3 C;  2OJE D;  2KIQ A;  2VXD A;  3GZN B;  3AE6 C;  4GO1 A;  4HX4 A;  3FBN B;  3HRN A;  2DT7 B;  1QQI A;  2QSG X;  1IFM A;  3V2P A;  2XAJ A;  3RKX A;  3HB9 A;  2HPC A;  1NVO A;  4A0X A;  1IRX A;  1TWF J;  4HNU A;  1ZGW A;  2E7X A;  2KKO A;  3PNY A;  5K7F A;  4JYC A;  4HRI A;  3HTK B;  2NVX J;  2RAE A;  2ZNY A;  4IL6 C;  3WTY C;  4FET A;  5GTI C;  3ABT A;  1BJZ A;  3SSU A;  4RDU A;  1DP3 A;  1DD3 A;  2IGO A;  3G1O A;  4A3B J;  3FBI B;  4NPF X;  3VMY A;  2IAI A;  3HUG B;  3PEF A;  2K9Q A;  2P7V B;  1LNQ A;  4G94 A;  3WU2 E;  1CF7 A;  4A0Z A;  4S05 A;  5A9S B;  1KFN A;  2KIK A;  1ZRD A;  1PVE A;  2ISY A;  5IOY A;  3O6Q A;  1VQK P;  3P8C D;  1Q86 Q;  3H32 A;  1XGO A;  4CCJ A;  3CD6 I;  1KOR A;  1X3W B;  4I2O A;  2QBY B;  2HOD B;  3GX4 X;  2FMY A;  3V2N A;  3HOS A;  2OA4 A;  4I0A A;  1GUU A;  3PLR A;  3FHN A;  1F43 A;  4QSH A;  5FKO A;  3L75 D;  2WPQ A;  4MGR A;  4KIF A;  3IH3 A;  1YJ9 I;  1K78 A;  4PJ0 C;  1XCV A;  1Q7Y Q;  3GTL J;  5DCM A;  5ED4 A;  3R0J A;  4MHG A;  1RQU A;  1VI0 A;  4IFD K;  3ELK A;  2Q6Q A;  4R4L A;  3W6J B;  5LGT A;  3MTU E;  1N7S A;  5C39 A;  2QJP B;  1S5L H;  4ZDL A;  1KTM A;  5LD2 C;  3REO A;  2O01 N;  2DXI A;  2OFP A;  3Q5R A;  4LMY A;  1FDM A;  2W1O A;  4YFK F;  1QHH D;  3H0D A;  2Q1K A;  1S6L A;  2WSC H;  3BPX A;  1HSJ A;  1Q2N A;  2BAS A;  3Q5P A;  2A5W A;  2ADU A;  5E20 A;  2IW5 A;  3GZ6 A;  3F72 A;  3W2A A;  2LK2 A;  3GHG C;  1Z7U A;  3EDP A;  4HNV A;  2DTR A;  4PZD A;  5B5E H;  1EZV G;  4XE5 B;  2OF7 A;  3FX0 A;  4XRF A;  1KZH A;  3GTJ J;  3PLN A;  3D5S C;  1NHA A;  3S2H J;  3B4S A;  2VL8 A;  1CSB A;  3DWL E;  2O1J A;  2CQ7 A;  1FEX A;  3IQD B;  2X85 A;  4KJM A;  3GME A;  4H13 C;  3BJ6 A;  1T98 A;  3HPG A;  5BU8 B;  1ZK8 A;  3WU2 C;  2AHQ A;  3C1L A;  2PGD A;  1ZLL A;  3MKY B;  1HW2 A;  1R23 A;  4WY4 D;  2B87 B;  4HST A;  2XPV A;  2PFX A;  3PL8 A;  2LKX A;  2OUM A;  1BIB A;  2QSH X;  3RK3 D;  2R0Q C;  5BOX A;  1V4R A;  3H25 A;  4IHS A;  4DJG A;  2Z5U A;  2MA3 A;  1FMV A;  3CL3 D;  3DEU A;  1GV2 A;  3M7G A;  1RUN A;  3GHY A;  4CYC B;  2FXA A;  1F12 A;  4GOF A;  3G6E P;  3W6K B;  2E1O A;  1MNM C;  4L5J A;  3ML6 A;  3B5N A;  4U3F D;  3TMO A;  1URQ A;  3I83 A;  1BDC A;  2D2C D;  4D9J A;  3VWB A;  2HOE A;  2YS9 A;  5EEG A;  3A2K A;  1KIL B;  1LP1 B;  4IL6 H;  4E7H A;  5GTI H;  4N4O B;  5E3O A;  1L0N D;  4CPG A;  1IFN A;  1FJK A;  4Z2Y A;  4PJJ A;  2FYU J;  2L7Z A;  2Y48 A;  2W90 A;  4HW0 A;  1PUF A;  1MDM A;  2O01 H;  2IA1 A;  2XRN A;  3BZ6 A;  1B6A A;  2JK3 A;  3CLQ A;  1ZKG A;  4IHT A;  4DYD A;  3JCU E;  3L71 G;  1R58 A;  3DBL B;  1T38 A;  2OZU A;  1JDJ A;  3MKL A;  4HV5 A;  5DS9 A;  3FDY A;  3TGU J;  2L9S A;  3ADO A;  1BGY G;  5IPA A;  2FE3 A;  2VIX A;  3KET A;  2XF5 A;  4I2L C;  3H1I J;  1O7L A;  1FIA A;  1RNL A;  3AG1 H;  4M6X A;  3P7N A;  5CVU A;  2VUM J;  1LE8 A;  4ZYH A;  1RZ4 A;  1Z6T A;  3V7C A;  2HFH A;  2NVY J;  3ZN0 A;  1WRG A;  3TSI A;  1Y8Q B;  3OYC A;  1P84 H;  3PIP F;  2QJY B;  4RKU J;  2V7F A;  2P5V A;  5AVY B;  3WGG A;  3HDD A;  2XU6 A;  4PJ0 H;  4CCO A;  4IOI H;  3H6P A;  4JK1 X;  3BQY A;  3WG9 A;  5IP6 A;  5IYD J;  2DDA A;  1ULY A;  3WUT A;  2G3A A;  3CUQ B;  2COM A;  1KYO D;  5KLI B;  1VL2 A;  1SVM A;  4Y28 J;  5J8C A;  1X0X A;  1FU1 A;  3HD7 D;  5AVW B;  2ZJ2 A;  1DGR M;  4OGQ B;  4FX0 A;  2K27 A;  1I3Q J;  3BR3 A;  1NTK D;  2R7R A;  4PV1 C;  5CJ9 A;  2HYF A;  1D0Y A;  2FOW A;  2EJR A;  2I5U A;  3FZV A;  4GYI A;  3SEQ A;  2J59 M;  3BCC G;  2OYH B;  2LDU A;  4EIJ A;  1LUJ B;  5AW5 B;  3K7A J;  1ZME C;  5D8L B;  2VBW A;  1S2E A;  1VQK I;  1SC7 A;  3E6B A;  4FTH A;  3CCM I;  4E7I A;  1OW7 A;  3H1J G;  2N1T C;  2VOD A;  3HUS C;  2IGM A;  2PQ8 A;  3FR8 A;  4DT0 A;  5FKM A;  1FC3 A;  4BHP A;  1LSO A;  3FIS A;  2VBX A;  2LH9 A;  3WTT C;  3JCU C;  3MFK A;  4YIF A;  2ZJR F;  3MOG A;  3WU2 H;  4L9V A;  5J1U A;  3RYP A;  3H1L E;  1Y8R B;  3QYF A;  1ZHF A;  1Q90 D;  4CIC A;  4C7N B;  3HRM A;  4J01 A;  1FY7 A;  4MEY F;  5FKN A;  3L70 J;  1KYW A;  3TO6 A;  3S4R A;  4AYB A;  2HYN A;  2EZH A;  4CHU A;  1YRN B;  2C9N Y;  2EIM H;  3OYI A;  1PZQ A;  3USS A;  3HOW J;  4CCM A;  1FDO A;  1ZXG A;  2FQ4 A;  2M7A A;  3PSI A;  1X2N A;  1MFT A;  3BWG A;  4G6Q A;  4AC0 A;  2HS5 A;  3WFI A;  4WY4 A;  2H09 A;  4EJT A;  1J0R A;  1R1T A;  1BG6 A;  2K1A A;  3OMY A;  5CCG D;  1OCO H;  4AU7 A;  1MJA A;  2DLL A;  4R1N A;  5LRS A;  2V1U A;  5TIS E;  1SQP K;  1K05 A;  1O57 A;  3H1K J;  1V3F A;  2Q3I A;  4F3Q A;  4JX5 A;  5LEJ A;  5EGO B;  1W2B O;  2KLU A;  3A5T A;  5MGB A;  1I6X A;  4KN7 X;  3LQQ A;  2DT5 A;  4GDF A;  3P8C E;  1GV5 A;  4F93 B;  1PIX A;  2LR2 A;  3FXM A;  2CW0 F;  3IP4 B;  3GTO J;  3W6Z A;  2ZNZ A;  4LD5 A;  5EG0 A;  3LIE A;  3PJS K;  1S29 A;  3NTN A;  1QZZ A;  1KMI Z;  4A3C J;  3L75 E;  5BU5 A;  5FD5 A;  3WTX C;  4EJV A;  2YSR A;  2DA6 A;  3KYL A;  3ZHB A;  3ZQQ A;  4XSZ F;  2MKV A;  5GTH C;  1ETK A;  1IN6 A;  2R5B A;  1SAN A;  1L0L G;  4HX7 A;  3HG9 A;  4XL9 A;  1URQ C;  1JY2 O;  2OU2 A;  2XAQ A;  3ZQL A;  3FMQ A;  2OQQ A;  3PIO F;  3FXQ A;  1VQM I;  4HV6 A;  2DA1 A;  3BDD A;  1VQP P;  4J00 A;  4C2U A;  1JY2 N;  4G12 A;  2DMP A;  1L4A B;  2YXQ B;  1P9Q C;  3TDK A;  3GTM J;  3KDP B;  4NUB A;  4XID A;  3CCV P;  2E60 A;  1B72 A;  1SEU A;  1KIL E;  4P9U A;  1BA5 A;  3L72 E;  2ZME C;  3E97 A;  3DV8 A;  2FYN C;  2QJP C;  3F6V A;  3V2R A;  1G3S A;  5JE8 A;  4HSR A;  5TIS C;  5FLM J;  3VYU B;  1DIP A;  2M4G A;  3LMM A;  3ZPL A;  1Y9B A;  1R7J A;  2VJJ A;  2OTJ P;  1JTY A;  2PJR A;  2CPB A;  3JCU H;  3HM5 A;  2YMY A;  1ETX A;  1BR4 A;  1YJQ A;  2R3S A;  4PSX A;  4OIN F;  3GUD A;  1NU1 G;  2V7Q H;  1KN7 A;  2E75 D;  1B8I A;  1QPM A;  3RK3 E;  4O5V A;  3S3M A;  3W2V A;  3PQK A;  1UST A;  4ON0 A;  1D1C A;  1QMG A;  1CI6 A;  4U3F E;  3H1J D;  4HJG H;  3AL0 B;  4A6D A;  3D5R C;  1XGS A;  2XGC A;  2WSF J;  1SFE A;  2K9L A;  1YJW I;  3K5B A;  1LDD A;  3E7L A;  1NTK J;  3LSG A;  1IFI A;  3OOP A;  1L0N E;  4HG2 A;  1YB4 A;  2JWD A;  3Q3S A;  5AW0 B;  2PN6 A;  1WVR A;  2GXG A;  2R7O A;  4FT8 A;  2QSI A;  5APW A;  3DU6 A;  1D3Y A;  3ADP A;  2NRG A;  3LW5 H;  6PAX A;  2Z1D A;  2JA6 J;  1OFC X;  2M0B A;  5BS6 A;  1A31 A;  2QM3 A;  2PLA A;  2VE8 A;  4DLL A;  4BH9 A;  1HOM A;  1OIP A;  1S9K D;  3CCL I;  3WHB A;  3AG2 H;  5CCG A;  3F3X A;  1W7P D;  3L74 J;  5DDG A;  1XTC C;  5AYV A;  2X0L A;  5FGM A;  1YVE I;  1TQI A;  1Z3Y A;  2CWE A;  3D1N I;  2OYO A;  5EZH A;  2QQA A;  1TNS A;  2KRH A;  2A06 G;  2K3R A;  1QLE D;  1N7L A;  4LLN A;  3QOP A;  1L3L A;  1HCR A;  1TWC J;  2FBW C;  4B8X A;  2UV1 A;  2QCO A;  4B47 A;  1FOX A;  2IBZ I;  3F3S A;  2H1K A;  1SQX K;  2KIU A;  1VFC A;  1GHC A;  1OX3 A;  1KYO E;  1MZ9 A;  4WY4 C;  3TNU B;  2L4A A;  1HKS A;  2GOM A;  2EZI A;  2LYC A;  3Q0V A;  3CCU P;  4ZNC A;  2R5Z B;  2UXN A;  3RK3 C;  1NTK E;  3LOC A;  3BG9 A;  1Z67 A;  3ERM A;  3DLA A;  3R6S A;  4RB0 A;  2QGU A;  2I10 A;  4CUG A;  4N78 D;  1SFC B;  3E0J B;  2F4I A;  3SDB A;  2D2C C;  3D71 A;  2D3T A;  1OW8 A;  1WDM A;  1ZOY C;  1FBM A;  1L0L D;  1ETQ A;  2K4B A;  4KDP A;  1Y47 A;  4XIC A;  3C7J A;  1LKX A;  2QA4 P;  1AVY A;  3JSO A;  2P2U A;  5AVU B;  2DN0 A;  1K6O A;  5TIS H;  1ETY A;  1ENH A;  3HOU J;  2M8G X;  2W48 A;  3MAJ A;  5HWS A;  2IJL A;  1ETV A;  3M9B A;  4M9X A;  2K88 A;  3S93 A;  4XN0 A;  1M1J B;  3L6D A;  2JDI H;  2X6W A;  3BQZ A;  3GBG A;  1NG7 A;  1X8Y A;  5ICE A;  3A01 A;  3A03 A;  1A35 A;  4U0Y A;  3CCR P;  5CHX A;  1D0Z A;  3ZMU A;  1IFP A;  1V5E A;  5CJ0 A;  1KU9 A;  3VSK A;  4NC7 A;  2L0K A;  4RB2 C;  2EV0 A;  5JR3 A;  3KE2 A;  4CZC A;  4RM3 A;  4OQZ A;  4W97 A;  3MEX A;  3GLM A;  1HJB A;  3TW6 A;  1OPC A;  4BY7 J;  2F5E A;  4GIF A;  1R71 A;  1UII A;  1UHM A;  1GU4 A;  1SQQ D;  3CMY A;  4II2 A;  1NYH A;  1FJP A;  1LFB A;  1IZN B;  2XDJ A;  2YIU C;  3HD7 C;  1R6R A;  4BJ6 C;  2W82 A;  2BW3 A;  1H0T A;  2JA2 A;  2ZSH B;  3KLN A;  4S0H B;  2R5Y A;  2KZJ A;  2LSO A;  3AEB C;  2FXP A;  1FP1 D;  2W24 A;  2ETH A;  2Z3Y A;  1AU7 A;  1JTH A;  3H1H G;  1WJE A;  4BS9 A;  3HKZ A;  4CCL A;  2TCT A;  4CGZ A;  3BP8 A;  1K79 A;  3Q0W A;  1V54 H;  3FGA D;  4HNT A;  3ZQ7 A;  5APY A;  3X2Q H;  5KLV D;  3P32 A;  4GOE A;  4G8X A;  5HLG A;  2XV4 S;  4YCA A;  3BOQ A;  1SAX A;  2YPR A;  1ZEL A;  2X51 A;  4WCG A;  4HYT B;  4HEA 2;  4EQQ A;  2XRO A;  1FOK A;  3ZGY A;  3HDH A;  4OOI A;  4RAF A;  4PD4 D;  1W7P A;  3QOE A;  3IN6 A;  1F36 A;  5FRN A;  1MBK A;  2LBF A;  1UMQ A;  3I4M J;  3OL4 A;  2HOS A;  1DGW Y;  1RF1 B;  1YTY A;  4NQW B;  1L0O C;  4BHC A;  3WTW C;  1WZ2 A;  3KEQ A;  5H20 A;  3G73 A;  4LFU A;  1OVU A;  4WWI A;  3OSF A;  3DTI A;  2Y0M A;  1A6I A;  3OY9 A;  2JWA A;  2HOA A;  3HSE A;  3B71 A;  1SD7 A;  2DAO A;  4RM2 A;  1T95 A;  5CCG C;  2GAU A;  2HPI A;  3HHG A;  1M8O B;  4LK0 F;  5AW8 B;  2JP3 A;  3E5Q A;  3GLL A;  4FQG A;  2KRC A;  3SFI A;  3GW6 A;  1MD0 A;  5FLX K;  2ITA A;  2K85 A;  1JJ6 C;  3V5B A;  3GZ5 A;  3VMX A;  4I98 B;  3ZOB A;  3IC7 A;  1BI0 A;  3CCU I;  2FML A;  2KIS A;  1M75 A;  1H88 A;  2Q2E B;  2E76 B;  2FQ3 A;  2DFH A;  3I59 B;  3RKY A;  5EEA A;  3AE7 C;  1YIO A;  3M07 A;  4AVZ A;  3H1J E;  3HRT A;  2AS5 F;  1FJL A;  3TO7 A;  3DPT A;  5FKK A;  4DNC A;  2M3B A;  2XKO A;  3WMM 0;  1FT9 A;  3ABK H;  3SFZ A;  1IXS B;  1K04 A;  3HE5 A;  1RC9 A;  4XN3 A;  2OBP A;  1TC3 C;  4E70 A;  5GAG J;  1KYO H;  2OQG A;  1DU6 A;  1YIT P;  4OMZ A;  3CCQ P;  2WSE J;  4H44 B;  1VQO I;  2D1H A;  3KP2 A;  2EV5 A;  2PBI A;  4Q48 A;  2VKD A;  3ZMZ A;  2W7N A;  2NXN B;  1J1D C;  4RO0 A;  3DTK A;  1S9K E;  5FFZ A;  3K96 A;  4XLN F;  3RQS A;  5AW7 B;  1SQV D;  1YIJ P;  3HOV J;  2RQQ A;  2OAR A;  3CCR I;  4M71 A;  2AEM A;  1P6R A;  5M5X J;  1I6H J;  1HXD A;  2WB1 A;  2OTL P;  2MC4 A;  1MMD A;  2Y9Y A;  1P2F A;  1HC8 A;  2W57 A;  3C8V A;  2F5D A;  1MIJ A;  2DMN A;  5AVV B;  4N4N B;  2NS7 A;  2CV1 A;  3BCB A;  1FX7 A;  3W68 A;  3EGO A;  3RGU A;  1M1E B;  1OYY A;  3BG7 A;  3DFU A;  2E74 B;  2E75 C;  2HQA A;  2FEZ A;  1J7K A;  1OCC H;  3DPU A;  2FFD A;  3H1H D;  2IS4 A;  3ABL H;  2HGC A;  4L75 A;  1YS7 A;  2R32 A;  2WBM A;  1BOA A;  2AQF A;  2CW7 A;  2PP6 A;  1G3Y A;  3GFM A;  1FLI A;  4N78 E;  5L8R J;  4BHB A;  4LB6 B;  1SQQ J;  2KRF A;  1QVF O;  2K86 A;  4Y13 A;  4GKG A;  2EFP A;  1WDK A;  4GWG A;  3KZZ A;  1PYV A;  4UUV A;  1S72 P;  2EH3 A;  1L0L E;  3IAO A;  3SFD C;  4KIT B;  2NNY A;  3C7A A;  3EFG A;  2B88 A;  2OCC H;  4HA8 A;  5M3M J;  4JP0 A;  2L3D A;  1LT1 A;  4QPO A;  3AE9 C;  1H8A A;  5IP7 J;  1QU3 A;  3ONQ A;  3AFH A;  4JQF A;  4LOC A;  1R22 A;  2RC4 A;  1GVD A;  2XGX A;  2R92 J;  4M9S A;  5K7H A;  2NOG A;  3J81 K;  3OBB A;  2LKM A;  5KLV J;  4B48 A;  1XTG B;  4DZP A;  2JPC A;  1AWC A;  3SEZ A;  4UV8 A;  4C3J J;  1P4W A;  2JRM A;  3EUK L;  4UUS A;  3EQL F;  2YX4 A;  4XMY A;  3BTL A;  3A0H E;  2BXY A;  4ZC3 A;  1ZRT D;  1BIA A;  1SQB G;  2L7M P;  2AQE A;  4DGW B;  1MUU A;  1AKH B;  3QHA A;  1U5T B;  1KU7 A;  5CLS A;  2H27 A;  1QA6 A;  1GXQ A;  2XAF A;  4UUT A;  2ZJP F;  4C3H J;  4UNO A;  2AXT E;  5HDG A;  2FJ1 A;  1NU1 E;  1XMK A;  3OIO A;  1H89 C;  1WJA A;  4KUG A;  4MNU A;  1WSU A;  1E17 A;  1FZC B;  3LSR A;  1NTM D;  1G6N A;  2ELH A;  2DFF A;  5APQ A;  2MSY A;  1FBS A;  2D1V A;  3AEA C;  3VB2 A;  2AO9 A;  2WY8 Q;  3NAR A;  1YON A;  2XB5 A;  4HOB A;  3VOD A;  2M5A B;  1JKO C;  4Z1M H;  2B7E A;  1N25 A;  2KP6 A;  1W0U A;  4FGW A;  3IF4 A;  3TOA A;  3T1B A;  3DEE A;  4QLC U;  3K4L A;  2CV2 A;  2JA5 J;  3FX3 A;  1EH7 A;  4YFX F;  4XOP A;  1HST A;  1H88 C;  4LB5 A;  1B1B A;  3OS1 A;  1LTJ B;  2BCC D;  4Q5S F;  5CMZ A;  3MKZ A;  4FAS D;  1LWU A;  1IV6 A;  1JKR C;  2KZG A;  4RLF A;  2GXA A;  4PD4 E;  2WQY C;  3RL0 B;  3TDU C;  3U1K A;  2FF4 A;  2M45 A;  2OPT A;  1S7E A;  4D3D A;  2F5C A;  2GWR A;  5JLW A;  4R79 A;  2LKP A;  4LG0 A;  5E17 F;  4FX4 A;  1YIT I;  1AVO A;  2CQN A;  1WWX A;  3ISP A;  1MND A;  1AA0 A;  3E1R A;  3AE3 C;  2PMH A;  4HLX A;  3A0H C;  1IO4 A;  1NWQ A;  2O01 J;  2B63 J;  3WTZ A;  2NZ2 A;  4IQ4 A;  1TWH J;  1M7L A;  2E7W A;  2HVQ A;  2NPS D;  3VMA A;  5BQT A;  2HTS A;  2KMU A;  1USE A;  5KCM A;  4LLL A;  2ZXH A;  2AXT C;  4PZC A;  2XF7 A;  1WPK A;  1S8N A;  3RKQ A;  2V4H A;  3FWL A;  4U7J A;  2JTV A;  1FOW A;  2GIV A;  2FD5 A;  1FNN A;  2LG4 A;  1KON A;  5BPD A;  5KK1 A;  3GHG A;  4L76 A;  3CF2 A;  3G0O A;  1VQ4 P;  3HGY A;  3V42 A;  2VJ4 A;  3PO3 J;  1Q82 Q;  2VQL A;  1DEB A;  1L0N K;  1R4M B;  3FMR A;  4MQ9 F;  3E6M A;  1R8E A;  2V26 A;  3LSP A;  2DJN A;  4KJZ A;  2M1B A;  2IYO A;  1UB9 A;  2KHM A;  2FFD C;  1ON2 A;  2ME6 A;  1MMN A;  2YMK A;  5F0C A;  2AEF A;  2FKW B;  1M57 D;  3L73 D;  3C7C B;  3M8J A;  4BXX J;  2HXI A;  3VSL A;  1G3T A;  1SMY F;  2P6T A;  3D1L A;  2KNC A;  1X58 A;  3J7Y J;  2UWM A;  2COB A;  2FNP A;  3AEE C;  3L70 G;  3S8P A;  3TOB A;  3PTZ A;  4PCQ A;  2P7C B;  3G17 A;  2HPC B;  2HU9 A;  5D5W B;  3BT9 A;  3H35 A;  4Y7N J;  4M3G A;  2QEX P;  3HRS A;  2CU7 A;  4OIR F;  4Q47 A;  1I27 A;  2BVM A;  3FHZ A;  2WWY A;  1P7I A;  1H8A C;  4IL6 X;  1WMK A;  2E1N A;  5FFX A;  2K9N A;  5K1Y A;  4JX6 A;  5DUI A;  2KS1 A;  2EIL H;  4L9N A;  3NXS A;  2FU4 A;  3RTR A;  1WJ5 A;  2BVL A;  5KNL A;  2VE9 A;  4N9H A;  2IP2 A;  4IEJ A;  2MH9 A;  2V6E A;  1SQV E;  3H1K G;  3JRE A;  2VJI A;  2BXZ A;  3LFU A;  1SQB D;  3ABV C;  1MH3 A;  2VOP A;  1NTK K;  1R4N B;  4WVZ A;  1ZH5 A;  2R7D A;  2KLO A;  1Y0N A;  1ITY A;  4IHX A;  4BNC A;  2IBD A;  1NTZ D;  1ZW0 A;  5AW1 B;  3H32 B;  4BRY B;  2Y75 A;  4WX9 A;  1YRL A;  3DEW A;  2P81 A;  4BBS J;  1R49 A;  3V2Q A;  3VP9 A;  3IAS 2;  3FKI J;  3WHC A;  2F2E A;  1A6Q A;  3H1H E;  3JRA A;  2DDB A;  3LNQ A;  4M3F A;  1O3S A;  5B1B H;  2R7X A;  5DCM B;  1KYO I;  1RE4 A;  2IPP A;  2E34 A;  1DDN A;  1MMS A;  3PNT A;  2RDP A;  1N7S B;  3HN2 A;  3C7D B;  2H88 C;  3AEG C;  1Z1D A;  3S1M J;  3A0H H;  3MQ0 A;  4CSW A;  4S04 A;  1G1I A;  3DOJ A;  3V4G A;  5DD8 A;  1NKZ B;  2PRR A;  1NKN A;  2JRT A;  2E1C A;  4JOM A;  5ICC A;  5A9T A;  2DQR A;  3QPH A;  2IT0 A;  2GBY A;  3L2V A;  4BUP A;  4AVP A;  1AHD P;  1JGS A;  1NTM J;  4W80 A;  1E3P A;  1MBF A;  2AXT H;  1Z3X A;  3F9K A;  3R4K A;  3EET A;  3PH0 A;  2HI3 A;  1N86 A;  4MLO A;  1A5J A;  2BE5 F;  4B86 A;  3S1K A;  3SWY A;  1F4K A;  4HBL A;  3G3Z A;  1MSE C;  1OVV A;  2CFX A;  1LWU C;  4H0E A;  4GOD A;  1BE3 D;  2R44 A;  3A0B E;  1BM9 A;  2NPS A;  3H5R A;  3IL2 A;  3I54 A;  3R0A A;  2N1T A;  3HUS A;  3E6D A;  3Q9V A;  3CCM P;  5HOD A;  1NHL A;  3GMA A;  1VQ5 P;  2M4K A;  2HQ5 A;  3FXU A;  3GCM A;  3GWZ A;  5C3E J;  3T8R A;  3MHV A;  5LGN A;  5M1B A;  2LFB A;  1ZRT E;  2EB7 A;  3QU3 A;  4R1H A;  3E6C C;  1DLJ A;  4ZZD A;  1WH7 A;  3AG3 H;  1LTA C;  4KFC A;  2V1X A;  5DM7 F;  2QM7 A;  1WH5 A;  3CDI A;  2JA8 J;  3S1R J;  3PRJ A;  2OYI C;  3GF2 A;  1K9M Q;  4PD4 H;  1T2K D;  2K40 A;  3NRV A;  5M3F J;  3F21 A;  1BCC D;  3B5N B;  5E3N A;  1RKT A;  2MYS A;  5IOZ A;  2DK8 A;  4GGG A;  4KT5 C;  1IV8 A;  2VQG A;  3ZMS A;  3AAF A;  2HVS A;  1NTM E;  4YTP C;  3NEU A;  2W00 A;  4ZTF A;  4B09 A;  1TW2 A;  4L0Z B;  1JT6 A;  1VQ4 I;  2O61 A;  1WPQ A;  4OIP F;  3FXK A;  2XVC A;  3ZGK A;  2VQC A;  2W85 A;  1IL0 A;  1ZN5 A;  3L09 A;  5TGT A;  1KIL D;  1SS1 A;  3JSV C;  3L72 D;  4NPD A;  4I7Z B;  5F0F A;  1HGV A;  2V7Q J;  3L2Q A;  1NGM B;  3S15 J;  2A6E F;  3CUO A;  2BCC E;  1AOY A;  2X48 A;  3BAT A;  3HRU A;  3BG5 A;  4M72 A;  4EJO A;  4M3D A;  3S1Q J;  2RMZ A;  3O8Z A;  2LD5 A;  2E43 A;  3LFK A;  3RYR A;  1LE8 B;  2KI7 B;  4OAY A;  2Z5H A;  2KZI A;  4MTD A;  3H9Q A;  2ZVO B;  3A0B C;  3JTH A;  1LB2 A;  2Q1Z B;  4XRS G;  3HSF A;  3CX5 D;  1LT9 C;  2QEX I;  1FYL A;  3FK6 A;  1TT5 B;  4EM1 A;  1M56 D;  2P67 A;  4XFJ A;  1GD2 E;  1XDU A;  2E1M C;  3GTQ J;  5KVR A;  2HDC A;  5J47 A;  3AED C;  5A9S A;  2DT6 A;  2H6C A;  3C3W A;  4LK1 F;  4OL9 A;  2FNA A;  4XLC A;  3CWB D;  3RPU D;  1R1U A;  3OYN A;  4IF4 A;  5K5Q A;  1YJN I;  3LW5 J;  3TK1 A;  4AWX B;  1SMT A;  4BQO A;  2QBY A;  3CCS I;  4XBF A;  4EVI A;  2HOD A;  1VQM P;  2LF7 A;  1X4O A;  2P5L C;  1GXP A;  4L74 A;  3RQI A;  3ZQH A;  1YYC A;  2I8D A;  4OGQ D;  4LGW A;  3ABM H;  2ZCW A;  2JMW A;  3H0G J;  2CUE A;  4QIW N;  2IDB A;  5APT A;  3IH2 A;  3IR9 A;  4PDK A;  2NRA C;  3P9K A;  4RAG A;  4UB8 H;  3OYL A;  1OLT A;  4IHW A;  3EFF K;  4I1L A;  2ZME A;  4Q4Z F;  1PPJ G;  2JT1 A;  5KHD A;  3Q3C A;  4Y52 J;  1MW7 A;  2EWN A;  4IZZ A;  3L73 E;  5DV5 A;  4KUM A;  1RE4 C;  3WG7 H;  2M34 A;  3WFJ A;  3H1L J;  1RET A;  3ZWA A;  1F9N A;  4WK8 F;  2WAE A;  2QQ9 A;  5F1R A;  1FS0 E;  2BEZ F;  2E19 A;  3LL7 A;  1OKR A;  4NB5 A;  3LWF A;  3HAD A;  2DJI A;  3E5X A;  3B8E B;  4IJA A;  3D70 A;  4EDF A;  1J5Y A;  4A3D J;  2YR2 A;  1KS9 A;  3ZW9 A;  1LJ8 A;  1OCP A;  2CRG A;  4LLG F;  5JHF A;  1BL0 A;  5E3M A;  3HE4 A;  2O0Y A;  3CO7 C;  4WBA A;  2DBB A;  3J7Z I;  1SVF A;  3CJT B;  1IZ1 A;  2GOX B;  1Z7L A;  1BC8 C;  4EMS A;  1UAA A;  2K5C A;  1BC7 C;  2YKO A;  4DYR A;  3OW2 O;  4ZJZ A;  2EW2 A;  1YJW P;  1K83 J;  3SZG A;  4I7H A;  2BV6 A;  1SQB E;  2ELK A;  1T2K A;  4XKV A;  2NPS C;  4GT1 A;  5HLT A;  3OV8 A;  1FYM A;  3RDI A;  3N7N A;  1VQ5 I;  1AQT A;  3I64 A;  1NTZ E;  3IH4 A;  1VQ7 I;  3TO9 A;  2XDV A;  4NBQ A;  4CYC A;  5LHI A;  1WI9 A;  1J9I A;  1LTB C;  3SZT A;  3RSN A;  2VPR A;  1HLV A;  2VB6 A;  1DU0 A;  1PUE E;  1N73 C;  4IO9 F;  1KIL A;  3L75 J;  3CCL P;  1LP1 A;  2DA7 A;  3A0B H;  3DPL C;  4U88 A;  4I0B A;  2QE7 H;  4HH2 A;  2DI3 A;  1VND A;  3LQR A;  2R7V A;  2R3C A;  4OMY A;  3CQZ J;  4CYD A;  1EZV D;  5D5X B;  1AV1 A;  4A93 J;  2XB0 X;  3VFZ A;  2Y69 H;  3GF3 A;  2VXZ A;  4I09 A;  2ESH A;  1D7M A;  5E1Z B;  5ILS A;  3G71 I;  4XOT A;  1BCC J;  2W6B A;  2IFM A;  1OIS A;  2XGD A;  2DU9 A;  5DD4 A;  3RIR A;  3NFQ A;  5LBQ A;  1XSX A;  3L2U A;  4XKC A;  1SVL A;  2RQP A;  1Z82 A;  4G6T B;  1MJB A;  4EAT A;  4B43 A;  3K9T A;  2KXP B;  1L4A D;  2ELJ A;  1S7A A;  2QKM B;  1B72 B;  3L2W A;  3L7W A;  3GTG J;  1IN4 A;  2JPB A;  3L72 J;  5LFA A;  3B02 A;  4C3I J;  4EM2 A;  3OJA B;  1BE3 E;  3LA2 A;  2HTJ A;  1YW8 A;  4BQA A;  1SQQ K;  2WY7 Q;  3BTC A;  3CUQ A;  4HF2 A;  3PFY A;  1XC5 A;  2CPS A;  2P10 A;  1JEK A;  4MQV A;  4XQF A;  2EFW A;  2DW4 A;  3KXD A;  3MCZ A;  3F5H A;  2NOJ B;  3QH9 A;  1S9H A;  1VQ8 P;  4PZE A;  1WI3 A;  1N78 A;  2K4J A;  4HPQ A;  3WUU A;  1U78 A;  3P7K A;  2MC3 A;  2TDX A;  2OYH A;  2K02 A;  1HF0 A;  1B8I B;  2A45 H;  2PMU A;  5APS A;  1T56 A;  1RE3 C;  4BY1 J;  1YQ4 C;  3LSM A;  1IJW C;  4RGU A;  2ZVN B;  3L71 D;  5KLV K;  1CI6 B;  2HQR A;  4U3F J;  1BCC E;  3KYD B;  2M0C A;  1BGY D;  5F0H A;  4E7J A;  3K10 A;  1UJ8 A;  5D5V B;  2FBH A;  5J6X A;  3W2W A;  2K9S A;  1PPJ D;  3BC8 A;  3M91 A;  2OQR A;  3HC7 A;  1XX5 A;  1L0N J;  4FHT A;  2HDW A;  2ZKZ A;  2ZXI A;  2DMU A;  2DMT A;  2W25 A;  3T8T A;  1Y1V J;  1S7O A;  5LHH A;  1MV8 A;  1R5H A;  4KIS A;  4C7N A;  1P4X A;  5K5O A;  2HKO A;  4BQQ A;  4IFF A;  3HD7 A;  1UIX A;  3V8J A;  1XG1 A;  1JXS A;  1VF5 B;  2V9V A;  2HWV A;  1RRJ A;  4HQM A;  3FWN A;  1RY3 A;  4Y99 B;  3CPW O;  2G7U A;  5HDN A;  2Y9Z A;  1V5G A;  3HGG A;  2L5G B;  3E5U A;  1LPQ A;  1O7F A;  1QNT A;  4XK4 A;  5F04 A;  1KU3 A;  3BCC D;  1MBE A;  4E4H A;  5FRM A;  1M67 A;  3OYA A;  2JVH A;  3KX2 A;  1N77 A;  2DPU A;  1J1E B;  2OGU A;  4RBO A;  4PD4 I;  2KDO A;  3AE8 C;  2A07 F;  4G9Y A;  4TT3 H;  1IDZ A;  2HZT A;  3OYF A;  2IFN A;  1GDT A;  2GQQ A;  4UVA A;  4K35 A;  3F8F A;  5D6F A;  3S16 J;  1JCD A;  1SQP G;  2QM8 A;  2ZT9 B;  1MBH A;  3CWB E;  2G0E A;  2KIM A;  5AVQ B;  3U1A A;  1Z0X A;  2LOO A;  3CCE I;  1XCB A;  2DQL A;  5CVJ A;  1X0T A;  3PDU A;  2K3F A;  2KLV A;  1JY3 O;  3JAM K;  1JJ8 C;  2GA2 A;  1T2K C;  2EV6 A;  3OR1 C;  4L0Y B;  1DX7 A;  4AUX A;  1YI2 I;  1W5C E;  2Y31 A;  5J8F A;  3RBX A;  1JY3 N;  2M9H A;  2Q0O A;  1CGP A;  1I36 A;  1SFC D;  1FYK A;  4P5O A;  1ZGJ A;  1PGP A;  1YTZ I;  3ASO H;  2JQ7 A;  4D6T G;  1OYI A;  2HOT A;  2KQR A;  1U7J A;  5GPA A;  1QRY A;  3CKY A;  2CQQ A;  1KIL C;  3BVH A;  4IRI A;  3WUV A;  5CYV A;  2QF7 A;  3CP2 A;  1WP4 A;  2FUG 2;  3TW7 A;  3WGI A;  4L9J A;  2CGP A;  1L4A A;  2FYZ A;  2IEK A;  4BWN A;  3SHF A;  5CQE A;  4AYC A;  3A01 B;  1ZP0 C;  2JEE A;  1T6A A;  1SQV K;  4H4K C;  4BYY A;  4U7B A;  2Z33 A;  4F92 B;  3ZQC A;  1Z77 A;  1DPU A;  1OR7 C;  2AEJ A;  5APU A; 
#chains in the Genus database with same CATH homology
 9ANT A;  3Q0U A;  3K6J A;  5M5X J;  1I6H J;  3ZQF A;  2I9P A;  5C44 J;  1RES A;  2Y9Y A;  3IV5 A;  2WB1 N;  2L9R A;  3TED A;  2O7O A;  2DMN A;  1K61 A;  3BR2 A;  5EYR A;  1P7J A;  2NS7 A;  5EG0 B;  1MBG A;  1APL C;  2VI6 A;  3EGO A;  1RPW A;  3DFU A;  1X0V A;  4JQ0 D;  1JTX A;  5J3L A;  4BKX A;  2R5Y B;  1JKQ C;  3BR0 A;  4D7N A;  4E13 A;  1OCT C;  1F17 A;  4M6V A;  2QYT A;  4GWG A;  1WDK A;  3GTP J;  2EH3 A;  3CDL A;  3CCY A;  3C7A A;  4FE7 A;  3PID A;  5M3M J;  4JP0 A;  3HB9 A;  5IP7 J;  2ZYA A;  2E2J J;  2O8K A;  4A3G J;  1TWF J;  1ZGW A;  4LOC A;  5K7F A;  1GVD A;  4M3B A;  2R92 J;  2P4Q A;  3B6A A;  2NOG A;  2RAE A;  5K7H A;  2NVX J;  3OBB A;  4DZP A;  1BJZ A;  4RDU A;  2VKV A;  1CQT A;  1EF4 A;  5DTD A;  4C3J J;  2CQX A;  3G1O A;  4A3B J;  2IAI A;  1RR7 A;  4UUS A;  2K9Q A;  3PEF A;  5A9S B;  3BTL A;  2WV1 A;  3B6C A;  5IOY A;  3GTK J;  1I50 J;  2L7M P;  1AKH B;  3QHA A;  1NK3 P;  4GWK A;  4UUT A;  4C3H J;  2DA5 A;  1GUU A;  2FJ1 A;  3PLR A;  1F43 A;  4QSH A;  3OIO A;  5FKO A;  1H89 C;  1MBJ A;  4KUG A;  4D3S A;  3IH3 A;  1G2H A;  4JPZ B;  3VPR A;  3HWR A;  1U9N A;  3LSR A;  3GTL J;  1ORK A;  4A3L J;  2MSY A;  1VI0 A;  4A3E J;  1DLI A;  2AO9 A;  2WAQ N;  3NAR A;  1YON A;  2XB5 A;  3BR5 A;  1JKO C;  1IC8 A;  1W0U A;  4FGW A;  4J0F A;  2DMQ A;  2JA5 J;  2OFP A;  3SDG A;  1E3O C;  1H88 C;  3PO2 J;  4EZB A;  4GBJ A;  4I6Z A;  2LK2 A;  1IV6 A;  4HNV A;  1JKR C;  1YRN A;  4PZD A;  2YUS A;  2IZ1 A;  2OF7 A;  3GTJ J;  5EDN A;  3S2H J;  2OPT A;  1S7E A;  5FLV A;  1BW5 A;  3JR9 A;  1ZCJ A;  4D3D A;  1YJ8 A;  4D7M A;  5JLW A;  1FEX A;  2ZB9 A;  3IQD B;  3SJM A;  2EBI A;  4MO7 A;  3TP0 A;  3W6V A;  1POG A;  5J1R A;  1ZK8 A;  2AHQ A;  2ECB A;  1GT0 C;  1EVY A;  2PGD A;  5EGO A;  3JRI A;  2B63 J;  1TWH J;  3ULK A;  2XPV A;  2LKX A;  3OSG A;  4IM7 A;  1WDL A;  2R0Q C;  3M3Y J;  4PZC A;  1WPK A;  3RKQ A;  1GV2 A;  5C4J J;  3GHY A;  4CYC B;  2MGQ A;  1F12 A;  2E1O A;  1MNM C;  2FD5 A;  4B3I A;  2ID3 A;  3I83 A;  3HBL A;  3G0O A;  3HGY A;  2EZK A;  3PO3 J;  2YS9 A;  2JWT A;  1QVT A;  3LSP A;  1O4X A;  5E3O A;  2DJN A;  2KT0 A;  2L7Z A;  2IYO A;  2W90 A;  3L1P A;  1PUF A;  2ME6 A;  3O8G A;  2JK3 A;  5F0C A;  1ZKG A;  4DYD A;  3C7C B;  1D5Y A;  2E2I J;  4BXX J;  1JDJ A;  2HXI A;  3MKL A;  5DS9 A;  1QPI A;  2HXO A;  1X58 A;  4XRS A;  2YU9 J;  2COB A;  5IPA A;  3ADO A;  3JRG A;  1FIA A;  4J19 A;  3RZD J;  3G17 A;  2VUM J;  1QVU A;  1LE8 A;  1PGO A;  1N1E A;  3BT9 A;  4Y7N J;  4M3G A;  2NVY J;  1BW6 A;  2CU7 A;  1PGQ A;  1P7I A;  1H8A C;  3BR6 A;  2K9N A;  3HDD A;  2LTP A;  4JX6 A;  1LSJ A;  3BQY A;  5IP6 A;  5IYD J;  1IUF A;  1MH4 A;  4IEJ A;  3JRE A;  2ME0 A;  4UUS B;  1X0X A;  1MH3 A;  3H3V K;  2CUF A;  4GFB A;  3BR3 A;  1I3Q J;  3QSG A;  1ITY A;  4IHX A;  3BTJ A;  2IBD A;  2NS8 A;  2UYY A;  3K7A J;  4KUH A;  2DA2 A;  3DEW A;  2P81 A;  4BBR J;  1YRL A;  4BBS J;  1RKW A;  4C2M J;  4FTH A;  3FKI J;  1TWA J;  3WHC A;  3JRA A;  3FR8 A;  3LNQ A;  4M3F A;  5FKM A;  3K2A A;  1EVZ A;  1LSO A;  4IHV A;  3FIS A;  5FKL A;  3HN2 A;  3MOG A;  3C7D B;  2LR8 A;  4S3M A;  5J1U A;  3S1M J;  3JRB A;  3DOJ A;  1ZR2 A;  2NVQ J;  2JN6 A;  5A9T A;  5FKN A;  2GBY A;  2EZH A;  1AHD P;  1MBF A;  4AYB N;  5IYC J;  1LFU P;  2GLO A;  1YRN B;  2HI3 A;  4MLO A;  3HOW J;  1A5J A;  2FQ4 A;  3S2D J;  3UKG A;  1X2N A;  1MSE C;  4AC0 A;  3WFI A;  4EEF G;  1W0T A;  1BG6 A;  4KUE A;  3ZQI A;  4R1N A;  5HOD A;  3HOV J;  2HQ5 A;  4JX5 A;  5EGO B;  4X6A J;  5C3E J;  2R5Z A;  5MGB A;  2LFB A;  1JUP A;  1DLJ A;  3ZW8 A;  1GV5 A;  1WH7 A;  4M3E A;  3GTO J;  3W6Z A;  1WH5 A;  5EG0 A;  4W1U A;  2JA8 J;  3S1R J;  4OM8 A;  4MIM A;  2LY9 A;  2K40 A;  5M3F J;  2D5V A;  4A3C J;  5E3N A;  1RKT A;  2DA6 A;  5IOZ A;  4JX4 A;  3ZHB A;  2GF2 A;  1ETK A;  2R7Z J;  1SAN A;  4E21 A;  1M76 A;  3O8H A;  3JRF A;  5GPC A;  1JT6 A;  2FX0 A;  1WPQ A;  3ZQL A;  2DA3 A;  1IL0 A;  3QPL A;  4D5C A;  3MVP A;  2DA1 A;  5F0F A;  4G12 A;  2DMP A;  1X2M A;  1WCM J;  3S15 J;  3GTM J;  2Y0S N;  1UHS A;  2X48 A;  4V2G A;  3CTV A;  3BG5 A;  5C4X J;  4M3D A;  4XID A;  3S1Q J;  4QTR A;  2LD5 A;  1LE8 B;  1B72 A;  3OOU A;  1VF9 A;  1BA5 A;  3BR1 A;  1FIP A;  2TRT A;  1N1G A;  3QPS A;  1F0Y A;  5EF6 A;  4XRS G;  5K7Z A;  5JE8 A;  5FLM J;  3FK6 A;  4J0E A;  2H8R A;  4A3K J;  4A3F J;  1HDD C;  3GTQ J;  1JTY A;  2R93 J;  5A9S A;  3HM5 A;  3S14 J;  4OL9 A;  1ETX A;  1YJQ A;  3PM1 A;  2HDH A;  1B8I A;  3FR7 A;  3QQA A;  3RQI A;  3ZQH A;  5F27 A;  1QMG A;  2JMW A;  3H0G J;  2CUE A;  4QIW N;  5M5Y J;  4DW6 A;  2XGC A;  4B1R A;  3IH2 A;  3E7L A;  3LSG A;  4XRM A;  4B4C A;  4IHW A;  5JLX A;  2XSD C;  4A3J J;  2O9L A;  3Q3S A;  1YB4 A;  3RZO J;  1JT0 A;  2IYP A;  4Y52 J;  3Q3C A;  2JJ7 A;  1JKP C;  2HDD A;  4FE4 A;  2JA7 J;  3ADP A;  2M34 A;  3WFJ A;  1RET A;  3ZWA A;  1WGX A;  2IZ0 A;  1JGG A;  2E19 A;  1OFC X;  2JA6 J;  1IDY A;  4MFE A;  2PLA A;  4OQY A;  1HOM A;  3HAD A;  4DLL A;  3WHB A;  2EQR A;  2L7F P;  4A3D J;  1KS9 A;  2LVS A;  1LJ8 A;  3ZW9 A;  1UG2 A;  5AYV A;  3FIW A;  5M5W J;  1OCP A;  3G1M A;  3D1N I;  2CRG A;  1YVE I;  5EZH A;  1BL0 A;  5E3M A;  4FCY A;  2PMZ N;  1HCR A;  4DYQ A;  1TWC J;  2Y2Z A;  4FIS A;  2LP0 A;  2QCO A;  3F3S A;  4DYR A;  2H1K A;  1MSF C;  4MFD A;  5IP9 J;  1VFC A;  2CVZ A;  2EW2 A;  1PGN A;  1K83 J;  5GP9 A;  3G1L A;  3M4O J;  2ID6 A;  3Q0V A;  2EZI A;  2ELK A;  2R5Z B;  4E12 A;  3HOY J;  3LOC A;  3BG9 A;  1T33 A;  1FTT A;  3FK7 A;  3IH4 A;  2I10 A;  4CYC A;  3DCF A;  2XRL A;  2VPR A;  1HLV A;  1DU0 A;  2XPW A;  2D3T A;  1WDM A;  1ETQ A;  2DA7 A;  4XIC A;  1F14 A;  5A9R A;  1VND A;  1VPD A;  3CQZ J;  2E2H J;  2DN0 A;  1ETY A;  1ENH A;  3HOU J;  4A93 J;  2M8G X;  2XB0 X;  2W48 A;  5HWS A;  1ETV A;  1IRZ A;  3A02 A;  1TXG A;  3L6D A;  2X58 A;  3BQZ A;  2XGD A;  3GBG A;  3A01 A;  3A03 A;  3TP3 A;  1Z82 A;  2MG4 A;  3S17 J;  4DZJ A;  3BG3 A;  4D3F A;  2M2E A;  2L0K A;  4A69 C;  1B72 B;  1U9O A;  5FWN A;  4OQZ A;  4W97 A;  2ZYD A;  3GTG J;  2W8Z A;  3TW6 A;  4L5E A;  4C3I J;  1XS9 A;  4BY7 J;  1HDP A;  3W6U A;  3BTC A;  3CMY A;  1XC5 A;  1LFB A;  4A3I J;  3HEF A;  4S0H B;  4B3A A;  1WI3 A;  5F08 A;  2R5Y A;  4PZE A;  4V2F A;  1U78 A;  3JRH A;  1HF0 A;  1AU7 A;  1B8I B;  5IYB J;  1PGJ A;  1T56 A;  2TCT A;  5F1J A;  1R9T J;  3HKZ N;  3Q0W A;  4DCK A;  4BY1 J;  1IJW C;  1PUF B;  1M2W A;  2XGE A;  2XPU A;  1Q1V A;  2M0C A;  4YCA A;  4X1E A;  5F0H A;  4B3J A;  3MN2 A;  1IG7 A;  2Y30 A;  3WS7 A;  5J1Y A;  2K9S A;  1TWG J;  3JRD A;  3F0C A;  4B3H A;  3ZGY A;  1ZQ3 P;  2DMU A;  3JRC A;  2DMT A;  3HDH A;  1Y1V J;  4JYK A;  4DYC A;  2N8G A;  2JKV A;  1F36 A;  1MBK A;  2DA4 A;  2X9D A;  3H2Z A;  3ZWB A;  2EZL A;  1UMQ A;  1XG1 A;  3I4M J;  4D5F A;  2CJJ A;  2HOS A;  3FWN A;  2DTZ A;  4ABZ A;  2Y9Z A;  3NAU A;  3OSF A;  1A6I A;  3HGG A;  2HOA A;  1ZTR A;  2LLK A;  2VKE A;  1Y1W J;  2ZYG A;  1JUM A;  2ECC A;  4XK4 A;  5F04 A;  1AKH A;  1MBE A;  2HYJ A;  1M67 A;  4IHY A;  3I4N J;  4RBO A;  1ETW A;  1NK2 P;  1IDZ A;  1U8B A;  5FJ8 J;  3SFI A;  3S1N J;  1GDT A;  2X6O A;  3LSJ A;  3S16 J;  3PJG A;  1MBH A;  1JJ6 C;  1OJL A;  2G0E A;  1Z0X A;  2MW8 A;  3ZOB A;  4I76 A;  3ZWC A;  1M66 A;  1M75 A;  3PDU A;  1ETO A;  1JJ8 C;  4NDL A;  2KDZ A;  5EEA A;  2WTB A;  4AUX A;  5EZG A;  5BNG A;  2Y31 A;  1JUS A;  1FTZ A;  1FJL A;  2M9H A;  5FKK A;  1I36 A;  1PGP A;  1IGN A;  2HOT A;  1SFO J;  1TC3 C;  5GPA A;  1QRY A;  3CKY A;  2CQQ A;  3BTI A;  1DU6 A;  1ZR4 A;  2QF7 A;  4OVN F;  1WP4 A;  3TW7 A;  2NVT J;  2IEK A;  4A3M J;  1Z77 A;  1NTC A;  5E3L A;  3A01 B;  3HOZ J;  3ZQG A;  3K96 A;  3HOX J;  3RQS A;  3ZQC A;  3C2B A;  2GM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...