2Y9ZA

Chromatin remodeling factor isw1a(del_atpase) in dna complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
287
structure length
287
Chain Sequence
RSSTPSHPRMPKPHVFHSHQLQPPQLKVLYEKERMWTAKKTGYVPTMDDVKAAYGDISDEEEKKQKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDATKDRMKKED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)
publication title Structure and Mechanism of the Chromatin Remodelling Factor Isw1A
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 70
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09110 HAND HAND
A PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9zA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9zA04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2y9zA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 2y9zA03
4S0HB 1EF4A 3DCFA 5E3MA 2LR8A 2XGDA 2Y30A 5J1UA 3A01B 1IGNA 1OFCX 3JR9A 3S17J 4D5FA 2JA8J 2DN0A 1IV6A 4A93J 3GTOJ 3ZQGA 2DA3A 2LP0A 3B6CA 3FISA 1O4XA 4A3DJ 4B4CA 2GBYA 3HOYJ 2K9QA 3S16J 3RZDJ 1VI0A 1AHDP 2M0CA 4GFBA 1MBKA 1NTCA 2ID3A 1HOMA 3BQZA 1RKWA 3LSPA 3JRIA 3ZQIA 2LY9A 2LD5A 3W6VA 2XB0X 2L7MP 1XS9A 1HLVA 3ZQLA 3SDGA 3UKGA 4ABZA 1SFOJ 1IG7A 3HOVJ 1SANA 3I4NJ 1A5JA 1Q1VA 2R5ZB 2EZKA 5IYBJ 1TWCJ 3CQZJ 2OPTA 4DYCA 4BBRJ 3Q0VA 1ETYA 4C3HJ 3FIWA 5M5XJ 1Z0XA 4B3AA 3HDDA 4BY1J 3GBGA 3BT9A 5F0HA 4DW6A 2HOTA 2JWTA 2XB5A 3BR0A 3GTGJ 1PUFB 3JRBA 5M3MJ 4QSHA 1RR7A 4DCKA 2G0EA 4EEFG 1RKTA 3H0GJ 5C3EJ 1GUUA 5K7HA 3IH3A 3GTJJ 4AYBN 3BQYA 1ZTRA 1IC8A 2EZIA 5FLMJ 1FEXA 4J19A 1B72A 3TW7A 1GT0C 1I3QJ 3TEDA 2R7ZJ 3ZQHA 1X58A 2E19A 4I6ZA 3GTKJ 1TWAJ 2MW8A 3G1OA 3S1NJ 2ID6A 2YS9A 3DEWA 3LSJA 5GPCA 5E3OA 2TRTA 5C44J 1U9NA 2K9SA 3C2BA 1UMQA 5FKKA 4IHVA 4XK4A 1RESA 1ETXA 2EQRA 1OJLA 4UUTA 1IRZA 3B6AA 5K7ZA 5F0CA 1A6IA 2CQXA 2X48A 2FJ1A 2B63J 2NS8A 2XPUA 3HGYA 2VKEA 2VPRA 3QPLA 2E2HJ 2XGCA 4CYCB 3WHBA 1ORKA 3A03A 2DMPA 4X6AJ 2M8GX 4IHWA 3TP3A 3O8GA 3HOWJ 4JX6A 2IEKA 4JP0A 1RETA 4OVNF 4C3JJ 1XG1A 3S1QJ 2JMWA 5EG0B 1LFBA 5EF6A 5F0FA 1JUPA 1JKPC 2O8KA 3M3YJ 3JRFA 5IYDJ 3HB9A 1HDPA 4JX4A 1ENHA 2NOGA 2K40A 4MIMA 4L5EA 2LTPA 4JYKA 4FTHA 2DA6A 1HCRA 3GTLJ 2R0QC 5EEAA 3ZQFA 2VI6A 2CQQA 3QPSA 5HODA 4M6VA 2M34A 1WH5A 4D7MA 2AHQA 3NAUA 5FKNA 3CCYA 3RKQA 1ZQ3P 2EBIA 1BJZA 3Q0WA 2ECCA 2WV1A 3FK6A 1QRYA 3GTQJ 5IP7J 3BG5A 2LLKA 5F04A 2Y0SN 5EGOA 2XSDC 1B8IA 1OCTC 2IBDA 1ETKA 4UUSB 3S14J 2WB1N 3LOCA 1MBHA 2XPVA 4XRSA 2HOSA 1Y1VJ 1UHSA 4LOCA 3BTCA 3HEFA 1IJWC 5IP9J 2DJNA 1IDZA 4DZPA 2YU9J 3NARA 1JTYA 4RDUA 1GDTA 1S7EA 1AKHA 5E3NA 2COBA 2DA2A 1MSEC 4BKXA 1LE8A 3S2DJ 4BXXJ 1MNMC 2CUFA 1FJLA 3VPRA 4A3JJ 2ME0A 4V2FA 3SFIA 4A3GJ 5C4JJ 2RAEA 1JKQC 3SJMA 5EZGA 2XPWA 2GM4A 3BTLA 5BNGA 1VF9A 9ANTA 3BG9A 2CRGA 5IOZA 3OOUA 1WCMJ 2R5YA 4MLOA 5M5WJ 3MN2A 2L7FP 4M3EA 4D7NA 3LNQA 1R9TJ 4QTRA 4IHYA 3GTMJ 3FKIJ 3H3VK 4MO7A 1U78A 2D5VA 1JUSA 4QIWN 1MH4A 2N8GA 1RPWA 1UG2A 1ZR2A 1H8AC 3CMYA 1ETQA 4M3DA 2LVSA 2QCOA 4DZJA 1FIAA 2KT0A 1LFUP 2R93J 3IH2A 1ZGWA 4AC0A 3L1PA 1JJ6C 5IP6A 3Q0UA 5FJ8J 3JRCA 3MVPA 1YRNA 2EZHA 2FQ4A 3F0CA 1K83J 4W1UA 3JRGA 4B1RA 5EDNA 1POGA 3MKLA 1TWGJ 3OSGA 3O8HA 5FLVA 3I4MJ 3IH4A 1NK3P 1DU6A 2NS7A 2LK2A 2VKVA 2OF7A 1ZK8A 3G1MA 3QQAA 2LKXA 4FCYA 3A01A 3BTJA 3K7AJ 1BW6A 2ELKA 1MBJA 1B72B 3S1RJ 3TW6A 1Z77A 3HOUJ 4JQ0D 5EZHA 1GV5A 1W0UA 2HXOA 1X2MA 4A3FJ 2E2JJ 5FKLA 1APLC 4DYQA 2HYJA 3OIOA 1NK2P 2NVXJ 2FD5A 5F08A 4BBSJ 5IPAA 3BR6A 1GV2A 2HI3A 4MFDA 1F43A 2R5ZA 2XRLA 2JK3A 5M5YJ 3JRDA 3GTPJ 1WGXA 2W48A 2H8RA 4A3LJ 2CUEA 1FIPA 1MBFA 5FKOA 1BL0A 3CDLA 5J3LA 3BTIA 2HXIA 3JREA 4M3FA 2DMTA 2MG4A 1H89C 1AU7A 2DMNA 1TWFJ 3RQIA 1G2HA 1PUFA 3HGGA 4A3EJ 2DMQA 4C3IJ 2FX0A 1ETVA 5J1RA 3PM1A 2CU7A 1ITYA 3HOZJ 2TCTA 1ETWA 2ECBA 4A69C 3IV5A 1X2NA 3BR5A 3ZOBA 3D1NI 5GP9A 1JT6A 2HQ5A 2PMZN 3WHCA 1GVDA 2Y2ZA 1E3OC 1BW5A 2L9RA 1FTTA 1P7JA 2I10A 2VUMJ 1QPIA 2GLOA 4W97A 2JJ7A 3TP0A 2E1OA 3Q3SA 1VFCA 4RBOA 2YUSA 1MSFC 2H1KA 1FTZA 1D5YA 2ZB9A 3PO3J 2L0KA 2IAIA 4C2MJ 2X9DA 3ZQCA 2MGQA 1JT0A 1K61A 3M4OJ 3HBLA 1IDYA 3LSGA 1IUFA 4FISA 5F27A 5JLXA 2NVYJ 3JRHA 2Y9ZA 2O7OA 5EGOB 1B8IB 3HOXJ 1T56A 2CJJA 3K2AA 3BR2A 2NVTJ 1U8BA 4CYCA 2O9LA 2P81A 2R92J 1QVUA 4XRSG 1ZKGA 3BG3A 3BR3A 2WAQN 4X1EA 4JPZB 4A3BJ 2HDDA 1WPKA 5DTDA 4JX5A 1AKHB 1HDDC 1CQTA 4BY7J 2JN6A 5GPAA 1QVTA 5EG0A 2XGEA 4A3IJ 1LE8B 2ME6A 1MH3A 3G1LA 2E2IJ 4Y52J 4XRMA 1TC3C 3S2HJ 3FK7A 4V2GA 3HM5A 1ETOA 1JKRC 4MFEA 5IOYA 2HOAA 2JA7J 4A3KJ 5JLWA 2EH3A 3BR1A 2MSYA 4XICA 2R5YB 4M3BA 1HF0A 2DA7A 1TWHJ 5DS9A 5J1YA 1Y1WJ 4G12A 1I50J 2Y9YA 4IEJA 4NDLA 1H88C 3PO2J 4I76A 1ZR4A 1JKOC 1BA5A 4DYRA 1JJ8C 3LSRA 3S15J 4A3CJ 1OCPA 1MBEA 4Y7NJ 5FKMA 4M3GA 2L7ZA 2EZLA 5E3LA 5IYCJ 2DA4A 1P7IA 4IHXA 3HKZN 2LFBA 1VNDA 1WI3A 3A02A 2X6OA 4UUSA 1T33A 2NVQJ 3S1MJ 4D5CA 1U9OA 4XIDA 2KDZA 1I6HJ 2DTZA 2M2EA 2DA5A 3JRAA 3RZOJ 2DA1A 1JUMA 2K9NA 1WH7A 5M3FJ 1JGGA 1XC5A 4HNVA 1DU0A 1YRNB 4AUXA 2JA6J 4FE4A 2DMUA 2M9HA 1F36A 5K7FA 2Y31A 3OSFA 5C4XJ 5EYRA 2JA5J 3E7LA 2AO9A 2QF7A 1W0TA 1JTXA 5F1JA 4FE7A 4A3MJ 1MBGA
chains in the Genus database with same CATH superfamily
3ULQB 3ZR8X 4S0HB 1Z67A 3DCFA 5IT9Z 1MFTA 2K85A 3GLMA 1L4AC 1BGYD 2XKPA 2BXZA 2MYSA 2ZSIB 1TU3F 1Z9CA 2V1XA 1FLIA 4IZZA 4PGGA 3S17J 2X6XA 1A35A 4OIQF 1RQVA 1XGNA 3ROUA 4ASWA 1WJ5A 2DN0A 2W84A 1IV6A 3ISPA 2WBMA 1YTZI 3R61A 2KSJA 1S5LE 2PRRA 5FD6A 2A06G 5BQTA 4D3SA 1VQ7P 3FISA 2XDJA 2PG4A 3F8MA 2QBYA 5HS7A 5IT3A 3Q5SA 3S16J 1DH3A 3I3LA 1VI0A 1Z6RA 1TT0A 3TL4X 1D5VA 5APQA 3G6EP 2DPDA 4GFBA 1X3UA 1P2FA 2Y69H 1YI2P 2FNAA 2ID3A 2G3AA 3PEFA 1GD2E 1LTJB 3T97A 3HXLA 1MJ9A 2WPRA 5GTHC 2E1MC 3AEFC 2MH2A 2XAFA 2L7MP 4OIRF 4IKFA 1T0FA 1KILA 1RF0C 1SFOJ 1G3WA 4A0ZA 3KYLA 3UKGA 3HOVJ 3RL0C 3M8EA 3I4NJ 3GG2A 1A5JA 1Q1VA 4OMZA 2EWNA 1D1AA 4M74A 3OY9A 1VQNI 5IYBJ 3ZWCA 5FWNA 4BBRJ 3Q0VA 4KUEA 1S7OA 2LY2A 2LREA 3KP7A 4HSRA 4Z6YA 4CSWA 3OBBA 2LXCB 2W8ZA 2QG4A 3CCQP 4A0YA 2VBXA 3E1RA 2DT7B 2NNYA 2QWWA 1RF1B 2XNXA 4BEHA 3F72A 4B3JA 4PD4E 2JWTA 2XB5A 3DTEA 5B3SH 3PUBA 2HPMA 4BQAA 3M9HA 4B8XA 5GAHJ 3OA7A 1YRLA 4MNUA 3EYYA 2G0EA 3TOAA 3IR9A 2WT7B 1IW7F 4U0YA 4BHPA 5KLIB 4C30A 4RM3A 2ZXHA 1ZCJA 2LXBA 3K5BA 3RKXA 2E5NA 5KCMA 3K10A 5K7HA 3IH3A 2O5RA 5D5UB 1IC8A 1ZTRA 2FKWB 2EFWA 3S3MA 1BE3E 2EZIA 3QYBA 1SQVK 1KONA 3FWNA 1AVOA 4D3DA 2A5YB 1LVAA 2ISYA 3DBLB 2CS3A 5DM7F 3H1LD 4LG0B 3TEDA 3TQNA 3RIRA 2BW3A 3ABTA 4O6JA 1LTTC 1DIPA 4A12A 1GK6A 3L70E 4LLHA 2E19A 4AUWA 3LA2A 4NC6A 1G1IA 2XF7A 2SPZA 3CD6P 3AG2H 2MW8A 5TISC 2VRSA 1PGNA 3Q3CA 3CX5I 3I5CA 3E0JB 3K6JA 3F3XA 4G7ZF 1CF7A 2RH0A 2XF6A 3M0DA 4JBZA 1O7LA 1U9NA 1SD4A 4F92B 2IGOA 3FXDA 3A0BC 1LT9A 4O9BA 4YELA 5J47A 4IRGA 4CYDA 2XNDH 2X1EA 1HGZA 4XK4A 3GMAA 2FFDB 1ETXA 1HTLC 2NPSB 3K2ZA 4F91B 2HU9A 1XPXA 1B1BA 1ZMEC 5ED4A 5C39A 4GO1A 3MGNA 1M90Q 3MKWB 1A6IA 4BJ6C 1VQKI 4DGWB 1GLNA 1P84I 4YXWH 2IYOA 2FJ1A 2GF2A 4LLLA 4D1QA 1A04A 2B63J 5CVUA 2IRFG 4CZZA 2W6AA 5DEQA 3HDHA 3VMAA 3OL3A 1VQOI 3ECOA 4M72A 4PFOA 1E5WA 4XKCA 3HE4B 4HF2A 2HTSA 3DV8A 1N7SA 4R4LA 3VMYA 2A45I 3TK1A 2EIMH 2HVQA 4G6DA 2IP2A 1ORKA 3L2QA 1MMSA 3LSKA 1G2CB 2J5PA 2KRFA 5L3DA 4CGZA 2YKPA 3VSKA 3HOWJ 4YTPC 3CPWO 1OVUA 4RGXA 3O8ZA 3G0OA 4Q47A 2WWYA 1USSA 1K9MQ 5LRSA 2CO5A 2KMUA 3A1YA 1QA6A 1S9KE 2ZAEB 2BCCG 4DIQA 5IYDJ 2X58A 4IJAA 1HDPA 1FBMA 1G1JA 2PLAA 3CX5D 2P67A 3GXOA 4L18B 1BJAA 5KAIH 4BDYA 1IZNB 2LTPA 4KT0J 3CMAI 2B9BA 1TW2A 1XTAA 3L73D 3L74E 5D4RA 2DA6A 3GTLJ 5FRMA 1M76A 3IHUA 5EEAA 3I54A 2E75D 5L3EA 3LL7A 1DP3A 1B59A 4XRFA 3QPSA 4RAYA 1UZCA 5E79C 2M34A 4KHXA 1JCCA 1T2KC 3MKZA 2E7WA 1PZQA 1RE3A 1P84D 2PJRB 1PJRA 4CPGA 2ZKZA 4GWGA 2BEQD 1RE4C 3O6QA 3CWBJ 2FYUJ 1RY3A 1HW5A 4MTDA 5D5VB 1BDDA 3MTUE 5APTA 2WV1A 3FHNA 1GMJA 2QA4P 1R6RA 1SFCB 1D0XA 2GIVA 4LMYA 3GTQJ 3BG5A 3RL0D 5B66C 1I5ZA 3WG9A 1PV3A 4DBRA 3AE2C 3HUGB 4UB6E 1T95A 2LLKA 3BZ6A 1MMAA 4DJAA 5EGOA 2XSDC 3ZP5A 1RIOH 2IBDA 1O3SA 4UUSB 1DLIA 3DFGA 3ECHA 1MBHA 1P4AA 2HOSA 3PH0A 3U21A 1XCBA 2GA2A 3NXSA 1FDOA 5APSA 1NTKJ 1T8ZA 4IFDK 2E75B 2VBWA 3L73G 2KHMA 1R00A 4CUGA 5CVJA 3H1KD 1ZLJA 3V5BA 1FX7A 3B73A 5E3NA 3EETA 3HUSC 1JE8A 1URQB 2CK3H 4M73A 1MNMC 2JPBA 1W4MA 3LAPA 1FJLA 1TBXA 3IP4B 5ILSA 1YW8A 3WU2E 2HGCA 2GIZA 1N7LA 3NMDA 4IFMA 5KLVJ 3SFIA 4A3GJ 3AE7C 3HL2A 2Q1KA 4L0ZB 2G7HA 1ZN5A 3QOEA 3QPTA 2BBYA 1XSXA 4IRHA 2A45G 2QRXA 4ZYHA 2P1JA 3M07A 2V6EA 5KAFC 5ILVA 2BEZF 2IDBA 2PQ8A 3C7JA 3GF2A 3AEGC 2CRGA 2LBFB 3K70D 2KIKA 2ZJSE 3P8CD 1FZGA 1WCMJ 2P7VB 4ENKA 1O3RA 3L09A 4HX8A 3LNQA 1SQXE 2DYRH 2ZFUA 1WHUA 4DZOA 4UB8C 4U88A 5AVYB 1XDSA 4QTRA 3DBHB 3FKIJ 1H88A 2E5ZA 2FUG2 4OGQD 2EFPA 2ZXIA 4MO7A 3W3CA 4D3FA 2D5VA 1RQUA 1JUSA 1KMIZ 2CV1A 5JE8A 1IF1A 5MGBA 1ZRCA 3CCRP 1HGVA 2A45H 3EUHA 3RJPA 1N1EA 1KILC 1T0FC 3CF2A 4C7NA 3G4SP 2VONA 1FMVA 4XQFA 2F5VA 1JM0A 2KQRA 2PN6A 4PJ0E 2R93J 2VOOA 3IH2A 2NZ2A 3TO6A 4AC0A 3W2AA 4YFXF 5B1BH 3L1PA 4AVZA 4M9XA 1EH6A 3JTGA 1U2WA 4PZJA 1UIIA 2NXNB 3L35A 3JRCA 3MVPA 3D6YA 1N75A 3B5NA 3GEZA 1OCZH 2JTVA 2HEOA 2JSPA 2FQ4A 3F0CA 4RESB 1Z7LA 1LDDA 4AVPA 2OTLP 3JRGA 3AE5C 4IL6H 3R2PA 2QSGX 4Y17A 3T8TA 1AVYA 2DODA 1BGYE 3OSGA 3SEQA 3O8HA 4MQ9F 1X0TA 4OIOF 3IH4A 4E7ZA 2YIUC 3WFJA 2DQRA 3M9AA 1VPDA 1FP1D 2LK2A 1W7PB 4HV6A 3PHLA 3TYYA 1NJIQ 1ZRDA 2C9LY 3H9JA 2QEXP 2XGXA 4B09A 5JR3A 2M7BA 1UELB 3E1SA 1H9GA 3IQDB 4XSZF 2J59M 3IFMA 1Z77A 1K05A 4PSWA 3Q9SA 2Z9OA 1JI8A 1OVRA 1YJNP 2HDHA 1IAWA 1R5SA 2HXOA 4ZTJA 3KLOA 2O03A 2F48A 2I5UA 3JSOA 2UWMA 1APLC 2H6CA 1MJBA 1SVOA 2XSJC 2CW8A 1JY3P 3I83A 1MW7A 4Y3OA 4BH9A 2UV1A 3KYCB 1LTJA 1HF9A 3HSFA 1AQ5A 3B4SA 2VT3A 2GUVA 4M6XA 4BBSJ 5IPAA 4RB2C 1LT9C 3WGHA 2DOAA 2CG4A 1Q81Q 5L3GA 2QM7A 1Z6TA 4RAZA 4PV1D 3BRVB 2IA0A 5DV5A 2ZYGA 2KKOA 3F5HA 2FYNC 3LWFA 4BYYA 1SQPJ 2W48A 2GOMA 1R58A 2H8RA 2M5AB 4AYCA 2Q6QA 3RK3D 4A3LJ 2GUSA 5F64A 1R5GA 3P9CA 1BL0A 3MZWB 1HVVA 5J3LA 1VQ9P 2FOWA 3LSHA 3ZXSA 2R7WA 3K4LA 4XLFA 3P9KA 2EA2A 3RPUA 2WB1A 3U1KA 1XGMA 1E79H 1RF1A 3BDDA 1VDFA 2DMNA 3UNGC 4E7IA 1G2HA 3BCCG 4L76A 3JCUE 3G6EI 5E17F 2V7FA 4L9JA 2FBKA 4NHJA 2MFZA 1ETVA 4RGUA 1DGRM 3R4YA 1QNTA 4ESFA 2E36A 2WT7A 3MZ8A 3HRTA 3PM1A 1ITYA 3DFUA 3CCVI 3OJAB 1ETWA 4KUMA 3MOGA 1SQQD 2OARA 1JY3N 3H1LE 3BR5A 2F6CA 3A2KA 1QO0D 4M6YA 1PDNC 4PV1B 2W25A 3L72D 5A2QZ 3OOPA 2YO3A 4S05A 4N0BA 5GP9A 2H6BA 1KFMA 2GOXB 2HQ5A 3SZGA 2NRAC 2BCCJ 3BATA 2LF8A 4LG0A 2Y2ZA 3CCQI 4QWQA 1E3OC 3H1JG 3BRTB 1L0ND 1BW5A 2COMA 1LEBA 3FX0A 1ZRTD 2ZT9B 1K4TA 1DUXC 1ERDA 1R4MB 4OWRB 3RQSA 2H43A 2DT5A 3H9QA 3NFQA 1LUJB 2R5DA 2MA3A 1HSJA 1KC8Q 3ONQA 3F8FA 3CJTB 2YU3A 3D70A 2GLOA 1D1BA 3REOA 1YQ3C 1M56D 2R7SA 2RMZA 3H1HD 1VQNP 4H44B 1ODDA 4W97A 1UB9A 2K86A 2E1OA 2KPMA 3TP0A 3Q3SA 4D6TD 2ICWG 1VFCA 3Q2YA 3A2AA 1IV8A 2YKQA 2FXOA 4RBOA 1FTZA 2FFDA 2JQ7A 1ZH5A 1J2XA 2NPSA 2C9NY 5CHXA 3J80K 2E76D 2L0KA 1VQ4I 2A5WA 2X9DA 1JDJA 2Z33A 3CMEI 3WTVC 3BPVA 2HTJA 3BCAA 5HS8A 1JOCA 5AIPA 1JY3O 5K1YA 2L5GB 5HLGA 3CLOA 2BV6A 4FISA 4IQJA 2P7JA 3IF4A 3KZIC 3OYAA 4XN0A 4BQNA 1KU9A 3LQRA 3CO7C 1B8IB 1M1EB 1W5SA 3HE4A 2F5FA 3L72G 1VQPI 5AIQA 3HD7B 2H1LA 1R49A 3HPGA 2NVTJ 3IAOA 2P81A 4ASNA 2XKOA 4PJLA 1G2CA 4XRSG 3BR3A 1EZVG 1X3ZB 4HAMA 1L0NG 2B89A 1K8AQ 3MKYB 2W7NA 4KDPA 2FOKA 2VQGA 2P5VA 2JA2A 2ISZA 3VB2A 4PJJA 3L00A 2EV0A 1AKHB 1FZPB 5GAEJ 3CX5E 3L36A 1WP4A 4OAZA 1IO4A 1WDMA 1QVTA 3H1HG 2VPLA 1M67A 3KEOA 4HZFA 3USSA 3L73E 2DOEA 1R5LA 3OYHA 5LD2C 3H5AA 3KZZA 3TNUB 3L6DA 3AEAC 2JP3A 2HDCA 3E6DA 3KYDB 4U7BA 2HOAA 2VB6A 3AG4H 2M87A 1P84E 4A3KJ 2NYXA 5JLWA 1L0LD 1HA8A 2EFQA 3JC22 2NRGA 2MSYA 1N2DC 3F23A 2ZMEB 4KMFA 3IRQA 3PLNA 5FGMA 2Z4EA 2QJYC 2IGMA 2HYFA 2LRDA 2W57A 4B47A 4HDVA 2PJRA 4W7YA 3TSIA 1R8EA 5CVRA 4YXDC 4EZBA 1SC7A 4GBJA 2E1NA 2JWAA 3QRFF 1H88C 3ZMVA 1JKOC 1BA5A 2HKXA 1TP4A 1WDLA 3W2WA 3CTVA 2Q9IA 3KEYA 3LSRA 2R32A 1VQOP 3SWFA 4AM3A 2X1DA 1PP8F 3S15J 4I99C 3P5JA 4A3CJ 1SFCA 1QVFO 5FKMA 2E74B 2PMHA 1N78A 5IYCJ 3HUGA 4E12A 2KIQA 1P7IA 4HW0A 2I8DA 2L01A 3EUHC 1R36A 4OINF 1VNDA 2N1TD 3A02A 3S93A 1S5LH 4FETA 3SXYA 1Y56A 5IY5H 4UUSA 2V9PA 2KDZA 2D1HA 4HLYA 3ZWAA 3H1KE 2DTZA 2M2EA 2DA5A 2H7HA 3L7WA 1PYVA 4HG2A 3PRJA 3RZOJ 3OYBA 3PL8A 3T0YA 3Q3DA 4ZYDA 1F5TA 1R22A 2ZXJA 2JJLA 1XX5A 1WH7A 1MD0A 1J0RA 2ESNA 5M3FJ 2R44A 1EQ7A 2YNYA 2Q7CA 4PSXA 3B5NC 5GTIE 1XD7A 2JA6J 1NTKK 2OCCH 2MJZA 3CUOA 4YIRX 1URQA 2M9HA 5H2FE 1F36A 2Y31A 1M57D 4TT3H 3I56I 2JA5J 2Z3YA 4KUGA 1H0TB 3SYTA 4FE7A 4GOEA 3EUKL 3WFIA 3K4BA 5A9SB 3P8CE 4HYTB 2VT2A 1EH7A 3QU6A 1KA8A 1B9MA 2HQAA 4NC8A 5J1UA 4HNUA 4WCGA 1IGNA 1BE3G 1OFCX 2B88A 2XKMA 5J4YA 1YIJP 4IQ4A 2O3FA 3Q5RA 2M4KA 2LBFA 5EEGA 2R7XA 2TDXA 1OZHA 2JA8J 4LJZF 4PD4H 2BHZA 1NTZD 2KOGA 3ZGYA 1VQ6P 3B71A 1FOKA 1YBKA 4ESBA 3L70G 4KNYA 5BPIA 2A68F 3L4FA 1JO5A 2DBBA 2DU9A 3SZTA 3RZDJ 1AHDP 4ASVA 2B7EA 1PL5A 3PNVA 3NEUA 1MBKA 3VOEA 1J9IA 1BG6A 1LTJC 3V8JA 2AQFA 1XMKA 5DM6F 1X4PA 4ZJZA 4NUBA 3LSPA 3JRIA 3W6ZA 2AXTH 3BASA 4I7ZB 4WY4B 2LD5A 1TQIA 1XS9A 2EINH 2A69F 4CH7A 1IG7A 4ABZA 2JSCA 2R3CA 5B5EE 2OAZA 1Z3YA 2DFEA 5E8IA 2EZKA 1FOXA 1Q2NA 2D2CC 4Y13A 2PGDA 1LTBC 2ELHA 2NAZA 3BJ6A 3QPHA 3MQ0A 1K7AA 2FYZA 1NU1D 1MMGA 2YSRA 2FXMA 5CMZA 4O3MA 3MIWA 2AXLA 3OV8A 3BT9A 1W36C 3VN0A 3O2PE 5F0HA 3PNYA 4LB6B 4DW6A 4BXFA 5E1XA 1K73Q 1RF1C 2KDOA 5KKZB 3CCLP 4H0LC 2WSFH 4ZMDA 4CO8A 1QU3A 2KJCA 2O0YA 3I55I 2V26A 3A7OA 3BCCJ 3JRBA 2WAQA 2KNCB 1R4NB 1RR7A 3KEQA 1FC2C 2QJKC 3CCRI 3GWZA 1RKTA 4LK1F 2K7LA 4RMNA 4BUPA 4CCNA 1W7PA 2STTA 1EXIA 4G94A 5C3EJ 3G4SI 3IAS2 5HNHA 5HLTA 5FLXZ 3GF7A 3V2NA 1AFOA 2K9LA 3BQYA 3F9KA 3G71P 2IZ0A 5FLMJ 1FEXA 1ON2A 4A5NA 3TW7A 5CCHD 1GT0C 3K69A 1XTGB 1HBWA 2FMLA 5JVGF 1BR2A 3FMSA 3L74G 1NTMD 2DLLA 2R7ZJ 3ZQHA 2LYCA 1OYYA 1OWAA 4G8XA 1X58A 3HSRA 1IO2A 1HC8A 3BG7A 3H1JJ 2OTLI 1BR4A 4N4NB 2IPQX 3G1OA 2KYVA 1EDIA 1NU1G 2CYYA 4UVBA 5GPCA 5E3OA 2RN0A 2TRTA 2K3PA 2VXZA 5CLSA 3SZPA 1N1GA 4E21A 4AWXB 3VMXA 1QVGO 3OS1A 5AVXB 5CCGC 5TJJA 1QHGA 1UMQA 3RK3E 3CCMP 1WJBA 1IXSB 1RESA 1QL2A 4ZDPA 2CW7A 2FFDC 2BVMA 4Y33A 4M9ZA 2NPSC 2XZRA 1YIOA 4UUTA 1QZEA 1M75A 2M5AA 2QEXI 5K7ZA 5KJ7D 1PP9D 3M8JA 1TL8A 2MC3A 1VPCA 3TGUD 5CYVA 5CPRB 3ADPA 3HKZA 4F52A 4UV9A 1FMWA 3HGYA 5KAIC 1D8JA 3A5TA 3K1MA 1OYWA 3LIEA 1HW1A 2LF7A 4A6DA 4U7JA 3QPLA 1VQMP 2FU4A 1K4SA 4CYCB 3WHBA 2R7UA 1SQQE 3L71D 4I2OA 2DO7A 1BIBA 3S3OA 4IHWA 1NTMG 3GHGC 3TP3A 4UVCA 3DKYA 2UYYA 4Q5SF 1FYMA 1ONVA 4JX6A 2IEKA 4LIUA 1J2JB 1GL2D 2WZ7A 3L72E 2Z16A 5EFWB 4P5OA 1ZELA 2W1OA 1PGQA 1XG1A 2X6YA 4UB6H 5DJUB 3HADA 1PGOA 5LGTA 5FROA 1LFBA 3WGIA 5F0FA 1L0NE 1JKPC 3M3YJ 3WTZA 1ZRTE 3HB9A 4JX4A 1V5FA 3B02A 2NOGA 3KPHA 1REPC 1ZG1A 1T3UA 2IPPA 3DWLE 1VQ9I 1FU1A 5KK1A 1T3JA 3DLAA 1VF5D 5DCMB 3HTUA 4ITVA 3H1HE 4Q48A 1ULYA 1T98A 1SQBE 3ZDMA 4PZDA 4OOIA 1LNQA 4D6TE 1RH5B 4G7HF 1ZLKA 1R5HA 1LVKA 1BI1A 3DPTA 4A0XA 5LEJA 1JMBA 3C1LA 3BY6A 5HODA 1SQXG 2CH0A 5LBQA 4RKUJ 2LR2A 5FKNA 3QHAA 2XROA 2FF4A 1OIPA 3WU2H 3N4MA 3PDUA 3ZHBA 3LW5H 4RA2A 3P7KA 4RGRA 2UUZA 2O01N 2P8TA 1KQGB 3ASOH 1L3LA 5HLHA 2K9YA 1SFCC 2ACJA 2QYOA 3ZMSA 3OYNA 3AE6C 3E6BA 3BZKA 4YIFA 3PUFA 3IUOA 3HJEA 5F04A 2Y0SN 3M1EA 3KETA 1B8IA 1J1DB 3RTRA 3H5RA 3S14J 1VF5B 3HD7A 2XPVA 4XRSA 2L54A 4BU2A 3CCVP 2ZXXA 1UHSA 3KQGA 2BY1A 2CUJA 4XNFA 3BTCA 1H0MA 2ADUA 3V7RA 4ZZDA 2STWA 2DJNA 1IDZA 1Z56A 2HQNA 2PX9A 3DTKA 3V4GA 1JTYA 2Z2SB 1S7EA 4H0LD 5E1ZB 3RK2D 1BN5A 1ZRFA 1AKHA 2FNPA 2COBA 3TDKA 1Y39A 1YX5A 1W5TA 1URQC 3AEEC 3S32A 1BGYG 1GZLA 4N78D 3SHFA 2CUFA 1WRGA 4BGDA 2MABA 5DD4A 2RREA 3VPRA 2FRHA 4ENNA 4CICA 1NG6A 1IRGA 4HLXA 4PJ0H 5C4JJ 2RAEA 5H20A 1L0LE 3V42A 3EDPA 3TNUA 1IFJA 4A6EA 1IFMA 2XPWA 2GM4A 3BTLA 4J01A 1VF9A 2J58A 4H44C 1SMTA 3WUTA 4DOZA 1TT5B 3OOUA 1BE3J 1PPJE 2ZMEA 5M5WJ 4BE0A 4IRIA 2LKSA 3MN2A 3FR7A 1VQ4P 1GXQA 3CMEP 3T8RA 1VL2A 3CJNA 2RN7A 4P96A 4PZEA 2W6JH 5AVRB 1GTWA 3KDPB 4JBAA 2X1CA 4LITA 3L70J 2EPFA 2M5WA 1U78A 1VQLI 3LQQA 3GHYA 5AW7B 2V1UA 4IL6C 1SQPD 2VQLA 3G17A 1LB2A 1MH4A 2Z5HA 2BHYA 2DK5A 4U3FD 3RBZA 3D6ZA 1VQPP 3WMM0 4Q4ZF 3AE3C 3TOBA 1ZAOA 3WODF 1S7AA 1EKEA 5AW5B 3IAM2 3H1CA 3PJGA 1PGJA 1MNEA 2M30A 1UG2A 4GWKA 2WSFJ 1U3EM 4M3DA 4A5MA 3EYIA 3F89A 4L9TA 4NQWB 1UHMA 1Z7UA 2RC4A 4XKBA 1JJ6C 2R4GA 1LJ9A 2A05A 3MFKA 1WFXA 1FBUA 2R5BA 2HLOA 1KQ9A 1R23A 3V7CA 1F14A 1TNTA 1F12A 3V4WA 2EZHA 2IS6A 5BVZA 5HNFA 1IN7A 4KICA 3ZRGA 1R1UA 3ASNH 4OIPF 5LHHA 4I0BA 3I53A 2IJLA 4W1UA 3CDIA 2KZIA 4E7SA 1ZARA 4K35A 1O3QA 2C6YA 1OW6A 1IRFA 4IX7A 4FGWA 1H0TA 4EYYQ 4R8HA 3HYIA 1O3TA 5FLVA 3N4XA 1WPQA 4ZNCA 2QJPB 1W5CC 3H1LG 5A9SA 2DXIA 2JZYA 1QMGA 2VKVA 4E7LA 1NAYA 2E34A 3F8BA 4KN7X 1X0XA 3QQAA 2P0WA 4I0AA 4HRIA 1YJ8A 1NTZE 4U3FG 3WTWC 1N73B 2QKMB 4E70A 3K7AJ 1T08B 2MLGA 2ELKA 3J81K 1KYWA 2R3SA 1B72B 3JCUH 1SD7A 3CXHI 4YFKF 3FWLA 1GV5A 3CTAA 1MV8A 2JRMA 4Y99B 2Y0EA 4RM2A 1D0ZA 2K3FA 5FKLA 1L4AD 3L74J 2VOPA 3Q5PA 2VJ5A 4KMUX 3WU0A 3NWSA 2Z1DA 3OIOA 2P2UA 1Z82A 3C8VA 3ZMTA 3DKXA 4WY4A 1P4XA 3C18A 1KZUB 2WSCH 4PK4A 4YG2F 1NYHA 2P4WA 2OUMA 1GV2A 1RI7A 2FBHA 1X22A 3CJQB 1X9VA 3CP2A 1NU1E 1V4RA 1BOBA 2XRLA 1D7MA 2ZYDA 5LEKA 3GTPJ 1WGXA 1YIJI 2EIJH 1FZFA 3GX4X 5DD8A 1FIPA 1MBFA 4WWCA 4HSTA 2E1CA 5HOOA 3V2QA 2KIMA 2LKMA 3I56P 4AIHA 3JREA 1VQ6I 2CVZA 1OPCA 3DEEA 1WDKA 1OXZA 3E5XA 2MG4A 4ZC3A 3U2RA 1AU7A 4GYGA 1TWFJ 4IHTA 2ZJQF 4GYIA 4XM3A 1UJ8A 2DMQA 2H09A 3M1CA 2KNCA 5AW4B 2L3DA 1OR7C 1WJDA 5J1RA 1K6OA 1WJFA 4XLPF 4S3MA 4E7JA 2WA0A 3OYFA 3CXHD 1P6RA 3KFWX 1KQ8A 3R6SA 1YYCA 1TZLA 4HV5A 3ZOBA 1NTME 2BE5F 1SAXA 2KISA 5APVA 4V19K 5BU5A 3K9TA 4N9IA 3C7DB 2CWEA 2CV0A 1SQVD 2PMZN 2O1KA 2FYUE 4QPQA 3OMYA 3LW5J 1M1KQ 3WHCA 2IX7C 4IOCF 1GVDA 1TNSA 2YR2A 4RJTA 2WMMA 2D45A 2PJPA 1BI2A 2ZT9C 3LSMA 3CCLI 3LSIA 3MCZA 3ML6A 4XLAA 1OW7A 3EGOA 1QZYA 2I10A 1WT6A 2ZYAA 3CX5H 3RL0B 1QPIA 3CLQA 1DEBA 2L7KA 2JJ7A 2WPSA 1O57A 5D6EA 3ZMDA 2O1JA 3TKYA 3FHZA 1YW9A 2K5CA 1SQXJ 3M9BA 4MTEA 1JHHA 1LTSC 2YUSA 1PP9E 1S4XA 2J5OA 3U1DA 4XN3A 1D5YA 2Q3EA 3TGUE 3PO3J 3JAMZ 4L5JA 1HUCA 4NPDA 3ZQCA 1JT0A 3M4OJ 1X19A 1DQUA 2L5QA 5D8LB 3G71I 2PAJA 2OYHB 5CBNA 5D6FA 4EVIA 1P84H 1LFPA 1MZBA 2Q0OA 3OS0A 2I1JA 3BWGA 3I55P 3JRHA 2Y9ZA 2O7OA 3L71E 3TDZC 3HOXJ 1T56A 3H1KG 5KLVE 3W6KB 1G3SA 3DKWA 3K2AA 1YTYA 1YS7A 3BR2A 4KJZA 5JVTA 1ZYRF 2R7RA 3HD7C 2WTYA 4CYCA 3DU5A 4K2EA 2R92J 1QVUA 3MAJA 1UG0A 4LLGF 3I5UA 3S8PA 4PDKA 2ZJRF 1R71A 2UXNA 5IT9K 3BG3A 3SQNA 2IS4A 5FRNA 2M3EA 3H1ID 4N6JA 2F5CA 2HDDA 4OAYA 3KE2A 3CCMI 3S3NA 3FXRA 1CQTA 4NPEA 4BY7J 1V5EA 4A3IJ 2HZTA 4AD9A 4EATA 1L0NK 1MH3A 3PQKA 4KIBA 1BGYJ 2E42A 4R1HA 2WC2A 4R4MA 1NAFA 3FK7A 3IKVA 4MHGA 1S5LX 3QSGA 3H32B 5DCMA 1Q1HA 2C0XA 2YPRA 3PFIA 1ETOA 4OGQB 3GYHX 1S5LC 3Q9VA 4C2UA 1SVFA 3S1KA 5GTIH 5IOYA 3BC8A 2DDAA 1N86A 4PJNA 1VQMI 3KP4A 3KXDA 1Y9BA 3OAKA 1JUNA 3C3WA 2EH3A 5ILUA 5H2FH 2R5YB 1YG2A 1S2EA 1T39A 1HF0A 4L0YB 1EH8A 1TWHJ 4HEA2 2G8YA 3HRSA 5LGNA 1GW3A 1IFIA 2YMKA 3W67A 4IEJA 2Y9YA 5LRRA 2EV5A 3PO2J 2ETHA 3MMYB 2CV2A 1S1CX 1SMYF 3P8MC 1GU5A 1QEXA 1EJ9A 5CQGA 4Y7NJ 1X1BA 2E74C 1SVMA 4EJTA 2VODA 2YXQB 4M3GA 1FJKA 1M7LA 2K02A 1BSNA 4TV7A 4H13C 2L9NA 1T2KD 3ABKH 1NVOA 1D3YA 2LFBA 2KI7B 2CGPA 3OYJA 3QWLA 2H88C 4PGHA 5K5RA 3S1MJ 3M0DC 4BJ5C 3R4KA 3ZMZA 4D5CA 4XIDA 2OYOA 2DI3A 3GZ5A 3A0HE 3M9QA 1X1PA 3RSNA 4EI2A 2M0MA 4Z2YA 3GW2A 4F93B 1JUMA 2P5LC 4RB1A 4BS9A 1UAAA 5E8GA 1KS9A 4N78E 1JGGA 1XC5A 1U6GA 4HNVA 2JKVA 3ULKA 2MLKA 3ZQQA 5APWA 2Q8KA 2I1KA 1S72P 3QU3A 3JSVC 2DMUA 1LSJA 1XDUA 3OSFA 2ITAA 2K27A 2JO1A 4CA0A 1VQ8I 5EYRA 5B5EH 1D0YA 1FOWA 2BEOA 2OA4A 1ZG3A 5LHIA 4E7HA 4R1NA 1JTXA 5L8RJ 2VKHA 3M0AA 1N7SC 3PJRA 2AXTC 3GVAA 4A3MJ 1MBGA 2DFIA 3GF3A 1T38A 3H92A 3VSLA 2F4OB 4E6KG 2CPBA 3VYUB 1HH0A 3F22A 1XTCC 2XGDA 3EQ2A 2Y30A 3A01B 3H1LJ 1HSTA 2H94A 2K9MA 3JR9A 2WTEA 3K1NA 4D5FA 3FMRA 4N9HA 4C46A 4XLCA 2E7XA 4A93J 1YONA 2WSCJ 3GTOJ 1YITP 4JK1X 1X1CA 3ZQGA 1AV1A 1OISA 2IGKA 1SQPE 3L75D 4U3FE 1O4XA 4A3DJ 4YPCA 1ON1A 4B4CA 4GRIA 3AL0B 2GBYA 3HOYJ 4KIGA 5E18F 1NO4A 1YX3A 5J6XA 3ABMH 5LGUA 3H9GA 2M0CA 3WU1B 1KU2A 2PEXA 4J00A 3RK3B 3V6IA 3FM5A 2F5DA 1WVRA 4HH2A 3KP3A 1Z1DA 3CZ6A 4WY4C 1OCRH 4EGYA 4UY8I 4G6TB 2CFXA 3WE2A 4RB3C 4RLQA 2P4QA 3ZQLA 2MD5A 3PIDA 1BCCD 1ZOYC 2Y0DA 1I27A 2CQ7A 1SANA 1FAVA 3HC7A 1OW8A 1SQBD 3DTIA 4IO9F 1RE3C 4NQWA 2M3BA 2RKHA 1TWCJ 3ZPLA 4I6MC 2OPTA 4MN4C 1Q82Q 3HG9A 2P7CB 2K3RA 1ETYA 2NS0A 2XASA 1OMIA 2VJ4A 3DF8A 1HQCA 4B3AA 3HDDA 4UHTA 1X8YA 1LJ2A 5CKTA 2VL8A 3BG6A 1KILD 2HOTA 3VFZA 4U7DA 2QKLB 2HODB 1Y8QB 1SQQG 1GHCA 3BR0A 3GTGJ 1PUFB 4BWNA 2XU6A 4QMAA 2AXCA 3L75G 1S8NA 3HSEA 4L9NA 2FXPA 2K4JA 4EEFG 2BY2A 3H0GJ 3OYCA 1PIXA 2ZFCA 4RLFA 2QE7H 1M1JB 1QGKB 1N73A 4EMSA 5FFZA 3BROA 1G4DA 2O01H 2DJIA 2E5TA 2UWJE 2E5YA 1WWXA 4OL9A 1RNLA 1PVEA 1B72A 3L73J 1FZCB 1VQLP 3WE3A 5H6RA 2AEJA 1KQLA 4K3AA 3FXQA 1JY2P 3L9FA 2H8WA 1SQBG 2B0LA 4D6TG 2F2EA 2E76B 2R7QA 4HYEA 1DD3A 4U0VA 5EEHA 1E2XA 4MEYF 5DYMA 4I6ZA 1DLJA 3CCSP 1QHHD 5CJ4A 2Y48A 3GTKJ 2R7TA 2X6WA 1TWAJ 4I1LA 3U1CA 2Y0MA 3DEWA 2Q1ZB 5C44J 3AAFA 2P58A 2IA2A 1BC8C 4BXLA 2KLOA 1BI3A 2K9SA 5FKKA 1B4AA 2XAHA 4IHVA 1IFDA 2IA1A 2EILH 2L9VA 2IT0A 2RVCA 4DQ2A 3C7AA 4UB6C 1NU1K 5GTHE 1BBYA 2VQCA 3G3ZA 4HJGH 1PPJD 2VJIA 5F0CA 2V7QH 2LNBA 1P4WA 4H13D 2X48A 3CCEI 4CCMA 1IFPA 2QVOA 2NS8A 1J5YA 4BHBA 3K0LA 2HQRA 3PQJA 1XCVA 4AU7A 4UUVA 1LTGC 1ZREA 1LT1A 3LA3A 2E2HJ 2DTRA 3CXHE 1F4KA 3H1KJ 3A03A 4J0EA 3DPUA 3H5NA 5FO5A 1N25A 1LDJA 3N7NA 4X6AJ 1JY2N 2M8GX 1KYZA 1R5ID 2VQHA 4KITB 1KB9I 3M06A 3O8GA 3L2UA 1BDCA 1ZLLA 1RETA 1SQVE 3WU2C 3PIOF 2I76A 3HTKB 4I01A 3S1QJ 2JMWA 5EG0B 3C7CB 3HWRA 1QPMA 5EF6A 3C2GA 1NTMK 2O8KA 4M9SA 4DT0A 1KTMA 2GAUA 3C1DA 3JRFA 5L3CA 2PMUA 1AQTA 1ENHA 1L0LG 2M0BA 3CCJP 3K4NA 5K5QA 1MNDA 3HE5B 1X1DA 2QQ8A 3CESA 2QGUA 3ADOA 3QYFA 1JGSA 5AW2B 3ERMA 3FF5A 3W6UA 4JYKA 2JR8A 1OLTA 2GXAA 1PPJG 2QIWA 4IPAA 1LQ1A 2KZVA 2R0QC 4ZYEA 2OQGA 1RF0A 2VI6A 3GZNB 1DPRA 1MGTA 2V4JC 1KYOI 3V8KA 5KVRA 1W1WE 2AHQA 2N1TB 2FYNB 3K4MA 3ABLH 3NAUA 2OCEA 1EC5A 3CCYA 2KFDA 1ZQ3P 5TISE 2KS1B 4XONA 3J7AO 1D8KA 1IK9A 2W85A 2ZJPF 3Q0WA 2ECCA 1JY2O 2FQ3A 3E5QA 2BZTA 4RGSA 2KP6A 3A0BE 1SQXK 4G9YA 2WV0A 4RAGA 1A02F 5HDNA 2OYHA 1QRYA 5IP7J 1WJCA 2PBIA 2V4HA 2DFFA 4GGGA 5BMZA 2KL4A 3OYLA 4PJ0C 5AONA 1HW2A 1LP1B 4EOTA 1KB9D 1OCTC 1J1DC 1S9HA 3GLXA 3H1IE 2LG4A 3LOCA 5ICGA 3RGUA 5HS9A 3E6CC 3CC2P 1Y1VJ 1J7KA 1QQIA 4PUSA 2CSOA 4LOCA 4KN4X 3BOQA 1IZ1A 3HEFA 3OIQA 5DDGA 4F3QA 5IP9J 3E97A 4DZPA 3K96A 2YU9J 2DYSH 3W2VA 3FM3A 2AS5F 4RDUA 1XMXA 1GDTA 4HQEA 1YB4A 3LIDA 5K5GB 5FB2A 3SFDC 4X0GA 5CJ0A 2CPSA 3CC4P 2DA2A 2HG5D 3B8EB 4BKXA 2A6HF 5KTBA 2ZVNB 3H3UA 2Z5IA 3VP8A 5ICCA 2OQRA 4DNCA 1SFXA 1MJAA 2R7VA 1HKSA 2WADA 2FXAA 1NTZG 1KYOD 4Z1MH 2LOOA 3H32A 2HKOA 5AVQB 1JKQC 4A7PA 3SJMA 3OW2O 1GXPA 5D8KB 5EZGA 2KZJA 3PFYA 4II3A 2IS1A 1SFEA 2XF5A 4ZZLA 4MGRA 4BNCA 1IUYA 1S6LA 1AA7A 4ZDLA 5BNGA 3AG1H 3BG9A 3NRVA 5KLIC 3R60A 5IOZA 3CUQB 4BQOA 2QENA 2IFNA 1A02J 4EDFA 3K4JA 3M7GA 4MLOA 2R5YA 1LKXA 1LWUB 1HXDA 4P1WA 1GVJA 5ICFA 4D7NA 4XLEA 2WAEA 2B87B 2ZC2A 3FGAD 1DD4A 5J8CA 2L4MA 3H3VK 5E79E 2JVHA 4PCQA 3WTYC 1EDJA 4FX0A 3JTHA 4E7KA 3CWBD 2N8GA 2FYUD 1RHZB 3AECC 3HN2A 1RC9A 1RPWA 4N3YB 1KZHA 1TQPA 1ZR2A 1KD1Q 3IL2A 1BC7C 1ETQA 4G7OF 1ZG5A 3BVHA 2LVSA 2QCOA 2OC6A 4XBFA 4DZJA 5KHDA 1FIAA 5HDKA 3E1IA 3WUVA 5B66E 1LFUP 1YJWP 2XAGA 2H89C 4QLCU 3EWKA 1HBXG 1FBSA 3M8FA 1L0OC 4XR6A 3DLLF 4LK0F 3HRNA 3Q0UA 3JCUC 5FJ8J 2NVUB 2ZXWH 1JHFA 4ETSA 3GMEA 1USEA 2O01J 1K6YA 2WITA 3NWTA 2M7AA 4XOPA 1HJ0A 5A2QK 1NTKD 2UXXA 4W80A 3COAC 3MD2A 5APUA 4WF2A 4XA4A 4P9FA 5E20A 4B1RA 2JEEA 5EDNA 5CBOA 4KIFA 3L2CA 2W83C 4OQYA 1LGHB 3FXEA 4ENMA 1SQQJ 1YJ9P 2P10A 2BY3A 4IHSA 4LGDE 4LD5A 1DU6A 3FBIB 2WSEH 3QOPA 2NS7A 3L37A 2HZDA 1OCCH 3L72J 4FASD 4A2UA 2XRNA 1ZK8A 3B5ND 3G1MA 1N73C 2K88A 5KLVD 3A01A 1Y0NA 2C0WA 2QJYB 1WZ2A 3L75E 1UHWA 3BTJA 1QGPA 3CWBG 1BW6A 3HZJA 4XORA 4OQZA 2FYUG 1L0NJ 5AVWB 4ZTFA 5M1BA 4WBAA 3T5XA 2M1BA 3KP5A 2RGVA 1Z91A 3HOUJ 5EZHA 3H2ZA 5KAFE 2XV5A 1W0UA 5E1WA 4I7HA 1FY7A 4WWIA 1LEAA 2XV4S 3UR3C 2E2JJ 1S72I 3H1HJ 1SD6A 1NH4A 2KIUA 3WTXC 1IN6A 4N4OB 2V7QJ 3KYQA 1BCCE 1WKMA 2NVXJ 1JNMA 4UB8E 3MUDA 4H4KC 2A06D 1N77A 2FD5A 5TGTA 2Y75A 1PP9G 2LMDA 1Y8RB 4QPOA 3TGUG 2NOJB 1YW7A 5CQEA 2E43A 4WK8F 3H6PA 4MFDA 2JRTA 4C9YA 3SFEC 1FBQA 2YO2A 2L02A 3L2RA 3D5LA 4D0PA 5M5YJ 3JRDA 1CI6B 4KA4A 1F17A 3IC7A 1O7FA 2MBFA 2V6CA 1KILE 1TTYA 3LA7A 1GL2B 1R1TA 2Z5UA 5FKOA 3CDLA 5J4VA 1YITI 3L71G 1VQ8P 2KIFA 1SP4A 2HXIA 2Y0SA 2F5EA 1T8IA 4BRYB 5KLVG 1YQ4C 1KU7A 4DLLA 5ERIA 4M3FA 1BOAA 2DMTA 2OZUA 3GO5A 5LLQA 1WRJA 3BLYA 2A07F 1J1EB 4GXOA 1OX3A 2HODA 3RQIA 3RYPA 3CCUP 4EIJA 1MDMB 1M66A 1PUFA 1RUNA 3D71A 2BY0A 2V1NA 3HGGA 4A3EJ 2IBZE 2D2CD 2VBYA 2E60A 4YIIA 3F6OA 1R1VA 2DAOA 2CU7A 2BGCA 4J0FA 4HKZH 4IOIH 3HOZJ 2KJBA 4BQQA 1M1JA 2NNNA 4A69C 3RCOA 1W36D 3IV5A 3RPUD 1FP2A 1X2NA 2BXYA 1HKTA 2E75C 4XE5B 1A31A 3I71A 2BASA 6PAXA 4OM8A 3LMMA 1JT6A 4Y15A 4CXFA 2J5UA 1FZCA 3DOJA 3WTSC 2FSWA 2LSOA 3GCMA 3K4CA 5HWSA 1L0LJ 1G59A 2OQQA 3ESWB 1JXSA 2RV8A 3AE8C 1FTTA 1SFKA 4LG3A 3GUDA 4WXHA 1P7JA 1IC2A 2QVAA 4WXDA 4I09A 2OYIB 3GZ6A 4WB4A 2WSSH 1NGMB 4EJVA 2D2CB 3RKYA 2FA5A 2OV7A 4YCAA 1U57A 2WWWA 1LTAC 1MSFC 2H1KA 1LSOA 2ZB9A 2RNJA 4CCJA 1VQ5P 2FY8A 2V1DA 4C2MJ 1ZW0A 2DW3A 4Y4RA 3HBLA 3U59A 1NKNA 4IL6X 2AQEA 3KIOA 1BIAA 4EV0A 2EFNA 2WY8Q 2OYHC 4H0LB 5F27A 3RK2B 3KX2A 5JLXA 1FOYA 2KP8A 1FT9A 3VP9A 1EDLA 1E3PA 3OS2A 2JVGA 3EFGA 5CCGD 2CJJA 4I98B 4B3HA 3RDIA 2K37A 1LDKB 2QJKB 5GTIC 2DOFA 3CCSI 1U0JA 3D5RC 2O9LA 2NPSD 1NKZB 2ZXEB 3GFLA 5H2FC 1ZKGA 2D2WA 2OD5A 4D9JA 2RNGA 1Z05A 4X1EA 4LLNA 4JPZB 2VE8A 3MZHA 2AXTE 5JFRA 1OVVA 1WPKA 1I39A 5DTDA 1IRXA 4B43A 3HTKA 5AVSB 2JN6A 5EG0A 4HQMA 1LE8B 2E71A 3QP6A 3K70C 1MFZA 2HYNA 1T6SA 2FMYA 1U7JA 3I59B 3UIAA 5DUKA 5HVQC 3VDXA 2ZFWA 4ZH4F 2E2IJ 3JW4A 1TC3C 3DPLC 3S2HJ 4Y52J 1IJDB 2H8PD 3A0HH 3HE5A 2YMYA 2YX4A 4V2GA 3RQ4A 3FDYA 2L2OA 4OGQC 4CZCA 2IZ1A 1JKRC 1NTZJ 2VBZA 1YHQI 2BCCD 1TW3A 3H35A 4HX7A 2IYPA 3FXMA 1U5TB 3BR1A 1MZ9A 3V4QA 1SQPG 3OR2C 1NWQA 4M3BA 2QYTA 3EFFK 3TF5A 2JWDA 2N1TA 2A3SA 4PFPA 5DS9A 2KS1A 1E3HA 3ZW8A 4G12A 3C9IA 1BM9A 3CCEP 4NDLA 1XB4A 4I76A 1XN7A 1MMNA 1ZR4A 3WTUC 1FDMA 1JJ8C 1KB9E 3FMQA 2VASA 1OCPA 2MH9A 5B1AH 5B5EC 1G8XA 3CCJI 1FZEA 3TO9A 3K6GA 4GIFA 5E3LA 4CCOA 1ACIA 4XFJA 4OMYA 3AKZA 2W90A 2DA4A 3V8LA 1LP1A 2BYVE 3LAJA 2EB7A 2X6OA 4BE2A 3GHGB 2NVQJ 1BI0A 1U9OA 1NU1J 4NBQA 1I6HJ 1B6AA 3KZIE 2EIKH 2FBIA 3WS7A 4U87A 4M71A 1KORA 2WSEJ 2KK7A 3AEBC 2DA1A 2GA1A 3J80Z 4UXNA 5FLXK 1SFCD 3Q5FA 2KLVA 2VN2A 3U9GA 1X4OA 3ABUA 3H36A 1DU0A 1YRNB 4ZKPA 1V54H 1X1AA 1XGOA 2LH9A 4L5IA 2VKDA 3VODA 5D4SA 3DP7A 4JQFA 3PSIA 1EV7A 1KYOE 3PLRA 2OGUA 3F6VA 4HOBA 3J7YJ 3ZW9A 3ZGKA 3OYMA 2ZCWA 4XKWA 5C4XJ 3E7LA 5AVZB 2QF7A 5BU8B 2A6EF 1W0TA 5F1JA 1J09A 4ON0A 4P9UA 3QWOC 4O5VA 1EF4A 3R0AA 5E3MA 1L4AB 1JCDA 2LR8A 2V9VA 4U0WA 3OR1C 3TMOA 1FWZA 2WAFA 3LSTA 1URQD 3W6JB 1W2EA 1NTMJ 3CC2I 1Y47A 3CUQA 2PMZA 2R7OA 1LWUA 2DA3A 2LP0A 1YFHA 1F0YA 4HB1A 5L3FA 2HVSA 3B6CA 1FYKA 2B87A 2L91A 2OTKE 4PV1C 1MUUA 2HS5A 3AL0C 2M8RA 3CWBE 2K9QA 3CC4I 2KRCA 3QYEA 4CDGA 2YXRB 3DU6A 4EJOA 1NTCA 3RK3C 1HOMA 3CC7P 1DPUA 3BQZA 1E0EA 1FYLA 1FC3A 2I9PA 1RKWA 4H44D 3MUDC 3MD0A 4UVAA 3ZQIA 2EA4A 2E1MB 2LY9A 1XMAA 5A9TA 3W6VA 1IK7A 2XB0X 3BZCA 1HLVA 3VWBA 3DXJF 3SDGA 1H8AA 2HPCB 1SVLA 2L9SA 1DDNA 3RYRA 1PP9J 1FJPA 2QSHX 2POHA 2R5ZB 3TGUJ 3OWTA 2IVMA 3TGNA 2UZKA 3CQZJ 4DYCA 2VXDA 1FE6A 1NTKE 1FSHA 1QLED 1IN5A 5HLIA 4C3HJ 4IXAA 3FIWA 5M5XJ 2FEZA 3HRMA 1Z0XA 3I9V2 2IGNA 4BY1J 3GBGA 3L71J 2PFXA 4L74A 5ICEA 4UV8A 4YRVA 1QX8A 5AW6B 4ANJA 3HRUA 2XUBA 2F4IA 1IFNA 5CCHA 2PLYA 1S3JA 2FE3A 3N05A 2JT1A 2ZNYA 4QSHA 5M3MJ 2IS2A 2K1AA 1FZBA 5GTHH 4DCKA 4AYBA 2DK8A 1SQVG 3J7ZI 3NTNA 2GQQA 4KISA 3I4PA 2EK5A 3AEDC 3VYRB 4LFUA 3RPQA 1SQQK 1GUUA 4H0EA 1M1JC 3SEZA 4FHTA 3EPZA 2VE9A 3GTJJ 4AYBN 5DCFA 3PNTA 3EQLF 1UFMA 1YJWI 4J19A 2ZVOB 2KB7P 3CXHH 3ELKA 3MWMA 1FZCC 3FKJA 1I3QJ 5FFXA 1K79A 1YVEI 4B44A 1KV4A 1YOVB 3ZQ7A 2A06E 2E76C 3FZVA 1E17A 1W7PD 3RL0g 2GXGA 1XSVA 1TQMA 4HF0A 1IN4A 3S1NJ 5KJ7A 2ID6A 2YS9A 3OYDA 2V79A 2XDVA 1OYIA 2KRHA 3LSJA 4HPQA 1NHAA 4BE1A 1YJ9I 1SQBK 2P6TA 4B3XA 2W82A 4BHCA 1M8OB 2W24A 3CMMA 3AE9C 3PTZA 3C2BA 3GW6A 1V55H 4JF7A 2QZ8A 2ZMEC 3CP8A 1LTIC 3WUUA 1DGWY 4C2TA 1YQAA 2EQRA 5H6QA 3TBIA 1OJLA 3G73A 5KJ7C 1CI6A 4RB0A 1IRZA 3B6AA 1OCOH 1ZHFA 4BAYA 2CQXA 2OTJP 1GL2A 1P92A 3O3KA 2WPVB 2Q2EB 3PIPF 4BRYA 2O3JA 1TLHB 2XPUA 1EDKA 3OIPA 2VKEA 3H1IG 2VPRA 3RI4A 1H89A 4AIKA 1F1ZA 3HOSA 3ZWBA 2QSIA 5TISH 1MDMA 2XGCA 4EM1A 5JHFA 1V3FA 2OBPA 4EQQA 3AE4C 1WI9A 3WTTC 4LGWA 2DMPA 3H25A 2VIXA 3A0BH 2R7FA 1YJQA 1JTHB 1AOYA 2AEFA 4JP0A 2KLUA 3W68A 1Y0UA 3BCCD 4OVNF 4C3JJ 3F21A 1FSEA 3IWFA 2K9JB 3ITKA 4UNOA 3KZYA 1GU4A 2P5KA 1WSUA 3SSUA 2KUBA 2QQ9A 1JUPA 2RQPA 1DEEG 1ZXGA 4DBQA 3VMZA 1M2WA 2K40A 4NNJA 2YKOA 3GFJA 1D1CA 3QODA 4II2A 2D3TA 4B86A 1FOSE 4MIMA 2DQLA 4L5EA 4HDUA 2HNHA 3KP2A 4FTHA 3OL4A 2GXBA 5J40A 1HCRA 3O6BB 3G9RA 4KT5C 1EZVI 3CCUI 1L0LK 2XHKA 1IXRC 3ZQFA 1SS1A 3VTPC 2CQQA 3FXKA 2OYIA 2XC7A 2EW2A 4M6VA 1WH5A 1IXCA 4D7MA 3H1JD 1SAUA 2N1TC 4U3FJ 1A6QA 1OQYA 3FBNB 5L3BA 2EBIA 3RKQA 2KXPB 1PUEE 1BJZA 1G3TA 1K78B 4BJTA 1I36A 3KPEA 4F55A 1XSDA 4IF4A 2ZT9D 2DPUA 2OFPA 2IBZI 3FK6A 1EA3A 1ZGAA 3E3VA 3P7NA 4YEJA 1VQ7I 2Q5UA 1N8RQ 2ESHA 3I0TA 3FXJA 3L2WA 3PSFA 2O8XA 2JUCA 3D0SA 1QZZA 4GCVA 3I64A 3HHGA 1YI2I 3MZYA 3K1PA 1ETKA 3KHUA 1K04A 2WB1N 1ZP0C 4I7ZC 1X0VA 2G9WA 3S4RA 2HOEA 3R0JA 2OZ6A 1U7MA 2HFHA 4LB5A 5KAIE 1IJWC 5E79H 5AW8B 1ZGJA 5AVVB 2DDBA 2LC2A 3NARA 1QBJA 2MKVA 1SD5A 4NPFX 1YHQP 1GW4A 3HUSB 4DYDA 2ZJ2A 4ZDOA 2HFED 1MSEC 4DJGA 1LE8A 3BP8A 4E4HA 3S2DJ 4BXXJ 1VQ5I 3RKWA 2Q3IA 3HD7D 3ABVC 3I59A 1EZVD 2HR3A 4A3JJ 2MC4A 1MIJA 4XLHA 4AQRD 2BCCE 5B66H 2ME0A 4V2FA 3WG7H 5KKZC 2LY1A 1USDA 2LKPA 1I6XA 3GFMA 1C0WA 2KZGA 2F4MB 1FPQA 1LNWA 3RBXA 2O61A 3SFZA 2CQKA 1KFNA 4IVNA 3HTSB 4XLNF 2QQBA 1VTNC 2N9YB 9ANTA 4E13A 5CCGA 1YTZT 1YO5C 1U5TA 4R79A 3CUQC 1SLQA 1NTZK 2IBZD 1FOSF 4PD4I 1LWUC 1T6AA 4RO0A 4WVZA 2L7FP 2XAJA 4M3EA 5GAGJ 3D1LA 1R9TJ 5JHUA 1WQ2A 3V2PA 3OYGA 4IM7A 4KUHA 2QBYB 4IHYA 2DW4A 4HNTA 3GTMJ 1BCCG 1ZV8A 5LHGA 4EM0B 1PGPA 1RUOA 4QIWN 4KYWA 1KN7A 1YS6A 3T97B 2MD0A 3K4KA 3N97A 2HYGD 1HJBA 1RR8C 5DUIA 1KILB 3ERED 3CD6I 2N9BA 3OYIA 1GK4A 3II6A 2GWRA 1KGSA 2YX7A 1H8AC 3CMYA 3GHGA 1JMMA 5KAFH 3FR8A 2KT0A 4HA8A 3SWKA 5K5OA 3IWZA 1WJAA 1ZGWA 3LFKA 2EJRA 5IP6A 5BOXA 1FDIA 2E74D 3NQOA 4UB8H 3IKTA 1YRNA 5KNLA 1NG7A 4XKVA 1K83J 4BEHB 4AIJA 2IBZG 1BR1A 4FX4A 1EVZA 4NB5A 5CJ9A 5AVUB 1POGA 2OU2A 3MKLA 1TWGJ 2VC0A 2XVCA 2IXSA 3KP6A 1YLFA 2X85A 2KSEA 5CCHC 2YIUB 2EFOA 1NK3P 3I4MJ 4KJMA 4PD4D 3BPXA 1L4AA 2OF7A 1SQVJ 4XMYA 5A9RA 5AW9B 2LKXA 2B9SA 4FCYA 2G7UA 3F8CA 3IN6A 1U8RA 4W7ZA 3F3SA 3G2BA 4MEXF 3IRRA 2PI0A 4LC1A 1HWTC 3H0DA 2QM3A 1VQKP 1MBJA 4GDFA 4L9VA 4DOJA 3S1RJ 3TW6A 3I58A 5BPDA 4JQ0D 3JAMK 1S29A 2H27A 1N7SD 1BE3D 1X2MA 2BW3B 2HVRA 3P9IA 4A3FJ 3CF5F 1CGPA 2FYUK 1V5GA 3M91A 2HDWA 4DYQA 3MEXA 2HYJA 2JDIH 3PJSK 4H13B 5LFAA 1NK2P 3QAHA 5APXA 2DFHA 1CF7B 1NHLA 3FXOA 3CL3D 3L70D 5F08A 1LT9B 3H3ZA 3BR6A 2XAQA 1Q90D 2QLZA 4XSXF 4BXUA 3PP5A 2HI3A 4IL6E 2HPCA 2D1VA 3GLLA 1F43A 5AW3B 3ZMUA 2Z99A 2R5ZA 3GFIA 2JK3A 2ELJA 2OJED 5D5XB 4GT1A 1F9NA 1YE9A 2CUEA 3T1BA 1JB0J 1GL2C 1XGSA 1KQFB 1DX7A 3BTIA 3CMAP 4WY4D 1G6NA 3F8NA 1NOHA 1AJYA 4EJUA 2QA4I 1H89C 1CSBA 2W00A 3TO7A 4L73A 1J1EC 1N7SB 3H1IJ 4BL0B 4MQVA 1Z21A 2Y0CA 5DJTB 4Y28J 3CC7I 2WVRA 4C3IJ 2FX0A 2AEMA 1R7JA 5KLVK 2JPCA 2RKLA 1VF5C 3C2HA 3DBRB 4L75A 3VYSB 2TCTA 2ECBA 3FXLA 1Y6IA 1MMDA 2EV6A 2QUFA 4ZYAA 1IL0A 4GOFA 3MHVA 1WMKA 3U1AA 1FNNA 1W5CE 3D1NI 3AE1C 3JSPA 4PJMA 1TXGA 2CUZA 2XIGA 4P55A 3AG3H 1UCRA 5F1RA 4RAFA 3CJRB 1UIXA 4ENJA 2K4BA 2WQYC 4S04A 4OH8B 3P32A 5AVTB 4I02A 2VLAA 3VOPA 4BDZA 4ESJA 3ZCOA 1I1GA 3MP7B 1Z3XA 5AW1B 1S9KD 2HPIA 2L9RA 2ZO4A 3L2VA 3V2RA 2L4AA 2CFOA 1B9NA 3ZN0A 4B48A 4CCKA 4XL9A 2DCEA 2VUMJ 1HKQA 2OYIC 4WX9A 1KQ0A 3L74D 1FZAA 1SFUA 3J81Z 1G3YA 1SEUA 2X0LA 1Y8AA 3LFUA 4F7ZA 3SDBA 4XOTA 4HX4A 1A36A 2ZBKA 1YYVA 1KU3A 5AYVA 1PP7U 3O6QB 3E6MA 1P9QC 2IAIA 4ZYGA 2MGQA 2XAUA 1K61A 4GDOA 1IDYA 3LSGA 5TRDA 3OYKA 1IUFA 2M45A 2DT6A 2O6GE 3QH9A 2BVLA 3RK2C 2CW0F 3A0HC 2Q2EA 5CVVA 2NVYJ 1H9TA 2W6BA 2ZNZA 5EGOB 5CVIA 3D5SC 5BS6A 2PFBA 5GADJ 3VEPA 2LDUA 2JUGA 2E35A 4HBLA 1LJ8A 1U8BA 2RQQA 4RS8A 4FT8A 3BCCE 3HOTA 4FQGA 1AA0A 2QM8A 3HHHA 3Q1MA 4NC7A 3S2WA 2A61A 5JI6A 3A4CA 2WAQN 4GKGA 1KB9H 1WJEA 2CMPA 1J75A 4A3BJ 4B3IA 1JTHA 4CHUA 2R7DA 4IOAF 1FS0E 4JX5A 2HWVA 4JYCA 1HDDC 1L2PA 3ZN1A 1RZ4A 2K9JA 4GODA 5GPAA 2WY7Q 2XGEA 1OKRA 1I3AA 2V9KA 2ME6A 2M4GA 1NH3A 4HF1A 5TJHA 3WGGA 1JEKA 3E7KA 1RRJA 3G1LA 4ZKUA 4EJWA 3KZIH 4XRMA 2OTJI 3KLNA 3X2QH 3HM5A 2P6SA 4PZCA 2RDPA 4MFEA 3H1JE 1J59A 4JYBA 3J7AY 2JA7J 1STZA 2QJPC 3L75J 1BSHA 4KFCA 5D5WB 1U5TC 1KYOH 4IFFA 2CQNA 2IW5A 2M3AA 2BOLA 4XICA 3OYEA 1T2KA 2IFMA 5FD5A 2X51A 3A3YB 2DA7A 2QSFX 2WTBA 5AW0B 5J1YA 1Y1WJ 1QL1A 1RE4A 1K78A 3FX3A 1I50J 3EUAA 3HIFA 3KCCA 3CKYA 3CI9A 3VYIA 4OU0A 1SQPK 1IN8A 3CDHA 4DYRA 1YJNI 4M3LA 1SQXD 1DP7P 4Y99C 2GZWA 1BCCJ 3E5UA 3BCBA 1MBEA 1X79B 1MKMA 1X3WB 2FBWC 1Q7YQ 1SQBJ 2WPQA 1EXJA 2A6TA 2EZLA 2L7ZA 4D6TJ 4IHXA 3HKZN 1ZN2A 5APYA 3TDUC 1I1SA 1WI3A 3FXUA 5F6FA 4I2LC 4AIDA 4OWFA 4C7NB 1T33A 3DQVC 4WXCA 1OR7A 3HPHA 4CCLA 2QQAA 1NTKG 3BJAA 1AWCA 3SWYA 3JRAA 4G6QA 4KT6A 2VJJA 2W27A 1Q86Q 1VZ0A 2PP6A 4C7RA 4EM2A 5EJCA 2K9NA 2ZSHB 1CZQA 4JOMA 3B5NB 2W4SA 1EZVE 4AUXA 5J8FA 1PFIA 4YFNF 4FE4A 4LIVA 3CO6C 1EVYA 3HUSA 1W2BO 1KQSO 1CW5A 2X4HA 4TLFA 5K7FA 3BJOA 3AFHA 3S9OA 5HDGA 4BACA 3V7SA 3QP5A 3VYTB 2AO9A 1LPQA 3FWEA 2M8EA 4EGZA 3DEUA 1USTA 2VC1A
chains in the Genus database with same CATH topology
3WFIA 4S0HB 1EF4A 3DCFA 5E3MA 5A9SB 2LR8A 2XGDA 2Y30A 5J1UA 3A01B 1IGNA 1OFCX 3JR9A 3S17J 4D5FA 2JA8J 2DN0A 1IV6A 4A93J 1YONA 3GTOJ 3ZQGA 2DA3A 3ZGYA 2LP0A 1F0YA 4D3SA 3B6CA 3FISA 1O4XA 4A3DJ 4B4CA 2GBYA 3HOYJ 2K9QA 3S16J 3RZDJ 1VI0A 1AHDP 2M0CA 4GFBA 1MBKA 1NTCA 2ID3A 1HOMA 3PEFA 3BQZA 2I9PA 1RKWA 1BG6A 3LSPA 3JRIA 3ZQIA 3W6ZA 2LY9A 5A9TA 2LD5A 3W6VA 2XB0X 2L7MP 1XS9A 1HLVA 3PIDA 2P4QA 3ZQLA 3SDGA 3UKGA 4ABZA 1SFOJ 1IG7A 3HOVJ 1SANA 3I4NJ 1A5JA 1Q1VA 2R5ZB 2EZKA 3ZWCA 5IYBJ 1TWCJ 3CQZJ 2PGDA 2OPTA 4DYCA 5FWNA 4BBRJ 3Q0VA 1ETYA 4C3HJ 4KUEA 3FIWA 5M5XJ 3OBBA 1Z0XA 4B3AA 2W8ZA 3HDDA 4BY1J 3GBGA 3BT9A 5F0HA 4DW6A 2HOTA 4B3JA 2JWTA 2XB5A 3BR0A 3GTGJ 1PUFB 3JRBA 5M3MJ 4QSHA 1RR7A 1YRLA 4DCKA 2G0EA 4EEFG 1RKTA 3H0GJ 5C3EJ 1GUUA 1ZCJA 5K7HA 3IH3A 3GTJJ 4AYBN 3BQYA 1ZTRA 1IC8A 4OL9A 2IZ0A 2EZIA 5FLMJ 1FEXA 4J19A 1B72A 3FWNA 3TW7A 1GT0C 4D3DA 1I3QJ 1YVEI 3TEDA 2R7ZJ 3ZQHA 1X58A 2E19A 1DLJA 4I6ZA 3GTKJ 1TWAJ 2MW8A 3G1OA 3S1NJ 2ID6A 1PGNA 3Q3CA 2YS9A 3K6JA 3DEWA 3LSJA 5GPCA 5E3OA 2TRTA 5C44J 1N1GA 4E21A 1U9NA 2K9SA 3C2BA 1UMQA 5FKKA 4IHVA 4XK4A 1RESA 1ETXA 3C7AA 2EQRA 1OJLA 4UUTA 1M75A 1IRZA 3B6AA 5K7ZA 5F0CA 1A6IA 2CQXA 2X48A 2IYOA 2FJ1A 2GF2A 2B63J 3ADPA 2NS8A 2XPUA 3HGYA 2VKEA 3HDHA 2VPRA 3QPLA 2E2HJ 3ZWBA 2XGCA 4CYCB 3WHBA 1ORKA 3A03A 4J0EA 2DMPA 4X6AJ 2M8GX 4IHWA 3TP3A 1YJQA 2UYYA 3O8GA 3HOWJ 4JX6A 2IEKA 4JP0A 1RETA 3G0OA 4OVNF 4C3JJ 1PGQA 1XG1A 3C7CB 3S1QJ 2JMWA 5EG0B 1PGOA 3HADA 3HWRA 1LFBA 5EF6A 5F0FA 1JUPA 1JKPC 2O8KA 3M3YJ 3JRFA 5IYDJ 2X58A 3HB9A 1HDPA 4JX4A 1ENHA 2NOGA 1M2WA 2PLAA 2K40A 3ADOA 2D3TA 4MIMA 4L5EA 2LTPA 3W6UA 4JYKA 4FTHA 2DA6A 1HCRA 3GTLJ 1M76A 4PZDA 2R0QC 5EEAA 3ZQFA 2VI6A 2CQQA 3QPSA 5HODA 2EW2A 4M6VA 2M34A 1WH5A 4D7MA 2AHQA 3NAUA 5FKNA 3QHAA 3CCYA 3RKQA 1ZQ3P 2EBIA 3PDUA 4GWGA 3ZHBA 1BJZA 3Q0WA 2ECCA 1I36A 2OFPA 2WV1A 3FK6A 1QRYA 3GTQJ 5IP7J 3BG5A 2LLKA 5F04A 2Y0SN 5EGOA 2XSDC 1B8IA 1OCTC 2IBDA 1ETKA 4UUSB 3S14J 2WB1N 1DLIA 3LOCA 1MBHA 2XPVA 4XRSA 1X0VA 2HOSA 1Y1VJ 1UHSA 4LOCA 3BTCA 3K96A 3HEFA 1IJWC 5IP9J 2DJNA 1IDZA 4DZPA 2YU9J 3NARA 1JTYA 4RDUA 1GDTA 1S7EA 1YB4A 1AKHA 5E3NA 4DYDA 2COBA 2DA2A 1MSEC 4BKXA 1LE8A 3S2DJ 4BXXJ 1MNMC 2CUFA 1FJLA 3VPRA 4A3JJ 2ME0A 4V2FA 3SFIA 4A3GJ 5C4JJ 2RAEA 1JKQC 3SJMA 5EZGA 2XPWA 2GM4A 3BTLA 5BNGA 1VF9A 9ANTA 4E13A 3BG9A 2CRGA 5IOZA 3OOUA 1WCMJ 2R5YA 4MLOA 5M5WJ 3MN2A 3FR7A 2L7FP 4M3EA 4D7NA 3LNQA 1R9TJ 4PZEA 4IM7A 4KUHA 4QTRA 4IHYA 3GTMJ 3FKIJ 3H3VK 4MO7A 1U78A 3GHYA 2D5VA 1PGPA 1JUSA 4D3FA 4QIWN 3G17A 1MH4A 5JE8A 5MGBA 2N8GA 3PJGA 1PGJA 3HN2A 1RPWA 1UG2A 1N1EA 4GWKA 1ZR2A 1H8AC 3CMYA 1ETQA 4M3DA 2LVSA 2QCOA 4DZJA 3FR8A 1FIAA 2KT0A 1LFUP 2R93J 3IH2A 1ZGWA 4AC0A 3L1PA 1JJ6C 5IP6A 3Q0UA 5FJ8J 3JRCA 3MVPA 1F14A 1F12A 1YRNA 2EZHA 2FQ4A 3F0CA 1K83J 4W1UA 3JRGA 4B1RA 5EDNA 1EVZA 1POGA 3MKLA 4OQYA 1TWGJ 3OSGA 3O8HA 4FGWA 5FLVA 3I4MJ 3IH4A 1NK3P 1DU6A 1WPQA 3WFJA 1VPDA 2NS7A 5A9SA 2LK2A 1QMGA 2VKVA 2OF7A 1X0XA 1ZK8A 1YJ8A 3G1MA 3QQAA 2LKXA 5A9RA 4FCYA 3A01A 3BTJA 3K7AJ 3F3SA 1BW6A 2ELKA 4OQZA 1MBJA 3IQDB 1B72B 3S1RJ 3TW6A 1Z77A 3HOUJ 4JQ0D 5EZHA 1GV5A 2HDHA 3H2ZA 1W0UA 2HXOA 1X2MA 4A3FJ 2E2JJ 5FKLA 1APLC 4DYQA 2HYJA 3OIOA 1NK2P 3I83A 2NVXJ 1Z82A 2FD5A 5F08A 4BBSJ 5IPAA 3BR6A 1GV2A 2HI3A 4MFDA 1F43A 2R5ZA 2XRLA 2ZYGA 2ZYDA 2JK3A 5M5YJ 3JRDA 3GTPJ 1WGXA 2W48A 2H8RA 1F17A 4A3LJ 2CUEA 1FIPA 1MBFA 5FKOA 1BL0A 3CDLA 5J3LA 3BTIA 2HXIA 3JREA 2CVZA 1WDKA 4DLLA 4M3FA 2DMTA 2MG4A 1H89C 1AU7A 2DMNA 1TWFJ 3RQIA 1G2HA 1M66A 1PUFA 3HGGA 4A3EJ 2DMQA 4C3IJ 2FX0A 1ETVA 5J1RA 4S3MA 3PM1A 2CU7A 1ITYA 3DFUA 4J0FA 3HOZJ 2TCTA 1ETWA 3MOGA 2ECBA 4A69C 3IV5A 1X2NA 3BR5A 1IL0A 3ZOBA 3D1NI 1TXGA 5GP9A 3C7DB 4OM8A 1JT6A 2HQ5A 2PMZN 3WHCA 3DOJA 1GVDA 5HWSA 2Y2ZA 1E3OC 1BW5A 2L9RA 1FTTA 3RQSA 3EGOA 1P7JA 2I10A 2ZYAA 2VUMJ 1QPIA 2GLOA 4W97A 2JJ7A 3TP0A 2E1OA 3Q3SA 1VFCA 4YCAA 4RBOA 2YUSA 1MSFC 2H1KA 1FTZA 1D5YA 1LSOA 5AYVA 2ZB9A 3PO3J 2L0KA 2IAIA 4C2MJ 2X9DA 3ZQCA 2MGQA 1JT0A 1K61A 3M4OJ 3HBLA 1JDJA 1IDYA 3LSGA 1IUFA 4FISA 5F27A 5JLXA 2NVYJ 3JRHA 2Y9ZA 2O7OA 5EGOB 1B8IB 3HOXJ 1T56A 2CJJA 4B3HA 3K2AA 1LJ8A 3BR2A 2NVTJ 1U8BA 4CYCA 2O9LA 2P81A 2R92J 1QVUA 4XRSG 1ZKGA 3BG3A 3BR3A 2WAQN 4X1EA 4JPZB 4B3IA 4A3BJ 2HDDA 1WPKA 5DTDA 4JX5A 1AKHB 1HDDC 1WP4A 1CQTA 1WDMA 4BY7J 2JN6A 5GPAA 1QVTA 5EG0A 2XGEA 4A3IJ 1LE8B 2ME6A 1M67A 1MH3A 3G1LA 2E2IJ 4Y52J 4XRMA 1TC3C 3S2HJ 3FK7A 3QSGA 4V2GA 3L6DA 3HM5A 1ETOA 2IZ1A 1JKRC 4PZCA 4MFEA 5IOYA 2HOAA 2JA7J 4A3KJ 5JLWA 2EH3A 2IYPA 3BR1A 2MSYA 4XICA 2R5YB 4M3BA 2QYTA 1HF0A 2DA7A 1TWHJ 5DS9A 2WTBA 5J1YA 1Y1WJ 3ZW8A 4G12A 4EZBA 4GBJA 1I50J 2Y9YA 4IEJA 4NDLA 1H88C 3PO2J 4I76A 1ZR4A 1JKOC 1BA5A 1WDLA 3CKYA 4DYRA 1JJ8C 3LSRA 3CTVA 3S15J 4A3CJ 1OCPA 1MBEA 4Y7NJ 5FKMA 4M3GA 2L7ZA 2EZLA 5E3LA 5IYCJ 2W90A 2DA4A 4E12A 1P7IA 4IHXA 3HKZN 2LFBA 1VNDA 1WI3A 3A02A 2X6OA 4UUSA 1T33A 2NVQJ 3S1MJ 4D5CA 1U9OA 4XIDA 2KDZA 3ZWAA 1I6HJ 2DTZA 2M2EA 2DA5A 3JRAA 3WS7A 3RZOJ 2DA1A 1JUMA 1KS9A 2K9NA 1WH7A 5M3FJ 1JGGA 1XC5A 4HNVA 1DU0A 1YRNB 2JKVA 4AUXA 3ULKA 2JA6J 4FE4A 1EVYA 2DMUA 2M9HA 1F36A 1LSJA 5K7FA 3PLRA 2Y31A 3OSFA 3ZW9A 5C4XJ 5EYRA 2JA5J 3E7LA 2AO9A 2QF7A 4R1NA 1W0TA 4KUGA 1JTXA 5F1JA 4FE7A 4A3MJ 1MBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S0H B;  1EF4 A;  3DCF A;  5E3M A;  2LR8 A;  2XGD A;  2Y30 A;  5J1U A;  3A01 B;  1IGN A;  1OFC X;  3JR9 A;  3S17 J;  4D5F A;  2JA8 J;  2DN0 A;  1IV6 A;  4A93 J;  3GTO J;  3ZQG A;  2DA3 A;  2LP0 A;  3B6C A;  3FIS A;  1O4X A;  4A3D J;  4B4C A;  2GBY A;  3HOY J;  2K9Q A;  3S16 J;  3RZD J;  1VI0 A;  1AHD P;  2M0C A;  4GFB A;  1MBK A;  1NTC A;  2ID3 A;  1HOM A;  3BQZ A;  1RKW A;  3LSP A;  3JRI A;  3ZQI A;  2LY9 A;  2LD5 A;  3W6V A;  2XB0 X;  2L7M P;  1XS9 A;  1HLV A;  3ZQL A;  3SDG A;  3UKG A;  4ABZ A;  1SFO J;  1IG7 A;  3HOV J;  1SAN A;  3I4N J;  1A5J A;  1Q1V A;  2R5Z B;  2EZK A;  5IYB J;  1TWC J;  3CQZ J;  2OPT A;  4DYC A;  4BBR J;  3Q0V A;  1ETY A;  4C3H J;  3FIW A;  5M5X J;  1Z0X A;  4B3A A;  3HDD A;  4BY1 J;  3GBG A;  3BT9 A;  5F0H A;  4DW6 A;  2HOT A;  2JWT A;  2XB5 A;  3BR0 A;  3GTG J;  1PUF B;  3JRB A;  5M3M J;  4QSH A;  1RR7 A;  4DCK A;  2G0E A;  4EEF G;  1RKT A;  3H0G J;  5C3E J;  1GUU A;  5K7H A;  3IH3 A;  3GTJ J;  4AYB N;  3BQY A;  1ZTR A;  1IC8 A;  2EZI A;  5FLM J;  1FEX A;  4J19 A;  1B72 A;  3TW7 A;  1GT0 C;  1I3Q J;  3TED A;  2R7Z J;  3ZQH A;  1X58 A;  2E19 A;  4I6Z A;  3GTK J;  1TWA J;  2MW8 A;  3G1O A;  3S1N J;  2ID6 A;  2YS9 A;  3DEW A;  3LSJ A;  5GPC A;  5E3O A;  2TRT A;  5C44 J;  1U9N A;  2K9S A;  3C2B A;  1UMQ A;  5FKK A;  4IHV A;  4XK4 A;  1RES A;  1ETX A;  2EQR A;  1OJL A;  4UUT A;  1IRZ A;  3B6A A;  5K7Z A;  5F0C A;  1A6I A;  2CQX A;  2X48 A;  2FJ1 A;  2B63 J;  2NS8 A;  2XPU A;  3HGY A;  2VKE A;  2VPR A;  3QPL A;  2E2H J;  2XGC A;  4CYC B;  3WHB A;  1ORK A;  3A03 A;  2DMP A;  4X6A J;  2M8G X;  4IHW A;  3TP3 A;  3O8G A;  3HOW J;  4JX6 A;  2IEK A;  4JP0 A;  1RET A;  4OVN F;  4C3J J;  1XG1 A;  3S1Q J;  2JMW A;  5EG0 B;  1LFB A;  5EF6 A;  5F0F A;  1JUP A;  1JKP C;  2O8K A;  3M3Y J;  3JRF A;  5IYD J;  3HB9 A;  1HDP A;  4JX4 A;  1ENH A;  2NOG A;  2K40 A;  4MIM A;  4L5E A;  2LTP A;  4JYK A;  4FTH A;  2DA6 A;  1HCR A;  3GTL J;  2R0Q C;  5EEA A;  3ZQF A;  2VI6 A;  2CQQ A;  3QPS A;  5HOD A;  4M6V A;  2M34 A;  1WH5 A;  4D7M A;  2AHQ A;  3NAU A;  5FKN A;  3CCY A;  3RKQ A;  1ZQ3 P;  2EBI A;  1BJZ A;  3Q0W A;  2ECC A;  2WV1 A;  3FK6 A;  1QRY A;  3GTQ J;  5IP7 J;  3BG5 A;  2LLK A;  5F04 A;  2Y0S N;  5EGO A;  2XSD C;  1B8I A;  1OCT C;  2IBD A;  1ETK A;  4UUS B;  3S14 J;  2WB1 N;  3LOC A;  1MBH A;  2XPV A;  4XRS A;  2HOS A;  1Y1V J;  1UHS A;  4LOC A;  3BTC A;  3HEF A;  1IJW C;  5IP9 J;  2DJN A;  1IDZ A;  4DZP A;  2YU9 J;  3NAR A;  1JTY A;  4RDU A;  1GDT A;  1S7E A;  1AKH A;  5E3N A;  2COB A;  2DA2 A;  1MSE C;  4BKX A;  1LE8 A;  3S2D J;  4BXX J;  1MNM C;  2CUF A;  1FJL A;  3VPR A;  4A3J J;  2ME0 A;  4V2F A;  3SFI A;  4A3G J;  5C4J J;  2RAE A;  1JKQ C;  3SJM A;  5EZG A;  2XPW A;  2GM4 A;  3BTL A;  5BNG A;  1VF9 A;  9ANT A;  3BG9 A;  2CRG A;  5IOZ A;  3OOU A;  1WCM J;  2R5Y A;  4MLO A;  5M5W J;  3MN2 A;  2L7F P;  4M3E A;  4D7N A;  3LNQ A;  1R9T J;  4QTR A;  4IHY A;  3GTM J;  3FKI J;  3H3V K;  4MO7 A;  1U78 A;  2D5V A;  1JUS A;  4QIW N;  1MH4 A;  2N8G A;  1RPW A;  1UG2 A;  1ZR2 A;  1H8A C;  3CMY A;  1ETQ A;  4M3D A;  2LVS A;  2QCO A;  4DZJ A;  1FIA A;  2KT0 A;  1LFU P;  2R93 J;  3IH2 A;  1ZGW A;  4AC0 A;  3L1P A;  1JJ6 C;  5IP6 A;  3Q0U A;  5FJ8 J;  3JRC A;  3MVP A;  1YRN A;  2EZH A;  2FQ4 A;  3F0C A;  1K83 J;  4W1U A;  3JRG A;  4B1R A;  5EDN A;  1POG A;  3MKL A;  1TWG J;  3OSG A;  3O8H A;  5FLV A;  3I4M J;  3IH4 A;  1NK3 P;  1DU6 A;  2NS7 A;  2LK2 A;  2VKV A;  2OF7 A;  1ZK8 A;  3G1M A;  3QQA A;  2LKX A;  4FCY A;  3A01 A;  3BTJ A;  3K7A J;  1BW6 A;  2ELK A;  1MBJ A;  1B72 B;  3S1R J;  3TW6 A;  1Z77 A;  3HOU J;  4JQ0 D;  5EZH A;  1GV5 A;  1W0U A;  2HXO A;  1X2M A;  4A3F J;  2E2J J;  5FKL A;  1APL C;  4DYQ A;  2HYJ A;  3OIO A;  1NK2 P;  2NVX J;  2FD5 A;  5F08 A;  4BBS J;  5IPA A;  3BR6 A;  1GV2 A;  2HI3 A;  4MFD A;  1F43 A;  2R5Z A;  2XRL A;  2JK3 A;  5M5Y J;  3JRD A;  3GTP J;  1WGX A;  2W48 A;  2H8R A;  4A3L J;  2CUE A;  1FIP A;  1MBF A;  5FKO A;  1BL0 A;  3CDL A;  5J3L A;  3BTI A;  2HXI A;  3JRE A;  4M3F A;  2DMT A;  2MG4 A;  1H89 C;  1AU7 A;  2DMN A;  1TWF J;  3RQI A;  1G2H A;  1PUF A;  3HGG A;  4A3E J;  2DMQ A;  4C3I J;  2FX0 A;  1ETV A;  5J1R A;  3PM1 A;  2CU7 A;  1ITY A;  3HOZ J;  2TCT A;  1ETW A;  2ECB A;  4A69 C;  3IV5 A;  1X2N A;  3BR5 A;  3ZOB A;  3D1N I;  5GP9 A;  1JT6 A;  2HQ5 A;  2PMZ N;  3WHC A;  1GVD A;  2Y2Z A;  1E3O C;  1BW5 A;  2L9R A;  1FTT A;  1P7J A;  2I10 A;  2VUM J;  1QPI A;  2GLO A;  4W97 A;  2JJ7 A;  3TP0 A;  2E1O A;  3Q3S A;  1VFC A;  4RBO A;  2YUS A;  1MSF C;  2H1K A;  1FTZ A;  1D5Y A;  2ZB9 A;  3PO3 J;  2L0K A;  2IAI A;  4C2M J;  2X9D A;  3ZQC A;  2MGQ A;  1JT0 A;  1K61 A;  3M4O J;  3HBL A;  1IDY A;  3LSG A;  1IUF A;  4FIS A;  5F27 A;  5JLX A;  2NVY J;  3JRH A;  2Y9Z A;  2O7O A;  5EGO B;  1B8I B;  3HOX J;  1T56 A;  2CJJ A;  3K2A A;  3BR2 A;  2NVT J;  1U8B A;  4CYC A;  2O9L A;  2P81 A;  2R92 J;  1QVU A;  4XRS G;  1ZKG A;  3BG3 A;  3BR3 A;  2WAQ N;  4X1E A;  4JPZ B;  4A3B J;  2HDD A;  1WPK A;  5DTD A;  4JX5 A;  1AKH B;  1HDD C;  1CQT A;  4BY7 J;  2JN6 A;  5GPA A;  1QVT A;  5EG0 A;  2XGE A;  4A3I J;  1LE8 B;  2ME6 A;  1MH3 A;  3G1L A;  2E2I J;  4Y52 J;  4XRM A;  1TC3 C;  3S2H J;  3FK7 A;  4V2G A;  3HM5 A;  1ETO A;  1JKR C;  4MFE A;  5IOY A;  2HOA A;  2JA7 J;  4A3K J;  5JLW A;  2EH3 A;  3BR1 A;  2MSY A;  4XIC A;  2R5Y B;  4M3B A;  1HF0 A;  2DA7 A;  1TWH J;  5DS9 A;  5J1Y A;  1Y1W J;  4G12 A;  1I50 J;  2Y9Y A;  4IEJ A;  4NDL A;  1H88 C;  3PO2 J;  4I76 A;  1ZR4 A;  1JKO C;  1BA5 A;  4DYR A;  1JJ8 C;  3LSR A;  3S15 J;  4A3C J;  1OCP A;  1MBE A;  4Y7N J;  5FKM A;  4M3G A;  2L7Z A;  2EZL A;  5E3L A;  5IYC J;  2DA4 A;  1P7I A;  4IHX A;  3HKZ N;  2LFB A;  1VND A;  1WI3 A;  3A02 A;  2X6O A;  4UUS A;  1T33 A;  2NVQ J;  3S1M J;  4D5C A;  1U9O A;  4XID A;  2KDZ A;  1I6H J;  2DTZ A;  2M2E A;  2DA5 A;  3JRA A;  3RZO J;  2DA1 A;  1JUM A;  2K9N A;  1WH7 A;  5M3F J;  1JGG A;  1XC5 A;  4HNV A;  1DU0 A;  1YRN B;  4AUX A;  2JA6 J;  4FE4 A;  2DMU A;  2M9H A;  1F36 A;  5K7F A;  2Y31 A;  3OSF A;  5C4X J;  5EYR A;  2JA5 J;  3E7L A;  2AO9 A;  2QF7 A;  1W0T A;  1JTX A;  5F1J A;  4FE7 A;  4A3M J;  1MBG A; 
#chains in the Genus database with same CATH topology
 3ULQ B;  3ZR8 X;  4S0H B;  1Z67 A;  3DCF A;  5IT9 Z;  1MFT A;  2K85 A;  3GLM A;  1L4A C;  1BGY D;  2XKP A;  2BXZ A;  2MYS A;  2ZSI B;  1TU3 F;  1Z9C A;  2V1X A;  1FLI A;  4IZZ A;  4PGG A;  3S17 J;  2X6X A;  1A35 A;  4OIQ F;  1RQV A;  1XGN A;  3ROU A;  4ASW A;  1WJ5 A;  2DN0 A;  2W84 A;  1IV6 A;  3ISP A;  2WBM A;  1YTZ I;  3R61 A;  2KSJ A;  1S5L E;  2PRR A;  5FD6 A;  2A06 G;  5BQT A;  4D3S A;  1VQ7 P;  3FIS A;  2XDJ A;  2PG4 A;  3F8M A;  2QBY A;  5HS7 A;  5IT3 A;  3Q5S A;  3S16 J;  1DH3 A;  3I3L A;  1VI0 A;  1Z6R A;  1TT0 A;  3TL4 X;  1D5V A;  5APQ A;  3G6E P;  2DPD A;  4GFB A;  1X3U A;  1P2F A;  2Y69 H;  1YI2 P;  2FNA A;  2ID3 A;  2G3A A;  3PEF A;  1GD2 E;  1LTJ B;  3T97 A;  3HXL A;  1MJ9 A;  2WPR A;  5GTH C;  2E1M C;  3AEF C;  2MH2 A;  2XAF A;  2L7M P;  4OIR F;  4IKF A;  1T0F A;  1KIL A;  1RF0 C;  1SFO J;  1G3W A;  4A0Z A;  3KYL A;  3UKG A;  3HOV J;  3RL0 C;  3M8E A;  3I4N J;  3GG2 A;  1A5J A;  1Q1V A;  4OMZ A;  2EWN A;  1D1A A;  4M74 A;  3OY9 A;  1VQN I;  5IYB J;  3ZWC A;  5FWN A;  4BBR J;  3Q0V A;  4KUE A;  1S7O A;  2LY2 A;  2LRE A;  3KP7 A;  4HSR A;  4Z6Y A;  4CSW A;  3OBB A;  2LXC B;  2W8Z A;  2QG4 A;  3CCQ P;  4A0Y A;  2VBX A;  3E1R A;  2DT7 B;  2NNY A;  2QWW A;  1RF1 B;  2XNX A;  4BEH A;  3F72 A;  4B3J A;  4PD4 E;  2JWT A;  2XB5 A;  3DTE A;  5B3S H;  3PUB A;  2HPM A;  4BQA A;  3M9H A;  4B8X A;  5GAH J;  3OA7 A;  1YRL A;  4MNU A;  3EYY A;  2G0E A;  3TOA A;  3IR9 A;  2WT7 B;  1IW7 F;  4U0Y A;  4BHP A;  5KLI B;  4C30 A;  4RM3 A;  2ZXH A;  1ZCJ A;  2LXB A;  3K5B A;  3RKX A;  2E5N A;  5KCM A;  3K10 A;  5K7H A;  3IH3 A;  2O5R A;  5D5U B;  1IC8 A;  1ZTR A;  2FKW B;  2EFW A;  3S3M A;  1BE3 E;  2EZI A;  3QYB A;  1SQV K;  1KON A;  3FWN A;  1AVO A;  4D3D A;  2A5Y B;  1LVA A;  2ISY A;  3DBL B;  2CS3 A;  5DM7 F;  3H1L D;  4LG0 B;  3TED A;  3TQN A;  3RIR A;  2BW3 A;  3ABT A;  4O6J A;  1LTT C;  1DIP A;  4A12 A;  1GK6 A;  3L70 E;  4LLH A;  2E19 A;  4AUW A;  3LA2 A;  4NC6 A;  1G1I A;  2XF7 A;  2SPZ A;  3CD6 P;  3AG2 H;  2MW8 A;  5TIS C;  2VRS A;  1PGN A;  3Q3C A;  3CX5 I;  3I5C A;  3E0J B;  3K6J A;  3F3X A;  4G7Z F;  1CF7 A;  2RH0 A;  2XF6 A;  3M0D A;  4JBZ A;  1O7L A;  1U9N A;  1SD4 A;  4F92 B;  2IGO A;  3FXD A;  3A0B C;  1LT9 A;  4O9B A;  4YEL A;  5J47 A;  4IRG A;  4CYD A;  2XND H;  2X1E A;  1HGZ A;  4XK4 A;  3GMA A;  2FFD B;  1ETX A;  1HTL C;  2NPS B;  3K2Z A;  4F91 B;  2HU9 A;  1XPX A;  1B1B A;  1ZME C;  5ED4 A;  5C39 A;  4GO1 A;  3MGN A;  1M90 Q;  3MKW B;  1A6I A;  4BJ6 C;  1VQK I;  4DGW B;  1GLN A;  1P84 I;  4YXW H;  2IYO A;  2FJ1 A;  2GF2 A;  4LLL A;  4D1Q A;  1A04 A;  2B63 J;  5CVU A;  2IRF G;  4CZZ A;  2W6A A;  5DEQ A;  3HDH A;  3VMA A;  3OL3 A;  1VQO I;  3ECO A;  4M72 A;  4PFO A;  1E5W A;  4XKC A;  3HE4 B;  4HF2 A;  2HTS A;  3DV8 A;  1N7S A;  4R4L A;  3VMY A;  2A45 I;  3TK1 A;  2EIM H;  2HVQ A;  4G6D A;  2IP2 A;  1ORK A;  3L2Q A;  1MMS A;  3LSK A;  1G2C B;  2J5P A;  2KRF A;  5L3D A;  4CGZ A;  2YKP A;  3VSK A;  3HOW J;  4YTP C;  3CPW O;  1OVU A;  4RGX A;  3O8Z A;  3G0O A;  4Q47 A;  2WWY A;  1USS A;  1K9M Q;  5LRS A;  2CO5 A;  2KMU A;  3A1Y A;  1QA6 A;  1S9K E;  2ZAE B;  2BCC G;  4DIQ A;  5IYD J;  2X58 A;  4IJA A;  1HDP A;  1FBM A;  1G1J A;  2PLA A;  3CX5 D;  2P67 A;  3GXO A;  4L18 B;  1BJA A;  5KAI H;  4BDY A;  1IZN B;  2LTP A;  4KT0 J;  3CMA I;  2B9B A;  1TW2 A;  1XTA A;  3L73 D;  3L74 E;  5D4R A;  2DA6 A;  3GTL J;  5FRM A;  1M76 A;  3IHU A;  5EEA A;  3I54 A;  2E75 D;  5L3E A;  3LL7 A;  1DP3 A;  1B59 A;  4XRF A;  3QPS A;  4RAY A;  1UZC A;  5E79 C;  2M34 A;  4KHX A;  1JCC A;  1T2K C;  3MKZ A;  2E7W A;  1PZQ A;  1RE3 A;  1P84 D;  2PJR B;  1PJR A;  4CPG A;  2ZKZ A;  4GWG A;  2BEQ D;  1RE4 C;  3O6Q A;  3CWB J;  2FYU J;  1RY3 A;  1HW5 A;  4MTD A;  5D5V B;  1BDD A;  3MTU E;  5APT A;  2WV1 A;  3FHN A;  1GMJ A;  2QA4 P;  1R6R A;  1SFC B;  1D0X A;  2GIV A;  4LMY A;  3GTQ J;  3BG5 A;  3RL0 D;  5B66 C;  1I5Z A;  3WG9 A;  1PV3 A;  4DBR A;  3AE2 C;  3HUG B;  4UB6 E;  1T95 A;  2LLK A;  3BZ6 A;  1MMA A;  4DJA A;  5EGO A;  2XSD C;  3ZP5 A;  1RIO H;  2IBD A;  1O3S A;  4UUS B;  1DLI A;  3DFG A;  3ECH A;  1MBH A;  1P4A A;  2HOS A;  3PH0 A;  3U21 A;  1XCB A;  2GA2 A;  3NXS A;  1FDO A;  5APS A;  1NTK J;  1T8Z A;  4IFD K;  2E75 B;  2VBW A;  3L73 G;  2KHM A;  1R00 A;  4CUG A;  5CVJ A;  3H1K D;  1ZLJ A;  3V5B A;  1FX7 A;  3B73 A;  5E3N A;  3EET A;  3HUS C;  1JE8 A;  1URQ B;  2CK3 H;  4M73 A;  1MNM C;  2JPB A;  1W4M A;  3LAP A;  1FJL A;  1TBX A;  3IP4 B;  5ILS A;  1YW8 A;  3WU2 E;  2HGC A;  2GIZ A;  1N7L A;  3NMD A;  4IFM A;  5KLV J;  3SFI A;  4A3G J;  3AE7 C;  3HL2 A;  2Q1K A;  4L0Z B;  2G7H A;  1ZN5 A;  3QOE A;  3QPT A;  2BBY A;  1XSX A;  4IRH A;  2A45 G;  2QRX A;  4ZYH A;  2P1J A;  3M07 A;  2V6E A;  5KAF C;  5ILV A;  2BEZ F;  2IDB A;  2PQ8 A;  3C7J A;  3GF2 A;  3AEG C;  2CRG A;  2LBF B;  3K70 D;  2KIK A;  2ZJS E;  3P8C D;  1FZG A;  1WCM J;  2P7V B;  4ENK A;  1O3R A;  3L09 A;  4HX8 A;  3LNQ A;  1SQX E;  2DYR H;  2ZFU A;  1WHU A;  4DZO A;  4UB8 C;  4U88 A;  5AVY B;  1XDS A;  4QTR A;  3DBH B;  3FKI J;  1H88 A;  2E5Z A;  2FUG 2;  4OGQ D;  2EFP A;  2ZXI A;  4MO7 A;  3W3C A;  4D3F A;  2D5V A;  1RQU A;  1JUS A;  1KMI Z;  2CV1 A;  5JE8 A;  1IF1 A;  5MGB A;  1ZRC A;  3CCR P;  1HGV A;  2A45 H;  3EUH A;  3RJP A;  1N1E A;  1KIL C;  1T0F C;  3CF2 A;  4C7N A;  3G4S P;  2VON A;  1FMV A;  4XQF A;  2F5V A;  1JM0 A;  2KQR A;  2PN6 A;  4PJ0 E;  2R93 J;  2VOO A;  3IH2 A;  2NZ2 A;  3TO6 A;  4AC0 A;  3W2A A;  4YFX F;  5B1B H;  3L1P A;  4AVZ A;  4M9X A;  1EH6 A;  3JTG A;  1U2W A;  4PZJ A;  1UII A;  2NXN B;  3L35 A;  3JRC A;  3MVP A;  3D6Y A;  1N75 A;  3B5N A;  3GEZ A;  1OCZ H;  2JTV A;  2HEO A;  2JSP A;  2FQ4 A;  3F0C A;  4RES B;  1Z7L A;  1LDD A;  4AVP A;  2OTL P;  3JRG A;  3AE5 C;  4IL6 H;  3R2P A;  2QSG X;  4Y17 A;  3T8T A;  1AVY A;  2DOD A;  1BGY E;  3OSG A;  3SEQ A;  3O8H A;  4MQ9 F;  1X0T A;  4OIO F;  3IH4 A;  4E7Z A;  2YIU C;  3WFJ A;  2DQR A;  3M9A A;  1VPD A;  1FP1 D;  2LK2 A;  1W7P B;  4HV6 A;  3PHL A;  3TYY A;  1NJI Q;  1ZRD A;  2C9L Y;  3H9J A;  2QEX P;  2XGX A;  4B09 A;  5JR3 A;  2M7B A;  1UEL B;  3E1S A;  1H9G A;  3IQD B;  4XSZ F;  2J59 M;  3IFM A;  1Z77 A;  1K05 A;  4PSW A;  3Q9S A;  2Z9O A;  1JI8 A;  1OVR A;  1YJN P;  2HDH A;  1IAW A;  1R5S A;  2HXO A;  4ZTJ A;  3KLO A;  2O03 A;  2F48 A;  2I5U A;  3JSO A;  2UWM A;  1APL C;  2H6C A;  1MJB A;  1SVO A;  2XSJ C;  2CW8 A;  1JY3 P;  3I83 A;  1MW7 A;  4Y3O A;  4BH9 A;  2UV1 A;  3KYC B;  1LTJ A;  1HF9 A;  3HSF A;  1AQ5 A;  3B4S A;  2VT3 A;  2GUV A;  4M6X A;  4BBS J;  5IPA A;  4RB2 C;  1LT9 C;  3WGH A;  2DOA A;  2CG4 A;  1Q81 Q;  5L3G A;  2QM7 A;  1Z6T A;  4RAZ A;  4PV1 D;  3BRV B;  2IA0 A;  5DV5 A;  2ZYG A;  2KKO A;  3F5H A;  2FYN C;  3LWF A;  4BYY A;  1SQP J;  2W48 A;  2GOM A;  1R58 A;  2H8R A;  2M5A B;  4AYC A;  2Q6Q A;  3RK3 D;  4A3L J;  2GUS A;  5F64 A;  1R5G A;  3P9C A;  1BL0 A;  3MZW B;  1HVV A;  5J3L A;  1VQ9 P;  2FOW A;  3LSH A;  3ZXS A;  2R7W A;  3K4L A;  4XLF A;  3P9K A;  2EA2 A;  3RPU A;  2WB1 A;  3U1K A;  1XGM A;  1E79 H;  1RF1 A;  3BDD A;  1VDF A;  2DMN A;  3UNG C;  4E7I A;  1G2H A;  3BCC G;  4L76 A;  3JCU E;  3G6E I;  5E17 F;  2V7F A;  4L9J A;  2FBK A;  4NHJ A;  2MFZ A;  1ETV A;  4RGU A;  1DGR M;  3R4Y A;  1QNT A;  4ESF A;  2E36 A;  2WT7 A;  3MZ8 A;  3HRT A;  3PM1 A;  1ITY A;  3DFU A;  3CCV I;  3OJA B;  1ETW A;  4KUM A;  3MOG A;  1SQQ D;  2OAR A;  1JY3 N;  3H1L E;  3BR5 A;  2F6C A;  3A2K A;  1QO0 D;  4M6Y A;  1PDN C;  4PV1 B;  2W25 A;  3L72 D;  5A2Q Z;  3OOP A;  2YO3 A;  4S05 A;  4N0B A;  5GP9 A;  2H6B A;  1KFM A;  2GOX B;  2HQ5 A;  3SZG A;  2NRA C;  2BCC J;  3BAT A;  2LF8 A;  4LG0 A;  2Y2Z A;  3CCQ I;  4QWQ A;  1E3O C;  3H1J G;  3BRT B;  1L0N D;  1BW5 A;  2COM A;  1LEB A;  3FX0 A;  1ZRT D;  2ZT9 B;  1K4T A;  1DUX C;  1ERD A;  1R4M B;  4OWR B;  3RQS A;  2H43 A;  2DT5 A;  3H9Q A;  3NFQ A;  1LUJ B;  2R5D A;  2MA3 A;  1HSJ A;  1KC8 Q;  3ONQ A;  3F8F A;  3CJT B;  2YU3 A;  3D70 A;  2GLO A;  1D1B A;  3REO A;  1YQ3 C;  1M56 D;  2R7S A;  2RMZ A;  3H1H D;  1VQN P;  4H44 B;  1ODD A;  4W97 A;  1UB9 A;  2K86 A;  2E1O A;  2KPM A;  3TP0 A;  3Q3S A;  4D6T D;  2ICW G;  1VFC A;  3Q2Y A;  3A2A A;  1IV8 A;  2YKQ A;  2FXO A;  4RBO A;  1FTZ A;  2FFD A;  2JQ7 A;  1ZH5 A;  1J2X A;  2NPS A;  2C9N Y;  5CHX A;  3J80 K;  2E76 D;  2L0K A;  1VQ4 I;  2A5W A;  2X9D A;  1JDJ A;  2Z33 A;  3CME I;  3WTV C;  3BPV A;  2HTJ A;  3BCA A;  5HS8 A;  1JOC A;  5AIP A;  1JY3 O;  5K1Y A;  2L5G B;  5HLG A;  3CLO A;  2BV6 A;  4FIS A;  4IQJ A;  2P7J A;  3IF4 A;  3KZI C;  3OYA A;  4XN0 A;  4BQN A;  1KU9 A;  3LQR A;  3CO7 C;  1B8I B;  1M1E B;  1W5S A;  3HE4 A;  2F5F A;  3L72 G;  1VQP I;  5AIQ A;  3HD7 B;  2H1L A;  1R49 A;  3HPG A;  2NVT J;  3IAO A;  2P81 A;  4ASN A;  2XKO A;  4PJL A;  1G2C A;  4XRS G;  3BR3 A;  1EZV G;  1X3Z B;  4HAM A;  1L0N G;  2B89 A;  1K8A Q;  3MKY B;  2W7N A;  4KDP A;  2FOK A;  2VQG A;  2P5V A;  2JA2 A;  2ISZ A;  3VB2 A;  4PJJ A;  3L00 A;  2EV0 A;  1AKH B;  1FZP B;  5GAE J;  3CX5 E;  3L36 A;  1WP4 A;  4OAZ A;  1IO4 A;  1WDM A;  1QVT A;  3H1H G;  2VPL A;  1M67 A;  3KEO A;  4HZF A;  3USS A;  3L73 E;  2DOE A;  1R5L A;  3OYH A;  5LD2 C;  3H5A A;  3KZZ A;  3TNU B;  3L6D A;  3AEA C;  2JP3 A;  2HDC A;  3E6D A;  3KYD B;  4U7B A;  2HOA A;  2VB6 A;  3AG4 H;  2M87 A;  1P84 E;  4A3K J;  2NYX A;  5JLW A;  1L0L D;  1HA8 A;  2EFQ A;  3JC2 2;  2NRG A;  2MSY A;  1N2D C;  3F23 A;  2ZME B;  4KMF A;  3IRQ A;  3PLN A;  5FGM A;  2Z4E A;  2QJY C;  2IGM A;  2HYF A;  2LRD A;  2W57 A;  4B47 A;  4HDV A;  2PJR A;  4W7Y A;  3TSI A;  1R8E A;  5CVR A;  4YXD C;  4EZB A;  1SC7 A;  4GBJ A;  2E1N A;  2JWA A;  3QRF F;  1H88 C;  3ZMV A;  1JKO C;  1BA5 A;  2HKX A;  1TP4 A;  1WDL A;  3W2W A;  3CTV A;  2Q9I A;  3KEY A;  3LSR A;  2R32 A;  1VQO P;  3SWF A;  4AM3 A;  2X1D A;  1PP8 F;  3S15 J;  4I99 C;  3P5J A;  4A3C J;  1SFC A;  1QVF O;  5FKM A;  2E74 B;  2PMH A;  1N78 A;  5IYC J;  3HUG A;  4E12 A;  2KIQ A;  1P7I A;  4HW0 A;  2I8D A;  2L01 A;  3EUH C;  1R36 A;  4OIN F;  1VND A;  2N1T D;  3A02 A;  3S93 A;  1S5L H;  4FET A;  3SXY A;  1Y56 A;  5IY5 H;  4UUS A;  2V9P A;  2KDZ A;  2D1H A;  4HLY A;  3ZWA A;  3H1K E;  2DTZ A;  2M2E A;  2DA5 A;  2H7H A;  3L7W A;  1PYV A;  4HG2 A;  3PRJ A;  3RZO J;  3OYB A;  3PL8 A;  3T0Y A;  3Q3D A;  4ZYD A;  1F5T A;  1R22 A;  2ZXJ A;  2JJL A;  1XX5 A;  1WH7 A;  1MD0 A;  1J0R A;  2ESN A;  5M3F J;  2R44 A;  1EQ7 A;  2YNY A;  2Q7C A;  4PSX A;  3B5N C;  5GTI E;  1XD7 A;  2JA6 J;  1NTK K;  2OCC H;  2MJZ A;  3CUO A;  4YIR X;  1URQ A;  2M9H A;  5H2F E;  1F36 A;  2Y31 A;  1M57 D;  4TT3 H;  3I56 I;  2JA5 J;  2Z3Y A;  4KUG A;  1H0T B;  3SYT A;  4FE7 A;  4GOE A;  3EUK L;  3WFI A;  3K4B A;  5A9S B;  3P8C E;  4HYT B;  2VT2 A;  1EH7 A;  3QU6 A;  1KA8 A;  1B9M A;  2HQA A;  4NC8 A;  5J1U A;  4HNU A;  4WCG A;  1IGN A;  1BE3 G;  1OFC X;  2B88 A;  2XKM A;  5J4Y A;  1YIJ P;  4IQ4 A;  2O3F A;  3Q5R A;  2M4K A;  2LBF A;  5EEG A;  2R7X A;  2TDX A;  1OZH A;  2JA8 J;  4LJZ F;  4PD4 H;  2BHZ A;  1NTZ D;  2KOG A;  3ZGY A;  1VQ6 P;  3B71 A;  1FOK A;  1YBK A;  4ESB A;  3L70 G;  4KNY A;  5BPI A;  2A68 F;  3L4F A;  1JO5 A;  2DBB A;  2DU9 A;  3SZT A;  3RZD J;  1AHD P;  4ASV A;  2B7E A;  1PL5 A;  3PNV A;  3NEU A;  1MBK A;  3VOE A;  1J9I A;  1BG6 A;  1LTJ C;  3V8J A;  2AQF A;  1XMK A;  5DM6 F;  1X4P A;  4ZJZ A;  4NUB A;  3LSP A;  3JRI A;  3W6Z A;  2AXT H;  3BAS A;  4I7Z B;  4WY4 B;  2LD5 A;  1TQI A;  1XS9 A;  2EIN H;  2A69 F;  4CH7 A;  1IG7 A;  4ABZ A;  2JSC A;  2R3C A;  5B5E E;  2OAZ A;  1Z3Y A;  2DFE A;  5E8I A;  2EZK A;  1FOX A;  1Q2N A;  2D2C C;  4Y13 A;  2PGD A;  1LTB C;  2ELH A;  2NAZ A;  3BJ6 A;  3QPH A;  3MQ0 A;  1K7A A;  2FYZ A;  1NU1 D;  1MMG A;  2YSR A;  2FXM A;  5CMZ A;  4O3M A;  3MIW A;  2AXL A;  3OV8 A;  3BT9 A;  1W36 C;  3VN0 A;  3O2P E;  5F0H A;  3PNY A;  4LB6 B;  4DW6 A;  4BXF A;  5E1X A;  1K73 Q;  1RF1 C;  2KDO A;  5KKZ B;  3CCL P;  4H0L C;  2WSF H;  4ZMD A;  4CO8 A;  1QU3 A;  2KJC A;  2O0Y A;  3I55 I;  2V26 A;  3A7O A;  3BCC J;  3JRB A;  2WAQ A;  2KNC B;  1R4N B;  1RR7 A;  3KEQ A;  1FC2 C;  2QJK C;  3CCR I;  3GWZ A;  1RKT A;  4LK1 F;  2K7L A;  4RMN A;  4BUP A;  4CCN A;  1W7P A;  2STT A;  1EXI A;  4G94 A;  5C3E J;  3G4S I;  3IAS 2;  5HNH A;  5HLT A;  5FLX Z;  3GF7 A;  3V2N A;  1AFO A;  2K9L A;  3BQY A;  3F9K A;  3G71 P;  2IZ0 A;  5FLM J;  1FEX A;  1ON2 A;  4A5N A;  3TW7 A;  5CCH D;  1GT0 C;  3K69 A;  1XTG B;  1HBW A;  2FML A;  5JVG F;  1BR2 A;  3FMS A;  3L74 G;  1NTM D;  2DLL A;  2R7Z J;  3ZQH A;  2LYC A;  1OYY A;  1OWA A;  4G8X A;  1X58 A;  3HSR A;  1IO2 A;  1HC8 A;  3BG7 A;  3H1J J;  2OTL I;  1BR4 A;  4N4N B;  2IPQ X;  3G1O A;  2KYV A;  1EDI A;  1NU1 G;  2CYY A;  4UVB A;  5GPC A;  5E3O A;  2RN0 A;  2TRT A;  2K3P A;  2VXZ A;  5CLS A;  3SZP A;  1N1G A;  4E21 A;  4AWX B;  3VMX A;  1QVG O;  3OS1 A;  5AVX B;  5CCG C;  5TJJ A;  1QHG A;  1UMQ A;  3RK3 E;  3CCM P;  1WJB A;  1IXS B;  1RES A;  1QL2 A;  4ZDP A;  2CW7 A;  2FFD C;  2BVM A;  4Y33 A;  4M9Z A;  2NPS C;  2XZR A;  1YIO A;  4UUT A;  1QZE A;  1M75 A;  2M5A A;  2QEX I;  5K7Z A;  5KJ7 D;  1PP9 D;  3M8J A;  1TL8 A;  2MC3 A;  1VPC A;  3TGU D;  5CYV A;  5CPR B;  3ADP A;  3HKZ A;  4F52 A;  4UV9 A;  1FMW A;  3HGY A;  5KAI C;  1D8J A;  3A5T A;  3K1M A;  1OYW A;  3LIE A;  1HW1 A;  2LF7 A;  4A6D A;  4U7J A;  3QPL A;  1VQM P;  2FU4 A;  1K4S A;  4CYC B;  3WHB A;  2R7U A;  1SQQ E;  3L71 D;  4I2O A;  2DO7 A;  1BIB A;  3S3O A;  4IHW A;  1NTM G;  3GHG C;  3TP3 A;  4UVC A;  3DKY A;  2UYY A;  4Q5S F;  1FYM A;  1ONV A;  4JX6 A;  2IEK A;  4LIU A;  1J2J B;  1GL2 D;  2WZ7 A;  3L72 E;  2Z16 A;  5EFW B;  4P5O A;  1ZEL A;  2W1O A;  1PGQ A;  1XG1 A;  2X6Y A;  4UB6 H;  5DJU B;  3HAD A;  1PGO A;  5LGT A;  5FRO A;  1LFB A;  3WGI A;  5F0F A;  1L0N E;  1JKP C;  3M3Y J;  3WTZ A;  1ZRT E;  3HB9 A;  4JX4 A;  1V5F A;  3B02 A;  2NOG A;  3KPH A;  1REP C;  1ZG1 A;  1T3U A;  2IPP A;  3DWL E;  1VQ9 I;  1FU1 A;  5KK1 A;  1T3J A;  3DLA A;  1VF5 D;  5DCM B;  3HTU A;  4ITV A;  3H1H E;  4Q48 A;  1ULY A;  1T98 A;  1SQB E;  3ZDM A;  4PZD A;  4OOI A;  1LNQ A;  4D6T E;  1RH5 B;  4G7H F;  1ZLK A;  1R5H A;  1LVK A;  1BI1 A;  3DPT A;  4A0X A;  5LEJ A;  1JMB A;  3C1L A;  3BY6 A;  5HOD A;  1SQX G;  2CH0 A;  5LBQ A;  4RKU J;  2LR2 A;  5FKN A;  3QHA A;  2XRO A;  2FF4 A;  1OIP A;  3WU2 H;  3N4M A;  3PDU A;  3ZHB A;  3LW5 H;  4RA2 A;  3P7K A;  4RGR A;  2UUZ A;  2O01 N;  2P8T A;  1KQG B;  3ASO H;  1L3L A;  5HLH A;  2K9Y A;  1SFC C;  2ACJ A;  2QYO A;  3ZMS A;  3OYN A;  3AE6 C;  3E6B A;  3BZK A;  4YIF A;  3PUF A;  3IUO A;  3HJE A;  5F04 A;  2Y0S N;  3M1E A;  3KET A;  1B8I A;  1J1D B;  3RTR A;  3H5R A;  3S14 J;  1VF5 B;  3HD7 A;  2XPV A;  4XRS A;  2L54 A;  4BU2 A;  3CCV P;  2ZXX A;  1UHS A;  3KQG A;  2BY1 A;  2CUJ A;  4XNF A;  3BTC A;  1H0M A;  2ADU A;  3V7R A;  4ZZD A;  2STW A;  2DJN A;  1IDZ A;  1Z56 A;  2HQN A;  2PX9 A;  3DTK A;  3V4G A;  1JTY A;  2Z2S B;  1S7E A;  4H0L D;  5E1Z B;  3RK2 D;  1BN5 A;  1ZRF A;  1AKH A;  2FNP A;  2COB A;  3TDK A;  1Y39 A;  1YX5 A;  1W5T A;  1URQ C;  3AEE C;  3S32 A;  1BGY G;  1GZL A;  4N78 D;  3SHF A;  2CUF A;  1WRG A;  4BGD A;  2MAB A;  5DD4 A;  2RRE A;  3VPR A;  2FRH A;  4ENN A;  4CIC A;  1NG6 A;  1IRG A;  4HLX A;  4PJ0 H;  5C4J J;  2RAE A;  5H20 A;  1L0L E;  3V42 A;  3EDP A;  3TNU A;  1IFJ A;  4A6E A;  1IFM A;  2XPW A;  2GM4 A;  3BTL A;  4J01 A;  1VF9 A;  2J58 A;  4H44 C;  1SMT A;  3WUT A;  4DOZ A;  1TT5 B;  3OOU A;  1BE3 J;  1PPJ E;  2ZME A;  5M5W J;  4BE0 A;  4IRI A;  2LKS A;  3MN2 A;  3FR7 A;  1VQ4 P;  1GXQ A;  3CME P;  3T8R A;  1VL2 A;  3CJN A;  2RN7 A;  4P96 A;  4PZE A;  2W6J H;  5AVR B;  1GTW A;  3KDP B;  4JBA A;  2X1C A;  4LIT A;  3L70 J;  2EPF A;  2M5W A;  1U78 A;  1VQL I;  3LQQ A;  3GHY A;  5AW7 B;  2V1U A;  4IL6 C;  1SQP D;  2VQL A;  3G17 A;  1LB2 A;  1MH4 A;  2Z5H A;  2BHY A;  2DK5 A;  4U3F D;  3RBZ A;  3D6Z A;  1VQP P;  3WMM 0;  4Q4Z F;  3AE3 C;  3TOB A;  1ZAO A;  3WOD F;  1S7A A;  1EKE A;  5AW5 B;  3IAM 2;  3H1C A;  3PJG A;  1PGJ A;  1MNE A;  2M30 A;  1UG2 A;  4GWK A;  2WSF J;  1U3E M;  4M3D A;  4A5M A;  3EYI A;  3F89 A;  4L9T A;  4NQW B;  1UHM A;  1Z7U A;  2RC4 A;  4XKB A;  1JJ6 C;  2R4G A;  1LJ9 A;  2A05 A;  3MFK A;  1WFX A;  1FBU A;  2R5B A;  2HLO A;  1KQ9 A;  1R23 A;  3V7C A;  1F14 A;  1TNT A;  1F12 A;  3V4W A;  2EZH A;  2IS6 A;  5BVZ A;  5HNF A;  1IN7 A;  4KIC A;  3ZRG A;  1R1U A;  3ASN H;  4OIP F;  5LHH A;  4I0B A;  3I53 A;  2IJL A;  4W1U A;  3CDI A;  2KZI A;  4E7S A;  1ZAR A;  4K35 A;  1O3Q A;  2C6Y A;  1OW6 A;  1IRF A;  4IX7 A;  4FGW A;  1H0T A;  4EYY Q;  4R8H A;  3HYI A;  1O3T A;  5FLV A;  3N4X A;  1WPQ A;  4ZNC A;  2QJP B;  1W5C C;  3H1L G;  5A9S A;  2DXI A;  2JZY A;  1QMG A;  2VKV A;  4E7L A;  1NAY A;  2E34 A;  3F8B A;  4KN7 X;  1X0X A;  3QQA A;  2P0W A;  4I0A A;  4HRI A;  1YJ8 A;  1NTZ E;  4U3F G;  3WTW C;  1N73 B;  2QKM B;  4E70 A;  3K7A J;  1T08 B;  2MLG A;  2ELK A;  3J81 K;  1KYW A;  2R3S A;  1B72 B;  3JCU H;  1SD7 A;  3CXH I;  4YFK F;  3FWL A;  1GV5 A;  3CTA A;  1MV8 A;  2JRM A;  4Y99 B;  2Y0E A;  4RM2 A;  1D0Z A;  2K3F A;  5FKL A;  1L4A D;  3L74 J;  2VOP A;  3Q5P A;  2VJ5 A;  4KMU X;  3WU0 A;  3NWS A;  2Z1D A;  3OIO A;  2P2U A;  1Z82 A;  3C8V A;  3ZMT A;  3DKX A;  4WY4 A;  1P4X A;  3C18 A;  1KZU B;  2WSC H;  4PK4 A;  4YG2 F;  1NYH A;  2P4W A;  2OUM A;  1GV2 A;  1RI7 A;  2FBH A;  1X22 A;  3CJQ B;  1X9V A;  3CP2 A;  1NU1 E;  1V4R A;  1BOB A;  2XRL A;  1D7M A;  2ZYD A;  5LEK A;  3GTP J;  1WGX A;  1YIJ I;  2EIJ H;  1FZF A;  3GX4 X;  5DD8 A;  1FIP A;  1MBF A;  4WWC A;  4HST A;  2E1C A;  5HOO A;  3V2Q A;  2KIM A;  2LKM A;  3I56 P;  4AIH A;  3JRE A;  1VQ6 I;  2CVZ A;  1OPC A;  3DEE A;  1WDK A;  1OXZ A;  3E5X A;  2MG4 A;  4ZC3 A;  3U2R A;  1AU7 A;  4GYG A;  1TWF J;  4IHT A;  2ZJQ F;  4GYI A;  4XM3 A;  1UJ8 A;  2DMQ A;  2H09 A;  3M1C A;  2KNC A;  5AW4 B;  2L3D A;  1OR7 C;  1WJD A;  5J1R A;  1K6O A;  1WJF A;  4XLP F;  4S3M A;  4E7J A;  2WA0 A;  3OYF A;  3CXH D;  1P6R A;  3KFW X;  1KQ8 A;  3R6S A;  1YYC A;  1TZL A;  4HV5 A;  3ZOB A;  1NTM E;  2BE5 F;  1SAX A;  2KIS A;  5APV A;  4V19 K;  5BU5 A;  3K9T A;  4N9I A;  3C7D B;  2CWE A;  2CV0 A;  1SQV D;  2PMZ N;  2O1K A;  2FYU E;  4QPQ A;  3OMY A;  3LW5 J;  1M1K Q;  3WHC A;  2IX7 C;  4IOC F;  1GVD A;  1TNS A;  2YR2 A;  4RJT A;  2WMM A;  2D45 A;  2PJP A;  1BI2 A;  2ZT9 C;  3LSM A;  3CCL I;  3LSI A;  3MCZ A;  3ML6 A;  4XLA A;  1OW7 A;  3EGO A;  1QZY A;  2I10 A;  1WT6 A;  2ZYA A;  3CX5 H;  3RL0 B;  1QPI A;  3CLQ A;  1DEB A;  2L7K A;  2JJ7 A;  2WPS A;  1O57 A;  5D6E A;  3ZMD A;  2O1J A;  3TKY A;  3FHZ A;  1YW9 A;  2K5C A;  1SQX J;  3M9B A;  4MTE A;  1JHH A;  1LTS C;  2YUS A;  1PP9 E;  1S4X A;  2J5O A;  3U1D A;  4XN3 A;  1D5Y A;  2Q3E A;  3TGU E;  3PO3 J;  3JAM Z;  4L5J A;  1HUC A;  4NPD A;  3ZQC A;  1JT0 A;  3M4O J;  1X19 A;  1DQU A;  2L5Q A;  5D8L B;  3G71 I;  2PAJ A;  2OYH B;  5CBN A;  5D6F A;  4EVI A;  1P84 H;  1LFP A;  1MZB A;  2Q0O A;  3OS0 A;  2I1J A;  3BWG A;  3I55 P;  3JRH A;  2Y9Z A;  2O7O A;  3L71 E;  3TDZ C;  3HOX J;  1T56 A;  3H1K G;  5KLV E;  3W6K B;  1G3S A;  3DKW A;  3K2A A;  1YTY A;  1YS7 A;  3BR2 A;  4KJZ A;  5JVT A;  1ZYR F;  2R7R A;  3HD7 C;  2WTY A;  4CYC A;  3DU5 A;  4K2E A;  2R92 J;  1QVU A;  3MAJ A;  1UG0 A;  4LLG F;  3I5U A;  3S8P A;  4PDK A;  2ZJR F;  1R71 A;  2UXN A;  5IT9 K;  3BG3 A;  3SQN A;  2IS4 A;  5FRN A;  2M3E A;  3H1I D;  4N6J A;  2F5C A;  2HDD A;  4OAY A;  3KE2 A;  3CCM I;  3S3N A;  3FXR A;  1CQT A;  4NPE A;  4BY7 J;  1V5E A;  4A3I J;  2HZT A;  4AD9 A;  4EAT A;  1L0N K;  1MH3 A;  3PQK A;  4KIB A;  1BGY J;  2E42 A;  4R1H A;  2WC2 A;  4R4M A;  1NAF A;  3FK7 A;  3IKV A;  4MHG A;  1S5L X;  3QSG A;  3H32 B;  5DCM A;  1Q1H A;  2C0X A;  2YPR A;  3PFI A;  1ETO A;  4OGQ B;  3GYH X;  1S5L C;  3Q9V A;  4C2U A;  1SVF A;  3S1K A;  5GTI H;  5IOY A;  3BC8 A;  2DDA A;  1N86 A;  4PJN A;  1VQM I;  3KP4 A;  3KXD A;  1Y9B A;  3OAK A;  1JUN A;  3C3W A;  2EH3 A;  5ILU A;  5H2F H;  2R5Y B;  1YG2 A;  1S2E A;  1T39 A;  1HF0 A;  4L0Y B;  1EH8 A;  1TWH J;  4HEA 2;  2G8Y A;  3HRS A;  5LGN A;  1GW3 A;  1IFI A;  2YMK A;  3W67 A;  4IEJ A;  2Y9Y A;  5LRR A;  2EV5 A;  3PO2 J;  2ETH A;  3MMY B;  2CV2 A;  1S1C X;  1SMY F;  3P8M C;  1GU5 A;  1QEX A;  1EJ9 A;  5CQG A;  4Y7N J;  1X1B A;  2E74 C;  1SVM A;  4EJT A;  2VOD A;  2YXQ B;  4M3G A;  1FJK A;  1M7L A;  2K02 A;  1BSN A;  4TV7 A;  4H13 C;  2L9N A;  1T2K D;  3ABK H;  1NVO A;  1D3Y A;  2LFB A;  2KI7 B;  2CGP A;  3OYJ A;  3QWL A;  2H88 C;  4PGH A;  5K5R A;  3S1M J;  3M0D C;  4BJ5 C;  3R4K A;  3ZMZ A;  4D5C A;  4XID A;  2OYO A;  2DI3 A;  3GZ5 A;  3A0H E;  3M9Q A;  1X1P A;  3RSN A;  4EI2 A;  2M0M A;  4Z2Y A;  3GW2 A;  4F93 B;  1JUM A;  2P5L C;  4RB1 A;  4BS9 A;  1UAA A;  5E8G A;  1KS9 A;  4N78 E;  1JGG A;  1XC5 A;  1U6G A;  4HNV A;  2JKV A;  3ULK A;  2MLK A;  3ZQQ A;  5APW A;  2Q8K A;  2I1K A;  1S72 P;  3QU3 A;  3JSV C;  2DMU A;  1LSJ A;  1XDU A;  3OSF A;  2ITA A;  2K27 A;  2JO1 A;  4CA0 A;  1VQ8 I;  5EYR A;  5B5E H;  1D0Y A;  1FOW A;  2BEO A;  2OA4 A;  1ZG3 A;  5LHI A;  4E7H A;  4R1N A;  1JTX A;  5L8R J;  2VKH A;  3M0A A;  1N7S C;  3PJR A;  2AXT C;  3GVA A;  4A3M J;  1MBG A;  2DFI A;  3GF3 A;  1T38 A;  3H92 A;  3VSL A;  2F4O B;  4E6K G;  2CPB A;  3VYU B;  1HH0 A;  3F22 A;  1XTC C;  2XGD A;  3EQ2 A;  2Y30 A;  3A01 B;  3H1L J;  1HST A;  2H94 A;  2K9M A;  3JR9 A;  2WTE A;  3K1N A;  4D5F A;  3FMR A;  4N9H A;  4C46 A;  4XLC A;  2E7X A;  4A93 J;  1YON A;  2WSC J;  3GTO J;  1YIT P;  4JK1 X;  1X1C A;  3ZQG A;  1AV1 A;  1OIS A;  2IGK A;  1SQP E;  3L75 D;  4U3F E;  1O4X A;  4A3D J;  4YPC A;  1ON1 A;  4B4C A;  4GRI A;  3AL0 B;  2GBY A;  3HOY J;  4KIG A;  5E18 F;  1NO4 A;  1YX3 A;  5J6X A;  3ABM H;  5LGU A;  3H9G A;  2M0C A;  3WU1 B;  1KU2 A;  2PEX A;  4J00 A;  3RK3 B;  3V6I A;  3FM5 A;  2F5D A;  1WVR A;  4HH2 A;  3KP3 A;  1Z1D A;  3CZ6 A;  4WY4 C;  1OCR H;  4EGY A;  4UY8 I;  4G6T B;  2CFX A;  3WE2 A;  4RB3 C;  4RLQ A;  2P4Q A;  3ZQL A;  2MD5 A;  3PID A;  1BCC D;  1ZOY C;  2Y0D A;  1I27 A;  2CQ7 A;  1SAN A;  1FAV A;  3HC7 A;  1OW8 A;  1SQB D;  3DTI A;  4IO9 F;  1RE3 C;  4NQW A;  2M3B A;  2RKH A;  1TWC J;  3ZPL A;  4I6M C;  2OPT A;  4MN4 C;  1Q82 Q;  3HG9 A;  2P7C B;  2K3R A;  1ETY A;  2NS0 A;  2XAS A;  1OMI A;  2VJ4 A;  3DF8 A;  1HQC A;  4B3A A;  3HDD A;  4UHT A;  1X8Y A;  1LJ2 A;  5CKT A;  2VL8 A;  3BG6 A;  1KIL D;  2HOT A;  3VFZ A;  4U7D A;  2QKL B;  2HOD B;  1Y8Q B;  1SQQ G;  1GHC A;  3BR0 A;  3GTG J;  1PUF B;  4BWN A;  2XU6 A;  4QMA A;  2AXC A;  3L75 G;  1S8N A;  3HSE A;  4L9N A;  2FXP A;  2K4J A;  4EEF G;  2BY2 A;  3H0G J;  3OYC A;  1PIX A;  2ZFC A;  4RLF A;  2QE7 H;  1M1J B;  1QGK B;  1N73 A;  4EMS A;  5FFZ A;  3BRO A;  1G4D A;  2O01 H;  2DJI A;  2E5T A;  2UWJ E;  2E5Y A;  1WWX A;  4OL9 A;  1RNL A;  1PVE A;  1B72 A;  3L73 J;  1FZC B;  1VQL P;  3WE3 A;  5H6R A;  2AEJ A;  1KQL A;  4K3A A;  3FXQ A;  1JY2 P;  3L9F A;  2H8W A;  1SQB G;  2B0L A;  4D6T G;  2F2E A;  2E76 B;  2R7Q A;  4HYE A;  1DD3 A;  4U0V A;  5EEH A;  1E2X A;  4MEY F;  5DYM A;  4I6Z A;  1DLJ A;  3CCS P;  1QHH D;  5CJ4 A;  2Y48 A;  3GTK J;  2R7T A;  2X6W A;  1TWA J;  4I1L A;  3U1C A;  2Y0M A;  3DEW A;  2Q1Z B;  5C44 J;  3AAF A;  2P58 A;  2IA2 A;  1BC8 C;  4BXL A;  2KLO A;  1BI3 A;  2K9S A;  5FKK A;  1B4A A;  2XAH A;  4IHV A;  1IFD A;  2IA1 A;  2EIL H;  2L9V A;  2IT0 A;  2RVC A;  4DQ2 A;  3C7A A;  4UB6 C;  1NU1 K;  5GTH E;  1BBY A;  2VQC A;  3G3Z A;  4HJG H;  1PPJ D;  2VJI A;  5F0C A;  2V7Q H;  2LNB A;  1P4W A;  4H13 D;  2X48 A;  3CCE I;  4CCM A;  1IFP A;  2QVO A;  2NS8 A;  1J5Y A;  4BHB A;  3K0L A;  2HQR A;  3PQJ A;  1XCV A;  4AU7 A;  4UUV A;  1LTG C;  1ZRE A;  1LT1 A;  3LA3 A;  2E2H J;  2DTR A;  3CXH E;  1F4K A;  3H1K J;  3A03 A;  4J0E A;  3DPU A;  3H5N A;  5FO5 A;  1N25 A;  1LDJ A;  3N7N A;  4X6A J;  1JY2 N;  2M8G X;  1KYZ A;  1R5I D;  2VQH A;  4KIT B;  1KB9 I;  3M06 A;  3O8G A;  3L2U A;  1BDC A;  1ZLL A;  1RET A;  1SQV E;  3WU2 C;  3PIO F;  2I76 A;  3HTK B;  4I01 A;  3S1Q J;  2JMW A;  5EG0 B;  3C7C B;  3HWR A;  1QPM A;  5EF6 A;  3C2G A;  1NTM K;  2O8K A;  4M9S A;  4DT0 A;  1KTM A;  2GAU A;  3C1D A;  3JRF A;  5L3C A;  2PMU A;  1AQT A;  1ENH A;  1L0L G;  2M0B A;  3CCJ P;  3K4N A;  5K5Q A;  1MND A;  3HE5 B;  1X1D A;  2QQ8 A;  3CES A;  2QGU A;  3ADO A;  3QYF A;  1JGS A;  5AW2 B;  3ERM A;  3FF5 A;  3W6U A;  4JYK A;  2JR8 A;  1OLT A;  2GXA A;  1PPJ G;  2QIW A;  4IPA A;  1LQ1 A;  2KZV A;  2R0Q C;  4ZYE A;  2OQG A;  1RF0 A;  2VI6 A;  3GZN B;  1DPR A;  1MGT A;  2V4J C;  1KYO I;  3V8K A;  5KVR A;  1W1W E;  2AHQ A;  2N1T B;  2FYN B;  3K4M A;  3ABL H;  3NAU A;  2OCE A;  1EC5 A;  3CCY A;  2KFD A;  1ZQ3 P;  5TIS E;  2KS1 B;  4XON A;  3J7A O;  1D8K A;  1IK9 A;  2W85 A;  2ZJP F;  3Q0W A;  2ECC A;  1JY2 O;  2FQ3 A;  3E5Q A;  2BZT A;  4RGS A;  2KP6 A;  3A0B E;  1SQX K;  4G9Y A;  2WV0 A;  4RAG A;  1A02 F;  5HDN A;  2OYH A;  1QRY A;  5IP7 J;  1WJC A;  2PBI A;  2V4H A;  2DFF A;  4GGG A;  5BMZ A;  2KL4 A;  3OYL A;  4PJ0 C;  5AON A;  1HW2 A;  1LP1 B;  4EOT A;  1KB9 D;  1OCT C;  1J1D C;  1S9H A;  3GLX A;  3H1I E;  2LG4 A;  3LOC A;  5ICG A;  3RGU A;  5HS9 A;  3E6C C;  3CC2 P;  1Y1V J;  1J7K A;  1QQI A;  4PUS A;  2CSO A;  4LOC A;  4KN4 X;  3BOQ A;  1IZ1 A;  3HEF A;  3OIQ A;  5DDG A;  4F3Q A;  5IP9 J;  3E97 A;  4DZP A;  3K96 A;  2YU9 J;  2DYS H;  3W2V A;  3FM3 A;  2AS5 F;  4RDU A;  1XMX A;  1GDT A;  4HQE A;  1YB4 A;  3LID A;  5K5G B;  5FB2 A;  3SFD C;  4X0G A;  5CJ0 A;  2CPS A;  3CC4 P;  2DA2 A;  2HG5 D;  3B8E B;  4BKX A;  2A6H F;  5KTB A;  2ZVN B;  3H3U A;  2Z5I A;  3VP8 A;  5ICC A;  2OQR A;  4DNC A;  1SFX A;  1MJA A;  2R7V A;  1HKS A;  2WAD A;  2FXA A;  1NTZ G;  1KYO D;  4Z1M H;  2LOO A;  3H32 A;  2HKO A;  5AVQ B;  1JKQ C;  4A7P A;  3SJM A;  3OW2 O;  1GXP A;  5D8K B;  5EZG A;  2KZJ A;  3PFY A;  4II3 A;  2IS1 A;  1SFE A;  2XF5 A;  4ZZL A;  4MGR A;  4BNC A;  1IUY A;  1S6L A;  1AA7 A;  4ZDL A;  5BNG A;  3AG1 H;  3BG9 A;  3NRV A;  5KLI C;  3R60 A;  5IOZ A;  3CUQ B;  4BQO A;  2QEN A;  2IFN A;  1A02 J;  4EDF A;  3K4J A;  3M7G A;  4MLO A;  2R5Y A;  1LKX A;  1LWU B;  1HXD A;  4P1W A;  1GVJ A;  5ICF A;  4D7N A;  4XLE A;  2WAE A;  2B87 B;  2ZC2 A;  3FGA D;  1DD4 A;  5J8C A;  2L4M A;  3H3V K;  5E79 E;  2JVH A;  4PCQ A;  3WTY C;  1EDJ A;  4FX0 A;  3JTH A;  4E7K A;  3CWB D;  2N8G A;  2FYU D;  1RHZ B;  3AEC C;  3HN2 A;  1RC9 A;  1RPW A;  4N3Y B;  1KZH A;  1TQP A;  1ZR2 A;  1KD1 Q;  3IL2 A;  1BC7 C;  1ETQ A;  4G7O F;  1ZG5 A;  3BVH A;  2LVS A;  2QCO A;  2OC6 A;  4XBF A;  4DZJ A;  5KHD A;  1FIA A;  5HDK A;  3E1I A;  3WUV A;  5B66 E;  1LFU P;  1YJW P;  2XAG A;  2H89 C;  4QLC U;  3EWK A;  1HBX G;  1FBS A;  3M8F A;  1L0O C;  4XR6 A;  3DLL F;  4LK0 F;  3HRN A;  3Q0U A;  3JCU C;  5FJ8 J;  2NVU B;  2ZXW H;  1JHF A;  4ETS A;  3GME A;  1USE A;  2O01 J;  1K6Y A;  2WIT A;  3NWT A;  2M7A A;  4XOP A;  1HJ0 A;  5A2Q K;  1NTK D;  2UXX A;  4W80 A;  3COA C;  3MD2 A;  5APU A;  4WF2 A;  4XA4 A;  4P9F A;  5E20 A;  4B1R A;  2JEE A;  5EDN A;  5CBO A;  4KIF A;  3L2C A;  2W83 C;  4OQY A;  1LGH B;  3FXE A;  4ENM A;  1SQQ J;  1YJ9 P;  2P10 A;  2BY3 A;  4IHS A;  4LGD E;  4LD5 A;  1DU6 A;  3FBI B;  2WSE H;  3QOP A;  2NS7 A;  3L37 A;  2HZD A;  1OCC H;  3L72 J;  4FAS D;  4A2U A;  2XRN A;  1ZK8 A;  3B5N D;  3G1M A;  1N73 C;  2K88 A;  5KLV D;  3A01 A;  1Y0N A;  2C0W A;  2QJY B;  1WZ2 A;  3L75 E;  1UHW A;  3BTJ A;  1QGP A;  3CWB G;  1BW6 A;  3HZJ A;  4XOR A;  4OQZ A;  2FYU G;  1L0N J;  5AVW B;  4ZTF A;  5M1B A;  4WBA A;  3T5X A;  2M1B A;  3KP5 A;  2RGV A;  1Z91 A;  3HOU J;  5EZH A;  3H2Z A;  5KAF E;  2XV5 A;  1W0U A;  5E1W A;  4I7H A;  1FY7 A;  4WWI A;  1LEA A;  2XV4 S;  3UR3 C;  2E2J J;  1S72 I;  3H1H J;  1SD6 A;  1NH4 A;  2KIU A;  3WTX C;  1IN6 A;  4N4O B;  2V7Q J;  3KYQ A;  1BCC E;  1WKM A;  2NVX J;  1JNM A;  4UB8 E;  3MUD A;  4H4K C;  2A06 D;  1N77 A;  2FD5 A;  5TGT A;  2Y75 A;  1PP9 G;  2LMD A;  1Y8R B;  4QPO A;  3TGU G;  2NOJ B;  1YW7 A;  5CQE A;  2E43 A;  4WK8 F;  3H6P A;  4MFD A;  2JRT A;  4C9Y A;  3SFE C;  1FBQ A;  2YO2 A;  2L02 A;  3L2R A;  3D5L A;  4D0P A;  5M5Y J;  3JRD A;  1CI6 B;  4KA4 A;  1F17 A;  3IC7 A;  1O7F A;  2MBF A;  2V6C A;  1KIL E;  1TTY A;  3LA7 A;  1GL2 B;  1R1T A;  2Z5U A;  5FKO A;  3CDL A;  5J4V A;  1YIT I;  3L71 G;  1VQ8 P;  2KIF A;  1SP4 A;  2HXI A;  2Y0S A;  2F5E A;  1T8I A;  4BRY B;  5KLV G;  1YQ4 C;  1KU7 A;  4DLL A;  5ERI A;  4M3F A;  1BOA A;  2DMT A;  2OZU A;  3GO5 A;  5LLQ A;  1WRJ A;  3BLY A;  2A07 F;  1J1E B;  4GXO A;  1OX3 A;  2HOD A;  3RQI A;  3RYP A;  3CCU P;  4EIJ A;  1MDM B;  1M66 A;  1PUF A;  1RUN A;  3D71 A;  2BY0 A;  2V1N A;  3HGG A;  4A3E J;  2IBZ E;  2D2C D;  2VBY A;  2E60 A;  4YII A;  3F6O A;  1R1V A;  2DAO A;  2CU7 A;  2BGC A;  4J0F A;  4HKZ H;  4IOI H;  3HOZ J;  2KJB A;  4BQQ A;  1M1J A;  2NNN A;  4A69 C;  3RCO A;  1W36 D;  3IV5 A;  3RPU D;  1FP2 A;  1X2N A;  2BXY A;  1HKT A;  2E75 C;  4XE5 B;  1A31 A;  3I71 A;  2BAS A;  6PAX A;  4OM8 A;  3LMM A;  1JT6 A;  4Y15 A;  4CXF A;  2J5U A;  1FZC A;  3DOJ A;  3WTS C;  2FSW A;  2LSO A;  3GCM A;  3K4C A;  5HWS A;  1L0L J;  1G59 A;  2OQQ A;  3ESW B;  1JXS A;  2RV8 A;  3AE8 C;  1FTT A;  1SFK A;  4LG3 A;  3GUD A;  4WXH A;  1P7J A;  1IC2 A;  2QVA A;  4WXD A;  4I09 A;  2OYI B;  3GZ6 A;  4WB4 A;  2WSS H;  1NGM B;  4EJV A;  2D2C B;  3RKY A;  2FA5 A;  2OV7 A;  4YCA A;  1U57 A;  2WWW A;  1LTA C;  1MSF C;  2H1K A;  1LSO A;  2ZB9 A;  2RNJ A;  4CCJ A;  1VQ5 P;  2FY8 A;  2V1D A;  4C2M J;  1ZW0 A;  2DW3 A;  4Y4R A;  3HBL A;  3U59 A;  1NKN A;  4IL6 X;  2AQE A;  3KIO A;  1BIA A;  4EV0 A;  2EFN A;  2WY8 Q;  2OYH C;  4H0L B;  5F27 A;  3RK2 B;  3KX2 A;  5JLX A;  1FOY A;  2KP8 A;  1FT9 A;  3VP9 A;  1EDL A;  1E3P A;  3OS2 A;  2JVG A;  3EFG A;  5CCG D;  2CJJ A;  4I98 B;  4B3H A;  3RDI A;  2K37 A;  1LDK B;  2QJK B;  5GTI C;  2DOF A;  3CCS I;  1U0J A;  3D5R C;  2O9L A;  2NPS D;  1NKZ B;  2ZXE B;  3GFL A;  5H2F C;  1ZKG A;  2D2W A;  2OD5 A;  4D9J A;  2RNG A;  1Z05 A;  4X1E A;  4LLN A;  4JPZ B;  2VE8 A;  3MZH A;  2AXT E;  5JFR A;  1OVV A;  1WPK A;  1I39 A;  5DTD A;  1IRX A;  4B43 A;  3HTK A;  5AVS B;  2JN6 A;  5EG0 A;  4HQM A;  1LE8 B;  2E71 A;  3QP6 A;  3K70 C;  1MFZ A;  2HYN A;  1T6S A;  2FMY A;  1U7J A;  3I59 B;  3UIA A;  5DUK A;  5HVQ C;  3VDX A;  2ZFW A;  4ZH4 F;  2E2I J;  3JW4 A;  1TC3 C;  3DPL C;  3S2H J;  4Y52 J;  1IJD B;  2H8P D;  3A0H H;  3HE5 A;  2YMY A;  2YX4 A;  4V2G A;  3RQ4 A;  3FDY A;  2L2O A;  4OGQ C;  4CZC A;  2IZ1 A;  1JKR C;  1NTZ J;  2VBZ A;  1YHQ I;  2BCC D;  1TW3 A;  3H35 A;  4HX7 A;  2IYP A;  3FXM A;  1U5T B;  3BR1 A;  1MZ9 A;  3V4Q A;  1SQP G;  3OR2 C;  1NWQ A;  4M3B A;  2QYT A;  3EFF K;  3TF5 A;  2JWD A;  2N1T A;  2A3S A;  4PFP A;  5DS9 A;  2KS1 A;  1E3H A;  3ZW8 A;  4G12 A;  3C9I A;  1BM9 A;  3CCE P;  4NDL A;  1XB4 A;  4I76 A;  1XN7 A;  1MMN A;  1ZR4 A;  3WTU C;  1FDM A;  1JJ8 C;  1KB9 E;  3FMQ A;  2VAS A;  1OCP A;  2MH9 A;  5B1A H;  5B5E C;  1G8X A;  3CCJ I;  1FZE A;  3TO9 A;  3K6G A;  4GIF A;  5E3L A;  4CCO A;  1ACI A;  4XFJ A;  4OMY A;  3AKZ A;  2W90 A;  2DA4 A;  3V8L A;  1LP1 A;  2BYV E;  3LAJ A;  2EB7 A;  2X6O A;  4BE2 A;  3GHG B;  2NVQ J;  1BI0 A;  1U9O A;  1NU1 J;  4NBQ A;  1I6H J;  1B6A A;  3KZI E;  2EIK H;  2FBI A;  3WS7 A;  4U87 A;  4M71 A;  1KOR A;  2WSE J;  2KK7 A;  3AEB C;  2DA1 A;  2GA1 A;  3J80 Z;  4UXN A;  5FLX K;  1SFC D;  3Q5F A;  2KLV A;  2VN2 A;  3U9G A;  1X4O A;  3ABU A;  3H36 A;  1DU0 A;  1YRN B;  4ZKP A;  1V54 H;  1X1A A;  1XGO A;  2LH9 A;  4L5I A;  2VKD A;  3VOD A;  5D4S A;  3DP7 A;  4JQF A;  3PSI A;  1EV7 A;  1KYO E;  3PLR A;  2OGU A;  3F6V A;  4HOB A;  3J7Y J;  3ZW9 A;  3ZGK A;  3OYM A;  2ZCW A;  4XKW A;  5C4X J;  3E7L A;  5AVZ B;  2QF7 A;  5BU8 B;  2A6E F;  1W0T A;  5F1J A;  1J09 A;  4ON0 A;  4P9U A;  3QWO C;  4O5V A;  1EF4 A;  3R0A A;  5E3M A;  1L4A B;  1JCD A;  2LR8 A;  2V9V A;  4U0W A;  3OR1 C;  3TMO A;  1FWZ A;  2WAF A;  3LST A;  1URQ D;  3W6J B;  1W2E A;  1NTM J;  3CC2 I;  1Y47 A;  3CUQ A;  2PMZ A;  2R7O A;  1LWU A;  2DA3 A;  2LP0 A;  1YFH A;  1F0Y A;  4HB1 A;  5L3F A;  2HVS A;  3B6C A;  1FYK A;  2B87 A;  2L91 A;  2OTK E;  4PV1 C;  1MUU A;  2HS5 A;  3AL0 C;  2M8R A;  3CWB E;  2K9Q A;  3CC4 I;  2KRC A;  3QYE A;  4CDG A;  2YXR B;  3DU6 A;  4EJO A;  1NTC A;  3RK3 C;  1HOM A;  3CC7 P;  1DPU A;  3BQZ A;  1E0E A;  1FYL A;  1FC3 A;  2I9P A;  1RKW A;  4H44 D;  3MUD C;  3MD0 A;  4UVA A;  3ZQI A;  2EA4 A;  2E1M B;  2LY9 A;  1XMA A;  5A9T A;  3W6V A;  1IK7 A;  2XB0 X;  3BZC A;  1HLV A;  3VWB A;  3DXJ F;  3SDG A;  1H8A A;  2HPC B;  1SVL A;  2L9S A;  1DDN A;  3RYR A;  1PP9 J;  1FJP A;  2QSH X;  2POH A;  2R5Z B;  3TGU J;  3OWT A;  2IVM A;  3TGN A;  2UZK A;  3CQZ J;  4DYC A;  2VXD A;  1FE6 A;  1NTK E;  1FSH A;  1QLE D;  1IN5 A;  5HLI A;  4C3H J;  4IXA A;  3FIW A;  5M5X J;  2FEZ A;  3HRM A;  1Z0X A;  3I9V 2;  2IGN A;  4BY1 J;  3GBG A;  3L71 J;  2PFX A;  4L74 A;  5ICE A;  4UV8 A;  4YRV A;  1QX8 A;  5AW6 B;  4ANJ A;  3HRU A;  2XUB A;  2F4I A;  1IFN A;  5CCH A;  2PLY A;  1S3J A;  2FE3 A;  3N05 A;  2JT1 A;  2ZNY A;  4QSH A;  5M3M J;  2IS2 A;  2K1A A;  1FZB A;  5GTH H;  4DCK A;  4AYB A;  2DK8 A;  1SQV G;  3J7Z I;  3NTN A;  2GQQ A;  4KIS A;  3I4P A;  2EK5 A;  3AED C;  3VYR B;  4LFU A;  3RPQ A;  1SQQ K;  1GUU A;  4H0E A;  1M1J C;  3SEZ A;  4FHT A;  3EPZ A;  2VE9 A;  3GTJ J;  4AYB N;  5DCF A;  3PNT A;  3EQL F;  1UFM A;  1YJW I;  4J19 A;  2ZVO B;  2KB7 P;  3CXH H;  3ELK A;  3MWM A;  1FZC C;  3FKJ A;  1I3Q J;  5FFX A;  1K79 A;  1YVE I;  4B44 A;  1KV4 A;  1YOV B;  3ZQ7 A;  2A06 E;  2E76 C;  3FZV A;  1E17 A;  1W7P D;  3RL0 g;  2GXG A;  1XSV A;  1TQM A;  4HF0 A;  1IN4 A;  3S1N J;  5KJ7 A;  2ID6 A;  2YS9 A;  3OYD A;  2V79 A;  2XDV A;  1OYI A;  2KRH A;  3LSJ A;  4HPQ A;  1NHA A;  4BE1 A;  1YJ9 I;  1SQB K;  2P6T A;  4B3X A;  2W82 A;  4BHC A;  1M8O B;  2W24 A;  3CMM A;  3AE9 C;  3PTZ A;  3C2B A;  3GW6 A;  1V55 H;  4JF7 A;  2QZ8 A;  2ZME C;  3CP8 A;  1LTI C;  3WUU A;  1DGW Y;  4C2T A;  1YQA A;  2EQR A;  5H6Q A;  3TBI A;  1OJL A;  3G73 A;  5KJ7 C;  1CI6 A;  4RB0 A;  1IRZ A;  3B6A A;  1OCO H;  1ZHF A;  4BAY A;  2CQX A;  2OTJ P;  1GL2 A;  1P92 A;  3O3K A;  2WPV B;  2Q2E B;  3PIP F;  4BRY A;  2O3J A;  1TLH B;  2XPU A;  1EDK A;  3OIP A;  2VKE A;  3H1I G;  2VPR A;  3RI4 A;  1H89 A;  4AIK A;  1F1Z A;  3HOS A;  3ZWB A;  2QSI A;  5TIS H;  1MDM A;  2XGC A;  4EM1 A;  5JHF A;  1V3F A;  2OBP A;  4EQQ A;  3AE4 C;  1WI9 A;  3WTT C;  4LGW A;  2DMP A;  3H25 A;  2VIX A;  3A0B H;  2R7F A;  1YJQ A;  1JTH B;  1AOY A;  2AEF A;  4JP0 A;  2KLU A;  3W68 A;  1Y0U A;  3BCC D;  4OVN F;  4C3J J;  3F21 A;  1FSE A;  3IWF A;  2K9J B;  3ITK A;  4UNO A;  3KZY A;  1GU4 A;  2P5K A;  1WSU A;  3SSU A;  2KUB A;  2QQ9 A;  1JUP A;  2RQP A;  1DEE G;  1ZXG A;  4DBQ A;  3VMZ A;  1M2W A;  2K40 A;  4NNJ A;  2YKO A;  3GFJ A;  1D1C A;  3QOD A;  4II2 A;  2D3T A;  4B86 A;  1FOS E;  4MIM A;  2DQL A;  4L5E A;  4HDU A;  2HNH A;  3KP2 A;  4FTH A;  3OL4 A;  2GXB A;  5J40 A;  1HCR A;  3O6B B;  3G9R A;  4KT5 C;  1EZV I;  3CCU I;  1L0L K;  2XHK A;  1IXR C;  3ZQF A;  1SS1 A;  3VTP C;  2CQQ A;  3FXK A;  2OYI A;  2XC7 A;  2EW2 A;  4M6V A;  1WH5 A;  1IXC A;  4D7M A;  3H1J D;  1SAU A;  2N1T C;  4U3F J;  1A6Q A;  1OQY A;  3FBN B;  5L3B A;  2EBI A;  3RKQ A;  2KXP B;  1PUE E;  1BJZ A;  1G3T A;  1K78 B;  4BJT A;  1I36 A;  3KPE A;  4F55 A;  1XSD A;  4IF4 A;  2ZT9 D;  2DPU A;  2OFP A;  2IBZ I;  3FK6 A;  1EA3 A;  1ZGA A;  3E3V A;  3P7N A;  4YEJ A;  1VQ7 I;  2Q5U A;  1N8R Q;  2ESH A;  3I0T A;  3FXJ A;  3L2W A;  3PSF A;  2O8X A;  2JUC A;  3D0S A;  1QZZ A;  4GCV A;  3I64 A;  3HHG A;  1YI2 I;  3MZY A;  3K1P A;  1ETK A;  3KHU A;  1K04 A;  2WB1 N;  1ZP0 C;  4I7Z C;  1X0V A;  2G9W A;  3S4R A;  2HOE A;  3R0J A;  2OZ6 A;  1U7M A;  2HFH A;  4LB5 A;  5KAI E;  1IJW C;  5E79 H;  5AW8 B;  1ZGJ A;  5AVV B;  2DDB A;  2LC2 A;  3NAR A;  1QBJ A;  2MKV A;  1SD5 A;  4NPF X;  1YHQ P;  1GW4 A;  3HUS B;  4DYD A;  2ZJ2 A;  4ZDO A;  2HFE D;  1MSE C;  4DJG A;  1LE8 A;  3BP8 A;  4E4H A;  3S2D J;  4BXX J;  1VQ5 I;  3RKW A;  2Q3I A;  3HD7 D;  3ABV C;  3I59 A;  1EZV D;  2HR3 A;  4A3J J;  2MC4 A;  1MIJ A;  4XLH A;  4AQR D;  2BCC E;  5B66 H;  2ME0 A;  4V2F A;  3WG7 H;  5KKZ C;  2LY1 A;  1USD A;  2LKP A;  1I6X A;  3GFM A;  1C0W A;  2KZG A;  2F4M B;  1FPQ A;  1LNW A;  3RBX A;  2O61 A;  3SFZ A;  2CQK A;  1KFN A;  4IVN A;  3HTS B;  4XLN F;  2QQB A;  1VTN C;  2N9Y B;  9ANT A;  4E13 A;  5CCG A;  1YTZ T;  1YO5 C;  1U5T A;  4R79 A;  3CUQ C;  1SLQ A;  1NTZ K;  2IBZ D;  1FOS F;  4PD4 I;  1LWU C;  1T6A A;  4RO0 A;  4WVZ A;  2L7F P;  2XAJ A;  4M3E A;  5GAG J;  3D1L A;  1R9T J;  5JHU A;  1WQ2 A;  3V2P A;  3OYG A;  4IM7 A;  4KUH A;  2QBY B;  4IHY A;  2DW4 A;  4HNT A;  3GTM J;  1BCC G;  1ZV8 A;  5LHG A;  4EM0 B;  1PGP A;  1RUO A;  4QIW N;  4KYW A;  1KN7 A;  1YS6 A;  3T97 B;  2MD0 A;  3K4K A;  3N97 A;  2HYG D;  1HJB A;  1RR8 C;  5DUI A;  1KIL B;  3ERE D;  3CD6 I;  2N9B A;  3OYI A;  1GK4 A;  3II6 A;  2GWR A;  1KGS A;  2YX7 A;  1H8A C;  3CMY A;  3GHG A;  1JMM A;  5KAF H;  3FR8 A;  2KT0 A;  4HA8 A;  3SWK A;  5K5O A;  3IWZ A;  1WJA A;  1ZGW A;  3LFK A;  2EJR A;  5IP6 A;  5BOX A;  1FDI A;  2E74 D;  3NQO A;  4UB8 H;  3IKT A;  1YRN A;  5KNL A;  1NG7 A;  4XKV A;  1K83 J;  4BEH B;  4AIJ A;  2IBZ G;  1BR1 A;  4FX4 A;  1EVZ A;  4NB5 A;  5CJ9 A;  5AVU B;  1POG A;  2OU2 A;  3MKL A;  1TWG J;  2VC0 A;  2XVC A;  2IXS A;  3KP6 A;  1YLF A;  2X85 A;  2KSE A;  5CCH C;  2YIU B;  2EFO A;  1NK3 P;  3I4M J;  4KJM A;  4PD4 D;  3BPX A;  1L4A A;  2OF7 A;  1SQV J;  4XMY A;  5A9R A;  5AW9 B;  2LKX A;  2B9S A;  4FCY A;  2G7U A;  3F8C A;  3IN6 A;  1U8R A;  4W7Z A;  3F3S A;  3G2B A;  4MEX F;  3IRR A;  2PI0 A;  4LC1 A;  1HWT C;  3H0D A;  2QM3 A;  1VQK P;  1MBJ A;  4GDF A;  4L9V A;  4DOJ A;  3S1R J;  3TW6 A;  3I58 A;  5BPD A;  4JQ0 D;  3JAM K;  1S29 A;  2H27 A;  1N7S D;  1BE3 D;  1X2M A;  2BW3 B;  2HVR A;  3P9I A;  4A3F J;  3CF5 F;  1CGP A;  2FYU K;  1V5G A;  3M91 A;  2HDW A;  4DYQ A;  3MEX A;  2HYJ A;  2JDI H;  3PJS K;  4H13 B;  5LFA A;  1NK2 P;  3QAH A;  5APX A;  2DFH A;  1CF7 B;  1NHL A;  3FXO A;  3CL3 D;  3L70 D;  5F08 A;  1LT9 B;  3H3Z A;  3BR6 A;  2XAQ A;  1Q90 D;  2QLZ A;  4XSX F;  4BXU A;  3PP5 A;  2HI3 A;  4IL6 E;  2HPC A;  2D1V A;  3GLL A;  1F43 A;  5AW3 B;  3ZMU A;  2Z99 A;  2R5Z A;  3GFI A;  2JK3 A;  2ELJ A;  2OJE D;  5D5X B;  4GT1 A;  1F9N A;  1YE9 A;  2CUE A;  3T1B A;  1JB0 J;  1GL2 C;  1XGS A;  1KQF B;  1DX7 A;  3BTI A;  3CMA P;  4WY4 D;  1G6N A;  3F8N A;  1NOH A;  1AJY A;  4EJU A;  2QA4 I;  1H89 C;  1CSB A;  2W00 A;  3TO7 A;  4L73 A;  1J1E C;  1N7S B;  3H1I J;  4BL0 B;  4MQV A;  1Z21 A;  2Y0C A;  5DJT B;  4Y28 J;  3CC7 I;  2WVR A;  4C3I J;  2FX0 A;  2AEM A;  1R7J A;  5KLV K;  2JPC A;  2RKL A;  1VF5 C;  3C2H A;  3DBR B;  4L75 A;  3VYS B;  2TCT A;  2ECB A;  3FXL A;  1Y6I A;  1MMD A;  2EV6 A;  2QUF A;  4ZYA A;  1IL0 A;  4GOF A;  3MHV A;  1WMK A;  3U1A A;  1FNN A;  1W5C E;  3D1N I;  3AE1 C;  3JSP A;  4PJM A;  1TXG A;  2CUZ A;  2XIG A;  4P55 A;  3AG3 H;  1UCR A;  5F1R A;  4RAF A;  3CJR B;  1UIX A;  4ENJ A;  2K4B A;  2WQY C;  4S04 A;  4OH8 B;  3P32 A;  5AVT B;  4I02 A;  2VLA A;  3VOP A;  4BDZ A;  4ESJ A;  3ZCO A;  1I1G A;  3MP7 B;  1Z3X A;  5AW1 B;  1S9K D;  2HPI A;  2L9R A;  2ZO4 A;  3L2V A;  3V2R A;  2L4A A;  2CFO A;  1B9N A;  3ZN0 A;  4B48 A;  4CCK A;  4XL9 A;  2DCE A;  2VUM J;  1HKQ A;  2OYI C;  4WX9 A;  1KQ0 A;  3L74 D;  1FZA A;  1SFU A;  3J81 Z;  1G3Y A;  1SEU A;  2X0L A;  1Y8A A;  3LFU A;  4F7Z A;  3SDB A;  4XOT A;  4HX4 A;  1A36 A;  2ZBK A;  1YYV A;  1KU3 A;  5AYV A;  1PP7 U;  3O6Q B;  3E6M A;  1P9Q C;  2IAI A;  4ZYG A;  2MGQ A;  2XAU A;  1K61 A;  4GDO A;  1IDY A;  3LSG A;  5TRD A;  3OYK A;  1IUF A;  2M45 A;  2DT6 A;  2O6G E;  3QH9 A;  2BVL A;  3RK2 C;  2CW0 F;  3A0H C;  2Q2E A;  5CVV A;  2NVY J;  1H9T A;  2W6B A;  2ZNZ A;  5EGO B;  5CVI A;  3D5S C;  5BS6 A;  2PFB A;  5GAD J;  3VEP A;  2LDU A;  2JUG A;  2E35 A;  4HBL A;  1LJ8 A;  1U8B A;  2RQQ A;  4RS8 A;  4FT8 A;  3BCC E;  3HOT A;  4FQG A;  1AA0 A;  2QM8 A;  3HHH A;  3Q1M A;  4NC7 A;  3S2W A;  2A61 A;  5JI6 A;  3A4C A;  2WAQ N;  4GKG A;  1KB9 H;  1WJE A;  2CMP A;  1J75 A;  4A3B J;  4B3I A;  1JTH A;  4CHU A;  2R7D A;  4IOA F;  1FS0 E;  4JX5 A;  2HWV A;  4JYC A;  1HDD C;  1L2P A;  3ZN1 A;  1RZ4 A;  2K9J A;  4GOD A;  5GPA A;  2WY7 Q;  2XGE A;  1OKR A;  1I3A A;  2V9K A;  2ME6 A;  2M4G A;  1NH3 A;  4HF1 A;  5TJH A;  3WGG A;  1JEK A;  3E7K A;  1RRJ A;  3G1L A;  4ZKU A;  4EJW A;  3KZI H;  4XRM A;  2OTJ I;  3KLN A;  3X2Q H;  3HM5 A;  2P6S A;  4PZC A;  2RDP A;  4MFE A;  3H1J E;  1J59 A;  4JYB A;  3J7A Y;  2JA7 J;  1STZ A;  2QJP C;  3L75 J;  1BSH A;  4KFC A;  5D5W B;  1U5T C;  1KYO H;  4IFF A;  2CQN A;  2IW5 A;  2M3A A;  2BOL A;  4XIC A;  3OYE A;  1T2K A;  2IFM A;  5FD5 A;  2X51 A;  3A3Y B;  2DA7 A;  2QSF X;  2WTB A;  5AW0 B;  5J1Y A;  1Y1W J;  1QL1 A;  1RE4 A;  1K78 A;  3FX3 A;  1I50 J;  3EUA A;  3HIF A;  3KCC A;  3CKY A;  3CI9 A;  3VYI A;  4OU0 A;  1SQP K;  1IN8 A;  3CDH A;  4DYR A;  1YJN I;  4M3L A;  1SQX D;  1DP7 P;  4Y99 C;  2GZW A;  1BCC J;  3E5U A;  3BCB A;  1MBE A;  1X79 B;  1MKM A;  1X3W B;  2FBW C;  1Q7Y Q;  1SQB J;  2WPQ A;  1EXJ A;  2A6T A;  2EZL A;  2L7Z A;  4D6T J;  4IHX A;  3HKZ N;  1ZN2 A;  5APY A;  3TDU C;  1I1S A;  1WI3 A;  3FXU A;  5F6F A;  4I2L C;  4AID A;  4OWF A;  4C7N B;  1T33 A;  3DQV C;  4WXC A;  1OR7 A;  3HPH A;  4CCL A;  2QQA A;  1NTK G;  3BJA A;  1AWC A;  3SWY A;  3JRA A;  4G6Q A;  4KT6 A;  2VJJ A;  2W27 A;  1Q86 Q;  1VZ0 A;  2PP6 A;  4C7R A;  4EM2 A;  5EJC A;  2K9N A;  2ZSH B;  1CZQ A;  4JOM A;  3B5N B;  2W4S A;  1EZV E;  4AUX A;  5J8F A;  1PFI A;  4YFN F;  4FE4 A;  4LIV A;  3CO6 C;  1EVY A;  3HUS A;  1W2B O;  1KQS O;  1CW5 A;  2X4H A;  4TLF A;  5K7F A;  3BJO A;  3AFH A;  3S9O A;  5HDG A;  4BAC A;  3V7S A;  3QP5 A;  3VYT B;  2AO9 A;  1LPQ A;  3FWE A;  2M8E A;  4EGZ A;  3DEU A;  1UST A;  2VC1 A; 
#chains in the Genus database with same CATH homology
 3WFI A;  4S0H B;  1EF4 A;  3DCF A;  5E3M A;  5A9S B;  2LR8 A;  2XGD A;  2Y30 A;  5J1U A;  3A01 B;  1IGN A;  1OFC X;  3JR9 A;  3S17 J;  4D5F A;  2JA8 J;  2DN0 A;  1IV6 A;  4A93 J;  1YON A;  3GTO J;  3ZQG A;  2DA3 A;  3ZGY A;  2LP0 A;  1F0Y A;  4D3S A;  3B6C A;  3FIS A;  1O4X A;  4A3D J;  4B4C A;  2GBY A;  3HOY J;  2K9Q A;  3S16 J;  3RZD J;  1VI0 A;  1AHD P;  2M0C A;  4GFB A;  1MBK A;  1NTC A;  2ID3 A;  1HOM A;  3PEF A;  3BQZ A;  2I9P A;  1RKW A;  1BG6 A;  3LSP A;  3JRI A;  3ZQI A;  3W6Z A;  2LY9 A;  5A9T A;  2LD5 A;  3W6V A;  2XB0 X;  2L7M P;  1XS9 A;  1HLV A;  3PID A;  2P4Q A;  3ZQL A;  3SDG A;  3UKG A;  4ABZ A;  1SFO J;  1IG7 A;  3HOV J;  1SAN A;  3I4N J;  1A5J A;  1Q1V A;  2R5Z B;  2EZK A;  3ZWC A;  5IYB J;  1TWC J;  3CQZ J;  2PGD A;  2OPT A;  4DYC A;  5FWN A;  4BBR J;  3Q0V A;  1ETY A;  4C3H J;  4KUE A;  3FIW A;  5M5X J;  3OBB A;  1Z0X A;  4B3A A;  2W8Z A;  3HDD A;  4BY1 J;  3GBG A;  3BT9 A;  5F0H A;  4DW6 A;  2HOT A;  4B3J A;  2JWT A;  2XB5 A;  3BR0 A;  3GTG J;  1PUF B;  3JRB A;  5M3M J;  4QSH A;  1RR7 A;  1YRL A;  4DCK A;  2G0E A;  4EEF G;  1RKT A;  3H0G J;  5C3E J;  1GUU A;  1ZCJ A;  5K7H A;  3IH3 A;  3GTJ J;  4AYB N;  3BQY A;  1ZTR A;  1IC8 A;  4OL9 A;  2IZ0 A;  2EZI A;  5FLM J;  1FEX A;  4J19 A;  1B72 A;  3FWN A;  3TW7 A;  1GT0 C;  4D3D A;  1I3Q J;  1YVE I;  3TED A;  2R7Z J;  3ZQH A;  1X58 A;  2E19 A;  1DLJ A;  4I6Z A;  3GTK J;  1TWA J;  2MW8 A;  3G1O A;  3S1N J;  2ID6 A;  1PGN A;  3Q3C A;  2YS9 A;  3K6J A;  3DEW A;  3LSJ A;  5GPC A;  5E3O A;  2TRT A;  5C44 J;  1N1G A;  4E21 A;  1U9N A;  2K9S A;  3C2B A;  1UMQ A;  5FKK A;  4IHV A;  4XK4 A;  1RES A;  1ETX A;  3C7A A;  2EQR A;  1OJL A;  4UUT A;  1M75 A;  1IRZ A;  3B6A A;  5K7Z A;  5F0C A;  1A6I A;  2CQX A;  2X48 A;  2IYO A;  2FJ1 A;  2GF2 A;  2B63 J;  3ADP A;  2NS8 A;  2XPU A;  3HGY A;  2VKE A;  3HDH A;  2VPR A;  3QPL A;  2E2H J;  3ZWB A;  2XGC A;  4CYC B;  3WHB A;  1ORK A;  3A03 A;  4J0E A;  2DMP A;  4X6A J;  2M8G X;  4IHW A;  3TP3 A;  1YJQ A;  2UYY A;  3O8G A;  3HOW J;  4JX6 A;  2IEK A;  4JP0 A;  1RET A;  3G0O A;  4OVN F;  4C3J J;  1PGQ A;  1XG1 A;  3C7C B;  3S1Q J;  2JMW A;  5EG0 B;  1PGO A;  3HAD A;  3HWR A;  1LFB A;  5EF6 A;  5F0F A;  1JUP A;  1JKP C;  2O8K A;  3M3Y J;  3JRF A;  5IYD J;  2X58 A;  3HB9 A;  1HDP A;  4JX4 A;  1ENH A;  2NOG A;  1M2W A;  2PLA A;  2K40 A;  3ADO A;  2D3T A;  4MIM A;  4L5E A;  2LTP A;  3W6U A;  4JYK A;  4FTH A;  2DA6 A;  1HCR A;  3GTL J;  1M76 A;  4PZD A;  2R0Q C;  5EEA A;  3ZQF A;  2VI6 A;  2CQQ A;  3QPS A;  5HOD A;  2EW2 A;  4M6V A;  2M34 A;  1WH5 A;  4D7M A;  2AHQ A;  3NAU A;  5FKN A;  3QHA A;  3CCY A;  3RKQ A;  1ZQ3 P;  2EBI A;  3PDU A;  4GWG A;  3ZHB A;  1BJZ A;  3Q0W A;  2ECC A;  1I36 A;  2OFP A;  2WV1 A;  3FK6 A;  1QRY A;  3GTQ J;  5IP7 J;  3BG5 A;  2LLK A;  5F04 A;  2Y0S N;  5EGO A;  2XSD C;  1B8I A;  1OCT C;  2IBD A;  1ETK A;  4UUS B;  3S14 J;  2WB1 N;  1DLI A;  3LOC A;  1MBH A;  2XPV A;  4XRS A;  1X0V A;  2HOS A;  1Y1V J;  1UHS A;  4LOC A;  3BTC A;  3K96 A;  3HEF A;  1IJW C;  5IP9 J;  2DJN A;  1IDZ A;  4DZP A;  2YU9 J;  3NAR A;  1JTY A;  4RDU A;  1GDT A;  1S7E A;  1YB4 A;  1AKH A;  5E3N A;  4DYD A;  2COB A;  2DA2 A;  1MSE C;  4BKX A;  1LE8 A;  3S2D J;  4BXX J;  1MNM C;  2CUF A;  1FJL A;  3VPR A;  4A3J J;  2ME0 A;  4V2F A;  3SFI A;  4A3G J;  5C4J J;  2RAE A;  1JKQ C;  3SJM A;  5EZG A;  2XPW A;  2GM4 A;  3BTL A;  5BNG A;  1VF9 A;  9ANT A;  4E13 A;  3BG9 A;  2CRG A;  5IOZ A;  3OOU A;  1WCM J;  2R5Y A;  4MLO A;  5M5W J;  3MN2 A;  3FR7 A;  2L7F P;  4M3E A;  4D7N A;  3LNQ A;  1R9T J;  4PZE A;  4IM7 A;  4KUH A;  4QTR A;  4IHY A;  3GTM J;  3FKI J;  3H3V K;  4MO7 A;  1U78 A;  3GHY A;  2D5V A;  1PGP A;  1JUS A;  4D3F A;  4QIW N;  3G17 A;  1MH4 A;  5JE8 A;  5MGB A;  2N8G A;  3PJG A;  1PGJ A;  3HN2 A;  1RPW A;  1UG2 A;  1N1E A;  4GWK A;  1ZR2 A;  1H8A C;  3CMY A;  1ETQ A;  4M3D A;  2LVS A;  2QCO A;  4DZJ A;  3FR8 A;  1FIA A;  2KT0 A;  1LFU P;  2R93 J;  3IH2 A;  1ZGW A;  4AC0 A;  3L1P A;  1JJ6 C;  5IP6 A;  3Q0U A;  5FJ8 J;  3JRC A;  3MVP A;  1F14 A;  1F12 A;  1YRN A;  2EZH A;  2FQ4 A;  3F0C A;  1K83 J;  4W1U A;  3JRG A;  4B1R A;  5EDN A;  1EVZ A;  1POG A;  3MKL A;  4OQY A;  1TWG J;  3OSG A;  3O8H A;  4FGW A;  5FLV A;  3I4M J;  3IH4 A;  1NK3 P;  1DU6 A;  1WPQ A;  3WFJ A;  1VPD A;  2NS7 A;  5A9S A;  2LK2 A;  1QMG A;  2VKV A;  2OF7 A;  1X0X A;  1ZK8 A;  1YJ8 A;  3G1M A;  3QQA A;  2LKX A;  5A9R A;  4FCY A;  3A01 A;  3BTJ A;  3K7A J;  3F3S A;  1BW6 A;  2ELK A;  4OQZ A;  1MBJ A;  3IQD B;  1B72 B;  3S1R J;  3TW6 A;  1Z77 A;  3HOU J;  4JQ0 D;  5EZH A;  1GV5 A;  2HDH A;  3H2Z A;  1W0U A;  2HXO A;  1X2M A;  4A3F J;  2E2J J;  5FKL A;  1APL C;  4DYQ A;  2HYJ A;  3OIO A;  1NK2 P;  3I83 A;  2NVX J;  1Z82 A;  2FD5 A;  5F08 A;  4BBS J;  5IPA A;  3BR6 A;  1GV2 A;  2HI3 A;  4MFD A;  1F43 A;  2R5Z A;  2XRL A;  2ZYG A;  2ZYD A;  2JK3 A;  5M5Y J;  3JRD A;  3GTP J;  1WGX A;  2W48 A;  2H8R A;  1F17 A;  4A3L J;  2CUE A;  1FIP A;  1MBF A;  5FKO A;  1BL0 A;  3CDL A;  5J3L A;  3BTI A;  2HXI A;  3JRE A;  2CVZ A;  1WDK A;  4DLL A;  4M3F A;  2DMT A;  2MG4 A;  1H89 C;  1AU7 A;  2DMN A;  1TWF J;  3RQI A;  1G2H A;  1M66 A;  1PUF A;  3HGG A;  4A3E J;  2DMQ A;  4C3I J;  2FX0 A;  1ETV A;  5J1R A;  4S3M A;  3PM1 A;  2CU7 A;  1ITY A;  3DFU A;  4J0F A;  3HOZ J;  2TCT A;  1ETW A;  3MOG A;  2ECB A;  4A69 C;  3IV5 A;  1X2N A;  3BR5 A;  1IL0 A;  3ZOB A;  3D1N I;  1TXG A;  5GP9 A;  3C7D B;  4OM8 A;  1JT6 A;  2HQ5 A;  2PMZ N;  3WHC A;  3DOJ A;  1GVD A;  5HWS A;  2Y2Z A;  1E3O C;  1BW5 A;  2L9R A;  1FTT A;  3RQS A;  3EGO A;  1P7J A;  2I10 A;  2ZYA A;  2VUM J;  1QPI A;  2GLO A;  4W97 A;  2JJ7 A;  3TP0 A;  2E1O A;  3Q3S A;  1VFC A;  4YCA A;  4RBO A;  2YUS A;  1MSF C;  2H1K A;  1FTZ A;  1D5Y A;  1LSO A;  5AYV A;  2ZB9 A;  3PO3 J;  2L0K A;  2IAI A;  4C2M J;  2X9D A;  3ZQC A;  2MGQ A;  1JT0 A;  1K61 A;  3M4O J;  3HBL A;  1JDJ A;  1IDY A;  3LSG A;  1IUF A;  4FIS A;  5F27 A;  5JLX A;  2NVY J;  3JRH A;  2Y9Z A;  2O7O A;  5EGO B;  1B8I B;  3HOX J;  1T56 A;  2CJJ A;  4B3H A;  3K2A A;  1LJ8 A;  3BR2 A;  2NVT J;  1U8B A;  4CYC A;  2O9L A;  2P81 A;  2R92 J;  1QVU A;  4XRS G;  1ZKG A;  3BG3 A;  3BR3 A;  2WAQ N;  4X1E A;  4JPZ B;  4B3I A;  4A3B J;  2HDD A;  1WPK A;  5DTD A;  4JX5 A;  1AKH B;  1HDD C;  1WP4 A;  1CQT A;  1WDM A;  4BY7 J;  2JN6 A;  5GPA A;  1QVT A;  5EG0 A;  2XGE A;  4A3I J;  1LE8 B;  2ME6 A;  1M67 A;  1MH3 A;  3G1L A;  2E2I J;  4Y52 J;  4XRM A;  1TC3 C;  3S2H J;  3FK7 A;  3QSG A;  4V2G A;  3L6D A;  3HM5 A;  1ETO A;  2IZ1 A;  1JKR C;  4PZC A;  4MFE A;  5IOY A;  2HOA A;  2JA7 J;  4A3K J;  5JLW A;  2EH3 A;  2IYP A;  3BR1 A;  2MSY A;  4XIC A;  2R5Y B;  4M3B A;  2QYT A;  1HF0 A;  2DA7 A;  1TWH J;  5DS9 A;  2WTB A;  5J1Y A;  1Y1W J;  3ZW8 A;  4G12 A;  4EZB A;  4GBJ A;  1I50 J;  2Y9Y A;  4IEJ A;  4NDL A;  1H88 C;  3PO2 J;  4I76 A;  1ZR4 A;  1JKO C;  1BA5 A;  1WDL A;  3CKY A;  4DYR A;  1JJ8 C;  3LSR A;  3CTV A;  3S15 J;  4A3C J;  1OCP A;  1MBE A;  4Y7N J;  5FKM A;  4M3G A;  2L7Z A;  2EZL A;  5E3L A;  5IYC J;  2W90 A;  2DA4 A;  4E12 A;  1P7I A;  4IHX A;  3HKZ N;  2LFB A;  1VND A;  1WI3 A;  3A02 A;  2X6O A;  4UUS A;  1T33 A;  2NVQ J;  3S1M J;  4D5C A;  1U9O A;  4XID A;  2KDZ A;  3ZWA A;  1I6H J;  2DTZ A;  2M2E A;  2DA5 A;  3JRA A;  3WS7 A;  3RZO J;  2DA1 A;  1JUM A;  1KS9 A;  2K9N A;  1WH7 A;  5M3F J;  1JGG A;  1XC5 A;  4HNV A;  1DU0 A;  1YRN B;  2JKV A;  4AUX A;  3ULK A;  2JA6 J;  4FE4 A;  1EVY A;  2DMU A;  2M9H A;  1F36 A;  1LSJ A;  5K7F A;  3PLR A;  2Y31 A;  3OSF A;  3ZW9 A;  5C4X J;  5EYR A;  2JA5 J;  3E7L A;  2AO9 A;  2QF7 A;  4R1N A;  1W0T A;  4KUG A;  1JTX A;  5F1J A;  4FE7 A;  4A3M J;  1MBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...