2Y9ZA

Chromatin remodeling factor isw1a(del_atpase) in dna complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
287
structure length
287
Chain Sequence
RSSTPSHPRMPKPHVFHSHQLQPPQLKVLYEKERMWTAKKTGYVPTMDDVKAAYGDISDEEEKKQKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDATKDRMKKED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)
publication title Structure and Mechanism of the Chromatin Remodelling Factor Isw1A
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 70
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09110 HAND HAND
A PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9zA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9zA04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2y9zA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 2y9zA03
3FISA 2OPTA 1MSEC 3H3VK 4G12A 1U9NA 5F0FA 4DZPA 3OSFA 2ID3A 2HYJA 5EZGA 3VPRA 1DU0A 5F27A 4A3DJ 1Y1VJ 5K7HA 2L7ZA 5GP9A 1A6IA 1ENHA 3CDLA 3BTIA 1IDYA 3FK6A 5F0CA 2CQXA 2EZLA 5BNGA 1WPKA 3TP0A 2M34A 3MN2A 3JRAA 2EZHA 3CCYA 3BR5A 1B72A 4MIMA 4IHWA 1BL0A 1S7EA 3PO3J 3F0CA 2QF7A 2MSYA 2WAQN 3IH4A 2K9NA 2L9RA 3PM1A 1FIPA 4X1EA 3S16J 3HOXJ 1MBGA 1GV5A 4M3BA 1FJLA 1G2HA 1ZGWA 2IEKA 2NOGA 2H1KA 2LLKA 1AKHA 3OOUA 3ZQFA 1OJLA 2DA7A 5IYCJ 3A01A 3GTQJ 5FLVA 3S1MJ 3HOZJ 3BQYA 1F36A 3TP3A 3L1PA 4A3MJ 3TEDA 2MGQA 4V2FA 3G1MA 3NAUA 5E3OA 1HF0A 5J3LA 4LOCA 4JX5A 2JMWA 1HCRA 2DA5A 1ETOA 1XS9A 2CJJA 2DN0A 1U8BA 1TWCJ 2X48A 1ZK8A 2CQQA 3MKLA 3ZQHA 3JRIA 2ELKA 4CYCA 3JR9A 1SANA 1X2NA 2EH3A 1ZKGA 4D7MA 3S1RJ 2XPUA 4HNVA 4DCKA 2L0KA 4I76A 3GTGJ 3HBLA 5IPAA 4M3EA 4J19A 1A5JA 1LFBA 2WB1N 1B72B 4DYRA 1HLVA 1JKQC 2R5ZB 5FKNA 2ME6A 2CRGA 2DA6A 2LTPA 1CQTA 2R5YA 3A02A 3ZQCA 1TC3C 5M5YJ 4MO7A 2Y0SN 2HOSA 3RZDJ 3GTKJ 1XG1A 1BA5A 5EG0B 2KDZA 2NS8A 1AKHB 2LY9A 1ETWA 1D5YA 3A01B 3FKIJ 4W1UA 5FKOA 4JQ0D 2EZKA 3GBGA 3S14J 1UHSA 1QVUA 1T33A 1UMQA 1GDTA 2HI3A 2XGDA 3LSJA 4Y52J 4D7NA 2FX0A 3LSGA 4M6VA 4QSHA 1SFOJ 1YRNA 3WHBA 3HGGA 1ETXA 1W0UA 1MBFA 5IOYA 3GTLJ 4DZJA 5IYDJ 1WH5A 2FQ4A 4A93J 3LSRA 4IEJA 1FIAA 2DA3A 4CYCB 3Q0WA 3BQZA 4ABZA 1VNDA 1UG2A 2O8KA 2HOTA 1GV2A 4A69C 2LVSA 1E3OC 4BBRJ 3M4OJ 1BW5A 5C4XJ 4DW6A 3ZQLA 1ZR4A 1GVDA 4JX6A 3G1OA 2DTZA 1MBKA 2ECCA 2O7OA 2WV1A 1IDZA 4RDUA 3WHCA 2R5YB 1IG7A 2KT0A 1ETVA 3BTCA 1TWAJ 5EEAA 3Q0UA 3RQIA 4FTHA 1IV6A 5M3MJ 2XB5A 2LK2A 1QRYA 2LD5A 1P7IA 5IOZA 4JYKA 2MG4A 5IP7J 2EBIA 2DMUA 2JWTA 1MBJA 2GM4A 3JRDA 1NK2P 4MLOA 4JP0A 1HDPA 3BG3A 5J1UA 5FKLA 1OCPA 3S1NJ 1ETQA 2VUMJ 2DJNA 1HOMA 3BR1A 1JGGA 2H8RA 2X6OA 3O8HA 2D5VA 1MH3A 1APLC 2XRLA 4A3JJ 3HOUJ 2CUEA 3IH2A 2XPWA 4D5CA 1U78A 4GFBA 2TCTA 1HDDC 2VI6A 4C3JJ 4A3EJ 1JJ8C 1IC8A 2LP0A 4M3DA 3UKGA 1B8IA 3GTPJ 2IAIA 4D5FA 2JK3A 1BW6A 5F0HA 9ANTA 1I50J 4IHYA 1DU6A 4V2GA 5IP6A 1OFCX 1R9TJ 3M3YJ 2HXOA 5FKMA 1WI3A 1AU7A 2DA1A 3O8GA 1MH4A 3OIOA 2M9HA 2GBYA 1PUFA 5FLMJ 3TW7A 3B6CA 3HEFA 4DYCA 3TW6A 3HB9A 4B4CA 2VKEA 3HGYA 1W0TA 4XRSA 5FJ8J 2NVYJ 1O4XA 2JN6A 1JJ6C 3GTJJ 4BY1J 2M2EA 1WH7A 4Y7NJ 2NS7A 5IYBJ 4UUSA 5GPCA 5EYRA 3RKQA 3S17J 4A3GJ 5EGOA 2ID6A 1QVTA 1MNMC 3PO2J 4XRSG 2L7FP 2LR8A 4AUXA 3FIWA 2AO9A 3D1NI 2HOAA 4A3LJ 2O9LA 3GTMJ 1ZQ3P 3JRCA 4I6ZA 3CMYA 2Y9YA 2N8GA 1JTXA 4OVNF 3BTLA 2M0CA 1FEXA 1VF9A 5GPAA 2QCOA 2NVQJ 3ZQIA 3GTOJ 3BG5A 2GLOA 3BR6A 5J1YA 2E1OA 2W48A 4BXXJ 1ITYA 4S0HB 1B8IB 3HKZN 4A3KJ 4FE4A 3I4MJ 4XIDA 4C3HJ 4X6AJ 2XGCA 2RAEA 3QQAA 2COBA 3IH3A 2R93J 1JUPA 3S15J 5C3EJ 3I4NJ 1PUFB 2CU7A 1GUUA 2LKXA 5C4JJ 2K9SA 4FCYA 1POGA 1RR7A 2XSDC 3FK7A 5DTDA 4RBOA 3S2DJ 1Z0XA 1ZR2A 2EZIA 1P7JA 1Z77A 1RKTA 2DA2A 2L7MP 5IP9J 1MBHA 4UUSB 1JKPC 1H8AC 2Y2ZA 3QPSA 2XGEA 1I6HJ 4B3AA 2EQRA 3BT9A 1MSFC 4A3CJ 5FKKA 3BR2A 5K7FA 2R7ZJ 1GT0C 3C2BA 4BBSJ 4AYBN 3K7AJ 2YU9J 4BKXA 1WCMJ 4DYQA 3LNQA 3BR3A 2YUSA 3E7LA 2AHQA 5K7ZA 3IV5A 4MFEA 4NDLA 1TWGJ 1Q1VA 3JRHA 1RPWA 4A3FJ 3HOYJ 3H0GJ 1X2MA 4UUTA 3BG9A 3B6AA 2E2HJ 1YRNB 1EF4A 2M8GX 1RETA 2R5ZA 2YS9A 2VKVA 2XPVA 1ORKA 1XC5A 1TWHJ 2DMPA 1LE8A 5E3NA 1BJZA 2Y31A 1VFCA 2JJ7A 1K83J 5F08A 3Q3SA 2ECBA 5DS9A 4W97A 1IUFA 5E3LA 1U9OA 4IHXA 1RKWA 5EG0A 1ETYA 1OCTC 2DMNA 4B1RA 2E2IJ 5C44J 1T56A 4L5EA 2R0QC 3HM5A 2Y9ZA 3HDDA 2IBDA 5EF6A 4JPZB 3BTJA 3Q0VA 3DEWA 5J1RA 3JRBA 2JA5J 1Y1WJ 1H89C 2JA8J 3OSGA 5JLWA 1FTZA 4FISA 4XRMA 5M5XJ 3JRGA 4C2MJ 4AC0A 3SJMA 4M3GA 1JT0A 2DMTA 2ZB9A 1AHDP 5E3MA 5HODA 1F43A 5F04A 2VPRA 3SDGA 2JA6J 4EEFG 4QIWN 2NVXJ 5JLXA 2JA7J 4C3IJ 1JKOC 1IGNA 1FTTA 1JKRC 2ME0A 3QPLA 1TWFJ 1ZTRA 2DMQA 4MFDA 3K2AA 1I3QJ 3MVPA 2DA4A 3HOWJ 1VI0A 2OF7A 2P81A 3S2HJ 2X9DA 2PMZN 1MBEA 2K40A 4BY7J 1LE8B 2FJ1A 3LSPA 2TRTA 1WGXA 5EDNA 5EZHA 2XB0X 2I10A 3BR0A 3CQZJ 3DCFA 5F1JA 2HQ5A 3W6VA 4FE7A 1ETKA 3RZOJ 3SFIA 2Y30A 3NARA 4M3FA 1NK3P 1IJWC 2R92J 2G0EA 5M5WJ 1NTCA 2LFBA 4JX4A 2CUFA 1X58A 1JUSA 4IHVA 4A3IJ 2MW8A 2HXIA 2NVTJ 2FD5A 3HOVJ 2HDDA 4A3BJ 1JT6A 3G1LA 4XICA 4QTRA 3JREA 1H88C 1JTYA 2K9QA 1QPIA 1IRZA 4XK4A 1RESA 1JUMA 1LFUP 2B63J 3ZOBA 3LOCA 3A03A 3ZQGA 5M3FJ 2E19A 2E2JJ 3S1QJ 3JRFA 1K61A 5EGOB
chains in the Genus database with same CATH superfamily
3N05A 3FISA 4Y17A 2BEOA 2OPTA 1MSEC 3H3VK 4G12A 2EA2A 3PP5A 3AE4C 1QNTA 3H1CA 3VPRA 2HPCA 3ABTA 2G7UA 1KU9A 2HQAA 4A3DJ 1OCOH 5K7HA 1WDMA 3IKVA 5BOXA 4JBZA 2FFDB 2M87A 4OIQF 4L73A 1RF0A 1U5TB 3CDLA 1ZLKA 2PFBA 2XSJC 2FRHA 2VC1A 4ZDOA 5KLVD 3A0BC 3OYIA 2V1UA 3IAS2 1ZRTE 5J4YA 3Q5SA 3U1AA 3FK6A 3WTWC 3SDBA 1Q1HA 1K4SA 4PV1C 1M1EB 2EZLA 1WPKA 2M34A 3I71A 3MN2A 4U3FE 3BCCJ 1VQ5P 1EZVG 2EZHA 1K9MQ 2UUZA 3DBRB 5AVUB 1NTKD 3BROA 1O7FA 4IHWA 2F5VA 2LKSA 3EUAA 5D5XB 5AW8B 4OM8A 2QJKC 2DT5A 3FXDA 2N1TD 2CH0A 3K5BA 1IW7F 3F0CA 4NQWB 3COAC 1IF1A 1LB2A 3IH4A 1NU1J 2K9NA 1Z6TA 2L9RA 2EIKH 1FIPA 4X1EA 3J7YJ 4RAYA 1H9TA 5AVYB 3KP4A 4IFFA 3PQJA 1PP9D 2VKDA 4OH8B 3E6MA 2IX7C 1S2EA 3AE5C 1NWQA 1KQSO 2ELJA 3ZN1A 2IZ1A 2JRTA 1ZGWA 2NOGA 5DJTB 2EFNA 2LLKA 4IF4A 3WFIA 3OOUA 1KORA 1M57D 5F64A 3JAMK 3HZJA 2LF7A 2ZT9B 3OS2A 2I76A 1NTMJ 1RQUA 2PI0A 3HOZJ 2P0WA 3EYYA 4P5OA 1SQXK 1W7PD 5FRMA 1KFMA 2MH2A 1URQC 3FXKA 3G1MA 5E3OA 1KC8Q 4MEXF 2H89C 1FZGA 1PIXA 2YKQA 3K10A 5LRRA 4KA4A 2M30A 2KNCB 2K4BA 2M5AB 4RGUA 1LTJB 4I2OA 3AG2H 1AA0A 2Y0MA 2LKMA 1ODDA 1HQCA 3ZPLA 5FFXA 1ETOA 2LREA 3CP2A 3OYNA 2V1NA 1K79A 1LTIC 4PGGA 3SWYA 3BPVA 4GDOA 3GLXA 1R5SA 4HX7A 1JEKA 3MFKA 1GW3A 2Q6QA 2FNAA 3MKLA 4WXDA 2ZJQF 2VJ4A 4CYCA 1ZRDA 2OZUA 1X2NA 1BCCJ 5LRSA 2RREA 3BWGA 3TO6A 2AS5F 2P4QA 1ZKGA 3H5AA 1KGSA 3M8JA 1YX3A 3OL3A 4XE5B 1HBXG 3ABLH 3VMZA 4PSXA 1O3SA 4NC6A 1T6AA 1D1BA 5AVWB 4A0YA 3CCMP 1L0ND 5AIQA 3CX5I 1U57A 1LFBA 2L9NA 1MNDA 4DIQA 1JY3P 2NRGA 2WSFJ 2WSCJ 2R4GA 4WF2A 1JKQC 2F6CA 5FKNA 5BPIA 4E12A 3TDZC 2CRGA 3AECC 3H1IJ 5E1WA 1SFXA 2OYHC 3CWBG 1FYLA 1KILA 3CCEP 2WAEA 2E5YA 2WITA 3F23A 3Q2YA 1N73C 4J0EA 3L72E 3FKJA 3L7WA 1R4MB 2Z5HA 5ED4A 4DOZA 2HYGD 3PLNA 3J7AY 1JTHB 4YTPC 1SMYF 3BG7A 2G7HA 2BY3A 1OMIA 2CW7A 2KIFA 4ZZDA 3UIAA 2N9YB 1UIIA 1R71A 3A01B 4PCQA 3MKZA 4IL6C 5E20A 3CCVI 4PJ0C 3HD7C 2ADUA 2O3JA 1PDNC 3CDHA 1EV7A 2FOKA 2FYZA 3JCUC 4E13A 4IRIA 2VBYA 1A35A 3G9RA 1F0YA 3TOAA 3Q5RA 2M45A 3MCZA 4M9SA 1SFOJ 1AQTA 1KONA 3H5NA 3SWKA 5E79C 3M9HA 3H1JE 1N7SA 3L2VA 5JHFA 1FBQA 3FM5A 4A7PA 4F3QA 1YLFA 4KIGA 4D3FA 2B9SA 4IEJA 5E17F 5GTHC 3Q0WA 3CF2A 2OARA 1VNDA 1UG2A 2DI3A 4YFXF 2O8KA 2WVRA 2HQRA 4XLPF 1SQVG 2O01N 2E43A 2O8XA 2JPBA 3KP5A 2OU2A 1WJBA 4DW6A 3WTYC 3ZQLA 1ZR4A 1GVDA 4F93B 1WDLA 4YEJA 3A5TA 1MNEA 3DU6A 5L3FA 2FYUJ 2AQFA 3G1OA 2DTZA 1MBKA 2O7OA 3ZGYA 4XR6A 5JFRA 1HSTA 1P4AA 2P4WA 2FKWB 3L70G 5FGMA 3AE3C 2R5YB 2IA1A 3P9KA 1BBYA 1VQMP 1R5GA 1X4PA 1M1JC 1Y56A 2RH0A 1SFCC 4UNOA 3NWSA 3TQNA 2YPRA 3WFJA 2LOOA 2K9YA 1DEBA 3PQKA 2NPSC 1L4AB 2X1EA 2K4JA 2XB5A 1HJ0A 2HQNA 5A9TA 1P7IA 2EV0A 3CLQA 4DZOA 5KAIC 4B48A 2L4AA 3Q3CA 3WTUC 1VPDA 4FHTA 1Z67A 3I64A 4YELA 2QSGX 4G94A 2EWNA 1X1BA 5DCMA 4CSWA 2GM4A 2QJPB 3ASOH 2QQAA 1SQBJ 2FBWC 4E7IA 1IFJA 3BG3A 3FM3A 5J1UA 5IT3A 2ZCWA 1YTZI 3QWOC 1OCPA 3S1NJ 1FDMA 1I1SA 1HOMA 3BVHA 3TGUG 1SVMA 2D5VA 1SQQK 2W8ZA 3L73G 3CCRP 4S05A 1G3WA 1R6RA 2F5FA 1OYWA 2O3FA 1APLC 2Y0CA 1N73B 1OVUA 1KYZA 2WB1A 4JBAA 3WUVA 3NMDA 4R1NA 2HYFA 1GL2D 3IH2A 3E6CC 1VF5B 1ZHFA 1J09A 4GFBA 2F4OB 3S4RA 1ON1A 4DQ2A 1CF7B 3G17A 2Q3IA 2VONA 2WTBA 2KJCA 1JJ8C 2CWEA 3T1BA 3TKYA 3N4XA 5APXA 1SFUA 3GTPJ 2IAIA 3C3WA 4XKVA 1EKEA 3IRRA 3T5XA 1RE3C 1NJIQ 2VB6A 3NTNA 3BCAA 5F0HA 1Z21A 5HVQC 2G8YA 3V4GA 1VQKI 2P2UA 4V2GA 1YTYA 5IP6A 5C39A 2HVRA 2COMA 3MZHA 2O1JA 1FZCA 1R9TJ 4UV8A 3M3YJ 2HXOA 5FKMA 1ZW0A 1X8YA 3M07A 1U7MA 1ZRTD 1P84E 3O8GA 1PUFA 2OYOA 2GA2A 3DTEA 3TW7A 3B6CA 1F1ZA 2IGMA 1W5TA 3MZWB 3EUHA 2LBFA 1M67A 1HKSA 3SFZA 3WU0A 3HDHA 3AEFC 1S5LX 4B4CA 2VKEA 2ZXIA 3HGYA 4ZYDA 2F2EA 4XRSA 3AE1C 3EETA 5M1BA 3BCCG 3CLOA 1C0WA 2QSIA 3F89A 2IP2A 2YIUB 4Y7NJ 3ABVC 1OLTA 2RDPA 1BI3A 2FQ3A 2DQLA 4HF0A 4UUSA 3EQLF 2P5VA 1S9HA 2YKOA 3K4NA 3OYAA 3C7DB 2PP6A 5EGOA 2A06G 1MNMC 3G2BA 2EK5A 4LD5A 1YIJI 1U2WA 1NU1G 2RQQA 4EI2A 1HSJA 3FIWA 5D5WB 4OMYA 3SQNA 1DIPA 3HRSA 1ZLLA 2D2CB 1DP3A 2AXTC 3JRCA 4I6ZA 3SYTA 2OTLI 5KLIB 1JTXA 1QGPA 1V5EA 2Z5UA 2XAFA 3QOPA 3QU6A 4V19K 1VQOI 4XM3A 5CVVA 2O1KA 4NPEA 3LFKA 1GU4A 3W2AA 3DWLE 1IFNA 3F8CA 3QOEA 1NTMG 3AEGC 3J81K 2RGVA 3GTOJ 2WSEJ 2N1TC 3F8BA 4L75A 1HW1A 3DEEA 3JTGA 1NG7A 4DYDA 1YJ8A 2L5GB 4BHPA 2M7AA 5KAFC 1IFIA 1ITYA 1LVAA 3O6QA 1UJ8A 3OY9A 2JP3A 2QSFX 3IQDB 3CC7I 4UHTA 2W57A 1YJ9P 2WC2A 4BS9A 2KOGA 2JSCA 1D5VA 1Z56A 4A2UA 1U3EM 3WU2E 1J7KA 4X6AJ 1BSNA 2ZFCA 3EFGA 2RAEA 3QQAA 4E21A 3S15J 2R93J 1OKRA 1K6OA 1VQ9I 2R3SA 4CCNA 5C3EJ 3I4NJ 2AEJA 1W5SA 2EFWA 2B0LA 2LKXA 1BCCG 2X1CA 4HOBA 4LIUA 4UB6E 3FXMA 4KT6A 1Z05A 4FCYA 4Z6YA 1POGA 5LGUA 3KETA 1PV3A 1SQPK 4EJOA 2JQ7A 2MD0A 2UWJE 3JSVC 2RN7A 1KB9I 3S2DJ 1M2WA 2W83C 3WU2H 1XGMA 2D1VA 3W6JB 1IXRC 2EZIA 3WTVC 1P7JA 3RL0D 5JHUA 1IRFA 1MBHA 2EFQA 3TGNA 2XAUA 1HUCA 1KILB 1SVFA 2JR8A 2Y2ZA 3H1IG 1IL0A 1Q90D 2Q1ZB 3V8JA 3L72D 3SFDC 2HVQA 3QPSA 4UB6H 1R1TA 1BOBA 3JAMZ 2N9BA 3TYYA 3KCCA 4GCVA 4G7HF 5D6EA 5FKKA 3H1KJ 3VFZA 1RE4A 4AYBN 5A2QK 2H09A 1VQ7I 3CTVA 2JRMA 3CCQP 3PFIA 4DYQA 1LDDA 3E7LA 3ZMUA 2CW0F 1JY3N 2LR2A 3ISPA 4HBLA 4GOEA 1IJDB 1R22A 3BPXA 5LEKA 3OYHA 1N1GA 5AVXB 3F22A 1BGYD 2NZ2A 3PIOF 2B9BA 5D6FA 1RPWA 1X2MA 2Z16A 4XOTA 1SD6A 3B6AA 3LIDA 2VL8A 5HDKA 1MDMB 3H1JD 1N7SB 2A45G 1XC5A 3L2UA 1FDIA 1DP7P 3BY6A 1DX7A 4ENKA 2HFED 5B3SH 1N8RQ 1VQKP 3B5NA 1JGSA 1WJFA 3IP4B 1NTZE 1AV1A 3GHGC 3KXDA 2W1OA 1VFCA 2JJ7A 4WVZA 3U9GA 4EJVA 5D5UB 1IRXA 1LJ2A 3MWMA 1VQPI 4FX0A 3E5XA 2A61A 4H0LD 1RUNA 2OQGA 3S9OA 3M0DC 5ILUA 2DMNA 2HKXA 4B1RA 2E2IJ 1FBUA 4L5EA 2N1TB 3HM5A 1K78B 3ZMVA 1WWXA 1VQ4P 3OWTA 3Q0VA 3CJRB 3DEWA 4KITB 3QPHA 1V4RA 4A0ZA 5J1RA 2A69F 4RLQA 3H9GA 3OYLA 3OSGA 2OGUA 2L54A 2QJYC 5BVZA 2FYUG 4Q4ZF 2BBYA 3CTAA 2VT2A 2ACJA 1A36A 1FTZA 1E17A 2B89A 2WWWA 2E36A 4PJJA 2VPLA 4GDFA 3GW6A 4N78D 4EGYA 3T0YA 2DMTA 2CUZA 2ZB9A 1AHDP 2YO3A 3VP9A 2VPRA 3Q3DA 4EEFG 1FP2A 4HSRA 3CCLI 2P7VB 1XSVA 2FBKA 4LJZF 1U8RA 3C1LA 5APWA 1L0LE 2NNYA 4QIWN 3RPUA 4F7ZA 1R1UA 2NVXJ 1RC9A 1PPJE 4PV1D 1Q7YQ 1K4TA 4C3IJ 4QPQA 4ZZLA 3CJNA 1IGNA 1D8JA 1GHCA 1XSDA 2WZ7A 3O8ZA 2HTSA 2A5WA 1ZAOA 2G9WA 2VJJA 1VQOP 1OCZH 1UB9A 3HRUA 4KIFA 2R7SA 1MMNA 3T8RA 1OCCH 2HPMA 5KLVJ 4XNFA 2Q5UA 1Q82Q 3GZ6A 1WI9A 3AFHA 3HTUA 1YIOA 2E76B 4CDGA 3C9IA 3H6PA 2PGDA 2DA4A 3IF4A 4HKZH 3DKXA 4EVIA 4NBQA 3HOWJ 1BI2A 3VMAA 3CX5E 1NTKJ 4Y28J 1I39A 4LLGF 5JVTA 2DW3A 2XASA 1U5TA 3QRFF 2H8PD 3FR7A 2C9LY 3S2HJ 2OV7A 2VODA 1B4AA 4WWCA 2GQQA 1OXZA 3LIEA 1XCBA 1VZ0A 2X4HA 4KN4X 5CVIA 3IRQA 5APVA 2W00A 2TRTA 1FMWA 3HG9A 3DBHB 3WE3A 2VOOA 2XB0X 2BEZF 5CYVA 2J58A 2R32A 1VQ9P 4DJGA 2QKMB 4KISA 4KUEA 1PP9J 2BXZA 3SFIA 5DEQA 3W6ZA 3MKWB 3CX5H 1XB4A 3KHUA 3NEUA 3L00A 1JB0J 3A4CA 4HX4A 3M1EA 1QZYA 2RV8A 4JX4A 2C9NY 2LRDA 2MLKA 2R7DA 1OR7A 2JUGA 3G0OA 3LWFA 3U1KA 3OYFA 2MW8A 3R4YA 2HDDA 2ZXHA 1JT6A 1LSOA 2HLOA 3I3LA 2OBPA 3R0AA 4K3AA 3JREA 2LBFB 1JTYA 3G73A 3K1MA 2WPSA 5CQGA 1S1CX 2YR2A 2ZO4A 1YE9A 2KLVA 3K6JA 4HEA2 2WMMA 1YOVB 2L5QA 1I5ZA 1LSJA 1AQ5A 2E7WA 3ZQGA 1DGWY 1ZG5A 3S1QJ 2K02A 4GOFA 2BASA 1K61A 2KNCA 4MN4C 1W5CE 5EGOB 2R7VA 2A45I 2M5AA 2E5NA 2VBZA 3FDYA 3ERED 5KK1A 2HVSA 1LTJA 3IAOA 4PD4I 2M4KA 2GXAA 3VP8A 2ESNA 3GVAA 1KU7A 2ID3A 2VC0A 3MAJA 4M74A 4BL0B 4AWXB 4YIFA 1DU0A 1NTZK 1X4OA 5F27A 2HZDA 2ZYGA 1RY3A 1RF1A 1T8ZA 1Y1VJ 2ESHA 2LY1A 3WGIA 3OYDA 1L0NJ 1Y8RB 4L5JA 1QL2A 1PZQA 3OYEA 3A2KA 1B59A 3T97B 3P9CA 2EFOA 2VBWA 4BE1A 3D6ZA 3F72A 4Y99B 2XGXA 4UVBA 1VQ6P 2L02A 3CDIA 2KB7P 3HIFA 2P8TA 3TP0A 3GFMA 4HQEA 2OTKE 4QWQA 3O6QB 1X1DA 3O6BB 1SAXA 3BR5A 4IHSA 3HD7D 5CJ4A 1UZCA 4MIMA 1XTCC 6PAXA 2IS4A 1Y9BA 4WY4D 3HWRA 5K1YA 2L01A 4FGWA 1BL0A 1D8KA 3VEPA 2KQRA 4BQAA 1AOYA 2M0BA 1EDJA 3FBNB 1MMGA 4U87A 3B73A 1W2EA 5APTA 3GF2A 5GAGJ 5A9SA 2OFPA 4RM2A 1VQ5I 4MQ9F 4DOJA 2DYSH 5DM6F 1Z82A 4PZDA 3I59B 4M3BA 1G2HA 3LSIA 3RK3B 2IEKA 1GXPA 2H1KA 4BACA 1QLED 2OZ6A 2XZRA 4XMYA 3ZQFA 2HOEA 1KYOI 1ERDA 3A01A 1TQPA 5FLVA 1VDFA 4CXFA 3S1MJ 4XLAA 3BQYA 4F91B 1F36A 5L8RJ 2UXNA 2A6TA 2XRNA 2YX7A 3PJRA 1WJ5A 4G6TB 3AE2C 1HF0A 2ZKZA 4N0BA 3S3MA 5CCGC 1BR4A 2IVMA 2VT3A 1LWUC 1MMDA 2KXPB 2M3EA 4JX5A 3H25A 2JMWA 4NNJA 4FQGA 5H6RA 3MUDC 2VRSA 1QX8A 3F6OA 3WGHA 5GTIE 1CW5A 1HKQA 1X3ZB 2HR3A 3HPGA 1KD1Q 3NFQA 1Y8QB 1U8BA 3H1KG 4EJWA 1TWCJ 3K1PA 1R36A 3P8MC 1ZK8A 2CQQA 5CCHD 1GL2B 3L2WA 3JRIA 3HUSC 4PGHA 1GZLA 5GAEJ 2RMZA 3JR9A 4L9TA 1SVLA 2LSOA 3LQQA 3AEAC 1IXSB 1OWAA 2UWMA 5HLTA 2P58A 2XPUA 1URQA 1PL5A 1SQXE 3C2HA 2RC4A 1J75A 5GTIH 5CPRB 3M9AA 3RL0C 4M3EA 4II2A 2WB1N 1B72B 1J1DC 1HLVA 3AAFA 1Y0NA 4UVCA 2X6XA 1BDCA 2OA4A 3I54A 3GF7A 2VQGA 1KQ0A 2R7XA 1Q86Q 1BIAA 1MJ9A 1ZGJA 2R5YA 1O3QA 3C7CB 1ZN5A 2GF2A 1OW7A 1NTZD 2DAOA 3ZQ7A 2R7UA 3F8MA 3P9IA 4RB2C 4RJTA 3E1IA 3M91A 2HOSA 1F9NA 1X1CA 4YXDC 3WTTC 4ENNA 2GAUA 1LGHB 2W6BA 2Q8KA 1HH0A 4BU2A 3OYMA 1QHHD 1AKHB 5D5VB 2M0MA 3N7NA 3OYKA 1ETWA 2E35A 1HA8A 4JQ0D 3TO7A 4U7DA 2DFIA 4EM1A 1UHSA 4XN3A 4OL9A 3FHZA 1X1PA 5KTBA 3AL0C 2CQNA 1UMQA 3IAM2 1QZEA 3FBIB 5L3CA 3QHAA 4TV7A 1ZELA 3TMOA 5ICCA 2KIQA 1Z3YA 2KLUA 3GLMA 2FX0A 3L70E 2HTJA 3LSGA 1UAAA 1IRGA 1N73A 3L74D 3M9BA 4RGSA 1W0UA 1H9GA 2J5UA 1MBFA 1L0LD 1HKTA 1EDKA 1K8AQ 1XGOA 3CD6I 4OGQB 2FQ4A 2XV5A 4NB5A 3ZHBA 1FIAA 5E8GA 2V9VA 1CF7A 3DTKA 2WAQA 3BZ6A 2ZYDA 2HOTA 4A69C 2KI7B 4BBRJ 2DFHA 5AW5B 3CUQC 2X1DA 1BW5A 2OC6A 2KIKA 3KQGA 4JX6A 2MABA 3CX5D 2LY2A 1NHAA 2P5LC 5KVRA 4X0GA 2WV1A 3RJPA 3MOGA 3FX3A 1KB9E 4EDFA 3SHFA 3PSIA 3DF8A 1FS0E 1NTKG 2KT0A 3K4BA 4XONA 1ETVA 2IRFG 3MIWA 1WKMA 2FE3A 3BTCA 1TWAJ 2E1MC 2KP6A 1LTAC 5EEAA 1YJQA 3H1LG 1IV6A 3UR3C 3P8CD 2DW4A 1T38A 3TDKA 3SZGA 2LD5A 4BWNA 5IOZA 1E0EA 2P10A 1ZLJA 4R4MA 1PP9G 1IFPA 3TNUB 1KB9H 4L9JA 5D8LB 1JHHA 1VQMI 2P6TA 3RL0B 2FXPA 1AVYA 2K85A 2QVOA 3DPUA 3E5QA 1TXGA 2K3RA 1RIOH 3JRDA 4XOPA 4MLOA 2QGUA 2STWA 3OYBA 4JYBA 2JDIH 1HDPA 2JA2A 5FKLA 4I7ZC 1Y8AA 4PJLA 3W68A 3OV8A 1YJNI 1M1JA 3CXHI 1H0TA 5KHDA 2I9PA 2H8RA 4O6JA 4P1WA 1FU1A 3AEDC 3H5RA 2EIJH 4ENJA 4BXLA 4E4HA 5JE8A 5HNFA 4OIOF 2NPSA 2FF4A 2BHYA 2XAHA 4A3JJ 1O57A 3HOUJ 1SLQA 4DGWB 2MKVA 1AWCA 3HRMA 2R44A 2CPBA 2XF6A 3Q5FA 4ESBA 4RB1A 1OPCA 3ADOA 3HE5B 5ERIA 4HG2A 4Y13A 1HDDC 3BCCE 3VOEA 1YJWI 3FXRA 4C3JJ 3CCRI 5BPDA 4A3EJ 2P7CB 4TLFA 1KTMA 4M3DA 4AIJA 1Q2NA 3AL0B 1GW4A 4D5FA 1BW6A 1RF1B 3HOTA 2A06E 1I50J 2VE9A 4IHYA 1R58A 1IFMA 3FWEA 3V2QA 1W4MA 2K3FA 3CJQB 1NU1E 2DOAA 1OFCX 2OD5A 1SQQE 4ON0A 4H0EA 2H1LA 1L0NG 3W2WA 3H32B 1AU7A 4BXUA 4AU7A 3OIOA 2R3CA 5K5OA 3BLYA 3CZ6A 5FLMJ 4H0LB 1BR2A 3HEFA 3L72J 1SQVK 4PZJA 1JMMA 4GYGA 2BHZA 3HB9A 4BE2A 5FJ8J 5TGTA 1NTME 1JJ6C 3GTJJ 3H1HE 3I55I 3KZYA 2Z99A 4WK8F 3KPEA 5GAHJ 3ZW8A 4M9XA 3CUQB 3OL4A 1RE3A 5IYBJ 1FJKA 4NPFX 2FXAA 1ZG1A 3Q1MA 5HLHA 3RKQA 4ASNA 5A9SB 2ID6A 1GLNA 4BQNA 5BU8B 4XRSG 2L7FP 2LR8A 2KISA 4AUXA 1BGYJ 2FY8A 2HPIA 4G6QA 4PV1B 2O9LA 3MTUE 1E3PA 1R1VA 1LUJB 4RB0A 2O01H 2MD5A 1XGSA 5B5EE 1CI6B 1AVOA 3LQRA 2RN0A 3H1JJ 1SC7A 2M0CA 1G8XA 2CFXA 2KL4A 2QBYB 1BCCE 4ZKUA 3QSGA 3CD6P 1BE3D 2QCOA 5ICEA 2ZMEC 3ZQIA 2EFPA 1J5YA 2QJKB 4WY4C 5KJ7D 4ZTJA 1PGQA 2W6AA 2GLOA 2BXYA 1BM9A 1STZA 3BR6A 2KIUA 3BASA 3WU2C 3F5HA 2V1DA 3KFWX 3RPQA 2X85A 2E1OA 2W48A 4U88A 1Z1DA 4S0HB 1EH7A 4LLHA 1MDMA 1B8IB 4HB1A 1VQ8P 3E7KA 5B5EH 3FHNA 1YW7A 3PUFA 4I7ZB 2DFFA 3H1IE 4UB6C 1EZVI 2M3BA 2BCCD 4HZFA 3RDIA 4E70A 4C2TA 3OBBA 4C3HJ 2XGCA 3U2RA 3IH3A 3W3CA 1NKZB 2A3SA 2IS2A 1MW7A 3EWKA 1SQXD 1ZMEC 2CU7A 3D5LA 1URQB 4EV0A 2WSFH 4W7ZA 5C4JJ 1WJAA 1JY2P 1LT9C 1YJ9I 4HV5A 1RR7A 2N1TA 1K78A 3D71A 3V2RA 4MNUA 4PDKA 2XSDC 2V9KA 3MD2A 1KQFB 1SD5A 3G71P 2Y48A 2QIWA 1JY3O 4DLLA 5KKZC 1ZR2A 1FZBA 2XAQA 2BY0A 5IP9J 2CVZA 1JKPC 2GXBA 5APYA 1H8AC 1J2XA 1I3AA 5TRDA 1HGZA 3VOPA 3ZWCA 3KZIE 5CCHC 2WAFA 3HSFA 1I6HJ 1IN6A 4B3AA 4A3CJ 3S2WA 4AD9A 4RGXA 4PD4E 2X0LA 4EATA 2R7ZJ 1JO5A 1AA7A 1V3FA 4Y33A 3V7SA 4I01A 1BIBA 1CZQA 1YJNP 1W7PA 1X0XA 4BKXA 2WTYA 5J47A 5BMZA 4GODA 3RSNA 1V54H 2M3AA 1SQPE 2JVHA 4LMYA 3V4WA 2WADA 1M90Q 5J8FA 1E5WA 2YX4A 1ZG3A 1EJ9A 5LHHA 4XLEA 3OYJA 2A45H 2OYHB 1DLIA 3KEQA 1TWGJ 1Q1VA 2JZYA 2EINH 1YJWP 1NU1K 3I58A 3HOYJ 1E2XA 2F5CA 3H0GJ 3PIDA 4UUTA 4DBRA 4EZBA 1KMIZ 1BG6A 1WJDA 2PJRB 3IUOA 3CCQI 1EF4A 2VXZA 2UV1A 1M66A 1KU3A 1DD3A 2VKVA 3QYFA 3CO7C 2QM7A 1TWHJ 2K7LA 5J40A 1PYVA 1S6LA 2KUBA 3SFEC 2X51A 4DNCA 1GK4A 4IX7A 3HUGA 1NTMK 5H2FC 1XDSA 3BG6A 4IFMA 4WCGA 4GIFA 1YB4A 4JK1X 5EEGA 3HD7B 4H13D 5AVQB 4XA4A 2ZMEB 1RKWA 5EG0A 1ETYA 1KQLA 3A7OA 3QYEA 3L71E 1XMKA 2E60A 2M4GA 1ZCJA 2IBDA 5EF6A 5DV5A 3BTJA 3BC8A 3EFFK 2UZKA 4E7JA 1KYOE 1S5LE 1YVEI 4J01A 2AEMA 2XUBA 1KB9D 1Y1WJ 1H89C 3I55P 1UCRA 2ICWG 1KN7A 3E0JB 3FXQA 1JM0A 2OJED 1IK9A 4FISA 2WV0A 2ELHA 4XRMA 3GFLA 3LSMA 4M72A 5M5XJ 1GU5A 4AC0A 5HLGA 4M3GA 2KJBA 4U3FD 1YHQP 3DV8A 1JT0A 1F43A 4BYYA 1OIPA 1BN5A 2DK5A 2JA6J 4IOIH 3JSPA 1VQ4I 3WMM0 2ZJPF 4U7BA 2FYNC 5TISE 1KYOH 1W36D 1S5LH 4H4KC 4A6DA 4CCJA 4U0YA 3KYLA 2MYSA 5JLXA 2R7FA 4KN7X 3M0DA 1MZ9A 2LH9A 1P84H 3J80K 1N78A 2ZVOB 5TJJA 4KFCA 2Q2EB 4B3IA 4ZYHA 2H6CA 2UYYA 3LA7A 4D9JA 2CYYA 1FPQA 1ONVA 4KUHA 3V7RA 5EJCA 2NXNB 3H2ZA 2IFMA 1TWFJ 4HNTA 3L09A 3WODF 2GZWA 1I3QJ 1M1JB 1H0TB 1SFCB 3MVPA 2KPMA 5TISH 4B43A 4XBFA 2E7XA 3AG3H 3ZWBA 3BZKA 5HNHA 2NPSB 4M3LA 1USSA 2JSPA 3N4MA 1FOSF 3QH9A 3T97A 1U0JA 3W6KB 5HS9A 4NPDA 3ROUA 2R5BA 1LTSC 2K40A 4L0ZB 1LE8B 1V5FA 4CZCA 3ZN0A 5EFWB 2IFNA 2XU6A 2W85A 1WGXA 3RTRA 4M6XA 5DUKA 5EZHA 5EDNA 3RK2C 3BR0A 4LG3A 1MZBA 2DK8A 4R8HA 3AKZA 4B3JA 1RRJA 2XAJA 2WY7Q 5L3EA 2PQ8A 3W6VA 2Q9IA 1CSBA 3K4JA 3NARA 3PUBA 5CCGD 2ZXWH 4MTDA 2A06D 1P2FA 3AG4H 2G0EA 1MV8A 4AIHA 2OYIC 5AIPA 4BQQA 3WTXC 4M73A 2ISZA 1S7AA 1YO5C 4BXFA 1SQQD 2V7QJ 2DU9A 3HHHA 2FXOA 3V4QA 3L2CA 3H3UA 2YSRA 4CHUA 5DYMA 2FD5A 4HSTA 2R7QA 1T2KD 2VLAA 2E42A 5HDNA 3B8EB 3I59A 3ERMA 1IN4A 1GTWA 1YQ4C 3PFYA 2IW5A 1PGJA 4IOCF 3PTZA 4I0AA 2XKPA 1H88C 2K9QA 5CLSA 1LJ9A 1QPIA 3GWZA 2Y0EA 2CSOA 1W5CC 5JVGF 1OZHA 1HBWA 1JUMA 1UFMA 4RAFA 4AIDA 2RVCA 3BZCA 1QBJA 3FR8A 3H1HD 3L72G 1A6QA 4IZZA 1HW2A 2V26A 4KJZA 3LOCA 3MMYB 4XORA 1IAWA 2ZVNB 4JQFA 2IGNA 4CICA 2LDUA 4U7JA 2FYUK 2HODB 3BJAA 2Z4EA 4IL6X 5E18F 1A04A 3BDDA 1O3TA 3WS7A 3TL4X 1T3JA 1N2DC 1U9NA 4DZPA 2UXXA 2W7NA 1SFKA 3OSFA 5EZGA 1PP7U 2CV1A 1MD0A 3OR1C 4RGRA 1ZH5A 1KQ9A 1EVYA 1NH4A 1OYIA 1OQYA 1IXCA 2FNPA 1BR1A 2DYRH 2L7ZA 5GP9A 4OIRF 1BGYG 1GL2A 3K2ZA 1X79B 1MMSA 4A5NA 2EV6A 3DPLC 3QP5A 3BTIA 1JE8A 2WSEH 2NRAC 1XD7A 3NXSA 3A2AA 3H1JG 1LTBC 5F0CA 4O9BA 1ACIA 1EA3A 1G3SA 5E1XA 2CV2A 1I36A 1L2PA 3JRAA 1P4WA 1TL8A 2E75D 3MEXA 3F8FA 2EJRA 1B72A 1B6AA 2DDAA 3H3ZA 1DEEG 1YITP 3ELKA 3M1CA 4HQMA 1FSHA 3ZW9A 1SQBK 3KPHA 3C7JA 3VYUB 4YG2F 3PEFA 1S7EA 2ZT9D 2ZJRF 3CCUI 3PO3J 1OVVA 3TOBA 1EXJA 2MSYA 3C1DA 1VQ6I 2E1NA 2WAQN 1XPXA 4QPOA 5CVRA 3ECHA 5ILVA 2AEFA 3L75J 5J6XA 1M1KQ 1BC8C 3HOXJ 1SP4A 3H1KE 4PFOA 2BVMA 1ZOYC 3K69A 1FJLA 2XDJA 4B3XA 1Y47A 1HGVA 3NRVA 5GADJ 3EQ2A 2SPZA 3CXHE 1AKHA 1FZCC 5AW2B 5BU5A 1VQLP 4ETSA 2DA7A 5IYCJ 4ENMA 3GTQJ 1FDOA 2QVAA 2B87B 4XLFA 3FZVA 3L74J 2PRRA 3VMXA 5AW4B 3TP3A 3BJOA 5GTIC 4WX9A 3L1PA 1YBKA 2MGQA 1ULYA 4MEYF 5DJUB 3C2GA 3NAUA 5CVUA 3RYPA 4NHJA 2ZNZA 3OYGA 1G3TA 4OOIA 3CMEI 2FMLA 1FZEA 1EDIA 3WTZA 1LQ1A 3KLOA 4CA0A 2GIZA 5E1ZB 1YW9A 2W6JH 2GUVA 3CXHH 5FB2A 5CBNA 2IT0A 4IM7A 1N1EA 1XS9A 1K7AA 3KP6A 2F4MB 2DN0A 3KX2A 2A07F 1QVFO 1W7PB 4K2EA 2X48A 5LD2C 4XLHA 3REOA 4IHTA 1WZ2A 1SQPD 4OAZA 2Y75A 1JY2N 2ELKA 3GCMA 1SANA 2H27A 5LEJA 3QAHA 2EH3A 4RKUJ 2KKOA 3K4CA 3KE2A 3E3VA 4CCMA 4CYDA 4I76A 3V42A 1WDKA 1YRLA 3R60A 2IYOA 4G9YA 1KILE 1SQBG 3V8KA 2H7HA 5IPAA 1RI7A 4J19A 2JO1A 2P1JA 1LWUA 3DLLF 4DYRA 4KDPA 4HAMA 1RZ4A 1UG0A 4E7LA 2AXCA 3RCOA 2LTPA 4IOAF 5ICGA 2GIVA 3A02A 5J8CA 3ZQCA 1CQTA 3ADPA 5EEHA 5M5YJ 3OA7A 2OAZA 4MO7A 2Y0SN 1B1BA 3HUGB 5D4RA 3HUSA 4YFNF 4W80A 2BY1A 4Y4RA 1K04A 4D6TE 1X19A 2BZTA 5F6FA 3L71D 4BHBA 5EG0B 2KDZA 1T8IA 2NS8A 3CKYA 4HH2A 4YPCA 3ZWAA 2LY9A 3TNUA 3GXOA 1D5YA 3HYIA 5FKOA 1RR8C 3K4LA 1IC2A 3GBGA 1FX7A 3S14J 4WXCA 1QVUA 4HLYA 1P84D 2BOLA 4YFKF 4PJNA 1Y39A 4UB8E 1ZN2A 2LC2A 1AFOA 1T33A 2XROA 4HV6A 2HI3A 1JDJA 4Y52J 4D7NA 3GHGB 2QKLB 3M06A 2NYXA 4N4OB 4H44D 5JI6A 3WHBA 1R23A 1ETXA 3HGGA 3LSTA 1NTKE 4RS8A 4XKWA 1ZXGA 3GG2A 2RNGA 2K37A 3QWLA 3MD0A 1XMXA 3PDUA 4LC1A 1ZP0C 1I27A 1GXQA 2HS5A 3WE2A 4H13C 4KJMA 4HLXA 1WH5A 4UB8H 4A93J 1W2BO 1EZVE 3H1LE 3LSRA 2CMPA 1USTA 3HE5A 3RKWA 2OTJP 2CQKA 3BQZA 3LL7A 3D6YA 4ABZA 4OQYA 1V55H 1Z6RA 3LAJA 1LT1A 1T98A 4D0PA 1PP9E 4PJMA 2H6BA 2LYCA 3SEZA 1E3OC 1XTAA 3W67A 2IYPA 2WQYC 3I5CA 1J0RA 5CVJA 1VTNC 2IDBA 4DT0A 3I56I 1IZ1A 4D1QA 1L4AD 2WA0A 4ANJA 3PNVA 3SWFA 5FO5A 4GRIA 2V6CA 1IDZA 4RDUA 3WHCA 1S29A 3CCUP 5A9RA 3H32A 4ZYEA 2P5KA 2HFHA 2E5ZA 4L9VA 3C8VA 1W36C 3HHGA 3H36A 4ZDPA 1IN7A 3K0LA 3Q0UA 3RQIA 2BGCA 1YYVA 5M3MJ 5IT9K 4L76A 3A0HE 1DQUA 1YFHA 4ZMDA 2EIMH 2LK2A 3L9FA 1QRYA 4AYCA 2QM3A 1TTYA 4QLCU 4EIJA 3CI9A 4ZJZA 3CUQA 2J5PA 3M7GA 4XN0A 1I1GA 4E7SA 2IZ0A 1GK6A 1BDDA 1MBJA 4M71A 4UY8I 2DTRA 4JP0A 2IBZG 4G7OF 1BE3J 4AUWA 3MZ8A 1VF5D 3CMEP 1G2CA 1KFNA 3HSEA 2L3DA 2VUMJ 2DJNA 3S3OA 5FRNA 3A0HH 4BEHB 3BR1A 3CCSI 1JGGA 5AW6B 1N77A 4RA2A 4KICA 1MH3A 1L0NE 1FY7A 3J80Z 2O5RA 5CQEA 2VJIA 1CI6A 4Y3OA 3MHVA 1S7OA 2QQBA 3E6DA 2D2WA 4LGWA 5BS6A 1RQVA 4BQOA 1ZRCA 3V8LA 2A5YB 2QBYA 2K88A 2NVUB 2GOMA 1T08B 2JWDA 1FYMA 3GF3A 5AW7B 3SSUA 2L4MA 4EMSA 3N97A 2IPPA 1FT9A 4HF2A 2BCCJ 4D5CA 3L35A 4JYCA 3G6EP 1Z9CA 2KZVA 4GBJA 3EPZA 4I6MC 2VI6A 3GUDA 2H43A 1F4KA 2VOPA 2HEOA 1NHLA 2LP0A 3UKGA 3EDPA 1B8IA 1SQXJ 3CWBE 4Z2YA 3GZ5A 4ZKPA 2D3TA 4F92B 4UVAA 1T2KC 3QYBA 3LA3A 4GT1A 4G7ZF 4MTEA 3SXYA 1DU6A 4S04A 4UUVA 3LW5J 1G1JA 1YW8A 2KZIA 2PBIA 1F12A 1MH4A 3U1DA 3V2PA 4I09A 1N86A 1FAVA 2M9HA 2GBYA 3VYIA 4D3SA 3ECOA 4HJGH 4HPQA 3V5BA 1VQNP 2FFDC 4LLLA 5AW1B 5CKTA 3WUTA 4GO1A 3TW6A 4DYCA 3ZXSA 1U5TC 4N9HA 4I98B 1KA8A 3QODA 5KLVK 2I1JA 2V9PA 3K1NA 2JN6A 1O4XA 4YXWH 2PLYA 2D2CD 2M2EA 3F8NA 1USEA 2NS7A 5K5RA 3AE9C 4AIKA 1MGTA 1F14A 5GPCA 1WRJA 1XDUA 2XV4S 1S72P 2DLLA 2JT1A 3S17J 4A3GJ 2CPSA 1NTKK 2PMUA 3OIPA 5B5EC 1TP4A 1IUYA 3H9JA 1D7MA 2V4HA 3OJAB 1S9KE 2PEXA 3KIOA 4C9YA 1IFDA 4HX8A 2E1CA 3P32A 4IFDK 3VYRB 3CXHD 2AO9A 3D1NI 2HOAA 3L75G 3CMMA 4GWGA 4LITA 5AW3B 2IPQX 1GD2E 4GWKA 1FOWA 2Y9YA 1B9MA 4BGDA 3CCJI 1YS7A 3S93A 4LLNA 1SQVE 2YU3A 2E75C 1RUOA 2M8EA 3I0TA 1PGPA 3DTIA 1WP4A 1NOHA 1X3UA 1VF9A 5GPAA 4OIPF 1PGOA 2Q7CA 3TK1A 1JUNA 3L74G 1V5GA 3BG5A 3AE8C 5H2FH 3ITKA 2OYHA 2ZT9C 2IXSA 1IV8A 1CGPA 2DQRA 3K4KA 3IHUA 4YCAA 3CC4I 2R7OA 4BXXJ 4R79A 2PJRA 1T0FC 4KMFA 3USSA 4E7ZA 5DUIA 4AVPA 3RK3E 3I56P 1HVVA 1PPJD 4A3KJ 4FE4A 3TBIA 4XIDA 2ZXXA 3RL0g 3HPHA 4RMNA 1Y0UA 2W84A 3FMSA 3HRNA 1OYYA 1LTJC 2QYTA 4A5MA 5H2FE 3DKYA 1BI1A 1T95A 3OOPA 1FZPB 1JUPA 4OMZA 4P55A 4GKGA 4G8XA 4PK4A 4XSZF 4ZC3A 1KILD 2L9SA 3HD7A 1W1WE 1VQ8I 2HDWA 2ZMEA 2YXQB 2XNXA 2FEZA 1NAYA 2IGOA 4U3FJ 4WY4A 5KLVG 1EH6A 1LP1A 2E71A 1TQMA 1LWUB 2DODA 2IBZI 1IO2A 5APQA 4CPGA 1IN5A 3K9TA 1ZGAA 2FA5A 4RBOA 2KSJA 2Y69H 1Z0XA 2FBIA 3DFUA 2Q3EA 2VBXA 4C7NA 4KMUX 3TGUE 3KZZA 2DA2A 4ZH4F 2L7MP 1O7LA 2D1HA 4I99C 4BJ6C 5DM7F 1M76A 3L73E 2X6YA 2STTA 1L0NK 1HWTC 5K5QA 3HUSB 2XGEA 3FX0A 4QMAA 4D6TD 2P7JA 1MSFC 2ZXEB 2JKVA 4LK0F 5DCFA 3BR2A 2Y0DA 3C2BA 4A0XA 3ZMTA 3OIQA 2AQEA 4BBSJ 4XKCA 3G71I 3CCSP 3K7AJ 4N9IA 1XGNA 4EJTA 5CJ0A 3WGGA 2YU9J 3RK2D 4XQFA 1LT9A 1XSXA 3LNQA 3BR3A 2Q2EA 1N7SD 2YUSA 1J1DB 1TW3A 3DXJF 4E7HA 5DD8A 2HG5D 1A31A 2A6HF 3IV5A 2EB7A 4NDLA 2HNHA 4LB6B 3KYQA 3E1RA 3BJ6A 3S32A 1R5ID 1SFCA 3HTKB 3JRHA 1H8AA 2C0WA 4BJTA 1BI0A 3BG9A 3KP7A 2DFEA 2E2HJ 5CCHA 3IC7A 2BW3B 3GW2A 1LFPA 1RETA 2M8GX 2XDVA 2YS9A 2R5ZA 1LDKB 1ORKA 3EGOA 4HDUA 4HNUA 3KYCB 2XIGA 3X2QH 1QHGA 1LEBA 3VB2A 1FBSA 5HS8A 1EZVD 2WPVB 3H1LD 3E6BA 2FU4A 1LE8A 5E3NA 1VL2A 4RAZA 1SQQJ 1NO4A 4LB5A 1LDJA 1K83J 2VN2A 1QL1A 1S5LC 3FWLA 3U59A 2R7TA 3Q3SA 4KIBA 4UV9A 2Y0SA 3CMAI 2E75B 4I1LA 5DS9A 4L9NA 4W97A 1R7JA 2QEXI 1LPQA 3ZGKA 3G4SI 1L0OC 5E3LA 2WPQA 2Z5IA 4KHXA 5CHXA 3QPTA 4HYTB 3HDDA 1E79H 5C44J 1T56A 2Y9ZA 1IN8A 2VE8A 2G3AA 4JPZB 5HDGA 3VWBA 4UXNA 1TBXA 2HDHA 3JRBA 2JA8J 3H1HJ 3SZPA 3FMRA 5DDGA 1QQIA 5JLWA 2O01J 4H44C 2WT7B 1DH3A 1FMVA 5TISC 4KUGA 2W90A 2WY8Q 3JRGA 2QZ8A 1LTTC 3SJMA 2F5DA 2KDOA 2RKLA 2QA4P 3CUOA 5E3MA 3PHLA 3CL3D 5HWSA 1WJCA 3SDGA 1M8OB 3KDPB 2E5TA 2E76D 3GEZA 1YTZT 1PP8F 3KP2A 3L4FA 3NQOA 3HKZA 1JKOC 1NKNA 3CCJP 1TT5B 1S4XA 2K9LA 2QYOA 1L4AC 1YHQI 2HODA 1X0TA 1EQ7A 2MBFA 2ME0A 4U0VA 1TW2A 1H89A 3QPLA 3AE7C 4YRVA 2DMQA 2KRCA 4MFDA 5HOOA 1G2CB 5HLIA 3B71A 2XHKA 1BE3G 3ABUA 1VPCA 3CC4P 2E1MB 1EC5A 5FLXK 1LJ8A 1ZARA 3FMQA 1DUXC 5FWNA 4Q47A 3HN2A 2QJPC 2V4JC 4WBAA 1SEUA 2P81A 2PFXA 4KYWA 2O6GE 2X9DA 1MBEA 1R5HA 4BY7J 2FJ1A 3LSPA 3V2NA 1MJAA 3K70D 5LLQA 3B02A 3TDUC 3C7AA 4XSXF 2PX9A 2HQ5A 2QJYB 1J2JB 2BCCG 3ZDMA 2VJ5A 1ETKA 3RZOJ 3CWBD 4ZTFA 3WTSC 2Q1KA 1Z3XA 2MC3A 5LGTA 4M3FA 2X58A 1KU2A 2ETHA 3PIPF 1IJWC 1LTGC 1VF5C 4IRHA 1SQXG 1TNTA 2HU9A 3LA2A 4GXOA 1X58A 3DPTA 4NC7A 1LNWA 4IO9F 2HGCA 4IHVA 5AVRB 2W25A 4A3IJ 3VSKA 2HXIA 2NVTJ 5IT9Z 2YKPA 5AVTB 2HZTA 2ITAA 4A3BJ 1UELB 1KZUB 1MIJA 3FXUA 4BUPA 3OS0A 1BGYE 2WSCH 1JCCA 1QVGO 2ZC2A 3BOQA 1IRZA 1RF0C 1JHFA 2ZSIB 4XL9A 4XK4A 4DBQA 2DO7A 1U6GA 2KZGA 2B87A 3WUUA 1FBMA 4EOTA 3KYDB 2JEEA 1LFUP 3I9V2 1DGRM 2MA3A 5IY5H 2DDBA 2JVGA 1PUEE 3A03A 2DOEA 1EH8A 5B66E 5M3FJ 1OX3A 1SQPJ 2JWAA 3M9QA 3JRFA 2OYIA 3TSIA 2KRFA 5AW0B 1HC8A 4PZEA 1S9KD 2RNJA 4H44B 1HTLC 3K4MA 5F0FA 2HKOA 3D0SA 4O5VA 2AXLA 5HS7A 2YIUC 1MUUA 2E74D 3HE4B 1KYWA 2HYJA 4E6KG 1FJPA 1SFEA 1WFXA 2L91A 2JUCA 2V6EA 1SQVD 1A6IA 1H88A 1ENHA 1JCDA 4WWIA 1R00A 1X1AA 5D4SA 4AVZA 5B66H 1J9IA 3GMAA 3KZIH 1FOSE 3PLRA 1L3LA 1IDYA 3CO6C 1Y6IA 3DKWA 2CQXA 2QLZA 3Q9VA 5BNGA 2D2CC 3L36A 4OWFA 4PD4H 3U1CA 4N78E 3I4PA 3ZP5A 5KLIC 1ZYRF 3L70D 2EPFA 4PZCA 3CCYA 1R5LA 3CMAP 3AE6C 3RKXA 2FYUE 1DD4A 2QWWA 1QU3A 2QEXP 3A0BE 3RK3D 3G4SP 1HW5A 4FT8A 1D1AA 3G3ZA 1WHUA 3L71J 1M56D 3E5UA 3K96A 4IQJA 1GMJA 1JOCA 1WMKA 2QF7A 5K5GB 2QE7H 1YG2A 3ABKH 1ZRFA 2NNNA 3PM1A 1U7JA 3S16J 2C0XA 2L7KA 3P7NA 5KNLA 3R0JA 2JJLA 1QPMA 1MMAA 5KJ7C 3OS1A 3ONQA 1WT6A 1MBGA 1GV5A 1S3JA 2VQLA 1YITI 2GUSA 2YO2A 4WY4B 1MFTA 1ON2A 2O03A 3A0BH 1ZREA 1LP1B 1OJLA 2CQ7A 1PJRA 4U3FG 1JY2O 4J0FA 2BVLA 2YMYA 3ESWB 1A02J 4A3MJ 3TEDA 1SQBE 4LGDE 3O3KA 4C7NB 4R1HA 3TGUD 2NAZA 4V2FA 1BSHA 3L73D 3IWZA 3MZYA 5J3LA 2PMZA 4CCKA 5DD4A 4CGZA 4LOCA 2ZYAA 4BHCA 3LAPA 1QA6A 3GHGA 2PLAA 1YS6A 4IQ4A 1VQLI 1HCRA 1WSUA 5AYVA 3L2RA 3IN6A 3S1KA 2DA5A 1NYHA 3LMMA 2CJJA 2BY2A 2HPCB 1M75A 1KILC 4GYIA 1H0MA 1K73Q 3ZMSA 1LT9B 3ZMDA 3ZQHA 2H88C 5KJ7A 3VMYA 2GOXB 5ICFA 3FXEA 3D70A 4B44A 4L0YB 2LKPA 4B86A 2EA4A 3I5UA 1YX5A 4JOMA 4U0WA 3OR2C 3B5ND 4D7MA 2KRHA 4BJ5C 3S1RJ 4HNVA 4WXHA 4GGGA 2QSHX 2CW8A 2L0KA 3VSLA 3GTGJ 4DCKA 5KKZB 3PH0A 1SD4A 1YQAA 3HBLA 4O3MA 1DPRA 1A5JA 3K6GA 1QEXA 4C7RA 2KFDA 3OYCA 2ZAEB 4P96A 2R5ZB 5B1BH 4LG0A 5L3BA 2ME6A 1X22A 2DA6A 4EM2A 3CP8A 4BRYA 1AJYA 3HSRA 1TC3C 1FWZA 4R4LA 3PJGA 3IKTA 3CCVP 1MJBA 4KNYA 3BCCD 3KEOA 1PGNA 3RZDJ 3ML6A 4IXAA 1XG1A 2DT6A 2OCEA 2QUFA 2DPDA 4UB8C 3GTKJ 1BA5A 1N7SC 1SQQG 3IFMA 1JNMA 4I0BA 1BC7C 1PVEA 1D0ZA 4TT3H 1R4NB 2KZJA 2KLOA 1NU1D 1FOYA 3FKIJ 4W1UA 3MKYB 4F52A 2EZKA 2V79A 3RPUD 2GWRA 3J7ZI 1D0XA 4OGQD 3L37A 3U21A 2O0YA 1GDTA 4XFJA 3H1HG 2XGDA 3LSJA 1N25A 2VQCA 3RIRA 3M8FA 4BEHA 1PFIA 2W24A 4EGZA 3P5JA 1OW6A 3OAKA 4IL6E 2LG4A 3D5RC 4M6VA 1UHWA 2IGKA 4QSHA 1YRNA 1NTMD 4PJ0E 3AG1H 1D0YA 5IOYA 3JCUE 3GTLJ 1R8EA 1EDLA 4DZJA 5IYDJ 3AEEC 3JC22 2PG4A 1X0VA 1P92A 2RKHA 2CS3A 3HC7A 2DA3A 4CYCB 1I6XA 5E79E 2IS1A 1GV2A 1K05A 2LVSA 1K6YA 3PNTA 2I5UA 2IS6A 1JXSA 4IL6H 4PJ0H 3M4OJ 1QZZA 2FUG2 2QQ8A 5C4XJ 4LK1F 3JTHA 1SAUA 4C30A 3JCUH 5LBQA 1SMTA 5GTHE 2ZNYA 2KHMA 3L2QA 5ILSA 1UHMA 4CH7A 2ECCA 1HXDA 1WRGA 2IBZE 1NGMB 3D5SC 2OTJI 1BCCD 3A0HC 3W2VA 3LSKA 3F21A 1IG7A 3DQVC 4XLNF 2E76C 3ABMH 2FYNB 1KQGB 2IA0A 2ZFWA 5H20A 1NTZJ 3VODA 2V1XA 3O2PE 4BH9A 2ZJSE 5E79H 1XCVA 3ULQB 5L3GA 2ZFUA 4FTHA 4C46A 2FBHA 4G6DA 3RKYA 3PSFA 1QO0D 2B88A 3BRTB 1A02F 2XF5A 2Z1DA 2EILH 5GTHH 3EYIA 3OW2O 3H1ID 2DBBA 2OQRA 4HRIA 4JYKA 2MG4A 2V7QH 5IP7J 3CESA 2XVCA 2Q0OA 3DU5A 2EBIA 2POHA 1YYCA 2DMUA 2FSWA 1Q81Q 1TLHB 2VXDA 2JWTA 2VIXA 2LMDA 1NK2P 2HWVA 5JR3A 1FOKA 1DPUA 4OINF 3OMYA 5KAIE 1ETQA 1Z91A 3BCBA 4OAYA 1OCRH 2K86A 4PSWA 2X6OA 3O8HA 3CC2I 1NVOA 2IA2A 4AM3A 3AEBC 3SEQA 2R7RA 1TZLA 2CG4A 2WSSH 3K70C 3RK2B 2ZXJA 2KIMA 2XRLA 3F9KA 2F48A 2HDCA 1L0LJ 2NS0A 2CUEA 2KS1A 1X3WB 2TDXA 2M7BA 3LSHA 2YXRB 2XPWA 1SS1A 2R5DA 3EUHC 4RESB 1U78A 1T39A 1J1EC 2TCTA 1NG6A 1REPC 5KAIH 2OYIB 1N7LA 4FETA 3GLLA 2VQHA 3GHYA 5H6QA 5FLXZ 4PD4D 5AVZB 1SQPG 4KUMA 4B47A 1IC8A 2C6YA 3P7KA 2JTVA 1OISA 4M9ZA 3ULKA 3R2PA 2JK3A 4EQQA 5KCMA 4HA8A 5BQTA 1WPQA 5E8IA 9ANTA 3HL2A 3FWNA 3KP3A 3H92A 1TNSA 1XX5A 3G6EI 3PL8A 2M8RA 1S8NA 1WI3A 2DA1A 2XAGA 3RYRA 2EW2A 3L75E 1YI2I 3H0DA 3PRJA 4B8XA 4JF7A 5L3DA 3HOSA 1N75A 2NOJB 4ITVA 1IZNB 2O61A 4I02A 3I53A 5CCGA 1YIJP 2FYUD 4D6TJ 1SD7A 1W0TA 2F4IA 3L74E 2NVYJ 4NUBA 4Y99C 4W7YA 3MUDA 4BY1J 1IO4A 2K9JA 1WH7A 2L9VA 2B7EA 4ESJA 2E74C 2OTLP 5D8KB 1T2KA 3W6UA 1ZV8A 3CJTB 3L71G 5FD5A 2CUJA 5EYRA 1SVOA 5DCMB 1VQNI 2QQ9A 3PNYA 3A1YA 2QRXA 1QVTA 3FF5A 3PO2J 3C18A 2CK3H 1WVRA 3RQ4A 4EM0B 3T8TA 5CMZA 4ZNCA 4B09A 3HTSB 2DJIA 4A3LJ 1FE6A 1Z7UA 1ZQ3P 1R49A 3GTMJ 3CMYA 1KYOD 2FFDA 2ISYA 2QG4A 2N8GA 2W4SA 4OVNF 3BTLA 2BE5F 3DEUA 1S72I 2HYNA 3CC7P 3GFJA 1FEXA 1SQBD 3FXJA 3B4SA 5KLVE 2LNBA 2NVQJ 2MJZA 3RK3C 3H1LJ 1IK7A 3PJSK 4N4NB 2LXCB 1RHZB 3E97A 1UIXA 2AXTE 3GMEA 2R7WA 1MFZA 3HTKA 1E3HA 1GVJA 3FXOA 2J5OA 5J1YA 2A68F 1BOAA 3GYHX 2LF8A 1URQD 2BW3A 3P8CE 3UNGC 1P4XA 3HKZN 2D45A 5MGBA 2W27A 1F17A 2XKMA 1KZHA 3I4MJ 4KT0J 2KP8A 2YNYA 1FYKA 4M6YA 4NQWA 4RLFA 3KEYA 3V6IA 4D3DA 5LHGA 1FZCB 1D1CA 1T6SA 4IVNA 4RO0A 2RQPA 4OWRB 5KAFE 1P6RA 2H8WA 4E7KA 2AXTH 2COBA 1RE4C 2XKOA 2MH9A 2V7FA 2W82A 3NWTA 1PUFB 3M0AA 2VASA 1GUUA 3E1SA 3BP8A 4P9UA 5LFAA 3VTPC 2K9SA 1GL2C 2KK7A 1FSEA 2VKHA 2WTEA 1J1EB 2ZSHB 2FXMA 3MP7B 4ASVA 3Q5PA 3FK7A 5DTDA 1G59A 5AW9B 3GZNB 4LG0B 3DOJA 2M5WA 4BRYB 1VQ7P 1T0FA 2J59M 5KAFH 2WT7A 4CCLA 1Z77A 3ZMZA 1FP1D 1RKTA 1P9QC 5J4VA 2ZJ2A 4UUSB 3JSOA 4LFUA 4EYYQ 4OU0A 3H35A 5AVVB 3RI4A 3VYSB 3L6DA 3QP6A 4N6JA 2EQRA 3BT9A 2KSEA 2CFOA 5K7FA 3EUKL 2GXGA 5CJ9A 1TT0A 1GT0C 1NH3A 1KV4A 3ZR8X 1EVZA 4MQVA 1DLJA 3CC2P 3B5NC 1XN7A 1FOXA 2PAJA 3HJEA 3MGNA 2FMYA 1QGKB 3Q9SA 4BAYA 3II6A 3CPWO 2Z9OA 1WCMJ 4HF1A 1QMGA 3R6SA 4CZZA 1KS9A 4N3YB 2AHQA 2I1KA 5K7ZA 4F55A 4IPAA 1FZAA 2JPCA 4BE0A 2Z2SB 4MFEA 1B9NA 3M8EA 2E74B 2DPUA 4I2LC 4I7HA 2EV5A 3IR9A 1VQPP 3ZQQA 2H94A 4A3FJ 3WG9A 4HYEA 2E34A 1FC2C 2XC7A 1LNQA 1EXIA 1YRNB 3CWBJ 4Q48A 3HADA 3ZCOA 1F5TA 1WQ2A 3DFGA 2XPVA 1T3UA 3CF5F 2Z33A 4RAGA 2DMPA 3HXLA 3F3SA 2K3PA 4RB3C 1BJZA 1HJBA 2KYVA 1WJEA 1TQIA 4BNCA 2Y31A 2MC4A 2MFZA 2WPRA 4MGRA 4HDVA 2IJLA 5F08A 4FASD 1FC3A 2XNDH 4ZDLA 1YI2P 4XRFA 2ECBA 2L2OA 1L0LK 2K1AA 1RH5B 1IUFA 1JTHA 1D3YA 1U9OA 4NC8A 2WWYA 4IHXA 1JI8A 4OGQC 4WB4A 1OCTC 4LIVA 3IWFA 4B3HA 2R0QC 1FNNA 3MQ0A 3WU1B 3RGUA 2IBZD 4Q5SF 3CCLP 3VN0A 3ASNH 2JA5J 2QENA 3HRTA 5LHIA 5TJHA 4DJAA 1P84I 3S3NA 4HW0A 2ZBKA 3H9QA 1BE3E 2OUMA 4C2MJ 3A3YB 5FFZA 2CGPA 2KMUA 4H13B 3KLNA 3TO9A 3BRVB 3S8PA 5AVSB 5HODA 1NTZG 4L74A 4XLCA 5F04A 4RM3A 1LEAA 1HF9A 1NAFA 1SFCD 3R4KA 4Z1MH 2BYVE 4A12A 1KQ8A 4XKBA 4MHGA 2JA7J 3J81Z 3F6VA 2NPSD 4ZYGA 1FTTA 1SQVJ 2BCCE 4YIIA 2QA4I 1G1IA 1BJAA 1JKRC 1G4DA 4PUSA 2CO5A 1YQ3C 1DDNA 3RQSA 3H1KD 1ZTRA 3F3XA 3VDXA 3HE4A 1Z7LA 4BDYA 3I83A 3K2AA 3FGAD 2PMHA 4C2UA 3DBLB 2P67A 3JW4A 5FROA 2GA1A 2K27A 3DP7A 1OR7C 3L70J 1XMAA 2DXIA 1VI0A 2M1BA 3R61A 3LFUA 2OF7A 5B1AH 1OW8A 4CCOA 4FX4A 2K9MA 2KS1B 3ZRGA 2PMZN 3SZTA 4ZYAA 3GFIA 5CBOA 3B5NB 3GX4X 2PN6A 2I8DA 2K5CA 1L0LG 2Z3YA 1G6NA 1PPJG 4A6EA 1MKMA 1FLIA 2LXBA 3CCMI 3DCFA 3CQZJ 2I10A 2MLGA 1LKXA 5F1JA 2CV0A 3RBXA 2P6SA 1L4AA 3TF5A 4FE7A 4L18B 2WBMA 2OCCH 4ESFA 4AQRD 4IRGA 2Y30A 5APSA 4KT5C 4J00A 1NK3P 3BATA 1M7LA 3LW5H 2BV6A 2R92J 4EJUA 5FD6A 4AYBA 5M5WJ 1NTCA 2LFBA 2OQQA 2DCEA 2CUFA 2DT7B 2A6EF 4K35A 2PJPA 5AONA 5APUA 2FOWA 2X6WA 2DOFA 3CCEI 4ASWA 1JUSA 3VYTB 3L75D 2XF7A 3FXLA 3HOVJ 3TGUJ 4BDZA 4IJAA 1JMBA 4IKFA 1OVRA 3L73J 3QU3A 5LGNA 4YIRX 3G1LA 1TU3F 4PFPA 4XICA 5A2QZ 1RNLA 3GO5A 3IL2A 4OQZA 1RF1C 4QTRA 5B66C 1USDA 2BEQD 2YMKA 3KZIC 1X9VA 2A05A 4L5IA 1G3YA 1RESA 1O3RA 1LVKA 4P9FA 2B63J 4CO8A 2K9JB 3ZOBA 4D6TG 3V7CA 4H0LC 4Y15A 3WG7H 4CUGA 3D1LA 2F5EA 5F1RA 1J59A 3DLAA 2E2JJ 2E19A 4S3MA 4II3A 3J7AO 3RBZA 1FZFA 1YONA 2QM8A 1XTGB
chains in the Genus database with same CATH topology
3FISA 2OPTA 4PZEA 1MSEC 3H3VK 3WS7A 4G12A 1U9NA 5F0FA 4DZPA 3OSFA 1YJQA 2ID3A 2HYJA 5EZGA 3VPRA 1EVYA 1DU0A 2ZYGA 5F27A 4A3DJ 1Y1VJ 5K7HA 1WDMA 2L7ZA 5GP9A 1A6IA 1ENHA 3CDLA 3BTIA 3PLRA 1IDYA 3FK6A 5F0CA 2CQXA 2EZLA 5BNGA 1WPKA 3TP0A 1I36A 2M34A 3MN2A 3JRAA 2EZHA 4PZCA 3CCYA 3BR5A 1B72A 4MIMA 4IHWA 3ZW9A 4OM8A 3HWRA 4FGWA 1BL0A 3PEFA 1S7EA 3K96A 3PO3J 3F0CA 2QF7A 2MSYA 2WAQN 3IH4A 2K9NA 2L9RA 3PM1A 1FIPA 4X1EA 3S16J 5A9SA 2OFPA 1Z82A 3HOXJ 1MBGA 4PZDA 1GV5A 4M3BA 1FJLA 1G2HA 2IZ1A 1ZGWA 2IEKA 2NOGA 2H1KA 3WFIA 2LLKA 1AKHA 3OOUA 3ZQFA 1OJLA 2DA7A 5IYCJ 3A01A 3GTQJ 5FLVA 3S1MJ 3HOZJ 4J0FA 3BQYA 1F36A 3TP3A 3L1PA 4A3MJ 3TEDA 2MGQA 4V2FA 3G1MA 3NAUA 5E3OA 1HF0A 5J3LA 4LOCA 4JX5A 2ZYAA 2JMWA 2PLAA 1HCRA 5AYVA 4IM7A 2DA5A 1N1EA 1ETOA 1XS9A 2CJJA 2DN0A 1M75A 1U8BA 1TWCJ 2X48A 1ZK8A 2CQQA 3MKLA 3ZQHA 3JRIA 2ELKA 4CYCA 3JR9A 1SANA 1X2NA 2EH3A 2P4QA 1ZKGA 4D7MA 3S1RJ 2XPUA 4HNVA 4DCKA 2L0KA 4I76A 3GTGJ 1WDKA 1YRLA 2IYOA 3HBLA 5IPAA 4M3EA 4J19A 1A5JA 1LFBA 2WB1N 1B72B 4DYRA 1HLVA 1JKQC 2R5ZB 5FKNA 4E12A 2ME6A 2CRGA 2DA6A 2LTPA 1CQTA 2R5YA 3A02A 3ZQCA 3C7CB 1TC3C 2GF2A 3ADPA 5M5YJ 3PJGA 4MO7A 2Y0SN 2HOSA 4J0EA 1PGNA 3RZDJ 3GTKJ 1XG1A 1BA5A 5EG0B 2KDZA 2NS8A 3CKYA 1AKHB 3ZWAA 2LY9A 1ETWA 1D5YA 3A01B 3FKIJ 4W1UA 5FKOA 4JQ0D 2EZKA 3GBGA 3S14J 1UHSA 1QVUA 4OL9A 1T33A 1UMQA 1GDTA 4E13A 2HI3A 2XGDA 1JDJA 3LSJA 3QHAA 1F0YA 4Y52J 4D7NA 2FX0A 3LSGA 4M6VA 4QSHA 1SFOJ 1YRNA 3WHBA 3HGGA 1ETXA 1W0UA 1MBFA 5IOYA 3PDUA 3GTLJ 4DZJA 5IYDJ 1WH5A 2FQ4A 4A93J 4D3FA 3LSRA 1X0VA 4IEJA 3ZHBA 1FIAA 2DA3A 4CYCB 3Q0WA 3BQZA 4ABZA 1VNDA 1UG2A 4OQYA 2O8KA 2ZYDA 2HOTA 1GV2A 4A69C 2LVSA 1E3OC 4BBRJ 2IYPA 3M4OJ 1BW5A 5C4XJ 4DW6A 3ZQLA 1ZR4A 1GVDA 4JX6A 1WDLA 3G1OA 2DTZA 1MBKA 2ECCA 2O7OA 2WV1A 3MOGA 3ZGYA 1IDZA 4RDUA 3WHCA 2R5YB 1IG7A 5A9RA 2KT0A 1ETVA 3BTCA 1TWAJ 5EEAA 3WFJA 3Q0UA 3RQIA 4FTHA 1IV6A 5M3MJ 2XB5A 2LK2A 5A9TA 1QRYA 2LD5A 1P7IA 5IOZA 4JYKA 2MG4A 3Q3CA 5IP7J 1VPDA 2EBIA 2DMUA 2IZ0A 1TXGA 2JWTA 1MBJA 2GM4A 3JRDA 1NK2P 4MLOA 4JP0A 1HDPA 3BG3A 5J1UA 5FKLA 1OCPA 3S1NJ 1ETQA 2VUMJ 2DJNA 1HOMA 3BR1A 1JGGA 2H8RA 2I9PA 2X6OA 3O8HA 2D5VA 2W8ZA 1MH3A 1APLC 5JE8A 2XRLA 4A3JJ 3HOUJ 2CUEA 4R1NA 3IH2A 2XPWA 3ADOA 4D5CA 1U78A 4GFBA 2TCTA 3G17A 4GBJA 1HDDC 2VI6A 3GHYA 2WTBA 4C3JJ 4A3EJ 1JJ8C 1IC8A 2LP0A 4M3DA 3UKGA 1B8IA 3GTPJ 2IAIA 3ULKA 4D5FA 2JK3A 2D3TA 1BW6A 1WPQA 5F0HA 9ANTA 1I50J 4IHYA 1DU6A 3FWNA 4V2GA 5IP6A 1OFCX 1R9TJ 3M3YJ 2HXOA 5FKMA 1WI3A 1AU7A 2DA1A 3O8GA 1MH4A 1F12A 2EW2A 3OIOA 2M9HA 2GBYA 1PUFA 4D3SA 5FLMJ 3TW7A 3B6CA 3HEFA 1M67A 4DYCA 3TW6A 3HDHA 3HB9A 4B4CA 2VKEA 3HGYA 1W0TA 4XRSA 5FJ8J 2NVYJ 1O4XA 2JN6A 1JJ6C 3GTJJ 4BY1J 2M2EA 1WH7A 4Y7NJ 3ZW8A 2NS7A 5IYBJ 1F14A 4UUSA 3W6UA 5GPCA 5EYRA 3RKQA 3S17J 4A3GJ 3C7DB 5A9SB 5EGOA 2ID6A 1QVTA 1MNMC 3PO2J 4XRSG 2L7FP 2LR8A 4AUXA 3FIWA 2AO9A 3D1NI 2HOAA 4A3LJ 4GWGA 2O9LA 3GTMJ 1ZQ3P 3JRCA 4I6ZA 3CMYA 4GWKA 2Y9YA 2N8GA 1JTXA 4OVNF 3BTLA 2M0CA 1PGPA 1WP4A 1FEXA 3QSGA 1VF9A 5GPAA 1PGOA 2QCOA 2NVQJ 3ZQIA 1PGQA 3GTOJ 3BG5A 2GLOA 4DYDA 3BR6A 1YJ8A 4YCAA 5J1YA 2E1OA 2W48A 4BXXJ 1ITYA 4S0HB 1B8IB 3IQDB 3HKZN 5MGBA 1F17A 4A3KJ 4FE4A 3I4MJ 4XIDA 4D3DA 2QYTA 3OBBA 4C3HJ 4X6AJ 2XGCA 2RAEA 3QQAA 4E21A 2COBA 3IH3A 2R93J 1JUPA 3S15J 5C3EJ 3I4NJ 1PUFB 2CU7A 1GUUA 2LKXA 5C4JJ 2K9SA 4FCYA 1POGA 1RR7A 2XSDC 3FK7A 5DTDA 4RBOA 3S2DJ 1M2WA 3DOJA 4DLLA 1Z0XA 1ZR2A 2EZIA 3DFUA 1P7JA 1Z77A 1RKTA 2DA2A 1M76A 2L7MP 5IP9J 1MBHA 4UUSB 1JKPC 2CVZA 1H8AC 2Y2ZA 3ZWCA 1IL0A 3QPSA 2XGEA 3L6DA 1I6HJ 4B3AA 2EQRA 3BT9A 1MSFC 4A3CJ 2JKVA 5FKKA 3BR2A 5K7FA 2R7ZJ 1GT0C 3C2BA 4BBSJ 4AYBN 1EVZA 1DLJA 3K7AJ 3CTVA 2YU9J 1X0XA 4BKXA 1WCMJ 4DYQA 3LNQA 3BR3A 1QMGA 1KS9A 2YUSA 3E7LA 2AHQA 5K7ZA 1N1GA 3IV5A 4MFEA 4NDLA 1DLIA 1TWGJ 1Q1VA 3JRHA 1RPWA 4A3FJ 3HOYJ 3H0GJ 1X2MA 4UUTA 3BG9A 3B6AA 3PIDA 1BG6A 2E2HJ 4EZBA 1YRNB 1EF4A 3HADA 2M8GX 1RETA 2R5ZA 2YS9A 2VKVA 1M66A 2XPVA 1ORKA 1XC5A 3EGOA 1TWHJ 2DMPA 3F3SA 1LE8A 5E3NA 1BJZA 2Y31A 1VFCA 2JJ7A 1K83J 5F08A 3Q3SA 1YB4A 2ECBA 5DS9A 4W97A 1IUFA 5E3LA 1U9OA 4IHXA 1RKWA 5EG0A 1ETYA 1OCTC 2DMNA 4B1RA 2E2IJ 5C44J 1T56A 4L5EA 2R0QC 3HM5A 2Y9ZA 3HDDA 2IBDA 5EF6A 1ZCJA 4B3HA 3BTJA 4JPZB 3Q0VA 3DEWA 3HN2A 5J1RA 1YVEI 2HDHA 3JRBA 2JA5J 1Y1WJ 1H89C 2JA8J 3OSGA 5JLWA 1FTZA 4FISA 4KUGA 4XRMA 2W90A 5M5XJ 3JRGA 4C2MJ 4AC0A 3SJMA 4M3GA 1JT0A 2DMTA 2ZB9A 1AHDP 5E3MA 5HODA 1F43A 5F04A 2VPRA 5HWSA 3SDGA 2JA6J 4EEFG 4QIWN 2NVXJ 5JLXA 2JA7J 4C3IJ 1JKOC 1IGNA 1FTTA 4B3IA 1JKRC 2UYYA 2ME0A 4KUHA 3RQSA 3QPLA 3H2ZA 1TWFJ 1ZTRA 2DMQA 4MFDA 3I83A 3K2AA 1I3QJ 3MVPA 2DA4A 2PGDA 3HOWJ 1LJ8A 5FWNA 1VI0A 3ZWBA 2OF7A 3FR7A 2P81A 3S2HJ 2X9DA 2PMZN 1MBEA 2K40A 4BY7J 1LE8B 2FJ1A 3LSPA 2TRTA 1WGXA 5EDNA 5EZHA 2XB0X 3C7AA 2I10A 3BR0A 3CQZJ 3DCFA 5F1JA 2HQ5A 4B3JA 3W6VA 4KUEA 4FE7A 1ETKA 3RZOJ 3SFIA 3W6ZA 2Y30A 3NARA 2X58A 4M3FA 1NK3P 1IJWC 2R92J 2G0EA 5M5WJ 1NTCA 2LFBA 4JX4A 2CUFA 1X58A 3G0OA 1JUSA 4IHVA 4A3IJ 2MW8A 2HXIA 2NVTJ 2FD5A 3HOVJ 2HDDA 4A3BJ 1JT6A 1LSOA 3G1LA 4OQZA 4XICA 4QTRA 1PGJA 3JREA 1H88C 1JTYA 2K9QA 1QPIA 1IRZA 4XK4A 1RESA 1JUMA 3FR8A 1LFUP 2B63J 3K6JA 3ZOBA 3LOCA 1LSJA 3A03A 3ZQGA 5M3FJ 2E19A 2E2JJ 3S1QJ 4S3MA 3JRFA 1K61A 1YONA 5EGOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIS A;  2OPT A;  1MSE C;  3H3V K;  4G12 A;  1U9N A;  5F0F A;  4DZP A;  3OSF A;  2ID3 A;  2HYJ A;  5EZG A;  3VPR A;  1DU0 A;  5F27 A;  4A3D J;  1Y1V J;  5K7H A;  2L7Z A;  5GP9 A;  1A6I A;  1ENH A;  3CDL A;  3BTI A;  1IDY A;  3FK6 A;  5F0C A;  2CQX A;  2EZL A;  5BNG A;  1WPK A;  3TP0 A;  2M34 A;  3MN2 A;  3JRA A;  2EZH A;  3CCY A;  3BR5 A;  1B72 A;  4MIM A;  4IHW A;  1BL0 A;  1S7E A;  3PO3 J;  3F0C A;  2QF7 A;  2MSY A;  2WAQ N;  3IH4 A;  2K9N A;  2L9R A;  3PM1 A;  1FIP A;  4X1E A;  3S16 J;  3HOX J;  1MBG A;  1GV5 A;  4M3B A;  1FJL A;  1G2H A;  1ZGW A;  2IEK A;  2NOG A;  2H1K A;  2LLK A;  1AKH A;  3OOU A;  3ZQF A;  1OJL A;  2DA7 A;  5IYC J;  3A01 A;  3GTQ J;  5FLV A;  3S1M J;  3HOZ J;  3BQY A;  1F36 A;  3TP3 A;  3L1P A;  4A3M J;  3TED A;  2MGQ A;  4V2F A;  3G1M A;  3NAU A;  5E3O A;  1HF0 A;  5J3L A;  4LOC A;  4JX5 A;  2JMW A;  1HCR A;  2DA5 A;  1ETO A;  1XS9 A;  2CJJ A;  2DN0 A;  1U8B A;  1TWC J;  2X48 A;  1ZK8 A;  2CQQ A;  3MKL A;  3ZQH A;  3JRI A;  2ELK A;  4CYC A;  3JR9 A;  1SAN A;  1X2N A;  2EH3 A;  1ZKG A;  4D7M A;  3S1R J;  2XPU A;  4HNV A;  4DCK A;  2L0K A;  4I76 A;  3GTG J;  3HBL A;  5IPA A;  4M3E A;  4J19 A;  1A5J A;  1LFB A;  2WB1 N;  1B72 B;  4DYR A;  1HLV A;  1JKQ C;  2R5Z B;  5FKN A;  2ME6 A;  2CRG A;  2DA6 A;  2LTP A;  1CQT A;  2R5Y A;  3A02 A;  3ZQC A;  1TC3 C;  5M5Y J;  4MO7 A;  2Y0S N;  2HOS A;  3RZD J;  3GTK J;  1XG1 A;  1BA5 A;  5EG0 B;  2KDZ A;  2NS8 A;  1AKH B;  2LY9 A;  1ETW A;  1D5Y A;  3A01 B;  3FKI J;  4W1U A;  5FKO A;  4JQ0 D;  2EZK A;  3GBG A;  3S14 J;  1UHS A;  1QVU A;  1T33 A;  1UMQ A;  1GDT A;  2HI3 A;  2XGD A;  3LSJ A;  4Y52 J;  4D7N A;  2FX0 A;  3LSG A;  4M6V A;  4QSH A;  1SFO J;  1YRN A;  3WHB A;  3HGG A;  1ETX A;  1W0U A;  1MBF A;  5IOY A;  3GTL J;  4DZJ A;  5IYD J;  1WH5 A;  2FQ4 A;  4A93 J;  3LSR A;  4IEJ A;  1FIA A;  2DA3 A;  4CYC B;  3Q0W A;  3BQZ A;  4ABZ A;  1VND A;  1UG2 A;  2O8K A;  2HOT A;  1GV2 A;  4A69 C;  2LVS A;  1E3O C;  4BBR J;  3M4O J;  1BW5 A;  5C4X J;  4DW6 A;  3ZQL A;  1ZR4 A;  1GVD A;  4JX6 A;  3G1O A;  2DTZ A;  1MBK A;  2ECC A;  2O7O A;  2WV1 A;  1IDZ A;  4RDU A;  3WHC A;  2R5Y B;  1IG7 A;  2KT0 A;  1ETV A;  3BTC A;  1TWA J;  5EEA A;  3Q0U A;  3RQI A;  4FTH A;  1IV6 A;  5M3M J;  2XB5 A;  2LK2 A;  1QRY A;  2LD5 A;  1P7I A;  5IOZ A;  4JYK A;  2MG4 A;  5IP7 J;  2EBI A;  2DMU A;  2JWT A;  1MBJ A;  2GM4 A;  3JRD A;  1NK2 P;  4MLO A;  4JP0 A;  1HDP A;  3BG3 A;  5J1U A;  5FKL A;  1OCP A;  3S1N J;  1ETQ A;  2VUM J;  2DJN A;  1HOM A;  3BR1 A;  1JGG A;  2H8R A;  2X6O A;  3O8H A;  2D5V A;  1MH3 A;  1APL C;  2XRL A;  4A3J J;  3HOU J;  2CUE A;  3IH2 A;  2XPW A;  4D5C A;  1U78 A;  4GFB A;  2TCT A;  1HDD C;  2VI6 A;  4C3J J;  4A3E J;  1JJ8 C;  1IC8 A;  2LP0 A;  4M3D A;  3UKG A;  1B8I A;  3GTP J;  2IAI A;  4D5F A;  2JK3 A;  1BW6 A;  5F0H A;  9ANT A;  1I50 J;  4IHY A;  1DU6 A;  4V2G A;  5IP6 A;  1OFC X;  1R9T J;  3M3Y J;  2HXO A;  5FKM A;  1WI3 A;  1AU7 A;  2DA1 A;  3O8G A;  1MH4 A;  3OIO A;  2M9H A;  2GBY A;  1PUF A;  5FLM J;  3TW7 A;  3B6C A;  3HEF A;  4DYC A;  3TW6 A;  3HB9 A;  4B4C A;  2VKE A;  3HGY A;  1W0T A;  4XRS A;  5FJ8 J;  2NVY J;  1O4X A;  2JN6 A;  1JJ6 C;  3GTJ J;  4BY1 J;  2M2E A;  1WH7 A;  4Y7N J;  2NS7 A;  5IYB J;  4UUS A;  5GPC A;  5EYR A;  3RKQ A;  3S17 J;  4A3G J;  5EGO A;  2ID6 A;  1QVT A;  1MNM C;  3PO2 J;  4XRS G;  2L7F P;  2LR8 A;  4AUX A;  3FIW A;  2AO9 A;  3D1N I;  2HOA A;  4A3L J;  2O9L A;  3GTM J;  1ZQ3 P;  3JRC A;  4I6Z A;  3CMY A;  2Y9Y A;  2N8G A;  1JTX A;  4OVN F;  3BTL A;  2M0C A;  1FEX A;  1VF9 A;  5GPA A;  2QCO A;  2NVQ J;  3ZQI A;  3GTO J;  3BG5 A;  2GLO A;  3BR6 A;  5J1Y A;  2E1O A;  2W48 A;  4BXX J;  1ITY A;  4S0H B;  1B8I B;  3HKZ N;  4A3K J;  4FE4 A;  3I4M J;  4XID A;  4C3H J;  4X6A J;  2XGC A;  2RAE A;  3QQA A;  2COB A;  3IH3 A;  2R93 J;  1JUP A;  3S15 J;  5C3E J;  3I4N J;  1PUF B;  2CU7 A;  1GUU A;  2LKX A;  5C4J J;  2K9S A;  4FCY A;  1POG A;  1RR7 A;  2XSD C;  3FK7 A;  5DTD A;  4RBO A;  3S2D J;  1Z0X A;  1ZR2 A;  2EZI A;  1P7J A;  1Z77 A;  1RKT A;  2DA2 A;  2L7M P;  5IP9 J;  1MBH A;  4UUS B;  1JKP C;  1H8A C;  2Y2Z A;  3QPS A;  2XGE A;  1I6H J;  4B3A A;  2EQR A;  3BT9 A;  1MSF C;  4A3C J;  5FKK A;  3BR2 A;  5K7F A;  2R7Z J;  1GT0 C;  3C2B A;  4BBS J;  4AYB N;  3K7A J;  2YU9 J;  4BKX A;  1WCM J;  4DYQ A;  3LNQ A;  3BR3 A;  2YUS A;  3E7L A;  2AHQ A;  5K7Z A;  3IV5 A;  4MFE A;  4NDL A;  1TWG J;  1Q1V A;  3JRH A;  1RPW A;  4A3F J;  3HOY J;  3H0G J;  1X2M A;  4UUT A;  3BG9 A;  3B6A A;  2E2H J;  1YRN B;  1EF4 A;  2M8G X;  1RET A;  2R5Z A;  2YS9 A;  2VKV A;  2XPV A;  1ORK A;  1XC5 A;  1TWH J;  2DMP A;  1LE8 A;  5E3N A;  1BJZ A;  2Y31 A;  1VFC A;  2JJ7 A;  1K83 J;  5F08 A;  3Q3S A;  2ECB A;  5DS9 A;  4W97 A;  1IUF A;  5E3L A;  1U9O A;  4IHX A;  1RKW A;  5EG0 A;  1ETY A;  1OCT C;  2DMN A;  4B1R A;  2E2I J;  5C44 J;  1T56 A;  4L5E A;  2R0Q C;  3HM5 A;  2Y9Z A;  3HDD A;  2IBD A;  5EF6 A;  4JPZ B;  3BTJ A;  3Q0V A;  3DEW A;  5J1R A;  3JRB A;  2JA5 J;  1Y1W J;  1H89 C;  2JA8 J;  3OSG A;  5JLW A;  1FTZ A;  4FIS A;  4XRM A;  5M5X J;  3JRG A;  4C2M J;  4AC0 A;  3SJM A;  4M3G A;  1JT0 A;  2DMT A;  2ZB9 A;  1AHD P;  5E3M A;  5HOD A;  1F43 A;  5F04 A;  2VPR A;  3SDG A;  2JA6 J;  4EEF G;  4QIW N;  2NVX J;  5JLX A;  2JA7 J;  4C3I J;  1JKO C;  1IGN A;  1FTT A;  1JKR C;  2ME0 A;  3QPL A;  1TWF J;  1ZTR A;  2DMQ A;  4MFD A;  3K2A A;  1I3Q J;  3MVP A;  2DA4 A;  3HOW J;  1VI0 A;  2OF7 A;  2P81 A;  3S2H J;  2X9D A;  2PMZ N;  1MBE A;  2K40 A;  4BY7 J;  1LE8 B;  2FJ1 A;  3LSP A;  2TRT A;  1WGX A;  5EDN A;  5EZH A;  2XB0 X;  2I10 A;  3BR0 A;  3CQZ J;  3DCF A;  5F1J A;  2HQ5 A;  3W6V A;  4FE7 A;  1ETK A;  3RZO J;  3SFI A;  2Y30 A;  3NAR A;  4M3F A;  1NK3 P;  1IJW C;  2R92 J;  2G0E A;  5M5W J;  1NTC A;  2LFB A;  4JX4 A;  2CUF A;  1X58 A;  1JUS A;  4IHV A;  4A3I J;  2MW8 A;  2HXI A;  2NVT J;  2FD5 A;  3HOV J;  2HDD A;  4A3B J;  1JT6 A;  3G1L A;  4XIC A;  4QTR A;  3JRE A;  1H88 C;  1JTY A;  2K9Q A;  1QPI A;  1IRZ A;  4XK4 A;  1RES A;  1JUM A;  1LFU P;  2B63 J;  3ZOB A;  3LOC A;  3A03 A;  3ZQG A;  5M3F J;  2E19 A;  2E2J J;  3S1Q J;  3JRF A;  1K61 A;  5EGO B; 
#chains in the Genus database with same CATH topology
 3N05 A;  3FIS A;  4Y17 A;  2BEO A;  2OPT A;  1MSE C;  3H3V K;  4G12 A;  2EA2 A;  3PP5 A;  3AE4 C;  1QNT A;  3H1C A;  3VPR A;  2HPC A;  3ABT A;  2G7U A;  1KU9 A;  2HQA A;  4A3D J;  1OCO H;  5K7H A;  1WDM A;  3IKV A;  5BOX A;  4JBZ A;  2FFD B;  2M87 A;  4OIQ F;  4L73 A;  1RF0 A;  1U5T B;  3CDL A;  1ZLK A;  2PFB A;  2XSJ C;  2FRH A;  2VC1 A;  4ZDO A;  5KLV D;  3A0B C;  3OYI A;  2V1U A;  3IAS 2;  1ZRT E;  5J4Y A;  3Q5S A;  3U1A A;  3FK6 A;  3WTW C;  3SDB A;  1Q1H A;  1K4S A;  4PV1 C;  1M1E B;  2EZL A;  1WPK A;  2M34 A;  3I71 A;  3MN2 A;  4U3F E;  3BCC J;  1VQ5 P;  1EZV G;  2EZH A;  1K9M Q;  2UUZ A;  3DBR B;  5AVU B;  1NTK D;  3BRO A;  1O7F A;  4IHW A;  2F5V A;  2LKS A;  3EUA A;  5D5X B;  5AW8 B;  4OM8 A;  2QJK C;  2DT5 A;  3FXD A;  2N1T D;  2CH0 A;  3K5B A;  1IW7 F;  3F0C A;  4NQW B;  3COA C;  1IF1 A;  1LB2 A;  3IH4 A;  1NU1 J;  2K9N A;  1Z6T A;  2L9R A;  2EIK H;  1FIP A;  4X1E A;  3J7Y J;  4RAY A;  1H9T A;  5AVY B;  3KP4 A;  4IFF A;  3PQJ A;  1PP9 D;  2VKD A;  4OH8 B;  3E6M A;  2IX7 C;  1S2E A;  3AE5 C;  1NWQ A;  1KQS O;  2ELJ A;  3ZN1 A;  2IZ1 A;  2JRT A;  1ZGW A;  2NOG A;  5DJT B;  2EFN A;  2LLK A;  4IF4 A;  3WFI A;  3OOU A;  1KOR A;  1M57 D;  5F64 A;  3JAM K;  3HZJ A;  2LF7 A;  2ZT9 B;  3OS2 A;  2I76 A;  1NTM J;  1RQU A;  2PI0 A;  3HOZ J;  2P0W A;  3EYY A;  4P5O A;  1SQX K;  1W7P D;  5FRM A;  1KFM A;  2MH2 A;  1URQ C;  3FXK A;  3G1M A;  5E3O A;  1KC8 Q;  4MEX F;  2H89 C;  1FZG A;  1PIX A;  2YKQ A;  3K10 A;  5LRR A;  4KA4 A;  2M30 A;  2KNC B;  2K4B A;  2M5A B;  4RGU A;  1LTJ B;  4I2O A;  3AG2 H;  1AA0 A;  2Y0M A;  2LKM A;  1ODD A;  1HQC A;  3ZPL A;  5FFX A;  1ETO A;  2LRE A;  3CP2 A;  3OYN A;  2V1N A;  1K79 A;  1LTI C;  4PGG A;  3SWY A;  3BPV A;  4GDO A;  3GLX A;  1R5S A;  4HX7 A;  1JEK A;  3MFK A;  1GW3 A;  2Q6Q A;  2FNA A;  3MKL A;  4WXD A;  2ZJQ F;  2VJ4 A;  4CYC A;  1ZRD A;  2OZU A;  1X2N A;  1BCC J;  5LRS A;  2RRE A;  3BWG A;  3TO6 A;  2AS5 F;  2P4Q A;  1ZKG A;  3H5A A;  1KGS A;  3M8J A;  1YX3 A;  3OL3 A;  4XE5 B;  1HBX G;  3ABL H;  3VMZ A;  4PSX A;  1O3S A;  4NC6 A;  1T6A A;  1D1B A;  5AVW B;  4A0Y A;  3CCM P;  1L0N D;  5AIQ A;  3CX5 I;  1U57 A;  1LFB A;  2L9N A;  1MND A;  4DIQ A;  1JY3 P;  2NRG A;  2WSF J;  2WSC J;  2R4G A;  4WF2 A;  1JKQ C;  2F6C A;  5FKN A;  5BPI A;  4E12 A;  3TDZ C;  2CRG A;  3AEC C;  3H1I J;  5E1W A;  1SFX A;  2OYH C;  3CWB G;  1FYL A;  1KIL A;  3CCE P;  2WAE A;  2E5Y A;  2WIT A;  3F23 A;  3Q2Y A;  1N73 C;  4J0E A;  3L72 E;  3FKJ A;  3L7W A;  1R4M B;  2Z5H A;  5ED4 A;  4DOZ A;  2HYG D;  3PLN A;  3J7A Y;  1JTH B;  4YTP C;  1SMY F;  3BG7 A;  2G7H A;  2BY3 A;  1OMI A;  2CW7 A;  2KIF A;  4ZZD A;  3UIA A;  2N9Y B;  1UII A;  1R71 A;  3A01 B;  4PCQ A;  3MKZ A;  4IL6 C;  5E20 A;  3CCV I;  4PJ0 C;  3HD7 C;  2ADU A;  2O3J A;  1PDN C;  3CDH A;  1EV7 A;  2FOK A;  2FYZ A;  3JCU C;  4E13 A;  4IRI A;  2VBY A;  1A35 A;  3G9R A;  1F0Y A;  3TOA A;  3Q5R A;  2M45 A;  3MCZ A;  4M9S A;  1SFO J;  1AQT A;  1KON A;  3H5N A;  3SWK A;  5E79 C;  3M9H A;  3H1J E;  1N7S A;  3L2V A;  5JHF A;  1FBQ A;  3FM5 A;  4A7P A;  4F3Q A;  1YLF A;  4KIG A;  4D3F A;  2B9S A;  4IEJ A;  5E17 F;  5GTH C;  3Q0W A;  3CF2 A;  2OAR A;  1VND A;  1UG2 A;  2DI3 A;  4YFX F;  2O8K A;  2WVR A;  2HQR A;  4XLP F;  1SQV G;  2O01 N;  2E43 A;  2O8X A;  2JPB A;  3KP5 A;  2OU2 A;  1WJB A;  4DW6 A;  3WTY C;  3ZQL A;  1ZR4 A;  1GVD A;  4F93 B;  1WDL A;  4YEJ A;  3A5T A;  1MNE A;  3DU6 A;  5L3F A;  2FYU J;  2AQF A;  3G1O A;  2DTZ A;  1MBK A;  2O7O A;  3ZGY A;  4XR6 A;  5JFR A;  1HST A;  1P4A A;  2P4W A;  2FKW B;  3L70 G;  5FGM A;  3AE3 C;  2R5Y B;  2IA1 A;  3P9K A;  1BBY A;  1VQM P;  1R5G A;  1X4P A;  1M1J C;  1Y56 A;  2RH0 A;  1SFC C;  4UNO A;  3NWS A;  3TQN A;  2YPR A;  3WFJ A;  2LOO A;  2K9Y A;  1DEB A;  3PQK A;  2NPS C;  1L4A B;  2X1E A;  2K4J A;  2XB5 A;  1HJ0 A;  2HQN A;  5A9T A;  1P7I A;  2EV0 A;  3CLQ A;  4DZO A;  5KAI C;  4B48 A;  2L4A A;  3Q3C A;  3WTU C;  1VPD A;  4FHT A;  1Z67 A;  3I64 A;  4YEL A;  2QSG X;  4G94 A;  2EWN A;  1X1B A;  5DCM A;  4CSW A;  2GM4 A;  2QJP B;  3ASO H;  2QQA A;  1SQB J;  2FBW C;  4E7I A;  1IFJ A;  3BG3 A;  3FM3 A;  5J1U A;  5IT3 A;  2ZCW A;  1YTZ I;  3QWO C;  1OCP A;  3S1N J;  1FDM A;  1I1S A;  1HOM A;  3BVH A;  3TGU G;  1SVM A;  2D5V A;  1SQQ K;  2W8Z A;  3L73 G;  3CCR P;  4S05 A;  1G3W A;  1R6R A;  2F5F A;  1OYW A;  2O3F A;  1APL C;  2Y0C A;  1N73 B;  1OVU A;  1KYZ A;  2WB1 A;  4JBA A;  3WUV A;  3NMD A;  4R1N A;  2HYF A;  1GL2 D;  3IH2 A;  3E6C C;  1VF5 B;  1ZHF A;  1J09 A;  4GFB A;  2F4O B;  3S4R A;  1ON1 A;  4DQ2 A;  1CF7 B;  3G17 A;  2Q3I A;  2VON A;  2WTB A;  2KJC A;  1JJ8 C;  2CWE A;  3T1B A;  3TKY A;  3N4X A;  5APX A;  1SFU A;  3GTP J;  2IAI A;  3C3W A;  4XKV A;  1EKE A;  3IRR A;  3T5X A;  1RE3 C;  1NJI Q;  2VB6 A;  3NTN A;  3BCA A;  5F0H A;  1Z21 A;  5HVQ C;  2G8Y A;  3V4G A;  1VQK I;  2P2U A;  4V2G A;  1YTY A;  5IP6 A;  5C39 A;  2HVR A;  2COM A;  3MZH A;  2O1J A;  1FZC A;  1R9T J;  4UV8 A;  3M3Y J;  2HXO A;  5FKM A;  1ZW0 A;  1X8Y A;  3M07 A;  1U7M A;  1ZRT D;  1P84 E;  3O8G A;  1PUF A;  2OYO A;  2GA2 A;  3DTE A;  3TW7 A;  3B6C A;  1F1Z A;  2IGM A;  1W5T A;  3MZW B;  3EUH A;  2LBF A;  1M67 A;  1HKS A;  3SFZ A;  3WU0 A;  3HDH A;  3AEF C;  1S5L X;  4B4C A;  2VKE A;  2ZXI A;  3HGY A;  4ZYD A;  2F2E A;  4XRS A;  3AE1 C;  3EET A;  5M1B A;  3BCC G;  3CLO A;  1C0W A;  2QSI A;  3F89 A;  2IP2 A;  2YIU B;  4Y7N J;  3ABV C;  1OLT A;  2RDP A;  1BI3 A;  2FQ3 A;  2DQL A;  4HF0 A;  4UUS A;  3EQL F;  2P5V A;  1S9H A;  2YKO A;  3K4N A;  3OYA A;  3C7D B;  2PP6 A;  5EGO A;  2A06 G;  1MNM C;  3G2B A;  2EK5 A;  4LD5 A;  1YIJ I;  1U2W A;  1NU1 G;  2RQQ A;  4EI2 A;  1HSJ A;  3FIW A;  5D5W B;  4OMY A;  3SQN A;  1DIP A;  3HRS A;  1ZLL A;  2D2C B;  1DP3 A;  2AXT C;  3JRC A;  4I6Z A;  3SYT A;  2OTL I;  5KLI B;  1JTX A;  1QGP A;  1V5E A;  2Z5U A;  2XAF A;  3QOP A;  3QU6 A;  4V19 K;  1VQO I;  4XM3 A;  5CVV A;  2O1K A;  4NPE A;  3LFK A;  1GU4 A;  3W2A A;  3DWL E;  1IFN A;  3F8C A;  3QOE A;  1NTM G;  3AEG C;  3J81 K;  2RGV A;  3GTO J;  2WSE J;  2N1T C;  3F8B A;  4L75 A;  1HW1 A;  3DEE A;  3JTG A;  1NG7 A;  4DYD A;  1YJ8 A;  2L5G B;  4BHP A;  2M7A A;  5KAF C;  1IFI A;  1ITY A;  1LVA A;  3O6Q A;  1UJ8 A;  3OY9 A;  2JP3 A;  2QSF X;  3IQD B;  3CC7 I;  4UHT A;  2W57 A;  1YJ9 P;  2WC2 A;  4BS9 A;  2KOG A;  2JSC A;  1D5V A;  1Z56 A;  4A2U A;  1U3E M;  3WU2 E;  1J7K A;  4X6A J;  1BSN A;  2ZFC A;  3EFG A;  2RAE A;  3QQA A;  4E21 A;  3S15 J;  2R93 J;  1OKR A;  1K6O A;  1VQ9 I;  2R3S A;  4CCN A;  5C3E J;  3I4N J;  2AEJ A;  1W5S A;  2EFW A;  2B0L A;  2LKX A;  1BCC G;  2X1C A;  4HOB A;  4LIU A;  4UB6 E;  3FXM A;  4KT6 A;  1Z05 A;  4FCY A;  4Z6Y A;  1POG A;  5LGU A;  3KET A;  1PV3 A;  1SQP K;  4EJO A;  2JQ7 A;  2MD0 A;  2UWJ E;  3JSV C;  2RN7 A;  1KB9 I;  3S2D J;  1M2W A;  2W83 C;  3WU2 H;  1XGM A;  2D1V A;  3W6J B;  1IXR C;  2EZI A;  3WTV C;  1P7J A;  3RL0 D;  5JHU A;  1IRF A;  1MBH A;  2EFQ A;  3TGN A;  2XAU A;  1HUC A;  1KIL B;  1SVF A;  2JR8 A;  2Y2Z A;  3H1I G;  1IL0 A;  1Q90 D;  2Q1Z B;  3V8J A;  3L72 D;  3SFD C;  2HVQ A;  3QPS A;  4UB6 H;  1R1T A;  1BOB A;  3JAM Z;  2N9B A;  3TYY A;  3KCC A;  4GCV A;  4G7H F;  5D6E A;  5FKK A;  3H1K J;  3VFZ A;  1RE4 A;  4AYB N;  5A2Q K;  2H09 A;  1VQ7 I;  3CTV A;  2JRM A;  3CCQ P;  3PFI A;  4DYQ A;  1LDD A;  3E7L A;  3ZMU A;  2CW0 F;  1JY3 N;  2LR2 A;  3ISP A;  4HBL A;  4GOE A;  1IJD B;  1R22 A;  3BPX A;  5LEK A;  3OYH A;  1N1G A;  5AVX B;  3F22 A;  1BGY D;  2NZ2 A;  3PIO F;  2B9B A;  5D6F A;  1RPW A;  1X2M A;  2Z16 A;  4XOT A;  1SD6 A;  3B6A A;  3LID A;  2VL8 A;  5HDK A;  1MDM B;  3H1J D;  1N7S B;  2A45 G;  1XC5 A;  3L2U A;  1FDI A;  1DP7 P;  3BY6 A;  1DX7 A;  4ENK A;  2HFE D;  5B3S H;  1N8R Q;  1VQK P;  3B5N A;  1JGS A;  1WJF A;  3IP4 B;  1NTZ E;  1AV1 A;  3GHG C;  3KXD A;  2W1O A;  1VFC A;  2JJ7 A;  4WVZ A;  3U9G A;  4EJV A;  5D5U B;  1IRX A;  1LJ2 A;  3MWM A;  1VQP I;  4FX0 A;  3E5X A;  2A61 A;  4H0L D;  1RUN A;  2OQG A;  3S9O A;  3M0D C;  5ILU A;  2DMN A;  2HKX A;  4B1R A;  2E2I J;  1FBU A;  4L5E A;  2N1T B;  3HM5 A;  1K78 B;  3ZMV A;  1WWX A;  1VQ4 P;  3OWT A;  3Q0V A;  3CJR B;  3DEW A;  4KIT B;  3QPH A;  1V4R A;  4A0Z A;  5J1R A;  2A69 F;  4RLQ A;  3H9G A;  3OYL A;  3OSG A;  2OGU A;  2L54 A;  2QJY C;  5BVZ A;  2FYU G;  4Q4Z F;  2BBY A;  3CTA A;  2VT2 A;  2ACJ A;  1A36 A;  1FTZ A;  1E17 A;  2B89 A;  2WWW A;  2E36 A;  4PJJ A;  2VPL A;  4GDF A;  3GW6 A;  4N78 D;  4EGY A;  3T0Y A;  2DMT A;  2CUZ A;  2ZB9 A;  1AHD P;  2YO3 A;  3VP9 A;  2VPR A;  3Q3D A;  4EEF G;  1FP2 A;  4HSR A;  3CCL I;  2P7V B;  1XSV A;  2FBK A;  4LJZ F;  1U8R A;  3C1L A;  5APW A;  1L0L E;  2NNY A;  4QIW N;  3RPU A;  4F7Z A;  1R1U A;  2NVX J;  1RC9 A;  1PPJ E;  4PV1 D;  1Q7Y Q;  1K4T A;  4C3I J;  4QPQ A;  4ZZL A;  3CJN A;  1IGN A;  1D8J A;  1GHC A;  1XSD A;  2WZ7 A;  3O8Z A;  2HTS A;  2A5W A;  1ZAO A;  2G9W A;  2VJJ A;  1VQO P;  1OCZ H;  1UB9 A;  3HRU A;  4KIF A;  2R7S A;  1MMN A;  3T8R A;  1OCC H;  2HPM A;  5KLV J;  4XNF A;  2Q5U A;  1Q82 Q;  3GZ6 A;  1WI9 A;  3AFH A;  3HTU A;  1YIO A;  2E76 B;  4CDG A;  3C9I A;  3H6P A;  2PGD A;  2DA4 A;  3IF4 A;  4HKZ H;  3DKX A;  4EVI A;  4NBQ A;  3HOW J;  1BI2 A;  3VMA A;  3CX5 E;  1NTK J;  4Y28 J;  1I39 A;  4LLG F;  5JVT A;  2DW3 A;  2XAS A;  1U5T A;  3QRF F;  2H8P D;  3FR7 A;  2C9L Y;  3S2H J;  2OV7 A;  2VOD A;  1B4A A;  4WWC A;  2GQQ A;  1OXZ A;  3LIE A;  1XCB A;  1VZ0 A;  2X4H A;  4KN4 X;  5CVI A;  3IRQ A;  5APV A;  2W00 A;  2TRT A;  1FMW A;  3HG9 A;  3DBH B;  3WE3 A;  2VOO A;  2XB0 X;  2BEZ F;  5CYV A;  2J58 A;  2R32 A;  1VQ9 P;  4DJG A;  2QKM B;  4KIS A;  4KUE A;  1PP9 J;  2BXZ A;  3SFI A;  5DEQ A;  3W6Z A;  3MKW B;  3CX5 H;  1XB4 A;  3KHU A;  3NEU A;  3L00 A;  1JB0 J;  3A4C A;  4HX4 A;  3M1E A;  1QZY A;  2RV8 A;  4JX4 A;  2C9N Y;  2LRD A;  2MLK A;  2R7D A;  1OR7 A;  2JUG A;  3G0O A;  3LWF A;  3U1K A;  3OYF A;  2MW8 A;  3R4Y A;  2HDD A;  2ZXH A;  1JT6 A;  1LSO A;  2HLO A;  3I3L A;  2OBP A;  3R0A A;  4K3A A;  3JRE A;  2LBF B;  1JTY A;  3G73 A;  3K1M A;  2WPS A;  5CQG A;  1S1C X;  2YR2 A;  2ZO4 A;  1YE9 A;  2KLV A;  3K6J A;  4HEA 2;  2WMM A;  1YOV B;  2L5Q A;  1I5Z A;  1LSJ A;  1AQ5 A;  2E7W A;  3ZQG A;  1DGW Y;  1ZG5 A;  3S1Q J;  2K02 A;  4GOF A;  2BAS A;  1K61 A;  2KNC A;  4MN4 C;  1W5C E;  5EGO B;  2R7V A;  2A45 I;  2M5A A;  2E5N A;  2VBZ A;  3FDY A;  3ERE D;  5KK1 A;  2HVS A;  1LTJ A;  3IAO A;  4PD4 I;  2M4K A;  2GXA A;  3VP8 A;  2ESN A;  3GVA A;  1KU7 A;  2ID3 A;  2VC0 A;  3MAJ A;  4M74 A;  4BL0 B;  4AWX B;  4YIF A;  1DU0 A;  1NTZ K;  1X4O A;  5F27 A;  2HZD A;  2ZYG A;  1RY3 A;  1RF1 A;  1T8Z A;  1Y1V J;  2ESH A;  2LY1 A;  3WGI A;  3OYD A;  1L0N J;  1Y8R B;  4L5J A;  1QL2 A;  1PZQ A;  3OYE A;  3A2K A;  1B59 A;  3T97 B;  3P9C A;  2EFO A;  2VBW A;  4BE1 A;  3D6Z A;  3F72 A;  4Y99 B;  2XGX A;  4UVB A;  1VQ6 P;  2L02 A;  3CDI A;  2KB7 P;  3HIF A;  2P8T A;  3TP0 A;  3GFM A;  4HQE A;  2OTK E;  4QWQ A;  3O6Q B;  1X1D A;  3O6B B;  1SAX A;  3BR5 A;  4IHS A;  3HD7 D;  5CJ4 A;  1UZC A;  4MIM A;  1XTC C;  6PAX A;  2IS4 A;  1Y9B A;  4WY4 D;  3HWR A;  5K1Y A;  2L01 A;  4FGW A;  1BL0 A;  1D8K A;  3VEP A;  2KQR A;  4BQA A;  1AOY A;  2M0B A;  1EDJ A;  3FBN B;  1MMG A;  4U87 A;  3B73 A;  1W2E A;  5APT A;  3GF2 A;  5GAG J;  5A9S A;  2OFP A;  4RM2 A;  1VQ5 I;  4MQ9 F;  4DOJ A;  2DYS H;  5DM6 F;  1Z82 A;  4PZD A;  3I59 B;  4M3B A;  1G2H A;  3LSI A;  3RK3 B;  2IEK A;  1GXP A;  2H1K A;  4BAC A;  1QLE D;  2OZ6 A;  2XZR A;  4XMY A;  3ZQF A;  2HOE A;  1KYO I;  1ERD A;  3A01 A;  1TQP A;  5FLV A;  1VDF A;  4CXF A;  3S1M J;  4XLA A;  3BQY A;  4F91 B;  1F36 A;  5L8R J;  2UXN A;  2A6T A;  2XRN A;  2YX7 A;  3PJR A;  1WJ5 A;  4G6T B;  3AE2 C;  1HF0 A;  2ZKZ A;  4N0B A;  3S3M A;  5CCG C;  1BR4 A;  2IVM A;  2VT3 A;  1LWU C;  1MMD A;  2KXP B;  2M3E A;  4JX5 A;  3H25 A;  2JMW A;  4NNJ A;  4FQG A;  5H6R A;  3MUD C;  2VRS A;  1QX8 A;  3F6O A;  3WGH A;  5GTI E;  1CW5 A;  1HKQ A;  1X3Z B;  2HR3 A;  3HPG A;  1KD1 Q;  3NFQ A;  1Y8Q B;  1U8B A;  3H1K G;  4EJW A;  1TWC J;  3K1P A;  1R36 A;  3P8M C;  1ZK8 A;  2CQQ A;  5CCH D;  1GL2 B;  3L2W A;  3JRI A;  3HUS C;  4PGH A;  1GZL A;  5GAE J;  2RMZ A;  3JR9 A;  4L9T A;  1SVL A;  2LSO A;  3LQQ A;  3AEA C;  1IXS B;  1OWA A;  2UWM A;  5HLT A;  2P58 A;  2XPU A;  1URQ A;  1PL5 A;  1SQX E;  3C2H A;  2RC4 A;  1J75 A;  5GTI H;  5CPR B;  3M9A A;  3RL0 C;  4M3E A;  4II2 A;  2WB1 N;  1B72 B;  1J1D C;  1HLV A;  3AAF A;  1Y0N A;  4UVC A;  2X6X A;  1BDC A;  2OA4 A;  3I54 A;  3GF7 A;  2VQG A;  1KQ0 A;  2R7X A;  1Q86 Q;  1BIA A;  1MJ9 A;  1ZGJ A;  2R5Y A;  1O3Q A;  3C7C B;  1ZN5 A;  2GF2 A;  1OW7 A;  1NTZ D;  2DAO A;  3ZQ7 A;  2R7U A;  3F8M A;  3P9I A;  4RB2 C;  4RJT A;  3E1I A;  3M91 A;  2HOS A;  1F9N A;  1X1C A;  4YXD C;  3WTT C;  4ENN A;  2GAU A;  1LGH B;  2W6B A;  2Q8K A;  1HH0 A;  4BU2 A;  3OYM A;  1QHH D;  1AKH B;  5D5V B;  2M0M A;  3N7N A;  3OYK A;  1ETW A;  2E35 A;  1HA8 A;  4JQ0 D;  3TO7 A;  4U7D A;  2DFI A;  4EM1 A;  1UHS A;  4XN3 A;  4OL9 A;  3FHZ A;  1X1P A;  5KTB A;  3AL0 C;  2CQN A;  1UMQ A;  3IAM 2;  1QZE A;  3FBI B;  5L3C A;  3QHA A;  4TV7 A;  1ZEL A;  3TMO A;  5ICC A;  2KIQ A;  1Z3Y A;  2KLU A;  3GLM A;  2FX0 A;  3L70 E;  2HTJ A;  3LSG A;  1UAA A;  1IRG A;  1N73 A;  3L74 D;  3M9B A;  4RGS A;  1W0U A;  1H9G A;  2J5U A;  1MBF A;  1L0L D;  1HKT A;  1EDK A;  1K8A Q;  1XGO A;  3CD6 I;  4OGQ B;  2FQ4 A;  2XV5 A;  4NB5 A;  3ZHB A;  1FIA A;  5E8G A;  2V9V A;  1CF7 A;  3DTK A;  2WAQ A;  3BZ6 A;  2ZYD A;  2HOT A;  4A69 C;  2KI7 B;  4BBR J;  2DFH A;  5AW5 B;  3CUQ C;  2X1D A;  1BW5 A;  2OC6 A;  2KIK A;  3KQG A;  4JX6 A;  2MAB A;  3CX5 D;  2LY2 A;  1NHA A;  2P5L C;  5KVR A;  4X0G A;  2WV1 A;  3RJP A;  3MOG A;  3FX3 A;  1KB9 E;  4EDF A;  3SHF A;  3PSI A;  3DF8 A;  1FS0 E;  1NTK G;  2KT0 A;  3K4B A;  4XON A;  1ETV A;  2IRF G;  3MIW A;  1WKM A;  2FE3 A;  3BTC A;  1TWA J;  2E1M C;  2KP6 A;  1LTA C;  5EEA A;  1YJQ A;  3H1L G;  1IV6 A;  3UR3 C;  3P8C D;  2DW4 A;  1T38 A;  3TDK A;  3SZG A;  2LD5 A;  4BWN A;  5IOZ A;  1E0E A;  2P10 A;  1ZLJ A;  4R4M A;  1PP9 G;  1IFP A;  3TNU B;  1KB9 H;  4L9J A;  5D8L B;  1JHH A;  1VQM I;  2P6T A;  3RL0 B;  2FXP A;  1AVY A;  2K85 A;  2QVO A;  3DPU A;  3E5Q A;  1TXG A;  2K3R A;  1RIO H;  3JRD A;  4XOP A;  4MLO A;  2QGU A;  2STW A;  3OYB A;  4JYB A;  2JDI H;  1HDP A;  2JA2 A;  5FKL A;  4I7Z C;  1Y8A A;  4PJL A;  3W68 A;  3OV8 A;  1YJN I;  1M1J A;  3CXH I;  1H0T A;  5KHD A;  2I9P A;  2H8R A;  4O6J A;  4P1W A;  1FU1 A;  3AED C;  3H5R A;  2EIJ H;  4ENJ A;  4BXL A;  4E4H A;  5JE8 A;  5HNF A;  4OIO F;  2NPS A;  2FF4 A;  2BHY A;  2XAH A;  4A3J J;  1O57 A;  3HOU J;  1SLQ A;  4DGW B;  2MKV A;  1AWC A;  3HRM A;  2R44 A;  2CPB A;  2XF6 A;  3Q5F A;  4ESB A;  4RB1 A;  1OPC A;  3ADO A;  3HE5 B;  5ERI A;  4HG2 A;  4Y13 A;  1HDD C;  3BCC E;  3VOE A;  1YJW I;  3FXR A;  4C3J J;  3CCR I;  5BPD A;  4A3E J;  2P7C B;  4TLF A;  1KTM A;  4M3D A;  4AIJ A;  1Q2N A;  3AL0 B;  1GW4 A;  4D5F A;  1BW6 A;  1RF1 B;  3HOT A;  2A06 E;  1I50 J;  2VE9 A;  4IHY A;  1R58 A;  1IFM A;  3FWE A;  3V2Q A;  1W4M A;  2K3F A;  3CJQ B;  1NU1 E;  2DOA A;  1OFC X;  2OD5 A;  1SQQ E;  4ON0 A;  4H0E A;  2H1L A;  1L0N G;  3W2W A;  3H32 B;  1AU7 A;  4BXU A;  4AU7 A;  3OIO A;  2R3C A;  5K5O A;  3BLY A;  3CZ6 A;  5FLM J;  4H0L B;  1BR2 A;  3HEF A;  3L72 J;  1SQV K;  4PZJ A;  1JMM A;  4GYG A;  2BHZ A;  3HB9 A;  4BE2 A;  5FJ8 J;  5TGT A;  1NTM E;  1JJ6 C;  3GTJ J;  3H1H E;  3I55 I;  3KZY A;  2Z99 A;  4WK8 F;  3KPE A;  5GAH J;  3ZW8 A;  4M9X A;  3CUQ B;  3OL4 A;  1RE3 A;  5IYB J;  1FJK A;  4NPF X;  2FXA A;  1ZG1 A;  3Q1M A;  5HLH A;  3RKQ A;  4ASN A;  5A9S B;  2ID6 A;  1GLN A;  4BQN A;  5BU8 B;  4XRS G;  2L7F P;  2LR8 A;  2KIS A;  4AUX A;  1BGY J;  2FY8 A;  2HPI A;  4G6Q A;  4PV1 B;  2O9L A;  3MTU E;  1E3P A;  1R1V A;  1LUJ B;  4RB0 A;  2O01 H;  2MD5 A;  1XGS A;  5B5E E;  1CI6 B;  1AVO A;  3LQR A;  2RN0 A;  3H1J J;  1SC7 A;  2M0C A;  1G8X A;  2CFX A;  2KL4 A;  2QBY B;  1BCC E;  4ZKU A;  3QSG A;  3CD6 P;  1BE3 D;  2QCO A;  5ICE A;  2ZME C;  3ZQI A;  2EFP A;  1J5Y A;  2QJK B;  4WY4 C;  5KJ7 D;  4ZTJ A;  1PGQ A;  2W6A A;  2GLO A;  2BXY A;  1BM9 A;  1STZ A;  3BR6 A;  2KIU A;  3BAS A;  3WU2 C;  3F5H A;  2V1D A;  3KFW X;  3RPQ A;  2X85 A;  2E1O A;  2W48 A;  4U88 A;  1Z1D A;  4S0H B;  1EH7 A;  4LLH A;  1MDM A;  1B8I B;  4HB1 A;  1VQ8 P;  3E7K A;  5B5E H;  3FHN A;  1YW7 A;  3PUF A;  4I7Z B;  2DFF A;  3H1I E;  4UB6 C;  1EZV I;  2M3B A;  2BCC D;  4HZF A;  3RDI A;  4E70 A;  4C2T A;  3OBB A;  4C3H J;  2XGC A;  3U2R A;  3IH3 A;  3W3C A;  1NKZ B;  2A3S A;  2IS2 A;  1MW7 A;  3EWK A;  1SQX D;  1ZME C;  2CU7 A;  3D5L A;  1URQ B;  4EV0 A;  2WSF H;  4W7Z A;  5C4J J;  1WJA A;  1JY2 P;  1LT9 C;  1YJ9 I;  4HV5 A;  1RR7 A;  2N1T A;  1K78 A;  3D71 A;  3V2R A;  4MNU A;  4PDK A;  2XSD C;  2V9K A;  3MD2 A;  1KQF B;  1SD5 A;  3G71 P;  2Y48 A;  2QIW A;  1JY3 O;  4DLL A;  5KKZ C;  1ZR2 A;  1FZB A;  2XAQ A;  2BY0 A;  5IP9 J;  2CVZ A;  1JKP C;  2GXB A;  5APY A;  1H8A C;  1J2X A;  1I3A A;  5TRD A;  1HGZ A;  3VOP A;  3ZWC A;  3KZI E;  5CCH C;  2WAF A;  3HSF A;  1I6H J;  1IN6 A;  4B3A A;  4A3C J;  3S2W A;  4AD9 A;  4RGX A;  4PD4 E;  2X0L A;  4EAT A;  2R7Z J;  1JO5 A;  1AA7 A;  1V3F A;  4Y33 A;  3V7S A;  4I01 A;  1BIB A;  1CZQ A;  1YJN P;  1W7P A;  1X0X A;  4BKX A;  2WTY A;  5J47 A;  5BMZ A;  4GOD A;  3RSN A;  1V54 H;  2M3A A;  1SQP E;  2JVH A;  4LMY A;  3V4W A;  2WAD A;  1M90 Q;  5J8F A;  1E5W A;  2YX4 A;  1ZG3 A;  1EJ9 A;  5LHH A;  4XLE A;  3OYJ A;  2A45 H;  2OYH B;  1DLI A;  3KEQ A;  1TWG J;  1Q1V A;  2JZY A;  2EIN H;  1YJW P;  1NU1 K;  3I58 A;  3HOY J;  1E2X A;  2F5C A;  3H0G J;  3PID A;  4UUT A;  4DBR A;  4EZB A;  1KMI Z;  1BG6 A;  1WJD A;  2PJR B;  3IUO A;  3CCQ I;  1EF4 A;  2VXZ A;  2UV1 A;  1M66 A;  1KU3 A;  1DD3 A;  2VKV A;  3QYF A;  3CO7 C;  2QM7 A;  1TWH J;  2K7L A;  5J40 A;  1PYV A;  1S6L A;  2KUB A;  3SFE C;  2X51 A;  4DNC A;  1GK4 A;  4IX7 A;  3HUG A;  1NTM K;  5H2F C;  1XDS A;  3BG6 A;  4IFM A;  4WCG A;  4GIF A;  1YB4 A;  4JK1 X;  5EEG A;  3HD7 B;  4H13 D;  5AVQ B;  4XA4 A;  2ZME B;  1RKW A;  5EG0 A;  1ETY A;  1KQL A;  3A7O A;  3QYE A;  3L71 E;  1XMK A;  2E60 A;  2M4G A;  1ZCJ A;  2IBD A;  5EF6 A;  5DV5 A;  3BTJ A;  3BC8 A;  3EFF K;  2UZK A;  4E7J A;  1KYO E;  1S5L E;  1YVE I;  4J01 A;  2AEM A;  2XUB A;  1KB9 D;  1Y1W J;  1H89 C;  3I55 P;  1UCR A;  2ICW G;  1KN7 A;  3E0J B;  3FXQ A;  1JM0 A;  2OJE D;  1IK9 A;  4FIS A;  2WV0 A;  2ELH A;  4XRM A;  3GFL A;  3LSM A;  4M72 A;  5M5X J;  1GU5 A;  4AC0 A;  5HLG A;  4M3G A;  2KJB A;  4U3F D;  1YHQ P;  3DV8 A;  1JT0 A;  1F43 A;  4BYY A;  1OIP A;  1BN5 A;  2DK5 A;  2JA6 J;  4IOI H;  3JSP A;  1VQ4 I;  3WMM 0;  2ZJP F;  4U7B A;  2FYN C;  5TIS E;  1KYO H;  1W36 D;  1S5L H;  4H4K C;  4A6D A;  4CCJ A;  4U0Y A;  3KYL A;  2MYS A;  5JLX A;  2R7F A;  4KN7 X;  3M0D A;  1MZ9 A;  2LH9 A;  1P84 H;  3J80 K;  1N78 A;  2ZVO B;  5TJJ A;  4KFC A;  2Q2E B;  4B3I A;  4ZYH A;  2H6C A;  2UYY A;  3LA7 A;  4D9J A;  2CYY A;  1FPQ A;  1ONV A;  4KUH A;  3V7R A;  5EJC A;  2NXN B;  3H2Z A;  2IFM A;  1TWF J;  4HNT A;  3L09 A;  3WOD F;  2GZW A;  1I3Q J;  1M1J B;  1H0T B;  1SFC B;  3MVP A;  2KPM A;  5TIS H;  4B43 A;  4XBF A;  2E7X A;  3AG3 H;  3ZWB A;  3BZK A;  5HNH A;  2NPS B;  4M3L A;  1USS A;  2JSP A;  3N4M A;  1FOS F;  3QH9 A;  3T97 A;  1U0J A;  3W6K B;  5HS9 A;  4NPD A;  3ROU A;  2R5B A;  1LTS C;  2K40 A;  4L0Z B;  1LE8 B;  1V5F A;  4CZC A;  3ZN0 A;  5EFW B;  2IFN A;  2XU6 A;  2W85 A;  1WGX A;  3RTR A;  4M6X A;  5DUK A;  5EZH A;  5EDN A;  3RK2 C;  3BR0 A;  4LG3 A;  1MZB A;  2DK8 A;  4R8H A;  3AKZ A;  4B3J A;  1RRJ A;  2XAJ A;  2WY7 Q;  5L3E A;  2PQ8 A;  3W6V A;  2Q9I A;  1CSB A;  3K4J A;  3NAR A;  3PUB A;  5CCG D;  2ZXW H;  4MTD A;  2A06 D;  1P2F A;  3AG4 H;  2G0E A;  1MV8 A;  4AIH A;  2OYI C;  5AIP A;  4BQQ A;  3WTX C;  4M73 A;  2ISZ A;  1S7A A;  1YO5 C;  4BXF A;  1SQQ D;  2V7Q J;  2DU9 A;  3HHH A;  2FXO A;  3V4Q A;  3L2C A;  3H3U A;  2YSR A;  4CHU A;  5DYM A;  2FD5 A;  4HST A;  2R7Q A;  1T2K D;  2VLA A;  2E42 A;  5HDN A;  3B8E B;  3I59 A;  3ERM A;  1IN4 A;  1GTW A;  1YQ4 C;  3PFY A;  2IW5 A;  1PGJ A;  4IOC F;  3PTZ A;  4I0A A;  2XKP A;  1H88 C;  2K9Q A;  5CLS A;  1LJ9 A;  1QPI A;  3GWZ A;  2Y0E A;  2CSO A;  1W5C C;  5JVG F;  1OZH A;  1HBW A;  1JUM A;  1UFM A;  4RAF A;  4AID A;  2RVC A;  3BZC A;  1QBJ A;  3FR8 A;  3H1H D;  3L72 G;  1A6Q A;  4IZZ A;  1HW2 A;  2V26 A;  4KJZ A;  3LOC A;  3MMY B;  4XOR A;  1IAW A;  2ZVN B;  4JQF A;  2IGN A;  4CIC A;  2LDU A;  4U7J A;  2FYU K;  2HOD B;  3BJA A;  2Z4E A;  4IL6 X;  5E18 F;  1A04 A;  3BDD A;  1O3T A;  3WS7 A;  3TL4 X;  1T3J A;  1N2D C;  1U9N A;  4DZP A;  2UXX A;  2W7N A;  1SFK A;  3OSF A;  5EZG A;  1PP7 U;  2CV1 A;  1MD0 A;  3OR1 C;  4RGR A;  1ZH5 A;  1KQ9 A;  1EVY A;  1NH4 A;  1OYI A;  1OQY A;  1IXC A;  2FNP A;  1BR1 A;  2DYR H;  2L7Z A;  5GP9 A;  4OIR F;  1BGY G;  1GL2 A;  3K2Z A;  1X79 B;  1MMS A;  4A5N A;  2EV6 A;  3DPL C;  3QP5 A;  3BTI A;  1JE8 A;  2WSE H;  2NRA C;  1XD7 A;  3NXS A;  3A2A A;  3H1J G;  1LTB C;  5F0C A;  4O9B A;  1ACI A;  1EA3 A;  1G3S A;  5E1X A;  2CV2 A;  1I36 A;  1L2P A;  3JRA A;  1P4W A;  1TL8 A;  2E75 D;  3MEX A;  3F8F A;  2EJR A;  1B72 A;  1B6A A;  2DDA A;  3H3Z A;  1DEE G;  1YIT P;  3ELK A;  3M1C A;  4HQM A;  1FSH A;  3ZW9 A;  1SQB K;  3KPH A;  3C7J A;  3VYU B;  4YG2 F;  3PEF A;  1S7E A;  2ZT9 D;  2ZJR F;  3CCU I;  3PO3 J;  1OVV A;  3TOB A;  1EXJ A;  2MSY A;  3C1D A;  1VQ6 I;  2E1N A;  2WAQ N;  1XPX A;  4QPO A;  5CVR A;  3ECH A;  5ILV A;  2AEF A;  3L75 J;  5J6X A;  1M1K Q;  1BC8 C;  3HOX J;  1SP4 A;  3H1K E;  4PFO A;  2BVM A;  1ZOY C;  3K69 A;  1FJL A;  2XDJ A;  4B3X A;  1Y47 A;  1HGV A;  3NRV A;  5GAD J;  3EQ2 A;  2SPZ A;  3CXH E;  1AKH A;  1FZC C;  5AW2 B;  5BU5 A;  1VQL P;  4ETS A;  2DA7 A;  5IYC J;  4ENM A;  3GTQ J;  1FDO A;  2QVA A;  2B87 B;  4XLF A;  3FZV A;  3L74 J;  2PRR A;  3VMX A;  5AW4 B;  3TP3 A;  3BJO A;  5GTI C;  4WX9 A;  3L1P A;  1YBK A;  2MGQ A;  1ULY A;  4MEY F;  5DJU B;  3C2G A;  3NAU A;  5CVU A;  3RYP A;  4NHJ A;  2ZNZ A;  3OYG A;  1G3T A;  4OOI A;  3CME I;  2FML A;  1FZE A;  1EDI A;  3WTZ A;  1LQ1 A;  3KLO A;  4CA0 A;  2GIZ A;  5E1Z B;  1YW9 A;  2W6J H;  2GUV A;  3CXH H;  5FB2 A;  5CBN A;  2IT0 A;  4IM7 A;  1N1E A;  1XS9 A;  1K7A A;  3KP6 A;  2F4M B;  2DN0 A;  3KX2 A;  2A07 F;  1QVF O;  1W7P B;  4K2E A;  2X48 A;  5LD2 C;  4XLH A;  3REO A;  4IHT A;  1WZ2 A;  1SQP D;  4OAZ A;  2Y75 A;  1JY2 N;  2ELK A;  3GCM A;  1SAN A;  2H27 A;  5LEJ A;  3QAH A;  2EH3 A;  4RKU J;  2KKO A;  3K4C A;  3KE2 A;  3E3V A;  4CCM A;  4CYD A;  4I76 A;  3V42 A;  1WDK A;  1YRL A;  3R60 A;  2IYO A;  4G9Y A;  1KIL E;  1SQB G;  3V8K A;  2H7H A;  5IPA A;  1RI7 A;  4J19 A;  2JO1 A;  2P1J A;  1LWU A;  3DLL F;  4DYR A;  4KDP A;  4HAM A;  1RZ4 A;  1UG0 A;  4E7L A;  2AXC A;  3RCO A;  2LTP A;  4IOA F;  5ICG A;  2GIV A;  3A02 A;  5J8C A;  3ZQC A;  1CQT A;  3ADP A;  5EEH A;  5M5Y J;  3OA7 A;  2OAZ A;  4MO7 A;  2Y0S N;  1B1B A;  3HUG B;  5D4R A;  3HUS A;  4YFN F;  4W80 A;  2BY1 A;  4Y4R A;  1K04 A;  4D6T E;  1X19 A;  2BZT A;  5F6F A;  3L71 D;  4BHB A;  5EG0 B;  2KDZ A;  1T8I A;  2NS8 A;  3CKY A;  4HH2 A;  4YPC A;  3ZWA A;  2LY9 A;  3TNU A;  3GXO A;  1D5Y A;  3HYI A;  5FKO A;  1RR8 C;  3K4L A;  1IC2 A;  3GBG A;  1FX7 A;  3S14 J;  4WXC A;  1QVU A;  4HLY A;  1P84 D;  2BOL A;  4YFK F;  4PJN A;  1Y39 A;  4UB8 E;  1ZN2 A;  2LC2 A;  1AFO A;  1T33 A;  2XRO A;  4HV6 A;  2HI3 A;  1JDJ A;  4Y52 J;  4D7N A;  3GHG B;  2QKL B;  3M06 A;  2NYX A;  4N4O B;  4H44 D;  5JI6 A;  3WHB A;  1R23 A;  1ETX A;  3HGG A;  3LST A;  1NTK E;  4RS8 A;  4XKW A;  1ZXG A;  3GG2 A;  2RNG A;  2K37 A;  3QWL A;  3MD0 A;  1XMX A;  3PDU A;  4LC1 A;  1ZP0 C;  1I27 A;  1GXQ A;  2HS5 A;  3WE2 A;  4H13 C;  4KJM A;  4HLX A;  1WH5 A;  4UB8 H;  4A93 J;  1W2B O;  1EZV E;  3H1L E;  3LSR A;  2CMP A;  1UST A;  3HE5 A;  3RKW A;  2OTJ P;  2CQK A;  3BQZ A;  3LL7 A;  3D6Y A;  4ABZ A;  4OQY A;  1V55 H;  1Z6R A;  3LAJ A;  1LT1 A;  1T98 A;  4D0P A;  1PP9 E;  4PJM A;  2H6B A;  2LYC A;  3SEZ A;  1E3O C;  1XTA A;  3W67 A;  2IYP A;  2WQY C;  3I5C A;  1J0R A;  5CVJ A;  1VTN C;  2IDB A;  4DT0 A;  3I56 I;  1IZ1 A;  4D1Q A;  1L4A D;  2WA0 A;  4ANJ A;  3PNV A;  3SWF A;  5FO5 A;  4GRI A;  2V6C A;  1IDZ A;  4RDU A;  3WHC A;  1S29 A;  3CCU P;  5A9R A;  3H32 A;  4ZYE A;  2P5K A;  2HFH A;  2E5Z A;  4L9V A;  3C8V A;  1W36 C;  3HHG A;  3H36 A;  4ZDP A;  1IN7 A;  3K0L A;  3Q0U A;  3RQI A;  2BGC A;  1YYV A;  5M3M J;  5IT9 K;  4L76 A;  3A0H E;  1DQU A;  1YFH A;  4ZMD A;  2EIM H;  2LK2 A;  3L9F A;  1QRY A;  4AYC A;  2QM3 A;  1TTY A;  4QLC U;  4EIJ A;  3CI9 A;  4ZJZ A;  3CUQ A;  2J5P A;  3M7G A;  4XN0 A;  1I1G A;  4E7S A;  2IZ0 A;  1GK6 A;  1BDD A;  1MBJ A;  4M71 A;  4UY8 I;  2DTR A;  4JP0 A;  2IBZ G;  4G7O F;  1BE3 J;  4AUW A;  3MZ8 A;  1VF5 D;  3CME P;  1G2C A;  1KFN A;  3HSE A;  2L3D A;  2VUM J;  2DJN A;  3S3O A;  5FRN A;  3A0H H;  4BEH B;  3BR1 A;  3CCS I;  1JGG A;  5AW6 B;  1N77 A;  4RA2 A;  4KIC A;  1MH3 A;  1L0N E;  1FY7 A;  3J80 Z;  2O5R A;  5CQE A;  2VJI A;  1CI6 A;  4Y3O A;  3MHV A;  1S7O A;  2QQB A;  3E6D A;  2D2W A;  4LGW A;  5BS6 A;  1RQV A;  4BQO A;  1ZRC A;  3V8L A;  2A5Y B;  2QBY A;  2K88 A;  2NVU B;  2GOM A;  1T08 B;  2JWD A;  1FYM A;  3GF3 A;  5AW7 B;  3SSU A;  2L4M A;  4EMS A;  3N97 A;  2IPP A;  1FT9 A;  4HF2 A;  2BCC J;  4D5C A;  3L35 A;  4JYC A;  3G6E P;  1Z9C A;  2KZV A;  4GBJ A;  3EPZ A;  4I6M C;  2VI6 A;  3GUD A;  2H43 A;  1F4K A;  2VOP A;  2HEO A;  1NHL A;  2LP0 A;  3UKG A;  3EDP A;  1B8I A;  1SQX J;  3CWB E;  4Z2Y A;  3GZ5 A;  4ZKP A;  2D3T A;  4F92 B;  4UVA A;  1T2K C;  3QYB A;  3LA3 A;  4GT1 A;  4G7Z F;  4MTE A;  3SXY A;  1DU6 A;  4S04 A;  4UUV A;  3LW5 J;  1G1J A;  1YW8 A;  2KZI A;  2PBI A;  1F12 A;  1MH4 A;  3U1D A;  3V2P A;  4I09 A;  1N86 A;  1FAV A;  2M9H A;  2GBY A;  3VYI A;  4D3S A;  3ECO A;  4HJG H;  4HPQ A;  3V5B A;  1VQN P;  2FFD C;  4LLL A;  5AW1 B;  5CKT A;  3WUT A;  4GO1 A;  3TW6 A;  4DYC A;  3ZXS A;  1U5T C;  4N9H A;  4I98 B;  1KA8 A;  3QOD A;  5KLV K;  2I1J A;  2V9P A;  3K1N A;  2JN6 A;  1O4X A;  4YXW H;  2PLY A;  2D2C D;  2M2E A;  3F8N A;  1USE A;  2NS7 A;  5K5R A;  3AE9 C;  4AIK A;  1MGT A;  1F14 A;  5GPC A;  1WRJ A;  1XDU A;  2XV4 S;  1S72 P;  2DLL A;  2JT1 A;  3S17 J;  4A3G J;  2CPS A;  1NTK K;  2PMU A;  3OIP A;  5B5E C;  1TP4 A;  1IUY A;  3H9J A;  1D7M A;  2V4H A;  3OJA B;  1S9K E;  2PEX A;  3KIO A;  4C9Y A;  1IFD A;  4HX8 A;  2E1C A;  3P32 A;  4IFD K;  3VYR B;  3CXH D;  2AO9 A;  3D1N I;  2HOA A;  3L75 G;  3CMM A;  4GWG A;  4LIT A;  5AW3 B;  2IPQ X;  1GD2 E;  4GWK A;  1FOW A;  2Y9Y A;  1B9M A;  4BGD A;  3CCJ I;  1YS7 A;  3S93 A;  4LLN A;  1SQV E;  2YU3 A;  2E75 C;  1RUO A;  2M8E A;  3I0T A;  1PGP A;  3DTI A;  1WP4 A;  1NOH A;  1X3U A;  1VF9 A;  5GPA A;  4OIP F;  1PGO A;  2Q7C A;  3TK1 A;  1JUN A;  3L74 G;  1V5G A;  3BG5 A;  3AE8 C;  5H2F H;  3ITK A;  2OYH A;  2ZT9 C;  2IXS A;  1IV8 A;  1CGP A;  2DQR A;  3K4K A;  3IHU A;  4YCA A;  3CC4 I;  2R7O A;  4BXX J;  4R79 A;  2PJR A;  1T0F C;  4KMF A;  3USS A;  4E7Z A;  5DUI A;  4AVP A;  3RK3 E;  3I56 P;  1HVV A;  1PPJ D;  4A3K J;  4FE4 A;  3TBI A;  4XID A;  2ZXX A;  3RL0 g;  3HPH A;  4RMN A;  1Y0U A;  2W84 A;  3FMS A;  3HRN A;  1OYY A;  1LTJ C;  2QYT A;  4A5M A;  5H2F E;  3DKY A;  1BI1 A;  1T95 A;  3OOP A;  1FZP B;  1JUP A;  4OMZ A;  4P55 A;  4GKG A;  4G8X A;  4PK4 A;  4XSZ F;  4ZC3 A;  1KIL D;  2L9S A;  3HD7 A;  1W1W E;  1VQ8 I;  2HDW A;  2ZME A;  2YXQ B;  2XNX A;  2FEZ A;  1NAY A;  2IGO A;  4U3F J;  4WY4 A;  5KLV G;  1EH6 A;  1LP1 A;  2E71 A;  1TQM A;  1LWU B;  2DOD A;  2IBZ I;  1IO2 A;  5APQ A;  4CPG A;  1IN5 A;  3K9T A;  1ZGA A;  2FA5 A;  4RBO A;  2KSJ A;  2Y69 H;  1Z0X A;  2FBI A;  3DFU A;  2Q3E A;  2VBX A;  4C7N A;  4KMU X;  3TGU E;  3KZZ A;  2DA2 A;  4ZH4 F;  2L7M P;  1O7L A;  2D1H A;  4I99 C;  4BJ6 C;  5DM7 F;  1M76 A;  3L73 E;  2X6Y A;  2STT A;  1L0N K;  1HWT C;  5K5Q A;  3HUS B;  2XGE A;  3FX0 A;  4QMA A;  4D6T D;  2P7J A;  1MSF C;  2ZXE B;  2JKV A;  4LK0 F;  5DCF A;  3BR2 A;  2Y0D A;  3C2B A;  4A0X A;  3ZMT A;  3OIQ A;  2AQE A;  4BBS J;  4XKC A;  3G71 I;  3CCS P;  3K7A J;  4N9I A;  1XGN A;  4EJT A;  5CJ0 A;  3WGG A;  2YU9 J;  3RK2 D;  4XQF A;  1LT9 A;  1XSX A;  3LNQ A;  3BR3 A;  2Q2E A;  1N7S D;  2YUS A;  1J1D B;  1TW3 A;  3DXJ F;  4E7H A;  5DD8 A;  2HG5 D;  1A31 A;  2A6H F;  3IV5 A;  2EB7 A;  4NDL A;  2HNH A;  4LB6 B;  3KYQ A;  3E1R A;  3BJ6 A;  3S32 A;  1R5I D;  1SFC A;  3HTK B;  3JRH A;  1H8A A;  2C0W A;  4BJT A;  1BI0 A;  3BG9 A;  3KP7 A;  2DFE A;  2E2H J;  5CCH A;  3IC7 A;  2BW3 B;  3GW2 A;  1LFP A;  1RET A;  2M8G X;  2XDV A;  2YS9 A;  2R5Z A;  1LDK B;  1ORK A;  3EGO A;  4HDU A;  4HNU A;  3KYC B;  2XIG A;  3X2Q H;  1QHG A;  1LEB A;  3VB2 A;  1FBS A;  5HS8 A;  1EZV D;  2WPV B;  3H1L D;  3E6B A;  2FU4 A;  1LE8 A;  5E3N A;  1VL2 A;  4RAZ A;  1SQQ J;  1NO4 A;  4LB5 A;  1LDJ A;  1K83 J;  2VN2 A;  1QL1 A;  1S5L C;  3FWL A;  3U59 A;  2R7T A;  3Q3S A;  4KIB A;  4UV9 A;  2Y0S A;  3CMA I;  2E75 B;  4I1L A;  5DS9 A;  4L9N A;  4W97 A;  1R7J A;  2QEX I;  1LPQ A;  3ZGK A;  3G4S I;  1L0O C;  5E3L A;  2WPQ A;  2Z5I A;  4KHX A;  5CHX A;  3QPT A;  4HYT B;  3HDD A;  1E79 H;  5C44 J;  1T56 A;  2Y9Z A;  1IN8 A;  2VE8 A;  2G3A A;  4JPZ B;  5HDG A;  3VWB A;  4UXN A;  1TBX A;  2HDH A;  3JRB A;  2JA8 J;  3H1H J;  3SZP A;  3FMR A;  5DDG A;  1QQI A;  5JLW A;  2O01 J;  4H44 C;  2WT7 B;  1DH3 A;  1FMV A;  5TIS C;  4KUG A;  2W90 A;  2WY8 Q;  3JRG A;  2QZ8 A;  1LTT C;  3SJM A;  2F5D A;  2KDO A;  2RKL A;  2QA4 P;  3CUO A;  5E3M A;  3PHL A;  3CL3 D;  5HWS A;  1WJC A;  3SDG A;  1M8O B;  3KDP B;  2E5T A;  2E76 D;  3GEZ A;  1YTZ T;  1PP8 F;  3KP2 A;  3L4F A;  3NQO A;  3HKZ A;  1JKO C;  1NKN A;  3CCJ P;  1TT5 B;  1S4X A;  2K9L A;  2QYO A;  1L4A C;  1YHQ I;  2HOD A;  1X0T A;  1EQ7 A;  2MBF A;  2ME0 A;  4U0V A;  1TW2 A;  1H89 A;  3QPL A;  3AE7 C;  4YRV A;  2DMQ A;  2KRC A;  4MFD A;  5HOO A;  1G2C B;  5HLI A;  3B71 A;  2XHK A;  1BE3 G;  3ABU A;  1VPC A;  3CC4 P;  2E1M B;  1EC5 A;  5FLX K;  1LJ8 A;  1ZAR A;  3FMQ A;  1DUX C;  5FWN A;  4Q47 A;  3HN2 A;  2QJP C;  2V4J C;  4WBA A;  1SEU A;  2P81 A;  2PFX A;  4KYW A;  2O6G E;  2X9D A;  1MBE A;  1R5H A;  4BY7 J;  2FJ1 A;  3LSP A;  3V2N A;  1MJA A;  3K70 D;  5LLQ A;  3B02 A;  3TDU C;  3C7A A;  4XSX F;  2PX9 A;  2HQ5 A;  2QJY B;  1J2J B;  2BCC G;  3ZDM A;  2VJ5 A;  1ETK A;  3RZO J;  3CWB D;  4ZTF A;  3WTS C;  2Q1K A;  1Z3X A;  2MC3 A;  5LGT A;  4M3F A;  2X58 A;  1KU2 A;  2ETH A;  3PIP F;  1IJW C;  1LTG C;  1VF5 C;  4IRH A;  1SQX G;  1TNT A;  2HU9 A;  3LA2 A;  4GXO A;  1X58 A;  3DPT A;  4NC7 A;  1LNW A;  4IO9 F;  2HGC A;  4IHV A;  5AVR B;  2W25 A;  4A3I J;  3VSK A;  2HXI A;  2NVT J;  5IT9 Z;  2YKP A;  5AVT B;  2HZT A;  2ITA A;  4A3B J;  1UEL B;  1KZU B;  1MIJ A;  3FXU A;  4BUP A;  3OS0 A;  1BGY E;  2WSC H;  1JCC A;  1QVG O;  2ZC2 A;  3BOQ A;  1IRZ A;  1RF0 C;  1JHF A;  2ZSI B;  4XL9 A;  4XK4 A;  4DBQ A;  2DO7 A;  1U6G A;  2KZG A;  2B87 A;  3WUU A;  1FBM A;  4EOT A;  3KYD B;  2JEE A;  1LFU P;  3I9V 2;  1DGR M;  2MA3 A;  5IY5 H;  2DDB A;  2JVG A;  1PUE E;  3A03 A;  2DOE A;  1EH8 A;  5B66 E;  5M3F J;  1OX3 A;  1SQP J;  2JWA A;  3M9Q A;  3JRF A;  2OYI A;  3TSI A;  2KRF A;  5AW0 B;  1HC8 A;  4PZE A;  1S9K D;  2RNJ A;  4H44 B;  1HTL C;  3K4M A;  5F0F A;  2HKO A;  3D0S A;  4O5V A;  2AXL A;  5HS7 A;  2YIU C;  1MUU A;  2E74 D;  3HE4 B;  1KYW A;  2HYJ A;  4E6K G;  1FJP A;  1SFE A;  1WFX A;  2L91 A;  2JUC A;  2V6E A;  1SQV D;  1A6I A;  1H88 A;  1ENH A;  1JCD A;  4WWI A;  1R00 A;  1X1A A;  5D4S A;  4AVZ A;  5B66 H;  1J9I A;  3GMA A;  3KZI H;  1FOS E;  3PLR A;  1L3L A;  1IDY A;  3CO6 C;  1Y6I A;  3DKW A;  2CQX A;  2QLZ A;  3Q9V A;  5BNG A;  2D2C C;  3L36 A;  4OWF A;  4PD4 H;  3U1C A;  4N78 E;  3I4P A;  3ZP5 A;  5KLI C;  1ZYR F;  3L70 D;  2EPF A;  4PZC A;  3CCY A;  1R5L A;  3CMA P;  3AE6 C;  3RKX A;  2FYU E;  1DD4 A;  2QWW A;  1QU3 A;  2QEX P;  3A0B E;  3RK3 D;  3G4S P;  1HW5 A;  4FT8 A;  1D1A A;  3G3Z A;  1WHU A;  3L71 J;  1M56 D;  3E5U A;  3K96 A;  4IQJ A;  1GMJ A;  1JOC A;  1WMK A;  2QF7 A;  5K5G B;  2QE7 H;  1YG2 A;  3ABK H;  1ZRF A;  2NNN A;  3PM1 A;  1U7J A;  3S16 J;  2C0X A;  2L7K A;  3P7N A;  5KNL A;  3R0J A;  2JJL A;  1QPM A;  1MMA A;  5KJ7 C;  3OS1 A;  3ONQ A;  1WT6 A;  1MBG A;  1GV5 A;  1S3J A;  2VQL A;  1YIT I;  2GUS A;  2YO2 A;  4WY4 B;  1MFT A;  1ON2 A;  2O03 A;  3A0B H;  1ZRE A;  1LP1 B;  1OJL A;  2CQ7 A;  1PJR A;  4U3F G;  1JY2 O;  4J0F A;  2BVL A;  2YMY A;  3ESW B;  1A02 J;  4A3M J;  3TED A;  1SQB E;  4LGD E;  3O3K A;  4C7N B;  4R1H A;  3TGU D;  2NAZ A;  4V2F A;  1BSH A;  3L73 D;  3IWZ A;  3MZY A;  5J3L A;  2PMZ A;  4CCK A;  5DD4 A;  4CGZ A;  4LOC A;  2ZYA A;  4BHC A;  3LAP A;  1QA6 A;  3GHG A;  2PLA A;  1YS6 A;  4IQ4 A;  1VQL I;  1HCR A;  1WSU A;  5AYV A;  3L2R A;  3IN6 A;  3S1K A;  2DA5 A;  1NYH A;  3LMM A;  2CJJ A;  2BY2 A;  2HPC B;  1M75 A;  1KIL C;  4GYI A;  1H0M A;  1K73 Q;  3ZMS A;  1LT9 B;  3ZMD A;  3ZQH A;  2H88 C;  5KJ7 A;  3VMY A;  2GOX B;  5ICF A;  3FXE A;  3D70 A;  4B44 A;  4L0Y B;  2LKP A;  4B86 A;  2EA4 A;  3I5U A;  1YX5 A;  4JOM A;  4U0W A;  3OR2 C;  3B5N D;  4D7M A;  2KRH A;  4BJ5 C;  3S1R J;  4HNV A;  4WXH A;  4GGG A;  2QSH X;  2CW8 A;  2L0K A;  3VSL A;  3GTG J;  4DCK A;  5KKZ B;  3PH0 A;  1SD4 A;  1YQA A;  3HBL A;  4O3M A;  1DPR A;  1A5J A;  3K6G A;  1QEX A;  4C7R A;  2KFD A;  3OYC A;  2ZAE B;  4P96 A;  2R5Z B;  5B1B H;  4LG0 A;  5L3B A;  2ME6 A;  1X22 A;  2DA6 A;  4EM2 A;  3CP8 A;  4BRY A;  1AJY A;  3HSR A;  1TC3 C;  1FWZ A;  4R4L A;  3PJG A;  3IKT A;  3CCV P;  1MJB A;  4KNY A;  3BCC D;  3KEO A;  1PGN A;  3RZD J;  3ML6 A;  4IXA A;  1XG1 A;  2DT6 A;  2OCE A;  2QUF A;  2DPD A;  4UB8 C;  3GTK J;  1BA5 A;  1N7S C;  1SQQ G;  3IFM A;  1JNM A;  4I0B A;  1BC7 C;  1PVE A;  1D0Z A;  4TT3 H;  1R4N B;  2KZJ A;  2KLO A;  1NU1 D;  1FOY A;  3FKI J;  4W1U A;  3MKY B;  4F52 A;  2EZK A;  2V79 A;  3RPU D;  2GWR A;  3J7Z I;  1D0X A;  4OGQ D;  3L37 A;  3U21 A;  2O0Y A;  1GDT A;  4XFJ A;  3H1H G;  2XGD A;  3LSJ A;  1N25 A;  2VQC A;  3RIR A;  3M8F A;  4BEH A;  1PFI A;  2W24 A;  4EGZ A;  3P5J A;  1OW6 A;  3OAK A;  4IL6 E;  2LG4 A;  3D5R C;  4M6V A;  1UHW A;  2IGK A;  4QSH A;  1YRN A;  1NTM D;  4PJ0 E;  3AG1 H;  1D0Y A;  5IOY A;  3JCU E;  3GTL J;  1R8E A;  1EDL A;  4DZJ A;  5IYD J;  3AEE C;  3JC2 2;  2PG4 A;  1X0V A;  1P92 A;  2RKH A;  2CS3 A;  3HC7 A;  2DA3 A;  4CYC B;  1I6X A;  5E79 E;  2IS1 A;  1GV2 A;  1K05 A;  2LVS A;  1K6Y A;  3PNT A;  2I5U A;  2IS6 A;  1JXS A;  4IL6 H;  4PJ0 H;  3M4O J;  1QZZ A;  2FUG 2;  2QQ8 A;  5C4X J;  4LK1 F;  3JTH A;  1SAU A;  4C30 A;  3JCU H;  5LBQ A;  1SMT A;  5GTH E;  2ZNY A;  2KHM A;  3L2Q A;  5ILS A;  1UHM A;  4CH7 A;  2ECC A;  1HXD A;  1WRG A;  2IBZ E;  1NGM B;  3D5S C;  2OTJ I;  1BCC D;  3A0H C;  3W2V A;  3LSK A;  3F21 A;  1IG7 A;  3DQV C;  4XLN F;  2E76 C;  3ABM H;  2FYN B;  1KQG B;  2IA0 A;  2ZFW A;  5H20 A;  1NTZ J;  3VOD A;  2V1X A;  3O2P E;  4BH9 A;  2ZJS E;  5E79 H;  1XCV A;  3ULQ B;  5L3G A;  2ZFU A;  4FTH A;  4C46 A;  2FBH A;  4G6D A;  3RKY A;  3PSF A;  1QO0 D;  2B88 A;  3BRT B;  1A02 F;  2XF5 A;  2Z1D A;  2EIL H;  5GTH H;  3EYI A;  3OW2 O;  3H1I D;  2DBB A;  2OQR A;  4HRI A;  4JYK A;  2MG4 A;  2V7Q H;  5IP7 J;  3CES A;  2XVC A;  2Q0O A;  3DU5 A;  2EBI A;  2POH A;  1YYC A;  2DMU A;  2FSW A;  1Q81 Q;  1TLH B;  2VXD A;  2JWT A;  2VIX A;  2LMD A;  1NK2 P;  2HWV A;  5JR3 A;  1FOK A;  1DPU A;  4OIN F;  3OMY A;  5KAI E;  1ETQ A;  1Z91 A;  3BCB A;  4OAY A;  1OCR H;  2K86 A;  4PSW A;  2X6O A;  3O8H A;  3CC2 I;  1NVO A;  2IA2 A;  4AM3 A;  3AEB C;  3SEQ A;  2R7R A;  1TZL A;  2CG4 A;  2WSS H;  3K70 C;  3RK2 B;  2ZXJ A;  2KIM A;  2XRL A;  3F9K A;  2F48 A;  2HDC A;  1L0L J;  2NS0 A;  2CUE A;  2KS1 A;  1X3W B;  2TDX A;  2M7B A;  3LSH A;  2YXR B;  2XPW A;  1SS1 A;  2R5D A;  3EUH C;  4RES B;  1U78 A;  1T39 A;  1J1E C;  2TCT A;  1NG6 A;  1REP C;  5KAI H;  2OYI B;  1N7L A;  4FET A;  3GLL A;  2VQH A;  3GHY A;  5H6Q A;  5FLX Z;  4PD4 D;  5AVZ B;  1SQP G;  4KUM A;  4B47 A;  1IC8 A;  2C6Y A;  3P7K A;  2JTV A;  1OIS A;  4M9Z A;  3ULK A;  3R2P A;  2JK3 A;  4EQQ A;  5KCM A;  4HA8 A;  5BQT A;  1WPQ A;  5E8I A;  9ANT A;  3HL2 A;  3FWN A;  3KP3 A;  3H92 A;  1TNS A;  1XX5 A;  3G6E I;  3PL8 A;  2M8R A;  1S8N A;  1WI3 A;  2DA1 A;  2XAG A;  3RYR A;  2EW2 A;  3L75 E;  1YI2 I;  3H0D A;  3PRJ A;  4B8X A;  4JF7 A;  5L3D A;  3HOS A;  1N75 A;  2NOJ B;  4ITV A;  1IZN B;  2O61 A;  4I02 A;  3I53 A;  5CCG A;  1YIJ P;  2FYU D;  4D6T J;  1SD7 A;  1W0T A;  2F4I A;  3L74 E;  2NVY J;  4NUB A;  4Y99 C;  4W7Y A;  3MUD A;  4BY1 J;  1IO4 A;  2K9J A;  1WH7 A;  2L9V A;  2B7E A;  4ESJ A;  2E74 C;  2OTL P;  5D8K B;  1T2K A;  3W6U A;  1ZV8 A;  3CJT B;  3L71 G;  5FD5 A;  2CUJ A;  5EYR A;  1SVO A;  5DCM B;  1VQN I;  2QQ9 A;  3PNY A;  3A1Y A;  2QRX A;  1QVT A;  3FF5 A;  3PO2 J;  3C18 A;  2CK3 H;  1WVR A;  3RQ4 A;  4EM0 B;  3T8T A;  5CMZ A;  4ZNC A;  4B09 A;  3HTS B;  2DJI A;  4A3L J;  1FE6 A;  1Z7U A;  1ZQ3 P;  1R49 A;  3GTM J;  3CMY A;  1KYO D;  2FFD A;  2ISY A;  2QG4 A;  2N8G A;  2W4S A;  4OVN F;  3BTL A;  2BE5 F;  3DEU A;  1S72 I;  2HYN A;  3CC7 P;  3GFJ A;  1FEX A;  1SQB D;  3FXJ A;  3B4S A;  5KLV E;  2LNB A;  2NVQ J;  2MJZ A;  3RK3 C;  3H1L J;  1IK7 A;  3PJS K;  4N4N B;  2LXC B;  1RHZ B;  3E97 A;  1UIX A;  2AXT E;  3GME A;  2R7W A;  1MFZ A;  3HTK A;  1E3H A;  1GVJ A;  3FXO A;  2J5O A;  5J1Y A;  2A68 F;  1BOA A;  3GYH X;  2LF8 A;  1URQ D;  2BW3 A;  3P8C E;  3UNG C;  1P4X A;  3HKZ N;  2D45 A;  5MGB A;  2W27 A;  1F17 A;  2XKM A;  1KZH A;  3I4M J;  4KT0 J;  2KP8 A;  2YNY A;  1FYK A;  4M6Y A;  4NQW A;  4RLF A;  3KEY A;  3V6I A;  4D3D A;  5LHG A;  1FZC B;  1D1C A;  1T6S A;  4IVN A;  4RO0 A;  2RQP A;  4OWR B;  5KAF E;  1P6R A;  2H8W A;  4E7K A;  2AXT H;  2COB A;  1RE4 C;  2XKO A;  2MH9 A;  2V7F A;  2W82 A;  3NWT A;  1PUF B;  3M0A A;  2VAS A;  1GUU A;  3E1S A;  3BP8 A;  4P9U A;  5LFA A;  3VTP C;  2K9S A;  1GL2 C;  2KK7 A;  1FSE A;  2VKH A;  2WTE A;  1J1E B;  2ZSH B;  2FXM A;  3MP7 B;  4ASV A;  3Q5P A;  3FK7 A;  5DTD A;  1G59 A;  5AW9 B;  3GZN B;  4LG0 B;  3DOJ A;  2M5W A;  4BRY B;  1VQ7 P;  1T0F A;  2J59 M;  5KAF H;  2WT7 A;  4CCL A;  1Z77 A;  3ZMZ A;  1FP1 D;  1RKT A;  1P9Q C;  5J4V A;  2ZJ2 A;  4UUS B;  3JSO A;  4LFU A;  4EYY Q;  4OU0 A;  3H35 A;  5AVV B;  3RI4 A;  3VYS B;  3L6D A;  3QP6 A;  4N6J A;  2EQR A;  3BT9 A;  2KSE A;  2CFO A;  5K7F A;  3EUK L;  2GXG A;  5CJ9 A;  1TT0 A;  1GT0 C;  1NH3 A;  1KV4 A;  3ZR8 X;  1EVZ A;  4MQV A;  1DLJ A;  3CC2 P;  3B5N C;  1XN7 A;  1FOX A;  2PAJ A;  3HJE A;  3MGN A;  2FMY A;  1QGK B;  3Q9S A;  4BAY A;  3II6 A;  3CPW O;  2Z9O A;  1WCM J;  4HF1 A;  1QMG A;  3R6S A;  4CZZ A;  1KS9 A;  4N3Y B;  2AHQ A;  2I1K A;  5K7Z A;  4F55 A;  4IPA A;  1FZA A;  2JPC A;  4BE0 A;  2Z2S B;  4MFE A;  1B9N A;  3M8E A;  2E74 B;  2DPU A;  4I2L C;  4I7H A;  2EV5 A;  3IR9 A;  1VQP P;  3ZQQ A;  2H94 A;  4A3F J;  3WG9 A;  4HYE A;  2E34 A;  1FC2 C;  2XC7 A;  1LNQ A;  1EXI A;  1YRN B;  3CWB J;  4Q48 A;  3HAD A;  3ZCO A;  1F5T A;  1WQ2 A;  3DFG A;  2XPV A;  1T3U A;  3CF5 F;  2Z33 A;  4RAG A;  2DMP A;  3HXL A;  3F3S A;  2K3P A;  4RB3 C;  1BJZ A;  1HJB A;  2KYV A;  1WJE A;  1TQI A;  4BNC A;  2Y31 A;  2MC4 A;  2MFZ A;  2WPR A;  4MGR A;  4HDV A;  2IJL A;  5F08 A;  4FAS D;  1FC3 A;  2XND H;  4ZDL A;  1YI2 P;  4XRF A;  2ECB A;  2L2O A;  1L0L K;  2K1A A;  1RH5 B;  1IUF A;  1JTH A;  1D3Y A;  1U9O A;  4NC8 A;  2WWY A;  4IHX A;  1JI8 A;  4OGQ C;  4WB4 A;  1OCT C;  4LIV A;  3IWF A;  4B3H A;  2R0Q C;  1FNN A;  3MQ0 A;  3WU1 B;  3RGU A;  2IBZ D;  4Q5S F;  3CCL P;  3VN0 A;  3ASN H;  2JA5 J;  2QEN A;  3HRT A;  5LHI A;  5TJH A;  4DJA A;  1P84 I;  3S3N A;  4HW0 A;  2ZBK A;  3H9Q A;  1BE3 E;  2OUM A;  4C2M J;  3A3Y B;  5FFZ A;  2CGP A;  2KMU A;  4H13 B;  3KLN A;  3TO9 A;  3BRV B;  3S8P A;  5AVS B;  5HOD A;  1NTZ G;  4L74 A;  4XLC A;  5F04 A;  4RM3 A;  1LEA A;  1HF9 A;  1NAF A;  1SFC D;  3R4K A;  4Z1M H;  2BYV E;  4A12 A;  1KQ8 A;  4XKB A;  4MHG A;  2JA7 J;  3J81 Z;  3F6V A;  2NPS D;  4ZYG A;  1FTT A;  1SQV J;  2BCC E;  4YII A;  2QA4 I;  1G1I A;  1BJA A;  1JKR C;  1G4D A;  4PUS A;  2CO5 A;  1YQ3 C;  1DDN A;  3RQS A;  3H1K D;  1ZTR A;  3F3X A;  3VDX A;  3HE4 A;  1Z7L A;  4BDY A;  3I83 A;  3K2A A;  3FGA D;  2PMH A;  4C2U A;  3DBL B;  2P67 A;  3JW4 A;  5FRO A;  2GA1 A;  2K27 A;  3DP7 A;  1OR7 C;  3L70 J;  1XMA A;  2DXI A;  1VI0 A;  2M1B A;  3R61 A;  3LFU A;  2OF7 A;  5B1A H;  1OW8 A;  4CCO A;  4FX4 A;  2K9M A;  2KS1 B;  3ZRG A;  2PMZ N;  3SZT A;  4ZYA A;  3GFI A;  5CBO A;  3B5N B;  3GX4 X;  2PN6 A;  2I8D A;  2K5C A;  1L0L G;  2Z3Y A;  1G6N A;  1PPJ G;  4A6E A;  1MKM A;  1FLI A;  2LXB A;  3CCM I;  3DCF A;  3CQZ J;  2I10 A;  2MLG A;  1LKX A;  5F1J A;  2CV0 A;  3RBX A;  2P6S A;  1L4A A;  3TF5 A;  4FE7 A;  4L18 B;  2WBM A;  2OCC H;  4ESF A;  4AQR D;  4IRG A;  2Y30 A;  5APS A;  4KT5 C;  4J00 A;  1NK3 P;  3BAT A;  1M7L A;  3LW5 H;  2BV6 A;  2R92 J;  4EJU A;  5FD6 A;  4AYB A;  5M5W J;  1NTC A;  2LFB A;  2OQQ A;  2DCE A;  2CUF A;  2DT7 B;  2A6E F;  4K35 A;  2PJP A;  5AON A;  5APU A;  2FOW A;  2X6W A;  2DOF A;  3CCE I;  4ASW A;  1JUS A;  3VYT B;  3L75 D;  2XF7 A;  3FXL A;  3HOV J;  3TGU J;  4BDZ A;  4IJA A;  1JMB A;  4IKF A;  1OVR A;  3L73 J;  3QU3 A;  5LGN A;  4YIR X;  3G1L A;  1TU3 F;  4PFP A;  4XIC A;  5A2Q Z;  1RNL A;  3GO5 A;  3IL2 A;  4OQZ A;  1RF1 C;  4QTR A;  5B66 C;  1USD A;  2BEQ D;  2YMK A;  3KZI C;  1X9V A;  2A05 A;  4L5I A;  1G3Y A;  1RES A;  1O3R A;  1LVK A;  4P9F A;  2B63 J;  4CO8 A;  2K9J B;  3ZOB A;  4D6T G;  3V7C A;  4H0L C;  4Y15 A;  3WG7 H;  4CUG A;  3D1L A;  2F5E A;  5F1R A;  1J59 A;  3DLA A;  2E2J J;  2E19 A;  4S3M A;  4II3 A;  3J7A O;  3RBZ A;  1FZF A;  1YON A;  2QM8 A;  1XTG B; 
#chains in the Genus database with same CATH homology
 3FIS A;  2OPT A;  4PZE A;  1MSE C;  3H3V K;  3WS7 A;  4G12 A;  1U9N A;  5F0F A;  4DZP A;  3OSF A;  1YJQ A;  2ID3 A;  2HYJ A;  5EZG A;  3VPR A;  1EVY A;  1DU0 A;  2ZYG A;  5F27 A;  4A3D J;  1Y1V J;  5K7H A;  1WDM A;  2L7Z A;  5GP9 A;  1A6I A;  1ENH A;  3CDL A;  3BTI A;  3PLR A;  1IDY A;  3FK6 A;  5F0C A;  2CQX A;  2EZL A;  5BNG A;  1WPK A;  3TP0 A;  1I36 A;  2M34 A;  3MN2 A;  3JRA A;  2EZH A;  4PZC A;  3CCY A;  3BR5 A;  1B72 A;  4MIM A;  4IHW A;  3ZW9 A;  4OM8 A;  3HWR A;  4FGW A;  1BL0 A;  3PEF A;  1S7E A;  3K96 A;  3PO3 J;  3F0C A;  2QF7 A;  2MSY A;  2WAQ N;  3IH4 A;  2K9N A;  2L9R A;  3PM1 A;  1FIP A;  4X1E A;  3S16 J;  5A9S A;  2OFP A;  1Z82 A;  3HOX J;  1MBG A;  4PZD A;  1GV5 A;  4M3B A;  1FJL A;  1G2H A;  2IZ1 A;  1ZGW A;  2IEK A;  2NOG A;  2H1K A;  3WFI A;  2LLK A;  1AKH A;  3OOU A;  3ZQF A;  1OJL A;  2DA7 A;  5IYC J;  3A01 A;  3GTQ J;  5FLV A;  3S1M J;  3HOZ J;  4J0F A;  3BQY A;  1F36 A;  3TP3 A;  3L1P A;  4A3M J;  3TED A;  2MGQ A;  4V2F A;  3G1M A;  3NAU A;  5E3O A;  1HF0 A;  5J3L A;  4LOC A;  4JX5 A;  2ZYA A;  2JMW A;  2PLA A;  1HCR A;  5AYV A;  4IM7 A;  2DA5 A;  1N1E A;  1ETO A;  1XS9 A;  2CJJ A;  2DN0 A;  1M75 A;  1U8B A;  1TWC J;  2X48 A;  1ZK8 A;  2CQQ A;  3MKL A;  3ZQH A;  3JRI A;  2ELK A;  4CYC A;  3JR9 A;  1SAN A;  1X2N A;  2EH3 A;  2P4Q A;  1ZKG A;  4D7M A;  3S1R J;  2XPU A;  4HNV A;  4DCK A;  2L0K A;  4I76 A;  3GTG J;  1WDK A;  1YRL A;  2IYO A;  3HBL A;  5IPA A;  4M3E A;  4J19 A;  1A5J A;  1LFB A;  2WB1 N;  1B72 B;  4DYR A;  1HLV A;  1JKQ C;  2R5Z B;  5FKN A;  4E12 A;  2ME6 A;  2CRG A;  2DA6 A;  2LTP A;  1CQT A;  2R5Y A;  3A02 A;  3ZQC A;  3C7C B;  1TC3 C;  2GF2 A;  3ADP A;  5M5Y J;  3PJG A;  4MO7 A;  2Y0S N;  2HOS A;  4J0E A;  1PGN A;  3RZD J;  3GTK J;  1XG1 A;  1BA5 A;  5EG0 B;  2KDZ A;  2NS8 A;  3CKY A;  1AKH B;  3ZWA A;  2LY9 A;  1ETW A;  1D5Y A;  3A01 B;  3FKI J;  4W1U A;  5FKO A;  4JQ0 D;  2EZK A;  3GBG A;  3S14 J;  1UHS A;  1QVU A;  4OL9 A;  1T33 A;  1UMQ A;  1GDT A;  4E13 A;  2HI3 A;  2XGD A;  1JDJ A;  3LSJ A;  3QHA A;  1F0Y A;  4Y52 J;  4D7N A;  2FX0 A;  3LSG A;  4M6V A;  4QSH A;  1SFO J;  1YRN A;  3WHB A;  3HGG A;  1ETX A;  1W0U A;  1MBF A;  5IOY A;  3PDU A;  3GTL J;  4DZJ A;  5IYD J;  1WH5 A;  2FQ4 A;  4A93 J;  4D3F A;  3LSR A;  1X0V A;  4IEJ A;  3ZHB A;  1FIA A;  2DA3 A;  4CYC B;  3Q0W A;  3BQZ A;  4ABZ A;  1VND A;  1UG2 A;  4OQY A;  2O8K A;  2ZYD A;  2HOT A;  1GV2 A;  4A69 C;  2LVS A;  1E3O C;  4BBR J;  2IYP A;  3M4O J;  1BW5 A;  5C4X J;  4DW6 A;  3ZQL A;  1ZR4 A;  1GVD A;  4JX6 A;  1WDL A;  3G1O A;  2DTZ A;  1MBK A;  2ECC A;  2O7O A;  2WV1 A;  3MOG A;  3ZGY A;  1IDZ A;  4RDU A;  3WHC A;  2R5Y B;  1IG7 A;  5A9R A;  2KT0 A;  1ETV A;  3BTC A;  1TWA J;  5EEA A;  3WFJ A;  3Q0U A;  3RQI A;  4FTH A;  1IV6 A;  5M3M J;  2XB5 A;  2LK2 A;  5A9T A;  1QRY A;  2LD5 A;  1P7I A;  5IOZ A;  4JYK A;  2MG4 A;  3Q3C A;  5IP7 J;  1VPD A;  2EBI A;  2DMU A;  2IZ0 A;  1TXG A;  2JWT A;  1MBJ A;  2GM4 A;  3JRD A;  1NK2 P;  4MLO A;  4JP0 A;  1HDP A;  3BG3 A;  5J1U A;  5FKL A;  1OCP A;  3S1N J;  1ETQ A;  2VUM J;  2DJN A;  1HOM A;  3BR1 A;  1JGG A;  2H8R A;  2I9P A;  2X6O A;  3O8H A;  2D5V A;  2W8Z A;  1MH3 A;  1APL C;  5JE8 A;  2XRL A;  4A3J J;  3HOU J;  2CUE A;  4R1N A;  3IH2 A;  2XPW A;  3ADO A;  4D5C A;  1U78 A;  4GFB A;  2TCT A;  3G17 A;  4GBJ A;  1HDD C;  2VI6 A;  3GHY A;  2WTB A;  4C3J J;  4A3E J;  1JJ8 C;  1IC8 A;  2LP0 A;  4M3D A;  3UKG A;  1B8I A;  3GTP J;  2IAI A;  3ULK A;  4D5F A;  2JK3 A;  2D3T A;  1BW6 A;  1WPQ A;  5F0H A;  9ANT A;  1I50 J;  4IHY A;  1DU6 A;  3FWN A;  4V2G A;  5IP6 A;  1OFC X;  1R9T J;  3M3Y J;  2HXO A;  5FKM A;  1WI3 A;  1AU7 A;  2DA1 A;  3O8G A;  1MH4 A;  1F12 A;  2EW2 A;  3OIO A;  2M9H A;  2GBY A;  1PUF A;  4D3S A;  5FLM J;  3TW7 A;  3B6C A;  3HEF A;  1M67 A;  4DYC A;  3TW6 A;  3HDH A;  3HB9 A;  4B4C A;  2VKE A;  3HGY A;  1W0T A;  4XRS A;  5FJ8 J;  2NVY J;  1O4X A;  2JN6 A;  1JJ6 C;  3GTJ J;  4BY1 J;  2M2E A;  1WH7 A;  4Y7N J;  3ZW8 A;  2NS7 A;  5IYB J;  1F14 A;  4UUS A;  3W6U A;  5GPC A;  5EYR A;  3RKQ A;  3S17 J;  4A3G J;  3C7D B;  5A9S B;  5EGO A;  2ID6 A;  1QVT A;  1MNM C;  3PO2 J;  4XRS G;  2L7F P;  2LR8 A;  4AUX A;  3FIW A;  2AO9 A;  3D1N I;  2HOA A;  4A3L J;  4GWG A;  2O9L A;  3GTM J;  1ZQ3 P;  3JRC A;  4I6Z A;  3CMY A;  4GWK A;  2Y9Y A;  2N8G A;  1JTX A;  4OVN F;  3BTL A;  2M0C A;  1PGP A;  1WP4 A;  1FEX A;  3QSG A;  1VF9 A;  5GPA A;  1PGO A;  2QCO A;  2NVQ J;  3ZQI A;  1PGQ A;  3GTO J;  3BG5 A;  2GLO A;  4DYD A;  3BR6 A;  1YJ8 A;  4YCA A;  5J1Y A;  2E1O A;  2W48 A;  4BXX J;  1ITY A;  4S0H B;  1B8I B;  3IQD B;  3HKZ N;  5MGB A;  1F17 A;  4A3K J;  4FE4 A;  3I4M J;  4XID A;  4D3D A;  2QYT A;  3OBB A;  4C3H J;  4X6A J;  2XGC A;  2RAE A;  3QQA A;  4E21 A;  2COB A;  3IH3 A;  2R93 J;  1JUP A;  3S15 J;  5C3E J;  3I4N J;  1PUF B;  2CU7 A;  1GUU A;  2LKX A;  5C4J J;  2K9S A;  4FCY A;  1POG A;  1RR7 A;  2XSD C;  3FK7 A;  5DTD A;  4RBO A;  3S2D J;  1M2W A;  3DOJ A;  4DLL A;  1Z0X A;  1ZR2 A;  2EZI A;  3DFU A;  1P7J A;  1Z77 A;  1RKT A;  2DA2 A;  1M76 A;  2L7M P;  5IP9 J;  1MBH A;  4UUS B;  1JKP C;  2CVZ A;  1H8A C;  2Y2Z A;  3ZWC A;  1IL0 A;  3QPS A;  2XGE A;  3L6D A;  1I6H J;  4B3A A;  2EQR A;  3BT9 A;  1MSF C;  4A3C J;  2JKV A;  5FKK A;  3BR2 A;  5K7F A;  2R7Z J;  1GT0 C;  3C2B A;  4BBS J;  4AYB N;  1EVZ A;  1DLJ A;  3K7A J;  3CTV A;  2YU9 J;  1X0X A;  4BKX A;  1WCM J;  4DYQ A;  3LNQ A;  3BR3 A;  1QMG A;  1KS9 A;  2YUS A;  3E7L A;  2AHQ A;  5K7Z A;  1N1G A;  3IV5 A;  4MFE A;  4NDL A;  1DLI A;  1TWG J;  1Q1V A;  3JRH A;  1RPW A;  4A3F J;  3HOY J;  3H0G J;  1X2M A;  4UUT A;  3BG9 A;  3B6A A;  3PID A;  1BG6 A;  2E2H J;  4EZB A;  1YRN B;  1EF4 A;  3HAD A;  2M8G X;  1RET A;  2R5Z A;  2YS9 A;  2VKV A;  1M66 A;  2XPV A;  1ORK A;  1XC5 A;  3EGO A;  1TWH J;  2DMP A;  3F3S A;  1LE8 A;  5E3N A;  1BJZ A;  2Y31 A;  1VFC A;  2JJ7 A;  1K83 J;  5F08 A;  3Q3S A;  1YB4 A;  2ECB A;  5DS9 A;  4W97 A;  1IUF A;  5E3L A;  1U9O A;  4IHX A;  1RKW A;  5EG0 A;  1ETY A;  1OCT C;  2DMN A;  4B1R A;  2E2I J;  5C44 J;  1T56 A;  4L5E A;  2R0Q C;  3HM5 A;  2Y9Z A;  3HDD A;  2IBD A;  5EF6 A;  1ZCJ A;  4B3H A;  3BTJ A;  4JPZ B;  3Q0V A;  3DEW A;  3HN2 A;  5J1R A;  1YVE I;  2HDH A;  3JRB A;  2JA5 J;  1Y1W J;  1H89 C;  2JA8 J;  3OSG A;  5JLW A;  1FTZ A;  4FIS A;  4KUG A;  4XRM A;  2W90 A;  5M5X J;  3JRG A;  4C2M J;  4AC0 A;  3SJM A;  4M3G A;  1JT0 A;  2DMT A;  2ZB9 A;  1AHD P;  5E3M A;  5HOD A;  1F43 A;  5F04 A;  2VPR A;  5HWS A;  3SDG A;  2JA6 J;  4EEF G;  4QIW N;  2NVX J;  5JLX A;  2JA7 J;  4C3I J;  1JKO C;  1IGN A;  1FTT A;  4B3I A;  1JKR C;  2UYY A;  2ME0 A;  4KUH A;  3RQS A;  3QPL A;  3H2Z A;  1TWF J;  1ZTR A;  2DMQ A;  4MFD A;  3I83 A;  3K2A A;  1I3Q J;  3MVP A;  2DA4 A;  2PGD A;  3HOW J;  1LJ8 A;  5FWN A;  1VI0 A;  3ZWB A;  2OF7 A;  3FR7 A;  2P81 A;  3S2H J;  2X9D A;  2PMZ N;  1MBE A;  2K40 A;  4BY7 J;  1LE8 B;  2FJ1 A;  3LSP A;  2TRT A;  1WGX A;  5EDN A;  5EZH A;  2XB0 X;  3C7A A;  2I10 A;  3BR0 A;  3CQZ J;  3DCF A;  5F1J A;  2HQ5 A;  4B3J A;  3W6V A;  4KUE A;  4FE7 A;  1ETK A;  3RZO J;  3SFI A;  3W6Z A;  2Y30 A;  3NAR A;  2X58 A;  4M3F A;  1NK3 P;  1IJW C;  2R92 J;  2G0E A;  5M5W J;  1NTC A;  2LFB A;  4JX4 A;  2CUF A;  1X58 A;  3G0O A;  1JUS A;  4IHV A;  4A3I J;  2MW8 A;  2HXI A;  2NVT J;  2FD5 A;  3HOV J;  2HDD A;  4A3B J;  1JT6 A;  1LSO A;  3G1L A;  4OQZ A;  4XIC A;  4QTR A;  1PGJ A;  3JRE A;  1H88 C;  1JTY A;  2K9Q A;  1QPI A;  1IRZ A;  4XK4 A;  1RES A;  1JUM A;  3FR8 A;  1LFU P;  2B63 J;  3K6J A;  3ZOB A;  3LOC A;  1LSJ A;  3A03 A;  3ZQG A;  5M3F J;  2E19 A;  2E2J J;  3S1Q J;  4S3M A;  3JRF A;  1K61 A;  1YON A;  5EGO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...