2Y9ZA

Chromatin remodeling factor isw1a(del_atpase) in dna complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
287
structure length
287
Chain Sequence
RSSTPSHPRMPKPHVFHSHQLQPPQLKVLYEKERMWTAKKTGYVPTMDDVKAAYGDISDEEEKKQKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDATKDRMKKED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Mechanism of the Chromatin Remodelling Factor Isw1A
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)
total genus 70
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09110 HAND HAND
A PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9zA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9zA04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2y9zA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 2y9zA03
1S7EA 3E7LA 2ELKA 3SFIA 4A3GJ 3LSGA 2W48A 2E2JJ 4B4CA 4RBOA 1DU6A 1SANA 1JKRC 4JQ0D 3ZOBA 3S14J 2GBYA 2ECBA 1RKTA 2CRGA 2NVQJ 1NK2P 1F36A 3W6VA 3S17J 5M3MJ 3FISA 1D5YA 3HGYA 5IP9J 1POGA 2RAEA 2WB1N 1IG7A 3I4MJ 5GPAA 1FTTA 4AYBN 1GVDA 1OFCX 5F0HA 5J3LA 4QIWN 3LOCA 5IYCJ 5EYRA 3BTLA 3GTPJ 1B72B 3LSPA 1ETKA 1B72A 3Q0VA 1JJ6C 4A93J 5E3NA 1W0TA 2X48A 3BR5A 2VPRA 1TWGJ 5EG0B 1JUMA 3HOVJ 1HDPA 2YUSA 3Q0UA 3S2DJ 2VKVA 3HOZJ 4LOCA 3TW7A 1JTYA 1JT6A 3IH2A 2HQ5A 2NOGA 4DZPA 4JX5A 2O7OA 3RQIA 2Y30A 2ID6A 1ZKGA 4C3HJ 4QTRA 1A5JA 4M3DA 3HOXJ 4S0HB 1MH4A 1VI0A 3RZOJ 1GT0C 1HCRA 1I6HJ 4NDLA 5C4JJ 4FISA 3S1MJ 1TWFJ 1JT0A 2EZKA 5FKNA 1FEXA 2DMPA 2HYJA 1B8IB 4A3MJ 3LSJA 3S15J 3JRIA 1ENHA 2NVTJ 2VUMJ 2VI6A 3JRHA 2O9LA 2E19A 1G2HA 2JA8J 5JLXA 1BW6A 4JP0A 5M5XJ 2DMTA 3K2AA 2HOTA 3JRGA 5EEAA 2HXIA 3TEDA 2XGEA 2YU9J 2JA7J 1HOMA 4DCKA 4M3BA 4A3BJ 2MGQA 4XRSA 5FKOA 3BR0A 1MH3A 2O8KA 4BY1J 2DTZA 1ZGWA 1FTZA 4D5FA 4HNVA 1IUFA 2LLKA 4I76A 1E3OC 1QPIA 2OF7A 3BTJA 1LFUP 2R5ZB 4MLOA 4JX4A 3LNQA 2DA3A 1O4XA 5IP6A 5M5WJ 3GTLJ 2JMWA 2K9QA 1ITYA 3S1NJ 2ME0A 1GV5A 4D7NA 2AHQA 1UHSA 4DYCA 3S2HJ 3JRBA 2R5YB 1ETXA 3RZDJ 3OIOA 2WAQN 4X1EA 5IOYA 2R92J 1X58A 3I4NJ 2OPTA 4UUSB 1QVUA 5BNGA 2COBA 5FLMJ 5FLVA 1LE8B 1X2NA 3BR3A 1TC3C 4FE4A 4BXXJ 4XICA 1P7IA 4I6ZA 3BG9A 3HOYJ 3PO2J 4D7MA 5K7ZA 5FKKA 4X6AJ 1WGXA 3MN2A 1IRZA 3DCFA 3QPLA 1RPWA 4IHYA 3HB9A 2EZIA 1U9NA 3FK7A 1T33A 5EG0A 3K7AJ 3H3VK 1Z77A 5F1JA 4DZJA 1ETOA 5EDNA 2EH3A 1Q1VA 3ZQLA 2R5YA 5F27A 3GTMJ 2IEKA 3BQYA 1AKHB 5FJ8J 1SFOJ 2MW8A 4GFBA 9ANTA 2ME6A 3PO3J 5EZHA 1PUFA 1F43A 2L0KA 1OJLA 1PUFB 2B63J 2JJ7A 4BBSJ 3A03A 4RDUA 4A3FJ 3QQAA 4Y7NJ 2TCTA 3G1OA 2DMUA 3MKLA 2DN0A 4MFEA 2ZB9A 3HOUJ 1IGNA 3JREA 1MBEA 2DA2A 3TP0A 3OSFA 3JRCA 3GBGA 2MG4A 4ABZA 2M9HA 4IEJA 3IV5A 4XK4A 1MSEC 1TWHJ 1Y1WJ 1BL0A 3M3YJ 5IYBJ 3C2BA 1MBFA 2XRLA 1WH7A 2EZHA 1WCMJ 2CQXA 2Y0SN 1R9TJ 2JA6J 2CUFA 2R7ZJ 2G0EA 1OCTC 1VNDA 4CYCA 1FIAA 2KT0A 2CJJA 1HF0A 2R5ZA 4FTHA 2GM4A 5K7HA 2HOSA 3NARA 1DU0A 5F0FA 3IH3A 3JR9A 2M8GX 1XC5A 4AC0A 1K83J 1JKOC 2H1KA 3S1RJ 2XGDA 4Y52J 4W1UA 4IHXA 4B3AA 1H8AC 2L7FP 2DA6A 2LFBA 4DYQA 3B6CA 5GP9A 5IOZA 2K9SA 1VF9A 4DYRA 3GTQJ 5EGOB 3VPRA 3UKGA 2JA5J 2WV1A 5F0CA 4A3CJ 1GDTA 4BBRJ 2NVXJ 2DA7A 1TWAJ 4JPZB 2DMQA 2JK3A 3SJMA 2DA4A 1ETQA 1UG2A 2XPUA 1RESA 3HGGA 3OOUA 2E2HJ 2HOAA 4EEFG 4OVNF 4A3IJ 1ZR2A 1I3QJ 1JJ8C 3S16J 3ZQFA 5E3OA 3BR2A 3HKZN 1ETWA 3ZQCA 2XGCA 1UMQA 5EZGA 3LSRA 2YS9A 3HDDA 2FJ1A 5DTDA 2ECCA 1RETA 2FD5A 4M3GA 4B1RA 5DS9A 5IP7J 1MNMC 4C3JJ 5C44J 4BKXA 1Z0XA 1JKPC 2HI3A 3D1NI 4A3JJ 3IH4A 3HEFA 1A6IA 3A01A 1JUPA 3JRFA 2HDDA 5FKLA 5J1RA 4M6VA 1ZQ3P 3GTKJ 2LVSA 1APLC 5J1UA 1W0UA 2D5VA 4JYKA 3ZQHA 4D5CA 2H8RA 3BQZA 2K9NA 2GLOA 1RKWA 3CQZJ 1IDZA 1YRNB 5E3MA 2CU7A 4JX6A 1FJLA 2XSDC 2XPWA 4A3KJ 2R93J 1QRYA 1BW5A 3RKQA 2HXOA 2NS8A 2CUEA 3BG5A 3H0GJ 5EF6A 1H89C 2L7MP 1FIPA 2KDZA 4C2MJ 3BR6A 2NS7A 1BA5A 1WPKA 4V2GA 1IDYA 3CMYA 2IBDA 2XPVA 3GTJJ 3BG3A 1NK3P 4DW6A 2DA5A 1U78A 3JRDA 2EBIA 3FK6A 2LKXA 1GV2A 1U9OA 3HM5A 1RR7A 2XB5A 5GPCA 1VFCA 3SDGA 3FIWA 2JN6A 2QF7A 3S1QJ 1ETVA 3PM1A 2Y9ZA 1Y1VJ 4XRSG 1AKHA 1TWCJ 1I50J 3MVPA 4AUXA 2FX0A 3BT9A 1AHDP 2DJNA 1MBJA 1H88C 1QVTA 3M4OJ 5IPAA 1U8BA 3FKIJ 1ZTRA 4UUSA 1JTXA 3A02A 4G12A 2IAIA 3ZQIA 4MO7A 4BY7J 1CQTA 1HLVA 4A3DJ 3G1LA 5F08A 5K7FA 3NAUA 2MSYA 3WHBA 2EZLA 3OSGA 2AO9A 1P7JA 1MBHA 5JLWA 2K40A 4C3IJ 5J1YA 1NTCA 2Y2ZA 4QSHA 1IV6A 1B8IA 2LK2A 2L9RA 1JUSA 1LFBA 2LTPA 1GUUA 2L7ZA 4A69C 2VKEA 3L1PA 5HODA 4IHVA 3HOWJ 1BJZA 2X6OA 3TW6A 4M3EA 1MBGA 2ID3A 2TRTA 4FE7A 2FQ4A 1MSFC 2LY9A 2R0QC 1XS9A 2P81A 1IC8A 2I10A 5M5YJ 2E1OA 3GTOJ 5C4XJ 3BTIA 1X2MA 4A3EJ 1JGGA 3GTGJ 2CQQA 4L5EA 1WH5A 3JRAA 1AU7A 2Y31A 1ETYA 3F0CA 3Q0WA 2LR8A 2N8GA 4J19A 1WI3A 1LE8A 5FKMA 1EF4A 4XIDA 1XG1A 4M3FA 2LP0A 3G1MA 4UUTA 3CDLA 1ZK8A 3ZQGA 4XRMA 1OCPA 1IJWC 5EGOA 5F04A 1YRNA 5C3EJ 2QCOA 2JWTA 3O8GA 4W97A 4FCYA 4V2FA 2M0CA 1MBKA 2Y9YA 1T56A 4IHWA 2DA1A 2DMNA 5IYDJ 3DEWA 2NVYJ 2PMZN 3O8HA 1ORKA 2EQRA 2X9DA 3BR1A 3CCYA 4MIMA 2M2EA 3TP3A 1K61A 5E3LA 4CYCB 2M34A 3WHCA 3A01B 1ZR4A 5M3FJ 1JKQC 1HDDC 3BTCA 3B6AA 3HBLA 2E2IJ 3QPSA 4MFDA 3Q3SA 2XB0X 2LD5A 4A3LJ
chains in the Genus database with same CATH superfamily
4UXNA 3E7LA 4IOAF 1SC7A 2HR3A 1Q82Q 2OTLI 2E2JJ 4UB6E 1Y6IA 1Z6TA 2ICWG 4ZTJA 1YHQI 5AIPA 1DU6A 3PJGA 2QYTA 2M4KA 3C18A 1HJBA 1HSTA 1JKRC 4K35A 1U5TA 4WXDA 2XV4S 1SQVG 2WWYA 4B3HA 4E21A 5MGBA 3S14J 3TGUJ 3CX5H 2GBYA 3GZ6A 2ECBA 2CRGA 1W1WE 4ZZLA 4UY8I 1EA3A 4WY4A 2KLVA 5M3MJ 3FISA 1FDIA 5AVTB 4UVAA 2JR8A 2DT7B 2A69F 1D5YA 5AVQB 5IP9J 2FXPA 3I55I 2WSSH 3E1RA 3I4MJ 4E7LA 2OGUA 2QQ8A 3OYJA 2DPUA 2IA0A 1JCDA 2WPQA 3SWYA 4OH8B 4JBAA 2G3AA 2F2EA 2YNYA 3BP8A 3EUHA 4XNFA 1HW5A 1WKMA 5ICEA 1N75A 3RL0B 5CCGA 4AYBN 3OYBA 4JYBA 1SD7A 1X9VA 1YE9A 4EM0B 3V8JA 3H0DA 1LSOA 5H2FC 3HC7A 2DLLA 4F93B 3VDXA 2G8YA 4OM8A 1B72B 3AE6C 4WY4D 1ETKA 4Q5SF 2P5VA 3WU2E 3W6KB 3H9QA 2AXLA 2K9JA 2WAQA 2UZKA 2XNXA 2QQBA 3CCUI 2X48A 2GIZA 4EIJA 2VPRA 4LD5A 1TWGJ 1YJQA 2GOMA 1JUMA 1WRJA 4GWKA 1RE3A 2IBZG 1F4KA 4HW0A 2XAGA 1NTZJ 2QQ9A 2ZXWH 2NPSC 4N78D 1OCRH 4W80A 3GUDA 2W84A 1OCCH 5ED4A 4B86A 4PV1B 3CCLI 2I5UA 1B1BA 3H1HD 4H0LB 1ODDA 2O7OA 2KRHA 2Y30A 4XKCA 3DKXA 2JKVA 1W7PB 3K6GA 3NEUA 2XROA 1JM0A 4NPDA 3BWGA 1IO2A 2RC4A 2M3AA 3DPLC 3WGHA 4QLCU 4UV8A 3MOGA 1VI0A 1G2CB 3QH9A 2Q9IA 3R6SA 1HCRA 4UVBA 2KI7B 1K78B 2VC1A 4H13B 4G7OF 2F5EA 3H1JE 3VP8A 3UR3C 1L0NG 3CCVI 1FP2A 3OL4A 3MAJA 3PSFA 1DGRM 4BE2A 3QRFF 1NTKJ 4A3MJ 2MH9A 3CXHI 3M8FA 1U7MA 2RV8A 2BCCE 1GL2D 2E7WA 2VT3A 2NVTJ 1D0ZA 5J8FA 2VUMJ 4YFXF 2O9LA 1JY3P 1NTZG 4PJLA 5B66H 2G7UA 4L9TA 5AVYB 4JP0A 4MGRA 2M7AA 3K2AA 2M4GA 3H32A 5EEAA 2HXIA 3U1CA 2D45A 1PP8F 5FB2A 3J80Z 4I7ZC 3ZMSA 5BS6A 1T8IA 5ICFA 2E42A 4A3BJ 2MGQA 4XRSA 2DO7A 3Q5FA 5J40A 1MH3A 1PPJD 4BY1J 2QBYA 3H25A 4ETSA 3CCSP 4L76A 1YHQP 2DTZA 2EILH 3G2BA 1ZGWA 4GO1A 1B9MA 1IUFA 4LK1F 4HH2A 5DCMA 3ASNH 2HPMA 3V2PA 2AXCA 2OF7A 2E1NA 4IFFA 2OQQA 3PSIA 1X3WB 3LNQA 1QU3A 3TKYA 1JMBA 1LTJB 2KZIA 1IJDB 5E79E 1L0NJ 3I64A 1M1EB 2VXDA 3CKYA 5A2QK 2K9QA 1F17A 2BASA 2A05A 2Y69H 1D1AA 3HTKB 2ME0A 1BCCD 2C0XA 3IC7A 4BYYA 1STZA 1GV5A 5IY5H 4D7NA 4HG2A 1EDKA 3ZCOA 2F5FA 2AHQA 1EZVG 5KAFH 1WP4A 1LUJB 3EPZA 3GXOA 1R58A 1S7AA 3MKZA 1ETXA 2DW3A 1KU3A 3Q9SA 4HSRA 3OIOA 4BQAA 4X1EA 3W2AA 2D2CB 4RB2C 3GVAA 4M74A 1WQ2A 2DFHA 2DJIA 2VBYA 3CJTB 4OGQC 1OISA 2HTJA 5E17F 3K96A 2BY1A 3ZWBA 2Q3IA 2VQLA 1ZW0A 4D6TE 3RI4A 3CWBE 2OPTA 1BOBA 3BROA 4LLGF 1EJ9A 2COBA 1BR2A 2O3FA 4P55A 1X0VA 1L0LG 2ZJSE 2BBYA 3P7KA 3FX0A 1SQXG 3C7JA 3FXQA 2ZMEB 2XV5A 4FE4A 3I3LA 5ICCA 1P7IA 2A3SA 2R3SA 3BG9A 2DU9A 4MEXF 4GT1A 2JA2A 4D7MA 1KYOH 1PDNC 1PGQA 5FKKA 5LFAA 4X6AJ 2KB7P 1YTYA 4R8HA 3MN2A 2X6YA 2F5CA 2VQGA 2VJIA 1IRZA 1BE3D 2QIWA 4FX4A 3JCUE 4PJMA 4YG2F 3BZ6A 1KC8Q 4RGSA 5CLSA 3HL2A 2EZIA 1VQ6P 1OW8A 3PEFA 4P9UA 1J9IA 4YTPC 2POHA 3CESA 1EZVI 1RUOA 2W85A 2O6GE 5D4SA 5E1WA 1T3UA 2EH3A 4IL6H 2QSHX 1GL2B 1FBSA 1K05A 4IZZA 1WJAA 1NKZB 3VYSB 2R5YA 5F27A 3ABTA 1VQ6I 3ADOA 1KQ9A 5A2QZ 2RVCA 4R4MA 3DXJF 4B09A 1HW1A 5L8RJ 2B7EA 2L2OA 2OBPA 3H3ZA 2ME6A 4CZZA 3CWBD 1D5VA 2R7DA 1X0TA 2QLZA 1E3HA 5EZHA 2JQ7A 1PUFA 1VQ9I 2J5UA 2WWWA 2IFMA 1SFCB 4GRIA 4RDUA 4A3FJ 4L9NA 2Z16A 1DD3A 2HZTA 1NU1J 1PGPA 5CCGC 2TCTA 1TQPA 1YIJP 3G1OA 3CP2A 3ZRGA 3AE4C 4PSWA 1TQIA 2ZB9A 4G94A 4AIDA 1GL2C 1HH0A 3JW4A 3M1EA 1MBEA 1FZEA 2X58A 3BJAA 1F1ZA 4HQMA 4PCQA 1FZAA 2LXBA 3CCRI 2QENA 2MG4A 3LSHA 1FYLA 4ABZA 2M9HA 3JC22 5TISE 1M1KQ 4EJVA 4IEJA 2OU2A 3FXKA 5F6FA 1YG2A 3L36A 2IGNA 5KJ7C 1YJ9P 1MSEC 1R1UA 2XF6A 4NQWA 3S3OA 3IQDB 2W6JH 2LBFB 3H1LE 1XTAA 3SZGA 3WFIA 2HYGD 1KMIZ 4BE0A 4R1HA 3ZMTA 5EEHA 4ZKPA 2FYUK 1AWCA 5AW1B 2E76C 1MMSA 4XSXF 4JF7A 4EM1A 2G0EA 1FOXA 3ERMA 1OCTC 5DYMA 1VDFA 3CCVP 1FIAA 2KT0A 1L3LA 1AVYA 3IAS2 4YCAA 2QWWA 4XLEA 4WCGA 3VOPA 1DU0A 5KLIC 5F0FA 2YX7A 3OR1C 3MKWB 1ACIA 1OVRA 1PGOA 1XC5A 1XTGB 1K83J 3D5RC 1LQ1A 2H1KA 2LYCA 3E97A 5HLGA 3S1RJ 4W1UA 2VE8A 4IQ4A 1LGHB 1NWQA 2ZNZA 1H8AC 3L74D 3RL0C 2DPDA 4I7HA 2LFBA 1NTMD 2IRFG 3BJOA 2IBZD 1B59A 3ABKH 5AIQA 3MUDC 2IT0A 1X19A 1IC2A 1BR1A 2RQPA 3R0AA 2P10A 4DYRA 3UKGA 1RQUA 3K4MA 2WV1A 5F0CA 3ROUA 3MQ0A 5F64A 4A3CJ 2NVXJ 3HHHA 1JDJA 4Z1MH 1IUYA 2GIVA 4KT0J 2DMQA 1ZCJA 3FHNA 3CCUP 4ZYDA 2OCCH 1SFKA 1VQ4I 1I27A 3HIFA 2V1DA 3GZNB 4MHGA 1SQXD 2R5BA 3EQ2A 1Y47A 2DA4A 4CSWA 4UB6H 3JSVC 1NTZD 4WVZA 2XVCA 1VQOI 4YFNF 1VQNI 3B5NB 4R79A 1K78A 1UJ8A 3A0BE 1RESA 3HE5B 1DIPA 4EJWA 2L9NA 3B5NC 3VYUB 1XMKA 1QNTA 1ZRTE 2DQLA 3PJSK 2JO1A 5LHIA 1ZGJA 3L7WA 1H89A 1VQNP 4Y99C 3CI9A 3EFGA 2VJ4A 1OR7A 2WAFA 4KN4X 2FBHA 3CCJP 4F7ZA 1L0NK 4BU2A 3LSRA 4M3LA 5D5VB 4WY4C 3H1JJ 2Y48A 4CHUA 1RETA 1FAVA 3EUKL 2YR2A 2AXTE 2NNYA 2QJKB 2KLUA 1U5TB 4JYCA 3H3UA 5CQGA 2Y75A 2IS1A 4XRFA 2HI3A 3F23A 4IQJA 4A7PA 5B1BH 3L72J 4HRIA 4MQVA 4DZOA 1R00A 2KIUA 2I1JA 4LITA 1A6IA 3VSKA 1JUPA 3AEFC 4I99C 1IN7A 2YX4A 1HBWA 3MMYB 1KB9D 1VTNC 1IV8A 1USSA 1S3JA 3OMYA 2YKOA 3M0DC 1URQA 2V7FA 4N9IA 2LVSA 2FE3A 2ZFCA 4BXLA 1KB9E 2LKMA 4D5CA 4B43A 3G6EI 2K37A 2HPCA 1BCCG 3CMEI 1H9GA 2A68F 2XASA 3BQZA 2UXNA 5BPIA 1DPRA 2L4AA 1IDZA 3FMQA 1W36C 3FF5A 4HJGH 5CYVA 3USSA 2IGOA 4PZJA 3ITKA 1JTHA 5LRRA 3L37A 3QPTA 5IT3A 4WY4B 1V54H 2ESNA 2QM8A 2ZFUA 2ZXIA 3DKYA 3K4BA 3RCOA 3BG5A 1F5TA 2AQEA 4KMFA 5KKZB 3KYCB 4C2TA 3W6JB 4EI2A 4XKWA 3L72G 1FIPA 4XONA 1NTME 3F8CA 2YU3A 4RAGA 1DP7P 5HS8A 1HBXG 3I59A 4BGDA 2E71A 4C2MJ 2Z5HA 1HKSA 4A0YA 1I3AA 1IN8A 3KEQA 4B44A 1BGYD 5GAEJ 4IHTA 5AONA 3J7AO 1NU1D 4Y28J 4HOBA 3SZPA 1FZCA 2R7FA 4RMNA 3DPUA 1Y39A 2A6HF 1BE3G 1ULYA 3VODA 4HYTB 1TW2A 1U5TC 5ICGA 1ZG1A 3ZXSA 1ZOYC 2K9JB 3A7OA 5GTIE 2FUG2 2BVLA 4HBLA 4EQQA 1LDDA 4S3MA 3P32A 4I09A 2KZGA 1PP9J 3KZZA 1R71A 1K79A 2LG4A 1DUXC 3CZ6A 4J0FA 2DOAA 2MLKA 2FYUE 3A2AA 4U7JA 4L5JA 4ENMA 2QF7A 4UB6C 3S1QJ 2Y9ZA 1VQ8I 2L4MA 2R44A 2KP6A 4GODA 3VMYA 3CCEP 1YLFA 3U21A 1HA8A 3WG9A 1AHDP 2VB6A 1MBJA 2PBIA 2RDPA 1H88C 1QVTA 2H09A 2JTVA 3GHGB 4ZDOA 2YMYA 1ZTRA 4XKVA 2GUSA 2NRGA 3H1IG 3N7NA 2MA3A 5FROA 1RNLA 3HXLA 1HLVA 1DEEG 5F08A 5HLTA 2R7RA 1IF1A 3WHBA 4BH9A 3MZYA 2V9VA 4P1WA 3CCJI 3OSGA 2XF7A 2AO9A 1LJ9A 2K7LA 3BZCA 4OMZA 4BJ5C 4I2LC 4TT3H 1MBHA 5D5WB 4U3FE 3H35A 3LSTA 3BJ6A 2K40A 3OS1A 1P4AA 1YOVB 3K70D 2Y2ZA 1XCBA 1S2EA 2EFOA 3IF4A 3SFEC 5KLVE 1FZFA 1FZCB 2VONA 2M3EA 2IFNA 3C7AA 1SVOA 3OYEA 2FQ3A 3KYQA 3TNUA 4D6TJ 3CJRB 3WTWC 1PP9G 3TDZC 3I4PA 4HQEA 5HODA 1SQVJ 1PV3A 1YX3A 3HTSB 3OYLA 5L3GA 4M3EA 4HLYA 1IN6A 2A6TA 3I54A 4UHTA 4FE7A 4BRYA 5K5GB 4A5NA 1T08B 2FQ4A 2LY9A 2R3CA 4EYYQ 1P4WA 4BDYA 3V2NA 5B3SH 5GADJ 1XS9A 3KZYA 3RGUA 3DPTA 3I56P 3EYIA 2ZSIB 3H36A 3KETA 5C4XJ 1N86A 3BTIA 4A3EJ 2ZXXA 3VTPC 2CQQA 1J2JB 3P5JA 4RB1A 3JRAA 2X85A 4OL9A 1O3RA 1DD4A 1Z3YA 3PUFA 4XN0A 2V7QJ 1YW8A 3HOSA 3Q9VA 3F89A 3GW2A 5ERIA 2W00A 1S5LX 4JQFA 3L70D 5GTHE 1USEA 1SQBJ 5K5RA 3M07A 4A6EA 2BZTA 4EMSA 3C7CB 1EF4A 3LW5H 5KNLA 2P5KA 3PQJA 1K7AA 3I71A 4D1QA 1FZCC 1OCPA 3S2WA 1FMWA 1D8KA 1IJWC 2CW0F 2QJKC 3ECHA 1K04A 2HFHA 1CGPA 2JWTA 4W97A 4FCYA 1KILB 4UNOA 2OYHA 1UHWA 4UB8C 2RN0A 1FJKA 1V3FA 2M0MA 1NU1E 2E7XA 4ZH4F 4WBAA 3CO7C 2DA1A 2R7UA 5IYDJ 4C46A 3M1CA 1ORKA 3LA2A 5CMZA 2KZVA 4P9FA 4BHCA 3AEDC 1K61A 2GAUA 5E3LA 4PUSA 3E7KA 3LAJA 1JKQC 1H9TA 3V2QA 3PUBA 1ZREA 1MJ9A 1FC2C 5B5EH 3A2KA 3HWRA 4DOZA 3BC8A 2XB0X 2VASA 2MC3A 3VMZA 5H2FE 4NC7A 1NTKG 4BQQA 2CQNA 4WXCA 1SEUA 2JT1A 1MFTA 4RBOA 4IKFA 1YJWP 4OAZA 4RAFA 3H2ZA 3IP4B 1SANA 3RK3C 1DPUA 4RAZA 3RQ4A 1WPQA 3ZOBA 1X4PA 3CLOA 3H1IE 1IXRC 3T8TA 1OPCA 1AV1A 4HDVA 2K5CA 1RKTA 4BNCA 1MUUA 2MBFA 3AE3C 2FBWC 1OXZA 3ZQ7A 1TU3F 1K6YA 3HGYA 1IG7A 2QZ8A 4YELA 1OCOH 3FBIB 2HNHA 3I9V2 1YI2I 2W27A 1UG0A 2WMMA 2Q1KA 3WGGA 4XLNF 1UFMA 4AM3A 3E0JB 4MQ9F 1FWZA 1FY7A 4HEA2 5DD8A 3ZGYA 3HD7A 5BMZA 1X1PA 4M6XA 4CCNA 2FOKA 1WDLA 3L72D 1R5GA 1OFCX 5DM6F 3LOCA 5IYCJ 3L2RA 2KL4A 2LOOA 1ZRCA 3WTTC 1NHAA 2MFZA 3BTLA 3GTPJ 5TRDA 2NPSB 5CJ4A 3VMXA 3HD7C 4EOTA 1D1CA 3LSPA 3NQOA 1BGYG 3OA7A 1JJ6C 1FYKA 2KZJA 1N73B 5E3NA 1K6OA 1JOCA 1QQIA 1R5HA 2EJRA 2ZFWA 3BR5A 1YW9A 3AEAC 2KLOA 1YX5A 3HOVJ 4RLQA 1GTWA 3IHUA 3S2DJ 3HOZJ 2GXAA 4L0YB 1Y0UA 5DJUB 2ZXJA 1B9NA 2NRAC 1JT6A 2Z5IA 2KPMA 3IH2A 2NOGA 5DEQA 3E5XA 4JX5A 3RDIA 3H1HJ 4G6QA 1R6RA 1HSJA 3LL7A 4WF2A 4XKBA 4E7HA 4XBFA 3JSOA 3L2QA 1FBMA 4HLXA 1A5JA 1IRXA 2IGKA 4QTRA 3N97A 2CVZA 2EW2A 1UIIA 2I1KA 4W7YA 1RE3C 3HOXJ 1CF7A 3RZOJ 3TDUC 2OTJI 1L0LD 1RC9A 4NDLA 1CW5A 1SQBK 4FISA 3H1HE 3S1MJ 1TWFJ 2KMUA 5FRMA 3CMMA 1BGYJ 2KFDA 4GKGA 1GHCA 3FBNB 2PN6A 1Z6RA 2DMPA 2XHKA 3V7CA 5D5UB 2KIQA 3LFUA 1B8IB 4P5OA 2MABA 2B9BA 3V8LA 2FOWA 2NVUB 3WTZA 4HNTA 3OAKA 3NTNA 2XUBA 3HUGB 3CCSI 2XKPA 3S1KA 2QEXP 2LRDA 2VI6A 2HYFA 3V6IA 1G2HA 2JRTA 2ZT9C 5M5XJ 5D4RA 1CSBA 2EFPA 3JRGA 2YU9J 2JA7J 2XGXA 2QJPB 1N78A 4PGHA 4IM7A 3I59B 2RKLA 1IK9A 4DCKA 1JMMA 3M0DA 3B5ND 1SFCC 4KIFA 2WPRA 2JVGA 3WUTA 2QJPC 2K9YA 1A02F 2E34A 2P8TA 1ON2A 1X1AA 1J0RA 4HNVA 4DOJA 3QAHA 4I76A 5DCMB 1LB2A 1E3OC 2HEOA 5H6QA 1T0FA 3PDUA 1JCCA 1OZHA 1ZRFA 3QU6A 3L75J 3ZQQA 2HWVA 5FWNA 3VP9A 3MHVA 1KYOD 1QLED 1JHFA 5IP6A 2R32A 5M5WJ 3GTLJ 1SLQA 2KRCA 2JMWA 1YRLA 2CMPA 2PAJA 3CMEP 2PMZA 1I39A 1G8XA 2HDWA 4A2UA 3S1NJ 2FYNC 4KIGA 3H1CA 3V5BA 3VOEA 2K4BA 1OVUA 4EJOA 3ZN1A 3CL3D 1VQKI 4GDFA 2R7VA 5D6EA 3L6DA 3H5RA 2PJPA 3SHFA 1VF5C 1KD1Q 2WVRA 4YXDC 4IRIA 2K9MA 4FASD 2P67A 2FXAA 2LSOA 2QG4A 4HV6A 1X58A 2LH9A 4ESFA 2QA4I 3VB2A 3L2WA 1L0LJ 1WMKA 2P4QA 2E76B 1MMAA 2QKLB 4XLPF 2AQFA 4XMYA 3Q3CA 5JHUA 4L9JA 1U57A 4JOMA 1OLTA 2DW4A 1YO5C 4F52A 3PNVA 5BNGA 4PD4D 2ZBKA 2L9VA 1RHZB 5AVRB 1LWUA 3GLMA 4TLFA 1AFOA 3L2UA 2PG4A 1IFJA 5AW5B 4Y99B 3MCZA 1TBXA 4XICA 3QOPA 1YITP 4I6ZA 2E1CA 1M1JB 2E43A 5K7ZA 2I9PA 2A06D 2H6BA 4HF1A 1Z1DA 1KGSA 1MW7A 2WBMA 4P96A 1E0EA 1RPWA 3HB9A 5BQTA 4I0AA 3K7AJ 1P92A 4CDGA 3AG3H 4TV7A 5F1JA 4CCLA 2MJZA 2WSCJ 4H44D 5DD4A 4Y13A 5B66E 1J59A 5JFRA 3FMSA 2XDJA 3VFZA 1E3PA 4RAYA 1Q1VA 3ZQLA 1VPCA 3F8BA 1JXSA 1IRGA 4DT0A 3CCMP 2M8RA 2XAJA 3GWZA 1SFOJ 1ZH5A 4E7KA 2V9KA 5APXA 4GFBA 5EFWB 1DGWY 4U3FD 3BZKA 4ZNCA 4KT5C 4PZDA 1YONA 1NTKD 2YSRA 4ZC3A 4E7IA 1Q1HA 1F43A 3L70E 2L0KA 4BBSJ 3Q3DA 1BIBA 3I83A 3A03A 1P84I 1L4AB 4AIJA 1KFNA 2BVMA 4D9JA 3G71I 3S9OA 1E17A 3MKLA 1KQ0A 2KJBA 1Z3XA 2DN0A 4MFEA 5AYVA 1LPQA 1SQPK 3JREA 3LFKA 3TP0A 1O3QA 4B47A 2V9PA 4CUGA 3ISPA 3RK3D 4IVNA 1TQMA 1L0LE 3U59A 1HXDA 1VQ5I 3IV5A 4PK4A 3DU6A 3L2CA 3S4RA 2M1BA 3JTHA 1WDKA 3RK2C 4EV0A 2KK7A 1BL0A 4OIQF 1HF9A 2P58A 3BG6A 4C9YA 3M3YJ 3C2BA 5JE8A 1BM9A 4PSXA 4E13A 1BN5A 3GW6A 3Q2YA 1MBFA 2V7QH 1BI2A 3EUAA 2ZJRF 2O01N 1ZP0C 1IN5A 2Z3YA 2KOGA 2Y0SN 1R9TJ 2HGCA 4XN3A 5K5QA 4AIKA 2ZSHB 1ZG5A 2O5RA 5KJ7D 3CD6I 1TW3A 4CYCA 1VQMI 1YYCA 2BCCJ 1NJIQ 2A61A 3BRTB 2N1TD 3J80K 3FXDA 2K4JA 1HF0A 4XFJA 2R5ZA 3O2PE 3ERED 4FTHA 4ZMDA 1J2XA 3CCRP 1X0XA 1MFZA 1Z7UA 2MLGA 3T0YA 4CXFA 4Q4ZF 2IDBA 4E7SA 4GIFA 3JR9A 4AC0A 4Y52J 2BY3A 2KIKA 3ABVC 2FRHA 3HD7D 3D5SC 2IYPA 3NMDA 1W4MA 2X51A 1MV8A 3KE2A 1HJ0A 1SQBE 4Q48A 3P9IA 5TISC 2BYVE 2FFDB 2N1TB 3DLAA 2YPRA 1LFPA 1SQQG 1VQ9P 5EGOB 3VPRA 2FYUD 1RR8C 2JA5J 1JGSA 2C0WA 1FS0E 4BBRJ 2DFFA 2DA7A 3RKWA 4B3JA 1TWAJ 1Z9CA 4PJ0C 2JK3A 1W7PA 4G6TB 3CX5D 5LGUA 3V8KA 2KDOA 4ZZDA 5AW4B 1SFCA 4F92B 2CG4A 5CBNA 2M45A 4M9ZA 3SZTA 3TL4X 1T6AA 2MC4A 2XPUA 4RJTA 2CFOA 3GHGC 3KP7A 2F4MB 2XIGA 4FGWA 3AECC 1O57A 3H1LG 3IFMA 3KHUA 1DH3A 1PGNA 1Q81Q 3B71A 1ZR2A 1SAXA 1HC8A 1S9HA 2MD5A 3R60A 1AVOA 2IP2A 1BR4A 1LTJA 2B9SA 5AW2B 1N73A 1YS7A 4OWRB 4QPQA 1TT5B 5AW7B 3RK3E 1VQ8P 2XGCA 1UMQA 1FSEA 1FNNA 2QKMB 4ZDPA 1IL0A 2FJ1A 1N7SA 3LSIA 2LKPA 2WT7B 2HOEA 1CI6B 4PFOA 1AA7A 5B1AH 3AEEC 4BEHA 4GYGA 1V5FA 3GFMA 4IOCF 5C44J 2QVOA 1MNMC 2JP3A 4BKXA 1Z0XA 3VWBA 2YXQB 3L71G 3PRJA 5BU5A 1NTZK 2ZT9D 1P2FA 1T2KA 4M72A 3RPUD 2K3RA 5CVUA 5H6RA 1ZELA 3C1DA 4OU0A 3CD6P 3FXLA 2MD0A 3OOPA 3WE3A 4A3JJ 3HEFA 4G9YA 2QRXA 4M9SA 3JRFA 2CQKA 1A04A 1EZVE 1XPXA 4XOPA 1S5LE 2WSFH 4QWQA 1K9MQ 1URQB 4H13C 4BWNA 1IK7A 2XF5A 3AE5C 5J1UA 1W0UA 1W5TA 2O03A 4EGYA 4XORA 4CH7A 4PJJA 1Z56A 3LSMA 2L9SA 2VLAA 2KQRA 3S8PA 3L2VA 1W5CC 3KDPB 2GLOA 4I2OA 1PP9D 1RKWA 4IL6X 4UB8E 2B87A 2QE7H 2J58A 1A02J 3S3MA 1YRNB 4UVCA 2L5GB 2WPSA 4PV1C 2CU7A 1FJLA 5APTA 2XSDC 2XPWA 4U7BA 3HJEA 3HPGA 4A3KJ 1IFMA 1BW5A 1LDKB 3K10A 3G4SP 1PGJA 3L71J 1D1BA 1NU1K 3ZPLA 2DAOA 1H89C 2OQGA 2RQQA 3GLLA 1R1VA 3L73G 2OV7A 2ZT9B 5E79H 4K2EA 2AEJA 2RH0A 3BR6A 2NS7A 1BA5A 5DJTB 2AXTC 4V2GA 2X1DA 1LKXA 3J81K 4PD4I 1IDYA 5KTBA 2D2CD 3DF8A 3AE2C 2R4GA 1JY2N 5KAIE 2IBDA 2COMA 2LF7A 3GCMA 4HV5A 5LD2C 1NK3P 3AEBC 1BIAA 2PRRA 1Q7YQ 1SQBG 2XNDH 2FF4A 1YQ4C 4CCOA 3R4YA 1QHHD 1SQVE 2R7TA 2Q2EA 3QYEA 2EBIA 3FK6A 2LKXA 2MKVA 2N9BA 3VEPA 2XB5A 2ZYAA 1LT9C 3KEOA 1NOHA 5ILUA 3FDYA 3SDGA 1ZXGA 3C2HA 3IKTA 2JN6A 3U1DA 1H88A 4ZJZA 3PM1A 1Y1VJ 3GF2A 2EFNA 1TWCJ 2ADUA 2LY2A 3KIOA 4FX0A 4OINF 3GG2A 4AUXA 4J00A 2FX0A 2CW8A 4IOIH 5CQEA 4B3XA 4DJGA 2DJNA 1BBYA 2DDBA 3BCAA 1JE8A 2HG5D 3EETA 3JAMZ 1ZAOA 1OW6A 5IPAA 1DLIA 3HSEA 4WWIA 3FKIJ 3KPHA 5K5OA 1NKNA 2P2UA 3CMAI 3BY6A 5C39A 3ZQIA 1CQTA 5LLQA 1Z05A 3DLLF 4A3DJ 1CZQA 2WV0A 1J1DC 3G1LA 2CPSA 4PGGA 5K7FA 1GU4A 3NAUA 4ASNA 4FQGA 3CXHH 4AU7A 2GWRA 2EZLA 2MH2A 3HD7B 3GFIA 1P6RA 2LF8A 5JLWA 5LGTA 3A3YB 2WITA 3L75D 4C3IJ 5J1YA 4QSHA 1B8IA 1A35A 2NPSA 1L0OC 1SVLA 4PFPA 2L9RA 3MZWB 1GXQA 2FSWA 3L71E 2LKSA 3PNYA 1GUUA 4A6DA 1PIXA 1V5EA 3OYFA 1G3WA 2KSJA 3L1PA 4IHVA 2KUBA 3HOWJ 2VPLA 1MMDA 1BJZA 1EH7A 1G3SA 3BATA 2C9NY 2VT2A 4NQWB 4AYBA 3M0AA 1MBGA 4ZYAA 4KFCA 3VMAA 2F4IA 1F9NA 2WC2A 2R7XA 2B89A 2W6AA 1U0JA 1U2WA 2R0QC 1IC8A 1BE3E 4OQYA 2A06E 1QBJA 4XL9A 2UYYA 1B4AA 5AW0B 2QUFA 1IW7F 5GAHJ 1KYOE 3GTGJ 1JGGA 3QWLA 4II3A 4KUEA 5CVVA 4L5EA 5E20A 4DIQA 3JCUH 3K70C 1AU7A 1TZLA 1TL8A 4Y15A 3WTSC 2FYUG 2XU6A 4GWGA 1LEBA 3F3SA 1CF7B 2BGCA 2N8GA 3OYDA 3R61A 4J19A 4ZTFA 2DK5A 3D0SA 1LE8A 2P7JA 5FKMA 1G1IA 1WWXA 2XZRA 1YJ8A 3QHAA 1XG1A 3DV8A 4M3FA 3G1MA 3A0HH 2CV1A 5KHDA 2JSCA 5BOXA 1Y8QB 2ZNYA 4ENNA 5BVZA 2AEMA 2HZDA 1YRNA 1AQTA 1U8RA 3ULQB 2QCOA 2Z33A 1LP1B 1N7LA 2V26A 3ZP5A 2PI0A 2P0WA 1ZRDA 1MBKA 1XSXA 2E5ZA 2Y9YA 1T56A 1QZYA 3F6VA 3UNGC 4BJ6C 4IHWA 2CV2A 1S29A 4ASWA 5L3CA 5HOOA 4W7ZA 4GGGA 2DMNA 4PZCA 3BVHA 3ULKA 1T95A 1QZZA 1PP9E 1L2PA 1VQLI 3BR1A 5HS7A 4MIMA 2EFWA 4HF2A 3OWTA 4NNJA 1Q90D 2FYUJ 4L5IA 4DLLA 2VKHA 3AL0B 1S1CX 1RI7A 3WHCA 1Z67A 5ILVA 3B6AA 1SMTA 1HKTA 4BXUA 3MWMA 3P9CA 2FMLA 3QPSA 4MFDA 4AVPA 4DGWB 3Q3SA 3K6JA 4IX7A 3TK1A 2LD5A 4BXFA 3WE2A 3H1KE 2LC2A 2ZJPF 3SFIA 4A3GJ 5D6FA 4E12A 3P9KA 2W48A 3KLNA 4N78E 3CCQP 4CICA 1FP1D 4RESB 1CI6A 3G71P 1R4MB 3TSIA 2SPZA 4F55A 1ZGAA 1OIPA 2F5DA 1QX8A 2P4WA 4JQ0D 3WTVC 2E5YA 3DBHB 3GO5A 1J1EB 1VQPP 4LC1A 1OMIA 5KVRA 5IT9Z 2Z99A 3U2RA 1G6NA 2NVQJ 1NAYA 1NK2P 2O1KA 4MTDA 2STWA 3W6VA 2KISA 4LGDE 3S17J 2HQRA 4F91B 3JTGA 4HX4A 3ZMZA 4U7DA 1LWUC 3BG7A 2X0LA 2J5OA 3OYGA 3U1KA 1POGA 4C7RA 2W7NA 2OYIA 2CFXA 3FHZA 2EA2A 4M9XA 1BSNA 1QPMA 5LRSA 3SWFA 4RS8A 4UV9A 1FTTA 3L75G 2XAQA 3GHYA 2PJRB 1GVDA 2ZMEA 5FRNA 1WFXA 1F12A 2WSCH 2Q1ZB 5E1ZB 2X1EA 2Q7CA 3CO6C 4I0BA 3H92A 3M8EA 1W5SA 3RKXA 5J6XA 5EYRA 3I56I 2RN7A 2GXBA 1RH5B 3F8NA 2HKOA 4S05A 3RL0g 2AS5F 2OZUA 2WAEA 1B72A 3Q0VA 4A93J 4OWFA 4PDKA 3SFDC 1Z91A 3IAM2 4YEJA 2IS4A 2L01A 3OYHA 2M7BA 1M1JC 1W0TA 1NHLA 1QL2A 3RBXA 2EIMH 5EG0B 2E60A 3GF3A 1OCZH 3CMAP 2XAUA 4LFUA 4KA4A 2IXSA 5KKZC 5E18F 1P9QC 1S8NA 1QVGO 3F8MA 3Q0UA 3RK3B 1U6GA 3PFIA 1G1JA 2VKVA 2Z1DA 4N3YB 2XKMA 4A5MA 4LOCA 5KLVJ 1SQBD 2H1LA 4EJUA 4D3DA 3KPEA 1JHHA 4U0VA 1J7KA 1O3SA 4DZPA 5HS9A 3RQIA 1X3ZB 5K1YA 1SQVK 3OYAA 1EVZA 1ZKGA 1VQ7P 3T5XA 1L4AD 4M3DA 1R5ID 5IT9K 1JO5A 5TJHA 2JEEA 3J7AY 4U0YA 2ELJA 3JSPA 4S0HB 1D0XA 1MH4A 2KNCB 1GT0C 1OR7C 3BPXA 3L09A 5C4JJ 2UV1A 1S72I 4H13D 2GXGA 4LLHA 1G4DA 3TYYA 3OYNA 3GLXA 5FKNA 3WTXC 1F14A 3I0TA 2V4HA 3WTUC 1L4AC 3TMOA 2IS2A 2CK3H 3FX3A 5DM7F 5AW3B 2QQAA 4GDOA 4E70A 5APSA 3TO6A 1ENHA 3ZMVA 4O9BA 4IJAA 5CCHD 3JRHA 1TTYA 2JA8J 1W2EA 1BW6A 2PFBA 4PV1D 2DMTA 2YXRB 1EDLA 4ZYEA 1NG6A 2VXZA 3TEDA 4D6TD 2XGEA 5KLVG 3M91A 3IRQA 1HOMA 3V2RA 3KX2A 3H1JD 1ON1A 5FKOA 1WT6A 2XRNA 3H1KG 3U9GA 3L73D 3HSRA 1BI3A 3B73A 1FTZA 3COAC 4D5FA 3T97A 3L74E 1FOSF 2H8WA 1QPIA 3DU5A 1FOKA 1JY3O 3IN6A 5TGTA 1DLJA 1P4XA 4ENKA 2OYIC 3V42A 1A31A 4AYCA 3F9KA 4GBJA 2B0LA 2DA3A 2E35A 3T1BA 5J8CA 5CCHA 2NXNB 3AFHA 4RM2A 2NAZA 2Z4EA 3LQQA 2GOXB 4XLHA 1QZEA 5BU8B 1SD5A 1HGZA 5H20A 3C3WA 1XB4A 2JPBA 2VBZA 3CC4I 1YVEI 4BEHB 4A12A 1A36A 1FZBA 4I1LA 2JJLA 4MEYF 4BUPA 1SVMA 1UHSA 5TISH 4NB5A 1FX7A 3JRBA 3OR2C 4QMAA 5D8LB 2KYVA 3RTRA 2WAQN 5IOYA 2HODA 4FHTA 2FU4A 2EIKH 1NG7A 3KCCA 1LTAC 3I58A 3H1LD 3TGUG 1D8JA 2CGPA 2ITAA 1KN7A 4UUVA 4I98B 4L73A 4UUSB 3F3XA 2OYHC 1LJ8A 5FLMJ 3AG1H 1MJBA 3CP8A 2PX9A 3OV8A 1NGMB 4LJZF 1X2NA 3VYIA 2GF2A 2QSIA 1LVAA 3HE5A 2Q5UA 3C2GA 1J1DB 3L9FA 2JUGA 1E2XA 1RZ4A 3HRTA 4LB6B 3H9GA 4ENJA 3PO2J 1WZ2A 2HS5A 2OCEA 3OS0A 1FLIA 2KIMA 2RNGA 4OIRF 1IXCA 2M5AA 1EXJA 3RK2B 2PP6A 3O6QA 3K4LA 1KYZA 1RE4C 1M67A 1U9NA 3HZJA 1SQQJ 1T33A 5EG0A 2I8DA 1RUNA 2Z2SB 5LEJA 3CC7I 1Z77A 3H3VK 3KZIH 1FC3A 1GW4A 4DZJA 5EDNA 2HFED 4DBQA 1AOYA 3AE7C 3GMEA 3L74J 5AVXB 2IEKA 4RA2A 5FJ8J 5APUA 2MW8A 3S3NA 3QP6A 1T39A 1LT1A 1GU5A 1IFDA 4EGZA 3FXUA 4G7ZF 3CJQB 5BPDA 1KILD 1UHMA 1N1GA 4D0PA 3PO3J 5EEGA 3OS2A 3N4XA 1JY2P 2WQYC 2L5QA 1UCRA 2Q2EB 4ON0A 1OJLA 1PUFB 1RQVA 4RKUJ 1M90Q 1BCCJ 1VPDA 2OARA 3OIQA 3I53A 4Y7NJ 3DWLE 3SEZA 3EGOA 2CS3A 4OAYA 2IPQX 2IA1A 3WS7A 2DTRA 2RMZA 2GQQA 1M8OB 2YKPA 1S9KD 3OYKA 3HOUJ 2EWNA 2K9LA 1PZQA 4L18B 1IGNA 5CCGD 2DYSH 2DA2A 1NTMG 4Z2YA 4Y17A 2WPVB 5KAFE 3QWOC 4E6KG 5B66C 1KILA 1LP1A 3V7RA 2Q3EA 2E75C 2EPFA 2L3DA 3H1JG 2Y0DA 4PD4H 1TWHJ 2LMDA 1Y1WJ 5LBQA 5IYBJ 2DQRA 4PJ0E 1WH7A 1LTGC 3VYRB 5D8KB 2Q8KA 2CQXA 2BCCG 1WJ5A 3B5NA 2JA6J 2CUFA 1NTZE 3HUSA 3L71D 4I01A 5CJ9A 1BE3J 2FYZA 3LIDA 2K3FA 1D7MA 1BOAA 1J5YA 1I5ZA 2CJJA 2CWEA 4CO8A 3CX5E 3KXDA 2AEFA 5KLIB 2FFDC 4WB4A 3TF5A 5HNHA 2GM4A 2QSFX 4C30A 5K7HA 2HOSA 4MNUA 2Y0MA 2P5LC 1YB4A 1Q86Q 3IH3A 3EUHC 4RGUA 2Z9OA 3O6QB 2E1MC 2E75B 3HG9A 4XQFA 2XGDA 1HW2A 1EXIA 3K9TA 1R8EA 2EV6A 4B3AA 3BCCE 1DQUA 4DYQA 3DEUA 2PQ8A 3B6CA 3ECOA 5IOZA 3ASOH 3HSFA 2N9YB 3IUOA 3K1NA 1UZCA 2NZ2A 2YIUB 3L70G 1VF9A 1GD2E 4EJTA 5KCMA 1USDA 3MP7B 2XSJC 4ZDLA 4AQRD 2H88C 3WU2H 1U7JA 4YPCA 3QSGA 2DT5A 4U3FG 3HDHA 2R7SA 4WK8F 4LK0F 4N9HA 2BXYA 3CUQA 3OBBA 1YI2P 3D6YA 5H2FH 2OYIB 3R0JA 1IN4A 3WGIA 3K4KA 4DNCA 4BS9A 2WSFJ 3ESWB 2D1HA 5KK1A 1UG2A 2ZJ2A 1ZN5A 3HGGA 3OOUA 4I02A 3GF7A 2E2HJ 2HOAA 5KLVD 4D6TG 2QJYC 3CC2P 5EJCA 5LEKA 5FD6A 1NYHA 3W67A 3C7DB 2BW3B 2QM3A 3X2QH 1P84H 1JJ8C 3S16J 3MTUE 2TDXA 3EQLF 3ZQFA 5E3OA 2DYRH 1RY3A 1ETWA 1XGOA 3SQNA 5GTHC 1PL5A 3P8CD 2IPPA 5EZGA 3HDDA 1KFMA 2ZJQF 2FD5A 3HYIA 4M3GA 2WADA 4B1RA 1SFCD 2KS1A 4KHXA 5IP7J 1FZPB 2VBXA 2X1CA 4C3JJ 1N77A 1X22A 5D5XB 1KV4A 3RJPA 1XSDA 2EINH 4U0WA 1JKPC 2N1TA 5APQA 1KILC 1SFXA 2LDUA 1RIOH 1MZBA 3IRRA 3D1NI 2BHYA 3K4CA 3P8MC 4B8XA 3PLNA 3IH4A 3I55P 4GYIA 5APVA 2HDDA 3AEGC 2OD5A 1WJBA 3DOJA 3E3VA 3CUQB 3CLQA 4M6VA 3T8RA 2I76A 1SVFA 4KICA 1YQAA 3JCUC 4NPFX 3E6DA 1I6XA 2KJCA 3TOBA 3Q5RA 5CVJA 1SP4A 3MD2A 3ZQHA 3I5CA 1SD4A 1EVYA 2R7WA 1K4TA 1FU1A 3K0LA 3E1SA 1VF5D 2QYOA 4CYDA 1EZVD 2E74C 1QHGA 4FETA 2J59M 4C2UA 3CQZJ 1M66A 1SQQD 5L3BA 2AXTH 3DTIA 2ZXHA 3A0BC 1OVVA 3TGNA 3HUGA 1AA0A 2R93J 2VC0A 5HDNA 2CUZA 2QEXI 3ADPA 2HXOA 1LEAA 2OZ6A 4XSZF 5FLXZ 2NS8A 4BHPA 3BPVA 1ZLJA 5LHGA 4NBQA 1N73C 2OYHB 1KTMA 2QGUA 2O1JA 2LBFA 5EF6A 1LTSC 2ZAEB 3GHGA 2L7MP 1Z7LA 1VQMP 5L3FA 2ZYDA 4LIUA 2M0BA 1NH4A 3DBLB 3MGNA 3OYIA 2PLAA 5APYA 2ELHA 4BHBA 3LA7A 3HE4B 3BOQA 4ZYHA 3H1ID 4OGQD 3S93A 3ABLH 2M87A 5A9RA 2NS0A 1WPKA 3HUSB 2QBYB 3RKYA 3WTYC 2LXCB 3AE9C 3CMYA 2F6CA 3MIWA 3BG3A 1ZHFA 3P7NA 3TO9A 3SWKA 1NVOA 4DW6A 1JEKA 2DA5A 1YTZT 5FFXA 1ZV8A 1SQXK 3AAFA 2WSEJ 1BI1A 1U78A 1E79H 4KITB 2G7HA 2OA4A 4XR6A 5J47A 3C1LA 4H44C 3DTKA 3J81Z 1GV2A 1Q2NA 1T2KD 2FEZA 3HM5A 4G8XA 2W57A 2OC6A 5GPCA 3PIDA 4KIBA 3OL3A 5DUIA 1I36A 2CW7A 1IXSB 2BY0A 2HDHA 3FIWA 3SYTA 4NUBA 1ETVA 1EDJA 5A9SA 2ZMEC 1GK6A 3BT9A 4LMYA 2FXMA 1X1DA 3HN2A 2K86A 3G6EP 3F5HA 1HTLC 1GXPA 1U8BA 5M1BA 2W24A 4UUSA 1LVKA 2FBIA 3A02A 1H0MA 4N4OB 4G12A 3M7GA 3F22A 5KAIC 3BCCD 3TGUD 4BY7J 2DFEA 3VN0A 4IL6E 1EV7A 3FKJA 3AE1C 1FOSE 3GFJA 3K1MA 5B5EE 1P7JA 3FXRA 2IX7C 3A5TA 1R23A 3DQVC 1FOWA 1NTCA 2ISYA 5E79C 1IV6A 3WG7H 3BASA 2LK2A 1LFBA 3WU0A 4G6DA 4IRGA 2L7ZA 1T6SA 2GA2A 4KNYA 4HAMA 4RGRA 2X6OA 3TW6A 3V4GA 1SQPG 1Y56A 3FWEA 2L02A 5J4VA 2A45G 1K73Q 1V4RA 2TRTA 3H32B 1UELB 2W82A 1ZARA 4KN7X 3RIRA 2E1MB 1LNWA 4CPGA 4PZEA 2I10A 2KRFA 3PJRA 1X4OA 5M5YJ 2E1OA 3GTOJ 2WTBA 1FZGA 3ZR8X 1UB9A 1X2MA 2HVRA 3CC2I 1GW3A 2IA2A 1L0ND 4O5VA 2HYNA 1FE6A 1XSVA 1OYYA 3KP3A 4HF0A 3PIOF 1WH5A 3RPQA 4L9VA 5FFZA 1TT0A 1WJFA 3G3ZA 1QGKB 2Y31A 4H4KC 1MD0A 1URQD 3F0CA 3Q0WA 2ACJA 4B3IA 1G2CA 4H0LC 3SEQA 5DUKA 2Y0SA 4HNUA 1E5WA 1BSHA 1SAUA 2CSOA 1YQ3C 2Y0EA 4IFDK 3QYFA 5CBOA 3D70A 2OUMA 3E6CC 4Z6YA 1GLNA 2HVQA 3CDLA 4XRMA 3ZQGA 1KQFB 3A4CA 4XA4A 4RM3A 4JK1X 5E8GA 5HVQC 1KILE 3CWBG 3IKVA 2FNPA 3FZVA 5EGOA 1S4XA 5F04A 1SD6A 5A9SB 3CPWO 1VQ5P 3FR8A 3OYCA 3RL0D 3O8GA 2KKOA 1DEBA 2E5TA 4V2FA 3E6BA 4YXWH 4C7NB 2M0CA 1M2WA 3D1LA 2H6CA 1BCCE 2JWAA 2F5VA 2M8EA 4PJNA 3RYPA 1QO0D 2H89C 1FSHA 3DEWA 2NVYJ 2PMUA 2IYOA 1LSJA 3O8HA 2EQRA 2X9DA 4HX8A 1AQ5A 2M2EA 3TP3A 4KISA 2FKWB 1FMVA 3KZIC 2ZC2A 2M34A 2V6CA 2W8ZA 1KU9A 1HDDC 1ZR4A 1XDSA 4DYDA 1GK4A 1YTZI 2IBZE 3EWKA 2BW3A 2HQAA 3HOTA 3KP4A 1LT9B 1P84D 3G4SI 2XKOA 3HOYJ 2K02A 1ZN2A 2VRSA 1S7EA 3FGAD 2ELKA 3N4MA 1KB9I 3H5NA 3LSGA 3KQGA 4PD4E 2IVMA 1TXGA 4B4CA 2QM7A 1V55H 3WU2C 2ZCWA 5B5EC 3LMMA 3HTUA 1LTIC 4L74A 1NO4A 4BRYB 1IO4A 2NOJB 3L4FA 2A6EF 4M73A 5AVWB 4KMUX 1QVFO 3MUDA 2J5PA 2PGDA 3W6ZA 3G0OA 3ZW9A 2YKQA 2HPIA 4CZCA 2WTEA 1F36A 3OJAB 1T3JA 2QJYB 2O8XA 4BQNA 3IR9A 3FXJA 1L0NE 1Z21A 4AIHA 4O3MA 4OIPF 2M30A 2XC7A 4V19K 2WB1N 2RAEA 1X1CA 1RF1C 2ESHA 2OAZA 2N1TC 5LGNA 2CV0A 5GPAA 2WB1A 2JPCA 2OFPA 1PPJG 4OGQB 4BACA 2BHZA 1H0TB 1SQPE 3PP5A 4XLFA 1TNTA 1HGVA 5HNFA 1SMYF 3RSNA 5F0HA 5J3LA 3TQNA 4QIWN 3GEZA 2M5WA 4LLLA 1VQPI 3ZDMA 2H7HA 3HADA 3NWSA 1XMAA 4Q47A 4B48A 3R2PA 1NAFA 1WJCA 3ZGKA 1M57D 3N05A 2FMYA 3K2ZA 2V1UA 2BEQD 2VOOA 1N7SB 5KJ7A 3NRVA 2DCEA 2X6XA 2KS1B 1VQKP 3CUQC 1EH8A 3SFZA 1Z82A 3FWLA 3CDIA 3PTZA 1HDPA 2F4OB 1KB9H 2YUSA 5FGMA 4KUGA 1WDMA 3PH0A 2BY2A 3V4QA 2K27A 5DV5A 4BL0B 3TW7A 4R1NA 1JTYA 1T2KC 2VQCA 1USTA 2HQ5A 1V5GA 3FM5A 3W6UA 4X0GA 1PP7U 1IAWA 4KUHA 4HB1A 3ZWAA 1URQC 2ID6A 1RF1B 3CCEI 4C3HJ 5CVRA 2VOPA 3DKWA 1LJ2A 5HWSA 2V1NA 2W25A 2P1JA 2KNCA 1XMXA 3ELKA 2WSEH 1I6HJ 1PJRA 1TLHB 1Y0NA 3EDPA 3HPHA 4IHSA 2OYOA 1O7LA 4I6MC 3H9JA 2HLOA 3G73A 1BC8C 4BAYA 3HRSA 2EZKA 1JT0A 2Q6QA 4KJMA 1FEXA 1MGTA 2HYJA 3A1YA 3LSJA 3QODA 2W90A 5APWA 2MYSA 1T98A 2GZWA 3ZN0A 1BI0A 1TP4A 2BOLA 3JRIA 2EV0A 3S15J 3HUSC 1JTHB 1SQXE 3K69A 1NH3A 1MDMB 4XE5B 3L75E 1L0LK 3KFWX 5JI6A 3TO7A 2E19A 4ITVA 4E7JA 2CPBA 2H94A 3HRNA 4H44B 5JLXA 3KYDB 3HRUA 1ZLKA 3C8VA 3PNTA 2HOTA 3H1KJ 3MZHA 1J1EC 3PQKA 2IW5A 3CUOA 3U1AA 4M3BA 3REOA 1JY2O 5CJ0A 1XGSA 3BR0A 3LWFA 1MNDA 4XLAA 2G9WA 3E5UA 4QPOA 1R49A 2O8KA 3CTVA 1R5SA 1Y8RB 2UWMA 5CCHC 1N7SD 3B4SA 3TBIA 2LLKA 4DQ2A 5JVGF 1FOYA 4OOIA 3A0HC 1SQPD 2O3JA 4UB8H 1JB0J 3BTJA 3DEEA 1LFUP 2FA5A 2R5ZB 4MLOA 1D3YA 1LDJA 1YIOA 4EATA 4JX4A 3K1PA 1O4XA 2P7CB 1FYMA 1RRJA 4AWXB 1SQQE 3TNUB 1FDOA 2A06G 3AL0C 2JWDA 3RPUA 1S7OA 1W5CE 4LG0B 2O01J 1IFIA 2IGMA 1ITYA 1XDUA 2R7OA 2JDIH 2EV5A 1R36A 3PIPF 1YYVA 1ERDA 3LIEA 4HKZH 1BDCA 4DYCA 2H43A 2LR2A 3S2HJ 3L00A 2R5YB 1OQYA 3LQRA 3RZDJ 2QSGX 1KQLA 1LNQA 2B87B 3D6ZA 1B6AA 5KAIH 3CCLP 1PYVA 2R92J 1PPJE 2A5YB 1VZ0A 4HA8A 2ZXEB 4WX9A 3PFYA 4D3SA 1R5LA 3LW5J 1S72P 1KYWA 1VQLP 3I4NJ 5GTIH 1TNSA 2A45H 1HQCA 3I5UA 3F21A 1ZMEC 1QVUA 3DTEA 5FLVA 4I7ZB 1LE8B 1KONA 2WY7Q 2IZ1A 3ML6A 2DOEA 2OTKE 3MD0A 3Q5PA 4IO9F 3BR3A 5DDGA 1TC3C 2V6EA 2A45I 2FYNB 3RBZA 2E5NA 4BXXJ 1FJPA 3O3KA 1VQ4P 4LLNA 1RE4A 2FY8A 3G17A 4RO0A 1SQXJ 4BQOA 3P8CE 3LA3A 3V7SA 2GUVA 1X8YA 1WGXA 3L72E 1DP3A 1VF5B 3DCFA 3QPLA 3C9IA 6PAXA 2K1AA 2H8PD 4IHYA 3DFGA 1VQOP 3QYBA 1HVVA 2PEXA 1X79B 3L70J 2WT7A 1YW7A 1MZ9A 3FK7A 5E1XA 2ZO4A 5CPRB 3FWNA 3L74G 3DFUA 5GTHH 1M56D 3FXOA 4J0EA 5A9TA 1ETOA 1FBQA 1Y8AA 1QA6A 3HKZA 4ESBA 4Y3OA 3KP5A 3GTMJ 3W2VA 3BQYA 1AKHB 2YMKA 1FBUA 2B88A 1OW7A 1QL1A 3GZ5A 9ANTA 1UIXA 2CUJA 3ABMH 3W3CA 5JHFA 4PJ0H 4L0ZB 3CX5I 2A07F 5HLHA 1RF1A 4NC8A 4MTEA 3LSKA 5CKTA 2B63J 2JJ7A 4A0ZA 3A0BH 3OYMA 4HSTA 2IJLA 2V79A 3QQAA 4KUMA 3II6A 2OTLP 2E36A 1NTMJ 1W7PD 1RF0A 1S9KE 2DMUA 4O6JA 2IS6A 3TGUE 1T8ZA 2LNBA 4H0LD 2O01H 1SS1A 2DT6A 2HU9A 3NWTA 2O61A 4IL6C 2HQNA 1EKEA 1MNEA 3OSFA 2D1VA 1NTKK 3JRCA 3B8EB 3GBGA 3MZ8A 3GYHX 2HKXA 3ZW8A 2HODB 3E1IA 3Q5SA 2STTA 4LGWA 3AG4H 1F0YA 5GAGJ 4A0XA 1ZRTD 3L73J 1N8RQ 1T38A 4YIFA 4XK4A 5AVUB 3H1HG 5AVSB 2V1XA 1QGPA 3IWFA 2VBWA 2L54A 4CCJA 4R4LA 2XRLA 2EZHA 2YO3A 1N7SC 1WCMJ 3TOAA 4JBZA 1J75A 1YJ9I 3HE4A 1JI8A 3PHLA 2PMHA 3IAOA 1QEXA 4XOTA 2R7ZJ 3AKZA 1H0TA 1I1GA 3ZMDA 1LTJC 1OKRA 1PFIA 2D2WA 3D5LA 1LTBC 2NYXA 1VNDA 2FXOA 4AUWA 3KEYA 2E76D 3IWZA 4KJZA 5J4YA 2VQHA 1MMGA 4BDZA 3F8FA 1O3TA 3J7ZI 2ZYGA 4NPEA 5LHHA 3NARA 2M8GX 2JSPA 2XDVA 4HYEA 2V4JC 1JKOC 4EDFA 4HX7A 2E75D 2RKHA 1PVEA 4IHXA 2D2CC 2Z5UA 1R1TA 2L7FP 3L35A 2DA6A 1KQSO 3GFLA 3CDHA 3SSUA 2IBZI 1GVJA 5HDGA 5GP9A 1T0FC 5KAFC 2K9SA 1JUNA 3KP2A 1IZNB 4U3FJ 1X1BA 3GTQJ 1WJEA 4II2A 1S5LC 2M3BA 2PFXA 3PL8A 4M6YA 4ZYGA 3MKYB 1GDTA 1KYOI 4NHJA 1K8AQ 4JPZB 3K4JA 2K3PA 4WXHA 2HVSA 2P7VB 1MJAA 3KYLA 3SJMA 1NTMK 1WRGA 1BDDA 1KZUB 5HDKA 1YJNP 4BJTA 1W36D 2ZKZA 3F6OA 2VIXA 5HLIA 4KYWA 1K4SA 1ETQA 1ONVA 2DXIA 2VL8A 3CC7P 5CVIA 2HPCB 3CF2A 1G59A 4L75A 3HRMA 4EEFG 1NU1G 1DDNA 4A3IJ 4OVNF 4HDUA 3FMRA 1I3QJ 1M76A 1R7JA 3UIAA 2BV6A 3M8JA 4LG3A 2OQRA 4YIIA 3HKZN 3BR2A 3ZQCA 4GOEA 2EA4A 4YIRX 4D3FA 1IFPA 3CCQI 1OX3A 3IL2A 1EQ7A 4ZKUA 2YS9A 5AW6B 5DTDA 4AD9A 4OIOF 3V4WA 3WUUA 1XD7A 2W1OA 4DJAA 2ECCA 2RGVA 5DS9A 3B02A 2UUZA 1EDIA 1GMJA 4N4NB 3JAMK 3O8ZA 3G9RA 1IZ1A 2EB7A 4GXOA 3CC4P 3ONQA 2VE9A 2ZVOB 2WA0A 3BCBA 3FXMA 1C0WA 1ZYRF 3OIPA 1NTKE 1X3UA 2BEOA 1OYWA 3OY9A 1R4NB 4J01A 3ABUA 5KLVK 2P6TA 3A01A 3BCCG 3QP5A 3ZHBA 1ZG3A 5FKLA 4CCMA 1SFEA 4M71A 4XLCA 5J1RA 1M7LA 1SQQK 1KORA 1ZQ3P 3CXHE 1D0YA 3GTKJ 3KLOA 2Y0CA 1APLC 2BEZF 1YFHA 2A5WA 5ILSA 2D5VA 2R5DA 2X6WA 4JYKA 3SXYA 3O6BB 5AW9B 3RK2D 5F1RA 2H8RA 1A6QA 1UAAA 3EYYA 4IF4A 2PLYA 1EC5A 4GCVA 4IFMA 4RB0A 2FFDA 2K9NA 1SQPJ 4IXAA 3RQSA 1XN7A 3FM3A 2KP8A 2L91A 5E3MA 4JX6A 2WTYA 1O7FA 2DDAA 2KSEA 3R4KA 1QRYA 2BXZA 5AVVB 3WMM0 3RKQA 2ZVNB 1KU7A 2WZ7A 4U87A 2ISZA 3M9HA 1IRFA 2JZYA 2NPSD 2CUEA 2R7QA 3GX4X 4YFKF 3H0GJ 4FT8A 1FT9A 2HDCA 1SFUA 1S6LA 2YIUC 1REPC 2W4SA 4GOFA 2E74B 3DBRB 1ZLLA 2KDZA 4ESJA 3BCCJ 5FD5A 1S5LH 3HHGA 4LIVA 3BRVB 4ANJA 4H0EA 3T97B 1N1EA 4S04A 3AG2H 2HTSA 2XPVA 3GTJJ 2F48A 3PLRA 2EK5A 3WODF 1HUCA 1KS9A 3VSLA 3D71A 4RLFA 1P84E 3JRDA 2JRMA 4LG0A 1KQGB 3CWBJ 1U9OA 1RR7A 2BE5F 4EVIA 3CF5F 1XGNA 1M75A 2W6BA 3CXHD 4F3QA 1WHUA 1LTTC 1AJYA 2K85A 3WU1B 1XGMA 1VFCA 2D3TA 3NFQA 2VJJA 2VODA 4OMYA 2IZ0A 2KIFA 1XCVA 1XX5A 3CCMI 1U3EM 1VQ7I 1AKHA 4XRSG 4E4HA 1H8AA 2C9LY 1I50J 2Q0OA 3MVPA 2UWJE 3BDDA 4XM3A 2CH0A 1YBKA 3CTAA 3M4OJ 2P6SA 1JTXA 2DFIA 3K4NA 1BG6A 5AW8B 2IAIA 3M9BA 4MO7A 4AVZA 5E8IA 3MEXA 2YO2A 1QMGA 2K88A 2MSYA 2JVHA 1MMNA 2WY8Q 1BJAA 3MFKA 3E6MA 3H1IJ 1W2BO 1N2DC 1FDMA 4G7HF 4IRHA 2KXPB 4Y4RA 1YITI 2RREA 1JY3N 3H1KD 2CO5A 1JUSA 1MKMA 2FBKA 5FO5A 2LTPA 2M5AB 4BE1A 3H1LJ 4HZFA 2CYYA 4A69C 2DODA 2VKEA 1MDMA 2E74D 3A0HE 4K3AA 5L3EA 4C7NA 1I1SA 3QOEA 3KP6A 5AVZB 3HTKA 2NNNA 3W2WA 2ID3A 3OW2O 2GA1A 2XAFA 1YJNI 2QA4P 1WI9A 4Y33A 2EFQA 1MSFC 5TJJA 4CA0A 1GL2A 5DCFA 2PJRA 1HKQA 1FPQA 3ZMUA 2P81A 4CCKA 1G3TA 4CGZA 2EIJH 4ASVA 3K5BA 2KHMA 2L7KA 3TDKA 2DK8A 5CHXA 1R22A 2O0YA 2DOFA 2C6YA 3W68A 1KA8A 4IPAA 3J7YJ 2VJ5A 3M9AA 1XTCC 1WSUA 1KU2A 1LT9A 1ETYA 1YS6A 3KZIE 4OQZA 1HWTC 4KT6A 4LB5A 2LR8A 2OJED 3FXEA 1L4AA 4U88A 1LWUB 1WI3A 1OWAA 1G3YA 3VYTB 2JUCA 4YRVA 3GMAA 3BLYA 2UXXA 1KZHA 2X4HA 4XIDA 4EZBA 1DX7A 2LP0A 1JNMA 5L3DA 4UUTA 2VKDA 1PUEE 1J09A 1ZK8A 4N0BA 3EFFK 1OYIA 2VN2A 3H5AA 2BCCD 1IFNA 2CQ7A 4E7ZA 3E5QA 1Y9BA 3H6PA 2XAHA 5C3EJ 3WFJA 3F72A 1EH6A 3DP7A 3FR7A 2H27A 2OTJP 4RGXA 3QU3A 1SQVD 3AE8C 1YJWI 5GTIC 4RB3C 1VL2A 3RYRA 3NXSA 3WUVA 1N25A 1GZLA 1WVRA 1KQ8A 3SDBA 3QPHA 4HPQA 3S32A 2PMZN 1BGYE 2ETHA 1YIJI 4NC6A 2LREA 5FLXK 1RF0C 3CCYA 2QVAA 4EM2A 2DI3A 1BC7C 4CYCB 2W83C 2RNJA 4DBRA 3M06A 3A01B 5M3FJ 2FNAA 1M1JA 3BTCA 5JR3A 3LAPA 3L73E 4MN4C 4N6JA 3M9QA 3HBLA 1MIJA 2LY1A 2E2IJ 2DBBA 3Q1MA 4WWCA 1WJDA 3CJNA 4KDPA 3ZWCA 4A3LJ 5JVTA
chains in the Genus database with same CATH topology
1S7EA 3E7LA 2ELKA 3SFIA 4A3GJ 3LSGA 4E12A 2W48A 2E2JJ 1TXGA 4B4CA 4RBOA 1DU6A 3PJGA 3H2ZA 1SANA 2QYTA 1JKRC 4JQ0D 1WPQA 3ZOBA 4E21A 4B3HA 5MGBA 3S14J 2GBYA 2PGDA 3W6ZA 3G0OA 2ECBA 3ZW9A 1RKTA 2CRGA 2NVQJ 1NK2P 1F36A 3W6VA 3S17J 5M3MJ 3FISA 1D5YA 3HGYA 5IP9J 1POGA 2RAEA 2WB1N 1IG7A 3I4MJ 5GPAA 2OFPA 1FTTA 3GHYA 3ZGYA 4AYBN 1GVDA 1F12A 1WDLA 1OFCX 5F0HA 5J3LA 1LSOA 4QIWN 3LOCA 5IYCJ 3HADA 5EYRA 3BTLA 3GTPJ 4OM8A 1B72B 3LSPA 1ETKA 1B72A 3Q0VA 1JJ6C 4A93J 5E3NA 1W0TA 2X48A 3BR5A 2VPRA 1TWGJ 5EG0B 1YJQA 1JUMA 4GWKA 1Z82A 3HOVJ 1HDPA 2YUSA 3Q0UA 4KUGA 1WDMA 3S2DJ 2VKVA 3HOZJ 4R1NA 4LOCA 3TW7A 1JTYA 4D3DA 1JT6A 3IH2A 3W6UA 2HQ5A 2NOGA 4DZPA 4JX5A 2O7OA 4KUHA 3RQIA 2Y30A 2JKVA 3ZWAA 2ID6A 1EVZA 1ZKGA 4C3HJ 4QTRA 1A5JA 2CVZA 4M3DA 2EW2A 5HWSA 3HOXJ 4S0HB 1MH4A 1VI0A 3RZOJ 1GT0C 1HCRA 1I6HJ 3MOGA 4NDLA 5C4JJ 4FISA 3S1MJ 1TWFJ 1JT0A 2EZKA 5FKNA 1F14A 1FEXA 2DMPA 2HYJA 1B8IB 4A3MJ 3LSJA 2W90A 3S15J 3JRIA 1ENHA 2NVTJ 2VUMJ 2VI6A 3JRHA 2O9LA 2E19A 1G2HA 2JA8J 5JLXA 1BW6A 4JP0A 5M5XJ 2DMTA 3K2AA 2HOTA 3JRGA 5EEAA 2HXIA 3TEDA 2XGEA 2YU9J 2JA7J 4IM7A 1HOMA 4DCKA 4M3BA 4A3BJ 2MGQA 4XRSA 5FKOA 3BR0A 1MH3A 2O8KA 4BY1J 3CTVA 2DTZA 1ZGWA 1FTZA 4D5FA 4HNVA 1IUFA 2LLKA 4I76A 1E3OC 3PDUA 1QPIA 2OF7A 3BTJA 1LFUP 1DLJA 2R5ZB 4MLOA 4JX4A 3LNQA 5FWNA 4GBJA 2DA3A 1O4XA 5IP6A 5M5WJ 3GTLJ 3CKYA 2JMWA 1YRLA 2K9QA 1F17A 1ITYA 3S1NJ 2ME0A 1YVEI 1GV5A 4D7NA 2AHQA 1UHSA 4DYCA 1WP4A 3L6DA 3S2HJ 3JRBA 2R5YB 1ETXA 3RZDJ 3OIOA 2WAQN 4X1EA 5IOYA 2R92J 1X58A 4D3SA 3K96A 3I4NJ 3ZWBA 2P4QA 2OPTA 4UUSB 3Q3CA 1LJ8A 1QVUA 5BNGA 2COBA 5FLMJ 1X0VA 5FLVA 1LE8B 2IZ1A 1X2NA 2GF2A 3BR3A 1TC3C 4FE4A 4BXXJ 4XICA 1P7IA 4I6ZA 3BG9A 3HOYJ 3PO2J 4D7MA 5K7ZA 3G17A 1PGQA 5FKKA 4X6AJ 2I9PA 1WGXA 3MN2A 1IRZA 3DCFA 3QPLA 1RPWA 4IHYA 3HB9A 2EZIA 1M67A 1U9NA 3PEFA 3FK7A 1T33A 5EG0A 3K7AJ 3H3VK 3DFUA 3FWNA 1Z77A 5F1JA 4J0EA 5A9TA 4DZJA 1ETOA 5EDNA 2EH3A 1Q1VA 3ZQLA 2R5YA 5F27A 3GTMJ 2IEKA 3BQYA 1AKHB 3ADOA 5FJ8J 1SFOJ 2MW8A 4GFBA 9ANTA 1N1GA 2ME6A 3PO3J 4PZDA 1YONA 5EZHA 1PUFA 1F43A 2L0KA 1OJLA 1PUFB 2B63J 2JJ7A 4BBSJ 3I83A 1VPDA 3A03A 4RDUA 4A3FJ 3QQAA 4Y7NJ 1PGPA 2TCTA 3EGOA 3G1OA 2DMUA 3MKLA 5AYVA 3WS7A 2DN0A 4MFEA 2ZB9A 3HOUJ 1IGNA 3JREA 1MBEA 2DA2A 3TP0A 3OSFA 2X58A 3JRCA 3GBGA 2MG4A 3ZW8A 4ABZA 2M9HA 4IEJA 1F0YA 3IV5A 4XK4A 1MSEC 1WDKA 3IQDB 1TWHJ 1Y1WJ 1BL0A 3M3YJ 5IYBJ 5JE8A 3C2BA 3WFIA 4E13A 1MBFA 2XRLA 1WH7A 2EZHA 1WCMJ 2CQXA 2Y0SN 1R9TJ 2JA6J 2CUFA 2R7ZJ 2G0EA 1OCTC 1VNDA 4CYCA 1FIAA 2KT0A 2CJJA 4YCAA 1HF0A 2ZYGA 2R5ZA 4FTHA 2GM4A 1X0XA 5K7HA 2HOSA 3NARA 1DU0A 5F0FA 1YB4A 3IH3A 3JR9A 2M8GX 1XC5A 4AC0A 1K83J 1JKOC 1PGOA 2H1KA 3S1RJ 2XGDA 4Y52J 4W1UA 4IHXA 4B3AA 1H8AC 2L7FP 2IYPA 2DA6A 2LFBA 4DYQA 3B6CA 5GP9A 5IOZA 2K9SA 1VF9A 4DYRA 3GTQJ 5EGOB 3VPRA 3UKGA 2JA5J 2WV1A 5F0CA 4A3CJ 1GDTA 4BBRJ 2NVXJ 1JDJA 2DA7A 4B3JA 3QSGA 1TWAJ 4JPZB 3HDHA 2DMQA 2JK3A 1ZCJA 3SJMA 3OBBA 2DA4A 1ETQA 1UG2A 2XPUA 1RESA 3HGGA 3OOUA 4FGWA 2E2HJ 2HOAA 4EEFG 1PGNA 3C7DB 4A3IJ 1ZR2A 4OVNF 1M76A 1I3QJ 1JJ8C 3S16J 3ZQFA 5E3OA 3BR2A 3HKZN 1ETWA 3ZQCA 4D3FA 2XGCA 1UMQA 5EZGA 3LSRA 1IL0A 2YS9A 3HDDA 2FJ1A 5DTDA 2ECCA 1RETA 2FD5A 4M3GA 4B1RA 5DS9A 5IP7J 1MNMC 4C3JJ 5C44J 4BKXA 1Z0XA 1JKPC 2HI3A 3D1NI 4A3JJ 3IH4A 3HEFA 1A6IA 3A01A 1JUPA 3JRFA 2HDDA 3ZHBA 5FKLA 3DOJA 5J1RA 4M6VA 1ZQ3P 3GTKJ 2LVSA 1APLC 5J1UA 1W0UA 2D5VA 4JYKA 3ZQHA 4D5CA 2H8RA 1EVYA 3BQZA 2K9NA 2GLOA 1RKWA 3CQZJ 1IDZA 1M66A 3RQSA 1YRNB 5E3MA 2CU7A 4JX6A 1FJLA 2XSDC 2XPWA 4A3KJ 2R93J 1QRYA 3ADPA 1BW5A 3RKQA 2HXOA 1PGJA 2NS8A 2CUEA 3BG5A 3H0GJ 5EF6A 1H89C 2L7MP 2ZYDA 1FIPA 2PLAA 2KDZA 4C2MJ 3BR6A 2NS7A 1BA5A 5A9RA 1WPKA 4V2GA 1IDYA 1N1EA 3CMYA 2IBDA 2XPVA 3GTJJ 3BG3A 1NK3P 3PLRA 4DW6A 2DA5A 1KS9A 1U78A 3JRDA 2EBIA 3FK6A 2LKXA 1GV2A 1U9OA 3HM5A 1RR7A 2XB5A 5GPCA 1M75A 3PIDA 2ZYAA 4S3MA 1VFCA 1I36A 2HDHA 3SDGA 2D3TA 3FIWA 4J0FA 2JN6A 2IZ0A 2QF7A 3S1QJ 1ETVA 3PM1A 2Y9ZA 1Y1VJ 4XRSG 1AKHA 1TWCJ 5A9SA 1I50J 3MVPA 4AUXA 2FX0A 3BT9A 1AHDP 2DJNA 1MBJA 1H88C 3HN2A 1QVTA 3M4OJ 5IPAA 1U8BA 1DLIA 3FKIJ 1ZTRA 4UUSA 1JTXA 1BG6A 3A02A 4G12A 2IAIA 3ZQIA 4MO7A 4BY7J 1CQTA 1HLVA 4A3DJ 3G1LA 1QMGA 5F08A 5K7FA 3NAUA 2MSYA 3WHBA 2EZLA 3OSGA 2AO9A 1P7JA 1MBHA 5JLWA 2K40A 4C3IJ 5J1YA 1NTCA 2Y2ZA 4QSHA 1IV6A 1B8IA 2LK2A 2L9RA 1JUSA 1LFBA 3C7AA 2LTPA 1GUUA 2L7ZA 4A69C 2VKEA 3L1PA 5HODA 4IHVA 3HOWJ 1BJZA 2X6OA 3TW6A 4M3EA 1MBGA 2ID3A 2TRTA 4FE7A 2FQ4A 1MSFC 2LY9A 2R0QC 1XS9A 2P81A 1IC8A 4OQYA 4PZEA 2I10A 2UYYA 5M5YJ 2E1OA 3GTOJ 2WTBA 5C4XJ 3BTIA 1X2MA 4A3EJ 1JGGA 3GTGJ 2CQQA 4KUEA 4L5EA 1WH5A 3JRAA 4OL9A 1AU7A 2Y31A 1ETYA 4OQZA 4GWGA 3F0CA 3Q0WA 3F3SA 2LR8A 4B3IA 2N8GA 4J19A 1WI3A 1LE8A 5FKMA 3C7CB 1EF4A 4EZBA 4XIDA 1YJ8A 3QHAA 1XG1A 4M3FA 2LP0A 3G1MA 4UUTA 3CDLA 1ZK8A 3ZQGA 4XRMA 1OCPA 1IJWC 5EGOA 5F04A 1YRNA 5A9SB 5C3EJ 3FR8A 3WFJA 2QCOA 2JWTA 3O8GA 4W97A 4FCYA 4V2FA 3FR7A 2M0CA 1M2WA 1MBKA 2Y9YA 1T56A 4IHWA 2DA1A 2DMNA 4PZCA 5IYDJ 3DEWA 2NVYJ 2PMZN 2IYOA 1LSJA 3O8HA 3ULKA 1ORKA 2EQRA 2X9DA 3BR1A 3CCYA 4MIMA 2M2EA 3TP3A 1K61A 5E3LA 4DLLA 4CYCB 2W8ZA 2M34A 3WHCA 3A01B 1ZR4A 5M3FJ 1JKQC 1HDDC 4DYDA 3BTCA 3B6AA 3HBLA 2E2IJ 3QPSA 4MFDA 3HWRA 3Q3SA 3K6JA 2XB0X 2LD5A 3ZWCA 4A3LJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7E A;  3E7L A;  2ELK A;  3SFI A;  4A3G J;  3LSG A;  2W48 A;  2E2J J;  4B4C A;  4RBO A;  1DU6 A;  1SAN A;  1JKR C;  4JQ0 D;  3ZOB A;  3S14 J;  2GBY A;  2ECB A;  1RKT A;  2CRG A;  2NVQ J;  1NK2 P;  1F36 A;  3W6V A;  3S17 J;  5M3M J;  3FIS A;  1D5Y A;  3HGY A;  5IP9 J;  1POG A;  2RAE A;  2WB1 N;  1IG7 A;  3I4M J;  5GPA A;  1FTT A;  4AYB N;  1GVD A;  1OFC X;  5F0H A;  5J3L A;  4QIW N;  3LOC A;  5IYC J;  5EYR A;  3BTL A;  3GTP J;  1B72 B;  3LSP A;  1ETK A;  1B72 A;  3Q0V A;  1JJ6 C;  4A93 J;  5E3N A;  1W0T A;  2X48 A;  3BR5 A;  2VPR A;  1TWG J;  5EG0 B;  1JUM A;  3HOV J;  1HDP A;  2YUS A;  3Q0U A;  3S2D J;  2VKV A;  3HOZ J;  4LOC A;  3TW7 A;  1JTY A;  1JT6 A;  3IH2 A;  2HQ5 A;  2NOG A;  4DZP A;  4JX5 A;  2O7O A;  3RQI A;  2Y30 A;  2ID6 A;  1ZKG A;  4C3H J;  4QTR A;  1A5J A;  4M3D A;  3HOX J;  4S0H B;  1MH4 A;  1VI0 A;  3RZO J;  1GT0 C;  1HCR A;  1I6H J;  4NDL A;  5C4J J;  4FIS A;  3S1M J;  1TWF J;  1JT0 A;  2EZK A;  5FKN A;  1FEX A;  2DMP A;  2HYJ A;  1B8I B;  4A3M J;  3LSJ A;  3S15 J;  3JRI A;  1ENH A;  2NVT J;  2VUM J;  2VI6 A;  3JRH A;  2O9L A;  2E19 A;  1G2H A;  2JA8 J;  5JLX A;  1BW6 A;  4JP0 A;  5M5X J;  2DMT A;  3K2A A;  2HOT A;  3JRG A;  5EEA A;  2HXI A;  3TED A;  2XGE A;  2YU9 J;  2JA7 J;  1HOM A;  4DCK A;  4M3B A;  4A3B J;  2MGQ A;  4XRS A;  5FKO A;  3BR0 A;  1MH3 A;  2O8K A;  4BY1 J;  2DTZ A;  1ZGW A;  1FTZ A;  4D5F A;  4HNV A;  1IUF A;  2LLK A;  4I76 A;  1E3O C;  1QPI A;  2OF7 A;  3BTJ A;  1LFU P;  2R5Z B;  4MLO A;  4JX4 A;  3LNQ A;  2DA3 A;  1O4X A;  5IP6 A;  5M5W J;  3GTL J;  2JMW A;  2K9Q A;  1ITY A;  3S1N J;  2ME0 A;  1GV5 A;  4D7N A;  2AHQ A;  1UHS A;  4DYC A;  3S2H J;  3JRB A;  2R5Y B;  1ETX A;  3RZD J;  3OIO A;  2WAQ N;  4X1E A;  5IOY A;  2R92 J;  1X58 A;  3I4N J;  2OPT A;  4UUS B;  1QVU A;  5BNG A;  2COB A;  5FLM J;  5FLV A;  1LE8 B;  1X2N A;  3BR3 A;  1TC3 C;  4FE4 A;  4BXX J;  4XIC A;  1P7I A;  4I6Z A;  3BG9 A;  3HOY J;  3PO2 J;  4D7M A;  5K7Z A;  5FKK A;  4X6A J;  1WGX A;  3MN2 A;  1IRZ A;  3DCF A;  3QPL A;  1RPW A;  4IHY A;  3HB9 A;  2EZI A;  1U9N A;  3FK7 A;  1T33 A;  5EG0 A;  3K7A J;  3H3V K;  1Z77 A;  5F1J A;  4DZJ A;  1ETO A;  5EDN A;  2EH3 A;  1Q1V A;  3ZQL A;  2R5Y A;  5F27 A;  3GTM J;  2IEK A;  3BQY A;  1AKH B;  5FJ8 J;  1SFO J;  2MW8 A;  4GFB A;  9ANT A;  2ME6 A;  3PO3 J;  5EZH A;  1PUF A;  1F43 A;  2L0K A;  1OJL A;  1PUF B;  2B63 J;  2JJ7 A;  4BBS J;  3A03 A;  4RDU A;  4A3F J;  3QQA A;  4Y7N J;  2TCT A;  3G1O A;  2DMU A;  3MKL A;  2DN0 A;  4MFE A;  2ZB9 A;  3HOU J;  1IGN A;  3JRE A;  1MBE A;  2DA2 A;  3TP0 A;  3OSF A;  3JRC A;  3GBG A;  2MG4 A;  4ABZ A;  2M9H A;  4IEJ A;  3IV5 A;  4XK4 A;  1MSE C;  1TWH J;  1Y1W J;  1BL0 A;  3M3Y J;  5IYB J;  3C2B A;  1MBF A;  2XRL A;  1WH7 A;  2EZH A;  1WCM J;  2CQX A;  2Y0S N;  1R9T J;  2JA6 J;  2CUF A;  2R7Z J;  2G0E A;  1OCT C;  1VND A;  4CYC A;  1FIA A;  2KT0 A;  2CJJ A;  1HF0 A;  2R5Z A;  4FTH A;  2GM4 A;  5K7H A;  2HOS A;  3NAR A;  1DU0 A;  5F0F A;  3IH3 A;  3JR9 A;  2M8G X;  1XC5 A;  4AC0 A;  1K83 J;  1JKO C;  2H1K A;  3S1R J;  2XGD A;  4Y52 J;  4W1U A;  4IHX A;  4B3A A;  1H8A C;  2L7F P;  2DA6 A;  2LFB A;  4DYQ A;  3B6C A;  5GP9 A;  5IOZ A;  2K9S A;  1VF9 A;  4DYR A;  3GTQ J;  5EGO B;  3VPR A;  3UKG A;  2JA5 J;  2WV1 A;  5F0C A;  4A3C J;  1GDT A;  4BBR J;  2NVX J;  2DA7 A;  1TWA J;  4JPZ B;  2DMQ A;  2JK3 A;  3SJM A;  2DA4 A;  1ETQ A;  1UG2 A;  2XPU A;  1RES A;  3HGG A;  3OOU A;  2E2H J;  2HOA A;  4EEF G;  4OVN F;  4A3I J;  1ZR2 A;  1I3Q J;  1JJ8 C;  3S16 J;  3ZQF A;  5E3O A;  3BR2 A;  3HKZ N;  1ETW A;  3ZQC A;  2XGC A;  1UMQ A;  5EZG A;  3LSR A;  2YS9 A;  3HDD A;  2FJ1 A;  5DTD A;  2ECC A;  1RET A;  2FD5 A;  4M3G A;  4B1R A;  5DS9 A;  5IP7 J;  1MNM C;  4C3J J;  5C44 J;  4BKX A;  1Z0X A;  1JKP C;  2HI3 A;  3D1N I;  4A3J J;  3IH4 A;  3HEF A;  1A6I A;  3A01 A;  1JUP A;  3JRF A;  2HDD A;  5FKL A;  5J1R A;  4M6V A;  1ZQ3 P;  3GTK J;  2LVS A;  1APL C;  5J1U A;  1W0U A;  2D5V A;  4JYK A;  3ZQH A;  4D5C A;  2H8R A;  3BQZ A;  2K9N A;  2GLO A;  1RKW A;  3CQZ J;  1IDZ A;  1YRN B;  5E3M A;  2CU7 A;  4JX6 A;  1FJL A;  2XSD C;  2XPW A;  4A3K J;  2R93 J;  1QRY A;  1BW5 A;  3RKQ A;  2HXO A;  2NS8 A;  2CUE A;  3BG5 A;  3H0G J;  5EF6 A;  1H89 C;  2L7M P;  1FIP A;  2KDZ A;  4C2M J;  3BR6 A;  2NS7 A;  1BA5 A;  1WPK A;  4V2G A;  1IDY A;  3CMY A;  2IBD A;  2XPV A;  3GTJ J;  3BG3 A;  1NK3 P;  4DW6 A;  2DA5 A;  1U78 A;  3JRD A;  2EBI A;  3FK6 A;  2LKX A;  1GV2 A;  1U9O A;  3HM5 A;  1RR7 A;  2XB5 A;  5GPC A;  1VFC A;  3SDG A;  3FIW A;  2JN6 A;  2QF7 A;  3S1Q J;  1ETV A;  3PM1 A;  2Y9Z A;  1Y1V J;  4XRS G;  1AKH A;  1TWC J;  1I50 J;  3MVP A;  4AUX A;  2FX0 A;  3BT9 A;  1AHD P;  2DJN A;  1MBJ A;  1H88 C;  1QVT A;  3M4O J;  5IPA A;  1U8B A;  3FKI J;  1ZTR A;  4UUS A;  1JTX A;  3A02 A;  4G12 A;  2IAI A;  3ZQI A;  4MO7 A;  4BY7 J;  1CQT A;  1HLV A;  4A3D J;  3G1L A;  5F08 A;  5K7F A;  3NAU A;  2MSY A;  3WHB A;  2EZL A;  3OSG A;  2AO9 A;  1P7J A;  1MBH A;  5JLW A;  2K40 A;  4C3I J;  5J1Y A;  1NTC A;  2Y2Z A;  4QSH A;  1IV6 A;  1B8I A;  2LK2 A;  2L9R A;  1JUS A;  1LFB A;  2LTP A;  1GUU A;  2L7Z A;  4A69 C;  2VKE A;  3L1P A;  5HOD A;  4IHV A;  3HOW J;  1BJZ A;  2X6O A;  3TW6 A;  4M3E A;  1MBG A;  2ID3 A;  2TRT A;  4FE7 A;  2FQ4 A;  1MSF C;  2LY9 A;  2R0Q C;  1XS9 A;  2P81 A;  1IC8 A;  2I10 A;  5M5Y J;  2E1O A;  3GTO J;  5C4X J;  3BTI A;  1X2M A;  4A3E J;  1JGG A;  3GTG J;  2CQQ A;  4L5E A;  1WH5 A;  3JRA A;  1AU7 A;  2Y31 A;  1ETY A;  3F0C A;  3Q0W A;  2LR8 A;  2N8G A;  4J19 A;  1WI3 A;  1LE8 A;  5FKM A;  1EF4 A;  4XID A;  1XG1 A;  4M3F A;  2LP0 A;  3G1M A;  4UUT A;  3CDL A;  1ZK8 A;  3ZQG A;  4XRM A;  1OCP A;  1IJW C;  5EGO A;  5F04 A;  1YRN A;  5C3E J;  2QCO A;  2JWT A;  3O8G A;  4W97 A;  4FCY A;  4V2F A;  2M0C A;  1MBK A;  2Y9Y A;  1T56 A;  4IHW A;  2DA1 A;  2DMN A;  5IYD J;  3DEW A;  2NVY J;  2PMZ N;  3O8H A;  1ORK A;  2EQR A;  2X9D A;  3BR1 A;  3CCY A;  4MIM A;  2M2E A;  3TP3 A;  1K61 A;  5E3L A;  4CYC B;  2M34 A;  3WHC A;  3A01 B;  1ZR4 A;  5M3F J;  1JKQ C;  1HDD C;  3BTC A;  3B6A A;  3HBL A;  2E2I J;  3QPS A;  4MFD A;  3Q3S A;  2XB0 X;  2LD5 A;  4A3L J; 
#chains in the Genus database with same CATH topology
 4UXN A;  3E7L A;  4IOA F;  1SC7 A;  2HR3 A;  1Q82 Q;  2OTL I;  2E2J J;  4UB6 E;  1Y6I A;  1Z6T A;  2ICW G;  4ZTJ A;  1YHQ I;  5AIP A;  1DU6 A;  3PJG A;  2QYT A;  2M4K A;  3C18 A;  1HJB A;  1HST A;  1JKR C;  4K35 A;  1U5T A;  4WXD A;  2XV4 S;  1SQV G;  2WWY A;  4B3H A;  4E21 A;  5MGB A;  3S14 J;  3TGU J;  3CX5 H;  2GBY A;  3GZ6 A;  2ECB A;  2CRG A;  1W1W E;  4ZZL A;  4UY8 I;  1EA3 A;  4WY4 A;  2KLV A;  5M3M J;  3FIS A;  1FDI A;  5AVT B;  4UVA A;  2JR8 A;  2DT7 B;  2A69 F;  1D5Y A;  5AVQ B;  5IP9 J;  2FXP A;  3I55 I;  2WSS H;  3E1R A;  3I4M J;  4E7L A;  2OGU A;  2QQ8 A;  3OYJ A;  2DPU A;  2IA0 A;  1JCD A;  2WPQ A;  3SWY A;  4OH8 B;  4JBA A;  2G3A A;  2F2E A;  2YNY A;  3BP8 A;  3EUH A;  4XNF A;  1HW5 A;  1WKM A;  5ICE A;  1N75 A;  3RL0 B;  5CCG A;  4AYB N;  3OYB A;  4JYB A;  1SD7 A;  1X9V A;  1YE9 A;  4EM0 B;  3V8J A;  3H0D A;  1LSO A;  5H2F C;  3HC7 A;  2DLL A;  4F93 B;  3VDX A;  2G8Y A;  4OM8 A;  1B72 B;  3AE6 C;  4WY4 D;  1ETK A;  4Q5S F;  2P5V A;  3WU2 E;  3W6K B;  3H9Q A;  2AXL A;  2K9J A;  2WAQ A;  2UZK A;  2XNX A;  2QQB A;  3CCU I;  2X48 A;  2GIZ A;  4EIJ A;  2VPR A;  4LD5 A;  1TWG J;  1YJQ A;  2GOM A;  1JUM A;  1WRJ A;  4GWK A;  1RE3 A;  2IBZ G;  1F4K A;  4HW0 A;  2XAG A;  1NTZ J;  2QQ9 A;  2ZXW H;  2NPS C;  4N78 D;  1OCR H;  4W80 A;  3GUD A;  2W84 A;  1OCC H;  5ED4 A;  4B86 A;  4PV1 B;  3CCL I;  2I5U A;  1B1B A;  3H1H D;  4H0L B;  1ODD A;  2O7O A;  2KRH A;  2Y30 A;  4XKC A;  3DKX A;  2JKV A;  1W7P B;  3K6G A;  3NEU A;  2XRO A;  1JM0 A;  4NPD A;  3BWG A;  1IO2 A;  2RC4 A;  2M3A A;  3DPL C;  3WGH A;  4QLC U;  4UV8 A;  3MOG A;  1VI0 A;  1G2C B;  3QH9 A;  2Q9I A;  3R6S A;  1HCR A;  4UVB A;  2KI7 B;  1K78 B;  2VC1 A;  4H13 B;  4G7O F;  2F5E A;  3H1J E;  3VP8 A;  3UR3 C;  1L0N G;  3CCV I;  1FP2 A;  3OL4 A;  3MAJ A;  3PSF A;  1DGR M;  4BE2 A;  3QRF F;  1NTK J;  4A3M J;  2MH9 A;  3CXH I;  3M8F A;  1U7M A;  2RV8 A;  2BCC E;  1GL2 D;  2E7W A;  2VT3 A;  2NVT J;  1D0Z A;  5J8F A;  2VUM J;  4YFX F;  2O9L A;  1JY3 P;  1NTZ G;  4PJL A;  5B66 H;  2G7U A;  4L9T A;  5AVY B;  4JP0 A;  4MGR A;  2M7A A;  3K2A A;  2M4G A;  3H32 A;  5EEA A;  2HXI A;  3U1C A;  2D45 A;  1PP8 F;  5FB2 A;  3J80 Z;  4I7Z C;  3ZMS A;  5BS6 A;  1T8I A;  5ICF A;  2E42 A;  4A3B J;  2MGQ A;  4XRS A;  2DO7 A;  3Q5F A;  5J40 A;  1MH3 A;  1PPJ D;  4BY1 J;  2QBY A;  3H25 A;  4ETS A;  3CCS P;  4L76 A;  1YHQ P;  2DTZ A;  2EIL H;  3G2B A;  1ZGW A;  4GO1 A;  1B9M A;  1IUF A;  4LK1 F;  4HH2 A;  5DCM A;  3ASN H;  2HPM A;  3V2P A;  2AXC A;  2OF7 A;  2E1N A;  4IFF A;  2OQQ A;  3PSI A;  1X3W B;  3LNQ A;  1QU3 A;  3TKY A;  1JMB A;  1LTJ B;  2KZI A;  1IJD B;  5E79 E;  1L0N J;  3I64 A;  1M1E B;  2VXD A;  3CKY A;  5A2Q K;  2K9Q A;  1F17 A;  2BAS A;  2A05 A;  2Y69 H;  1D1A A;  3HTK B;  2ME0 A;  1BCC D;  2C0X A;  3IC7 A;  4BYY A;  1STZ A;  1GV5 A;  5IY5 H;  4D7N A;  4HG2 A;  1EDK A;  3ZCO A;  2F5F A;  2AHQ A;  1EZV G;  5KAF H;  1WP4 A;  1LUJ B;  3EPZ A;  3GXO A;  1R58 A;  1S7A A;  3MKZ A;  1ETX A;  2DW3 A;  1KU3 A;  3Q9S A;  4HSR A;  3OIO A;  4BQA A;  4X1E A;  3W2A A;  2D2C B;  4RB2 C;  3GVA A;  4M74 A;  1WQ2 A;  2DFH A;  2DJI A;  2VBY A;  3CJT B;  4OGQ C;  1OIS A;  2HTJ A;  5E17 F;  3K96 A;  2BY1 A;  3ZWB A;  2Q3I A;  2VQL A;  1ZW0 A;  4D6T E;  3RI4 A;  3CWB E;  2OPT A;  1BOB A;  3BRO A;  4LLG F;  1EJ9 A;  2COB A;  1BR2 A;  2O3F A;  4P55 A;  1X0V A;  1L0L G;  2ZJS E;  2BBY A;  3P7K A;  3FX0 A;  1SQX G;  3C7J A;  3FXQ A;  2ZME B;  2XV5 A;  4FE4 A;  3I3L A;  5ICC A;  1P7I A;  2A3S A;  2R3S A;  3BG9 A;  2DU9 A;  4MEX F;  4GT1 A;  2JA2 A;  4D7M A;  1KYO H;  1PDN C;  1PGQ A;  5FKK A;  5LFA A;  4X6A J;  2KB7 P;  1YTY A;  4R8H A;  3MN2 A;  2X6Y A;  2F5C A;  2VQG A;  2VJI A;  1IRZ A;  1BE3 D;  2QIW A;  4FX4 A;  3JCU E;  4PJM A;  4YG2 F;  3BZ6 A;  1KC8 Q;  4RGS A;  5CLS A;  3HL2 A;  2EZI A;  1VQ6 P;  1OW8 A;  3PEF A;  4P9U A;  1J9I A;  4YTP C;  2POH A;  3CES A;  1EZV I;  1RUO A;  2W85 A;  2O6G E;  5D4S A;  5E1W A;  1T3U A;  2EH3 A;  4IL6 H;  2QSH X;  1GL2 B;  1FBS A;  1K05 A;  4IZZ A;  1WJA A;  1NKZ B;  3VYS B;  2R5Y A;  5F27 A;  3ABT A;  1VQ6 I;  3ADO A;  1KQ9 A;  5A2Q Z;  2RVC A;  4R4M A;  3DXJ F;  4B09 A;  1HW1 A;  5L8R J;  2B7E A;  2L2O A;  2OBP A;  3H3Z A;  2ME6 A;  4CZZ A;  3CWB D;  1D5V A;  2R7D A;  1X0T A;  2QLZ A;  1E3H A;  5EZH A;  2JQ7 A;  1PUF A;  1VQ9 I;  2J5U A;  2WWW A;  2IFM A;  1SFC B;  4GRI A;  4RDU A;  4A3F J;  4L9N A;  2Z16 A;  1DD3 A;  2HZT A;  1NU1 J;  1PGP A;  5CCG C;  2TCT A;  1TQP A;  1YIJ P;  3G1O A;  3CP2 A;  3ZRG A;  3AE4 C;  4PSW A;  1TQI A;  2ZB9 A;  4G94 A;  4AID A;  1GL2 C;  1HH0 A;  3JW4 A;  3M1E A;  1MBE A;  1FZE A;  2X58 A;  3BJA A;  1F1Z A;  4HQM A;  4PCQ A;  1FZA A;  2LXB A;  3CCR I;  2QEN A;  2MG4 A;  3LSH A;  1FYL A;  4ABZ A;  2M9H A;  3JC2 2;  5TIS E;  1M1K Q;  4EJV A;  4IEJ A;  2OU2 A;  3FXK A;  5F6F A;  1YG2 A;  3L36 A;  2IGN A;  5KJ7 C;  1YJ9 P;  1MSE C;  1R1U A;  2XF6 A;  4NQW A;  3S3O A;  3IQD B;  2W6J H;  2LBF B;  3H1L E;  1XTA A;  3SZG A;  3WFI A;  2HYG D;  1KMI Z;  4BE0 A;  4R1H A;  3ZMT A;  5EEH A;  4ZKP A;  2FYU K;  1AWC A;  5AW1 B;  2E76 C;  1MMS A;  4XSX F;  4JF7 A;  4EM1 A;  2G0E A;  1FOX A;  3ERM A;  1OCT C;  5DYM A;  1VDF A;  3CCV P;  1FIA A;  2KT0 A;  1L3L A;  1AVY A;  3IAS 2;  4YCA A;  2QWW A;  4XLE A;  4WCG A;  3VOP A;  1DU0 A;  5KLI C;  5F0F A;  2YX7 A;  3OR1 C;  3MKW B;  1ACI A;  1OVR A;  1PGO A;  1XC5 A;  1XTG B;  1K83 J;  3D5R C;  1LQ1 A;  2H1K A;  2LYC A;  3E97 A;  5HLG A;  3S1R J;  4W1U A;  2VE8 A;  4IQ4 A;  1LGH B;  1NWQ A;  2ZNZ A;  1H8A C;  3L74 D;  3RL0 C;  2DPD A;  4I7H A;  2LFB A;  1NTM D;  2IRF G;  3BJO A;  2IBZ D;  1B59 A;  3ABK H;  5AIQ A;  3MUD C;  2IT0 A;  1X19 A;  1IC2 A;  1BR1 A;  2RQP A;  3R0A A;  2P10 A;  4DYR A;  3UKG A;  1RQU A;  3K4M A;  2WV1 A;  5F0C A;  3ROU A;  3MQ0 A;  5F64 A;  4A3C J;  2NVX J;  3HHH A;  1JDJ A;  4Z1M H;  1IUY A;  2GIV A;  4KT0 J;  2DMQ A;  1ZCJ A;  3FHN A;  3CCU P;  4ZYD A;  2OCC H;  1SFK A;  1VQ4 I;  1I27 A;  3HIF A;  2V1D A;  3GZN B;  4MHG A;  1SQX D;  2R5B A;  3EQ2 A;  1Y47 A;  2DA4 A;  4CSW A;  4UB6 H;  3JSV C;  1NTZ D;  4WVZ A;  2XVC A;  1VQO I;  4YFN F;  1VQN I;  3B5N B;  4R79 A;  1K78 A;  1UJ8 A;  3A0B E;  1RES A;  3HE5 B;  1DIP A;  4EJW A;  2L9N A;  3B5N C;  3VYU B;  1XMK A;  1QNT A;  1ZRT E;  2DQL A;  3PJS K;  2JO1 A;  5LHI A;  1ZGJ A;  3L7W A;  1H89 A;  1VQN P;  4Y99 C;  3CI9 A;  3EFG A;  2VJ4 A;  1OR7 A;  2WAF A;  4KN4 X;  2FBH A;  3CCJ P;  4F7Z A;  1L0N K;  4BU2 A;  3LSR A;  4M3L A;  5D5V B;  4WY4 C;  3H1J J;  2Y48 A;  4CHU A;  1RET A;  1FAV A;  3EUK L;  2YR2 A;  2AXT E;  2NNY A;  2QJK B;  2KLU A;  1U5T B;  4JYC A;  3H3U A;  5CQG A;  2Y75 A;  2IS1 A;  4XRF A;  2HI3 A;  3F23 A;  4IQJ A;  4A7P A;  5B1B H;  3L72 J;  4HRI A;  4MQV A;  4DZO A;  1R00 A;  2KIU A;  2I1J A;  4LIT A;  1A6I A;  3VSK A;  1JUP A;  3AEF C;  4I99 C;  1IN7 A;  2YX4 A;  1HBW A;  3MMY B;  1KB9 D;  1VTN C;  1IV8 A;  1USS A;  1S3J A;  3OMY A;  2YKO A;  3M0D C;  1URQ A;  2V7F A;  4N9I A;  2LVS A;  2FE3 A;  2ZFC A;  4BXL A;  1KB9 E;  2LKM A;  4D5C A;  4B43 A;  3G6E I;  2K37 A;  2HPC A;  1BCC G;  3CME I;  1H9G A;  2A68 F;  2XAS A;  3BQZ A;  2UXN A;  5BPI A;  1DPR A;  2L4A A;  1IDZ A;  3FMQ A;  1W36 C;  3FF5 A;  4HJG H;  5CYV A;  3USS A;  2IGO A;  4PZJ A;  3ITK A;  1JTH A;  5LRR A;  3L37 A;  3QPT A;  5IT3 A;  4WY4 B;  1V54 H;  2ESN A;  2QM8 A;  2ZFU A;  2ZXI A;  3DKY A;  3K4B A;  3RCO A;  3BG5 A;  1F5T A;  2AQE A;  4KMF A;  5KKZ B;  3KYC B;  4C2T A;  3W6J B;  4EI2 A;  4XKW A;  3L72 G;  1FIP A;  4XON A;  1NTM E;  3F8C A;  2YU3 A;  4RAG A;  1DP7 P;  5HS8 A;  1HBX G;  3I59 A;  4BGD A;  2E71 A;  4C2M J;  2Z5H A;  1HKS A;  4A0Y A;  1I3A A;  1IN8 A;  3KEQ A;  4B44 A;  1BGY D;  5GAE J;  4IHT A;  5AON A;  3J7A O;  1NU1 D;  4Y28 J;  4HOB A;  3SZP A;  1FZC A;  2R7F A;  4RMN A;  3DPU A;  1Y39 A;  2A6H F;  1BE3 G;  1ULY A;  3VOD A;  4HYT B;  1TW2 A;  1U5T C;  5ICG A;  1ZG1 A;  3ZXS A;  1ZOY C;  2K9J B;  3A7O A;  5GTI E;  2FUG 2;  2BVL A;  4HBL A;  4EQQ A;  1LDD A;  4S3M A;  3P32 A;  4I09 A;  2KZG A;  1PP9 J;  3KZZ A;  1R71 A;  1K79 A;  2LG4 A;  1DUX C;  3CZ6 A;  4J0F A;  2DOA A;  2MLK A;  2FYU E;  3A2A A;  4U7J A;  4L5J A;  4ENM A;  2QF7 A;  4UB6 C;  3S1Q J;  2Y9Z A;  1VQ8 I;  2L4M A;  2R44 A;  2KP6 A;  4GOD A;  3VMY A;  3CCE P;  1YLF A;  3U21 A;  1HA8 A;  3WG9 A;  1AHD P;  2VB6 A;  1MBJ A;  2PBI A;  2RDP A;  1H88 C;  1QVT A;  2H09 A;  2JTV A;  3GHG B;  4ZDO A;  2YMY A;  1ZTR A;  4XKV A;  2GUS A;  2NRG A;  3H1I G;  3N7N A;  2MA3 A;  5FRO A;  1RNL A;  3HXL A;  1HLV A;  1DEE G;  5F08 A;  5HLT A;  2R7R A;  1IF1 A;  3WHB A;  4BH9 A;  3MZY A;  2V9V A;  4P1W A;  3CCJ I;  3OSG A;  2XF7 A;  2AO9 A;  1LJ9 A;  2K7L A;  3BZC A;  4OMZ A;  4BJ5 C;  4I2L C;  4TT3 H;  1MBH A;  5D5W B;  4U3F E;  3H35 A;  3LST A;  3BJ6 A;  2K40 A;  3OS1 A;  1P4A A;  1YOV B;  3K70 D;  2Y2Z A;  1XCB A;  1S2E A;  2EFO A;  3IF4 A;  3SFE C;  5KLV E;  1FZF A;  1FZC B;  2VON A;  2M3E A;  2IFN A;  3C7A A;  1SVO A;  3OYE A;  2FQ3 A;  3KYQ A;  3TNU A;  4D6T J;  3CJR B;  3WTW C;  1PP9 G;  3TDZ C;  3I4P A;  4HQE A;  5HOD A;  1SQV J;  1PV3 A;  1YX3 A;  3HTS B;  3OYL A;  5L3G A;  4M3E A;  4HLY A;  1IN6 A;  2A6T A;  3I54 A;  4UHT A;  4FE7 A;  4BRY A;  5K5G B;  4A5N A;  1T08 B;  2FQ4 A;  2LY9 A;  2R3C A;  4EYY Q;  1P4W A;  4BDY A;  3V2N A;  5B3S H;  5GAD J;  1XS9 A;  3KZY A;  3RGU A;  3DPT A;  3I56 P;  3EYI A;  2ZSI B;  3H36 A;  3KET A;  5C4X J;  1N86 A;  3BTI A;  4A3E J;  2ZXX A;  3VTP C;  2CQQ A;  1J2J B;  3P5J A;  4RB1 A;  3JRA A;  2X85 A;  4OL9 A;  1O3R A;  1DD4 A;  1Z3Y A;  3PUF A;  4XN0 A;  2V7Q J;  1YW8 A;  3HOS A;  3Q9V A;  3F89 A;  3GW2 A;  5ERI A;  2W00 A;  1S5L X;  4JQF A;  3L70 D;  5GTH E;  1USE A;  1SQB J;  5K5R A;  3M07 A;  4A6E A;  2BZT A;  4EMS A;  3C7C B;  1EF4 A;  3LW5 H;  5KNL A;  2P5K A;  3PQJ A;  1K7A A;  3I71 A;  4D1Q A;  1FZC C;  1OCP A;  3S2W A;  1FMW A;  1D8K A;  1IJW C;  2CW0 F;  2QJK C;  3ECH A;  1K04 A;  2HFH A;  1CGP A;  2JWT A;  4W97 A;  4FCY A;  1KIL B;  4UNO A;  2OYH A;  1UHW A;  4UB8 C;  2RN0 A;  1FJK A;  1V3F A;  2M0M A;  1NU1 E;  2E7X A;  4ZH4 F;  4WBA A;  3CO7 C;  2DA1 A;  2R7U A;  5IYD J;  4C46 A;  3M1C A;  1ORK A;  3LA2 A;  5CMZ A;  2KZV A;  4P9F A;  4BHC A;  3AED C;  1K61 A;  2GAU A;  5E3L A;  4PUS A;  3E7K A;  3LAJ A;  1JKQ C;  1H9T A;  3V2Q A;  3PUB A;  1ZRE A;  1MJ9 A;  1FC2 C;  5B5E H;  3A2K A;  3HWR A;  4DOZ A;  3BC8 A;  2XB0 X;  2VAS A;  2MC3 A;  3VMZ A;  5H2F E;  4NC7 A;  1NTK G;  4BQQ A;  2CQN A;  4WXC A;  1SEU A;  2JT1 A;  1MFT A;  4RBO A;  4IKF A;  1YJW P;  4OAZ A;  4RAF A;  3H2Z A;  3IP4 B;  1SAN A;  3RK3 C;  1DPU A;  4RAZ A;  3RQ4 A;  1WPQ A;  3ZOB A;  1X4P A;  3CLO A;  3H1I E;  1IXR C;  3T8T A;  1OPC A;  1AV1 A;  4HDV A;  2K5C A;  1RKT A;  4BNC A;  1MUU A;  2MBF A;  3AE3 C;  2FBW C;  1OXZ A;  3ZQ7 A;  1TU3 F;  1K6Y A;  3HGY A;  1IG7 A;  2QZ8 A;  4YEL A;  1OCO H;  3FBI B;  2HNH A;  3I9V 2;  1YI2 I;  2W27 A;  1UG0 A;  2WMM A;  2Q1K A;  3WGG A;  4XLN F;  1UFM A;  4AM3 A;  3E0J B;  4MQ9 F;  1FWZ A;  1FY7 A;  4HEA 2;  5DD8 A;  3ZGY A;  3HD7 A;  5BMZ A;  1X1P A;  4M6X A;  4CCN A;  2FOK A;  1WDL A;  3L72 D;  1R5G A;  1OFC X;  5DM6 F;  3LOC A;  5IYC J;  3L2R A;  2KL4 A;  2LOO A;  1ZRC A;  3WTT C;  1NHA A;  2MFZ A;  3BTL A;  3GTP J;  5TRD A;  2NPS B;  5CJ4 A;  3VMX A;  3HD7 C;  4EOT A;  1D1C A;  3LSP A;  3NQO A;  1BGY G;  3OA7 A;  1JJ6 C;  1FYK A;  2KZJ A;  1N73 B;  5E3N A;  1K6O A;  1JOC A;  1QQI A;  1R5H A;  2EJR A;  2ZFW A;  3BR5 A;  1YW9 A;  3AEA C;  2KLO A;  1YX5 A;  3HOV J;  4RLQ A;  1GTW A;  3IHU A;  3S2D J;  3HOZ J;  2GXA A;  4L0Y B;  1Y0U A;  5DJU B;  2ZXJ A;  1B9N A;  2NRA C;  1JT6 A;  2Z5I A;  2KPM A;  3IH2 A;  2NOG A;  5DEQ A;  3E5X A;  4JX5 A;  3RDI A;  3H1H J;  4G6Q A;  1R6R A;  1HSJ A;  3LL7 A;  4WF2 A;  4XKB A;  4E7H A;  4XBF A;  3JSO A;  3L2Q A;  1FBM A;  4HLX A;  1A5J A;  1IRX A;  2IGK A;  4QTR A;  3N97 A;  2CVZ A;  2EW2 A;  1UII A;  2I1K A;  4W7Y A;  1RE3 C;  3HOX J;  1CF7 A;  3RZO J;  3TDU C;  2OTJ I;  1L0L D;  1RC9 A;  4NDL A;  1CW5 A;  1SQB K;  4FIS A;  3H1H E;  3S1M J;  1TWF J;  2KMU A;  5FRM A;  3CMM A;  1BGY J;  2KFD A;  4GKG A;  1GHC A;  3FBN B;  2PN6 A;  1Z6R A;  2DMP A;  2XHK A;  3V7C A;  5D5U B;  2KIQ A;  3LFU A;  1B8I B;  4P5O A;  2MAB A;  2B9B A;  3V8L A;  2FOW A;  2NVU B;  3WTZ A;  4HNT A;  3OAK A;  3NTN A;  2XUB A;  3HUG B;  3CCS I;  2XKP A;  3S1K A;  2QEX P;  2LRD A;  2VI6 A;  2HYF A;  3V6I A;  1G2H A;  2JRT A;  2ZT9 C;  5M5X J;  5D4R A;  1CSB A;  2EFP A;  3JRG A;  2YU9 J;  2JA7 J;  2XGX A;  2QJP B;  1N78 A;  4PGH A;  4IM7 A;  3I59 B;  2RKL A;  1IK9 A;  4DCK A;  1JMM A;  3M0D A;  3B5N D;  1SFC C;  4KIF A;  2WPR A;  2JVG A;  3WUT A;  2QJP C;  2K9Y A;  1A02 F;  2E34 A;  2P8T A;  1ON2 A;  1X1A A;  1J0R A;  4HNV A;  4DOJ A;  3QAH A;  4I76 A;  5DCM B;  1LB2 A;  1E3O C;  2HEO A;  5H6Q A;  1T0F A;  3PDU A;  1JCC A;  1OZH A;  1ZRF A;  3QU6 A;  3L75 J;  3ZQQ A;  2HWV A;  5FWN A;  3VP9 A;  3MHV A;  1KYO D;  1QLE D;  1JHF A;  5IP6 A;  2R32 A;  5M5W J;  3GTL J;  1SLQ A;  2KRC A;  2JMW A;  1YRL A;  2CMP A;  2PAJ A;  3CME P;  2PMZ A;  1I39 A;  1G8X A;  2HDW A;  4A2U A;  3S1N J;  2FYN C;  4KIG A;  3H1C A;  3V5B A;  3VOE A;  2K4B A;  1OVU A;  4EJO A;  3ZN1 A;  3CL3 D;  1VQK I;  4GDF A;  2R7V A;  5D6E A;  3L6D A;  3H5R A;  2PJP A;  3SHF A;  1VF5 C;  1KD1 Q;  2WVR A;  4YXD C;  4IRI A;  2K9M A;  4FAS D;  2P67 A;  2FXA A;  2LSO A;  2QG4 A;  4HV6 A;  1X58 A;  2LH9 A;  4ESF A;  2QA4 I;  3VB2 A;  3L2W A;  1L0L J;  1WMK A;  2P4Q A;  2E76 B;  1MMA A;  2QKL B;  4XLP F;  2AQF A;  4XMY A;  3Q3C A;  5JHU A;  4L9J A;  1U57 A;  4JOM A;  1OLT A;  2DW4 A;  1YO5 C;  4F52 A;  3PNV A;  5BNG A;  4PD4 D;  2ZBK A;  2L9V A;  1RHZ B;  5AVR B;  1LWU A;  3GLM A;  4TLF A;  1AFO A;  3L2U A;  2PG4 A;  1IFJ A;  5AW5 B;  4Y99 B;  3MCZ A;  1TBX A;  4XIC A;  3QOP A;  1YIT P;  4I6Z A;  2E1C A;  1M1J B;  2E43 A;  5K7Z A;  2I9P A;  2A06 D;  2H6B A;  4HF1 A;  1Z1D A;  1KGS A;  1MW7 A;  2WBM A;  4P96 A;  1E0E A;  1RPW A;  3HB9 A;  5BQT A;  4I0A A;  3K7A J;  1P92 A;  4CDG A;  3AG3 H;  4TV7 A;  5F1J A;  4CCL A;  2MJZ A;  2WSC J;  4H44 D;  5DD4 A;  4Y13 A;  5B66 E;  1J59 A;  5JFR A;  3FMS A;  2XDJ A;  3VFZ A;  1E3P A;  4RAY A;  1Q1V A;  3ZQL A;  1VPC A;  3F8B A;  1JXS A;  1IRG A;  4DT0 A;  3CCM P;  2M8R A;  2XAJ A;  3GWZ A;  1SFO J;  1ZH5 A;  4E7K A;  2V9K A;  5APX A;  4GFB A;  5EFW B;  1DGW Y;  4U3F D;  3BZK A;  4ZNC A;  4KT5 C;  4PZD A;  1YON A;  1NTK D;  2YSR A;  4ZC3 A;  4E7I A;  1Q1H A;  1F43 A;  3L70 E;  2L0K A;  4BBS J;  3Q3D A;  1BIB A;  3I83 A;  3A03 A;  1P84 I;  1L4A B;  4AIJ A;  1KFN A;  2BVM A;  4D9J A;  3G71 I;  3S9O A;  1E17 A;  3MKL A;  1KQ0 A;  2KJB A;  1Z3X A;  2DN0 A;  4MFE A;  5AYV A;  1LPQ A;  1SQP K;  3JRE A;  3LFK A;  3TP0 A;  1O3Q A;  4B47 A;  2V9P A;  4CUG A;  3ISP A;  3RK3 D;  4IVN A;  1TQM A;  1L0L E;  3U59 A;  1HXD A;  1VQ5 I;  3IV5 A;  4PK4 A;  3DU6 A;  3L2C A;  3S4R A;  2M1B A;  3JTH A;  1WDK A;  3RK2 C;  4EV0 A;  2KK7 A;  1BL0 A;  4OIQ F;  1HF9 A;  2P58 A;  3BG6 A;  4C9Y A;  3M3Y J;  3C2B A;  5JE8 A;  1BM9 A;  4PSX A;  4E13 A;  1BN5 A;  3GW6 A;  3Q2Y A;  1MBF A;  2V7Q H;  1BI2 A;  3EUA A;  2ZJR F;  2O01 N;  1ZP0 C;  1IN5 A;  2Z3Y A;  2KOG A;  2Y0S N;  1R9T J;  2HGC A;  4XN3 A;  5K5Q A;  4AIK A;  2ZSH B;  1ZG5 A;  2O5R A;  5KJ7 D;  3CD6 I;  1TW3 A;  4CYC A;  1VQM I;  1YYC A;  2BCC J;  1NJI Q;  2A61 A;  3BRT B;  2N1T D;  3J80 K;  3FXD A;  2K4J A;  1HF0 A;  4XFJ A;  2R5Z A;  3O2P E;  3ERE D;  4FTH A;  4ZMD A;  1J2X A;  3CCR P;  1X0X A;  1MFZ A;  1Z7U A;  2MLG A;  3T0Y A;  4CXF A;  4Q4Z F;  2IDB A;  4E7S A;  4GIF A;  3JR9 A;  4AC0 A;  4Y52 J;  2BY3 A;  2KIK A;  3ABV C;  2FRH A;  3HD7 D;  3D5S C;  2IYP A;  3NMD A;  1W4M A;  2X51 A;  1MV8 A;  3KE2 A;  1HJ0 A;  1SQB E;  4Q48 A;  3P9I A;  5TIS C;  2BYV E;  2FFD B;  2N1T B;  3DLA A;  2YPR A;  1LFP A;  1SQQ G;  1VQ9 P;  5EGO B;  3VPR A;  2FYU D;  1RR8 C;  2JA5 J;  1JGS A;  2C0W A;  1FS0 E;  4BBR J;  2DFF A;  2DA7 A;  3RKW A;  4B3J A;  1TWA J;  1Z9C A;  4PJ0 C;  2JK3 A;  1W7P A;  4G6T B;  3CX5 D;  5LGU A;  3V8K A;  2KDO A;  4ZZD A;  5AW4 B;  1SFC A;  4F92 B;  2CG4 A;  5CBN A;  2M45 A;  4M9Z A;  3SZT A;  3TL4 X;  1T6A A;  2MC4 A;  2XPU A;  4RJT A;  2CFO A;  3GHG C;  3KP7 A;  2F4M B;  2XIG A;  4FGW A;  3AEC C;  1O57 A;  3H1L G;  3IFM A;  3KHU A;  1DH3 A;  1PGN A;  1Q81 Q;  3B71 A;  1ZR2 A;  1SAX A;  1HC8 A;  1S9H A;  2MD5 A;  3R60 A;  1AVO A;  2IP2 A;  1BR4 A;  1LTJ A;  2B9S A;  5AW2 B;  1N73 A;  1YS7 A;  4OWR B;  4QPQ A;  1TT5 B;  5AW7 B;  3RK3 E;  1VQ8 P;  2XGC A;  1UMQ A;  1FSE A;  1FNN A;  2QKM B;  4ZDP A;  1IL0 A;  2FJ1 A;  1N7S A;  3LSI A;  2LKP A;  2WT7 B;  2HOE A;  1CI6 B;  4PFO A;  1AA7 A;  5B1A H;  3AEE C;  4BEH A;  4GYG A;  1V5F A;  3GFM A;  4IOC F;  5C44 J;  2QVO A;  1MNM C;  2JP3 A;  4BKX A;  1Z0X A;  3VWB A;  2YXQ B;  3L71 G;  3PRJ A;  5BU5 A;  1NTZ K;  2ZT9 D;  1P2F A;  1T2K A;  4M72 A;  3RPU D;  2K3R A;  5CVU A;  5H6R A;  1ZEL A;  3C1D A;  4OU0 A;  3CD6 P;  3FXL A;  2MD0 A;  3OOP A;  3WE3 A;  4A3J J;  3HEF A;  4G9Y A;  2QRX A;  4M9S A;  3JRF A;  2CQK A;  1A04 A;  1EZV E;  1XPX A;  4XOP A;  1S5L E;  2WSF H;  4QWQ A;  1K9M Q;  1URQ B;  4H13 C;  4BWN A;  1IK7 A;  2XF5 A;  3AE5 C;  5J1U A;  1W0U A;  1W5T A;  2O03 A;  4EGY A;  4XOR A;  4CH7 A;  4PJJ A;  1Z56 A;  3LSM A;  2L9S A;  2VLA A;  2KQR A;  3S8P A;  3L2V A;  1W5C C;  3KDP B;  2GLO A;  4I2O A;  1PP9 D;  1RKW A;  4IL6 X;  4UB8 E;  2B87 A;  2QE7 H;  2J58 A;  1A02 J;  3S3M A;  1YRN B;  4UVC A;  2L5G B;  2WPS A;  4PV1 C;  2CU7 A;  1FJL A;  5APT A;  2XSD C;  2XPW A;  4U7B A;  3HJE A;  3HPG A;  4A3K J;  1IFM A;  1BW5 A;  1LDK B;  3K10 A;  3G4S P;  1PGJ A;  3L71 J;  1D1B A;  1NU1 K;  3ZPL A;  2DAO A;  1H89 C;  2OQG A;  2RQQ A;  3GLL A;  1R1V A;  3L73 G;  2OV7 A;  2ZT9 B;  5E79 H;  4K2E A;  2AEJ A;  2RH0 A;  3BR6 A;  2NS7 A;  1BA5 A;  5DJT B;  2AXT C;  4V2G A;  2X1D A;  1LKX A;  3J81 K;  4PD4 I;  1IDY A;  5KTB A;  2D2C D;  3DF8 A;  3AE2 C;  2R4G A;  1JY2 N;  5KAI E;  2IBD A;  2COM A;  2LF7 A;  3GCM A;  4HV5 A;  5LD2 C;  1NK3 P;  3AEB C;  1BIA A;  2PRR A;  1Q7Y Q;  1SQB G;  2XND H;  2FF4 A;  1YQ4 C;  4CCO A;  3R4Y A;  1QHH D;  1SQV E;  2R7T A;  2Q2E A;  3QYE A;  2EBI A;  3FK6 A;  2LKX A;  2MKV A;  2N9B A;  3VEP A;  2XB5 A;  2ZYA A;  1LT9 C;  3KEO A;  1NOH A;  5ILU A;  3FDY A;  3SDG A;  1ZXG A;  3C2H A;  3IKT A;  2JN6 A;  3U1D A;  1H88 A;  4ZJZ A;  3PM1 A;  1Y1V J;  3GF2 A;  2EFN A;  1TWC J;  2ADU A;  2LY2 A;  3KIO A;  4FX0 A;  4OIN F;  3GG2 A;  4AUX A;  4J00 A;  2FX0 A;  2CW8 A;  4IOI H;  5CQE A;  4B3X A;  4DJG A;  2DJN A;  1BBY A;  2DDB A;  3BCA A;  1JE8 A;  2HG5 D;  3EET A;  3JAM Z;  1ZAO A;  1OW6 A;  5IPA A;  1DLI A;  3HSE A;  4WWI A;  3FKI J;  3KPH A;  5K5O A;  1NKN A;  2P2U A;  3CMA I;  3BY6 A;  5C39 A;  3ZQI A;  1CQT A;  5LLQ A;  1Z05 A;  3DLL F;  4A3D J;  1CZQ A;  2WV0 A;  1J1D C;  3G1L A;  2CPS A;  4PGG A;  5K7F A;  1GU4 A;  3NAU A;  4ASN A;  4FQG A;  3CXH H;  4AU7 A;  2GWR A;  2EZL A;  2MH2 A;  3HD7 B;  3GFI A;  1P6R A;  2LF8 A;  5JLW A;  5LGT A;  3A3Y B;  2WIT A;  3L75 D;  4C3I J;  5J1Y A;  4QSH A;  1B8I A;  1A35 A;  2NPS A;  1L0O C;  1SVL A;  4PFP A;  2L9R A;  3MZW B;  1GXQ A;  2FSW A;  3L71 E;  2LKS A;  3PNY A;  1GUU A;  4A6D A;  1PIX A;  1V5E A;  3OYF A;  1G3W A;  2KSJ A;  3L1P A;  4IHV A;  2KUB A;  3HOW J;  2VPL A;  1MMD A;  1BJZ A;  1EH7 A;  1G3S A;  3BAT A;  2C9N Y;  2VT2 A;  4NQW B;  4AYB A;  3M0A A;  1MBG A;  4ZYA A;  4KFC A;  3VMA A;  2F4I A;  1F9N A;  2WC2 A;  2R7X A;  2B89 A;  2W6A A;  1U0J A;  1U2W A;  2R0Q C;  1IC8 A;  1BE3 E;  4OQY A;  2A06 E;  1QBJ A;  4XL9 A;  2UYY A;  1B4A A;  5AW0 B;  2QUF A;  1IW7 F;  5GAH J;  1KYO E;  3GTG J;  1JGG A;  3QWL A;  4II3 A;  4KUE A;  5CVV A;  4L5E A;  5E20 A;  4DIQ A;  3JCU H;  3K70 C;  1AU7 A;  1TZL A;  1TL8 A;  4Y15 A;  3WTS C;  2FYU G;  2XU6 A;  4GWG A;  1LEB A;  3F3S A;  1CF7 B;  2BGC A;  2N8G A;  3OYD A;  3R61 A;  4J19 A;  4ZTF A;  2DK5 A;  3D0S A;  1LE8 A;  2P7J A;  5FKM A;  1G1I A;  1WWX A;  2XZR A;  1YJ8 A;  3QHA A;  1XG1 A;  3DV8 A;  4M3F A;  3G1M A;  3A0H H;  2CV1 A;  5KHD A;  2JSC A;  5BOX A;  1Y8Q B;  2ZNY A;  4ENN A;  5BVZ A;  2AEM A;  2HZD A;  1YRN A;  1AQT A;  1U8R A;  3ULQ B;  2QCO A;  2Z33 A;  1LP1 B;  1N7L A;  2V26 A;  3ZP5 A;  2PI0 A;  2P0W A;  1ZRD A;  1MBK A;  1XSX A;  2E5Z A;  2Y9Y A;  1T56 A;  1QZY A;  3F6V A;  3UNG C;  4BJ6 C;  4IHW A;  2CV2 A;  1S29 A;  4ASW A;  5L3C A;  5HOO A;  4W7Z A;  4GGG A;  2DMN A;  4PZC A;  3BVH A;  3ULK A;  1T95 A;  1QZZ A;  1PP9 E;  1L2P A;  1VQL I;  3BR1 A;  5HS7 A;  4MIM A;  2EFW A;  4HF2 A;  3OWT A;  4NNJ A;  1Q90 D;  2FYU J;  4L5I A;  4DLL A;  2VKH A;  3AL0 B;  1S1C X;  1RI7 A;  3WHC A;  1Z67 A;  5ILV A;  3B6A A;  1SMT A;  1HKT A;  4BXU A;  3MWM A;  3P9C A;  2FML A;  3QPS A;  4MFD A;  4AVP A;  4DGW B;  3Q3S A;  3K6J A;  4IX7 A;  3TK1 A;  2LD5 A;  4BXF A;  3WE2 A;  3H1K E;  2LC2 A;  2ZJP F;  3SFI A;  4A3G J;  5D6F A;  4E12 A;  3P9K A;  2W48 A;  3KLN A;  4N78 E;  3CCQ P;  4CIC A;  1FP1 D;  4RES B;  1CI6 A;  3G71 P;  1R4M B;  3TSI A;  2SPZ A;  4F55 A;  1ZGA A;  1OIP A;  2F5D A;  1QX8 A;  2P4W A;  4JQ0 D;  3WTV C;  2E5Y A;  3DBH B;  3GO5 A;  1J1E B;  1VQP P;  4LC1 A;  1OMI A;  5KVR A;  5IT9 Z;  2Z99 A;  3U2R A;  1G6N A;  2NVQ J;  1NAY A;  1NK2 P;  2O1K A;  4MTD A;  2STW A;  3W6V A;  2KIS A;  4LGD E;  3S17 J;  2HQR A;  4F91 B;  3JTG A;  4HX4 A;  3ZMZ A;  4U7D A;  1LWU C;  3BG7 A;  2X0L A;  2J5O A;  3OYG A;  3U1K A;  1POG A;  4C7R A;  2W7N A;  2OYI A;  2CFX A;  3FHZ A;  2EA2 A;  4M9X A;  1BSN A;  1QPM A;  5LRS A;  3SWF A;  4RS8 A;  4UV9 A;  1FTT A;  3L75 G;  2XAQ A;  3GHY A;  2PJR B;  1GVD A;  2ZME A;  5FRN A;  1WFX A;  1F12 A;  2WSC H;  2Q1Z B;  5E1Z B;  2X1E A;  2Q7C A;  3CO6 C;  4I0B A;  3H92 A;  3M8E A;  1W5S A;  3RKX A;  5J6X A;  5EYR A;  3I56 I;  2RN7 A;  2GXB A;  1RH5 B;  3F8N A;  2HKO A;  4S05 A;  3RL0 g;  2AS5 F;  2OZU A;  2WAE A;  1B72 A;  3Q0V A;  4A93 J;  4OWF A;  4PDK A;  3SFD C;  1Z91 A;  3IAM 2;  4YEJ A;  2IS4 A;  2L01 A;  3OYH A;  2M7B A;  1M1J C;  1W0T A;  1NHL A;  1QL2 A;  3RBX A;  2EIM H;  5EG0 B;  2E60 A;  3GF3 A;  1OCZ H;  3CMA P;  2XAU A;  4LFU A;  4KA4 A;  2IXS A;  5KKZ C;  5E18 F;  1P9Q C;  1S8N A;  1QVG O;  3F8M A;  3Q0U A;  3RK3 B;  1U6G A;  3PFI A;  1G1J A;  2VKV A;  2Z1D A;  4N3Y B;  2XKM A;  4A5M A;  4LOC A;  5KLV J;  1SQB D;  2H1L A;  4EJU A;  4D3D A;  3KPE A;  1JHH A;  4U0V A;  1J7K A;  1O3S A;  4DZP A;  5HS9 A;  3RQI A;  1X3Z B;  5K1Y A;  1SQV K;  3OYA A;  1EVZ A;  1ZKG A;  1VQ7 P;  3T5X A;  1L4A D;  4M3D A;  1R5I D;  5IT9 K;  1JO5 A;  5TJH A;  2JEE A;  3J7A Y;  4U0Y A;  2ELJ A;  3JSP A;  4S0H B;  1D0X A;  1MH4 A;  2KNC B;  1GT0 C;  1OR7 C;  3BPX A;  3L09 A;  5C4J J;  2UV1 A;  1S72 I;  4H13 D;  2GXG A;  4LLH A;  1G4D A;  3TYY A;  3OYN A;  3GLX A;  5FKN A;  3WTX C;  1F14 A;  3I0T A;  2V4H A;  3WTU C;  1L4A C;  3TMO A;  2IS2 A;  2CK3 H;  3FX3 A;  5DM7 F;  5AW3 B;  2QQA A;  4GDO A;  4E70 A;  5APS A;  3TO6 A;  1ENH A;  3ZMV A;  4O9B A;  4IJA A;  5CCH D;  3JRH A;  1TTY A;  2JA8 J;  1W2E A;  1BW6 A;  2PFB A;  4PV1 D;  2DMT A;  2YXR B;  1EDL A;  4ZYE A;  1NG6 A;  2VXZ A;  3TED A;  4D6T D;  2XGE A;  5KLV G;  3M91 A;  3IRQ A;  1HOM A;  3V2R A;  3KX2 A;  3H1J D;  1ON1 A;  5FKO A;  1WT6 A;  2XRN A;  3H1K G;  3U9G A;  3L73 D;  3HSR A;  1BI3 A;  3B73 A;  1FTZ A;  3COA C;  4D5F A;  3T97 A;  3L74 E;  1FOS F;  2H8W A;  1QPI A;  3DU5 A;  1FOK A;  1JY3 O;  3IN6 A;  5TGT A;  1DLJ A;  1P4X A;  4ENK A;  2OYI C;  3V42 A;  1A31 A;  4AYC A;  3F9K A;  4GBJ A;  2B0L A;  2DA3 A;  2E35 A;  3T1B A;  5J8C A;  5CCH A;  2NXN B;  3AFH A;  4RM2 A;  2NAZ A;  2Z4E A;  3LQQ A;  2GOX B;  4XLH A;  1QZE A;  5BU8 B;  1SD5 A;  1HGZ A;  5H20 A;  3C3W A;  1XB4 A;  2JPB A;  2VBZ A;  3CC4 I;  1YVE I;  4BEH B;  4A12 A;  1A36 A;  1FZB A;  4I1L A;  2JJL A;  4MEY F;  4BUP A;  1SVM A;  1UHS A;  5TIS H;  4NB5 A;  1FX7 A;  3JRB A;  3OR2 C;  4QMA A;  5D8L B;  2KYV A;  3RTR A;  2WAQ N;  5IOY A;  2HOD A;  4FHT A;  2FU4 A;  2EIK H;  1NG7 A;  3KCC A;  1LTA C;  3I58 A;  3H1L D;  3TGU G;  1D8J A;  2CGP A;  2ITA A;  1KN7 A;  4UUV A;  4I98 B;  4L73 A;  4UUS B;  3F3X A;  2OYH C;  1LJ8 A;  5FLM J;  3AG1 H;  1MJB A;  3CP8 A;  2PX9 A;  3OV8 A;  1NGM B;  4LJZ F;  1X2N A;  3VYI A;  2GF2 A;  2QSI A;  1LVA A;  3HE5 A;  2Q5U A;  3C2G A;  1J1D B;  3L9F A;  2JUG A;  1E2X A;  1RZ4 A;  3HRT A;  4LB6 B;  3H9G A;  4ENJ A;  3PO2 J;  1WZ2 A;  2HS5 A;  2OCE A;  3OS0 A;  1FLI A;  2KIM A;  2RNG A;  4OIR F;  1IXC A;  2M5A A;  1EXJ A;  3RK2 B;  2PP6 A;  3O6Q A;  3K4L A;  1KYZ A;  1RE4 C;  1M67 A;  1U9N A;  3HZJ A;  1SQQ J;  1T33 A;  5EG0 A;  2I8D A;  1RUN A;  2Z2S B;  5LEJ A;  3CC7 I;  1Z77 A;  3H3V K;  3KZI H;  1FC3 A;  1GW4 A;  4DZJ A;  5EDN A;  2HFE D;  4DBQ A;  1AOY A;  3AE7 C;  3GME A;  3L74 J;  5AVX B;  2IEK A;  4RA2 A;  5FJ8 J;  5APU A;  2MW8 A;  3S3N A;  3QP6 A;  1T39 A;  1LT1 A;  1GU5 A;  1IFD A;  4EGZ A;  3FXU A;  4G7Z F;  3CJQ B;  5BPD A;  1KIL D;  1UHM A;  1N1G A;  4D0P A;  3PO3 J;  5EEG A;  3OS2 A;  3N4X A;  1JY2 P;  2WQY C;  2L5Q A;  1UCR A;  2Q2E B;  4ON0 A;  1OJL A;  1PUF B;  1RQV A;  4RKU J;  1M90 Q;  1BCC J;  1VPD A;  2OAR A;  3OIQ A;  3I53 A;  4Y7N J;  3DWL E;  3SEZ A;  3EGO A;  2CS3 A;  4OAY A;  2IPQ X;  2IA1 A;  3WS7 A;  2DTR A;  2RMZ A;  2GQQ A;  1M8O B;  2YKP A;  1S9K D;  3OYK A;  3HOU J;  2EWN A;  2K9L A;  1PZQ A;  4L18 B;  1IGN A;  5CCG D;  2DYS H;  2DA2 A;  1NTM G;  4Z2Y A;  4Y17 A;  2WPV B;  5KAF E;  3QWO C;  4E6K G;  5B66 C;  1KIL A;  1LP1 A;  3V7R A;  2Q3E A;  2E75 C;  2EPF A;  2L3D A;  3H1J G;  2Y0D A;  4PD4 H;  1TWH J;  2LMD A;  1Y1W J;  5LBQ A;  5IYB J;  2DQR A;  4PJ0 E;  1WH7 A;  1LTG C;  3VYR B;  5D8K B;  2Q8K A;  2CQX A;  2BCC G;  1WJ5 A;  3B5N A;  2JA6 J;  2CUF A;  1NTZ E;  3HUS A;  3L71 D;  4I01 A;  5CJ9 A;  1BE3 J;  2FYZ A;  3LID A;  2K3F A;  1D7M A;  1BOA A;  1J5Y A;  1I5Z A;  2CJJ A;  2CWE A;  4CO8 A;  3CX5 E;  3KXD A;  2AEF A;  5KLI B;  2FFD C;  4WB4 A;  3TF5 A;  5HNH A;  2GM4 A;  2QSF X;  4C30 A;  5K7H A;  2HOS A;  4MNU A;  2Y0M A;  2P5L C;  1YB4 A;  1Q86 Q;  3IH3 A;  3EUH C;  4RGU A;  2Z9O A;  3O6Q B;  2E1M C;  2E75 B;  3HG9 A;  4XQF A;  2XGD A;  1HW2 A;  1EXI A;  3K9T A;  1R8E A;  2EV6 A;  4B3A A;  3BCC E;  1DQU A;  4DYQ A;  3DEU A;  2PQ8 A;  3B6C A;  3ECO A;  5IOZ A;  3ASO H;  3HSF A;  2N9Y B;  3IUO A;  3K1N A;  1UZC A;  2NZ2 A;  2YIU B;  3L70 G;  1VF9 A;  1GD2 E;  4EJT A;  5KCM A;  1USD A;  3MP7 B;  2XSJ C;  4ZDL A;  4AQR D;  2H88 C;  3WU2 H;  1U7J A;  4YPC A;  3QSG A;  2DT5 A;  4U3F G;  3HDH A;  2R7S A;  4WK8 F;  4LK0 F;  4N9H A;  2BXY A;  3CUQ A;  3OBB A;  1YI2 P;  3D6Y A;  5H2F H;  2OYI B;  3R0J A;  1IN4 A;  3WGI A;  3K4K A;  4DNC A;  4BS9 A;  2WSF J;  3ESW B;  2D1H A;  5KK1 A;  1UG2 A;  2ZJ2 A;  1ZN5 A;  3HGG A;  3OOU A;  4I02 A;  3GF7 A;  2E2H J;  2HOA A;  5KLV D;  4D6T G;  2QJY C;  3CC2 P;  5EJC A;  5LEK A;  5FD6 A;  1NYH A;  3W67 A;  3C7D B;  2BW3 B;  2QM3 A;  3X2Q H;  1P84 H;  1JJ8 C;  3S16 J;  3MTU E;  2TDX A;  3EQL F;  3ZQF A;  5E3O A;  2DYR H;  1RY3 A;  1ETW A;  1XGO A;  3SQN A;  5GTH C;  1PL5 A;  3P8C D;  2IPP A;  5EZG A;  3HDD A;  1KFM A;  2ZJQ F;  2FD5 A;  3HYI A;  4M3G A;  2WAD A;  4B1R A;  1SFC D;  2KS1 A;  4KHX A;  5IP7 J;  1FZP B;  2VBX A;  2X1C A;  4C3J J;  1N77 A;  1X22 A;  5D5X B;  1KV4 A;  3RJP A;  1XSD A;  2EIN H;  4U0W A;  1JKP C;  2N1T A;  5APQ A;  1KIL C;  1SFX A;  2LDU A;  1RIO H;  1MZB A;  3IRR A;  3D1N I;  2BHY A;  3K4C A;  3P8M C;  4B8X A;  3PLN A;  3IH4 A;  3I55 P;  4GYI A;  5APV A;  2HDD A;  3AEG C;  2OD5 A;  1WJB A;  3DOJ A;  3E3V A;  3CUQ B;  3CLQ A;  4M6V A;  3T8R A;  2I76 A;  1SVF A;  4KIC A;  1YQA A;  3JCU C;  4NPF X;  3E6D A;  1I6X A;  2KJC A;  3TOB A;  3Q5R A;  5CVJ A;  1SP4 A;  3MD2 A;  3ZQH A;  3I5C A;  1SD4 A;  1EVY A;  2R7W A;  1K4T A;  1FU1 A;  3K0L A;  3E1S A;  1VF5 D;  2QYO A;  4CYD A;  1EZV D;  2E74 C;  1QHG A;  4FET A;  2J59 M;  4C2U A;  3CQZ J;  1M66 A;  1SQQ D;  5L3B A;  2AXT H;  3DTI A;  2ZXH A;  3A0B C;  1OVV A;  3TGN A;  3HUG A;  1AA0 A;  2R93 J;  2VC0 A;  5HDN A;  2CUZ A;  2QEX I;  3ADP A;  2HXO A;  1LEA A;  2OZ6 A;  4XSZ F;  5FLX Z;  2NS8 A;  4BHP A;  3BPV A;  1ZLJ A;  5LHG A;  4NBQ A;  1N73 C;  2OYH B;  1KTM A;  2QGU A;  2O1J A;  2LBF A;  5EF6 A;  1LTS C;  2ZAE B;  3GHG A;  2L7M P;  1Z7L A;  1VQM P;  5L3F A;  2ZYD A;  4LIU A;  2M0B A;  1NH4 A;  3DBL B;  3MGN A;  3OYI A;  2PLA A;  5APY A;  2ELH A;  4BHB A;  3LA7 A;  3HE4 B;  3BOQ A;  4ZYH A;  3H1I D;  4OGQ D;  3S93 A;  3ABL H;  2M87 A;  5A9R A;  2NS0 A;  1WPK A;  3HUS B;  2QBY B;  3RKY A;  3WTY C;  2LXC B;  3AE9 C;  3CMY A;  2F6C A;  3MIW A;  3BG3 A;  1ZHF A;  3P7N A;  3TO9 A;  3SWK A;  1NVO A;  4DW6 A;  1JEK A;  2DA5 A;  1YTZ T;  5FFX A;  1ZV8 A;  1SQX K;  3AAF A;  2WSE J;  1BI1 A;  1U78 A;  1E79 H;  4KIT B;  2G7H A;  2OA4 A;  4XR6 A;  5J47 A;  3C1L A;  4H44 C;  3DTK A;  3J81 Z;  1GV2 A;  1Q2N A;  1T2K D;  2FEZ A;  3HM5 A;  4G8X A;  2W57 A;  2OC6 A;  5GPC A;  3PID A;  4KIB A;  3OL3 A;  5DUI A;  1I36 A;  2CW7 A;  1IXS B;  2BY0 A;  2HDH A;  3FIW A;  3SYT A;  4NUB A;  1ETV A;  1EDJ A;  5A9S A;  2ZME C;  1GK6 A;  3BT9 A;  4LMY A;  2FXM A;  1X1D A;  3HN2 A;  2K86 A;  3G6E P;  3F5H A;  1HTL C;  1GXP A;  1U8B A;  5M1B A;  2W24 A;  4UUS A;  1LVK A;  2FBI A;  3A02 A;  1H0M A;  4N4O B;  4G12 A;  3M7G A;  3F22 A;  5KAI C;  3BCC D;  3TGU D;  4BY7 J;  2DFE A;  3VN0 A;  4IL6 E;  1EV7 A;  3FKJ A;  3AE1 C;  1FOS E;  3GFJ A;  3K1M A;  5B5E E;  1P7J A;  3FXR A;  2IX7 C;  3A5T A;  1R23 A;  3DQV C;  1FOW A;  1NTC A;  2ISY A;  5E79 C;  1IV6 A;  3WG7 H;  3BAS A;  2LK2 A;  1LFB A;  3WU0 A;  4G6D A;  4IRG A;  2L7Z A;  1T6S A;  2GA2 A;  4KNY A;  4HAM A;  4RGR A;  2X6O A;  3TW6 A;  3V4G A;  1SQP G;  1Y56 A;  3FWE A;  2L02 A;  5J4V A;  2A45 G;  1K73 Q;  1V4R A;  2TRT A;  3H32 B;  1UEL B;  2W82 A;  1ZAR A;  4KN7 X;  3RIR A;  2E1M B;  1LNW A;  4CPG A;  4PZE A;  2I10 A;  2KRF A;  3PJR A;  1X4O A;  5M5Y J;  2E1O A;  3GTO J;  2WTB A;  1FZG A;  3ZR8 X;  1UB9 A;  1X2M A;  2HVR A;  3CC2 I;  1GW3 A;  2IA2 A;  1L0N D;  4O5V A;  2HYN A;  1FE6 A;  1XSV A;  1OYY A;  3KP3 A;  4HF0 A;  3PIO F;  1WH5 A;  3RPQ A;  4L9V A;  5FFZ A;  1TT0 A;  1WJF A;  3G3Z A;  1QGK B;  2Y31 A;  4H4K C;  1MD0 A;  1URQ D;  3F0C A;  3Q0W A;  2ACJ A;  4B3I A;  1G2C A;  4H0L C;  3SEQ A;  5DUK A;  2Y0S A;  4HNU A;  1E5W A;  1BSH A;  1SAU A;  2CSO A;  1YQ3 C;  2Y0E A;  4IFD K;  3QYF A;  5CBO A;  3D70 A;  2OUM A;  3E6C C;  4Z6Y A;  1GLN A;  2HVQ A;  3CDL A;  4XRM A;  3ZQG A;  1KQF B;  3A4C A;  4XA4 A;  4RM3 A;  4JK1 X;  5E8G A;  5HVQ C;  1KIL E;  3CWB G;  3IKV A;  2FNP A;  3FZV A;  5EGO A;  1S4X A;  5F04 A;  1SD6 A;  5A9S B;  3CPW O;  1VQ5 P;  3FR8 A;  3OYC A;  3RL0 D;  3O8G A;  2KKO A;  1DEB A;  2E5T A;  4V2F A;  3E6B A;  4YXW H;  4C7N B;  2M0C A;  1M2W A;  3D1L A;  2H6C A;  1BCC E;  2JWA A;  2F5V A;  2M8E A;  4PJN A;  3RYP A;  1QO0 D;  2H89 C;  1FSH A;  3DEW A;  2NVY J;  2PMU A;  2IYO A;  1LSJ A;  3O8H A;  2EQR A;  2X9D A;  4HX8 A;  1AQ5 A;  2M2E A;  3TP3 A;  4KIS A;  2FKW B;  1FMV A;  3KZI C;  2ZC2 A;  2M34 A;  2V6C A;  2W8Z A;  1KU9 A;  1HDD C;  1ZR4 A;  1XDS A;  4DYD A;  1GK4 A;  1YTZ I;  2IBZ E;  3EWK A;  2BW3 A;  2HQA A;  3HOT A;  3KP4 A;  1LT9 B;  1P84 D;  3G4S I;  2XKO A;  3HOY J;  2K02 A;  1ZN2 A;  2VRS A;  1S7E A;  3FGA D;  2ELK A;  3N4M A;  1KB9 I;  3H5N A;  3LSG A;  3KQG A;  4PD4 E;  2IVM A;  1TXG A;  4B4C A;  2QM7 A;  1V55 H;  3WU2 C;  2ZCW A;  5B5E C;  3LMM A;  3HTU A;  1LTI C;  4L74 A;  1NO4 A;  4BRY B;  1IO4 A;  2NOJ B;  3L4F A;  2A6E F;  4M73 A;  5AVW B;  4KMU X;  1QVF O;  3MUD A;  2J5P A;  2PGD A;  3W6Z A;  3G0O A;  3ZW9 A;  2YKQ A;  2HPI A;  4CZC A;  2WTE A;  1F36 A;  3OJA B;  1T3J A;  2QJY B;  2O8X A;  4BQN A;  3IR9 A;  3FXJ A;  1L0N E;  1Z21 A;  4AIH A;  4O3M A;  4OIP F;  2M30 A;  2XC7 A;  4V19 K;  2WB1 N;  2RAE A;  1X1C A;  1RF1 C;  2ESH A;  2OAZ A;  2N1T C;  5LGN A;  2CV0 A;  5GPA A;  2WB1 A;  2JPC A;  2OFP A;  1PPJ G;  4OGQ B;  4BAC A;  2BHZ A;  1H0T B;  1SQP E;  3PP5 A;  4XLF A;  1TNT A;  1HGV A;  5HNF A;  1SMY F;  3RSN A;  5F0H A;  5J3L A;  3TQN A;  4QIW N;  3GEZ A;  2M5W A;  4LLL A;  1VQP I;  3ZDM A;  2H7H A;  3HAD A;  3NWS A;  1XMA A;  4Q47 A;  4B48 A;  3R2P A;  1NAF A;  1WJC A;  3ZGK A;  1M57 D;  3N05 A;  2FMY A;  3K2Z A;  2V1U A;  2BEQ D;  2VOO A;  1N7S B;  5KJ7 A;  3NRV A;  2DCE A;  2X6X A;  2KS1 B;  1VQK P;  3CUQ C;  1EH8 A;  3SFZ A;  1Z82 A;  3FWL A;  3CDI A;  3PTZ A;  1HDP A;  2F4O B;  1KB9 H;  2YUS A;  5FGM A;  4KUG A;  1WDM A;  3PH0 A;  2BY2 A;  3V4Q A;  2K27 A;  5DV5 A;  4BL0 B;  3TW7 A;  4R1N A;  1JTY A;  1T2K C;  2VQC A;  1UST A;  2HQ5 A;  1V5G A;  3FM5 A;  3W6U A;  4X0G A;  1PP7 U;  1IAW A;  4KUH A;  4HB1 A;  3ZWA A;  1URQ C;  2ID6 A;  1RF1 B;  3CCE I;  4C3H J;  5CVR A;  2VOP A;  3DKW A;  1LJ2 A;  5HWS A;  2V1N A;  2W25 A;  2P1J A;  2KNC A;  1XMX A;  3ELK A;  2WSE H;  1I6H J;  1PJR A;  1TLH B;  1Y0N A;  3EDP A;  3HPH A;  4IHS A;  2OYO A;  1O7L A;  4I6M C;  3H9J A;  2HLO A;  3G73 A;  1BC8 C;  4BAY A;  3HRS A;  2EZK A;  1JT0 A;  2Q6Q A;  4KJM A;  1FEX A;  1MGT A;  2HYJ A;  3A1Y A;  3LSJ A;  3QOD A;  2W90 A;  5APW A;  2MYS A;  1T98 A;  2GZW A;  3ZN0 A;  1BI0 A;  1TP4 A;  2BOL A;  3JRI A;  2EV0 A;  3S15 J;  3HUS C;  1JTH B;  1SQX E;  3K69 A;  1NH3 A;  1MDM B;  4XE5 B;  3L75 E;  1L0L K;  3KFW X;  5JI6 A;  3TO7 A;  2E19 A;  4ITV A;  4E7J A;  2CPB A;  2H94 A;  3HRN A;  4H44 B;  5JLX A;  3KYD B;  3HRU A;  1ZLK A;  3C8V A;  3PNT A;  2HOT A;  3H1K J;  3MZH A;  1J1E C;  3PQK A;  2IW5 A;  3CUO A;  3U1A A;  4M3B A;  3REO A;  1JY2 O;  5CJ0 A;  1XGS A;  3BR0 A;  3LWF A;  1MND A;  4XLA A;  2G9W A;  3E5U A;  4QPO A;  1R49 A;  2O8K A;  3CTV A;  1R5S A;  1Y8R B;  2UWM A;  5CCH C;  1N7S D;  3B4S A;  3TBI A;  2LLK A;  4DQ2 A;  5JVG F;  1FOY A;  4OOI A;  3A0H C;  1SQP D;  2O3J A;  4UB8 H;  1JB0 J;  3BTJ A;  3DEE A;  1LFU P;  2FA5 A;  2R5Z B;  4MLO A;  1D3Y A;  1LDJ A;  1YIO A;  4EAT A;  4JX4 A;  3K1P A;  1O4X A;  2P7C B;  1FYM A;  1RRJ A;  4AWX B;  1SQQ E;  3TNU B;  1FDO A;  2A06 G;  3AL0 C;  2JWD A;  3RPU A;  1S7O A;  1W5C E;  4LG0 B;  2O01 J;  1IFI A;  2IGM A;  1ITY A;  1XDU A;  2R7O A;  2JDI H;  2EV5 A;  1R36 A;  3PIP F;  1YYV A;  1ERD A;  3LIE A;  4HKZ H;  1BDC A;  4DYC A;  2H43 A;  2LR2 A;  3S2H J;  3L00 A;  2R5Y B;  1OQY A;  3LQR A;  3RZD J;  2QSG X;  1KQL A;  1LNQ A;  2B87 B;  3D6Z A;  1B6A A;  5KAI H;  3CCL P;  1PYV A;  2R92 J;  1PPJ E;  2A5Y B;  1VZ0 A;  4HA8 A;  2ZXE B;  4WX9 A;  3PFY A;  4D3S A;  1R5L A;  3LW5 J;  1S72 P;  1KYW A;  1VQL P;  3I4N J;  5GTI H;  1TNS A;  2A45 H;  1HQC A;  3I5U A;  3F21 A;  1ZME C;  1QVU A;  3DTE A;  5FLV A;  4I7Z B;  1LE8 B;  1KON A;  2WY7 Q;  2IZ1 A;  3ML6 A;  2DOE A;  2OTK E;  3MD0 A;  3Q5P A;  4IO9 F;  3BR3 A;  5DDG A;  1TC3 C;  2V6E A;  2A45 I;  2FYN B;  3RBZ A;  2E5N A;  4BXX J;  1FJP A;  3O3K A;  1VQ4 P;  4LLN A;  1RE4 A;  2FY8 A;  3G17 A;  4RO0 A;  1SQX J;  4BQO A;  3P8C E;  3LA3 A;  3V7S A;  2GUV A;  1X8Y A;  1WGX A;  3L72 E;  1DP3 A;  1VF5 B;  3DCF A;  3QPL A;  3C9I A;  6PAX A;  2K1A A;  2H8P D;  4IHY A;  3DFG A;  1VQO P;  3QYB A;  1HVV A;  2PEX A;  1X79 B;  3L70 J;  2WT7 A;  1YW7 A;  1MZ9 A;  3FK7 A;  5E1X A;  2ZO4 A;  5CPR B;  3FWN A;  3L74 G;  3DFU A;  5GTH H;  1M56 D;  3FXO A;  4J0E A;  5A9T A;  1ETO A;  1FBQ A;  1Y8A A;  1QA6 A;  3HKZ A;  4ESB A;  4Y3O A;  3KP5 A;  3GTM J;  3W2V A;  3BQY A;  1AKH B;  2YMK A;  1FBU A;  2B88 A;  1OW7 A;  1QL1 A;  3GZ5 A;  9ANT A;  1UIX A;  2CUJ A;  3ABM H;  3W3C A;  5JHF A;  4PJ0 H;  4L0Z B;  3CX5 I;  2A07 F;  5HLH A;  1RF1 A;  4NC8 A;  4MTE A;  3LSK A;  5CKT A;  2B63 J;  2JJ7 A;  4A0Z A;  3A0B H;  3OYM A;  4HST A;  2IJL A;  2V79 A;  3QQA A;  4KUM A;  3II6 A;  2OTL P;  2E36 A;  1NTM J;  1W7P D;  1RF0 A;  1S9K E;  2DMU A;  4O6J A;  2IS6 A;  3TGU E;  1T8Z A;  2LNB A;  4H0L D;  2O01 H;  1SS1 A;  2DT6 A;  2HU9 A;  3NWT A;  2O61 A;  4IL6 C;  2HQN A;  1EKE A;  1MNE A;  3OSF A;  2D1V A;  1NTK K;  3JRC A;  3B8E B;  3GBG A;  3MZ8 A;  3GYH X;  2HKX A;  3ZW8 A;  2HOD B;  3E1I A;  3Q5S A;  2STT A;  4LGW A;  3AG4 H;  1F0Y A;  5GAG J;  4A0X A;  1ZRT D;  3L73 J;  1N8R Q;  1T38 A;  4YIF A;  4XK4 A;  5AVU B;  3H1H G;  5AVS B;  2V1X A;  1QGP A;  3IWF A;  2VBW A;  2L54 A;  4CCJ A;  4R4L A;  2XRL A;  2EZH A;  2YO3 A;  1N7S C;  1WCM J;  3TOA A;  4JBZ A;  1J75 A;  1YJ9 I;  3HE4 A;  1JI8 A;  3PHL A;  2PMH A;  3IAO A;  1QEX A;  4XOT A;  2R7Z J;  3AKZ A;  1H0T A;  1I1G A;  3ZMD A;  1LTJ C;  1OKR A;  1PFI A;  2D2W A;  3D5L A;  1LTB C;  2NYX A;  1VND A;  2FXO A;  4AUW A;  3KEY A;  2E76 D;  3IWZ A;  4KJZ A;  5J4Y A;  2VQH A;  1MMG A;  4BDZ A;  3F8F A;  1O3T A;  3J7Z I;  2ZYG A;  4NPE A;  5LHH A;  3NAR A;  2M8G X;  2JSP A;  2XDV A;  4HYE A;  2V4J C;  1JKO C;  4EDF A;  4HX7 A;  2E75 D;  2RKH A;  1PVE A;  4IHX A;  2D2C C;  2Z5U A;  1R1T A;  2L7F P;  3L35 A;  2DA6 A;  1KQS O;  3GFL A;  3CDH A;  3SSU A;  2IBZ I;  1GVJ A;  5HDG A;  5GP9 A;  1T0F C;  5KAF C;  2K9S A;  1JUN A;  3KP2 A;  1IZN B;  4U3F J;  1X1B A;  3GTQ J;  1WJE A;  4II2 A;  1S5L C;  2M3B A;  2PFX A;  3PL8 A;  4M6Y A;  4ZYG A;  3MKY B;  1GDT A;  1KYO I;  4NHJ A;  1K8A Q;  4JPZ B;  3K4J A;  2K3P A;  4WXH A;  2HVS A;  2P7V B;  1MJA A;  3KYL A;  3SJM A;  1NTM K;  1WRG A;  1BDD A;  1KZU B;  5HDK A;  1YJN P;  4BJT A;  1W36 D;  2ZKZ A;  3F6O A;  2VIX A;  5HLI A;  4KYW A;  1K4S A;  1ETQ A;  1ONV A;  2DXI A;  2VL8 A;  3CC7 P;  5CVI A;  2HPC B;  3CF2 A;  1G59 A;  4L75 A;  3HRM A;  4EEF G;  1NU1 G;  1DDN A;  4A3I J;  4OVN F;  4HDU A;  3FMR A;  1I3Q J;  1M76 A;  1R7J A;  3UIA A;  2BV6 A;  3M8J A;  4LG3 A;  2OQR A;  4YII A;  3HKZ N;  3BR2 A;  3ZQC A;  4GOE A;  2EA4 A;  4YIR X;  4D3F A;  1IFP A;  3CCQ I;  1OX3 A;  3IL2 A;  1EQ7 A;  4ZKU A;  2YS9 A;  5AW6 B;  5DTD A;  4AD9 A;  4OIO F;  3V4W A;  3WUU A;  1XD7 A;  2W1O A;  4DJA A;  2ECC A;  2RGV A;  5DS9 A;  3B02 A;  2UUZ A;  1EDI A;  1GMJ A;  4N4N B;  3JAM K;  3O8Z A;  3G9R A;  1IZ1 A;  2EB7 A;  4GXO A;  3CC4 P;  3ONQ A;  2VE9 A;  2ZVO B;  2WA0 A;  3BCB A;  3FXM A;  1C0W A;  1ZYR F;  3OIP A;  1NTK E;  1X3U A;  2BEO A;  1OYW A;  3OY9 A;  1R4N B;  4J01 A;  3ABU A;  5KLV K;  2P6T A;  3A01 A;  3BCC G;  3QP5 A;  3ZHB A;  1ZG3 A;  5FKL A;  4CCM A;  1SFE A;  4M71 A;  4XLC A;  5J1R A;  1M7L A;  1SQQ K;  1KOR A;  1ZQ3 P;  3CXH E;  1D0Y A;  3GTK J;  3KLO A;  2Y0C A;  1APL C;  2BEZ F;  1YFH A;  2A5W A;  5ILS A;  2D5V A;  2R5D A;  2X6W A;  4JYK A;  3SXY A;  3O6B B;  5AW9 B;  3RK2 D;  5F1R A;  2H8R A;  1A6Q A;  1UAA A;  3EYY A;  4IF4 A;  2PLY A;  1EC5 A;  4GCV A;  4IFM A;  4RB0 A;  2FFD A;  2K9N A;  1SQP J;  4IXA A;  3RQS A;  1XN7 A;  3FM3 A;  2KP8 A;  2L91 A;  5E3M A;  4JX6 A;  2WTY A;  1O7F A;  2DDA A;  2KSE A;  3R4K A;  1QRY A;  2BXZ A;  5AVV B;  3WMM 0;  3RKQ A;  2ZVN B;  1KU7 A;  2WZ7 A;  4U87 A;  2ISZ A;  3M9H A;  1IRF A;  2JZY A;  2NPS D;  2CUE A;  2R7Q A;  3GX4 X;  4YFK F;  3H0G J;  4FT8 A;  1FT9 A;  2HDC A;  1SFU A;  1S6L A;  2YIU C;  1REP C;  2W4S A;  4GOF A;  2E74 B;  3DBR B;  1ZLL A;  2KDZ A;  4ESJ A;  3BCC J;  5FD5 A;  1S5L H;  3HHG A;  4LIV A;  3BRV B;  4ANJ A;  4H0E A;  3T97 B;  1N1E A;  4S04 A;  3AG2 H;  2HTS A;  2XPV A;  3GTJ J;  2F48 A;  3PLR A;  2EK5 A;  3WOD F;  1HUC A;  1KS9 A;  3VSL A;  3D71 A;  4RLF A;  1P84 E;  3JRD A;  2JRM A;  4LG0 A;  1KQG B;  3CWB J;  1U9O A;  1RR7 A;  2BE5 F;  4EVI A;  3CF5 F;  1XGN A;  1M75 A;  2W6B A;  3CXH D;  4F3Q A;  1WHU A;  1LTT C;  1AJY A;  2K85 A;  3WU1 B;  1XGM A;  1VFC A;  2D3T A;  3NFQ A;  2VJJ A;  2VOD A;  4OMY A;  2IZ0 A;  2KIF A;  1XCV A;  1XX5 A;  3CCM I;  1U3E M;  1VQ7 I;  1AKH A;  4XRS G;  4E4H A;  1H8A A;  2C9L Y;  1I50 J;  2Q0O A;  3MVP A;  2UWJ E;  3BDD A;  4XM3 A;  2CH0 A;  1YBK A;  3CTA A;  3M4O J;  2P6S A;  1JTX A;  2DFI A;  3K4N A;  1BG6 A;  5AW8 B;  2IAI A;  3M9B A;  4MO7 A;  4AVZ A;  5E8I A;  3MEX A;  2YO2 A;  1QMG A;  2K88 A;  2MSY A;  2JVH A;  1MMN A;  2WY8 Q;  1BJA A;  3MFK A;  3E6M A;  3H1I J;  1W2B O;  1N2D C;  1FDM A;  4G7H F;  4IRH A;  2KXP B;  4Y4R A;  1YIT I;  2RRE A;  1JY3 N;  3H1K D;  2CO5 A;  1JUS A;  1MKM A;  2FBK A;  5FO5 A;  2LTP A;  2M5A B;  4BE1 A;  3H1L J;  4HZF A;  2CYY A;  4A69 C;  2DOD A;  2VKE A;  1MDM A;  2E74 D;  3A0H E;  4K3A A;  5L3E A;  4C7N A;  1I1S A;  3QOE A;  3KP6 A;  5AVZ B;  3HTK A;  2NNN A;  3W2W A;  2ID3 A;  3OW2 O;  2GA1 A;  2XAF A;  1YJN I;  2QA4 P;  1WI9 A;  4Y33 A;  2EFQ A;  1MSF C;  5TJJ A;  4CA0 A;  1GL2 A;  5DCF A;  2PJR A;  1HKQ A;  1FPQ A;  3ZMU A;  2P81 A;  4CCK A;  1G3T A;  4CGZ A;  2EIJ H;  4ASV A;  3K5B A;  2KHM A;  2L7K A;  3TDK A;  2DK8 A;  5CHX A;  1R22 A;  2O0Y A;  2DOF A;  2C6Y A;  3W68 A;  1KA8 A;  4IPA A;  3J7Y J;  2VJ5 A;  3M9A A;  1XTC C;  1WSU A;  1KU2 A;  1LT9 A;  1ETY A;  1YS6 A;  3KZI E;  4OQZ A;  1HWT C;  4KT6 A;  4LB5 A;  2LR8 A;  2OJE D;  3FXE A;  1L4A A;  4U88 A;  1LWU B;  1WI3 A;  1OWA A;  1G3Y A;  3VYT B;  2JUC A;  4YRV A;  3GMA A;  3BLY A;  2UXX A;  1KZH A;  2X4H A;  4XID A;  4EZB A;  1DX7 A;  2LP0 A;  1JNM A;  5L3D A;  4UUT A;  2VKD A;  1PUE E;  1J09 A;  1ZK8 A;  4N0B A;  3EFF K;  1OYI A;  2VN2 A;  3H5A A;  2BCC D;  1IFN A;  2CQ7 A;  4E7Z A;  3E5Q A;  1Y9B A;  3H6P A;  2XAH A;  5C3E J;  3WFJ A;  3F72 A;  1EH6 A;  3DP7 A;  3FR7 A;  2H27 A;  2OTJ P;  4RGX A;  3QU3 A;  1SQV D;  3AE8 C;  1YJW I;  5GTI C;  4RB3 C;  1VL2 A;  3RYR A;  3NXS A;  3WUV A;  1N25 A;  1GZL A;  1WVR A;  1KQ8 A;  3SDB A;  3QPH A;  4HPQ A;  3S32 A;  2PMZ N;  1BGY E;  2ETH A;  1YIJ I;  4NC6 A;  2LRE A;  5FLX K;  1RF0 C;  3CCY A;  2QVA A;  4EM2 A;  2DI3 A;  1BC7 C;  4CYC B;  2W83 C;  2RNJ A;  4DBR A;  3M06 A;  3A01 B;  5M3F J;  2FNA A;  1M1J A;  3BTC A;  5JR3 A;  3LAP A;  3L73 E;  4MN4 C;  4N6J A;  3M9Q A;  3HBL A;  1MIJ A;  2LY1 A;  2E2I J;  2DBB A;  3Q1M A;  4WWC A;  1WJD A;  3CJN A;  4KDP A;  3ZWC A;  4A3L J;  5JVT A; 
#chains in the Genus database with same CATH homology
 1S7E A;  3E7L A;  2ELK A;  3SFI A;  4A3G J;  3LSG A;  4E12 A;  2W48 A;  2E2J J;  1TXG A;  4B4C A;  4RBO A;  1DU6 A;  3PJG A;  3H2Z A;  1SAN A;  2QYT A;  1JKR C;  4JQ0 D;  1WPQ A;  3ZOB A;  4E21 A;  4B3H A;  5MGB A;  3S14 J;  2GBY A;  2PGD A;  3W6Z A;  3G0O A;  2ECB A;  3ZW9 A;  1RKT A;  2CRG A;  2NVQ J;  1NK2 P;  1F36 A;  3W6V A;  3S17 J;  5M3M J;  3FIS A;  1D5Y A;  3HGY A;  5IP9 J;  1POG A;  2RAE A;  2WB1 N;  1IG7 A;  3I4M J;  5GPA A;  2OFP A;  1FTT A;  3GHY A;  3ZGY A;  4AYB N;  1GVD A;  1F12 A;  1WDL A;  1OFC X;  5F0H A;  5J3L A;  1LSO A;  4QIW N;  3LOC A;  5IYC J;  3HAD A;  5EYR A;  3BTL A;  3GTP J;  4OM8 A;  1B72 B;  3LSP A;  1ETK A;  1B72 A;  3Q0V A;  1JJ6 C;  4A93 J;  5E3N A;  1W0T A;  2X48 A;  3BR5 A;  2VPR A;  1TWG J;  5EG0 B;  1YJQ A;  1JUM A;  4GWK A;  1Z82 A;  3HOV J;  1HDP A;  2YUS A;  3Q0U A;  4KUG A;  1WDM A;  3S2D J;  2VKV A;  3HOZ J;  4R1N A;  4LOC A;  3TW7 A;  1JTY A;  4D3D A;  1JT6 A;  3IH2 A;  3W6U A;  2HQ5 A;  2NOG A;  4DZP A;  4JX5 A;  2O7O A;  4KUH A;  3RQI A;  2Y30 A;  2JKV A;  3ZWA A;  2ID6 A;  1EVZ A;  1ZKG A;  4C3H J;  4QTR A;  1A5J A;  2CVZ A;  4M3D A;  2EW2 A;  5HWS A;  3HOX J;  4S0H B;  1MH4 A;  1VI0 A;  3RZO J;  1GT0 C;  1HCR A;  1I6H J;  3MOG A;  4NDL A;  5C4J J;  4FIS A;  3S1M J;  1TWF J;  1JT0 A;  2EZK A;  5FKN A;  1F14 A;  1FEX A;  2DMP A;  2HYJ A;  1B8I B;  4A3M J;  3LSJ A;  2W90 A;  3S15 J;  3JRI A;  1ENH A;  2NVT J;  2VUM J;  2VI6 A;  3JRH A;  2O9L A;  2E19 A;  1G2H A;  2JA8 J;  5JLX A;  1BW6 A;  4JP0 A;  5M5X J;  2DMT A;  3K2A A;  2HOT A;  3JRG A;  5EEA A;  2HXI A;  3TED A;  2XGE A;  2YU9 J;  2JA7 J;  4IM7 A;  1HOM A;  4DCK A;  4M3B A;  4A3B J;  2MGQ A;  4XRS A;  5FKO A;  3BR0 A;  1MH3 A;  2O8K A;  4BY1 J;  3CTV A;  2DTZ A;  1ZGW A;  1FTZ A;  4D5F A;  4HNV A;  1IUF A;  2LLK A;  4I76 A;  1E3O C;  3PDU A;  1QPI A;  2OF7 A;  3BTJ A;  1LFU P;  1DLJ A;  2R5Z B;  4MLO A;  4JX4 A;  3LNQ A;  5FWN A;  4GBJ A;  2DA3 A;  1O4X A;  5IP6 A;  5M5W J;  3GTL J;  3CKY A;  2JMW A;  1YRL A;  2K9Q A;  1F17 A;  1ITY A;  3S1N J;  2ME0 A;  1YVE I;  1GV5 A;  4D7N A;  2AHQ A;  1UHS A;  4DYC A;  1WP4 A;  3L6D A;  3S2H J;  3JRB A;  2R5Y B;  1ETX A;  3RZD J;  3OIO A;  2WAQ N;  4X1E A;  5IOY A;  2R92 J;  1X58 A;  4D3S A;  3K96 A;  3I4N J;  3ZWB A;  2P4Q A;  2OPT A;  4UUS B;  3Q3C A;  1LJ8 A;  1QVU A;  5BNG A;  2COB A;  5FLM J;  1X0V A;  5FLV A;  1LE8 B;  2IZ1 A;  1X2N A;  2GF2 A;  3BR3 A;  1TC3 C;  4FE4 A;  4BXX J;  4XIC A;  1P7I A;  4I6Z A;  3BG9 A;  3HOY J;  3PO2 J;  4D7M A;  5K7Z A;  3G17 A;  1PGQ A;  5FKK A;  4X6A J;  2I9P A;  1WGX A;  3MN2 A;  1IRZ A;  3DCF A;  3QPL A;  1RPW A;  4IHY A;  3HB9 A;  2EZI A;  1M67 A;  1U9N A;  3PEF A;  3FK7 A;  1T33 A;  5EG0 A;  3K7A J;  3H3V K;  3DFU A;  3FWN A;  1Z77 A;  5F1J A;  4J0E A;  5A9T A;  4DZJ A;  1ETO A;  5EDN A;  2EH3 A;  1Q1V A;  3ZQL A;  2R5Y A;  5F27 A;  3GTM J;  2IEK A;  3BQY A;  1AKH B;  3ADO A;  5FJ8 J;  1SFO J;  2MW8 A;  4GFB A;  9ANT A;  1N1G A;  2ME6 A;  3PO3 J;  4PZD A;  1YON A;  5EZH A;  1PUF A;  1F43 A;  2L0K A;  1OJL A;  1PUF B;  2B63 J;  2JJ7 A;  4BBS J;  3I83 A;  1VPD A;  3A03 A;  4RDU A;  4A3F J;  3QQA A;  4Y7N J;  1PGP A;  2TCT A;  3EGO A;  3G1O A;  2DMU A;  3MKL A;  5AYV A;  3WS7 A;  2DN0 A;  4MFE A;  2ZB9 A;  3HOU J;  1IGN A;  3JRE A;  1MBE A;  2DA2 A;  3TP0 A;  3OSF A;  2X58 A;  3JRC A;  3GBG A;  2MG4 A;  3ZW8 A;  4ABZ A;  2M9H A;  4IEJ A;  1F0Y A;  3IV5 A;  4XK4 A;  1MSE C;  1WDK A;  3IQD B;  1TWH J;  1Y1W J;  1BL0 A;  3M3Y J;  5IYB J;  5JE8 A;  3C2B A;  3WFI A;  4E13 A;  1MBF A;  2XRL A;  1WH7 A;  2EZH A;  1WCM J;  2CQX A;  2Y0S N;  1R9T J;  2JA6 J;  2CUF A;  2R7Z J;  2G0E A;  1OCT C;  1VND A;  4CYC A;  1FIA A;  2KT0 A;  2CJJ A;  4YCA A;  1HF0 A;  2ZYG A;  2R5Z A;  4FTH A;  2GM4 A;  1X0X A;  5K7H A;  2HOS A;  3NAR A;  1DU0 A;  5F0F A;  1YB4 A;  3IH3 A;  3JR9 A;  2M8G X;  1XC5 A;  4AC0 A;  1K83 J;  1JKO C;  1PGO A;  2H1K A;  3S1R J;  2XGD A;  4Y52 J;  4W1U A;  4IHX A;  4B3A A;  1H8A C;  2L7F P;  2IYP A;  2DA6 A;  2LFB A;  4DYQ A;  3B6C A;  5GP9 A;  5IOZ A;  2K9S A;  1VF9 A;  4DYR A;  3GTQ J;  5EGO B;  3VPR A;  3UKG A;  2JA5 J;  2WV1 A;  5F0C A;  4A3C J;  1GDT A;  4BBR J;  2NVX J;  1JDJ A;  2DA7 A;  4B3J A;  3QSG A;  1TWA J;  4JPZ B;  3HDH A;  2DMQ A;  2JK3 A;  1ZCJ A;  3SJM A;  3OBB A;  2DA4 A;  1ETQ A;  1UG2 A;  2XPU A;  1RES A;  3HGG A;  3OOU A;  4FGW A;  2E2H J;  2HOA A;  4EEF G;  1PGN A;  3C7D B;  4A3I J;  1ZR2 A;  4OVN F;  1M76 A;  1I3Q J;  1JJ8 C;  3S16 J;  3ZQF A;  5E3O A;  3BR2 A;  3HKZ N;  1ETW A;  3ZQC A;  4D3F A;  2XGC A;  1UMQ A;  5EZG A;  3LSR A;  1IL0 A;  2YS9 A;  3HDD A;  2FJ1 A;  5DTD A;  2ECC A;  1RET A;  2FD5 A;  4M3G A;  4B1R A;  5DS9 A;  5IP7 J;  1MNM C;  4C3J J;  5C44 J;  4BKX A;  1Z0X A;  1JKP C;  2HI3 A;  3D1N I;  4A3J J;  3IH4 A;  3HEF A;  1A6I A;  3A01 A;  1JUP A;  3JRF A;  2HDD A;  3ZHB A;  5FKL A;  3DOJ A;  5J1R A;  4M6V A;  1ZQ3 P;  3GTK J;  2LVS A;  1APL C;  5J1U A;  1W0U A;  2D5V A;  4JYK A;  3ZQH A;  4D5C A;  2H8R A;  1EVY A;  3BQZ A;  2K9N A;  2GLO A;  1RKW A;  3CQZ J;  1IDZ A;  1M66 A;  3RQS A;  1YRN B;  5E3M A;  2CU7 A;  4JX6 A;  1FJL A;  2XSD C;  2XPW A;  4A3K J;  2R93 J;  1QRY A;  3ADP A;  1BW5 A;  3RKQ A;  2HXO A;  1PGJ A;  2NS8 A;  2CUE A;  3BG5 A;  3H0G J;  5EF6 A;  1H89 C;  2L7M P;  2ZYD A;  1FIP A;  2PLA A;  2KDZ A;  4C2M J;  3BR6 A;  2NS7 A;  1BA5 A;  5A9R A;  1WPK A;  4V2G A;  1IDY A;  1N1E A;  3CMY A;  2IBD A;  2XPV A;  3GTJ J;  3BG3 A;  1NK3 P;  3PLR A;  4DW6 A;  2DA5 A;  1KS9 A;  1U78 A;  3JRD A;  2EBI A;  3FK6 A;  2LKX A;  1GV2 A;  1U9O A;  3HM5 A;  1RR7 A;  2XB5 A;  5GPC A;  1M75 A;  3PID A;  2ZYA A;  4S3M A;  1VFC A;  1I36 A;  2HDH A;  3SDG A;  2D3T A;  3FIW A;  4J0F A;  2JN6 A;  2IZ0 A;  2QF7 A;  3S1Q J;  1ETV A;  3PM1 A;  2Y9Z A;  1Y1V J;  4XRS G;  1AKH A;  1TWC J;  5A9S A;  1I50 J;  3MVP A;  4AUX A;  2FX0 A;  3BT9 A;  1AHD P;  2DJN A;  1MBJ A;  1H88 C;  3HN2 A;  1QVT A;  3M4O J;  5IPA A;  1U8B A;  1DLI A;  3FKI J;  1ZTR A;  4UUS A;  1JTX A;  1BG6 A;  3A02 A;  4G12 A;  2IAI A;  3ZQI A;  4MO7 A;  4BY7 J;  1CQT A;  1HLV A;  4A3D J;  3G1L A;  1QMG A;  5F08 A;  5K7F A;  3NAU A;  2MSY A;  3WHB A;  2EZL A;  3OSG A;  2AO9 A;  1P7J A;  1MBH A;  5JLW A;  2K40 A;  4C3I J;  5J1Y A;  1NTC A;  2Y2Z A;  4QSH A;  1IV6 A;  1B8I A;  2LK2 A;  2L9R A;  1JUS A;  1LFB A;  3C7A A;  2LTP A;  1GUU A;  2L7Z A;  4A69 C;  2VKE A;  3L1P A;  5HOD A;  4IHV A;  3HOW J;  1BJZ A;  2X6O A;  3TW6 A;  4M3E A;  1MBG A;  2ID3 A;  2TRT A;  4FE7 A;  2FQ4 A;  1MSF C;  2LY9 A;  2R0Q C;  1XS9 A;  2P81 A;  1IC8 A;  4OQY A;  4PZE A;  2I10 A;  2UYY A;  5M5Y J;  2E1O A;  3GTO J;  2WTB A;  5C4X J;  3BTI A;  1X2M A;  4A3E J;  1JGG A;  3GTG J;  2CQQ A;  4KUE A;  4L5E A;  1WH5 A;  3JRA A;  4OL9 A;  1AU7 A;  2Y31 A;  1ETY A;  4OQZ A;  4GWG A;  3F0C A;  3Q0W A;  3F3S A;  2LR8 A;  4B3I A;  2N8G A;  4J19 A;  1WI3 A;  1LE8 A;  5FKM A;  3C7C B;  1EF4 A;  4EZB A;  4XID A;  1YJ8 A;  3QHA A;  1XG1 A;  4M3F A;  2LP0 A;  3G1M A;  4UUT A;  3CDL A;  1ZK8 A;  3ZQG A;  4XRM A;  1OCP A;  1IJW C;  5EGO A;  5F04 A;  1YRN A;  5A9S B;  5C3E J;  3FR8 A;  3WFJ A;  2QCO A;  2JWT A;  3O8G A;  4W97 A;  4FCY A;  4V2F A;  3FR7 A;  2M0C A;  1M2W A;  1MBK A;  2Y9Y A;  1T56 A;  4IHW A;  2DA1 A;  2DMN A;  4PZC A;  5IYD J;  3DEW A;  2NVY J;  2PMZ N;  2IYO A;  1LSJ A;  3O8H A;  3ULK A;  1ORK A;  2EQR A;  2X9D A;  3BR1 A;  3CCY A;  4MIM A;  2M2E A;  3TP3 A;  1K61 A;  5E3L A;  4DLL A;  4CYC B;  2W8Z A;  2M34 A;  3WHC A;  3A01 B;  1ZR4 A;  5M3F J;  1JKQ C;  1HDD C;  4DYD A;  3BTC A;  3B6A A;  3HBL A;  2E2I J;  3QPS A;  4MFD A;  3HWR A;  3Q3S A;  3K6J A;  2XB0 X;  2LD5 A;  3ZWC A;  4A3L J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...