2Y9ZA

Chromatin remodeling factor isw1a(del_atpase) in dna complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
287
structure length
287
Chain Sequence
RSSTPSHPRMPKPHVFHSHQLQPPQLKVLYEKERMWTAKKTGYVPTMDDVKAAYGDISDEEEKKQKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDATKDRMKKED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Mechanism of the Chromatin Remodelling Factor Isw1A
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)
total genus 70
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09110 HAND HAND
A PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9zA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9zA04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2y9zA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 2y9zA03
2WB1N 2MW8A 4XICA 1GDTA 3PO2J 1F36A 3HBLA 3SDGA 3JRIA 3BT9A 2JJ7A 3BR5A 5JLWA 3JR9A 1BW5A 1UG2A 3C2BA 4UUTA 5J3LA 3PO3J 1WH5A 4AYBN 5IOZA 1JT0A 1MH3A 1DU0A 5FKOA 2HXOA 2ELKA 3VPRA 2M9HA 5FJ8J 4QTRA 3S1NJ 1HOMA 4L5EA 2R5ZB 2QCOA 4M3DA 3RKQA 2XB0X 1JKOC 1QPIA 3M3YJ 4V2FA 3L1PA 1HCRA 2OPTA 2XRLA 3IH4A 1LFBA 2XPVA 2DA1A 2DJNA 1ZR2A 3F0CA 3CMYA 5IYBJ 5IOYA 4MFDA 1GUUA 3QPLA 1ETOA 2NOGA 4D5CA 2VI6A 2OF7A 3S1MJ 4M6VA 4BXXJ 3S2HJ 1XS9A 4A69C 3JREA 4M3FA 2HOSA 3TP0A 2CUEA 2CU7A 3HOZJ 1TWGJ 2O8KA 4C3JJ 3HEFA 2KDZA 2HQ5A 1HF0A 3S14J 1IV6A 3LSRA 3HOYJ 1ZR4A 5EZHA 3HM5A 1YRNA 3BTJA 3FKIJ 4FE7A 1JUMA 2LKXA 5EYRA 2TRTA 3GTGJ 4DCKA 1WCMJ 2HYJA 1VF9A 5IP7J 1FIAA 4M3EA 2D5VA 1YRNB 3BR6A 5EG0A 1K61A 5F1JA 1JUSA 2VPRA 3CCYA 3MVPA 3BTCA 3GTOJ 3ZQGA 5J1YA 4JYKA 2TCTA 2EZLA 4W97A 3HGGA 3HB9A 3I4NJ 1U9OA 1MSEC 5IP6A 5J1UA 3ZOBA 3BG9A 1U78A 4RBOA 1UHSA 4BBRJ 3LSGA 1P7IA 1X2NA 2DN0A 1U9NA 2EBIA 4MIMA 1VNDA 3S17J 4A3CJ 1MBGA 3G1LA 1T33A 1OCPA 3CDLA 4D7MA 3NARA 1WH7A 1ETKA 3Q3SA 1R9TJ 2L7ZA 1BA5A 3BR0A 3RZOJ 4JX5A 3W6VA 4IHWA 1IDYA 4B1RA 3JRGA 2H1KA 2E1OA 3QPSA 2YS9A 1FTZA 1IC8A 4JQ0D 1IUFA 5M5WJ 1RKWA 4QSHA 2HXIA 2KT0A 4BKXA 1X2MA 4UUSB 2E2JJ 2EH3A 4RDUA 3GBGA 1I6HJ 3FISA 3ZQIA 2VUMJ 3LSJA 3HOXJ 1A6IA 2LR8A 5DS9A 4A93J 2CRGA 1TWFJ 2JN6A 1LFUP 4IHXA 4A3FJ 3UKGA 5F04A 5M5XJ 3JRDA 2E19A 2DMNA 2MSYA 2XPUA 5FKKA 3G1MA 3SJMA 5IP9J 5EEAA 1S7EA 5K7FA 3IH3A 4IHVA 3JRAA 3S1QJ 1UMQA 5C4XJ 1JTYA 2XPWA 1JJ6C 1NK3P 2AHQA 1AKHB 4B4CA 2YU9J 3JRFA 2JWTA 1I50J 1MBFA 5EDNA 1ZK8A 1H8AC 2DMUA 3JRHA 3S1RJ 1JKPC 1BJZA 1ZQ3P 4DZPA 3H0GJ 5FKNA 2EZIA 2PMZN 3WHBA 3WHCA 2ID6A 4AUXA 2HDDA 1IJWC 2R92J 1PUFB 5E3NA 3GTLJ 1ETWA 3BR3A 2XB5A 1TWAJ 5F0CA 2L7FP 1LE8A 1U8BA 1JGGA 2K40A 3B6AA 5EZGA 4A3LJ 2DA7A 4XRSA 2NVXJ 3ZQFA 4BY7J 2ID3A 3K2AA 1E3OC 3NAUA 1X58A 4D5FA 3BR2A 3G1OA 3ZQHA 1P7JA 1AKHA 2Y31A 2R0QC 1XC5A 1TWHJ 2K9NA 1ORKA 5F08A 2HOTA 1FIPA 2K9QA 1ETQA 3BQZA 1ETVA 3GTPJ 1K83J 5E3OA 1B72B 4A3KJ 2EZHA 4A3MJ 5GPAA 2LLKA 1ETYA 2GLOA 2O9LA 3OSFA 1TWCJ 2G0EA 1GVDA 1MBEA 2VKEA 2M34A 2DA6A 1MBJA 2DTZA 3TEDA 2DMTA 5K7ZA 4BBSJ 2FQ4A 2FX0A 2FD5A 1B8IB 3HKZN 4C3IJ 4A3EJ 2H8RA 3QQAA 2R5YA 3IH2A 1Q1VA 2IAIA 1ZGWA 2RAEA 4DZJA 1BW6A 1APLC 3E7LA 1Y1WJ 1MSFC 5M3MJ 3ZQCA 3HOUJ 3BQYA 1HDDC 3A01A 3DEWA 9ANTA 4EEFG 5F0FA 1HDPA 2M2EA 1H88C 3PM1A 2ME0A 4V2GA 3RQIA 2JA5J 1G2HA 1AU7A 5GP9A 4J19A 5EGOB 3HGYA 1O4XA 1GT0C 5FLMJ 2MG4A 3TW7A 1MH4A 1NK2P 4X1EA 3JRCA 4S0HB 1FJLA 3A02A 2JA7J 4CYCB 5EGOA 4GFBA 4DW6A 3BR1A 2I10A 2QF7A 2Y30A 3OIOA 4JX6A 1OJLA 1I3QJ 3D1NI 3S16J 1PUFA 4FCYA 1QVTA 5HODA 1D5YA 4A3GJ 1FEXA 4HNVA 1LE8B 3GTMJ 2E2HJ 1DU6A 2JA8J 2NVQJ 4JP0A 2EQRA 1EF4A 2VKVA 3LSPA 4IHYA 5K7HA 2LP0A 2NS8A 1WI3A 2GM4A 1GV2A 3BTLA 2CUFA 2DA2A 1RESA 4FE4A 3TP3A 2DA4A 2ECBA 3IV5A 2R5YB 5FKLA 1VFCA 2X6OA 4A3JJ 2B63J 2GBYA 1RKTA 1A5JA 2FJ1A 3OOUA 5F0HA 4I6ZA 1Z77A 4A3BJ 2DA5A 1WGXA 2K9SA 1JUPA 4NDLA 4QIWN 2YUSA 2X48A 1BL0A 1OFCX 3MKLA 5GPCA 1ZTRA 2N8GA 3HOWJ 1H89C 2WAQN 1RR7A 3GTKJ 2HI3A 2IBDA 2JMWA 2O7OA 2NVYJ 4MLOA 2Y9ZA 4JPZB 1AHDP 3LNQA 4C3HJ 4A3IJ 3S2DJ 4D7NA 4Y52J 3SFIA 4BY1J 4MFEA 5IYCJ 1JTXA 3TW6A 3RZDJ 2HOAA 2COBA 2P81A 5J1RA 2Y9YA 1Y1VJ 2E2IJ 5EF6A 3ZQLA 2W48A 4CYCA 2X9DA 4MO7A 1ENHA 1VI0A 1ITYA 5E3MA 3OSGA 5FKMA 4DYRA 1IRZA 2M0CA 2R93J 2M8GX 3H3VK 2IEKA 2LK2A 4Y7NJ 3Q0UA 2NVTJ 3FIWA 2XGEA 3BG5A 1POGA 2XGDA 3FK6A 2LD5A 4OVNF 1MBHA 4XIDA 2XGCA 4X6AJ 4I76A 1HLVA 3GTQJ 1ETXA 1XG1A 5BNGA 1B72A 3BG3A 3M4OJ 3S15J 2NS7A 3MN2A 4B3AA 3A01B 3CQZJ 4M3BA 2MGQA 2LVSA 2Y2ZA 4W1UA 5M5YJ 2Y0SN 2CJJA 3Q0VA 2DMPA 3HOVJ 1JT6A 2R5ZA 5C44J 1F43A 4XRMA 3O8HA 4M3GA 4FTHA 1IDZA 4ABZA 1MBKA 1B8IA 1GV5A 1IG7A 5FLVA 4G12A 2L7MP 4A3DJ 2LTPA 2AO9A 1ZKGA 1JJ8C 1RPWA 2JK3A 5EG0B 1TC3C 5C4JJ 5IPAA 2JA6J 1JKQC 3HDDA 5IYDJ 1CQTA 5C3EJ 1QVUA 2DMQA 1FTTA 5E3LA 5F27A 3JRBA 1WPKA 1MNMC 1SANA 4DYQA 4UUSA 2CQXA 3I4MJ 4XK4A 4XRSG 1OCTC 3K7AJ 2ZB9A 1RETA 3B6CA 1JKRC 4LOCA 3DCFA 2WV1A 5JLXA 2CQQA 2L9RA 3Q0WA 3BTIA 4JX4A 1QRYA 2ECCA 4IEJA 2ME6A 5M3FJ 1IGNA 2L0KA 3O8GA 2DA3A 3FK7A 1Z0XA 4FISA 2XSDC 1T56A 2EZKA 2LFBA 3A03A 5DTDA 2LY9A 3LOCA 3GTJJ 1SFOJ 4AC0A 4C2MJ 2R7ZJ 1W0TA 1NTCA 4DYCA 1W0UA
chains in the Genus database with same CATH superfamily
1MNEA 4G94A 2MW8A 1KQFB 3VYTB 2A68F 5D4SA 4R79A 1PP8F 2KLUA 4HF2A 3SWKA 1Z7UA 1OR7A 3JRIA 1N8RQ 1Z6RA 3ZN1A 4HDVA 3QSGA 1E5WA 3DQVC 3L2CA 3CUOA 2FYUE 3II6A 1KFNA 4M3LA 1BW5A 1LVKA 4JQFA 3C2BA 3T8TA 3ZWCA 2O3JA 2YKPA 3SFZA 1KC8Q 4AYBN 1JT0A 3CWBE 1FJPA 2DI3A 5JVTA 1MH3A 2OYIA 4B3XA 1YJ9P 3EYIA 3CL3D 2XKMA 3FXEA 3NQOA 4AYBA 2WITA 4PGHA 1JKOC 2XB0X 3RPUA 4YIRX 2L9NA 5FD6A 3L1PA 1QPIA 1MMGA 1L0ND 5CCGC 1HCRA 2OPTA 2HQAA 2VLAA 4ZYEA 1SVMA 2FEZA 4B3HA 5DUIA 1LFBA 4GYGA 1YYVA 5TJJA 1I1SA 1ZR2A 2VQGA 2XSJC 3CJQB 3H1HD 3HHHA 3H1HE 3L71D 4A0YA 5E17F 3LAPA 5KJ7D 1OYWA 1OWAA 4I01A 3H1LD 4NB5A 4D5CA 1HJ0A 4ENJA 4IRHA 1YONA 2CV0A 3PIOF 3G0OA 3QP5A 1FU1A 2ZXXA 2P4QA 2PFXA 2YXRB 2XAHA 4I09A 5LEKA 3ZMZA 1XS9A 1KQ9A 3WFIA 2LF8A 4A69C 3JREA 1JCDA 1LPQA 3TP0A 3V7CA 1OX3A 1N2DC 3HOZJ 3BCCG 1TWGJ 1XN7A 3JSPA 3KX2A 2VKHA 4C3JJ 2BCCG 3CCJP 2V1XA 2G7UA 3EWKA 3S14J 4P1WA 1RZ4A 4I02A 3LSRA 2P7CB 3GHGA 1WJFA 4RAFA 4QMAA 5J4VA 3WTUC 1YRNA 3M91A 1FOSE 3F6VA 1VQ4I 1ZG1A 1JUMA 4XKCA 1G59A 1U0JA 2TRTA 3GTGJ 3SXYA 3LA3A 4HDUA 3A0HE 3OBBA 1BDDA 3P9IA 2BW3A 2HYJA 4GOEA 1OYYA 5B5EE 2OJED 1I27A 4L74A 2L5QA 4S04A 2GXGA 1UB9A 1ZRDA 1YRNB 2D5VA 4GBJA 1N86A 2QKLB 2E1MB 1JUSA 5CVRA 3CCYA 5EEHA 3ZRGA 1FAVA 5AIPA 3OS0A 3RPQA 3BTCA 5KK1A 1R8EA 1KYWA 1G1JA 1S1CX 2EWNA 2QJYB 2F2EA 5J1YA 2DYSH 3I83A 4XL9A 1LKXA 5M1BA 2EZLA 1EXJA 4MNUA 3F8MA 1XD7A 3CUQB 2MC3A 3FM3A 4WY4A 4Q47A 3HGGA 3HB9A 5AW4B 3CPWO 4ZYDA 1MSEC 1HXDA 1FWZA 4Z2YA 3W6JB 1T6SA 2XASA 3ZOBA 4J01A 1VQOI 1TNSA 2PRRA 4L5JA 4RJTA 3BP8A 3R60A 1OISA 1TQPA 2CQ7A 3LSGA 2ZMEB 1LWUA 2VKDA 3V5BA 5JE8A 2BY3A 4MIMA 5APWA 2IPPA 4PV1C 1MBGA 3VYUB 1W36D 3CDLA 1GU5A 5ERIA 3OYFA 3AE4C 3BZKA 1R1UA 2PLAA 3BR0A 5HWSA 3CTAA 5CVIA 1IDYA 2K9LA 1Z67A 2HR3A 1ON2A 5LD2C 2M8EA 3ZCOA 1GLNA 2CUJA 1SFKA 3QPSA 3IRRA 1FTZA 3MKWB 1QGPA 1IC8A 4YFXF 3HRUA 1IC2A 4JQ0D 3TYYA 5FD5A 2K37A 1U8RA 2QWWA 3BCAA 1RKWA 2R44A 4IKFA 1V55H 5HS7A 3PIDA 2HXIA 1VQ9I 1YJWI 3GVAA 4UUSB 3JSVC 2EH3A 4RDUA 1I6HJ 5KJ7C 4C2UA 3CI9A 1HGZA 1L4AD 1QA6A 3K6JA 2OA4A 4KUMA 5AVVB 4GYIA 2V79A 3F3XA 2LR8A 2X6YA 5A9TA 4RB3C 3RL0g 2HGCA 5DS9A 1IN4A 5A2QZ 1YI2I 1L3LA 3MWMA 2R7XA 4TLFA 1VQ4P 3CF5F 3UKGA 5F04A 4MQ9F 5M5XJ 2V7FA 3FF5A 1Z6TA 2EFQA 3ERMA 4N78D 3M7GA 1XDUA 4XMYA 5B1BH 2OQGA 1VTNC 4KN4X 3J81K 1M2WA 4BRYB 3OY9A 4WWIA 2LBFA 3LAJA 1HQCA 3DXJF 5HNFA 3S2WA 3HUGA 3ULQB 2WPVB 4C9YA 3JRAA 1UMQA 5C4XJ 4PSWA 1RH5B 1JTYA 1OMIA 1JJ6C 3E5XA 4ZYGA 3HE4A 3BC8A 4M9ZA 4B09A 1X22A 4OM8A 1IXSB 2JRTA 3L70G 1RR8C 2JSCA 1Z56A 3EFFK 4A5MA 2YU9J 2XVCA 4ZC3A 4UVAA 2HVQA 2FOWA 3M06A 3MAJA 1IK7A 2CS3A 4I2LC 3MD0A 1R5GA 2EZIA 2K4JA 3WHBA 3WHCA 2ACJA 1NAFA 1W7PB 4KT5C 4PJMA 2ID6A 2AXTC 2HDDA 3CX5I 3E0JB 3K96A 2E75D 1IJWC 3AL0B 5KVRA 1WRJA 1OVUA 2Y0EA 3RL0D 4IHSA 3BR3A 2XB5A 3KP6A 4ESJA 2HPCB 3WE3A 2L7FP 3BOQA 1LE8A 1LT9A 4BS9A 1U8BA 3L71E 1USTA 3RYRA 4KIBA 1YX3A 4RM2A 4HQEA 4N4NB 3PP5A 3B6AA 3I3LA 2X6XA 3QH9A 4NPFX 5KAFC 2BY1A 1C0WA 3K4CA 2CFXA 4XKVA 3O3KA 1E3OC 1E79H 3TNUB 1YJWP 5KCMA 1N75A 3NAUA 1X58A 3T0YA 3F22A 4Y28J 3U1AA 1BGYG 3BR2A 4U0WA 1G4DA 3AE7C 5AVYB 1XC5A 1XMXA 1ODDA 1TWHJ 2K9NA 3EQ2A 3HTKB 3SWYA 1FZPB 2W25A 2CQNA 1HKTA 2IT0A 2K9QA 5CPRB 2ZJRF 1ETQA 4XLAA 5GTIC 3CCMI 2JPBA 2Y75A 3GTPJ 2H1LA 3C1LA 4EJVA 1B72B 2KISA 2PFBA 2KRCA 4A3MJ 1VQKI 1BI3A 2KUBA 1QZZA 4LJZF 4EGZA 2ZJSE 2PJRB 1JGSA 5ICCA 1G6NA 3E1RA 4U7DA 2O9LA 3RYPA 1VQOP 1JCCA 3H1KJ 3G71I 1VQPI 1NTZJ 1IUYA 2QSIA 2QRXA 1GVDA 1KB9H 2KSJA 3GHGC 1TQIA 3ZMSA 1VQMP 1MMSA 1OLTA 3TEDA 1FZBA 2MFZA 4ZDOA 1N7SC 4BBSJ 2FX0A 5DD8A 5D4RA 1YHQI 1NHLA 4NQWA 2YIUC 5AW6B 3I4PA 3GF3A 1EZVG 1SQBK 3L35A 1NYHA 5E79C 5BVZA 1X19A 5JHFA 1W1WE 1R22A 2L9VA 4DZJA 1RRJA 3GW2A 1APLC 2K88A 1S7AA 4L5IA 1OXZA 1AA0A 5JHUA 2LR2A 1BE3G 2OCEA 1SFCA 1HDDC 2KOGA 3A01A 1FPQA 2ZVOB 4IOIH 1A02J 4IRIA 4OAYA 2BCCJ 3M8EA 5L3CA 3Q9SA 3MOGA 3L71J 4RGUA 2ME0A 3L75D 3RQIA 1G2HA 2H09A 3F23A 3CXHE 3L74G 3KIOA 5HLGA 1IO4A 2HPMA 1MMDA 2DK8A 4F7ZA 4S3MA 2RKHA 1KILA 1PIXA 4H44C 2FF4A 4HF0A 3NRVA 3HUSC 2W85A 3EYYA 1ZG5A 1IFPA 3P7KA 3V4WA 2MG4A 3EQLF 4IQJA 2QGUA 2EIMH 3TW7A 4UB6H 1G3WA 2WV0A 2B9BA 2KRFA 3QHAA 2XZRA 1DX7A 2E74C 2YSRA 3H1LJ 1P6RA 3F72A 1FE6A 1TNTA 2RN7A 2X58A 2I1JA 3H1JD 3A02A 1K6OA 1EA3A 3JTHA 4MGRA 4GFBA 5EGOA 2C0XA 3E6DA 2WWWA 3L73D 3VP9A 3RPUD 3PQKA 4R4MA 1SQPJ 3V2QA 1IL0A 3ESWB 1OIPA 2DYRH 2I10A 2QF7A 2Y30A 2GAUA 1BG6A 3CCLP 3EDPA 3OIOA 1S72P 4PDKA 4UB8E 1SQXK 2QIWA 2K9YA 3RKXA 5AVQB 5FWNA 3D1NI 1OZHA 5AW3B 3CC2I 2UYYA 1RF1C 2XAFA 1JHHA 3GX4X 4KYWA 1O7FA 1EZVI 3H1IJ 1S9KD 1TTYA 3CESA 1ZOYC 5HODA 1D5YA 1ZRTE 4ASNA 4IXAA 3GTMJ 2HZTA 4BUPA 1VQ7I 3C2GA 2JA8J 2KIKA 2NVQJ 3WU2E 3MGNA 1K4TA 2O01H 4RM3A 3OYBA 3JSOA 4P96A 1L0NG 2E76C 5A9RA 3IWFA 1BIAA 1W7PA 2LP0A 1WI3A 5K7HA 3P5JA 2GM4A 4U3FG 3H36A 4I0BA 3I59A 5ICFA 3TGUJ 4H0EA 2Z5HA 4JF7A 4R4LA 2DA4A 1W4MA 3IV5A 3WFJA 2FYNC 2NPSC 4XN3A 1VFCA 1OR7C 2O8XA 2DFEA 3A2AA 3FWEA 3P9KA 3QYBA 2QEXI 4CO8A 2V6EA 3EPZA 3FXQA 1HUCA 4A3BJ 4EOTA 1RI7A 5ILSA 4Y15A 1DQUA 1WGXA 1VF5C 2K9SA 4JBZA 4DT0A 1U6GA 1Z21A 4B43A 1BCCD 2Q3IA 2QSGX 2A5WA 3SSUA 2QE7H 2OYHA 2O6GE 3H92A 1FOKA 3I56P 3CCUP 1VQ9P 2PQ8A 2UUZA 1TW2A 3GTKJ 1LJ9A 4PD4H 2HI3A 2IBDA 2ZC2A 4IL6X 3AAFA 5LHIA 2X6WA 2Y9ZA 4JPZB 1G2CA 3TGUG 4MHGA 1USSA 5KAIH 3RKWA 3F5HA 1YIJI 3ABLH 1TU3F 2LXBA 2M4KA 2CMPA 2P81A 4PD4I 4EDFA 4P5OA 5J1RA 2Y9YA 3GLMA 5CVJA 2PJPA 3K70D 1IK9A 4BH9A 4L9NA 1H8AA 3ZQLA 1FC2C 4CYCA 2K1AA 4PJ0C 3A0HH 1ENHA 3VOEA 1BM9A 2WB1A 2WC2A 1XCBA 4HZFA 5K5RA 1ITYA 1ZN5A 3MMYB 1M1JC 2H27A 5FKMA 5C39A 4DYRA 3WMM0 1X0TA 3R61A 5APUA 2M8GX 3K1NA 2Z3YA 4II3A 2LK2A 2Z1DA 3GMEA 4B44A 1YBKA 2BXYA 4IQ4A 1R5ID 3CC2P 1FZCC 1X3UA 4NHJA 1SD5A 3FK6A 1J1EC 4HH2A 1IZNB 4OVNF 1S5LC 2DTRA 4O6JA 2BASA 1KORA 5HLHA 2AEMA 3ZDMA 1SFEA 3BCCD 2ESHA 4X6AJ 1OW7A 4I76A 3LQRA 2H8WA 1HLVA 4NC8A 1ETXA 2P1JA 1L0NK 4WY4C 5BNGA 4I7HA 5ICGA 2GUVA 2VODA 3CLOA 1NU1G 1IV8A 3I9V2 2DODA 1LNWA 4L9VA 4D9JA 5CCHC 1S9KE 5K5QA 3CCVP 1JUNA 4M3BA 1WJDA 3SEQA 1R5HA 3PSIA 2EJRA 5L3DA 4A7PA 1GD2E 4RO0A 4V19K 3HADA 1QMGA 1VDFA 3I55I 4E21A 2BEQD 2DMPA 3HWRA 2K86A 2LY1A 4F92B 2R5ZA 1KQLA 1RQUA 2HG5D 4R1HA 3O8HA 1MDMB 1UHMA 2N9BA 4CHUA 2W83C 1QBJA 5DEQA 2QYOA 1NTZK 5LGUA 1B8IA 3R6SA 2GWRA 3DLLF 3W2AA 3JCUE 1IG7A 5FLVA 5J6XA 1DGRM 4G12A 3L74E 1XGNA 3DU6A 4YFKF 2LTPA 3K10A 3J81Z 1WSUA 1NTZD 2DT5A 4Q48A 3OYGA 2HPCA 2AO9A 5APXA 5BU5A 1CGPA 4PJJA 1OQYA 1JJ8C 4R1NA 1DEBA 3GZNB 3M07A 5EG0B 4XR6A 2EV5A 1P2FA 5IPAA 3GHYA 2JA6J 4AM3A 4D0PA 1FBSA 2CK3H 2HPIA 5HDGA 1HGVA 2QG4A 2H8PD 3KQGA 3AE5C 4U7JA 3USSA 2R7TA 4H13D 4CXFA 4N6JA 5BS6A 5IYDJ 3H35A 2KIQA 1N73A 2FQ3A 1MJ9A 2Z2SB 3CX5H 1QVUA 3CCVI 4ANJA 1WWXA 3JRBA 1WPKA 3CO6C 2XF6A 4HAMA 4YG2F 2A07F 1YJQA 3UNGC 1SQPK 2IJLA 3H1JJ 3I5CA 1A02F 2Q9IA 2OC6A 2E76B 4UUSA 2CQXA 3I4MJ 2KFDA 1UFMA 2KHMA 2ZKZA 1SQQE 3HJEA 3DCFA 3ZGKA 2WV1A 4KDPA 1NKNA 4F91B 3R4KA 2Q5UA 1GW4A 1IW7F 3U59A 1IGNA 4BU2A 1X1CA 4DYDA 2YMKA 1ZCJA 4XNFA 1IFNA 3FGAD 4AYCA 5CCGA 1DIPA 1ZMEC 3M9BA 2DA3A 2IGNA 2LMDA 3FK7A 3CWBD 1Z0XA 1JHFA 5DCFA 3K2ZA 1YLFA 3E6BA 1XTAA 3BZCA 2WY8Q 2XAJA 2Z5UA 3A03A 2J58A 1LB2A 3D6ZA 2FMLA 3SWFA 2LY9A 4S05A 2H7HA 3LWFA 2YO2A 4XLPF 1SFOJ 2QA4I 3SQNA 2KZGA 4M74A 2E7XA 1QNTA 3TOBA 2NVUB 1F0YA 3RQSA 3D70A 1DDNA 1NTCA 1PP9E 1I5ZA 1W0UA 4IL6C 2FFDC 3Q5FA 2H94A 3VMXA 1YVEI 1ZG3A 4HSRA 1JE8A 2FBIA 4XICA 3PO2J 2RVCA 4HA8A 1K73Q 5J8CA 2JVHA 3L36A 3K4MA 5AVTB 3HDHA 3OS1A 1JEKA 1PJRA 3F8NA 4LG0B 4LB5A 3J7AY 1WH5A 3PO3J 3MP7B 3NTNA 1G1IA 1PGPA 5FKOA 3PFIA 3VPRA 1R58A 2M9HA 3FDYA 2BHZA 5HLTA 2Q3EA 4QTRA 5L3BA 2A61A 3OA7A 3GFIA 4KT6A 1OVVA 3DBRB 2CUZA 3EUHC 4PJ0H 2XF7A 4HW0A 3CC7I 1AJYA 3H2ZA 2AQFA 1DEEG 3K6GA 1MZBA 2MD0A 5DCMB 3M3YJ 4V2FA 1YS6A 4MEXF 2XRLA 4EMSA 3IH4A 4G8XA 1HSJA 2BYVE 2FNAA 5CJ9A 1BSNA 1FLIA 2DFFA 3CMYA 4DBRA 1AV1A 1J0RA 5IOYA 1BR4A 5D5VB 4CGZA 1GUUA 1NH3A 1URQD 3O8ZA 2PG4A 1VQ8P 3KZYA 4UVCA 2XV5A 2DFIA 4KMUX 2A6HF 4WY4B 4IPAA 2NOGA 5JVGF 3S1MJ 2GIZA 1X1DA 4BXXJ 1LVAA 5HOOA 3S2HJ 3BPVA 4BQQA 2KS1B 5H20A 4N3YB 3OL3A 3TL4X 5J47A 1IRGA 3F6OA 2CU7A 4RA2A 1R5LA 4KT0J 2ELHA 3HEFA 5APSA 2BW3B 3RGUA 3Q1MA 4ZMDA 2PX9A 1IV6A 1OYIA 3PRJA 2O01N 2ZXIA 3HOYJ 3SZPA 1NVOA 3HM5A 3KEQA 1BC7C 3CLQA 1R49A 2E1CA 5B66E 5AW1B 3H1LE 3ABKH 2WSCJ 2BEZF 2RQQA 3WUVA 4DCKA 2ZJ2A 5GAEJ 3ULKA 3I71A 2KZVA 3DKYA 2CWEA 2EFOA 2QM7A 1D1AA 1FIAA 2JR8A 3IKTA 2DQRA 2D2CC 3CXHH 2IP2A 2QJKB 1SQVD 2P6TA 3GZ6A 1Y6IA 2COMA 2R5BA 4YXDC 2J5OA 4D1QA 3H1KG 3L72G 3D5SC 3GTOJ 2MYSA 2ZNZA 2PEXA 1XDSA 3ZQGA 3ZXSA 1S7OA 3UR3C 1PP9D 1ZLLA 1LGHB 2IGOA 5GTIH 5TISH 5D5XB 4A6DA 1VQKP 1OCZH 4J0FA 1MJBA 1BOAA 3PUFA 4EJTA 3I4NJ 1L0LE 1PYVA 1H9GA 1SFCD 5IP6A 2BEOA 3L70D 3FXUA 3KEOA 1FZAA 3V2PA 1U78A 3E97A 4RBOA 2VE9A 1EC5A 2HTJA 4IRGA 3H9JA 3BLYA 1FYMA 3A7OA 2Q7CA 1Z3XA 3FX0A 3V8KA 2YIUB 1UELB 2KNCB 5LHHA 1U9NA 5AVZB 2EBIA 3VP8A 4IF4A 2XAGA 3S17J 3J7AO 3NARA 1MUUA 1WI9A 3IHUA 1LDKB 3T97A 1FMVA 3Q3SA 4HYEA 2ZYAA 3DF8A 3HKZA 1R9TJ 1NHAA 2HTSA 2Z16A 3PJRA 1BA5A 1KQ8A 1Q90D 3VOPA 2M7AA 4IHWA 3ZW8A 1SQQG 3TSIA 4EM1A 3CMEI 2ELJA 2WSFJ 1KS9A 4OGQD 2E1OA 1KB9D 5B1AH 2HQNA 1NAYA 3DBLB 4B47A 1P4AA 1GK4A 1XSVA 2M30A 4OH8B 4CH7A 2ZBKA 3OIPA 1T95A 1RF1B 4LK1F 3HRMA 3CWBG 2KT0A 4BKXA 1X2MA 2E2JJ 1YQAA 3L75G 1STZA 4GGGA 4EJWA 2W8ZA 2FNPA 4B3IA 2E43A 2D2CD 2IW5A 1SQBD 2LSOA 2ISYA 1VQNI 5B5EC 2VUMJ 3ASNH 2I5UA 2W82A 2QSFX 2QSHX 3D5RC 4OL9A 5D8LB 1Z05A 4LMYA 4E7ZA 1UG0A 3VSKA 1WT6A 1BI0A 2ZXEB 5HDKA 4PV1D 1YOVB 3T8RA 1KA8A 2E1NA 5E18F 4IHXA 2MC4A 1J2JB 2UWJE 2STTA 3VB2A 5GTHE 2OARA 1ZLJA 3JRDA 4KHXA 1TZLA 2M87A 1W7PD 2XPUA 4CA0A 1XPXA 5EEAA 3GLLA 4KISA 1EVYA 3H9GA 2WTBA 2CW8A 5K7FA 1V4RA 4IHVA 4A0XA 1S6LA 4XE5B 1TP4A 3J7YJ 1LEAA 1ZAOA 4MEYF 4RB0A 1MIJA 2AHQA 2FYUJ 1LTJB 5H6QA 2L4AA 3ABUA 3FXLA 4FASD 3G6EI 2STWA 5CMZA 3GYHX 5AW2B 3CCSP 3OYAA 3WUTA 4RAYA 4FX4A 2K4BA 1MMNA 1LFPA 3OYKA 1N73B 3K70C 1H8AC 2W6AA 4U7BA 1ZYRF 3S1RJ 1JKPC 2GA2A 2IGMA 1BJZA 5E8IA 1ZQ3P 3J80K 4HF1A 3BCBA 1T98A 3LSMA 5FKNA 5HS9A 3A4CA 4II2A 1R7JA 3N7NA 3BRVB 1PUFB 1VF5D 2R3SA 5E3NA 3GTLJ 1NO4A 1ETWA 1KYZA 2MLGA 2YPRA 4M9SA 5KLVD 2OYHC 1LJ2A 1SP4A 2F5EA 4AIJA 5A9SA 3U2RA 1J7KA 1NG6A 4AIDA 2W6BA 5TISE 2DK5A 2DCEA 2HQRA 2XDJA 1IN6A 2DW4A 4G7HF 5EZGA 4A3LJ 2N1TC 3A3YB 4XRSA 3F21A 1URQC 2KXPB 3U1DA 4BY7J 1WJBA 3S3MA 1NTMD 3NXSA 3ZHBA 3NEUA 4QPQA 4D5FA 2QENA 2P10A 2QJPB 1EH7A 1J9IA 1L0LD 3TDUC 3AE6C 3MUDC 2Y31A 3FMQA 2R0QC 2E74B 4XRFA 4IL6E 3W2WA 2YKOA 3K4BA 1XSDA 2YMYA 1IFIA 1HVVA 2DT6A 3EETA 1DLJA 3MZWB 1KYOI 2M3EA 4EI2A 2P0WA 4BDZA 1ETVA 2FBHA 3HOTA 4GDOA 1YRLA 3BJ6A 2O61A 4F93B 5E3OA 3GZ5A 3HSEA 4W7ZA 3L72E 3M9AA 4KA4A 1Q82Q 4A3KJ 2EZHA 2A45G 3IF4A 2BHYA 2LLKA 1S9HA 1PP9G 3KYQA 1ETYA 1ZV8A 2GLOA 3A0BC 4LLLA 2OYIB 5BOXA 3GFMA 1BGYE 2BY2A 2PMZA 4BWNA 1NH4A 1YW7A 3AL0C 1WHUA 1H0MA 2M34A 2V4JC 4D3FA 1QLED 2DA6A 4FT8A 4OAZA 1MBJA 2J5UA 2DTZA 5AVSB 4DZOA 2WTYA 3Q3DA 2FFDA 1VQLI 3K0LA 5LFAA 1BE3J 4GRIA 4A3EJ 4E6KG 1T8ZA 1P92A 3WGIA 1IF1A 1OCRH 3WU0A 4BL0B 3HD7D 2KDOA 3JC22 4IVNA 1F1ZA 3BVHA 2V9KA 4ZH4F 3T5XA 3P8CE 3IH2A 2IAIA 4ZNCA 1ZGWA 3BWGA 3PSFA 1GU4A 1U57A 3M0DC 5DJTB 3RK3B 4KUHA 3IWZA 1A36A 3HOUJ 5M3MJ 3ZP5A 3RDIA 3BQYA 3I64A 3W6ZA 2VOOA 9ANTA 4EEFG 2M4GA 1P84I 1HDPA 1H88C 2CQKA 1O3SA 2HVRA 2XNDH 2C6YA 2JA5J 2LXCB 3TDZC 3PNVA 2P2UA 3G17A 3IQDB 1HJBA 1AU7A 2R7QA 3TQNA 3RIRA 4J19A 1AA7A 1BI2A 1P84H 5CJ4A 5EGOB 1N77A 3WS7A 1I36A 1GT0C 2VE8A 1TT5B 1KQSO 2PMHA 5CQGA 3RBXA 1U5TA 1H89A 1R00A 4P9FA 1N7SD 3CP2A 2BZTA 3OL4A 2Q8KA 2P67A 4MN4C 3TNUA 2CFOA 2A06G 4A2UA 2NS0A 2YU3A 4DIQA 5DM7F 2IBZE 2JA7J 3RK2C 3DP7A 2VXDA 3L73E 4BQNA 2FRHA 2UV1A 4U0YA 1YW8A 3CXHD 1JXSA 2ZFCA 2V9VA 4I2OA 2HYNA 1Z91A 4PCQA 1OJLA 3A1YA 4IX7A 1DP7P 2VXZA 3L2QA 2FMYA 4IZZA 2IYOA 5IY5H 3PJGA 3AE2C 5CBNA 3ROUA 4FCYA 3EGOA 1QVTA 2HODA 2V1NA 4XONA 1KMIZ 2YXQB 4A3GJ 4U3FJ 4L76A 1BJAA 3QU6A 4HNVA 2K3PA 2E2HJ 2KIMA 3AE1C 5APYA 2HS5A 3I58A 1MFZA 2EQRA 2DPUA 4L0ZB 1NTKK 3LSPA 3HRNA 2NS8A 2OTJP 3H1JE 2XDVA 3PLNA 1SLQA 1DD3A 3LW5H 1S8NA 3CDHA 4EM0B 2CUFA 4HNTA 4XLNF 3PEFA 1SVLA 1SQXE 4ENKA 2OGUA 2OQQA 1RESA 1KB9I 1VQLP 2MJZA 4LB6B 3BCCJ 3TP3A 2ECBA 2R5YB 1IFMA 5CCHD 2E36A 2NAZA 5FKLA 3LIDA 3CXHI 4A3JJ 1G3TA 2B63J 3TGUE 1RF0A 2E76D 1MGTA 1UIXA 1NG7A 1Z3YA 3RTRA 1RE3C 4F3QA 5AVUB 4BXFA 3WTXC 1EH6A 3CUQC 4ZTFA 2EB7A 1HKQA 1S72I 1JY3P 1V5FA 4B48A 3QYEA 1ERDA 1FZCA 2VPLA 1MJAA 2F5VA 2X48A 1J09A 3GFJA 5ILVA 4Y33A 1BL0A 4M72A 4BQAA 1D8JA 2WZ7A 5D5WB 3ZMVA 4L9JA 3HE5A 1XTGB 3HOWJ 1K04A 2D1VA 1OKRA 4OOIA 1VQ7P 1RR7A 3BY6A 3T1BA 1QZEA 4E7HA 1LNQA 4PD4E 4MLOA 2F5FA 2YX7A 3U9GA 1WFXA 4D7NA 4BY1J 3F8CA 1JTXA 3TW6A 5IYCJ 1FP2A 3IL2A 4WXDA 5BPDA 1JTHB 2BV6A 3MUDA 3V42A 1P84D 1W5CE 3I59B 3R2PA 4GWKA 2J59M 1T2KD 2E2IJ 1PFIA 3VMAA 3ZN0A 2W48A 2O0YA 4I0AA 1EZVE 1EZVD 1WJ5A 3ISPA 3ZMTA 1M7LA 1L0LJ 2G8YA 3A0BH 3A0BE 2ZT9D 4D6TG 2AEJA 4IL6H 3P8CD 1IRZA 3IUOA 1UAAA 1GVJA 4WB4A 2VT3A 3ADOA 5D6FA 4DOZA 2R7WA 3HL2A 3H3VK 3OV8A 3TOAA 2EW2A 1GZLA 3J7ZI 2NNYA 4Y7NJ 2PJRA 5B3SH 5BMZA 2NVTJ 2JO1A 3WUUA 4FX0A 2K3FA 3FIWA 2CV1A 2W90A 1PV3A 3FKJA 3BG5A 1POGA 1SQVJ 3ITKA 2LD5A 2VL8A 2FXOA 4XIDA 4PFOA 2QJKC 2YR2A 1Y39A 3GTQJ 1FNNA 2A5YB 3G6EP 2XC7A 4CZZA 3WGHA 3FM5A 2NS7A 4HRIA 3GWZA 2M0BA 4B86A 5AONA 2EILH 3E1IA 3L6DA 3B8EB 2MGQA 2OCCH 4ZDPA 1O3QA 4ON0A 1U3EM 2VBYA 1CI6A 1CSBA 2MABA 4W1UA 1L4AB 2CPBA 1KYOD 1JT6A 4G6QA 5C44J 2EIKH 2LF7A 1F43A 2GOMA 4BEHA 2DU9A 2ZJPF 4UB8H 1URQB 2IXSA 4IOCF 4L18B 4HX4A 1FOSF 4ABZA 4BRYA 3L70E 1R23A 1GV5A 2ZYDA 1X4PA 1NTZE 4A3DJ 2ADUA 2QVOA 1D3YA 1D5VA 4N4OB 5D6EA 4OGQB 4LG0A 5JFRA 4H44D 2E1MC 2MH9A 1L0NJ 1RF1A 4BAYA 3D0SA 3S3OA 2JK3A 1NTKJ 3JAMZ 5C4JJ 2FU4A 5CBOA 3GFLA 4RLQA 1QU3A 3FXJA 3TO7A 1GK6A 4JYCA 4K2EA 4HV6A 3CC4P 1BR1A 3ZQQA 1CQTA 2W00A 1XGSA 5C3EJ 5KLIC 2IS6A 4HLXA 4XBFA 1UHWA 2IBZG 2OAZA 2O1KA 3HD7B 2JVGA 4YCAA 1N73C 2FYUD 2OTLP 4HJGH 5GTHH 2TDXA 1LDJA 4YELA 4ESBA 2HKXA 3M8JA 1MNMC 2IX7C 4CPGA 5J40A 1E3HA 4BJ6C 2IRFG 1FSEA 4ASWA 4ZDLA 2JKVA 4RMNA 1R4MB 4XK4A 1OCTC 3K7AJ 2HDCA 1R5SA 3B6CA 1JKRC 2AS5F 2IS4A 1SQQD 1EDKA 3BG7A 4A12A 1EDLA 3Q0WA 5AYVA 5GTHC 2PI0A 1EH8A 2KS1A 5M3FJ 2ZXHA 1QRYA 4IEJA 2ME6A 1GXQA 3H1IE 3L75J 3BRTB 3H1ID 2A69F 2GQQA 3CDIA 2HDWA 1LTBC 1X1BA 3WTVC 4BJ5C 2WQYC 2EA4A 3N4MA 3CC4I 4FISA 1M75A 2XSDC 3WE2A 1T56A 3CMAI 1FYLA 3AEEC 1ZRCA 3HRSA 3MFKA 5DTDA 2M7BA 1BSHA 3GXOA 5GADJ 3MZHA 3G9RA 4H13C 1XGOA 5FFXA 3C18A 2R7ZJ 1W0TA 3B5NA 2B87B 4I7ZC 4DYCA 1N7SA 4IFFA 2CW0F 2WB1N 5KHDA 2EFNA 3OYIA 4E70A 5D5UB 1GDTA 1F36A 2N1TB 1G3YA 2R7DA 3SDGA 3WU1B 3H5NA 3L4FA 1D1BA 4TV7A 3BR5A 1FX7A 1SD4A 3PL8A 3IC7A 5CVUA 5JLWA 3JR9A 3I56I 3EUKL 4E13A 1UG2A 1KZUB 1MV8A 1USDA 2PMUA 5KAIC 4UUTA 5J3LA 2L91A 1T08B 5IOZA 3QRFF 1KYOE 3A2KA 1DU0A 2RMZA 2HXOA 4G6DA 1AFOA 3CCJI 3HTSB 2KIUA 2ZO4A 4BHBA 1KN7A 1HOMA 4L5EA 4BDYA 3RL0C 2DAOA 4IFMA 2P7VB 3Q5SA 2R5ZB 1KONA 4M3DA 3ZW9A 2HOEA 3OW2O 2ZXWH 5CKTA 1LWUB 2X4HA 2H6CA 1NWQA 3OIQA 3GMAA 1HW2A 3AE3C 4N9IA 2DA1A 2DJNA 2E5YA 3F0CA 2A3SA 2DOFA 4D6TD 3M1CA 4UNOA 2IS2A 1WQ2A 1YJ8A 3QPLA 5AW9B 3L2VA 2OBPA 3CP8A 4A6EA 4RGSA 2HEOA 2EK5A 2IS1A 1AQTA 1GTWA 5HNHA 2OF7A 3NMDA 4M6VA 4P55A 5DCMA 2GXAA 2K9JB 5LEJA 3LSIA 3KEYA 3SDBA 4CCKA 1TL8A 2VT2A 2OYIC 3TO6A 4CICA 4XQFA 3CD6P 3I5UA 5HS8A 1BIBA 1PPJE 2G3AA 2HOSA 3OYJA 4OQYA 2D45A 4HG2A 1I3AA 3DTKA 5B66C 1EV7A 2KDZA 1JY2O 2FSWA 3WTYC 1HF0A 3O2PE 1AQ5A 2F6CA 1W5CC 2M1BA 3I54A 3AE9C 2IA1A 3LMMA 1NTMG 5EZHA 3QU3A 2EV6A 5DJUB 1A04A 3PH0A 1EKEA 3BTJA 2NPSA 3FKIJ 1L0LG 2WT7A 1IRXA 3FXRA 3V8LA 2L7KA 1B4AA 1OPCA 2LKXA 1FYKA 5EYRA 3S3NA 2XKOA 2R7FA 3F3SA 4HOBA 1WCMJ 1V5GA 3V6IA 5HVQC 3BR6A 5KLVK 5F1JA 4EQQA 2AXTH 1HBWA 3MVPA 2JEEA 1G8XA 2UXNA 1R6RA 1K78B 2LNBA 4DOJA 1FZCB 1E17A 2K9MA 4M71A 2KP6A 2BVLA 2AXLA 3ECOA 3QWLA 1U9OA 1T8IA 2DOAA 3WU2H 4I98B 2V7QH 1DPRA 2FKWB 1X1PA 5FO5A 2OTLI 4NBQA 1L0LK 3G71P 4KICA 3ZMDA 1VQPP 4YEJA 3HG9A 1GL2B 1YQ3C 1X2NA 2FBKA 3VN0A 2DN0A 2CVZA 1FOYA 3ERED 3TO9A 1VNDA 4BJTA 2PN6A 4A3CJ 1T33A 1SD7A 3M8FA 1OCPA 2L01A 4QPOA 4D7MA 5DM6F 1T39A 1S4XA 4LK0F 1YTZI 1YIOA 2O03A 1IXRC 2LY2A 4LFUA 4QLCU 2NXNB 1LTJC 2L7ZA 2ZVNB 1SQPG 3RZOJ 3W6VA 2GXBA 4WXCA 3HUSA 2W6JH 3FXOA 3S1KA 4P9UA 2H1KA 1KILC 1FDMA 4HX7A 3TK1A 3GLXA 1YYCA 3IR9A 2YS9A 1IN7A 3P7NA 1IUFA 2KPMA 1T6AA 3L72J 3H1IG 4U87A 2WSFH 2KI7B 3QWOC 3M0AA 4HKZH 4D6TE 1EXIA 4EYYQ 4E7IA 4RB2C 1DH3A 4QSHA 4IO9F 3K4NA 5LHGA 3MZYA 4EJOA 2WSEH 4BEHB 3H1CA 2D1HA 2HFHA 3QPHA 2QYTA 2F5CA 1KU3A 1JDJA 1JY3O 1BDCA 6PAXA 3LL7A 1IN8A 2LKSA 1N78A 2FFDB 4OIPF 4WX9A 1LWUC 2C9NY 3HOXJ 2BOLA 1A6IA 2WY7Q 3A0HC 1YITI 2JP3A 2Z99A 2NPSD 1WJAA 4RB1A 3V7RA 3AKZA 3OAKA 4A93J 3CCMP 3CCQP 3H0DA 3G2BA 1QHGA 1TWFJ 1PGQA 3H32A 3KDPB 4I6MC 3RL0B 1PL5A 1R1TA 4A3FJ 3PNTA 1M1KQ 2EIJH 1FZFA 1LEBA 5B5EH 1ZP0C 1VPCA 2E19A 3HHGA 5KKZB 2MSYA 3CO7C 4HEA2 2OUMA 3G1MA 5JI6A 1LDDA 5AVRB 4C7NB 2B9SA 3ADPA 4ENNA 1S7EA 2E7WA 2ZYGA 3IH3A 3FXKA 1DGWY 2XPWA 4Y17A 3FWNA 5AW0B 2JDIH 2ZSHB 2KZJA 1T2KC 2KKOA 3KLOA 2RV8A 4M73A 5BU8B 4LLNA 3PFYA 2A06E 1SMYF 2QQAA 5CLSA 4I7ZB 1AKHB 4B4CA 2ESNA 3OJAB 4NC7A 3OR1C 4UHTA 5AW5B 4CYDA 3B4SA 2VJJA 2H89C 4XLHA 1I50J 3VSLA 1NTMJ 5CCHA 1VQNP 2IZ1A 3JRHA 3HPGA 3RQ4A 3V2RA 1TQMA 4DZPA 1PGOA 5FFZA 1XCVA 2PMZN 3OYMA 1FT9A 4G6TB 1KU9A 3CCQI 3L00A 4AUXA 4DNCA 4EJUA 2HFED 5CCGD 1KTMA 3M9HA 1CZQA 3L7WA 2R92J 2O5RA 3ZWAA 4KUGA 1KGSA 1DLIA 1OVRA 3M1EA 1TWAJ 3GUDA 2IFMA 4AIKA 3BDDA 5F0CA 3CMEP 1PUEE 3HSFA 2B7EA 2BBYA 1JGGA 5F1RA 1PPJG 2HODB 2IYPA 4LC1A 1OCCH 3RCOA 1WDLA 5GTIE 1K79A 2K40A 5CHXA 3BJOA 2XAQA 1HW5A 5JR3A 1FDIA 2I1KA 2D2CB 1WMKA 2JT1A 3DBHB 4RESB 4OWFA 2ID3A 1QL2A 3GEZA 4BNCA 1VQ6I 3C7JA 4KFCA 1CF7B 3ZQHA 3OR2C 1CI6B 1P7JA 1T0FA 2VJ4A 3GF2A 2ZJQF 5BPIA 3B02A 1AKHA 1YB4A 4PZEA 3HXLA 4BE0A 1ZELA 2QJPC 2HOTA 1F17A 2V4HA 2RGVA 2E5ZA 1KZHA 2KZIA 1D7MA 2W57A 3G4SP 3RSNA 5KLVJ 4KITB 2OYOA 3BQZA 4LGWA 3P8MC 4N78E 2P7JA 2WSSH 4OGQC 4AVPA 4OQZA 4IJAA 5GPAA 3SYTA 3VWBA 1BBYA 1FJKA 1ZRFA 1U2WA 3AG4H 3OSFA 4J00A 1LJ8A 2AXTE 4PJ0E 4Y4RA 4G7ZF 3WGGA 1V5EA 1X3ZB 1MBEA 3O6BB 2K5CA 2A45H 2EFWA 4CUGA 1CW5A 1J75A 2BGCA 1K7AA 1U7MA 4Y99C 2DMTA 5K7ZA 3C1DA 4XOPA 1M1JB 2FQ4A 1B8IB 1NU1E 3HKZN 2VBWA 2XKPA 2H8RA 3SFEC 2JUGA 3QQAA 2R5YA 3G3ZA 1SQBG 4O5VA 1JY2N 5TJHA 1UIIA 4XM3A 1YFHA 1M67A 1BW6A 2D2WA 3VDXA 2FBWC 2Y0SA 2JQ7A 3GG2A 4U0VA 2W84A 2ZCWA 4DLLA 5L8RJ 1M1EB 1WRGA 1JTHA 1Q1HA 3VODA 3LSKA 2BXZA 4PD4D 2M2EA 3VMYA 1QZYA 1XMKA 1GXPA 3D1LA 3PM1A 4V2GA 3OYEA 1Z82A 1ZREA 5D8KB 2RNJA 3CJNA 3TBIA 5GAHJ 3IN6A 2P5KA 5GP9A 3FXDA 2L3DA 3PQJA 2FE3A 2W24A 1O4XA 1J59A 3I0TA 3TMOA 2NZ2A 5FLMJ 2ZT9C 5KJ7A 1FBMA 2E75C 2WTEA 2QUFA 3EUAA 1Q86Q 2GF2A 1J1DC 2DJIA 5EEGA 4X1EA 4S0HB 4C2TA 3PTZA 1IXCA 1FJLA 1YHQP 2VIXA 3KE2A 2KLOA 2OV7A 3FHNA 4BHCA 2FYZA 3M9QA 3D71A 2YO3A 1SQXD 4DW6A 4A5NA 1EVZA 2C9LY 3F8FA 3E7KA 2OTKE 1UZCA 2H88C 2HYFA 4JX6A 2NOJB 1NTZG 1I3QJ 3O6QB 1MD0A 2E71A 3S16J 1RF0C 3Q5PA 2OQRA 2OZUA 4W80A 4M6XA 2X1DA 2EFPA 4WWCA 1RUNA 1Y9BA 2IBZI 2IFNA 1KYOH 5A9SB 3VYIA 1LE8B 1LT9B 3HE5B 3R4YA 2Y0MA 1FP1D 4ITVA 2A6EF 3J80Z 1DU6A 3CZ6A 3CCUI 1PGJA 1SC7A 1W36C 3H32B 1YG2A 2Q1ZB 1EF4A 2KQRA 1NU1K 5APVA 4IHYA 3AEDC 5FLXZ 1T2KA 1GV2A 3FMRA 2OU2A 3BTLA 3DV8A 3H9QA 4OIQF 2QM8A 1NU1D 4ZKUA 4WK8F 2A45I 3L2RA 4HSTA 1YX5A 2FXAA 1ZARA 2HKOA 2ZMEA 4KN7X 2X51A 2P6SA 3ABTA 1GMJA 1L4AA 2VC1A 4JK1X 3KETA 4GKGA 1A5JA 3FZVA 4RS8A 3OOUA 5FROA 1S3JA 5F0HA 2NYXA 2XAUA 4UUVA 3MHVA 4FETA 1RHZB 2SPZA 1NTKE 4NNJA 1JUPA 4GXOA 3HUSB 4NDLA 2YUSA 1MW7A 3COAC 3TF5A 4DQ2A 1OFCX 4C7NA 2F4OB 2LBFB 3DFGA 5GPCA 4EZBA 1VF5B 3L74J 1KILB 1Z7LA 4NPEA 4CCNA 2GOXB 3BZ6A 4WXHA 4H0LD 5E79E 1H89C 2WAQN 2JMWA 2O7OA 2LKPA 5FRNA 4F52A 1BC8C 2RC4A 3KPEA 4C3HJ 3K4KA 1PP9J 2KYVA 3SFIA 4ZZDA 3DWLE 4G9YA 5E1XA 2WBMA 3DEUA 4RLFA 4XSZF 1UCRA 2E74D 1Y1VJ 2RNGA 2LC2A 5EF6A 5FGMA 4WCGA 4ZTJA 1M56D 4FGWA 2X9DA 4MO7A 1VI0A 2BVMA 1LTJA 5E3MA 5ED4A 1ZHFA 4EATA 2QLZA 3DPUA 3LA2A 2M0CA 3S32A 4L9TA 2R93J 1X0VA 4J0EA 4GODA 3QPTA 3L75E 3ZWBA 2JUCA 2WSEJ 1LT9C 1U5TB 3Q0UA 4OIOF 4RAZA 1N1EA 2XROA 2XGEA 3Q5RA 1DD4A 3ZGYA 3W2VA 3ECHA 5HDNA 1R4NB 5E79H 1MBHA 4KMFA 3MIWA 1ZW0A 1K6YA 4XORA 2LYCA 1YW9A 3HIFA 1F9NA 2QBYB 1SAUA 2DXIA 4ZYAA 4U3FD 2DO7A 3WG9A 2QA4P 3L9FA 3BG3A 4E12A 3W3CA 2PGDA 2VJ5A 2LH9A 3MN2A 4JBAA 3SEZA 3A01B 1RE4A 3P9CA 3CQZJ 1MKMA 2H43A 1YIJP 1YITP 4PJLA 3H1LG 1VQ5P 4ESFA 1BGYD 3RK2D 2CW7A 1YQ4C 5E1ZB 4CCLA 1BE3E 1NJIQ 4XOTA 3IKVA 2ZT9B 3L73G 2K27A 4HBLA 4M3GA 1ZLKA 2DQLA 4FTHA 1IDZA 2X85A 5EFWB 1ZGAA 1SMTA 3C2HA 1BCCG 1X0XA 2DDAA 3H1KE 3N97A 2QM3A 1L2PA 3PJSK 2BCCD 1FC3A 3V8JA 1ZKGA 2C0WA 4BE2A 1JKQC 4OWRB 4UV9A 1IFDA 3E1SA 4Q4ZF 3LSTA 5FLXK 2RREA 5H2FH 1NTKD 4C46A 5FRMA 4L73A 3O6QA 4OINF 4IM7A 5CJ0A 3CJRB 4YTPC 1JI8A 2K7LA 3OYHA 3DFUA 2NPSB 4IOAF 3C7CB 3CX5D 3KLNA 5E3LA 4XKWA 5KAFE 1L0OC 2D3TA 1BN5A 2GIVA 2XGXA 3AG3H 1RUOA 3AG1H 4GDFA 1SQXG 2F4IA 1Q81Q 2R3CA 1SANA 1G3SA 1F14A 3K69A 4B3JA 2IDBA 3GHGB 1H0TB 3OYDA 1QQIA 3H1KD 1P9QC 1SVFA 3KHUA 4XRSG 2ICWG 1A31A 1J1EB 1WDMA 1RETA 1DP3A 1SQPD 4LOCA 2JA2A 2V6CA 3F9KA 4KJZA 4JOMA 4XKBA 2E34A 2VQLA 3IFMA 4PZDA 3BTIA 3KFWX 4JX4A 4GO1A 4BACA 2O3FA 1PP7U 1O3TA 5KAFH 2L0KA 4R8HA 3JCUC 2KMUA 3C8VA 5HLIA 2HYGD 1OCOH 3K1PA 1XB4A 4RGXA 3AECC 4XLCA 4IHTA 3ASOH 3LA7A 3RI4A 4MTDA 4H0LB 1KD1Q 3FWLA 3L73J 2M3BA 1QL1A 3Q9VA 4AC0A 4C2MJ 3N05A 3FHZA 3RK3E 4MQVA 3CUQA 1KFMA 2LREA 4GOFA 2E60A 4H13B 1HC8A 2OD5A 3AEFC 1R71A 2BY0A 3FBNB 2P5LC 3C9IA 3L2UA 3L37A 2Y69H 3IAS2 3HBLA 2JPCA 1WKMA 2L5GB 4LIVA 2JWDA 3I55P 3A5TA 3BT9A 2JJ7A 4YXWH 3B5NC 1LTAC 4PZCA 4H44B 5K5OA 3S8PA 1K78A 2WPQA 5K5GB 2LRDA 1QHHD 4NC6A 1W2EA 1WVRA 1ZH5A 3KP7A 4AWXB 2K02A 1Y0UA 2ELKA 2G9WA 2B87A 2FOKA 5FJ8J 3OYCA 4OMYA 2AQEA 3S1NJ 4E7JA 2L2OA 3DTIA 3AG2H 3AFHA 2VJIA 3MZ8A 1E0EA 1S5LX 5ILUA 4XA4A 3V4QA 2QCOA 3RKQA 1FSHA 1IAWA 2CV2A 1B9MA 3BCCE 1O57A 2VONA 4PV1B 1M57D 2WAEA 2V1UA 1GL2A 2WT7B 2KP8A 3JW4A 3HYIA 1Y47A 2DW3A 2XPVA 5F64A 3PLRA 3CX5E 1GL2C 3L09A 5IYBJ 3N4XA 4MFDA 3FR7A 2ZFUA 4XLFA 2RH0A 5IT3A 4C7RA 1ETOA 3HC7A 3RK3D 4ENMA 4CCMA 2R32A 2VI6A 1U7JA 1EQ7A 2NRGA 2Z4EA 2HNHA 3H5RA 2VBZA 3W6UA 2RQPA 4E7KA 1A35A 2QJYC 1FDOA 1T38A 4M3FA 4LITA 5LRRA 1U5TC 1K4SA 5AIQA 2CUEA 1QEXA 5KKZC 3AE8C 3Q3CA 1F5TA 2VN2A 1PGNA 2O8KA 1JO5A 2HQ5A 2FUG2 1F4KA 3H3ZA 1HA8A 1X1AA 1W5TA 5DUKA 2IGKA 2L4MA 1ZR4A 2WSCH 2YNYA 2X1CA 1AVYA 3CCRP 4UB6E 1YI2P 3V4GA 1MFTA 1PVEA 4WF2A 1RC9A 4FE7A 4CDGA 1XSXA 1H88A 3PHLA 1JY3N 3G73A 1NGMB 2R7SA 2FYUK 2CG4A 2QEXP 1M66A 4KUEA 3CCLI 1WPQA 3CKYA 1VF9A 2DDBA 3E6CC 5IP7J 2QVAA 4M3EA 3D5LA 5EG0A 2UXXA 4B8XA 1K61A 1SQVE 4XLEA 2VPRA 1ACIA 4KIGA 2XHKA 4HNUA 1PZQA 3P32A 3FMSA 4RAGA 5L3FA 4JYKA 4OIRF 1WDKA 2TCTA 4HYTB 4FHTA 5LGTA 1XX5A 2H6BA 2QQBA 4M6YA 3ML6A 4E7LA 4W97A 1YO5C 2A6TA 1NTKG 5J1UA 2OTJI 3BG9A 2FXMA 2XV4S 4ASVA 5EJCA 1FBQA 1UHSA 4BBRJ 4BYYA 1P7IA 4OMZA 1EJ9A 1D0ZA 3FR8A 2VC0A 1D1CA 3WG7H 2WADA 1LQ1A 3CTVA 2R7RA 1QO0D 3G1LA 3NFQA 1X4OA 3WU2C 1WH7A 1ZN2A 2ZFWA 1ETKA 3S9OA 1SS1A 3KXDA 2BE5F 1MNDA 2WA0A 4JX5A 2DPDA 4B1RA 3KYDB 1KQGB 3JRGA 4D3DA 1IRFA 1JMBA 1QGKB 3BJAA 1P4WA 3VMZA 5M5WJ 1PPJD 2LDUA 2XIGA 3HSRA 2EV0A 3U1KA 1SQBJ 1YS7A 1URQA 1PDNC 1REPC 1D0XA 4L75A 4EIJA 2N1TA 1R1VA 2W4SA 4RGRA 1MDMA 1IJDB 2AXCA 1S2EA 3GBGA 1N25A 3EUHA 1KV4A 3FISA 1I1GA 2E5TA 2DBBA 1LTSC 3ZQIA 4PSXA 3S93A 5LLQA 2F4MB 3LSJA 3R0AA 4LD5A 1O7LA 4BHPA 3MKZA 1SQXJ 1FMWA 4PGGA 4PJNA 3IP4B 1J5YA 4UV8A 4UXNA 3RKYA 4Y3OA 1QPMA 3JTGA 2KSEA 2W7NA 4AVZA 2Z9OA 3MCZA 2A05A 5J4YA 1B6AA 2CRGA 2MD5A 1M76A 2JN6A 1LFUP 2Y0DA 2HDHA 3DKXA 4CZCA 4UB6C 2JTVA 4XN0A 3UIAA 1HW1A 1TT0A 1RE3A 1ZXGA 3GO5A 2E75B 2P58A 2RDPA 4GT1A 4BXLA 3KCCA 1YTZT 2PP6A 4CSWA 4RKUJ 2DMNA 2MKVA 5FKKA 1B1BA 3L72D 2ZNYA 3SJMA 1YJ9I 3PUBA 1RNLA 3DOJA 1QVFO 3QODA 1EDJA 5IP9J 3HRTA 3RJPA 3CWBJ 4GIFA 3S1QJ 1N1GA 1BOBA 2CH0A 2M45A 4EGYA 1VQMI 4EVIA 1USEA 2FY8A 1NK3P 2KB7P 4HB1A 3ZR8X 3KYCB 1LT1A 3MKYB 2Z33A 5KTBA 2W1OA 2Y0CA 3H1JG 4AQRD 3OWTA 3JRFA 1Q2NA 2EA2A 2JWTA 1MBFA 3DU5A 1ZK8A 5EDNA 1NTME 2UWMA 3RK2B 1Y56A 2DMUA 4H0LC 2DLLA 4PZJA 3H0GJ 3K1MA 2V7QJ 4X0GA 3FXMA 2M5AB 2OZ6A 4LLGF 1YJNP 4IFDK 2RKLA 1HBXG 3CD6I 3CMMA 5CQEA 2QQ9A 5DV5A 3VFZA 1QVGO 3BPXA 2ZSIB 2CPSA 2IA0A 2KJBA 1SD6A 4Y13A 2FXPA 2E5NA 2O1JA 3KP5A 2VASA 3D6YA 2X1EA 4UVBA 3K5BA 1TXGA 3IAM2 1NTMK 5KAIE 1DUXC 3CCRI 4ETSA 5H2FC 3OS2A 5TGTA 2DA7A 1SQQJ 2NVXJ 5MGBA 3ZQFA 1SVOA 3ABVC 3ZQ7A 3B5ND 1TW3A 3K2AA 3CMAP 2FYNB 4KIFA 3K4JA 5AW8B 1S29A 1F12A 3G1OA 3U21A 1JNMA 1L4AC 2DOEA 1IO2A 2VB6A 2DT7B 2OFPA 1E2XA 2KJCA 4AIHA 2A06D 3S4RA 5LRSA 1S5LE 1J1DB 1ORKA 2Q2EA 5F08A 4HLYA 3HE4B 1FIPA 3QYFA 1WZ2A 2QBYA 3CCEP 4NUBA 3L71G 4GWGA 1BGYJ 1TBXA 2WPRA 3M0DA 1ON1A 1SQBE 4K35A 1K83J 1LSOA 2CGPA 1X79B 1KILD 3U1CA 3BASA 4OU0A 1BI1A 3HTUA 2R5DA 3E5UA 4PK4A 4I1LA 3QOEA 5APQA 1LSJA 1NKZB 4O9BA 1I39A 3I53A 3ONQA 1TWCJ 2HU9A 1GW3A 5KLVE 2G0EA 1FOXA 3TGUD 2L54A 1T3UA 2P8TA 2VKEA 2WAFA 1SFCB 3AEGC 4EV0A 4LLHA 2FD5A 2L9SA 2MBFA 4C3IJ 3F8BA 5F6FA 2FYUG 2RN0A 3HD7A 3CCSI 2IA2A 4I99C 2WPSA 1VQ6P 1Q1VA 1MZ9A 1FS0E 3E5QA 2IZ0A 3C7AA 1N7SB 2RAEA 1K8AQ 1ONVA 4HPQA 2M3AA 3E7LA 1Y1WJ 3EFGA 1YTYA 4WY4D 1MSFC 3ZQCA 4KJMA 3H5AA 2JJLA 3W68A 3DEWA 1VQ5I 2J5PA 1M8OB 5F0FA 1D8KA 3G4SI 1FOWA 1A6QA 3MQ0A 1YJNI 4ZKPA 2JZYA 5DDGA 2L02A 3HUGB 3HPHA 4MTEA 4DGWB 5DD4A 2JRMA 3BROA 1LTTC 1TLHB 1JOCA 2AEFA 5FB2A 3TGNA 5A2QK 2OYHB 3HGYA 1UJ8A 2R4GA 2VQCA 2YX4A 2ZXJA 5L3EA 3SFDC 5LGNA 3KP2A 3KZIE 3LFUA 3LQQA 4YPCA 1W5SA 1OW8A 2G7HA 2W27A 1MH4A 1NK2P 2R7VA 5B66H 3PNYA 4XSXF 2XU6A 1D0YA 1KB9E 1IN5A 4AU7A 3REOA 3JRCA 1Q7YQ 3OYLA 3PDUA 2PAJA 3PIPF 3B73A 2M5WA 3CF2A 3C7DB 5IT9K 4CYCB 4LIUA 3TDKA 3AEBC 1VQ8I 3BR1A 4AUWA 2YKQA 3VEPA 5BQTA 1YE9A 3E3VA 4BE1A 1MMAA 3BATA 3IAOA 1HF9A 3DTEA 1PUFA 2K3RA 2F5DA 4UB8C 2X0LA 1LTGC 4UY8I 1LUJB 1HH0A 1FEXA 2KIFA 3NWSA 2F48A 3NWTA 3WTZA 3R0JA 4G7OF 3KZIH 1E3PA 4CCOA 5IT9Z 2KLVA 3JAMK 4JP0A 1O3RA 1JM0A 1GHCA 2VKVA 5TISC 1P84E 3V2NA 2N9YB 4HV5A 3X2QH 4YIFA 2VOPA 2M5AA 1P4XA 1WJEA 3DPTA 1VZ0A 5CVVA 2DA2A 1FBUA 3SHFA 3HD7C 4LGDE 3FX3A 3KZIC 4FE4A 3KP4A 1RE4C 1SEUA 3LW5J 2Z5IA 2X6OA 3KP3A 1T0FC 1KQ0A 2KK7A 4CCJA 2GBYA 1RKTA 2Q2EB 3QAHA 5TRDA 5E1WA 1BE3D 4E7SA 3C3WA 2FJ1A 4I6ZA 2I8DA 5K1YA 2R7OA 2O01J 4YFNF 1Z77A 2P5VA 3VYRB 2PLYA 4D6TJ 2E42A 2DA5A 3MEXA 4U88A 2QZ8A 3DEEA 3L74D 3CJTB 3FBIB 2Q6QA 4DJAA 4QIWN 1L0NE 2CYYA 2EINH 2QKMB 2M0MA 4HX8A 1NOHA 2WVRA 1W2BO 1JMMA 3KPHA 5ICEA 4U3FE 2ITAA 3MKLA 4AD9A 3E6MA 1ZTRA 2N8GA 1HSTA 3DPLC 2HZDA 4W7YA 2MH2A 1AVOA 3QP6A 3SZTA 1HTLC 1H9TA 1JB0J 2NVYJ 3LIEA 5LBQA 3LNQA 4A3IJ 1AHDP 5CYVA 3S2DJ 4ZJZA 5L3GA 4Y52J 2CSOA 2I76A 4MFEA 3RZDJ 1SQPE 1SAXA 1XTCC 3HTKA 2HOAA 2MLKA 2P4WA 1BR2A 2COBA 3CCEI 3OMYA 4NPDA 1X3WB 2XRNA 5KNLA 4O3MA 2GUSA 2IBZD 2WMMA 3W67A 1K9MQ 3DLAA 3V7SA 4N9HA 3H1HG 1HWTC 4PFPA 3OSGA 3IRQA 2ISZA 1S5LH 1SFCC 1FZGA 1BCCJ 1X9VA 4NQWB 1G2CB 2XF5A 3LSHA 2IEKA 5E20A 3SZGA 4D3SA 3GW6A 4LG3A 2K85A 3KZZA 2MA3A 1XGMA 2V9PA 4YIIA 4Z6YA 2GZWA 4DJGA 3LFKA 4K3AA 5DYMA 1Y8AA 1IFJA 2XGDA 4KNYA 2POHA 1Y8RB 5KLVG 4A0ZA 3MD2A 5AVWB 1OW6A 2KNCA 1B9NA 2XGCA 1BCCE 3WTTC 2BCCE 1XG1A 4M9XA 2QQ8A 2HWVA 1B72A 1KILE 3M4OJ 3S15J 2Q1KA 2WAQA 1VL2A 4B3AA 2ZMEC 2JWAA 3B71A 4WBAA 5AW7B 3TKYA 2HLOA 1SFUA 3VTPC 1CF7A 5H2FE 3GCMA 2UZKA 2LVSA 2Y2ZA 4HQMA 5M5YJ 4TT3H 1SFXA 4Y99B 2Y0SN 2CJJA 3Q0VA 4N0BA 1R36A 1X8YA 3HOVJ 3AEAC 2B88A 1NU1J 2EPFA 2Y48A 4XRMA 1WP4A 1LTIC 2LOOA 2V26A 4BGDA 1AWCA 1LP1B 4JYBA 1MBKA 1J2XA 2K9JA 2FA5A 2KL4A 5H6RA 2B0LA 1Y0NA 1RY3A 4Z1MH 2L7MP 4H4KC 2VBXA 1FZEA 3RBZA 1VPDA 3BG6A 1RQVA 2PBIA 3F89A 3H6PA 2KRHA 1RPWA 3L70J 2Q0OA 5J8FA 2WWYA 3DKWA 3L2WA 1TC3C 2NRAC 1ZRTD 3T97B 1Z9CA 3HDDA 3H1HJ 1KU7A 3RK3C 2DFHA 2B89A 3ELKA 2VRSA 1AOYA 1FY7A 4YRVA 4L0YB 1GL2D 3ZPLA 1EDIA 2HVSA 2LG4A 3H3UA 3ZMUA 2DMQA 1RIOH 2R7UA 2E35A 1FTTA 3HOSA 3WODF 4EM2A 1IZ1A 1B59A 5F27A 4F55A 1ULYA 2GA1A 2I9PA 1JY2P 1M1JA 2IPQX 4DYQA 1SQVG 1M90Q 3OOPA 3WTWC 4GCVA 1SQQK 2N1TD 1SQVK 5GAGJ 4DBQA 1N7LA 1I6XA 1V54H 1Y8QB 3GF7A 3MTUE 3QOPA 2ZB9A 3KYLA 1QX8A 2LKMA 4BXUA 3Q2YA 1KU2A 5JLXA 2IVMA 2JSPA 4Q5SF 1Z1DA 2CQQA 2L9RA 4ZYHA 1LP1A 3ABMH 2ZAEB 1XMAA 2VQHA 3OYNA 2ECCA 3K9TA 4E4HA 1T3JA 4C30A 2XNXA 3W6KB 3CC7P 1DPUA 3O8GA 3B5NB 2XUBA 4WVZA 3K4LA 4ZZLA 3HN2A 3VYSB 2ETHA 1H0TA 4QWQA 3WTSC 1ZGJA 2EZKA 3H25A 2LFBA 5AVXB 4FQGA 3LOCA 3GTJJ 3HZJA 2CO5A 5E8GA 2M8RA 1HKSA 1V3FA 1WJCA 4XFJA 5KLIB 3JCUH 1K05A 5APTA 2V1DA 2NNNA 4PUSA 4BQOA
chains in the Genus database with same CATH topology
2WB1N 1YVEI 2MW8A 4XICA 1GDTA 3PO2J 1F36A 3HBLA 3SDGA 3JRIA 3BT9A 2JJ7A 3QSGA 3BR5A 5JLWA 3JR9A 1BW5A 3HDHA 4PZCA 4E13A 1UG2A 3C2BA 3ZWCA 4UUTA 5J3LA 3PO3J 1WH5A 4AYBN 5IOZA 1JT0A 1PGPA 1MH3A 1DU0A 5FKOA 2HXOA 2ELKA 3VPRA 2M9HA 5FJ8J 4QTRA 3S1NJ 1HOMA 4L5EA 3H2ZA 2R5ZB 2QCOA 4M3DA 3RKQA 2XB0X 1JKOC 1QPIA 3M3YJ 4V2FA 3L1PA 3ZW9A 1HCRA 2OPTA 2XRLA 3IH4A 4B3HA 1LFBA 2XPVA 2DA1A 2DJNA 1ZR2A 3PLRA 3F0CA 3CMYA 5IYBJ 5IOYA 4MFDA 3FR7A 1YJ8A 1GUUA 3QPLA 1ETOA 2NOGA 4D5CA 2VI6A 2OF7A 3S1MJ 1YONA 4M6VA 4BXXJ 3G0OA 2P4QA 3S2HJ 3W6UA 1XS9A 3WFIA 4A69C 3JREA 4M3FA 2HOSA 3TP0A 2CUEA 2CU7A 3HOZJ 1TWGJ 3Q3CA 4OQYA 1PGNA 2O8KA 4C3JJ 3HEFA 2KDZA 2HQ5A 1HF0A 3S14J 1IV6A 3LSRA 3HOYJ 1ZR4A 5EZHA 3HM5A 1YRNA 3BTJA 3FKIJ 4FE7A 1JUMA 2LKXA 5EYRA 2TRTA 3GTGJ 4DCKA 3F3SA 3ULKA 3OBBA 1M66A 4KUEA 1WCMJ 2HYJA 1WPQA 3CKYA 1VF9A 5IP7J 1FIAA 4M3EA 2D5VA 1YRNB 4GBJA 3BR6A 5EG0A 1K61A 5F1JA 1JUSA 2VPRA 3CCYA 3MVPA 3BTCA 3GTOJ 3ZQGA 5J1YA 4JYKA 1WDKA 2TCTA 3I83A 2EZLA 4J0FA 4W97A 3HGGA 3HB9A 3I4NJ 1U9OA 1MSEC 5IP6A 5J1UA 3ZOBA 3BG9A 1U78A 4RBOA 1UHSA 4BBRJ 3LSGA 1P7IA 1X2NA 2DN0A 2CVZA 3FR8A 3CTVA 5JE8A 1U9NA 2EBIA 4MIMA 1VNDA 3S17J 4A3CJ 1MBGA 3G1LA 1T33A 1OCPA 3CDLA 4D7MA 3NARA 1WH7A 1ETKA 3Q3SA 2ZYAA 1R9TJ 2L7ZA 1BA5A 2PLAA 3BR0A 3RZOJ 5HWSA 4JX5A 3W6VA 4IHWA 3ZW8A 1IDYA 4B1RA 3JRGA 2H1KA 1KS9A 4D3DA 2E1OA 3QPSA 2YS9A 1FTZA 1IC8A 4JQ0D 1IUFA 5M5WJ 1RKWA 4QSHA 3PIDA 2HXIA 2KT0A 4BKXA 1X2MA 4UUSB 2E2JJ 2EH3A 4RDUA 3GBGA 1I6HJ 2QYTA 2W8ZA 3FISA 4B3IA 1JDJA 3ZQIA 3K6JA 2VUMJ 3LSJA 3HOXJ 1A6IA 4OL9A 2LR8A 5A9TA 5DS9A 4A93J 2CRGA 1PGQA 1M76A 1TWFJ 2JN6A 1LFUP 4IHXA 2HDHA 4A3FJ 3UKGA 5F04A 5M5XJ 3JRDA 2E19A 2DMNA 2MSYA 2XPUA 5FKKA 1M2WA 3G1MA 3SJMA 3DOJA 5IP9J 5EEAA 1EVYA 2WTBA 3ADPA 1S7EA 5K7FA 3IH3A 4IHVA 2ZYGA 3JRAA 3S1QJ 1UMQA 5C4XJ 1N1GA 1JTYA 2XPWA 3FWNA 1JJ6C 1NK3P 2AHQA 4OM8A 1AKHB 4B4CA 2YU9J 3JRFA 2JWTA 1I50J 1MBFA 5EDNA 1ZK8A 1H8AC 2IZ1A 2DMUA 3JRHA 3S1RJ 1JKPC 1BJZA 1ZQ3P 4DZPA 3H0GJ 1PGOA 5FKNA 2EZIA 2PMZN 3WHBA 3WHCA 2ID6A 4AUXA 2HDDA 3K96A 1IJWC 2R92J 1PUFB 3ZWAA 5E3NA 3GTLJ 4KUGA 1ETWA 1DLIA 3BR3A 2XB5A 1TWAJ 5F0CA 2L7FP 1LE8A 1U8BA 1JGGA 5A9SA 2IYPA 1WDLA 2K40A 1TXGA 3B6AA 5EZGA 4A3LJ 2DA7A 4XRSA 2NVXJ 5MGBA 3ZQFA 4BY7J 2ID3A 3K2AA 1E3OC 3ZHBA 3NAUA 1X58A 4D5FA 1F12A 3BR2A 3G1OA 3ZQHA 1P7JA 1AKHA 2Y31A 2R0QC 1XC5A 1YB4A 2OFPA 4PZEA 1TWHJ 2K9NA 1ORKA 5F08A 2HOTA 1F17A 1FIPA 2K9QA 1DLJA 1ETQA 4GWGA 3BQZA 1ETVA 3GTPJ 1YRLA 1K83J 1LSOA 5E3OA 1B72B 4A3KJ 2EZHA 4A3MJ 5GPAA 4OQZA 2LLKA 1ETYA 2GLOA 1LSJA 2O9LA 3OSFA 1LJ8A 1TWCJ 2G0EA 1GVDA 1MBEA 2VKEA 4D3FA 2M34A 2DA6A 1MBJA 2DTZA 3TEDA 2DMTA 5K7ZA 4BBSJ 2FQ4A 2FX0A 2FD5A 1B8IB 3HKZN 4C3IJ 4A3EJ 2H8RA 3QQAA 2R5YA 3IH2A 1Q1VA 2IAIA 2IZ0A 1ZGWA 3C7AA 2RAEA 4DZJA 1M67A 1BW6A 1APLC 3E7LA 1Y1WJ 4KUHA 1MSFC 5M3MJ 3ZQCA 3HOUJ 4DLLA 3BQYA 3W6ZA 1HDDC 3A01A 3DEWA 9ANTA 4EEFG 5F0FA 3MOGA 1HDPA 2M2EA 1H88C 3PM1A 2ME0A 4V2GA 1Z82A 3RQIA 2JA5J 1G2HA 3G17A 3IQDB 1AU7A 5GP9A 4J19A 4S3MA 5EGOB 3HGYA 3WS7A 1I36A 1O4XA 1GT0C 5FLMJ 2MG4A 3TW7A 1MH4A 1NK2P 2GF2A 3QHAA 4X1EA 3JRCA 4S0HB 1FJLA 3PDUA 2X58A 3A02A 3C7DB 2JA7J 4CYCB 5EGOA 4GFBA 4DW6A 3BR1A 1IL0A 1EVZA 2I10A 2QF7A 2Y30A 1BG6A 3OIOA 4JX6A 2IYOA 1OJLA 1I3QJ 5FWNA 3D1NI 3PJGA 3S16J 2UYYA 1PUFA 4FCYA 3EGOA 1QVTA 5HODA 1D5YA 5A9SB 4A3GJ 1FEXA 4HNVA 1LE8B 3GTMJ 2E2HJ 1DU6A 2JA8J 1PGJA 2NVQJ 4JP0A 2EQRA 1EF4A 2VKVA 3LSPA 4IHYA 5A9RA 5K7HA 2LP0A 2NS8A 1WI3A 2GM4A 1GV2A 3BTLA 2CUFA 2DA2A 3PEFA 1RESA 4FE4A 3TP3A 2DA4A 2ECBA 3IV5A 2R5YB 3WFJA 5FKLA 1VFCA 2X6OA 4A3JJ 2B63J 2GBYA 1RKTA 1A5JA 2FJ1A 3OOUA 5F0HA 4I6ZA 1Z77A 4A3BJ 2DA5A 1WGXA 2K9SA 1JUPA 4NDLA 4QIWN 2YUSA 2X48A 1BL0A 1OFCX 3MKLA 5GPCA 4EZBA 1ZTRA 2N8GA 3HOWJ 1H89C 2WAQN 1RR7A 3GTKJ 2HI3A 2IBDA 2JMWA 2O7OA 2NVYJ 4MLOA 2Y9ZA 4JPZB 1AHDP 3LNQA 4C3HJ 4A3IJ 3S2DJ 4D7NA 4Y52J 3SFIA 4BY1J 4MFEA 5IYCJ 1JTXA 3TW6A 3RZDJ 2HOAA 2COBA 2P81A 5J1RA 2Y9YA 4GWKA 1Y1VJ 2E2IJ 5EF6A 3ZQLA 2W48A 4CYCA 4FGWA 2X9DA 4MO7A 1ENHA 1VI0A 1ITYA 5E3MA 3OSGA 5FKMA 4DYRA 1IRZA 2M0CA 2R93J 4J0EA 1X0VA 3ADOA 2M8GX 3H3VK 3ZWBA 2EW2A 4D3SA 2IEKA 2LK2A 4Y7NJ 3Q0UA 2NVTJ 1N1EA 3FIWA 2W90A 2XGEA 3BG5A 1POGA 3ZGYA 2XGDA 3FK6A 2LD5A 4OVNF 1MBHA 4XIDA 2XGCA 4X6AJ 4I76A 1HLVA 3GTQJ 1ETXA 1XG1A 5BNGA 1B72A 3BG3A 3M4OJ 3S15J 4E12A 2PGDA 2NS7A 3MN2A 4B3AA 3A01B 3CQZJ 3L6DA 4M3BA 2MGQA 2LVSA 2Y2ZA 4W1UA 5M5YJ 2Y0SN 3HADA 1QMGA 2CJJA 3Q0VA 4E21A 2DMPA 3HOVJ 3HWRA 1JT6A 2R5ZA 5C44J 1F43A 4XRMA 3O8HA 1WP4A 4M3GA 4FTHA 1IDZA 4ABZA 1MBKA 1B8IA 1GV5A 1IG7A 5FLVA 2ZYDA 4G12A 2L7MP 4A3DJ 1X0XA 2LTPA 1VPDA 2AO9A 1ZKGA 1JJ8C 1RPWA 2JK3A 4R1NA 5EG0B 1TC3C 5C4JJ 3GHYA 5IPAA 2JA6J 1JKQC 3HDDA 5IYDJ 4IM7A 1CQTA 5C3EJ 3DFUA 3C7CB 1QVUA 2DMQA 1FTTA 5E3LA 4YCAA 2D3TA 5F27A 2I9PA 3JRBA 1WPKA 1MNMC 1SANA 4DYQA 1F14A 1YJQA 4B3JA 4UUSA 2JKVA 2CQXA 3I4MJ 4XK4A 4XRSG 1OCTC 3K7AJ 2ZB9A 1RETA 3B6CA 1JKRC 1WDMA 4LOCA 3DCFA 2WV1A 5JLXA 2CQQA 2L9RA 3Q0WA 5AYVA 4PZDA 3BTIA 4JX4A 1QRYA 2ECCA 4IEJA 2ME6A 5M3FJ 1IGNA 1ZCJA 4DYDA 2L0KA 3O8GA 2DA3A 3FK7A 1Z0XA 4FISA 3HN2A 1M75A 2XSDC 1T56A 2EZKA 2LFBA 3A03A 5DTDA 2LY9A 3LOCA 3GTJJ 1SFOJ 4AC0A 4C2MJ 2R7ZJ 1W0TA 3RQSA 1F0YA 1NTCA 4DYCA 1W0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 N;  2MW8 A;  4XIC A;  1GDT A;  3PO2 J;  1F36 A;  3HBL A;  3SDG A;  3JRI A;  3BT9 A;  2JJ7 A;  3BR5 A;  5JLW A;  3JR9 A;  1BW5 A;  1UG2 A;  3C2B A;  4UUT A;  5J3L A;  3PO3 J;  1WH5 A;  4AYB N;  5IOZ A;  1JT0 A;  1MH3 A;  1DU0 A;  5FKO A;  2HXO A;  2ELK A;  3VPR A;  2M9H A;  5FJ8 J;  4QTR A;  3S1N J;  1HOM A;  4L5E A;  2R5Z B;  2QCO A;  4M3D A;  3RKQ A;  2XB0 X;  1JKO C;  1QPI A;  3M3Y J;  4V2F A;  3L1P A;  1HCR A;  2OPT A;  2XRL A;  3IH4 A;  1LFB A;  2XPV A;  2DA1 A;  2DJN A;  1ZR2 A;  3F0C A;  3CMY A;  5IYB J;  5IOY A;  4MFD A;  1GUU A;  3QPL A;  1ETO A;  2NOG A;  4D5C A;  2VI6 A;  2OF7 A;  3S1M J;  4M6V A;  4BXX J;  3S2H J;  1XS9 A;  4A69 C;  3JRE A;  4M3F A;  2HOS A;  3TP0 A;  2CUE A;  2CU7 A;  3HOZ J;  1TWG J;  2O8K A;  4C3J J;  3HEF A;  2KDZ A;  2HQ5 A;  1HF0 A;  3S14 J;  1IV6 A;  3LSR A;  3HOY J;  1ZR4 A;  5EZH A;  3HM5 A;  1YRN A;  3BTJ A;  3FKI J;  4FE7 A;  1JUM A;  2LKX A;  5EYR A;  2TRT A;  3GTG J;  4DCK A;  1WCM J;  2HYJ A;  1VF9 A;  5IP7 J;  1FIA A;  4M3E A;  2D5V A;  1YRN B;  3BR6 A;  5EG0 A;  1K61 A;  5F1J A;  1JUS A;  2VPR A;  3CCY A;  3MVP A;  3BTC A;  3GTO J;  3ZQG A;  5J1Y A;  4JYK A;  2TCT A;  2EZL A;  4W97 A;  3HGG A;  3HB9 A;  3I4N J;  1U9O A;  1MSE C;  5IP6 A;  5J1U A;  3ZOB A;  3BG9 A;  1U78 A;  4RBO A;  1UHS A;  4BBR J;  3LSG A;  1P7I A;  1X2N A;  2DN0 A;  1U9N A;  2EBI A;  4MIM A;  1VND A;  3S17 J;  4A3C J;  1MBG A;  3G1L A;  1T33 A;  1OCP A;  3CDL A;  4D7M A;  3NAR A;  1WH7 A;  1ETK A;  3Q3S A;  1R9T J;  2L7Z A;  1BA5 A;  3BR0 A;  3RZO J;  4JX5 A;  3W6V A;  4IHW A;  1IDY A;  4B1R A;  3JRG A;  2H1K A;  2E1O A;  3QPS A;  2YS9 A;  1FTZ A;  1IC8 A;  4JQ0 D;  1IUF A;  5M5W J;  1RKW A;  4QSH A;  2HXI A;  2KT0 A;  4BKX A;  1X2M A;  4UUS B;  2E2J J;  2EH3 A;  4RDU A;  3GBG A;  1I6H J;  3FIS A;  3ZQI A;  2VUM J;  3LSJ A;  3HOX J;  1A6I A;  2LR8 A;  5DS9 A;  4A93 J;  2CRG A;  1TWF J;  2JN6 A;  1LFU P;  4IHX A;  4A3F J;  3UKG A;  5F04 A;  5M5X J;  3JRD A;  2E19 A;  2DMN A;  2MSY A;  2XPU A;  5FKK A;  3G1M A;  3SJM A;  5IP9 J;  5EEA A;  1S7E A;  5K7F A;  3IH3 A;  4IHV A;  3JRA A;  3S1Q J;  1UMQ A;  5C4X J;  1JTY A;  2XPW A;  1JJ6 C;  1NK3 P;  2AHQ A;  1AKH B;  4B4C A;  2YU9 J;  3JRF A;  2JWT A;  1I50 J;  1MBF A;  5EDN A;  1ZK8 A;  1H8A C;  2DMU A;  3JRH A;  3S1R J;  1JKP C;  1BJZ A;  1ZQ3 P;  4DZP A;  3H0G J;  5FKN A;  2EZI A;  2PMZ N;  3WHB A;  3WHC A;  2ID6 A;  4AUX A;  2HDD A;  1IJW C;  2R92 J;  1PUF B;  5E3N A;  3GTL J;  1ETW A;  3BR3 A;  2XB5 A;  1TWA J;  5F0C A;  2L7F P;  1LE8 A;  1U8B A;  1JGG A;  2K40 A;  3B6A A;  5EZG A;  4A3L J;  2DA7 A;  4XRS A;  2NVX J;  3ZQF A;  4BY7 J;  2ID3 A;  3K2A A;  1E3O C;  3NAU A;  1X58 A;  4D5F A;  3BR2 A;  3G1O A;  3ZQH A;  1P7J A;  1AKH A;  2Y31 A;  2R0Q C;  1XC5 A;  1TWH J;  2K9N A;  1ORK A;  5F08 A;  2HOT A;  1FIP A;  2K9Q A;  1ETQ A;  3BQZ A;  1ETV A;  3GTP J;  1K83 J;  5E3O A;  1B72 B;  4A3K J;  2EZH A;  4A3M J;  5GPA A;  2LLK A;  1ETY A;  2GLO A;  2O9L A;  3OSF A;  1TWC J;  2G0E A;  1GVD A;  1MBE A;  2VKE A;  2M34 A;  2DA6 A;  1MBJ A;  2DTZ A;  3TED A;  2DMT A;  5K7Z A;  4BBS J;  2FQ4 A;  2FX0 A;  2FD5 A;  1B8I B;  3HKZ N;  4C3I J;  4A3E J;  2H8R A;  3QQA A;  2R5Y A;  3IH2 A;  1Q1V A;  2IAI A;  1ZGW A;  2RAE A;  4DZJ A;  1BW6 A;  1APL C;  3E7L A;  1Y1W J;  1MSF C;  5M3M J;  3ZQC A;  3HOU J;  3BQY A;  1HDD C;  3A01 A;  3DEW A;  9ANT A;  4EEF G;  5F0F A;  1HDP A;  2M2E A;  1H88 C;  3PM1 A;  2ME0 A;  4V2G A;  3RQI A;  2JA5 J;  1G2H A;  1AU7 A;  5GP9 A;  4J19 A;  5EGO B;  3HGY A;  1O4X A;  1GT0 C;  5FLM J;  2MG4 A;  3TW7 A;  1MH4 A;  1NK2 P;  4X1E A;  3JRC A;  4S0H B;  1FJL A;  3A02 A;  2JA7 J;  4CYC B;  5EGO A;  4GFB A;  4DW6 A;  3BR1 A;  2I10 A;  2QF7 A;  2Y30 A;  3OIO A;  4JX6 A;  1OJL A;  1I3Q J;  3D1N I;  3S16 J;  1PUF A;  4FCY A;  1QVT A;  5HOD A;  1D5Y A;  4A3G J;  1FEX A;  4HNV A;  1LE8 B;  3GTM J;  2E2H J;  1DU6 A;  2JA8 J;  2NVQ J;  4JP0 A;  2EQR A;  1EF4 A;  2VKV A;  3LSP A;  4IHY A;  5K7H A;  2LP0 A;  2NS8 A;  1WI3 A;  2GM4 A;  1GV2 A;  3BTL A;  2CUF A;  2DA2 A;  1RES A;  4FE4 A;  3TP3 A;  2DA4 A;  2ECB A;  3IV5 A;  2R5Y B;  5FKL A;  1VFC A;  2X6O A;  4A3J J;  2B63 J;  2GBY A;  1RKT A;  1A5J A;  2FJ1 A;  3OOU A;  5F0H A;  4I6Z A;  1Z77 A;  4A3B J;  2DA5 A;  1WGX A;  2K9S A;  1JUP A;  4NDL A;  4QIW N;  2YUS A;  2X48 A;  1BL0 A;  1OFC X;  3MKL A;  5GPC A;  1ZTR A;  2N8G A;  3HOW J;  1H89 C;  2WAQ N;  1RR7 A;  3GTK J;  2HI3 A;  2IBD A;  2JMW A;  2O7O A;  2NVY J;  4MLO A;  2Y9Z A;  4JPZ B;  1AHD P;  3LNQ A;  4C3H J;  4A3I J;  3S2D J;  4D7N A;  4Y52 J;  3SFI A;  4BY1 J;  4MFE A;  5IYC J;  1JTX A;  3TW6 A;  3RZD J;  2HOA A;  2COB A;  2P81 A;  5J1R A;  2Y9Y A;  1Y1V J;  2E2I J;  5EF6 A;  3ZQL A;  2W48 A;  4CYC A;  2X9D A;  4MO7 A;  1ENH A;  1VI0 A;  1ITY A;  5E3M A;  3OSG A;  5FKM A;  4DYR A;  1IRZ A;  2M0C A;  2R93 J;  2M8G X;  3H3V K;  2IEK A;  2LK2 A;  4Y7N J;  3Q0U A;  2NVT J;  3FIW A;  2XGE A;  3BG5 A;  1POG A;  2XGD A;  3FK6 A;  2LD5 A;  4OVN F;  1MBH A;  4XID A;  2XGC A;  4X6A J;  4I76 A;  1HLV A;  3GTQ J;  1ETX A;  1XG1 A;  5BNG A;  1B72 A;  3BG3 A;  3M4O J;  3S15 J;  2NS7 A;  3MN2 A;  4B3A A;  3A01 B;  3CQZ J;  4M3B A;  2MGQ A;  2LVS A;  2Y2Z A;  4W1U A;  5M5Y J;  2Y0S N;  2CJJ A;  3Q0V A;  2DMP A;  3HOV J;  1JT6 A;  2R5Z A;  5C44 J;  1F43 A;  4XRM A;  3O8H A;  4M3G A;  4FTH A;  1IDZ A;  4ABZ A;  1MBK A;  1B8I A;  1GV5 A;  1IG7 A;  5FLV A;  4G12 A;  2L7M P;  4A3D J;  2LTP A;  2AO9 A;  1ZKG A;  1JJ8 C;  1RPW A;  2JK3 A;  5EG0 B;  1TC3 C;  5C4J J;  5IPA A;  2JA6 J;  1JKQ C;  3HDD A;  5IYD J;  1CQT A;  5C3E J;  1QVU A;  2DMQ A;  1FTT A;  5E3L A;  5F27 A;  3JRB A;  1WPK A;  1MNM C;  1SAN A;  4DYQ A;  4UUS A;  2CQX A;  3I4M J;  4XK4 A;  4XRS G;  1OCT C;  3K7A J;  2ZB9 A;  1RET A;  3B6C A;  1JKR C;  4LOC A;  3DCF A;  2WV1 A;  5JLX A;  2CQQ A;  2L9R A;  3Q0W A;  3BTI A;  4JX4 A;  1QRY A;  2ECC A;  4IEJ A;  2ME6 A;  5M3F J;  1IGN A;  2L0K A;  3O8G A;  2DA3 A;  3FK7 A;  1Z0X A;  4FIS A;  2XSD C;  1T56 A;  2EZK A;  2LFB A;  3A03 A;  5DTD A;  2LY9 A;  3LOC A;  3GTJ J;  1SFO J;  4AC0 A;  4C2M J;  2R7Z J;  1W0T A;  1NTC A;  4DYC A;  1W0U A; 
#chains in the Genus database with same CATH topology
 1MNE A;  4G94 A;  2MW8 A;  1KQF B;  3VYT B;  2A68 F;  5D4S A;  4R79 A;  1PP8 F;  2KLU A;  4HF2 A;  3SWK A;  1Z7U A;  1OR7 A;  3JRI A;  1N8R Q;  1Z6R A;  3ZN1 A;  4HDV A;  3QSG A;  1E5W A;  3DQV C;  3L2C A;  3CUO A;  2FYU E;  3II6 A;  1KFN A;  4M3L A;  1BW5 A;  1LVK A;  4JQF A;  3C2B A;  3T8T A;  3ZWC A;  2O3J A;  2YKP A;  3SFZ A;  1KC8 Q;  4AYB N;  1JT0 A;  3CWB E;  1FJP A;  2DI3 A;  5JVT A;  1MH3 A;  2OYI A;  4B3X A;  1YJ9 P;  3EYI A;  3CL3 D;  2XKM A;  3FXE A;  3NQO A;  4AYB A;  2WIT A;  4PGH A;  1JKO C;  2XB0 X;  3RPU A;  4YIR X;  2L9N A;  5FD6 A;  3L1P A;  1QPI A;  1MMG A;  1L0N D;  5CCG C;  1HCR A;  2OPT A;  2HQA A;  2VLA A;  4ZYE A;  1SVM A;  2FEZ A;  4B3H A;  5DUI A;  1LFB A;  4GYG A;  1YYV A;  5TJJ A;  1I1S A;  1ZR2 A;  2VQG A;  2XSJ C;  3CJQ B;  3H1H D;  3HHH A;  3H1H E;  3L71 D;  4A0Y A;  5E17 F;  3LAP A;  5KJ7 D;  1OYW A;  1OWA A;  4I01 A;  3H1L D;  4NB5 A;  4D5C A;  1HJ0 A;  4ENJ A;  4IRH A;  1YON A;  2CV0 A;  3PIO F;  3G0O A;  3QP5 A;  1FU1 A;  2ZXX A;  2P4Q A;  2PFX A;  2YXR B;  2XAH A;  4I09 A;  5LEK A;  3ZMZ A;  1XS9 A;  1KQ9 A;  3WFI A;  2LF8 A;  4A69 C;  3JRE A;  1JCD A;  1LPQ A;  3TP0 A;  3V7C A;  1OX3 A;  1N2D C;  3HOZ J;  3BCC G;  1TWG J;  1XN7 A;  3JSP A;  3KX2 A;  2VKH A;  4C3J J;  2BCC G;  3CCJ P;  2V1X A;  2G7U A;  3EWK A;  3S14 J;  4P1W A;  1RZ4 A;  4I02 A;  3LSR A;  2P7C B;  3GHG A;  1WJF A;  4RAF A;  4QMA A;  5J4V A;  3WTU C;  1YRN A;  3M91 A;  1FOS E;  3F6V A;  1VQ4 I;  1ZG1 A;  1JUM A;  4XKC A;  1G59 A;  1U0J A;  2TRT A;  3GTG J;  3SXY A;  3LA3 A;  4HDU A;  3A0H E;  3OBB A;  1BDD A;  3P9I A;  2BW3 A;  2HYJ A;  4GOE A;  1OYY A;  5B5E E;  2OJE D;  1I27 A;  4L74 A;  2L5Q A;  4S04 A;  2GXG A;  1UB9 A;  1ZRD A;  1YRN B;  2D5V A;  4GBJ A;  1N86 A;  2QKL B;  2E1M B;  1JUS A;  5CVR A;  3CCY A;  5EEH A;  3ZRG A;  1FAV A;  5AIP A;  3OS0 A;  3RPQ A;  3BTC A;  5KK1 A;  1R8E A;  1KYW A;  1G1J A;  1S1C X;  2EWN A;  2QJY B;  2F2E A;  5J1Y A;  2DYS H;  3I83 A;  4XL9 A;  1LKX A;  5M1B A;  2EZL A;  1EXJ A;  4MNU A;  3F8M A;  1XD7 A;  3CUQ B;  2MC3 A;  3FM3 A;  4WY4 A;  4Q47 A;  3HGG A;  3HB9 A;  5AW4 B;  3CPW O;  4ZYD A;  1MSE C;  1HXD A;  1FWZ A;  4Z2Y A;  3W6J B;  1T6S A;  2XAS A;  3ZOB A;  4J01 A;  1VQO I;  1TNS A;  2PRR A;  4L5J A;  4RJT A;  3BP8 A;  3R60 A;  1OIS A;  1TQP A;  2CQ7 A;  3LSG A;  2ZME B;  1LWU A;  2VKD A;  3V5B A;  5JE8 A;  2BY3 A;  4MIM A;  5APW A;  2IPP A;  4PV1 C;  1MBG A;  3VYU B;  1W36 D;  3CDL A;  1GU5 A;  5ERI A;  3OYF A;  3AE4 C;  3BZK A;  1R1U A;  2PLA A;  3BR0 A;  5HWS A;  3CTA A;  5CVI A;  1IDY A;  2K9L A;  1Z67 A;  2HR3 A;  1ON2 A;  5LD2 C;  2M8E A;  3ZCO A;  1GLN A;  2CUJ A;  1SFK A;  3QPS A;  3IRR A;  1FTZ A;  3MKW B;  1QGP A;  1IC8 A;  4YFX F;  3HRU A;  1IC2 A;  4JQ0 D;  3TYY A;  5FD5 A;  2K37 A;  1U8R A;  2QWW A;  3BCA A;  1RKW A;  2R44 A;  4IKF A;  1V55 H;  5HS7 A;  3PID A;  2HXI A;  1VQ9 I;  1YJW I;  3GVA A;  4UUS B;  3JSV C;  2EH3 A;  4RDU A;  1I6H J;  5KJ7 C;  4C2U A;  3CI9 A;  1HGZ A;  1L4A D;  1QA6 A;  3K6J A;  2OA4 A;  4KUM A;  5AVV B;  4GYI A;  2V79 A;  3F3X A;  2LR8 A;  2X6Y A;  5A9T A;  4RB3 C;  3RL0 g;  2HGC A;  5DS9 A;  1IN4 A;  5A2Q Z;  1YI2 I;  1L3L A;  3MWM A;  2R7X A;  4TLF A;  1VQ4 P;  3CF5 F;  3UKG A;  5F04 A;  4MQ9 F;  5M5X J;  2V7F A;  3FF5 A;  1Z6T A;  2EFQ A;  3ERM A;  4N78 D;  3M7G A;  1XDU A;  4XMY A;  5B1B H;  2OQG A;  1VTN C;  4KN4 X;  3J81 K;  1M2W A;  4BRY B;  3OY9 A;  4WWI A;  2LBF A;  3LAJ A;  1HQC A;  3DXJ F;  5HNF A;  3S2W A;  3HUG A;  3ULQ B;  2WPV B;  4C9Y A;  3JRA A;  1UMQ A;  5C4X J;  4PSW A;  1RH5 B;  1JTY A;  1OMI A;  1JJ6 C;  3E5X A;  4ZYG A;  3HE4 A;  3BC8 A;  4M9Z A;  4B09 A;  1X22 A;  4OM8 A;  1IXS B;  2JRT A;  3L70 G;  1RR8 C;  2JSC A;  1Z56 A;  3EFF K;  4A5M A;  2YU9 J;  2XVC A;  4ZC3 A;  4UVA A;  2HVQ A;  2FOW A;  3M06 A;  3MAJ A;  1IK7 A;  2CS3 A;  4I2L C;  3MD0 A;  1R5G A;  2EZI A;  2K4J A;  3WHB A;  3WHC A;  2ACJ A;  1NAF A;  1W7P B;  4KT5 C;  4PJM A;  2ID6 A;  2AXT C;  2HDD A;  3CX5 I;  3E0J B;  3K96 A;  2E75 D;  1IJW C;  3AL0 B;  5KVR A;  1WRJ A;  1OVU A;  2Y0E A;  3RL0 D;  4IHS A;  3BR3 A;  2XB5 A;  3KP6 A;  4ESJ A;  2HPC B;  3WE3 A;  2L7F P;  3BOQ A;  1LE8 A;  1LT9 A;  4BS9 A;  1U8B A;  3L71 E;  1UST A;  3RYR A;  4KIB A;  1YX3 A;  4RM2 A;  4HQE A;  4N4N B;  3PP5 A;  3B6A A;  3I3L A;  2X6X A;  3QH9 A;  4NPF X;  5KAF C;  2BY1 A;  1C0W A;  3K4C A;  2CFX A;  4XKV A;  3O3K A;  1E3O C;  1E79 H;  3TNU B;  1YJW P;  5KCM A;  1N75 A;  3NAU A;  1X58 A;  3T0Y A;  3F22 A;  4Y28 J;  3U1A A;  1BGY G;  3BR2 A;  4U0W A;  1G4D A;  3AE7 C;  5AVY B;  1XC5 A;  1XMX A;  1ODD A;  1TWH J;  2K9N A;  3EQ2 A;  3HTK B;  3SWY A;  1FZP B;  2W25 A;  2CQN A;  1HKT A;  2IT0 A;  2K9Q A;  5CPR B;  2ZJR F;  1ETQ A;  4XLA A;  5GTI C;  3CCM I;  2JPB A;  2Y75 A;  3GTP J;  2H1L A;  3C1L A;  4EJV A;  1B72 B;  2KIS A;  2PFB A;  2KRC A;  4A3M J;  1VQK I;  1BI3 A;  2KUB A;  1QZZ A;  4LJZ F;  4EGZ A;  2ZJS E;  2PJR B;  1JGS A;  5ICC A;  1G6N A;  3E1R A;  4U7D A;  2O9L A;  3RYP A;  1VQO P;  1JCC A;  3H1K J;  3G71 I;  1VQP I;  1NTZ J;  1IUY A;  2QSI A;  2QRX A;  1GVD A;  1KB9 H;  2KSJ A;  3GHG C;  1TQI A;  3ZMS A;  1VQM P;  1MMS A;  1OLT A;  3TED A;  1FZB A;  2MFZ A;  4ZDO A;  1N7S C;  4BBS J;  2FX0 A;  5DD8 A;  5D4R A;  1YHQ I;  1NHL A;  4NQW A;  2YIU C;  5AW6 B;  3I4P A;  3GF3 A;  1EZV G;  1SQB K;  3L35 A;  1NYH A;  5E79 C;  5BVZ A;  1X19 A;  5JHF A;  1W1W E;  1R22 A;  2L9V A;  4DZJ A;  1RRJ A;  3GW2 A;  1APL C;  2K88 A;  1S7A A;  4L5I A;  1OXZ A;  1AA0 A;  5JHU A;  2LR2 A;  1BE3 G;  2OCE A;  1SFC A;  1HDD C;  2KOG A;  3A01 A;  1FPQ A;  2ZVO B;  4IOI H;  1A02 J;  4IRI A;  4OAY A;  2BCC J;  3M8E A;  5L3C A;  3Q9S A;  3MOG A;  3L71 J;  4RGU A;  2ME0 A;  3L75 D;  3RQI A;  1G2H A;  2H09 A;  3F23 A;  3CXH E;  3L74 G;  3KIO A;  5HLG A;  1IO4 A;  2HPM A;  1MMD A;  2DK8 A;  4F7Z A;  4S3M A;  2RKH A;  1KIL A;  1PIX A;  4H44 C;  2FF4 A;  4HF0 A;  3NRV A;  3HUS C;  2W85 A;  3EYY A;  1ZG5 A;  1IFP A;  3P7K A;  3V4W A;  2MG4 A;  3EQL F;  4IQJ A;  2QGU A;  2EIM H;  3TW7 A;  4UB6 H;  1G3W A;  2WV0 A;  2B9B A;  2KRF A;  3QHA A;  2XZR A;  1DX7 A;  2E74 C;  2YSR A;  3H1L J;  1P6R A;  3F72 A;  1FE6 A;  1TNT A;  2RN7 A;  2X58 A;  2I1J A;  3H1J D;  3A02 A;  1K6O A;  1EA3 A;  3JTH A;  4MGR A;  4GFB A;  5EGO A;  2C0X A;  3E6D A;  2WWW A;  3L73 D;  3VP9 A;  3RPU D;  3PQK A;  4R4M A;  1SQP J;  3V2Q A;  1IL0 A;  3ESW B;  1OIP A;  2DYR H;  2I10 A;  2QF7 A;  2Y30 A;  2GAU A;  1BG6 A;  3CCL P;  3EDP A;  3OIO A;  1S72 P;  4PDK A;  4UB8 E;  1SQX K;  2QIW A;  2K9Y A;  3RKX A;  5AVQ B;  5FWN A;  3D1N I;  1OZH A;  5AW3 B;  3CC2 I;  2UYY A;  1RF1 C;  2XAF A;  1JHH A;  3GX4 X;  4KYW A;  1O7F A;  1EZV I;  3H1I J;  1S9K D;  1TTY A;  3CES A;  1ZOY C;  5HOD A;  1D5Y A;  1ZRT E;  4ASN A;  4IXA A;  3GTM J;  2HZT A;  4BUP A;  1VQ7 I;  3C2G A;  2JA8 J;  2KIK A;  2NVQ J;  3WU2 E;  3MGN A;  1K4T A;  2O01 H;  4RM3 A;  3OYB A;  3JSO A;  4P96 A;  1L0N G;  2E76 C;  5A9R A;  3IWF A;  1BIA A;  1W7P A;  2LP0 A;  1WI3 A;  5K7H A;  3P5J A;  2GM4 A;  4U3F G;  3H36 A;  4I0B A;  3I59 A;  5ICF A;  3TGU J;  4H0E A;  2Z5H A;  4JF7 A;  4R4L A;  2DA4 A;  1W4M A;  3IV5 A;  3WFJ A;  2FYN C;  2NPS C;  4XN3 A;  1VFC A;  1OR7 C;  2O8X A;  2DFE A;  3A2A A;  3FWE A;  3P9K A;  3QYB A;  2QEX I;  4CO8 A;  2V6E A;  3EPZ A;  3FXQ A;  1HUC A;  4A3B J;  4EOT A;  1RI7 A;  5ILS A;  4Y15 A;  1DQU A;  1WGX A;  1VF5 C;  2K9S A;  4JBZ A;  4DT0 A;  1U6G A;  1Z21 A;  4B43 A;  1BCC D;  2Q3I A;  2QSG X;  2A5W A;  3SSU A;  2QE7 H;  2OYH A;  2O6G E;  3H92 A;  1FOK A;  3I56 P;  3CCU P;  1VQ9 P;  2PQ8 A;  2UUZ A;  1TW2 A;  3GTK J;  1LJ9 A;  4PD4 H;  2HI3 A;  2IBD A;  2ZC2 A;  4IL6 X;  3AAF A;  5LHI A;  2X6W A;  2Y9Z A;  4JPZ B;  1G2C A;  3TGU G;  4MHG A;  1USS A;  5KAI H;  3RKW A;  3F5H A;  1YIJ I;  3ABL H;  1TU3 F;  2LXB A;  2M4K A;  2CMP A;  2P81 A;  4PD4 I;  4EDF A;  4P5O A;  5J1R A;  2Y9Y A;  3GLM A;  5CVJ A;  2PJP A;  3K70 D;  1IK9 A;  4BH9 A;  4L9N A;  1H8A A;  3ZQL A;  1FC2 C;  4CYC A;  2K1A A;  4PJ0 C;  3A0H H;  1ENH A;  3VOE A;  1BM9 A;  2WB1 A;  2WC2 A;  1XCB A;  4HZF A;  5K5R A;  1ITY A;  1ZN5 A;  3MMY B;  1M1J C;  2H27 A;  5FKM A;  5C39 A;  4DYR A;  3WMM 0;  1X0T A;  3R61 A;  5APU A;  2M8G X;  3K1N A;  2Z3Y A;  4II3 A;  2LK2 A;  2Z1D A;  3GME A;  4B44 A;  1YBK A;  2BXY A;  4IQ4 A;  1R5I D;  3CC2 P;  1FZC C;  1X3U A;  4NHJ A;  1SD5 A;  3FK6 A;  1J1E C;  4HH2 A;  1IZN B;  4OVN F;  1S5L C;  2DTR A;  4O6J A;  2BAS A;  1KOR A;  5HLH A;  2AEM A;  3ZDM A;  1SFE A;  3BCC D;  2ESH A;  4X6A J;  1OW7 A;  4I76 A;  3LQR A;  2H8W A;  1HLV A;  4NC8 A;  1ETX A;  2P1J A;  1L0N K;  4WY4 C;  5BNG A;  4I7H A;  5ICG A;  2GUV A;  2VOD A;  3CLO A;  1NU1 G;  1IV8 A;  3I9V 2;  2DOD A;  1LNW A;  4L9V A;  4D9J A;  5CCH C;  1S9K E;  5K5Q A;  3CCV P;  1JUN A;  4M3B A;  1WJD A;  3SEQ A;  1R5H A;  3PSI A;  2EJR A;  5L3D A;  4A7P A;  1GD2 E;  4RO0 A;  4V19 K;  3HAD A;  1QMG A;  1VDF A;  3I55 I;  4E21 A;  2BEQ D;  2DMP A;  3HWR A;  2K86 A;  2LY1 A;  4F92 B;  2R5Z A;  1KQL A;  1RQU A;  2HG5 D;  4R1H A;  3O8H A;  1MDM B;  1UHM A;  2N9B A;  4CHU A;  2W83 C;  1QBJ A;  5DEQ A;  2QYO A;  1NTZ K;  5LGU A;  1B8I A;  3R6S A;  2GWR A;  3DLL F;  3W2A A;  3JCU E;  1IG7 A;  5FLV A;  5J6X A;  1DGR M;  4G12 A;  3L74 E;  1XGN A;  3DU6 A;  4YFK F;  2LTP A;  3K10 A;  3J81 Z;  1WSU A;  1NTZ D;  2DT5 A;  4Q48 A;  3OYG A;  2HPC A;  2AO9 A;  5APX A;  5BU5 A;  1CGP A;  4PJJ A;  1OQY A;  1JJ8 C;  4R1N A;  1DEB A;  3GZN B;  3M07 A;  5EG0 B;  4XR6 A;  2EV5 A;  1P2F A;  5IPA A;  3GHY A;  2JA6 J;  4AM3 A;  4D0P A;  1FBS A;  2CK3 H;  2HPI A;  5HDG A;  1HGV A;  2QG4 A;  2H8P D;  3KQG A;  3AE5 C;  4U7J A;  3USS A;  2R7T A;  4H13 D;  4CXF A;  4N6J A;  5BS6 A;  5IYD J;  3H35 A;  2KIQ A;  1N73 A;  2FQ3 A;  1MJ9 A;  2Z2S B;  3CX5 H;  1QVU A;  3CCV I;  4ANJ A;  1WWX A;  3JRB A;  1WPK A;  3CO6 C;  2XF6 A;  4HAM A;  4YG2 F;  2A07 F;  1YJQ A;  3UNG C;  1SQP K;  2IJL A;  3H1J J;  3I5C A;  1A02 F;  2Q9I A;  2OC6 A;  2E76 B;  4UUS A;  2CQX A;  3I4M J;  2KFD A;  1UFM A;  2KHM A;  2ZKZ A;  1SQQ E;  3HJE A;  3DCF A;  3ZGK A;  2WV1 A;  4KDP A;  1NKN A;  4F91 B;  3R4K A;  2Q5U A;  1GW4 A;  1IW7 F;  3U59 A;  1IGN A;  4BU2 A;  1X1C A;  4DYD A;  2YMK A;  1ZCJ A;  4XNF A;  1IFN A;  3FGA D;  4AYC A;  5CCG A;  1DIP A;  1ZME C;  3M9B A;  2DA3 A;  2IGN A;  2LMD A;  3FK7 A;  3CWB D;  1Z0X A;  1JHF A;  5DCF A;  3K2Z A;  1YLF A;  3E6B A;  1XTA A;  3BZC A;  2WY8 Q;  2XAJ A;  2Z5U A;  3A03 A;  2J58 A;  1LB2 A;  3D6Z A;  2FML A;  3SWF A;  2LY9 A;  4S05 A;  2H7H A;  3LWF A;  2YO2 A;  4XLP F;  1SFO J;  2QA4 I;  3SQN A;  2KZG A;  4M74 A;  2E7X A;  1QNT A;  3TOB A;  2NVU B;  1F0Y A;  3RQS A;  3D70 A;  1DDN A;  1NTC A;  1PP9 E;  1I5Z A;  1W0U A;  4IL6 C;  2FFD C;  3Q5F A;  2H94 A;  3VMX A;  1YVE I;  1ZG3 A;  4HSR A;  1JE8 A;  2FBI A;  4XIC A;  3PO2 J;  2RVC A;  4HA8 A;  1K73 Q;  5J8C A;  2JVH A;  3L36 A;  3K4M A;  5AVT B;  3HDH A;  3OS1 A;  1JEK A;  1PJR A;  3F8N A;  4LG0 B;  4LB5 A;  3J7A Y;  1WH5 A;  3PO3 J;  3MP7 B;  3NTN A;  1G1I A;  1PGP A;  5FKO A;  3PFI A;  3VPR A;  1R58 A;  2M9H A;  3FDY A;  2BHZ A;  5HLT A;  2Q3E A;  4QTR A;  5L3B A;  2A61 A;  3OA7 A;  3GFI A;  4KT6 A;  1OVV A;  3DBR B;  2CUZ A;  3EUH C;  4PJ0 H;  2XF7 A;  4HW0 A;  3CC7 I;  1AJY A;  3H2Z A;  2AQF A;  1DEE G;  3K6G A;  1MZB A;  2MD0 A;  5DCM B;  3M3Y J;  4V2F A;  1YS6 A;  4MEX F;  2XRL A;  4EMS A;  3IH4 A;  4G8X A;  1HSJ A;  2BYV E;  2FNA A;  5CJ9 A;  1BSN A;  1FLI A;  2DFF A;  3CMY A;  4DBR A;  1AV1 A;  1J0R A;  5IOY A;  1BR4 A;  5D5V B;  4CGZ A;  1GUU A;  1NH3 A;  1URQ D;  3O8Z A;  2PG4 A;  1VQ8 P;  3KZY A;  4UVC A;  2XV5 A;  2DFI A;  4KMU X;  2A6H F;  4WY4 B;  4IPA A;  2NOG A;  5JVG F;  3S1M J;  2GIZ A;  1X1D A;  4BXX J;  1LVA A;  5HOO A;  3S2H J;  3BPV A;  4BQQ A;  2KS1 B;  5H20 A;  4N3Y B;  3OL3 A;  3TL4 X;  5J47 A;  1IRG A;  3F6O A;  2CU7 A;  4RA2 A;  1R5L A;  4KT0 J;  2ELH A;  3HEF A;  5APS A;  2BW3 B;  3RGU A;  3Q1M A;  4ZMD A;  2PX9 A;  1IV6 A;  1OYI A;  3PRJ A;  2O01 N;  2ZXI A;  3HOY J;  3SZP A;  1NVO A;  3HM5 A;  3KEQ A;  1BC7 C;  3CLQ A;  1R49 A;  2E1C A;  5B66 E;  5AW1 B;  3H1L E;  3ABK H;  2WSC J;  2BEZ F;  2RQQ A;  3WUV A;  4DCK A;  2ZJ2 A;  5GAE J;  3ULK A;  3I71 A;  2KZV A;  3DKY A;  2CWE A;  2EFO A;  2QM7 A;  1D1A A;  1FIA A;  2JR8 A;  3IKT A;  2DQR A;  2D2C C;  3CXH H;  2IP2 A;  2QJK B;  1SQV D;  2P6T A;  3GZ6 A;  1Y6I A;  2COM A;  2R5B A;  4YXD C;  2J5O A;  4D1Q A;  3H1K G;  3L72 G;  3D5S C;  3GTO J;  2MYS A;  2ZNZ A;  2PEX A;  1XDS A;  3ZQG A;  3ZXS A;  1S7O A;  3UR3 C;  1PP9 D;  1ZLL A;  1LGH B;  2IGO A;  5GTI H;  5TIS H;  5D5X B;  4A6D A;  1VQK P;  1OCZ H;  4J0F A;  1MJB A;  1BOA A;  3PUF A;  4EJT A;  3I4N J;  1L0L E;  1PYV A;  1H9G A;  1SFC D;  5IP6 A;  2BEO A;  3L70 D;  3FXU A;  3KEO A;  1FZA A;  3V2P A;  1U78 A;  3E97 A;  4RBO A;  2VE9 A;  1EC5 A;  2HTJ A;  4IRG A;  3H9J A;  3BLY A;  1FYM A;  3A7O A;  2Q7C A;  1Z3X A;  3FX0 A;  3V8K A;  2YIU B;  1UEL B;  2KNC B;  5LHH A;  1U9N A;  5AVZ B;  2EBI A;  3VP8 A;  4IF4 A;  2XAG A;  3S17 J;  3J7A O;  3NAR A;  1MUU A;  1WI9 A;  3IHU A;  1LDK B;  3T97 A;  1FMV A;  3Q3S A;  4HYE A;  2ZYA A;  3DF8 A;  3HKZ A;  1R9T J;  1NHA A;  2HTS A;  2Z16 A;  3PJR A;  1BA5 A;  1KQ8 A;  1Q90 D;  3VOP A;  2M7A A;  4IHW A;  3ZW8 A;  1SQQ G;  3TSI A;  4EM1 A;  3CME I;  2ELJ A;  2WSF J;  1KS9 A;  4OGQ D;  2E1O A;  1KB9 D;  5B1A H;  2HQN A;  1NAY A;  3DBL B;  4B47 A;  1P4A A;  1GK4 A;  1XSV A;  2M30 A;  4OH8 B;  4CH7 A;  2ZBK A;  3OIP A;  1T95 A;  1RF1 B;  4LK1 F;  3HRM A;  3CWB G;  2KT0 A;  4BKX A;  1X2M A;  2E2J J;  1YQA A;  3L75 G;  1STZ A;  4GGG A;  4EJW A;  2W8Z A;  2FNP A;  4B3I A;  2E43 A;  2D2C D;  2IW5 A;  1SQB D;  2LSO A;  2ISY A;  1VQN I;  5B5E C;  2VUM J;  3ASN H;  2I5U A;  2W82 A;  2QSF X;  2QSH X;  3D5R C;  4OL9 A;  5D8L B;  1Z05 A;  4LMY A;  4E7Z A;  1UG0 A;  3VSK A;  1WT6 A;  1BI0 A;  2ZXE B;  5HDK A;  4PV1 D;  1YOV B;  3T8R A;  1KA8 A;  2E1N A;  5E18 F;  4IHX A;  2MC4 A;  1J2J B;  2UWJ E;  2STT A;  3VB2 A;  5GTH E;  2OAR A;  1ZLJ A;  3JRD A;  4KHX A;  1TZL A;  2M87 A;  1W7P D;  2XPU A;  4CA0 A;  1XPX A;  5EEA A;  3GLL A;  4KIS A;  1EVY A;  3H9G A;  2WTB A;  2CW8 A;  5K7F A;  1V4R A;  4IHV A;  4A0X A;  1S6L A;  4XE5 B;  1TP4 A;  3J7Y J;  1LEA A;  1ZAO A;  4MEY F;  4RB0 A;  1MIJ A;  2AHQ A;  2FYU J;  1LTJ B;  5H6Q A;  2L4A A;  3ABU A;  3FXL A;  4FAS D;  3G6E I;  2STW A;  5CMZ A;  3GYH X;  5AW2 B;  3CCS P;  3OYA A;  3WUT A;  4RAY A;  4FX4 A;  2K4B A;  1MMN A;  1LFP A;  3OYK A;  1N73 B;  3K70 C;  1H8A C;  2W6A A;  4U7B A;  1ZYR F;  3S1R J;  1JKP C;  2GA2 A;  2IGM A;  1BJZ A;  5E8I A;  1ZQ3 P;  3J80 K;  4HF1 A;  3BCB A;  1T98 A;  3LSM A;  5FKN A;  5HS9 A;  3A4C A;  4II2 A;  1R7J A;  3N7N A;  3BRV B;  1PUF B;  1VF5 D;  2R3S A;  5E3N A;  3GTL J;  1NO4 A;  1ETW A;  1KYZ A;  2MLG A;  2YPR A;  4M9S A;  5KLV D;  2OYH C;  1LJ2 A;  1SP4 A;  2F5E A;  4AIJ A;  5A9S A;  3U2R A;  1J7K A;  1NG6 A;  4AID A;  2W6B A;  5TIS E;  2DK5 A;  2DCE A;  2HQR A;  2XDJ A;  1IN6 A;  2DW4 A;  4G7H F;  5EZG A;  4A3L J;  2N1T C;  3A3Y B;  4XRS A;  3F21 A;  1URQ C;  2KXP B;  3U1D A;  4BY7 J;  1WJB A;  3S3M A;  1NTM D;  3NXS A;  3ZHB A;  3NEU A;  4QPQ A;  4D5F A;  2QEN A;  2P10 A;  2QJP B;  1EH7 A;  1J9I A;  1L0L D;  3TDU C;  3AE6 C;  3MUD C;  2Y31 A;  3FMQ A;  2R0Q C;  2E74 B;  4XRF A;  4IL6 E;  3W2W A;  2YKO A;  3K4B A;  1XSD A;  2YMY A;  1IFI A;  1HVV A;  2DT6 A;  3EET A;  1DLJ A;  3MZW B;  1KYO I;  2M3E A;  4EI2 A;  2P0W A;  4BDZ A;  1ETV A;  2FBH A;  3HOT A;  4GDO A;  1YRL A;  3BJ6 A;  2O61 A;  4F93 B;  5E3O A;  3GZ5 A;  3HSE A;  4W7Z A;  3L72 E;  3M9A A;  4KA4 A;  1Q82 Q;  4A3K J;  2EZH A;  2A45 G;  3IF4 A;  2BHY A;  2LLK A;  1S9H A;  1PP9 G;  3KYQ A;  1ETY A;  1ZV8 A;  2GLO A;  3A0B C;  4LLL A;  2OYI B;  5BOX A;  3GFM A;  1BGY E;  2BY2 A;  2PMZ A;  4BWN A;  1NH4 A;  1YW7 A;  3AL0 C;  1WHU A;  1H0M A;  2M34 A;  2V4J C;  4D3F A;  1QLE D;  2DA6 A;  4FT8 A;  4OAZ A;  1MBJ A;  2J5U A;  2DTZ A;  5AVS B;  4DZO A;  2WTY A;  3Q3D A;  2FFD A;  1VQL I;  3K0L A;  5LFA A;  1BE3 J;  4GRI A;  4A3E J;  4E6K G;  1T8Z A;  1P92 A;  3WGI A;  1IF1 A;  1OCR H;  3WU0 A;  4BL0 B;  3HD7 D;  2KDO A;  3JC2 2;  4IVN A;  1F1Z A;  3BVH A;  2V9K A;  4ZH4 F;  3T5X A;  3P8C E;  3IH2 A;  2IAI A;  4ZNC A;  1ZGW A;  3BWG A;  3PSF A;  1GU4 A;  1U57 A;  3M0D C;  5DJT B;  3RK3 B;  4KUH A;  3IWZ A;  1A36 A;  3HOU J;  5M3M J;  3ZP5 A;  3RDI A;  3BQY A;  3I64 A;  3W6Z A;  2VOO A;  9ANT A;  4EEF G;  2M4G A;  1P84 I;  1HDP A;  1H88 C;  2CQK A;  1O3S A;  2HVR A;  2XND H;  2C6Y A;  2JA5 J;  2LXC B;  3TDZ C;  3PNV A;  2P2U A;  3G17 A;  3IQD B;  1HJB A;  1AU7 A;  2R7Q A;  3TQN A;  3RIR A;  4J19 A;  1AA7 A;  1BI2 A;  1P84 H;  5CJ4 A;  5EGO B;  1N77 A;  3WS7 A;  1I36 A;  1GT0 C;  2VE8 A;  1TT5 B;  1KQS O;  2PMH A;  5CQG A;  3RBX A;  1U5T A;  1H89 A;  1R00 A;  4P9F A;  1N7S D;  3CP2 A;  2BZT A;  3OL4 A;  2Q8K A;  2P67 A;  4MN4 C;  3TNU A;  2CFO A;  2A06 G;  4A2U A;  2NS0 A;  2YU3 A;  4DIQ A;  5DM7 F;  2IBZ E;  2JA7 J;  3RK2 C;  3DP7 A;  2VXD A;  3L73 E;  4BQN A;  2FRH A;  2UV1 A;  4U0Y A;  1YW8 A;  3CXH D;  1JXS A;  2ZFC A;  2V9V A;  4I2O A;  2HYN A;  1Z91 A;  4PCQ A;  1OJL A;  3A1Y A;  4IX7 A;  1DP7 P;  2VXZ A;  3L2Q A;  2FMY A;  4IZZ A;  2IYO A;  5IY5 H;  3PJG A;  3AE2 C;  5CBN A;  3ROU A;  4FCY A;  3EGO A;  1QVT A;  2HOD A;  2V1N A;  4XON A;  1KMI Z;  2YXQ B;  4A3G J;  4U3F J;  4L76 A;  1BJA A;  3QU6 A;  4HNV A;  2K3P A;  2E2H J;  2KIM A;  3AE1 C;  5APY A;  2HS5 A;  3I58 A;  1MFZ A;  2EQR A;  2DPU A;  4L0Z B;  1NTK K;  3LSP A;  3HRN A;  2NS8 A;  2OTJ P;  3H1J E;  2XDV A;  3PLN A;  1SLQ A;  1DD3 A;  3LW5 H;  1S8N A;  3CDH A;  4EM0 B;  2CUF A;  4HNT A;  4XLN F;  3PEF A;  1SVL A;  1SQX E;  4ENK A;  2OGU A;  2OQQ A;  1RES A;  1KB9 I;  1VQL P;  2MJZ A;  4LB6 B;  3BCC J;  3TP3 A;  2ECB A;  2R5Y B;  1IFM A;  5CCH D;  2E36 A;  2NAZ A;  5FKL A;  3LID A;  3CXH I;  4A3J J;  1G3T A;  2B63 J;  3TGU E;  1RF0 A;  2E76 D;  1MGT A;  1UIX A;  1NG7 A;  1Z3Y A;  3RTR A;  1RE3 C;  4F3Q A;  5AVU B;  4BXF A;  3WTX C;  1EH6 A;  3CUQ C;  4ZTF A;  2EB7 A;  1HKQ A;  1S72 I;  1JY3 P;  1V5F A;  4B48 A;  3QYE A;  1ERD A;  1FZC A;  2VPL A;  1MJA A;  2F5V A;  2X48 A;  1J09 A;  3GFJ A;  5ILV A;  4Y33 A;  1BL0 A;  4M72 A;  4BQA A;  1D8J A;  2WZ7 A;  5D5W B;  3ZMV A;  4L9J A;  3HE5 A;  1XTG B;  3HOW J;  1K04 A;  2D1V A;  1OKR A;  4OOI A;  1VQ7 P;  1RR7 A;  3BY6 A;  3T1B A;  1QZE A;  4E7H A;  1LNQ A;  4PD4 E;  4MLO A;  2F5F A;  2YX7 A;  3U9G A;  1WFX A;  4D7N A;  4BY1 J;  3F8C A;  1JTX A;  3TW6 A;  5IYC J;  1FP2 A;  3IL2 A;  4WXD A;  5BPD A;  1JTH B;  2BV6 A;  3MUD A;  3V42 A;  1P84 D;  1W5C E;  3I59 B;  3R2P A;  4GWK A;  2J59 M;  1T2K D;  2E2I J;  1PFI A;  3VMA A;  3ZN0 A;  2W48 A;  2O0Y A;  4I0A A;  1EZV E;  1EZV D;  1WJ5 A;  3ISP A;  3ZMT A;  1M7L A;  1L0L J;  2G8Y A;  3A0B H;  3A0B E;  2ZT9 D;  4D6T G;  2AEJ A;  4IL6 H;  3P8C D;  1IRZ A;  3IUO A;  1UAA A;  1GVJ A;  4WB4 A;  2VT3 A;  3ADO A;  5D6F A;  4DOZ A;  2R7W A;  3HL2 A;  3H3V K;  3OV8 A;  3TOA A;  2EW2 A;  1GZL A;  3J7Z I;  2NNY A;  4Y7N J;  2PJR A;  5B3S H;  5BMZ A;  2NVT J;  2JO1 A;  3WUU A;  4FX0 A;  2K3F A;  3FIW A;  2CV1 A;  2W90 A;  1PV3 A;  3FKJ A;  3BG5 A;  1POG A;  1SQV J;  3ITK A;  2LD5 A;  2VL8 A;  2FXO A;  4XID A;  4PFO A;  2QJK C;  2YR2 A;  1Y39 A;  3GTQ J;  1FNN A;  2A5Y B;  3G6E P;  2XC7 A;  4CZZ A;  3WGH A;  3FM5 A;  2NS7 A;  4HRI A;  3GWZ A;  2M0B A;  4B86 A;  5AON A;  2EIL H;  3E1I A;  3L6D A;  3B8E B;  2MGQ A;  2OCC H;  4ZDP A;  1O3Q A;  4ON0 A;  1U3E M;  2VBY A;  1CI6 A;  1CSB A;  2MAB A;  4W1U A;  1L4A B;  2CPB A;  1KYO D;  1JT6 A;  4G6Q A;  5C44 J;  2EIK H;  2LF7 A;  1F43 A;  2GOM A;  4BEH A;  2DU9 A;  2ZJP F;  4UB8 H;  1URQ B;  2IXS A;  4IOC F;  4L18 B;  4HX4 A;  1FOS F;  4ABZ A;  4BRY A;  3L70 E;  1R23 A;  1GV5 A;  2ZYD A;  1X4P A;  1NTZ E;  4A3D J;  2ADU A;  2QVO A;  1D3Y A;  1D5V A;  4N4O B;  5D6E A;  4OGQ B;  4LG0 A;  5JFR A;  4H44 D;  2E1M C;  2MH9 A;  1L0N J;  1RF1 A;  4BAY A;  3D0S A;  3S3O A;  2JK3 A;  1NTK J;  3JAM Z;  5C4J J;  2FU4 A;  5CBO A;  3GFL A;  4RLQ A;  1QU3 A;  3FXJ A;  3TO7 A;  1GK6 A;  4JYC A;  4K2E A;  4HV6 A;  3CC4 P;  1BR1 A;  3ZQQ A;  1CQT A;  2W00 A;  1XGS A;  5C3E J;  5KLI C;  2IS6 A;  4HLX A;  4XBF A;  1UHW A;  2IBZ G;  2OAZ A;  2O1K A;  3HD7 B;  2JVG A;  4YCA A;  1N73 C;  2FYU D;  2OTL P;  4HJG H;  5GTH H;  2TDX A;  1LDJ A;  4YEL A;  4ESB A;  2HKX A;  3M8J A;  1MNM C;  2IX7 C;  4CPG A;  5J40 A;  1E3H A;  4BJ6 C;  2IRF G;  1FSE A;  4ASW A;  4ZDL A;  2JKV A;  4RMN A;  1R4M B;  4XK4 A;  1OCT C;  3K7A J;  2HDC A;  1R5S A;  3B6C A;  1JKR C;  2AS5 F;  2IS4 A;  1SQQ D;  1EDK A;  3BG7 A;  4A12 A;  1EDL A;  3Q0W A;  5AYV A;  5GTH C;  2PI0 A;  1EH8 A;  2KS1 A;  5M3F J;  2ZXH A;  1QRY A;  4IEJ A;  2ME6 A;  1GXQ A;  3H1I E;  3L75 J;  3BRT B;  3H1I D;  2A69 F;  2GQQ A;  3CDI A;  2HDW A;  1LTB C;  1X1B A;  3WTV C;  4BJ5 C;  2WQY C;  2EA4 A;  3N4M A;  3CC4 I;  4FIS A;  1M75 A;  2XSD C;  3WE2 A;  1T56 A;  3CMA I;  1FYL A;  3AEE C;  1ZRC A;  3HRS A;  3MFK A;  5DTD A;  2M7B A;  1BSH A;  3GXO A;  5GAD J;  3MZH A;  3G9R A;  4H13 C;  1XGO A;  5FFX A;  3C18 A;  2R7Z J;  1W0T A;  3B5N A;  2B87 B;  4I7Z C;  4DYC A;  1N7S A;  4IFF A;  2CW0 F;  2WB1 N;  5KHD A;  2EFN A;  3OYI A;  4E70 A;  5D5U B;  1GDT A;  1F36 A;  2N1T B;  1G3Y A;  2R7D A;  3SDG A;  3WU1 B;  3H5N A;  3L4F A;  1D1B A;  4TV7 A;  3BR5 A;  1FX7 A;  1SD4 A;  3PL8 A;  3IC7 A;  5CVU A;  5JLW A;  3JR9 A;  3I56 I;  3EUK L;  4E13 A;  1UG2 A;  1KZU B;  1MV8 A;  1USD A;  2PMU A;  5KAI C;  4UUT A;  5J3L A;  2L91 A;  1T08 B;  5IOZ A;  3QRF F;  1KYO E;  3A2K A;  1DU0 A;  2RMZ A;  2HXO A;  4G6D A;  1AFO A;  3CCJ I;  3HTS B;  2KIU A;  2ZO4 A;  4BHB A;  1KN7 A;  1HOM A;  4L5E A;  4BDY A;  3RL0 C;  2DAO A;  4IFM A;  2P7V B;  3Q5S A;  2R5Z B;  1KON A;  4M3D A;  3ZW9 A;  2HOE A;  3OW2 O;  2ZXW H;  5CKT A;  1LWU B;  2X4H A;  2H6C A;  1NWQ A;  3OIQ A;  3GMA A;  1HW2 A;  3AE3 C;  4N9I A;  2DA1 A;  2DJN A;  2E5Y A;  3F0C A;  2A3S A;  2DOF A;  4D6T D;  3M1C A;  4UNO A;  2IS2 A;  1WQ2 A;  1YJ8 A;  3QPL A;  5AW9 B;  3L2V A;  2OBP A;  3CP8 A;  4A6E A;  4RGS A;  2HEO A;  2EK5 A;  2IS1 A;  1AQT A;  1GTW A;  5HNH A;  2OF7 A;  3NMD A;  4M6V A;  4P55 A;  5DCM A;  2GXA A;  2K9J B;  5LEJ A;  3LSI A;  3KEY A;  3SDB A;  4CCK A;  1TL8 A;  2VT2 A;  2OYI C;  3TO6 A;  4CIC A;  4XQF A;  3CD6 P;  3I5U A;  5HS8 A;  1BIB A;  1PPJ E;  2G3A A;  2HOS A;  3OYJ A;  4OQY A;  2D45 A;  4HG2 A;  1I3A A;  3DTK A;  5B66 C;  1EV7 A;  2KDZ A;  1JY2 O;  2FSW A;  3WTY C;  1HF0 A;  3O2P E;  1AQ5 A;  2F6C A;  1W5C C;  2M1B A;  3I54 A;  3AE9 C;  2IA1 A;  3LMM A;  1NTM G;  5EZH A;  3QU3 A;  2EV6 A;  5DJU B;  1A04 A;  3PH0 A;  1EKE A;  3BTJ A;  2NPS A;  3FKI J;  1L0L G;  2WT7 A;  1IRX A;  3FXR A;  3V8L A;  2L7K A;  1B4A A;  1OPC A;  2LKX A;  1FYK A;  5EYR A;  3S3N A;  2XKO A;  2R7F A;  3F3S A;  4HOB A;  1WCM J;  1V5G A;  3V6I A;  5HVQ C;  3BR6 A;  5KLV K;  5F1J A;  4EQQ A;  2AXT H;  1HBW A;  3MVP A;  2JEE A;  1G8X A;  2UXN A;  1R6R A;  1K78 B;  2LNB A;  4DOJ A;  1FZC B;  1E17 A;  2K9M A;  4M71 A;  2KP6 A;  2BVL A;  2AXL A;  3ECO A;  3QWL A;  1U9O A;  1T8I A;  2DOA A;  3WU2 H;  4I98 B;  2V7Q H;  1DPR A;  2FKW B;  1X1P A;  5FO5 A;  2OTL I;  4NBQ A;  1L0L K;  3G71 P;  4KIC A;  3ZMD A;  1VQP P;  4YEJ A;  3HG9 A;  1GL2 B;  1YQ3 C;  1X2N A;  2FBK A;  3VN0 A;  2DN0 A;  2CVZ A;  1FOY A;  3ERE D;  3TO9 A;  1VND A;  4BJT A;  2PN6 A;  4A3C J;  1T33 A;  1SD7 A;  3M8F A;  1OCP A;  2L01 A;  4QPO A;  4D7M A;  5DM6 F;  1T39 A;  1S4X A;  4LK0 F;  1YTZ I;  1YIO A;  2O03 A;  1IXR C;  2LY2 A;  4LFU A;  4QLC U;  2NXN B;  1LTJ C;  2L7Z A;  2ZVN B;  1SQP G;  3RZO J;  3W6V A;  2GXB A;  4WXC A;  3HUS A;  2W6J H;  3FXO A;  3S1K A;  4P9U A;  2H1K A;  1KIL C;  1FDM A;  4HX7 A;  3TK1 A;  3GLX A;  1YYC A;  3IR9 A;  2YS9 A;  1IN7 A;  3P7N A;  1IUF A;  2KPM A;  1T6A A;  3L72 J;  3H1I G;  4U87 A;  2WSF H;  2KI7 B;  3QWO C;  3M0A A;  4HKZ H;  4D6T E;  1EXI A;  4EYY Q;  4E7I A;  4RB2 C;  1DH3 A;  4QSH A;  4IO9 F;  3K4N A;  5LHG A;  3MZY A;  4EJO A;  2WSE H;  4BEH B;  3H1C A;  2D1H A;  2HFH A;  3QPH A;  2QYT A;  2F5C A;  1KU3 A;  1JDJ A;  1JY3 O;  1BDC A;  6PAX A;  3LL7 A;  1IN8 A;  2LKS A;  1N78 A;  2FFD B;  4OIP F;  4WX9 A;  1LWU C;  2C9N Y;  3HOX J;  2BOL A;  1A6I A;  2WY7 Q;  3A0H C;  1YIT I;  2JP3 A;  2Z99 A;  2NPS D;  1WJA A;  4RB1 A;  3V7R A;  3AKZ A;  3OAK A;  4A93 J;  3CCM P;  3CCQ P;  3H0D A;  3G2B A;  1QHG A;  1TWF J;  1PGQ A;  3H32 A;  3KDP B;  4I6M C;  3RL0 B;  1PL5 A;  1R1T A;  4A3F J;  3PNT A;  1M1K Q;  2EIJ H;  1FZF A;  1LEB A;  5B5E H;  1ZP0 C;  1VPC A;  2E19 A;  3HHG A;  5KKZ B;  2MSY A;  3CO7 C;  4HEA 2;  2OUM A;  3G1M A;  5JI6 A;  1LDD A;  5AVR B;  4C7N B;  2B9S A;  3ADP A;  4ENN A;  1S7E A;  2E7W A;  2ZYG A;  3IH3 A;  3FXK A;  1DGW Y;  2XPW A;  4Y17 A;  3FWN A;  5AW0 B;  2JDI H;  2ZSH B;  2KZJ A;  1T2K C;  2KKO A;  3KLO A;  2RV8 A;  4M73 A;  5BU8 B;  4LLN A;  3PFY A;  2A06 E;  1SMY F;  2QQA A;  5CLS A;  4I7Z B;  1AKH B;  4B4C A;  2ESN A;  3OJA B;  4NC7 A;  3OR1 C;  4UHT A;  5AW5 B;  4CYD A;  3B4S A;  2VJJ A;  2H89 C;  4XLH A;  1I50 J;  3VSL A;  1NTM J;  5CCH A;  1VQN P;  2IZ1 A;  3JRH A;  3HPG A;  3RQ4 A;  3V2R A;  1TQM A;  4DZP A;  1PGO A;  5FFZ A;  1XCV A;  2PMZ N;  3OYM A;  1FT9 A;  4G6T B;  1KU9 A;  3CCQ I;  3L00 A;  4AUX A;  4DNC A;  4EJU A;  2HFE D;  5CCG D;  1KTM A;  3M9H A;  1CZQ A;  3L7W A;  2R92 J;  2O5R A;  3ZWA A;  4KUG A;  1KGS A;  1DLI A;  1OVR A;  3M1E A;  1TWA J;  3GUD A;  2IFM A;  4AIK A;  3BDD A;  5F0C A;  3CME P;  1PUE E;  3HSF A;  2B7E A;  2BBY A;  1JGG A;  5F1R A;  1PPJ G;  2HOD B;  2IYP A;  4LC1 A;  1OCC H;  3RCO A;  1WDL A;  5GTI E;  1K79 A;  2K40 A;  5CHX A;  3BJO A;  2XAQ A;  1HW5 A;  5JR3 A;  1FDI A;  2I1K A;  2D2C B;  1WMK A;  2JT1 A;  3DBH B;  4RES B;  4OWF A;  2ID3 A;  1QL2 A;  3GEZ A;  4BNC A;  1VQ6 I;  3C7J A;  4KFC A;  1CF7 B;  3ZQH A;  3OR2 C;  1CI6 B;  1P7J A;  1T0F A;  2VJ4 A;  3GF2 A;  2ZJQ F;  5BPI A;  3B02 A;  1AKH A;  1YB4 A;  4PZE A;  3HXL A;  4BE0 A;  1ZEL A;  2QJP C;  2HOT A;  1F17 A;  2V4H A;  2RGV A;  2E5Z A;  1KZH A;  2KZI A;  1D7M A;  2W57 A;  3G4S P;  3RSN A;  5KLV J;  4KIT B;  2OYO A;  3BQZ A;  4LGW A;  3P8M C;  4N78 E;  2P7J A;  2WSS H;  4OGQ C;  4AVP A;  4OQZ A;  4IJA A;  5GPA A;  3SYT A;  3VWB A;  1BBY A;  1FJK A;  1ZRF A;  1U2W A;  3AG4 H;  3OSF A;  4J00 A;  1LJ8 A;  2AXT E;  4PJ0 E;  4Y4R A;  4G7Z F;  3WGG A;  1V5E A;  1X3Z B;  1MBE A;  3O6B B;  2K5C A;  2A45 H;  2EFW A;  4CUG A;  1CW5 A;  1J75 A;  2BGC A;  1K7A A;  1U7M A;  4Y99 C;  2DMT A;  5K7Z A;  3C1D A;  4XOP A;  1M1J B;  2FQ4 A;  1B8I B;  1NU1 E;  3HKZ N;  2VBW A;  2XKP A;  2H8R A;  3SFE C;  2JUG A;  3QQA A;  2R5Y A;  3G3Z A;  1SQB G;  4O5V A;  1JY2 N;  5TJH A;  1UII A;  4XM3 A;  1YFH A;  1M67 A;  1BW6 A;  2D2W A;  3VDX A;  2FBW C;  2Y0S A;  2JQ7 A;  3GG2 A;  4U0V A;  2W84 A;  2ZCW A;  4DLL A;  5L8R J;  1M1E B;  1WRG A;  1JTH A;  1Q1H A;  3VOD A;  3LSK A;  2BXZ A;  4PD4 D;  2M2E A;  3VMY A;  1QZY A;  1XMK A;  1GXP A;  3D1L A;  3PM1 A;  4V2G A;  3OYE A;  1Z82 A;  1ZRE A;  5D8K B;  2RNJ A;  3CJN A;  3TBI A;  5GAH J;  3IN6 A;  2P5K A;  5GP9 A;  3FXD A;  2L3D A;  3PQJ A;  2FE3 A;  2W24 A;  1O4X A;  1J59 A;  3I0T A;  3TMO A;  2NZ2 A;  5FLM J;  2ZT9 C;  5KJ7 A;  1FBM A;  2E75 C;  2WTE A;  2QUF A;  3EUA A;  1Q86 Q;  2GF2 A;  1J1D C;  2DJI A;  5EEG A;  4X1E A;  4S0H B;  4C2T A;  3PTZ A;  1IXC A;  1FJL A;  1YHQ P;  2VIX A;  3KE2 A;  2KLO A;  2OV7 A;  3FHN A;  4BHC A;  2FYZ A;  3M9Q A;  3D71 A;  2YO3 A;  1SQX D;  4DW6 A;  4A5N A;  1EVZ A;  2C9L Y;  3F8F A;  3E7K A;  2OTK E;  1UZC A;  2H88 C;  2HYF A;  4JX6 A;  2NOJ B;  1NTZ G;  1I3Q J;  3O6Q B;  1MD0 A;  2E71 A;  3S16 J;  1RF0 C;  3Q5P A;  2OQR A;  2OZU A;  4W80 A;  4M6X A;  2X1D A;  2EFP A;  4WWC A;  1RUN A;  1Y9B A;  2IBZ I;  2IFN A;  1KYO H;  5A9S B;  3VYI A;  1LE8 B;  1LT9 B;  3HE5 B;  3R4Y A;  2Y0M A;  1FP1 D;  4ITV A;  2A6E F;  3J80 Z;  1DU6 A;  3CZ6 A;  3CCU I;  1PGJ A;  1SC7 A;  1W36 C;  3H32 B;  1YG2 A;  2Q1Z B;  1EF4 A;  2KQR A;  1NU1 K;  5APV A;  4IHY A;  3AED C;  5FLX Z;  1T2K A;  1GV2 A;  3FMR A;  2OU2 A;  3BTL A;  3DV8 A;  3H9Q A;  4OIQ F;  2QM8 A;  1NU1 D;  4ZKU A;  4WK8 F;  2A45 I;  3L2R A;  4HST A;  1YX5 A;  2FXA A;  1ZAR A;  2HKO A;  2ZME A;  4KN7 X;  2X51 A;  2P6S A;  3ABT A;  1GMJ A;  1L4A A;  2VC1 A;  4JK1 X;  3KET A;  4GKG A;  1A5J A;  3FZV A;  4RS8 A;  3OOU A;  5FRO A;  1S3J A;  5F0H A;  2NYX A;  2XAU A;  4UUV A;  3MHV A;  4FET A;  1RHZ B;  2SPZ A;  1NTK E;  4NNJ A;  1JUP A;  4GXO A;  3HUS B;  4NDL A;  2YUS A;  1MW7 A;  3COA C;  3TF5 A;  4DQ2 A;  1OFC X;  4C7N A;  2F4O B;  2LBF B;  3DFG A;  5GPC A;  4EZB A;  1VF5 B;  3L74 J;  1KIL B;  1Z7L A;  4NPE A;  4CCN A;  2GOX B;  3BZ6 A;  4WXH A;  4H0L D;  5E79 E;  1H89 C;  2WAQ N;  2JMW A;  2O7O A;  2LKP A;  5FRN A;  4F52 A;  1BC8 C;  2RC4 A;  3KPE A;  4C3H J;  3K4K A;  1PP9 J;  2KYV A;  3SFI A;  4ZZD A;  3DWL E;  4G9Y A;  5E1X A;  2WBM A;  3DEU A;  4RLF A;  4XSZ F;  1UCR A;  2E74 D;  1Y1V J;  2RNG A;  2LC2 A;  5EF6 A;  5FGM A;  4WCG A;  4ZTJ A;  1M56 D;  4FGW A;  2X9D A;  4MO7 A;  1VI0 A;  2BVM A;  1LTJ A;  5E3M A;  5ED4 A;  1ZHF A;  4EAT A;  2QLZ A;  3DPU A;  3LA2 A;  2M0C A;  3S32 A;  4L9T A;  2R93 J;  1X0V A;  4J0E A;  4GOD A;  3QPT A;  3L75 E;  3ZWB A;  2JUC A;  2WSE J;  1LT9 C;  1U5T B;  3Q0U A;  4OIO F;  4RAZ A;  1N1E A;  2XRO A;  2XGE A;  3Q5R A;  1DD4 A;  3ZGY A;  3W2V A;  3ECH A;  5HDN A;  1R4N B;  5E79 H;  1MBH A;  4KMF A;  3MIW A;  1ZW0 A;  1K6Y A;  4XOR A;  2LYC A;  1YW9 A;  3HIF A;  1F9N A;  2QBY B;  1SAU A;  2DXI A;  4ZYA A;  4U3F D;  2DO7 A;  3WG9 A;  2QA4 P;  3L9F A;  3BG3 A;  4E12 A;  3W3C A;  2PGD A;  2VJ5 A;  2LH9 A;  3MN2 A;  4JBA A;  3SEZ A;  3A01 B;  1RE4 A;  3P9C A;  3CQZ J;  1MKM A;  2H43 A;  1YIJ P;  1YIT P;  4PJL A;  3H1L G;  1VQ5 P;  4ESF A;  1BGY D;  3RK2 D;  2CW7 A;  1YQ4 C;  5E1Z B;  4CCL A;  1BE3 E;  1NJI Q;  4XOT A;  3IKV A;  2ZT9 B;  3L73 G;  2K27 A;  4HBL A;  4M3G A;  1ZLK A;  2DQL A;  4FTH A;  1IDZ A;  2X85 A;  5EFW B;  1ZGA A;  1SMT A;  3C2H A;  1BCC G;  1X0X A;  2DDA A;  3H1K E;  3N97 A;  2QM3 A;  1L2P A;  3PJS K;  2BCC D;  1FC3 A;  3V8J A;  1ZKG A;  2C0W A;  4BE2 A;  1JKQ C;  4OWR B;  4UV9 A;  1IFD A;  3E1S A;  4Q4Z F;  3LST A;  5FLX K;  2RRE A;  5H2F H;  1NTK D;  4C46 A;  5FRM A;  4L73 A;  3O6Q A;  4OIN F;  4IM7 A;  5CJ0 A;  3CJR B;  4YTP C;  1JI8 A;  2K7L A;  3OYH A;  3DFU A;  2NPS B;  4IOA F;  3C7C B;  3CX5 D;  3KLN A;  5E3L A;  4XKW A;  5KAF E;  1L0O C;  2D3T A;  1BN5 A;  2GIV A;  2XGX A;  3AG3 H;  1RUO A;  3AG1 H;  4GDF A;  1SQX G;  2F4I A;  1Q81 Q;  2R3C A;  1SAN A;  1G3S A;  1F14 A;  3K69 A;  4B3J A;  2IDB A;  3GHG B;  1H0T B;  3OYD A;  1QQI A;  3H1K D;  1P9Q C;  1SVF A;  3KHU A;  4XRS G;  2ICW G;  1A31 A;  1J1E B;  1WDM A;  1RET A;  1DP3 A;  1SQP D;  4LOC A;  2JA2 A;  2V6C A;  3F9K A;  4KJZ A;  4JOM A;  4XKB A;  2E34 A;  2VQL A;  3IFM A;  4PZD A;  3BTI A;  3KFW X;  4JX4 A;  4GO1 A;  4BAC A;  2O3F A;  1PP7 U;  1O3T A;  5KAF H;  2L0K A;  4R8H A;  3JCU C;  2KMU A;  3C8V A;  5HLI A;  2HYG D;  1OCO H;  3K1P A;  1XB4 A;  4RGX A;  3AEC C;  4XLC A;  4IHT A;  3ASO H;  3LA7 A;  3RI4 A;  4MTD A;  4H0L B;  1KD1 Q;  3FWL A;  3L73 J;  2M3B A;  1QL1 A;  3Q9V A;  4AC0 A;  4C2M J;  3N05 A;  3FHZ A;  3RK3 E;  4MQV A;  3CUQ A;  1KFM A;  2LRE A;  4GOF A;  2E60 A;  4H13 B;  1HC8 A;  2OD5 A;  3AEF C;  1R71 A;  2BY0 A;  3FBN B;  2P5L C;  3C9I A;  3L2U A;  3L37 A;  2Y69 H;  3IAS 2;  3HBL A;  2JPC A;  1WKM A;  2L5G B;  4LIV A;  2JWD A;  3I55 P;  3A5T A;  3BT9 A;  2JJ7 A;  4YXW H;  3B5N C;  1LTA C;  4PZC A;  4H44 B;  5K5O A;  3S8P A;  1K78 A;  2WPQ A;  5K5G B;  2LRD A;  1QHH D;  4NC6 A;  1W2E A;  1WVR A;  1ZH5 A;  3KP7 A;  4AWX B;  2K02 A;  1Y0U A;  2ELK A;  2G9W A;  2B87 A;  2FOK A;  5FJ8 J;  3OYC A;  4OMY A;  2AQE A;  3S1N J;  4E7J A;  2L2O A;  3DTI A;  3AG2 H;  3AFH A;  2VJI A;  3MZ8 A;  1E0E A;  1S5L X;  5ILU A;  4XA4 A;  3V4Q A;  2QCO A;  3RKQ A;  1FSH A;  1IAW A;  2CV2 A;  1B9M A;  3BCC E;  1O57 A;  2VON A;  4PV1 B;  1M57 D;  2WAE A;  2V1U A;  1GL2 A;  2WT7 B;  2KP8 A;  3JW4 A;  3HYI A;  1Y47 A;  2DW3 A;  2XPV A;  5F64 A;  3PLR A;  3CX5 E;  1GL2 C;  3L09 A;  5IYB J;  3N4X A;  4MFD A;  3FR7 A;  2ZFU A;  4XLF A;  2RH0 A;  5IT3 A;  4C7R A;  1ETO A;  3HC7 A;  3RK3 D;  4ENM A;  4CCM A;  2R32 A;  2VI6 A;  1U7J A;  1EQ7 A;  2NRG A;  2Z4E A;  2HNH A;  3H5R A;  2VBZ A;  3W6U A;  2RQP A;  4E7K A;  1A35 A;  2QJY C;  1FDO A;  1T38 A;  4M3F A;  4LIT A;  5LRR A;  1U5T C;  1K4S A;  5AIQ A;  2CUE A;  1QEX A;  5KKZ C;  3AE8 C;  3Q3C A;  1F5T A;  2VN2 A;  1PGN A;  2O8K A;  1JO5 A;  2HQ5 A;  2FUG 2;  1F4K A;  3H3Z A;  1HA8 A;  1X1A A;  1W5T A;  5DUK A;  2IGK A;  2L4M A;  1ZR4 A;  2WSC H;  2YNY A;  2X1C A;  1AVY A;  3CCR P;  4UB6 E;  1YI2 P;  3V4G A;  1MFT A;  1PVE A;  4WF2 A;  1RC9 A;  4FE7 A;  4CDG A;  1XSX A;  1H88 A;  3PHL A;  1JY3 N;  3G73 A;  1NGM B;  2R7S A;  2FYU K;  2CG4 A;  2QEX P;  1M66 A;  4KUE A;  3CCL I;  1WPQ A;  3CKY A;  1VF9 A;  2DDB A;  3E6C C;  5IP7 J;  2QVA A;  4M3E A;  3D5L A;  5EG0 A;  2UXX A;  4B8X A;  1K61 A;  1SQV E;  4XLE A;  2VPR A;  1ACI A;  4KIG A;  2XHK A;  4HNU A;  1PZQ A;  3P32 A;  3FMS A;  4RAG A;  5L3F A;  4JYK A;  4OIR F;  1WDK A;  2TCT A;  4HYT B;  4FHT A;  5LGT A;  1XX5 A;  2H6B A;  2QQB A;  4M6Y A;  3ML6 A;  4E7L A;  4W97 A;  1YO5 C;  2A6T A;  1NTK G;  5J1U A;  2OTJ I;  3BG9 A;  2FXM A;  2XV4 S;  4ASV A;  5EJC A;  1FBQ A;  1UHS A;  4BBR J;  4BYY A;  1P7I A;  4OMZ A;  1EJ9 A;  1D0Z A;  3FR8 A;  2VC0 A;  1D1C A;  3WG7 H;  2WAD A;  1LQ1 A;  3CTV A;  2R7R A;  1QO0 D;  3G1L A;  3NFQ A;  1X4O A;  3WU2 C;  1WH7 A;  1ZN2 A;  2ZFW A;  1ETK A;  3S9O A;  1SS1 A;  3KXD A;  2BE5 F;  1MND A;  2WA0 A;  4JX5 A;  2DPD A;  4B1R A;  3KYD B;  1KQG B;  3JRG A;  4D3D A;  1IRF A;  1JMB A;  1QGK B;  3BJA A;  1P4W A;  3VMZ A;  5M5W J;  1PPJ D;  2LDU A;  2XIG A;  3HSR A;  2EV0 A;  3U1K A;  1SQB J;  1YS7 A;  1URQ A;  1PDN C;  1REP C;  1D0X A;  4L75 A;  4EIJ A;  2N1T A;  1R1V A;  2W4S A;  4RGR A;  1MDM A;  1IJD B;  2AXC A;  1S2E A;  3GBG A;  1N25 A;  3EUH A;  1KV4 A;  3FIS A;  1I1G A;  2E5T A;  2DBB A;  1LTS C;  3ZQI A;  4PSX A;  3S93 A;  5LLQ A;  2F4M B;  3LSJ A;  3R0A A;  4LD5 A;  1O7L A;  4BHP A;  3MKZ A;  1SQX J;  1FMW A;  4PGG A;  4PJN A;  3IP4 B;  1J5Y A;  4UV8 A;  4UXN A;  3RKY A;  4Y3O A;  1QPM A;  3JTG A;  2KSE A;  2W7N A;  4AVZ A;  2Z9O A;  3MCZ A;  2A05 A;  5J4Y A;  1B6A A;  2CRG A;  2MD5 A;  1M76 A;  2JN6 A;  1LFU P;  2Y0D A;  2HDH A;  3DKX A;  4CZC A;  4UB6 C;  2JTV A;  4XN0 A;  3UIA A;  1HW1 A;  1TT0 A;  1RE3 A;  1ZXG A;  3GO5 A;  2E75 B;  2P58 A;  2RDP A;  4GT1 A;  4BXL A;  3KCC A;  1YTZ T;  2PP6 A;  4CSW A;  4RKU J;  2DMN A;  2MKV A;  5FKK A;  1B1B A;  3L72 D;  2ZNY A;  3SJM A;  1YJ9 I;  3PUB A;  1RNL A;  3DOJ A;  1QVF O;  3QOD A;  1EDJ A;  5IP9 J;  3HRT A;  3RJP A;  3CWB J;  4GIF A;  3S1Q J;  1N1G A;  1BOB A;  2CH0 A;  2M45 A;  4EGY A;  1VQM I;  4EVI A;  1USE A;  2FY8 A;  1NK3 P;  2KB7 P;  4HB1 A;  3ZR8 X;  3KYC B;  1LT1 A;  3MKY B;  2Z33 A;  5KTB A;  2W1O A;  2Y0C A;  3H1J G;  4AQR D;  3OWT A;  3JRF A;  1Q2N A;  2EA2 A;  2JWT A;  1MBF A;  3DU5 A;  1ZK8 A;  5EDN A;  1NTM E;  2UWM A;  3RK2 B;  1Y56 A;  2DMU A;  4H0L C;  2DLL A;  4PZJ A;  3H0G J;  3K1M A;  2V7Q J;  4X0G A;  3FXM A;  2M5A B;  2OZ6 A;  4LLG F;  1YJN P;  4IFD K;  2RKL A;  1HBX G;  3CD6 I;  3CMM A;  5CQE A;  2QQ9 A;  5DV5 A;  3VFZ A;  1QVG O;  3BPX A;  2ZSI B;  2CPS A;  2IA0 A;  2KJB A;  1SD6 A;  4Y13 A;  2FXP A;  2E5N A;  2O1J A;  3KP5 A;  2VAS A;  3D6Y A;  2X1E A;  4UVB A;  3K5B A;  1TXG A;  3IAM 2;  1NTM K;  5KAI E;  1DUX C;  3CCR I;  4ETS A;  5H2F C;  3OS2 A;  5TGT A;  2DA7 A;  1SQQ J;  2NVX J;  5MGB A;  3ZQF A;  1SVO A;  3ABV C;  3ZQ7 A;  3B5N D;  1TW3 A;  3K2A A;  3CMA P;  2FYN B;  4KIF A;  3K4J A;  5AW8 B;  1S29 A;  1F12 A;  3G1O A;  3U21 A;  1JNM A;  1L4A C;  2DOE A;  1IO2 A;  2VB6 A;  2DT7 B;  2OFP A;  1E2X A;  2KJC A;  4AIH A;  2A06 D;  3S4R A;  5LRS A;  1S5L E;  1J1D B;  1ORK A;  2Q2E A;  5F08 A;  4HLY A;  3HE4 B;  1FIP A;  3QYF A;  1WZ2 A;  2QBY A;  3CCE P;  4NUB A;  3L71 G;  4GWG A;  1BGY J;  1TBX A;  2WPR A;  3M0D A;  1ON1 A;  1SQB E;  4K35 A;  1K83 J;  1LSO A;  2CGP A;  1X79 B;  1KIL D;  3U1C A;  3BAS A;  4OU0 A;  1BI1 A;  3HTU A;  2R5D A;  3E5U A;  4PK4 A;  4I1L A;  3QOE A;  5APQ A;  1LSJ A;  1NKZ B;  4O9B A;  1I39 A;  3I53 A;  3ONQ A;  1TWC J;  2HU9 A;  1GW3 A;  5KLV E;  2G0E A;  1FOX A;  3TGU D;  2L54 A;  1T3U A;  2P8T A;  2VKE A;  2WAF A;  1SFC B;  3AEG C;  4EV0 A;  4LLH A;  2FD5 A;  2L9S A;  2MBF A;  4C3I J;  3F8B A;  5F6F A;  2FYU G;  2RN0 A;  3HD7 A;  3CCS I;  2IA2 A;  4I99 C;  2WPS A;  1VQ6 P;  1Q1V A;  1MZ9 A;  1FS0 E;  3E5Q A;  2IZ0 A;  3C7A A;  1N7S B;  2RAE A;  1K8A Q;  1ONV A;  4HPQ A;  2M3A A;  3E7L A;  1Y1W J;  3EFG A;  1YTY A;  4WY4 D;  1MSF C;  3ZQC A;  4KJM A;  3H5A A;  2JJL A;  3W68 A;  3DEW A;  1VQ5 I;  2J5P A;  1M8O B;  5F0F A;  1D8K A;  3G4S I;  1FOW A;  1A6Q A;  3MQ0 A;  1YJN I;  4ZKP A;  2JZY A;  5DDG A;  2L02 A;  3HUG B;  3HPH A;  4MTE A;  4DGW B;  5DD4 A;  2JRM A;  3BRO A;  1LTT C;  1TLH B;  1JOC A;  2AEF A;  5FB2 A;  3TGN A;  5A2Q K;  2OYH B;  3HGY A;  1UJ8 A;  2R4G A;  2VQC A;  2YX4 A;  2ZXJ A;  5L3E A;  3SFD C;  5LGN A;  3KP2 A;  3KZI E;  3LFU A;  3LQQ A;  4YPC A;  1W5S A;  1OW8 A;  2G7H A;  2W27 A;  1MH4 A;  1NK2 P;  2R7V A;  5B66 H;  3PNY A;  4XSX F;  2XU6 A;  1D0Y A;  1KB9 E;  1IN5 A;  4AU7 A;  3REO A;  3JRC A;  1Q7Y Q;  3OYL A;  3PDU A;  2PAJ A;  3PIP F;  3B73 A;  2M5W A;  3CF2 A;  3C7D B;  5IT9 K;  4CYC B;  4LIU A;  3TDK A;  3AEB C;  1VQ8 I;  3BR1 A;  4AUW A;  2YKQ A;  3VEP A;  5BQT A;  1YE9 A;  3E3V A;  4BE1 A;  1MMA A;  3BAT A;  3IAO A;  1HF9 A;  3DTE A;  1PUF A;  2K3R A;  2F5D A;  4UB8 C;  2X0L A;  1LTG C;  4UY8 I;  1LUJ B;  1HH0 A;  1FEX A;  2KIF A;  3NWS A;  2F48 A;  3NWT A;  3WTZ A;  3R0J A;  4G7O F;  3KZI H;  1E3P A;  4CCO A;  5IT9 Z;  2KLV A;  3JAM K;  4JP0 A;  1O3R A;  1JM0 A;  1GHC A;  2VKV A;  5TIS C;  1P84 E;  3V2N A;  2N9Y B;  4HV5 A;  3X2Q H;  4YIF A;  2VOP A;  2M5A A;  1P4X A;  1WJE A;  3DPT A;  1VZ0 A;  5CVV A;  2DA2 A;  1FBU A;  3SHF A;  3HD7 C;  4LGD E;  3FX3 A;  3KZI C;  4FE4 A;  3KP4 A;  1RE4 C;  1SEU A;  3LW5 J;  2Z5I A;  2X6O A;  3KP3 A;  1T0F C;  1KQ0 A;  2KK7 A;  4CCJ A;  2GBY A;  1RKT A;  2Q2E B;  3QAH A;  5TRD A;  5E1W A;  1BE3 D;  4E7S A;  3C3W A;  2FJ1 A;  4I6Z A;  2I8D A;  5K1Y A;  2R7O A;  2O01 J;  4YFN F;  1Z77 A;  2P5V A;  3VYR B;  2PLY A;  4D6T J;  2E42 A;  2DA5 A;  3MEX A;  4U88 A;  2QZ8 A;  3DEE A;  3L74 D;  3CJT B;  3FBI B;  2Q6Q A;  4DJA A;  4QIW N;  1L0N E;  2CYY A;  2EIN H;  2QKM B;  2M0M A;  4HX8 A;  1NOH A;  2WVR A;  1W2B O;  1JMM A;  3KPH A;  5ICE A;  4U3F E;  2ITA A;  3MKL A;  4AD9 A;  3E6M A;  1ZTR A;  2N8G A;  1HST A;  3DPL C;  2HZD A;  4W7Y A;  2MH2 A;  1AVO A;  3QP6 A;  3SZT A;  1HTL C;  1H9T A;  1JB0 J;  2NVY J;  3LIE A;  5LBQ A;  3LNQ A;  4A3I J;  1AHD P;  5CYV A;  3S2D J;  4ZJZ A;  5L3G A;  4Y52 J;  2CSO A;  2I76 A;  4MFE A;  3RZD J;  1SQP E;  1SAX A;  1XTC C;  3HTK A;  2HOA A;  2MLK A;  2P4W A;  1BR2 A;  2COB A;  3CCE I;  3OMY A;  4NPD A;  1X3W B;  2XRN A;  5KNL A;  4O3M A;  2GUS A;  2IBZ D;  2WMM A;  3W67 A;  1K9M Q;  3DLA A;  3V7S A;  4N9H A;  3H1H G;  1HWT C;  4PFP A;  3OSG A;  3IRQ A;  2ISZ A;  1S5L H;  1SFC C;  1FZG A;  1BCC J;  1X9V A;  4NQW B;  1G2C B;  2XF5 A;  3LSH A;  2IEK A;  5E20 A;  3SZG A;  4D3S A;  3GW6 A;  4LG3 A;  2K85 A;  3KZZ A;  2MA3 A;  1XGM A;  2V9P A;  4YII A;  4Z6Y A;  2GZW A;  4DJG A;  3LFK A;  4K3A A;  5DYM A;  1Y8A A;  1IFJ A;  2XGD A;  4KNY A;  2POH A;  1Y8R B;  5KLV G;  4A0Z A;  3MD2 A;  5AVW B;  1OW6 A;  2KNC A;  1B9N A;  2XGC A;  1BCC E;  3WTT C;  2BCC E;  1XG1 A;  4M9X A;  2QQ8 A;  2HWV A;  1B72 A;  1KIL E;  3M4O J;  3S15 J;  2Q1K A;  2WAQ A;  1VL2 A;  4B3A A;  2ZME C;  2JWA A;  3B71 A;  4WBA A;  5AW7 B;  3TKY A;  2HLO A;  1SFU A;  3VTP C;  1CF7 A;  5H2F E;  3GCM A;  2UZK A;  2LVS A;  2Y2Z A;  4HQM A;  5M5Y J;  4TT3 H;  1SFX A;  4Y99 B;  2Y0S N;  2CJJ A;  3Q0V A;  4N0B A;  1R36 A;  1X8Y A;  3HOV J;  3AEA C;  2B88 A;  1NU1 J;  2EPF A;  2Y48 A;  4XRM A;  1WP4 A;  1LTI C;  2LOO A;  2V26 A;  4BGD A;  1AWC A;  1LP1 B;  4JYB A;  1MBK A;  1J2X A;  2K9J A;  2FA5 A;  2KL4 A;  5H6R A;  2B0L A;  1Y0N A;  1RY3 A;  4Z1M H;  2L7M P;  4H4K C;  2VBX A;  1FZE A;  3RBZ A;  1VPD A;  3BG6 A;  1RQV A;  2PBI A;  3F89 A;  3H6P A;  2KRH A;  1RPW A;  3L70 J;  2Q0O A;  5J8F A;  2WWY A;  3DKW A;  3L2W A;  1TC3 C;  2NRA C;  1ZRT D;  3T97 B;  1Z9C A;  3HDD A;  3H1H J;  1KU7 A;  3RK3 C;  2DFH A;  2B89 A;  3ELK A;  2VRS A;  1AOY A;  1FY7 A;  4YRV A;  4L0Y B;  1GL2 D;  3ZPL A;  1EDI A;  2HVS A;  2LG4 A;  3H3U A;  3ZMU A;  2DMQ A;  1RIO H;  2R7U A;  2E35 A;  1FTT A;  3HOS A;  3WOD F;  4EM2 A;  1IZ1 A;  1B59 A;  5F27 A;  4F55 A;  1ULY A;  2GA1 A;  2I9P A;  1JY2 P;  1M1J A;  2IPQ X;  4DYQ A;  1SQV G;  1M90 Q;  3OOP A;  3WTW C;  4GCV A;  1SQQ K;  2N1T D;  1SQV K;  5GAG J;  4DBQ A;  1N7L A;  1I6X A;  1V54 H;  1Y8Q B;  3GF7 A;  3MTU E;  3QOP A;  2ZB9 A;  3KYL A;  1QX8 A;  2LKM A;  4BXU A;  3Q2Y A;  1KU2 A;  5JLX A;  2IVM A;  2JSP A;  4Q5S F;  1Z1D A;  2CQQ A;  2L9R A;  4ZYH A;  1LP1 A;  3ABM H;  2ZAE B;  1XMA A;  2VQH A;  3OYN A;  2ECC A;  3K9T A;  4E4H A;  1T3J A;  4C30 A;  2XNX A;  3W6K B;  3CC7 P;  1DPU A;  3O8G A;  3B5N B;  2XUB A;  4WVZ A;  3K4L A;  4ZZL A;  3HN2 A;  3VYS B;  2ETH A;  1H0T A;  4QWQ A;  3WTS C;  1ZGJ A;  2EZK A;  3H25 A;  2LFB A;  5AVX B;  4FQG A;  3LOC A;  3GTJ J;  3HZJ A;  2CO5 A;  5E8G A;  2M8R A;  1HKS A;  1V3F A;  1WJC A;  4XFJ A;  5KLI B;  3JCU H;  1K05 A;  5APT A;  2V1D A;  2NNN A;  4PUS A;  4BQO A; 
#chains in the Genus database with same CATH homology
 2WB1 N;  1YVE I;  2MW8 A;  4XIC A;  1GDT A;  3PO2 J;  1F36 A;  3HBL A;  3SDG A;  3JRI A;  3BT9 A;  2JJ7 A;  3QSG A;  3BR5 A;  5JLW A;  3JR9 A;  1BW5 A;  3HDH A;  4PZC A;  4E13 A;  1UG2 A;  3C2B A;  3ZWC A;  4UUT A;  5J3L A;  3PO3 J;  1WH5 A;  4AYB N;  5IOZ A;  1JT0 A;  1PGP A;  1MH3 A;  1DU0 A;  5FKO A;  2HXO A;  2ELK A;  3VPR A;  2M9H A;  5FJ8 J;  4QTR A;  3S1N J;  1HOM A;  4L5E A;  3H2Z A;  2R5Z B;  2QCO A;  4M3D A;  3RKQ A;  2XB0 X;  1JKO C;  1QPI A;  3M3Y J;  4V2F A;  3L1P A;  3ZW9 A;  1HCR A;  2OPT A;  2XRL A;  3IH4 A;  4B3H A;  1LFB A;  2XPV A;  2DA1 A;  2DJN A;  1ZR2 A;  3PLR A;  3F0C A;  3CMY A;  5IYB J;  5IOY A;  4MFD A;  3FR7 A;  1YJ8 A;  1GUU A;  3QPL A;  1ETO A;  2NOG A;  4D5C A;  2VI6 A;  2OF7 A;  3S1M J;  1YON A;  4M6V A;  4BXX J;  3G0O A;  2P4Q A;  3S2H J;  3W6U A;  1XS9 A;  3WFI A;  4A69 C;  3JRE A;  4M3F A;  2HOS A;  3TP0 A;  2CUE A;  2CU7 A;  3HOZ J;  1TWG J;  3Q3C A;  4OQY A;  1PGN A;  2O8K A;  4C3J J;  3HEF A;  2KDZ A;  2HQ5 A;  1HF0 A;  3S14 J;  1IV6 A;  3LSR A;  3HOY J;  1ZR4 A;  5EZH A;  3HM5 A;  1YRN A;  3BTJ A;  3FKI J;  4FE7 A;  1JUM A;  2LKX A;  5EYR A;  2TRT A;  3GTG J;  4DCK A;  3F3S A;  3ULK A;  3OBB A;  1M66 A;  4KUE A;  1WCM J;  2HYJ A;  1WPQ A;  3CKY A;  1VF9 A;  5IP7 J;  1FIA A;  4M3E A;  2D5V A;  1YRN B;  4GBJ A;  3BR6 A;  5EG0 A;  1K61 A;  5F1J A;  1JUS A;  2VPR A;  3CCY A;  3MVP A;  3BTC A;  3GTO J;  3ZQG A;  5J1Y A;  4JYK A;  1WDK A;  2TCT A;  3I83 A;  2EZL A;  4J0F A;  4W97 A;  3HGG A;  3HB9 A;  3I4N J;  1U9O A;  1MSE C;  5IP6 A;  5J1U A;  3ZOB A;  3BG9 A;  1U78 A;  4RBO A;  1UHS A;  4BBR J;  3LSG A;  1P7I A;  1X2N A;  2DN0 A;  2CVZ A;  3FR8 A;  3CTV A;  5JE8 A;  1U9N A;  2EBI A;  4MIM A;  1VND A;  3S17 J;  4A3C J;  1MBG A;  3G1L A;  1T33 A;  1OCP A;  3CDL A;  4D7M A;  3NAR A;  1WH7 A;  1ETK A;  3Q3S A;  2ZYA A;  1R9T J;  2L7Z A;  1BA5 A;  2PLA A;  3BR0 A;  3RZO J;  5HWS A;  4JX5 A;  3W6V A;  4IHW A;  3ZW8 A;  1IDY A;  4B1R A;  3JRG A;  2H1K A;  1KS9 A;  4D3D A;  2E1O A;  3QPS A;  2YS9 A;  1FTZ A;  1IC8 A;  4JQ0 D;  1IUF A;  5M5W J;  1RKW A;  4QSH A;  3PID A;  2HXI A;  2KT0 A;  4BKX A;  1X2M A;  4UUS B;  2E2J J;  2EH3 A;  4RDU A;  3GBG A;  1I6H J;  2QYT A;  2W8Z A;  3FIS A;  4B3I A;  1JDJ A;  3ZQI A;  3K6J A;  2VUM J;  3LSJ A;  3HOX J;  1A6I A;  4OL9 A;  2LR8 A;  5A9T A;  5DS9 A;  4A93 J;  2CRG A;  1PGQ A;  1M76 A;  1TWF J;  2JN6 A;  1LFU P;  4IHX A;  2HDH A;  4A3F J;  3UKG A;  5F04 A;  5M5X J;  3JRD A;  2E19 A;  2DMN A;  2MSY A;  2XPU A;  5FKK A;  1M2W A;  3G1M A;  3SJM A;  3DOJ A;  5IP9 J;  5EEA A;  1EVY A;  2WTB A;  3ADP A;  1S7E A;  5K7F A;  3IH3 A;  4IHV A;  2ZYG A;  3JRA A;  3S1Q J;  1UMQ A;  5C4X J;  1N1G A;  1JTY A;  2XPW A;  3FWN A;  1JJ6 C;  1NK3 P;  2AHQ A;  4OM8 A;  1AKH B;  4B4C A;  2YU9 J;  3JRF A;  2JWT A;  1I50 J;  1MBF A;  5EDN A;  1ZK8 A;  1H8A C;  2IZ1 A;  2DMU A;  3JRH A;  3S1R J;  1JKP C;  1BJZ A;  1ZQ3 P;  4DZP A;  3H0G J;  1PGO A;  5FKN A;  2EZI A;  2PMZ N;  3WHB A;  3WHC A;  2ID6 A;  4AUX A;  2HDD A;  3K96 A;  1IJW C;  2R92 J;  1PUF B;  3ZWA A;  5E3N A;  3GTL J;  4KUG A;  1ETW A;  1DLI A;  3BR3 A;  2XB5 A;  1TWA J;  5F0C A;  2L7F P;  1LE8 A;  1U8B A;  1JGG A;  5A9S A;  2IYP A;  1WDL A;  2K40 A;  1TXG A;  3B6A A;  5EZG A;  4A3L J;  2DA7 A;  4XRS A;  2NVX J;  5MGB A;  3ZQF A;  4BY7 J;  2ID3 A;  3K2A A;  1E3O C;  3ZHB A;  3NAU A;  1X58 A;  4D5F A;  1F12 A;  3BR2 A;  3G1O A;  3ZQH A;  1P7J A;  1AKH A;  2Y31 A;  2R0Q C;  1XC5 A;  1YB4 A;  2OFP A;  4PZE A;  1TWH J;  2K9N A;  1ORK A;  5F08 A;  2HOT A;  1F17 A;  1FIP A;  2K9Q A;  1DLJ A;  1ETQ A;  4GWG A;  3BQZ A;  1ETV A;  3GTP J;  1YRL A;  1K83 J;  1LSO A;  5E3O A;  1B72 B;  4A3K J;  2EZH A;  4A3M J;  5GPA A;  4OQZ A;  2LLK A;  1ETY A;  2GLO A;  1LSJ A;  2O9L A;  3OSF A;  1LJ8 A;  1TWC J;  2G0E A;  1GVD A;  1MBE A;  2VKE A;  4D3F A;  2M34 A;  2DA6 A;  1MBJ A;  2DTZ A;  3TED A;  2DMT A;  5K7Z A;  4BBS J;  2FQ4 A;  2FX0 A;  2FD5 A;  1B8I B;  3HKZ N;  4C3I J;  4A3E J;  2H8R A;  3QQA A;  2R5Y A;  3IH2 A;  1Q1V A;  2IAI A;  2IZ0 A;  1ZGW A;  3C7A A;  2RAE A;  4DZJ A;  1M67 A;  1BW6 A;  1APL C;  3E7L A;  1Y1W J;  4KUH A;  1MSF C;  5M3M J;  3ZQC A;  3HOU J;  4DLL A;  3BQY A;  3W6Z A;  1HDD C;  3A01 A;  3DEW A;  9ANT A;  4EEF G;  5F0F A;  3MOG A;  1HDP A;  2M2E A;  1H88 C;  3PM1 A;  2ME0 A;  4V2G A;  1Z82 A;  3RQI A;  2JA5 J;  1G2H A;  3G17 A;  3IQD B;  1AU7 A;  5GP9 A;  4J19 A;  4S3M A;  5EGO B;  3HGY A;  3WS7 A;  1I36 A;  1O4X A;  1GT0 C;  5FLM J;  2MG4 A;  3TW7 A;  1MH4 A;  1NK2 P;  2GF2 A;  3QHA A;  4X1E A;  3JRC A;  4S0H B;  1FJL A;  3PDU A;  2X58 A;  3A02 A;  3C7D B;  2JA7 J;  4CYC B;  5EGO A;  4GFB A;  4DW6 A;  3BR1 A;  1IL0 A;  1EVZ A;  2I10 A;  2QF7 A;  2Y30 A;  1BG6 A;  3OIO A;  4JX6 A;  2IYO A;  1OJL A;  1I3Q J;  5FWN A;  3D1N I;  3PJG A;  3S16 J;  2UYY A;  1PUF A;  4FCY A;  3EGO A;  1QVT A;  5HOD A;  1D5Y A;  5A9S B;  4A3G J;  1FEX A;  4HNV A;  1LE8 B;  3GTM J;  2E2H J;  1DU6 A;  2JA8 J;  1PGJ A;  2NVQ J;  4JP0 A;  2EQR A;  1EF4 A;  2VKV A;  3LSP A;  4IHY A;  5A9R A;  5K7H A;  2LP0 A;  2NS8 A;  1WI3 A;  2GM4 A;  1GV2 A;  3BTL A;  2CUF A;  2DA2 A;  3PEF A;  1RES A;  4FE4 A;  3TP3 A;  2DA4 A;  2ECB A;  3IV5 A;  2R5Y B;  3WFJ A;  5FKL A;  1VFC A;  2X6O A;  4A3J J;  2B63 J;  2GBY A;  1RKT A;  1A5J A;  2FJ1 A;  3OOU A;  5F0H A;  4I6Z A;  1Z77 A;  4A3B J;  2DA5 A;  1WGX A;  2K9S A;  1JUP A;  4NDL A;  4QIW N;  2YUS A;  2X48 A;  1BL0 A;  1OFC X;  3MKL A;  5GPC A;  4EZB A;  1ZTR A;  2N8G A;  3HOW J;  1H89 C;  2WAQ N;  1RR7 A;  3GTK J;  2HI3 A;  2IBD A;  2JMW A;  2O7O A;  2NVY J;  4MLO A;  2Y9Z A;  4JPZ B;  1AHD P;  3LNQ A;  4C3H J;  4A3I J;  3S2D J;  4D7N A;  4Y52 J;  3SFI A;  4BY1 J;  4MFE A;  5IYC J;  1JTX A;  3TW6 A;  3RZD J;  2HOA A;  2COB A;  2P81 A;  5J1R A;  2Y9Y A;  4GWK A;  1Y1V J;  2E2I J;  5EF6 A;  3ZQL A;  2W48 A;  4CYC A;  4FGW A;  2X9D A;  4MO7 A;  1ENH A;  1VI0 A;  1ITY A;  5E3M A;  3OSG A;  5FKM A;  4DYR A;  1IRZ A;  2M0C A;  2R93 J;  4J0E A;  1X0V A;  3ADO A;  2M8G X;  3H3V K;  3ZWB A;  2EW2 A;  4D3S A;  2IEK A;  2LK2 A;  4Y7N J;  3Q0U A;  2NVT J;  1N1E A;  3FIW A;  2W90 A;  2XGE A;  3BG5 A;  1POG A;  3ZGY A;  2XGD A;  3FK6 A;  2LD5 A;  4OVN F;  1MBH A;  4XID A;  2XGC A;  4X6A J;  4I76 A;  1HLV A;  3GTQ J;  1ETX A;  1XG1 A;  5BNG A;  1B72 A;  3BG3 A;  3M4O J;  3S15 J;  4E12 A;  2PGD A;  2NS7 A;  3MN2 A;  4B3A A;  3A01 B;  3CQZ J;  3L6D A;  4M3B A;  2MGQ A;  2LVS A;  2Y2Z A;  4W1U A;  5M5Y J;  2Y0S N;  3HAD A;  1QMG A;  2CJJ A;  3Q0V A;  4E21 A;  2DMP A;  3HOV J;  3HWR A;  1JT6 A;  2R5Z A;  5C44 J;  1F43 A;  4XRM A;  3O8H A;  1WP4 A;  4M3G A;  4FTH A;  1IDZ A;  4ABZ A;  1MBK A;  1B8I A;  1GV5 A;  1IG7 A;  5FLV A;  2ZYD A;  4G12 A;  2L7M P;  4A3D J;  1X0X A;  2LTP A;  1VPD A;  2AO9 A;  1ZKG A;  1JJ8 C;  1RPW A;  2JK3 A;  4R1N A;  5EG0 B;  1TC3 C;  5C4J J;  3GHY A;  5IPA A;  2JA6 J;  1JKQ C;  3HDD A;  5IYD J;  4IM7 A;  1CQT A;  5C3E J;  3DFU A;  3C7C B;  1QVU A;  2DMQ A;  1FTT A;  5E3L A;  4YCA A;  2D3T A;  5F27 A;  2I9P A;  3JRB A;  1WPK A;  1MNM C;  1SAN A;  4DYQ A;  1F14 A;  1YJQ A;  4B3J A;  4UUS A;  2JKV A;  2CQX A;  3I4M J;  4XK4 A;  4XRS G;  1OCT C;  3K7A J;  2ZB9 A;  1RET A;  3B6C A;  1JKR C;  1WDM A;  4LOC A;  3DCF A;  2WV1 A;  5JLX A;  2CQQ A;  2L9R A;  3Q0W A;  5AYV A;  4PZD A;  3BTI A;  4JX4 A;  1QRY A;  2ECC A;  4IEJ A;  2ME6 A;  5M3F J;  1IGN A;  1ZCJ A;  4DYD A;  2L0K A;  3O8G A;  2DA3 A;  3FK7 A;  1Z0X A;  4FIS A;  3HN2 A;  1M75 A;  2XSD C;  1T56 A;  2EZK A;  2LFB A;  3A03 A;  5DTD A;  2LY9 A;  3LOC A;  3GTJ J;  1SFO J;  4AC0 A;  4C2M J;  2R7Z J;  1W0T A;  3RQS A;  1F0Y A;  1NTC A;  4DYC A;  1W0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...