2XNXA

Bc1 fragment of streptococcal m1 protein in complex with human fibrinogen
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords FIBRINOGEN ALPHA CHAIN
publication title Streptococcal M1 Protein Constructs a Pathological Host Fibrinogen Network
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 20
structure length 74
sequence length 74
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2010-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2xnxA00
1JY2P 1N73B 2HPCB 1JY3O 1RF0C 1LWUC 1FZFA 2A45G 3E1IA 2Z4EA 2FFDC 1N73C 2HLOA 1FZCC 3GHGA 1JY2O 2HPCA 2XNXA 1RE4A 3GHGB 1T3UA 3HUSA 2OYIA 2OYHA 1N86A 2H43A 1LTJA 1M1JA 2A45H 3HUSB 1RE3C 1FZGA 1LTJB 1M1JB 1W2EA 2Q9IA 2OYIB 2A45I 1LT9A 1RF1A 2OYHB 1LT9B 1RE3A 1FZBA 1JY3N 1RF1B 1RF0A 3GHGC 1FZCA 1JY3P 3H32A 2OYHC 1LWUA 1RE4C 2HODA 3H32B 3HUSC 2OYIC 1LWUB 2HODB 1FZAA 1LTJC 1M1JC 3BVHA 2FFDA 1N73A 2FFDB 1FZEA 1JY2N 1LT9C 1RF1C 1FZCB
chains in the Genus database with same CATH superfamily
1NTZD 5B5EE 1LP1A 3MTUE 3VP8A 4I7ZC 1NWQA 3EFFK 3V4WA 3CWBD 3CCUP 3T97B 1ZXGA 3L71E 1RH5B 2WPRA 1HJBA 2R5BA 3EFGA 2B88A 2KZIA 1BGYE 2R3CA 3BATA 1G1IA 3LIDA 1H89A 1FDIA 3OA7A 3O6QB 1Q2NA 1T3UA 2KUBA 3H1LE 2GUSA 1P84E 3L75E 2AXTE 3RL0D 1NU1E 2P67A 4NPDA 3D6ZA 3P8CE 2WPSA 1LNQA 3S4RA 2WTYA 5KLVK 3VP9A 4D6TD 4U3FJ 1BE3E 4H44B 2LKMA 1AA0A 3VTPC 2Y0DA 3L73G 1FZEA 3H1KG 3HD7D 2N1TA 3HTKB 3AEEC 5APTA 4N6JA 2N9YB 1JB0J 1NTZK 1KYOI 5DJTB 1QEXA 3H25A 4EOTA 5KAIH 1L2PA 1KB9E 5TISH 3CX5I 3L71J 3GF3A 1EZVD 2Z4EA 1JTHB 2P10A 3AE5C 2FYUJ 4IFFA 2FYNC 5CJ4A 4NPFX 3RK3D 2WITA 1OVVA 3OJAB 1NO4A 5KLIC 2KNCB 3PP5A 2BCCG 3L75J 2XDJA 3MUDC 4MN4C 2R44A 1KZUB 1W2EA 2OQQA 1T2KC 2OYIC 1FDMA 3AEBC 1BCCG 4DJGA 3KQGA 1NKNA 3PJSK 2MJZA 4U3FD 1SLQA 2H8PD 1IK7A 1U7JA 3V6IA 5AW0B 1PGPA 2AEJA 1IFMA 3Q3DA 3MP7B 3FGAD 2M3BA 2O01J 1LTGC 1WT6A 3CCQP 2O1JA 2YKPA 1SQVD 1S72P 2O01N 1Q90D 1KILB 2A45I 1SQQK 4LLHA 5BU8B 4N3YB 3TYYA 5KAFE 4TT3H 4OH8B 4RKUJ 3L71D 5AVZB 2E5TA 1XTGB 1FS0E 3G4SP 2YIUB 1KC8Q 1BGYD 3SWYA 3HUSA 2OYHB 3BCCE 3B5NA 3AE3C 1YTZI 4WY4A 3L36A 1IFNA 3HD7A 1NTKJ 3JCUE 1SQXE 3L75D 4PD4E 2YXRB 4BWNA 2WSFH 3P8CD 1QGKB 3PH0A 3M9HA 3OW2O 2HODB 1BE3D 3L70J 2E76B 3IFMA 3AEFC 3CC2P 2W90A 2QJKB 3VMYA 5CJ0A 2CPBA 3AE4C 1LTIC 3FWLA 1SQPE 3L72J 2P58A 1SVFA 1VQ5P 2JDIH 3SWKA 5C39A 1SQVK 4IFMA 2IBZE 1FC2C 3TGUE 1GMJA 4PJ0E 1LTJC 1VDFA 4PV1D 2NPSA 3F89A 2ITAA 2QG4A 2V4HA 3M91A 4U7JA 2CK3H 3BASA 3TDKA 1KB9D 4R4LA 3S1KA 2YXQB 1NTMK 2PFXA 1L0NJ 3KPEA 5CCGA 2KB7P 1OFCX 1VQMP 2FFDB 1HUCA 1QX8A 5KKZC 5GTIE 3L37A 3V2PA 2FYUG 1KQLA 1KQSO 3GHGA 3ITKA 1T2KD 2W8ZA 1NU1K 2ZXEB 1RF1A 4L76A 2KOGA 2L91A 5CMZA 3H1KE 1NTKD 2QJPC 3U1CA 1Q81Q 1IK9A 3AE2C 5GTHE 1AFOA 2K37A 2QJYB 4OGQB 1IFJA 1KFNA 2KYVA 3EQ2A 3Q5RA 4WBAA 1JMBA 4OVNF 2IYOA 2WSEH 1UIIA 2A45G 2JEEA 5KJ7C 1J1DB 3AE1C 3CI9A 1Z56A 2ZYDA 4RESB 3LW5J 2C0XA 2HFED 1FZBA 4H13B 3CL3D 2M5AA 3MZWB 3D6YA 3M0DA 1BDDA 1FOSE 2Q7CA 3V5BA 2O1KA 2JWDA 4K3AA 1T6AA 1GDTA 5B5EH 3TF5A 1L0ND 4I1LA 5AW5B 1M1JC 1GK6A 2OTKE 3BCCD 2WZ7A 3WUUA 1RF0C 3AE8C 4DT0A 3AE9C 2J5UA 5E79E 1R5SA 3L73J 3QWOC 1JY2O 2E74B 1WRGA 1J1EB 4PD4D 1T8ZA 2UWJE 3A5TA 1QVFO 1HJ0A 1DH3A 2G3AA 3L35A 2YMYA 3KXDA 1YBKA 3U59A 1N8RQ 1H0TA 3L70G 2JP3A 2I8DA 1OW8A 2OYHC 1LTTC 1CSBA 1UIXA 3L74G 4BRYA 1DX7A 1NKZB 1K8AQ 1KQFB 1U7MA 1GU5A 4C7RA 1HVVA 3TGUD 2KS1B 2K9JB 3TSIA 3B71A 1D7MA 2OYIA 4C7NB 2BCCJ 4H44D 4DCKA 1W5CE 5CCHC 2MKVA 2KK7A 1M57D 1VQ6P 1Q82Q 5EFWB 2O01H 3PTZA 1Q86Q 1W2BO 1KB9H 1BCCJ 1SQBG 2QJKC 4GOFA 3CCSP 2K88A 1YI2P 3ABVC 4OWFA 1SQXK 4U3FE 1HWTC 2XNDH 3HE5A 1RQUA 1JY2P 2ZYGA 1DD4A 3VMXA 4Y28J 3H1KD 2Q3EA 1LT9B 3M0AA 1SP4A 1WMKA 3G6EP 2RH0A 5KJ7D 2W6JH 1FZCB 4H0LB 1SQPK 2B87A 2J59M 2FKWB 3IN6A 3CCEP 3H1IG 2VRSA 1SFCA 1ZN5A 1T3JA 3BRTB 1G2CA 5AW9B 5APQA 1L0LG 2FYUE 3GW6A 1URQC 2KSJA 2BCCD 1YJWP 1PGOA 1VF5B 3H32A 2D2CB 2M0BA 3HE4A 1X9VA 2ZAEB 1IFDA 4KT0J 1YQ3C 5APYA 1VQLP 1EZVI 1Q7YQ 1BCCD 5AVSB 3P32A 1RY3A 5KAFH 3MGNA 1LTJA 1J1DC 4M3LA 2QRXA 3CCJP 2K9YA 4GIFA 1RE3A 1YHQP 1GTWA 1GL2A 1K05A 2M8RA 2N1TB 4HYTB 4EDFA 1NJIQ 3JCUH 2HPCB 3VN0A 4PD4H 1N7SA 5KLVG 4GODA 1LGHB 2FXPA 4ZKUA 1DD3A 1SS1A 3JSVC 2HR3A 3CCVP 2OTJP 2XV5A 4PV1C 1R5LA 3AE7C 3GG2A 1KQGB 2Q3IA 5CCHD 1FJPA 3S9OA 2YNYA 1NTZG 2RMZA 2E74C 1LWUA 1ZLLA 4UB8E 2XZRA 1USDA 3CWBG 1DEEG 4IL6H 3VMAA 1NTMJ 4PJ0H 1FDOA 1M56D 4EYYQ 2FXMA 1NTKE 2Q9IA 2B9BA 3H6PA 5APVA 3KHUA 2Y9YA 1N73B 3USSA 4B86A 1KYOD 2NZ2A 3L70E 5AVYB 5GTIH 3WU2E 5M1BA 1J2JB 3L72E 1CI6A 2V7QJ 5AVWB 1P84I 1OVUA 3CCRP 1VQ9P 2DW3A 3TNUA 2R3SA 1Y8AA 1M1JA 1PZQA 3AEDC 3Q2YA 1RF0A 3Q5SA 1VQOP 3WUVA 2H88C 3TK1A 2Q1KA 5GTHH 3HRNA 1URQD 1L0NE 1FZFA 2Z5HA 2ZJSE 3MHVA 3I55P 2A06E 1NGMB 3RGUA 3HUSB 3GF7A 2FYUD 3B5NB 4WY4B 2AEFA 1EZVG 4OGQD 2Z5IA 2JR8A 2WSSH 1SQQG 1E5WA 1GU4A 1OMIA 1MFZA 2XU6A 1AVYA 4H0LC 1KB9I 3U1AA 4L75A 1FZAA 3CMEP 2WSCH 3L74J 5CCHA 1AVOA 5APUA 4ZMDA 1YJ9P 3RK3B 5E79H 4IL6E 2IX7C 1YITP 1OZHA 2M3EA 2NPSB 3H1HJ 1NOHA 1XTCC 2E74D 3A3YB 2Q6QA 3E1RA 3IF4A 1SQBJ 4H44C 1EDIA 4DOJA 4JYCA 1SQVG 3A0HE 1ZMEC 4N78E 2I1JA 1X79B 3GHGB 5AW3B 4EI2A 5AW4B 3D71A 4WB4A 1RF1B 2LXCB 1NYHA 1IO4A 2OYOA 3L73E 1NTMG 1N2DC 3PLNA 2W6AA 1JY3O 1PPJG 2FXOA 3G9RA 5B66E 4JPZB 1Y47A 2WMMA 1S2EA 3H1LG 4ZNCA 1NU1G 3CC7P 3L70D 1JEKA 3H1IJ 3II6A 2HYNA 1URQA 2LR2A 1X8YA 1KYOH 5APSA 1FJKA 3PHLA 3L72D 1L0LJ 3JC22 1BE3G 5AW7B 4PD4I 4HKZH 3G71P 2AXCA 1EQ7A 3CXHE 2PAJA 2M5AB 1X0TA 3H1JG 2JWAA 1S4XA 1L4AB 2BCCE 2BEZF 1TU3F 1AQ5A 2R5DA 1G1JA 2ZYAA 4L73A 1N73C 1YQ4C 2PP6A 4XFJA 3KZIE 1SQBD 3KYQA 3CD6P 4AYCA 5AW1B 1BCCE 2A06D 1OWAA 3R4YA 1KILE 4H0LD 3NXSA 4NPEA 2WT7A 3I56P 5CHXA 1NTKK 2IBZI 3P7KA 3RK2B 2PGDA 2W83C 2C9NY 1KFMA 1JUNA 1EDJA 2KI7B 1X22A 1FZGA 1S5LE 5KTBA 3WUTA 1JY3P 2FYZA 1K04A 1KILC 1BSHA 5KLVJ 5APXA 4KJMA 1OW7A 3C8VA 1PFIA 2FYNB 4A7PA 1DIPA 5KLIB 2YIUC 1H0TB 1ZRTD 1PV3A 4XA4A 1BSNA 2BEQD 1PP9G 3H1ID 3B5NC 3MUDA 4BRYB 4WY4C 1NAFA 1NTZJ 2W27A 3FXDA 1VQPP 1FAVA 1LTBC 3CPWO 2XNXA 1L0LD 3CWBJ 2C0WA 1U57A 2B89A 2OYIB 3C9IA 1HGZA 1S9KE 1GD2E 1YYCA 2YO2A 1FE6A 2QVAA 1L0NK 1KV4A 2WPQA 2KLVA 2P7JA 3N4XA 3H1HG 2IFMA 2GM4A 2E76C 2WSFJ 4I6MC 1R8EA 1AJYA 4CPGA 5K5GB 4N78D 4LC1A 1KYOE 1NVOA 2PRRA 1OIPA 3HE5B 3I5CA 1HBWA 3QH9A 5H2FE 2NRGA 1VQKP 3L73D 1QL2A 4UB8H 4D6TJ 2NPSC 3CX5E 3G3ZA 1RQVA 2CPSA 1ZV8A 4Z1MH 3BCCG 3A2AA 5KLVD 1M1KQ 5CCGC 2R32A 3OAKA 1SQXG 1LP1B 2FFDC 2B87B 2YKOA 2GA1A 3GHGC 1SFCB 1VQ4P 1RE4C 3NTNA 4HH2A 1G2CB 3KDPB 3AEGC 4JBZA 3WU2H 3CXHD 2L5GB 1SQQJ 1LTSC 3RBXA 3T97A 1SQPG 3MD0A 1NTME 3H32B 2IBZG 3TGUG 1PPJE 3HE4B 2K3RA 2XKMA 2QJYC 3W68A 1M8OB 4OGQC 3O6QA 1M7LA 2J58A 3CLQA 2ZT9B 3A0BE 3F5HA 5CBNA 2H7HA 1LTJB 4W7ZA 1KILD 2E43A 1OVRA 1GK4A 1GL2B 1DEBA 4H13C 2WSEJ 3CCMP 1JOCA 3FXEA 1EXJA 1L4AC 1H8AA 3M0DC 3V2QA 1EC5A 1IZNB 5TJHA 2E75B 1N7SB 3B5ND 2YKQA 2WQYC 3H1JE 4WY4D 4RO0A 5KKZB 2FBWC 1JY2N 2N9BA 3HTKA 2QSIA 3E1IA 3RL0g 2K1AA 2HPCA 1SQVJ 1PGJA 3GLMA 3RK2C 2QJPB 2JO1A 5AVQB 4BXLA 1MZ9A 1LWUB 4IL6X 1K73Q 1J1EC 2JKVA 4EIJA 2E76D 1M90Q 1SQQD 1S9KD 4W80A 1BGYJ 2KLUA 1JTHA 3LW5H 5AW2B 1VQ7P 4GOEA 3LIEA 1JNMA 3V2RA 3CCLP 1YIJP 3IR9A 5KJ7A 1FU1A 3H1LJ 2IPPA 2KNCA 2BASA 2NPSD 2IDBA 3RBZA 1NU1J 3VOPA 1OW6A 4TLFA 3M9QA 1QL1A 1QVGO 3A0HH 3N7NA 1PP9E 2WVRA 3L74E 5CCGD 1BE3J 1ZOYC 4I2LC 2SPZA 1N73A 3CX5D 4D6TG 1CI6B 5AVTB 1HGVA 5AVXB 3H1JJ 3B4SA 3C1LA 5AVRB 2HLOA 3TNUB 1IJDB 2Q5UA 2JJLA 3EWKA 1M1JB 4R4MA 3FX0A 4ZKPA 3RL0B 1HF9A 3P8MC 5B66H 1H88A 4YXDC 3H1HE 4Y99B 4K35A 3O8ZA 1IC2A 1Y9BA 3B8EB 1VPCA 2KZJA 4DZOA 1SQBE 2QIWA 2IFNA 5L8RJ 1KILA 2KP8A 4AUWA 2HG5D 3BVHA 1K9MQ 3M9BA 1LT9C 4GDOA 3HD7B 1PL5A 1KD1Q 1GW4A 2ZVNB 3CXHH 1NTMD 3PRJA 1FZCC 5AW6B 5BU5A 1PPJD 2OYHA 4IFDK 1ZP0C 2POHA 2E5YA 5AVUB 2AEMA 4H13D 3SFEC 1KORA 2QM8A 4UB6H 3H1LD 1SFCC 1L4AD 1P84D 3KZIH 2YMKA 4HJGH 1NU1D 1ZRTE 3R2PA 2P1JA 2C9LY 1PP9J 2Y0CA 5AVVB 2GUVA 5KAIE 3H1IE 5TISE 1GW3A 1KTMA 2RN0A 2ZFCA 4WVZA 4JQ0D 1S5LX 1YTZT 2HODA 4U3FG 1L0LE 5APWA 2KXPB 2P2UA 1S5LH 5AW8B 1VF5C 1NHLA 2D2CC 3H1JD 3RK2D 4GKGA 4W7YA 1VQNP 3V4QA 1HH0A 2OTLP 2ZT9C 1LTAC 1QLED 2OARA 1JO5A 2FYUK 2H43A 1RE3C 1JMMA 2FY8A 4JYBA 1GL2C 1MUUA 1A02J 3K5BA 1IFIA 3CMAP 2N1TC 3L71G 4JF7A 2W6BA 4C46A 2E75C 2FFDA 1N7SC 1BGYG 3D70A 3BCCJ 4I7ZB 1OXZA 1EXIA 3CC4P 4ASVA 1RE4A 3MIWA 3Q5PA 5KLVE 1SQXJ 4RJTA 1A02F 3L75G 3SWFA 2KSEA 2LXBA 2E42A 1URQB 1KN7A 1LWUC 1PP9D 1YJNP 1VL2A 3L74D 1JM0A 1CZQA 1N86A 1NTZE 2QA4P 5H2FH 4LGDE 2WPVB 3CWBE 1SQPJ 3CX5H 1VQ8P 3UIAA 3TGUJ 4KHXA 4YPCA 3H1HD 2OGUA 1OX3A 4UB6E 1S3JA 3NMDA 2KIKA 3SSUA 4WWIA 3A7OA 1L4AA 2RKLA 1ZR4A 3AECC 1GZLA 2WT7B 3VMZA 3Q1MA 2ZVOB 3V2NA 2YO3A 3WMM0 3SFDC 1USEA 1SFCD 4QMAA 3E7KA 4D6TE 4AQRD 4PV1B 3RL0C 2O3JA 3AEAC 1MKMA 4Y99C 5DJUB 4IOIH 3H1KJ 1SQXD 1NTKG 3L4FA 2WWWA 1RHZB 3A0BH 1VF5D 3HUSC 2D2CD 1PIXA 4L74A 1P84H 1N7LA 2AXTH 3HD7C 2ZT9D 1JCDA 1CW5A 1LT1A 2A45H 3FWNA 1E79H 1EZVE 4YTPC 1FBMA 1SQQE 1SQPD 1GL2D 2QEXP 2V7QH 1AQTA 1AV1A 3L72G 1SQBK 3NFQA 2IBZD 3RK3E 2N1TD 2KS1A 2K9JA 2IYPA 4C7NA 1ZW0A 4O9BA 2H89C 3VYIA 1KMIZ 2E75D 1N7SD 4ASWA 3W67A 3RK3C 4HB1A 1IFPA 2WSCJ 2QE7H 1L0NG 3CXHI 5CBOA 4GT1A 1NH4A 4XE5B 2Y0EA 2A06G 1S1CX 3IAOA 3BRVB 1JCCA 2IZ0A 1FOSF 2ZXXA 2I1KA 1PGQA 2QM7A 1NAYA 4YXWH 1MFTA 1LJ2A 1ZR2A 1BDCA 1EDLA 3ZDMA 1LT9A 2IZ1A 1JY3N 1HTLC 3AE6C 2Y9ZA 1L0LK 5BVZA 1MV8A 1EDKA 3GMAA 3M06A 2G8YA 1SQVE 1FZCA 1RF1C
chains in the Genus database with same CATH topology
2IPPA 2WZ7A 2BASA 1RF0C 2NPSB 2NPSD 3MTUE 3VP8A 3VOPA 1NWQA 1JY2O 1NOHA 1XTCC 3V4WA 3M9QA 1QL1A 1WRGA 3A3YB 3N7NA 1J1EB 2WPRA 1HJBA 1T8ZA 2R5BA 3EFGA 3A5TA 5CCGD 2R3CA 3BATA 4I2LC 1G1IA 4DOJA 1N73A 3LIDA 1CI6B 4JYCA 1H89A 5AVTB 1HGVA 3OA7A 1DH3A 3L35A 5AVXB 2YMYA 4N78E 2I1JA 5AVRB 2HLOA 3TNUB 1IJDB 2Q5UA 2JJLA 1X79B 3GHGB 1T3UA 5AW3B 3U59A 1M1JB 5AW4B 2GUSA 4ZKPA 3RL0B 4WB4A 1RF1B 3RL0D 1IO4A 3P8MC 2P67A 2OYHC 1LTTC 3P8CE 1H88A 1CSBA 1N2DC 1DX7A 4Y99B 2W6AA 3O8ZA 1NKZB 1IC2A 1JY3O 3B8EB 1GU5A 4C7RA 2WPSA 2WTYA 1HVVA 1VPCA 5KLVK 3VP9A 4DZOA 2IFNA 3TSIA 2OYIA 4C7NB 1KILA 2KP8A 2LKMA 5CCHC 4AUWA 2HG5D 3VTPC 3BVHA 1FZEA 3II6A 2HYNA 1LT9C 1URQA 3HD7B 3M9BA 3HD7D 2O01H 2N1TA 3HTKB 1GW4A 5APTA 4N6JA 1X8YA 1NTZK 1FZCC 5AW6B 5APSA 5BU5A 1FJKA 2OYHA 4IFDK 2POHA 5AW7B 5AVUB 1EQ7A 2PAJA 1SQXK 4EOTA 1HWTC 2QM8A 1SFCC 1L4AB 3HE5A 1L4AD 1JY2P 3VMXA 1AQ5A 3R2PA 2P1JA 2Z4EA 2C9LY 2R5DA 5AVVB 2GUVA 1G1JA 1N73C 1JTHB 2PP6A 1GW3A 4IFFA 1LT9B 2ZFCA 5CJ4A 3M0AA 3RK3D 2WITA 1SP4A 1YTZT 3KYQA 2HODA 4AYCA 5AW1B 3OJAB 1NO4A 1OWAA 5KJ7D 5APWA 2P2UA 1FZCB 5AW8B 1NHLA 3PP5A 3NXSA 2WT7A 2XDJA 5CHXA 1SQPK 1NTKK 3P7KA 3RK2B 3RK2D 4GKGA 2J59M 2C9NY 1KFMA 2FKWB 4W7YA 1JUNA 3V4QA 1HH0A 1KZUB 1FZGA 1W2EA 5KTBA 2VRSA 1SFCA 1ZN5A 1JY3P 1T2KC 1T3JA 2FYZA 3BRTB 1LTAC 2OYIC 1G2CA 1KILC 2OARA 5AW9B 1JO5A 2FYUK 5APXA 2H43A 1RE3C 1FDMA 1JMMA 3KQGA 5APQA 1NKNA 4JYBA 1GL2C 2MJZA 1MUUA 1SLQA 1PFIA 1URQC 2H8PD 1A02J 2KSJA 1IFIA 2N1TC 5AW0B 4JF7A 2W6BA 3H32A 4XA4A 4C46A 3HE4A 1X9VA 3B5NC 1N7SC 3MUDA 1IFDA 2FFDA 1IFMA 4WY4C 1NAFA 1OXZA 5APYA 2M3BA 2W27A 1LTGC 1WT6A 1FAVA 2O1JA 5AVSB 1LTBC 2YKPA 2XNXA 3P32A 1RE4A 1RY3A 2C0WA 3MIWA 3MGNA 2OYIB 1LTJA 1J1DC 1KILB 4M3LA 2A45I 1SQQK 3C9IA 4GIFA 4LLHA 1RE3A 5BU8B 4N3YB 1A02F 1HGZA 1S9KE 1GTWA 1GD2E 3SWFA 1GL2A 1YYCA 2YO2A 3TYYA 1L0NK 2WPQA 2KLVA 2P7JA 3N4XA 4OH8B 2M8RA 1URQB 2E42A 2IFMA 5AVZB 1LWUC 2GM4A 1XTGB 2N1TB 4HYTB 3SWYA 1CZQA 3HUSA 1N86A 4I6MC 2HPCB 2OYHB 3VN0A 3B5NA 1N7SA 1YTZI 4LGDE 4WY4A 1LGHB 3L36A 4N78D 4ZKUA 4LC1A 1IFNA 3HD7A 3HE5B 3I5CA 1HBWA 2XV5A 3UIAA 4KHXA 1QL2A 2WSFH 3P8CD 2NPSC 2Q3IA 5CCHD 3G3ZA 1FJPA 2CPSA 1ZV8A 3M9HA 2YNYA 3A2AA 3NMDA 1LWUA 1ZLLA 2HODB 3A7OA 1L4AA 2XZRA 3IFMA 1ZR4A 5CCGC 2R32A 1GZLA 3OAKA 2WT7B 3VMYA 5CJ0A 2FFDC 2CPBA 2YKOA 3VMZA 2FXMA 1LTIC 2Q9IA 1SVFA 3V2NA 2YO3A 3WMM0 1SQVK 3GHGC 1SFCB 4IFMA 1SFCD 1RE4C 3NTNA 3H6PA 5APVA 4AQRD 1LTJC 4HH2A 1G2CB 1VDFA 3RL0C 3KDPB 1N73B 2NPSA 4B86A 3M91A 4Y99C 2L5GB 3BASA 1LTSC 3T97A 1NTMK 5AVYB 3L4FA 2WWWA 3KPEA 3MD0A 5CCGA 2KB7P 3H32B 3HUSC 3HE4B 1J2JB 2FFDB 2XKMA 1CI6A 1HUCA 1N7LA 5AVWB 1M7LA 2J58A 3CLQA 3L37A 3V2PA 3HD7C 1KQLA 3TNUA 1JCDA 3GHGA 1CW5A 1T2KD 1M1JA 2A45H 2H7HA 1NU1K 1LTJB 4W7ZA 2ZXEB 1RF1A 1KILD 2E43A 1GK4A 1FBMA 2KOGA 1RF0A 3TK1A 5CMZA 1GL2B 1GL2D 1DEBA 3HRNA 3U1CA 1SQBK 1URQD 3NFQA 2Z5HA 1FZFA 1JOCA 2N1TD 1L4AC 1H8AA 3M0DC 3V2QA 1IK9A 4C7NA 3HUSB 1AFOA 4O9BA 3VYIA 3B5NB 1N7SB 3B5ND 1N7SD 4WY4B 2YKQA 4WY4D 1IFJA 1KFNA 2KYVA 3EQ2A 2Z5IA 4WBAA 1E5WA 3RK3C 1JY2N 1GU4A 2N9BA 2WSEH 3HTKA 1MFZA 2A45G 2JEEA 5KJ7C 3E1IA 1J1DB 4GT1A 2XU6A 3CI9A 1Z56A 2HPCA 4RESB 1NH4A 4XE5B 2C0XA 2HFED 3RK2C 1FZBA 3BRVB 3CL3D 1JCCA 5AVQB 3U1AA 1MZ9A 1LWUB 1FZAA 1FOSF 1J1EC 3M0DA 2I1KA 2WSCH 4EIJA 2QM7A 1FOSE 2Q7CA 3V5BA 2O1KA 1S9KD 4W80A 5CCHA 5APUA 1JTHA 1ZR2A 1GDTA 3LW5H 5AW2B 1LT9A 3LIEA 4I1LA 3RK3B 1JNMA 1JY3N 1HTLC 3V2RA 5AW5B 1L0LK 5BVZA 2IX7C 1MV8A 3IR9A 3M06A 1M1JC 1FU1A 5KJ7A 1GK6A 1FZCA 1RF1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY2 P;  1N73 B;  2HPC B;  1JY3 O;  1RF0 C;  1LWU C;  1FZF A;  2A45 G;  3E1I A;  2Z4E A;  2FFD C;  1N73 C;  2HLO A;  1FZC C;  3GHG A;  1JY2 O;  2HPC A;  2XNX A;  1RE4 A;  3GHG B;  1T3U A;  3HUS A;  2OYI A;  2OYH A;  1N86 A;  2H43 A;  1LTJ A;  1M1J A;  2A45 H;  3HUS B;  1RE3 C;  1FZG A;  1LTJ B;  1M1J B;  1W2E A;  2Q9I A;  2OYI B;  2A45 I;  1LT9 A;  1RF1 A;  2OYH B;  1LT9 B;  1RE3 A;  1FZB A;  1JY3 N;  1RF1 B;  1RF0 A;  3GHG C;  1FZC A;  1JY3 P;  3H32 A;  2OYH C;  1LWU A;  1RE4 C;  2HOD A;  3H32 B;  3HUS C;  2OYI C;  1LWU B;  2HOD B;  1FZA A;  1LTJ C;  1M1J C;  3BVH A;  2FFD A;  1N73 A;  2FFD B;  1FZE A;  1JY2 N;  1LT9 C;  1RF1 C;  1FZC B; 
#chains in the Genus database with same CATH topology
 1NTZ D;  5B5E E;  1LP1 A;  3MTU E;  3VP8 A;  4I7Z C;  1NWQ A;  3EFF K;  3V4W A;  3CWB D;  3CCU P;  3T97 B;  1ZXG A;  3L71 E;  1RH5 B;  2WPR A;  1HJB A;  2R5B A;  3EFG A;  2B88 A;  2KZI A;  1BGY E;  2R3C A;  3BAT A;  1G1I A;  3LID A;  1H89 A;  1FDI A;  3OA7 A;  3O6Q B;  1Q2N A;  1T3U A;  2KUB A;  3H1L E;  2GUS A;  1P84 E;  3L75 E;  2AXT E;  3RL0 D;  1NU1 E;  2P67 A;  4NPD A;  3D6Z A;  3P8C E;  2WPS A;  1LNQ A;  3S4R A;  2WTY A;  5KLV K;  3VP9 A;  4D6T D;  4U3F J;  1BE3 E;  4H44 B;  2LKM A;  1AA0 A;  3VTP C;  2Y0D A;  3L73 G;  1FZE A;  3H1K G;  3HD7 D;  2N1T A;  3HTK B;  3AEE C;  5APT A;  4N6J A;  2N9Y B;  1JB0 J;  1NTZ K;  1KYO I;  5DJT B;  1QEX A;  3H25 A;  4EOT A;  5KAI H;  1L2P A;  1KB9 E;  5TIS H;  3CX5 I;  3L71 J;  3GF3 A;  1EZV D;  2Z4E A;  1JTH B;  2P10 A;  3AE5 C;  2FYU J;  4IFF A;  2FYN C;  5CJ4 A;  4NPF X;  3RK3 D;  2WIT A;  1OVV A;  3OJA B;  1NO4 A;  5KLI C;  2KNC B;  3PP5 A;  2BCC G;  3L75 J;  2XDJ A;  3MUD C;  4MN4 C;  2R44 A;  1KZU B;  1W2E A;  2OQQ A;  1T2K C;  2OYI C;  1FDM A;  3AEB C;  1BCC G;  4DJG A;  3KQG A;  1NKN A;  3PJS K;  2MJZ A;  4U3F D;  1SLQ A;  2H8P D;  1IK7 A;  1U7J A;  3V6I A;  5AW0 B;  1PGP A;  2AEJ A;  1IFM A;  3Q3D A;  3MP7 B;  3FGA D;  2M3B A;  2O01 J;  1LTG C;  1WT6 A;  3CCQ P;  2O1J A;  2YKP A;  1SQV D;  1S72 P;  2O01 N;  1Q90 D;  1KIL B;  2A45 I;  1SQQ K;  4LLH A;  5BU8 B;  4N3Y B;  3TYY A;  5KAF E;  4TT3 H;  4OH8 B;  4RKU J;  3L71 D;  5AVZ B;  2E5T A;  1XTG B;  1FS0 E;  3G4S P;  2YIU B;  1KC8 Q;  1BGY D;  3SWY A;  3HUS A;  2OYH B;  3BCC E;  3B5N A;  3AE3 C;  1YTZ I;  4WY4 A;  3L36 A;  1IFN A;  3HD7 A;  1NTK J;  3JCU E;  1SQX E;  3L75 D;  4PD4 E;  2YXR B;  4BWN A;  2WSF H;  3P8C D;  1QGK B;  3PH0 A;  3M9H A;  3OW2 O;  2HOD B;  1BE3 D;  3L70 J;  2E76 B;  3IFM A;  3AEF C;  3CC2 P;  2W90 A;  2QJK B;  3VMY A;  5CJ0 A;  2CPB A;  3AE4 C;  1LTI C;  3FWL A;  1SQP E;  3L72 J;  2P58 A;  1SVF A;  1VQ5 P;  2JDI H;  3SWK A;  5C39 A;  1SQV K;  4IFM A;  2IBZ E;  1FC2 C;  3TGU E;  1GMJ A;  4PJ0 E;  1LTJ C;  1VDF A;  4PV1 D;  2NPS A;  3F89 A;  2ITA A;  2QG4 A;  2V4H A;  3M91 A;  4U7J A;  2CK3 H;  3BAS A;  3TDK A;  1KB9 D;  4R4L A;  3S1K A;  2YXQ B;  1NTM K;  2PFX A;  1L0N J;  3KPE A;  5CCG A;  2KB7 P;  1OFC X;  1VQM P;  2FFD B;  1HUC A;  1QX8 A;  5KKZ C;  5GTI E;  3L37 A;  3V2P A;  2FYU G;  1KQL A;  1KQS O;  3GHG A;  3ITK A;  1T2K D;  2W8Z A;  1NU1 K;  2ZXE B;  1RF1 A;  4L76 A;  2KOG A;  2L91 A;  5CMZ A;  3H1K E;  1NTK D;  2QJP C;  3U1C A;  1Q81 Q;  1IK9 A;  3AE2 C;  5GTH E;  1AFO A;  2K37 A;  2QJY B;  4OGQ B;  1IFJ A;  1KFN A;  2KYV A;  3EQ2 A;  3Q5R A;  4WBA A;  1JMB A;  4OVN F;  2IYO A;  2WSE H;  1UII A;  2A45 G;  2JEE A;  5KJ7 C;  1J1D B;  3AE1 C;  3CI9 A;  1Z56 A;  2ZYD A;  4RES B;  3LW5 J;  2C0X A;  2HFE D;  1FZB A;  4H13 B;  3CL3 D;  2M5A A;  3MZW B;  3D6Y A;  3M0D A;  1BDD A;  1FOS E;  2Q7C A;  3V5B A;  2O1K A;  2JWD A;  4K3A A;  1T6A A;  1GDT A;  5B5E H;  3TF5 A;  1L0N D;  4I1L A;  5AW5 B;  1M1J C;  1GK6 A;  2OTK E;  3BCC D;  2WZ7 A;  3WUU A;  1RF0 C;  3AE8 C;  4DT0 A;  3AE9 C;  2J5U A;  5E79 E;  1R5S A;  3L73 J;  3QWO C;  1JY2 O;  2E74 B;  1WRG A;  1J1E B;  4PD4 D;  1T8Z A;  2UWJ E;  3A5T A;  1QVF O;  1HJ0 A;  1DH3 A;  2G3A A;  3L35 A;  2YMY A;  3KXD A;  1YBK A;  3U59 A;  1N8R Q;  1H0T A;  3L70 G;  2JP3 A;  2I8D A;  1OW8 A;  2OYH C;  1LTT C;  1CSB A;  1UIX A;  3L74 G;  4BRY A;  1DX7 A;  1NKZ B;  1K8A Q;  1KQF B;  1U7M A;  1GU5 A;  4C7R A;  1HVV A;  3TGU D;  2KS1 B;  2K9J B;  3TSI A;  3B71 A;  1D7M A;  2OYI A;  4C7N B;  2BCC J;  4H44 D;  4DCK A;  1W5C E;  5CCH C;  2MKV A;  2KK7 A;  1M57 D;  1VQ6 P;  1Q82 Q;  5EFW B;  2O01 H;  3PTZ A;  1Q86 Q;  1W2B O;  1KB9 H;  1BCC J;  1SQB G;  2QJK C;  4GOF A;  3CCS P;  2K88 A;  1YI2 P;  3ABV C;  4OWF A;  1SQX K;  4U3F E;  1HWT C;  2XND H;  3HE5 A;  1RQU A;  1JY2 P;  2ZYG A;  1DD4 A;  3VMX A;  4Y28 J;  3H1K D;  2Q3E A;  1LT9 B;  3M0A A;  1SP4 A;  1WMK A;  3G6E P;  2RH0 A;  5KJ7 D;  2W6J H;  1FZC B;  4H0L B;  1SQP K;  2B87 A;  2J59 M;  2FKW B;  3IN6 A;  3CCE P;  3H1I G;  2VRS A;  1SFC A;  1ZN5 A;  1T3J A;  3BRT B;  1G2C A;  5AW9 B;  5APQ A;  1L0L G;  2FYU E;  3GW6 A;  1URQ C;  2KSJ A;  2BCC D;  1YJW P;  1PGO A;  1VF5 B;  3H32 A;  2D2C B;  2M0B A;  3HE4 A;  1X9V A;  2ZAE B;  1IFD A;  4KT0 J;  1YQ3 C;  5APY A;  1VQL P;  1EZV I;  1Q7Y Q;  1BCC D;  5AVS B;  3P32 A;  1RY3 A;  5KAF H;  3MGN A;  1LTJ A;  1J1D C;  4M3L A;  2QRX A;  3CCJ P;  2K9Y A;  4GIF A;  1RE3 A;  1YHQ P;  1GTW A;  1GL2 A;  1K05 A;  2M8R A;  2N1T B;  4HYT B;  4EDF A;  1NJI Q;  3JCU H;  2HPC B;  3VN0 A;  4PD4 H;  1N7S A;  5KLV G;  4GOD A;  1LGH B;  2FXP A;  4ZKU A;  1DD3 A;  1SS1 A;  3JSV C;  2HR3 A;  3CCV P;  2OTJ P;  2XV5 A;  4PV1 C;  1R5L A;  3AE7 C;  3GG2 A;  1KQG B;  2Q3I A;  5CCH D;  1FJP A;  3S9O A;  2YNY A;  1NTZ G;  2RMZ A;  2E74 C;  1LWU A;  1ZLL A;  4UB8 E;  2XZR A;  1USD A;  3CWB G;  1DEE G;  4IL6 H;  3VMA A;  1NTM J;  4PJ0 H;  1FDO A;  1M56 D;  4EYY Q;  2FXM A;  1NTK E;  2Q9I A;  2B9B A;  3H6P A;  5APV A;  3KHU A;  2Y9Y A;  1N73 B;  3USS A;  4B86 A;  1KYO D;  2NZ2 A;  3L70 E;  5AVY B;  5GTI H;  3WU2 E;  5M1B A;  1J2J B;  3L72 E;  1CI6 A;  2V7Q J;  5AVW B;  1P84 I;  1OVU A;  3CCR P;  1VQ9 P;  2DW3 A;  3TNU A;  2R3S A;  1Y8A A;  1M1J A;  1PZQ A;  3AED C;  3Q2Y A;  1RF0 A;  3Q5S A;  1VQO P;  3WUV A;  2H88 C;  3TK1 A;  2Q1K A;  5GTH H;  3HRN A;  1URQ D;  1L0N E;  1FZF A;  2Z5H A;  2ZJS E;  3MHV A;  3I55 P;  2A06 E;  1NGM B;  3RGU A;  3HUS B;  3GF7 A;  2FYU D;  3B5N B;  4WY4 B;  2AEF A;  1EZV G;  4OGQ D;  2Z5I A;  2JR8 A;  2WSS H;  1SQQ G;  1E5W A;  1GU4 A;  1OMI A;  1MFZ A;  2XU6 A;  1AVY A;  4H0L C;  1KB9 I;  3U1A A;  4L75 A;  1FZA A;  3CME P;  2WSC H;  3L74 J;  5CCH A;  1AVO A;  5APU A;  4ZMD A;  1YJ9 P;  3RK3 B;  5E79 H;  4IL6 E;  2IX7 C;  1YIT P;  1OZH A;  2M3E A;  2NPS B;  3H1H J;  1NOH A;  1XTC C;  2E74 D;  3A3Y B;  2Q6Q A;  3E1R A;  3IF4 A;  1SQB J;  4H44 C;  1EDI A;  4DOJ A;  4JYC A;  1SQV G;  3A0H E;  1ZME C;  4N78 E;  2I1J A;  1X79 B;  3GHG B;  5AW3 B;  4EI2 A;  5AW4 B;  3D71 A;  4WB4 A;  1RF1 B;  2LXC B;  1NYH A;  1IO4 A;  2OYO A;  3L73 E;  1NTM G;  1N2D C;  3PLN A;  2W6A A;  1JY3 O;  1PPJ G;  2FXO A;  3G9R A;  5B66 E;  4JPZ B;  1Y47 A;  2WMM A;  1S2E A;  3H1L G;  4ZNC A;  1NU1 G;  3CC7 P;  3L70 D;  1JEK A;  3H1I J;  3II6 A;  2HYN A;  1URQ A;  2LR2 A;  1X8Y A;  1KYO H;  5APS A;  1FJK A;  3PHL A;  3L72 D;  1L0L J;  3JC2 2;  1BE3 G;  5AW7 B;  4PD4 I;  4HKZ H;  3G71 P;  2AXC A;  1EQ7 A;  3CXH E;  2PAJ A;  2M5A B;  1X0T A;  3H1J G;  2JWA A;  1S4X A;  1L4A B;  2BCC E;  2BEZ F;  1TU3 F;  1AQ5 A;  2R5D A;  1G1J A;  2ZYA A;  4L73 A;  1N73 C;  1YQ4 C;  2PP6 A;  4XFJ A;  3KZI E;  1SQB D;  3KYQ A;  3CD6 P;  4AYC A;  5AW1 B;  1BCC E;  2A06 D;  1OWA A;  3R4Y A;  1KIL E;  4H0L D;  3NXS A;  4NPE A;  2WT7 A;  3I56 P;  5CHX A;  1NTK K;  2IBZ I;  3P7K A;  3RK2 B;  2PGD A;  2W83 C;  2C9N Y;  1KFM A;  1JUN A;  1EDJ A;  2KI7 B;  1X22 A;  1FZG A;  1S5L E;  5KTB A;  3WUT A;  1JY3 P;  2FYZ A;  1K04 A;  1KIL C;  1BSH A;  5KLV J;  5APX A;  4KJM A;  1OW7 A;  3C8V A;  1PFI A;  2FYN B;  4A7P A;  1DIP A;  5KLI B;  2YIU C;  1H0T B;  1ZRT D;  1PV3 A;  4XA4 A;  1BSN A;  2BEQ D;  1PP9 G;  3H1I D;  3B5N C;  3MUD A;  4BRY B;  4WY4 C;  1NAF A;  1NTZ J;  2W27 A;  3FXD A;  1VQP P;  1FAV A;  1LTB C;  3CPW O;  2XNX A;  1L0L D;  3CWB J;  2C0W A;  1U57 A;  2B89 A;  2OYI B;  3C9I A;  1HGZ A;  1S9K E;  1GD2 E;  1YYC A;  2YO2 A;  1FE6 A;  2QVA A;  1L0N K;  1KV4 A;  2WPQ A;  2KLV A;  2P7J A;  3N4X A;  3H1H G;  2IFM A;  2GM4 A;  2E76 C;  2WSF J;  4I6M C;  1R8E A;  1AJY A;  4CPG A;  5K5G B;  4N78 D;  4LC1 A;  1KYO E;  1NVO A;  2PRR A;  1OIP A;  3HE5 B;  3I5C A;  1HBW A;  3QH9 A;  5H2F E;  2NRG A;  1VQK P;  3L73 D;  1QL2 A;  4UB8 H;  4D6T J;  2NPS C;  3CX5 E;  3G3Z A;  1RQV A;  2CPS A;  1ZV8 A;  4Z1M H;  3BCC G;  3A2A A;  5KLV D;  1M1K Q;  5CCG C;  2R32 A;  3OAK A;  1SQX G;  1LP1 B;  2FFD C;  2B87 B;  2YKO A;  2GA1 A;  3GHG C;  1SFC B;  1VQ4 P;  1RE4 C;  3NTN A;  4HH2 A;  1G2C B;  3KDP B;  3AEG C;  4JBZ A;  3WU2 H;  3CXH D;  2L5G B;  1SQQ J;  1LTS C;  3RBX A;  3T97 A;  1SQP G;  3MD0 A;  1NTM E;  3H32 B;  2IBZ G;  3TGU G;  1PPJ E;  3HE4 B;  2K3R A;  2XKM A;  2QJY C;  3W68 A;  1M8O B;  4OGQ C;  3O6Q A;  1M7L A;  2J58 A;  3CLQ A;  2ZT9 B;  3A0B E;  3F5H A;  5CBN A;  2H7H A;  1LTJ B;  4W7Z A;  1KIL D;  2E43 A;  1OVR A;  1GK4 A;  1GL2 B;  1DEB A;  4H13 C;  2WSE J;  3CCM P;  1JOC A;  3FXE A;  1EXJ A;  1L4A C;  1H8A A;  3M0D C;  3V2Q A;  1EC5 A;  1IZN B;  5TJH A;  2E75 B;  1N7S B;  3B5N D;  2YKQ A;  2WQY C;  3H1J E;  4WY4 D;  4RO0 A;  5KKZ B;  2FBW C;  1JY2 N;  2N9B A;  3HTK A;  2QSI A;  3E1I A;  3RL0 g;  2K1A A;  2HPC A;  1SQV J;  1PGJ A;  3GLM A;  3RK2 C;  2QJP B;  2JO1 A;  5AVQ B;  4BXL A;  1MZ9 A;  1LWU B;  4IL6 X;  1K73 Q;  1J1E C;  2JKV A;  4EIJ A;  2E76 D;  1M90 Q;  1SQQ D;  1S9K D;  4W80 A;  1BGY J;  2KLU A;  1JTH A;  3LW5 H;  5AW2 B;  1VQ7 P;  4GOE A;  3LIE A;  1JNM A;  3V2R A;  3CCL P;  1YIJ P;  3IR9 A;  5KJ7 A;  1FU1 A;  3H1L J;  2IPP A;  2KNC A;  2BAS A;  2NPS D;  2IDB A;  3RBZ A;  1NU1 J;  3VOP A;  1OW6 A;  4TLF A;  3M9Q A;  1QL1 A;  1QVG O;  3A0H H;  3N7N A;  1PP9 E;  2WVR A;  3L74 E;  5CCG D;  1BE3 J;  1ZOY C;  4I2L C;  2SPZ A;  1N73 A;  3CX5 D;  4D6T G;  1CI6 B;  5AVT B;  1HGV A;  5AVX B;  3H1J J;  3B4S A;  3C1L A;  5AVR B;  2HLO A;  3TNU B;  1IJD B;  2Q5U A;  2JJL A;  3EWK A;  1M1J B;  4R4M A;  3FX0 A;  4ZKP A;  3RL0 B;  1HF9 A;  3P8M C;  5B66 H;  1H88 A;  4YXD C;  3H1H E;  4Y99 B;  4K35 A;  3O8Z A;  1IC2 A;  1Y9B A;  3B8E B;  1VPC A;  2KZJ A;  4DZO A;  1SQB E;  2QIW A;  2IFN A;  5L8R J;  1KIL A;  2KP8 A;  4AUW A;  2HG5 D;  3BVH A;  1K9M Q;  3M9B A;  1LT9 C;  4GDO A;  3HD7 B;  1PL5 A;  1KD1 Q;  1GW4 A;  2ZVN B;  3CXH H;  1NTM D;  3PRJ A;  1FZC C;  5AW6 B;  5BU5 A;  1PPJ D;  2OYH A;  4IFD K;  1ZP0 C;  2POH A;  2E5Y A;  5AVU B;  2AEM A;  4H13 D;  3SFE C;  1KOR A;  2QM8 A;  4UB6 H;  3H1L D;  1SFC C;  1L4A D;  1P84 D;  3KZI H;  2YMK A;  4HJG H;  1NU1 D;  1ZRT E;  3R2P A;  2P1J A;  2C9L Y;  1PP9 J;  2Y0C A;  5AVV B;  2GUV A;  5KAI E;  3H1I E;  5TIS E;  1GW3 A;  1KTM A;  2RN0 A;  2ZFC A;  4WVZ A;  4JQ0 D;  1S5L X;  1YTZ T;  2HOD A;  4U3F G;  1L0L E;  5APW A;  2KXP B;  2P2U A;  1S5L H;  5AW8 B;  1VF5 C;  1NHL A;  2D2C C;  3H1J D;  3RK2 D;  4GKG A;  4W7Y A;  1VQN P;  3V4Q A;  1HH0 A;  2OTL P;  2ZT9 C;  1LTA C;  1QLE D;  2OAR A;  1JO5 A;  2FYU K;  2H43 A;  1RE3 C;  1JMM A;  2FY8 A;  4JYB A;  1GL2 C;  1MUU A;  1A02 J;  3K5B A;  1IFI A;  3CMA P;  2N1T C;  3L71 G;  4JF7 A;  2W6B A;  4C46 A;  2E75 C;  2FFD A;  1N7S C;  1BGY G;  3D70 A;  3BCC J;  4I7Z B;  1OXZ A;  1EXI A;  3CC4 P;  4ASV A;  1RE4 A;  3MIW A;  3Q5P A;  5KLV E;  1SQX J;  4RJT A;  1A02 F;  3L75 G;  3SWF A;  2KSE A;  2LXB A;  2E42 A;  1URQ B;  1KN7 A;  1LWU C;  1PP9 D;  1YJN P;  1VL2 A;  3L74 D;  1JM0 A;  1CZQ A;  1N86 A;  1NTZ E;  2QA4 P;  5H2F H;  4LGD E;  2WPV B;  3CWB E;  1SQP J;  3CX5 H;  1VQ8 P;  3UIA A;  3TGU J;  4KHX A;  4YPC A;  3H1H D;  2OGU A;  1OX3 A;  4UB6 E;  1S3J A;  3NMD A;  2KIK A;  3SSU A;  4WWI A;  3A7O A;  1L4A A;  2RKL A;  1ZR4 A;  3AEC C;  1GZL A;  2WT7 B;  3VMZ A;  3Q1M A;  2ZVO B;  3V2N A;  2YO3 A;  3WMM 0;  3SFD C;  1USE A;  1SFC D;  4QMA A;  3E7K A;  4D6T E;  4AQR D;  4PV1 B;  3RL0 C;  2O3J A;  3AEA C;  1MKM A;  4Y99 C;  5DJU B;  4IOI H;  3H1K J;  1SQX D;  1NTK G;  3L4F A;  2WWW A;  1RHZ B;  3A0B H;  1VF5 D;  3HUS C;  2D2C D;  1PIX A;  4L74 A;  1P84 H;  1N7L A;  2AXT H;  3HD7 C;  2ZT9 D;  1JCD A;  1CW5 A;  1LT1 A;  2A45 H;  3FWN A;  1E79 H;  1EZV E;  4YTP C;  1FBM A;  1SQQ E;  1SQP D;  1GL2 D;  2QEX P;  2V7Q H;  1AQT A;  1AV1 A;  3L72 G;  1SQB K;  3NFQ A;  2IBZ D;  3RK3 E;  2N1T D;  2KS1 A;  2K9J A;  2IYP A;  4C7N A;  1ZW0 A;  4O9B A;  2H89 C;  3VYI A;  1KMI Z;  2E75 D;  1N7S D;  4ASW A;  3W67 A;  3RK3 C;  4HB1 A;  1IFP A;  2WSC J;  2QE7 H;  1L0N G;  3CXH I;  5CBO A;  4GT1 A;  1NH4 A;  4XE5 B;  2Y0E A;  2A06 G;  1S1C X;  3IAO A;  3BRV B;  1JCC A;  2IZ0 A;  1FOS F;  2ZXX A;  2I1K A;  1PGQ A;  2QM7 A;  1NAY A;  4YXW H;  1MFT A;  1LJ2 A;  1ZR2 A;  1BDC A;  1EDL A;  3ZDM A;  1LT9 A;  2IZ1 A;  1JY3 N;  1HTL C;  3AE6 C;  2Y9Z A;  1L0L K;  5BVZ A;  1MV8 A;  1EDK A;  3GMA A;  3M06 A;  2G8Y A;  1SQV E;  1FZC A;  1RF1 C; 
#chains in the Genus database with same CATH homology
 2IPP A;  2WZ7 A;  2BAS A;  1RF0 C;  2NPS B;  2NPS D;  3MTU E;  3VP8 A;  3VOP A;  1NWQ A;  1JY2 O;  1NOH A;  1XTC C;  3V4W A;  3M9Q A;  1QL1 A;  1WRG A;  3A3Y B;  3N7N A;  1J1E B;  2WPR A;  1HJB A;  1T8Z A;  2R5B A;  3EFG A;  3A5T A;  5CCG D;  2R3C A;  3BAT A;  4I2L C;  1G1I A;  4DOJ A;  1N73 A;  3LID A;  1CI6 B;  4JYC A;  1H89 A;  5AVT B;  1HGV A;  3OA7 A;  1DH3 A;  3L35 A;  5AVX B;  2YMY A;  4N78 E;  2I1J A;  5AVR B;  2HLO A;  3TNU B;  1IJD B;  2Q5U A;  2JJL A;  1X79 B;  3GHG B;  1T3U A;  5AW3 B;  3U59 A;  1M1J B;  5AW4 B;  2GUS A;  4ZKP A;  3RL0 B;  4WB4 A;  1RF1 B;  3RL0 D;  1IO4 A;  3P8M C;  2P67 A;  2OYH C;  1LTT C;  3P8C E;  1H88 A;  1CSB A;  1N2D C;  1DX7 A;  4Y99 B;  2W6A A;  3O8Z A;  1NKZ B;  1IC2 A;  1JY3 O;  3B8E B;  1GU5 A;  4C7R A;  2WPS A;  2WTY A;  1HVV A;  1VPC A;  5KLV K;  3VP9 A;  4DZO A;  2IFN A;  3TSI A;  2OYI A;  4C7N B;  1KIL A;  2KP8 A;  2LKM A;  5CCH C;  4AUW A;  2HG5 D;  3VTP C;  3BVH A;  1FZE A;  3II6 A;  2HYN A;  1LT9 C;  1URQ A;  3HD7 B;  3M9B A;  3HD7 D;  2O01 H;  2N1T A;  3HTK B;  1GW4 A;  5APT A;  4N6J A;  1X8Y A;  1NTZ K;  1FZC C;  5AW6 B;  5APS A;  5BU5 A;  1FJK A;  2OYH A;  4IFD K;  2POH A;  5AW7 B;  5AVU B;  1EQ7 A;  2PAJ A;  1SQX K;  4EOT A;  1HWT C;  2QM8 A;  1SFC C;  1L4A B;  3HE5 A;  1L4A D;  1JY2 P;  3VMX A;  1AQ5 A;  3R2P A;  2P1J A;  2Z4E A;  2C9L Y;  2R5D A;  5AVV B;  2GUV A;  1G1J A;  1N73 C;  1JTH B;  2PP6 A;  1GW3 A;  4IFF A;  1LT9 B;  2ZFC A;  5CJ4 A;  3M0A A;  3RK3 D;  2WIT A;  1SP4 A;  1YTZ T;  3KYQ A;  2HOD A;  4AYC A;  5AW1 B;  3OJA B;  1NO4 A;  1OWA A;  5KJ7 D;  5APW A;  2P2U A;  1FZC B;  5AW8 B;  1NHL A;  3PP5 A;  3NXS A;  2WT7 A;  2XDJ A;  5CHX A;  1SQP K;  1NTK K;  3P7K A;  3RK2 B;  3RK2 D;  4GKG A;  2J59 M;  2C9N Y;  1KFM A;  2FKW B;  4W7Y A;  1JUN A;  3V4Q A;  1HH0 A;  1KZU B;  1FZG A;  1W2E A;  5KTB A;  2VRS A;  1SFC A;  1ZN5 A;  1JY3 P;  1T2K C;  1T3J A;  2FYZ A;  3BRT B;  1LTA C;  2OYI C;  1G2C A;  1KIL C;  2OAR A;  5AW9 B;  1JO5 A;  2FYU K;  5APX A;  2H43 A;  1RE3 C;  1FDM A;  1JMM A;  3KQG A;  5APQ A;  1NKN A;  4JYB A;  1GL2 C;  2MJZ A;  1MUU A;  1SLQ A;  1PFI A;  1URQ C;  2H8P D;  1A02 J;  2KSJ A;  1IFI A;  2N1T C;  5AW0 B;  4JF7 A;  2W6B A;  3H32 A;  4XA4 A;  4C46 A;  3HE4 A;  1X9V A;  3B5N C;  1N7S C;  3MUD A;  1IFD A;  2FFD A;  1IFM A;  4WY4 C;  1NAF A;  1OXZ A;  5APY A;  2M3B A;  2W27 A;  1LTG C;  1WT6 A;  1FAV A;  2O1J A;  5AVS B;  1LTB C;  2YKP A;  2XNX A;  3P32 A;  1RE4 A;  1RY3 A;  2C0W A;  3MIW A;  3MGN A;  2OYI B;  1LTJ A;  1J1D C;  1KIL B;  4M3L A;  2A45 I;  1SQQ K;  3C9I A;  4GIF A;  4LLH A;  1RE3 A;  5BU8 B;  4N3Y B;  1A02 F;  1HGZ A;  1S9K E;  1GTW A;  1GD2 E;  3SWF A;  1GL2 A;  1YYC A;  2YO2 A;  3TYY A;  1L0N K;  2WPQ A;  2KLV A;  2P7J A;  3N4X A;  4OH8 B;  2M8R A;  1URQ B;  2E42 A;  2IFM A;  5AVZ B;  1LWU C;  2GM4 A;  1XTG B;  2N1T B;  4HYT B;  3SWY A;  1CZQ A;  3HUS A;  1N86 A;  4I6M C;  2HPC B;  2OYH B;  3VN0 A;  3B5N A;  1N7S A;  1YTZ I;  4LGD E;  4WY4 A;  1LGH B;  3L36 A;  4N78 D;  4ZKU A;  4LC1 A;  1IFN A;  3HD7 A;  3HE5 B;  3I5C A;  1HBW A;  2XV5 A;  3UIA A;  4KHX A;  1QL2 A;  2WSF H;  3P8C D;  2NPS C;  2Q3I A;  5CCH D;  3G3Z A;  1FJP A;  2CPS A;  1ZV8 A;  3M9H A;  2YNY A;  3A2A A;  3NMD A;  1LWU A;  1ZLL A;  2HOD B;  3A7O A;  1L4A A;  2XZR A;  3IFM A;  1ZR4 A;  5CCG C;  2R32 A;  1GZL A;  3OAK A;  2WT7 B;  3VMY A;  5CJ0 A;  2FFD C;  2CPB A;  2YKO A;  3VMZ A;  2FXM A;  1LTI C;  2Q9I A;  1SVF A;  3V2N A;  2YO3 A;  3WMM 0;  1SQV K;  3GHG C;  1SFC B;  4IFM A;  1SFC D;  1RE4 C;  3NTN A;  3H6P A;  5APV A;  4AQR D;  1LTJ C;  4HH2 A;  1G2C B;  1VDF A;  3RL0 C;  3KDP B;  1N73 B;  2NPS A;  4B86 A;  3M91 A;  4Y99 C;  2L5G B;  3BAS A;  1LTS C;  3T97 A;  1NTM K;  5AVY B;  3L4F A;  2WWW A;  3KPE A;  3MD0 A;  5CCG A;  2KB7 P;  3H32 B;  3HUS C;  3HE4 B;  1J2J B;  2FFD B;  2XKM A;  1CI6 A;  1HUC A;  1N7L A;  5AVW B;  1M7L A;  2J58 A;  3CLQ A;  3L37 A;  3V2P A;  3HD7 C;  1KQL A;  3TNU A;  1JCD A;  3GHG A;  1CW5 A;  1T2K D;  1M1J A;  2A45 H;  2H7H A;  1NU1 K;  1LTJ B;  4W7Z A;  2ZXE B;  1RF1 A;  1KIL D;  2E43 A;  1GK4 A;  1FBM A;  2KOG A;  1RF0 A;  3TK1 A;  5CMZ A;  1GL2 B;  1GL2 D;  1DEB A;  3HRN A;  3U1C A;  1SQB K;  1URQ D;  3NFQ A;  2Z5H A;  1FZF A;  1JOC A;  2N1T D;  1L4A C;  1H8A A;  3M0D C;  3V2Q A;  1IK9 A;  4C7N A;  3HUS B;  1AFO A;  4O9B A;  3VYI A;  3B5N B;  1N7S B;  3B5N D;  1N7S D;  4WY4 B;  2YKQ A;  4WY4 D;  1IFJ A;  1KFN A;  2KYV A;  3EQ2 A;  2Z5I A;  4WBA A;  1E5W A;  3RK3 C;  1JY2 N;  1GU4 A;  2N9B A;  2WSE H;  3HTK A;  1MFZ A;  2A45 G;  2JEE A;  5KJ7 C;  3E1I A;  1J1D B;  4GT1 A;  2XU6 A;  3CI9 A;  1Z56 A;  2HPC A;  4RES B;  1NH4 A;  4XE5 B;  2C0X A;  2HFE D;  3RK2 C;  1FZB A;  3BRV B;  3CL3 D;  1JCC A;  5AVQ B;  3U1A A;  1MZ9 A;  1LWU B;  1FZA A;  1FOS F;  1J1E C;  3M0D A;  2I1K A;  2WSC H;  4EIJ A;  2QM7 A;  1FOS E;  2Q7C A;  3V5B A;  2O1K A;  1S9K D;  4W80 A;  5CCH A;  5APU A;  1JTH A;  1ZR2 A;  1GDT A;  3LW5 H;  5AW2 B;  1LT9 A;  3LIE A;  4I1L A;  3RK3 B;  1JNM A;  1JY3 N;  1HTL C;  3V2R A;  5AW5 B;  1L0L K;  5BVZ A;  2IX7 C;  1MV8 A;  3IR9 A;  3M06 A;  1M1J C;  1FU1 A;  5KJ7 A;  1GK6 A;  1FZC A;  1RF1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...