2XNXA

Bc1 fragment of streptococcal m1 protein in complex with human fibrinogen
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Streptococcal M1 Protein Constructs a Pathological Host Fibrinogen Network
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
molecule keywords FIBRINOGEN ALPHA CHAIN
total genus 20
structure length 74
sequence length 74
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2010-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2xnxA00
1N73A 2FFDC 1LTJB 1M1JC 2HPCB 1T3UA 3GHGA 1LWUA 1RE3C 1RF0C 1W2EA 1LT9B 2HODB 2OYIA 1M1JA 1FZCB 2OYHC 1M1JB 1JY3P 2A45I 2A45G 2XNXA 1FZCA 2OYHA 1N73B 1FZCC 1LT9A 2HODA 1JY2P 1RF0A 1JY2O 2OYIB 2Q9IA 1RF1B 2OYHB 3HUSA 1FZFA 1N86A 2H43A 2OYIC 3HUSB 1RF1A 3GHGC 1RF1C 3GHGB 1JY2N 3HUSC 2HPCA 1LTJC 2A45H 1FZEA 1JY3O 1N73C 2FFDA 1FZBA 2HLOA 1LWUB 3H32A 2Z4EA 2FFDB 1FZAA 1RE4A 1FZGA 1LWUC 1RE4C 3H32B 3BVHA 1LT9C 1RE3A 3E1IA 1JY3N 1LTJA
chains in the Genus database with same CATH superfamily
4AUWA 1FC2C 2P2UA 1EXIA 1T2KC 3CWBD 1S3JA 1P84E 2AEMA 2JO1A 3FGAD 4W7ZA 3ZDMA 4EI2A 5AVXB 3RK3D 3CCRP 3M9QA 1RE3C 1S4XA 3K5BA 3FXEA 2OYIA 1NTKE 1SQXJ 1NKZB 1NTME 1M1JA 2W83C 3JCUE 2A45I 2WPRA 1NTKJ 1VQ5P 1Q86Q 4R4MA 2ZVOB 1FZCC 3CD6P 1LJ2A 1Y9BA 1BE3G 5APSA 1VQ4P 3L75J 1LTGC 1NTMG 1JNMA 2IBZI 2W90A 4WWIA 5E79E 3E7KA 1L0NJ 4NPEA 3CC7P 4WVZA 1HTLC 1Q2NA 1OW8A 1RHZB 3H1HE 2ZXXA 3M0DC 1FU1A 1LGHB 3L75E 1LTJC 3V4QA 1BSHA 5CCGD 1PGJA 1N73C 2VRSA 1N7LA 3M06A 2OTLP 3S1KA 1NO4A 1KB9E 3H1JG 3BVHA 1T6AA 1SQXE 1BCCE 1RE3A 4U3FD 2WPVB 3L73J 3B8EB 3L72E 1NU1E 3M0DA 3II6A 3A2AA 1VQOP 1L0LJ 1NWQA 2WITA 3RK2B 2JEEA 2HODB 2JR8A 4GKGA 2LR2A 2WSSH 3L72G 3GF7A 1KD1Q 2XV5A 1NTZE 2WMMA 3TDKA 3CC2P 2B88A 4R4LA 3OJAB 1JMMA 3AEEC 2M3BA 1QGKB 1KTMA 1NOHA 3O6QB 1BGYG 4UB8H 1SQQE 1FDIA 1KQGB 3KYQA 3GW6A 4L73A 2A45H 4A7PA 5CCHC 1IK7A 5AW3B 1L0LD 2OGUA 1RE4C 1QL1A 1N8RQ 1JM0A 1SLQA 2I1JA 4N78E 1M1JC 2QJKB 3S4RA 2Y0DA 1HF9A 5KLIC 3RL0C 5AVRB 4OGQC 2LXCB 1LWUA 3CCMP 1D7MA 4LGDE 3ABVC 3SSUA 4KHXA 1JEKA 2HYNA 5KLIB 2XDJA 1PP9G 1YQ3C 3MIWA 2J5UA 1H88A 3IF4A 4ZMDA 1GU4A 1JY2O 3MD0A 3CWBE 3H1JJ 3HUSA 1SQQJ 2OQQA 3B5NA 2AXCA 2KS1A 2QIWA 3TYYA 1J1DC 3JSVC 2WPQA 3PH0A 4PV1D 2BEQD 1IK9A 3RL0g 1K04A 1OVRA 3R2PA 2HLOA 2I1KA 1DEBA 2CPSA 2M5AB 5CBOA 2R5BA 4N6JA 3PJSK 1NTZJ 1RE4A 3EFFK 3AEGC 5KAIE 2NPSC 5L8RJ 4H13D 4YXWH 3CCJP 3CCUP 1H8AA 2C9LY 2E43A 4WY4A 5CCHA 1L0NE 4IFFA 2RKLA 3H1HD 2OTKE 1T8ZA 3L35A 1L4AB 1LTSC 1SQQK 2RMZA 3CI9A 5EFWB 1LP1B 1KILB 1LT9B 3AEBC 1SQPG 2KSJA 3L73E 2IFNA 3R4YA 3H1KD 3VYIA 5KAIH 5KKZB 2L5GB 1JY3P 1LTIC 1SQXD 2P58A 1USDA 3FX0A 1YIJP 1N7SA 4JQ0D 1KYOE 2IYPA 4I2LC 3W68A 1NU1D 4EIJA 2FYUG 2H43A 2Z5IA 1G1IA 3B5NC 1YHQP 4IL6X 4IOIH 3O8ZA 3MZWB 4OWFA 2KOGA 1EQ7A 4Y99B 1PFIA 1WT6A 1BDCA 3Q3DA 2Y0EA 2E74D 1SQPJ 1NTZD 2G8YA 1SQVD 3L70D 4HB1A 4H0LB 3VOPA 2FFDB 3AE1C 1LWUC 1PPJG 4KT0J 2FKWB 4C46A 3SWFA 2XZRA 2Q3IA 4W80A 1CZQA 2OYIC 1N73A 1DD3A 2P67A 3T97A 1SP4A 1AV1A 3BCCE 3L71G 2ZYAA 1G1JA 1R5SA 1H0TB 1ZLLA 1FOSE 1L4AC 2K9YA 1HVVA 2IPPA 1IFJA 2M3EA 2YKOA 1K8AQ 1OFCX 2A06D 4HH2A 2Q7CA 4JPZB 3CPWO 2NPSB 1J1EC 2A45G 3HE5B 1KQFB 3WUTA 2OYHC 1LT1A 2N1TC 3SFEC 2BCCE 4H13B 3TSIA 3TGUD 1FJPA 1S2EA 1FZFA 1W5CE 4C7NB 1KV4A 1KFMA 2BASA 4MN4C 5B66H 3M0AA 3GHGC 5AVYB 1NU1K 1U57A 2V7QJ 4D6TE 3VMXA 1CSBA 1NYHA 3Q2YA 1VF5D 1JY3O 1OWAA 2YO2A 2IBZD 1P84I 1LWUB 2W27A 3S9OA 1T2KD 1FZAA 1HGZA 3ITKA 1RY3A 2ITAA 1GW4A 3H32B 4D6TG 3FWNA 1SFCB 5B66E 1JUNA 3HTKB 3D71A 1CI6A 1S5LX 1OIPA 1WMKA 4WY4B 1S9KE 3AE3C 1L0NK 1KORA 3USSA 3GMAA 1GTWA 3B71A 3O6QA 2Q5UA 4L75A 4TLFA 1Q81Q 2FXOA 5AW8B 1L0LG 1OVUA 3H1IG 1UIXA 2R3CA 1JTHA 3TGUG 1ZMEC 1K73Q 4PJ0H 1JO5A 2AEFA 1GU5A 4U7JA 4UB6H 3L74D 3NXSA 4K35A 2OYIB 2OTJP 1CI6B 1RF0A 2M8RA 3HE5A 4N3YB 2Q9IA 2Z5HA 3H1KJ 1SQBG 1L2PA 2BEZF 1FBMA 1OVVA 2M0BA 2W6JH 2ZT9D 3AE9C 3L4FA 4L76A 4ASVA 1FZCB 2QRXA 2KSEA 1RF1C 5KJ7D 2KNCB 3GHGB 3L73D 1PP9D 3JC22 2HPCA 3H1KE 4BRYB 1FE6A 2V7QH 5KTBA 4UB6E 2ZYGA 1FZEA 5AVWB 3TGUJ 3TNUA 3AE2C 3Q5SA 1BCCD 3V2RA 5KJ7A 2KLUA 1XTGB 2GUVA 1IC2A 4C7NA 4XA4A 3H1KG 1X79B 5CCGC 1BE3J 2FXMA 3CXHI 1K05A 1PGQA 2JJLA 4DT0A 2W6BA 3Q1MA 1ZXGA 1IFIA 1LTBC 1NTKG 1URQC 3VMAA 2WPSA 1KILD 4IL6E 5AVTB 3CX5H 1W2BO 3V2NA 1SQVE 2MKVA 1AVYA 3L70E 5KLVK 4YPCA 3A5TA 1GD2E 2HG5D 1HUCA 4U3FG 3B5ND 5AW5B 1M56D 3AECC 2QM7A 2GUSA 1AJYA 1G2CA 2QJYB 1Z56A 3C9IA 5APUA 1SQQD 5B5EE 4RJTA 4KJMA 5GTHE 1GMJA 2E74B 2QJPC 3G6EP 2BCCG 1FDOA 2N9BA 2ZT9C 1EZVD 2E75D 2OYOA 3CXHE 3N7NA 4H0LD 2WT7A 1X8YA 1ZW0A 1GK4A 2FYNC 2FYUD 3V2PA 2O01H 2NRGA 3UIAA 2O1JA 1MUUA 1FZGA 3AEAC 3GF3A 2QJKC 2FYNB 1A02F 4EDFA 4H44D 3OW2O 3P8MC 2HPCB 2KIKA 3BCCJ 3I5CA 4PD4D 1YBKA 1NTZG 1KMIZ 2N1TD 2ZXEB 1Y8AA 3PP5A 4GODA 3IAOA 3C8VA 3L71J 3AE7C 3MUDC 2OYHA 2KZJA 1KILA 1LT9A 2IYOA 3G9RA 2WWWA 3U1AA 3KZIH 1SQXK 1NVOA 3F89A 3RK2C 1VQ6P 2RH0A 4GDOA 2AXTE 4Z1MH 5BU5A 1SFCD 1J1DB 3VN0A 1MKMA 2I8DA 1KZUB 4ZNCA 1RH5B 1QL2A 1SQBE 1UIIA 2NPSD 3M91A 1KQLA 3P32A 3L74E 1NTMK 4RKUJ 1KB9I 1Q7YQ 1PZQA 1SFCA 2Q3EA 2KS1B 3CX5I 2E75C 2HFED 1VDFA 1VF5C 2KUBA 3RK3B 3AE8C 1GZLA 3L74G 1FAVA 2D2CD 2E76B 3L37A 4H44B 4U3FJ 2IDBA 1PP9E 5APWA 1GL2C 1QX8A 4DZOA 1JTHB 3WU2E 3VTPC 2R5DA 3CX5D 3HD7B 4XE5B 1BE3E 1W2EA 5CCGA 3G71P 2B87B 2SPZA 4WB4A 3C1LA 3EFGA 3RBZA 5CBNA 2O1KA 1NJIQ 1ZRTD 1KC8Q 5DJUB 1BGYJ 4PV1B 1SQVG 3L70G 3RL0B 3SWYA 1DIPA 1FDMA 2IX7C 3B5NB 3BATA 3G4SP 3V6IA 1GL2A 1MV8A 1RF1A 3HE4A 1H89A 5TJHA 2XNDH 3KZIE 4ZKUA 1SQPD 3BASA 1NAYA 2QG4A 1IFPA 3IFMA 2C0XA 1PV3A 3CWBJ 2KB7P 3LIEA 4WY4C 5AVVB 2QJYC 1SFCC 2K9JB 2M5AA 3HTKA 1AVOA 1YTZI 2E75B 4IFMA 2Z4EA 3CMEP 1HBWA 2E74C 2QJPB 2YIUB 3BCCD 1L4AD 1NHLA 5AW1B 3NMDA 5CCHD 3IR9A 5TISH 5AW4B 1YI2P 2WSCJ 3L73G 2E76C 2MJZA 4K3AA 4HKZH 5AVQB 2JDIH 1EZVE 2GA1A 4PD4H 4ZKPA 5AVZB 1NH4A 2JWAA 1EDJA 2FY8A 1BCCG 1P84H 2K9JA 3HD7A 3MTUE 2LKMA 4XFJA 1AQ5A 1EDIA 1PPJD 2BCCD 3SWKA 1CW5A 1R8EA 1G2CB 1FZCA 1EZVI 2N1TB 2B87A 3IN6A 1N7SB 3T97B 2E42A 1J1EB 2OYHB 1T3JA 3H6PA 2FXPA 4C7RA 4D6TJ 3CCEP 1YYCA 2KK7A 4JF7A 3SFDC 4D6TD 1A02J 1YTZT 3CXHH 1VQMP 4I6MC 2PRRA 3H1LE 3U59A 1IZNB 2IBZE 3AE4C 1VQLP 1M8OB 3W67A 4WBAA 3KPEA 1NKNA 3TK1A 2B9BA 2XKMA 3FXDA 1S9KD 1ZR2A 1QLED 1HWTC 2WVRA 2FFDC 2L91A 1EC5A 1ZP0C 3L74J 1BSNA 1M7LA 1X9VA 2ZT9B 3KXDA 5CJ4A 1SQBD 4EOTA 3GHGA 2B89A 1LP1A 3A3YB 3HRNA 2YXRB 5CHXA 1EDLA 3LW5J 3P8CE 4AYCA 4GIFA 4B86A 1S1CX 4RO0A 1M1JB 3G3ZA 3PRJA 2QA4P 1OX3A 4L74A 1FOSF 3I56P 1LNQA 2IZ0A 3MHVA 4RESB 3AE6C 5KAFE 2ZVNB 3M9HA 2H8PD 2R32A 4QMAA 2WSEJ 3F5HA 3V5BA 3D70A 2O01N 2KXPB 3CWBG 2GM4A 2O01J 2KNCA 1ZRTE 5K5GB 2FFDA 1L0NG 3PTZA 5KJ7C 2QM8A 5KLVD 2YNYA 3KQGA 2FBWC 1GL2D 5KAFH 1ZR4A 3L75G 1KILC 1LT9C 4OGQD 4GOFA 1KILE 3E1IA 2R3SA 1LTJA 3VP9A 1JOCA 2P7JA 2KZIA 2WSEH 4W7YA 1ZV8A 4BRYA 5AVSB 3P7KA 4M3LA 2AEJA 1R5LA 5BVZA 3H1JE 2G3AA 3H1LJ 5C39A 2JKVA 3WUUA 1P84D 1NAFA 3NTNA 4OVNF 4JYCA 1DD4A 3VMYA 2WT7B 3RK3E 1KYOI 1KQSO 1QVFO 4EYYQ 1EZVG 2XNXA 3M9BA 2K1AA 4I7ZC 1YJNP 3WUVA 1J2JB 1HJ0A 1NTKD 2ZAEB 4OH8B 5APTA 1RF1B 4NPDA 3CC4P 2FYUJ 1SS1A 4WY4D 3HUSB 3MGNA 3CXHD 4I1LA 2H89C 1M1KQ 1HH0A 3AEDC 4CPGA 1S72P 3HUSC 2J59M 3OA7A 2RN0A 4HYTB 1TU3F 2FYUE 2XU6A 3V2QA 3OAKA 1NTKK 1U7JA 3FWLA 1LTTC 4JBZA 3H32A 5TISE 1AA0A 3H1LG 1K9MQ 1SQQG 4O9BA 4Y99C 2AXTH 3CCQP 4PD4E 1YJ9P 3GLMA 1IO4A 1SQPK 5DJTB 1JCCA 1FS0E 1SVFA 1KB9D 2Y9ZA 1T3UA 3Q5RA 4BWNA 4U3FE 1M90Q 5E79H 4HJGH 1OMIA 1X22A 2E5TA 1URQB 4NPFX 5AW0B 3RGUA 2PAJA 2K37A 1KFNA 1GK6A 5APYA 2POHA 3BCCG 3L71E 2CK3H 4I7ZB 3CMAP 1X0TA 3VP8A 2PFXA 3VMZA 1HJBA 1L0LK 1M57D 3B4SA 2QEXP 5GTIE 1SQBJ 2FYZA 3WU2H 2QVAA 1KYOH 3WMM0 5APQA 1WRGA 3QH9A 1JY2N 1BDDA 1PIXA 2E5YA 1OW7A 2KYVA 2YMYA 1PP9J 1SQBK 4PD4I 1MZ9A 1PGPA 3H1IJ 2YIUC 1VQKP 2QSIA 1N2DC 3PLNA 5H2FE 1NTZK 2YMKA 3MUDA 2N9YB 1LTAC 3D6YA 3A7OA 3AE5C 4IL6H 5CJ0A 1BGYD 2K88A 1LTJB 2UWJE 1OXZA 2IFMA 2P10A 3CX5E 1BE3D 3GG2A 3HE4B 3BRVB 3MP7B 4OGQB 1YJWP 3L72J 2V4HA 3A0BE 4N78D 1VPCA 1ZN5A 5AW7B 4DOJA 1QVGO 3RBXA 1BCCJ 1IFMA 3N4XA 4IFDK 1AQTA 1JB0J 5H2FH 1IJDB 1JCDA 1NGMB 2QE7H 1VQ9P 1N73B 2HODA 3LIDA 1VL2A 1ZOYC 3JCUH 1DH3A 5KLVG 3H1IE 4PV1C 1SQPE 4H0LC 3H1JD 1URQA 3H25A 3KHUA 1QEXA 3CCLP 2C0WA 2NPSA 3CL3D 4YTPC 2FYUK 5APXA 5AW6B 2ZFCA 1FZBA 4Y28J 1DEEG 4AQRD 2ZYDA 2WSFJ 4H44C 2D2CB 1NTMJ 2E76D 1HGVA 1NTMD 2LXBA 2PP6A 2Q6QA 2WTYA 4GT1A 5KLVJ 5BU8B 1SQVJ 2HR3A 3L70J 3HD7C 2Y0CA 2WZ7A 1KB9H 1E5WA 2W8ZA 1PPJE 4H13C 1L0ND 1S5LE 1RF0C 1Y47A 2JWDA 3A0HH 1USEA 3D6ZA 2JP3A 4DCKA 2K3RA 2NZ2A 2Q1KA 2R44A 3EQ2A 3L75D 3RK2D 2KI7B 2WSCH 1JY2P 1IFDA 3H1HG 4PJ0E 3TGUE 1VQ8P 2C9NY 2YO3A 3EWKA 1N7SD 1N86A 3H1LD 4DJGA 1OW6A 2H7HA 5AVUB 2OARA 1KYOD 3A0HE 1GW3A 1YQ4C 3E1RA 1XTCC 1S5LH 2H88C 3L72D 1YITP 2N1TA 3L71D 1Q82Q 1SQXG 3V4WA 4UB8E 3CCSP 2D2CC 2IZ1A 3CCVP 1URQD 3TNUB 1NU1G 3I55P 2KP8A 2WSFH 1L4AA 1U7MA 1E79H 2ZJSE 3NFQA 1RQUA 3RL0D 3Q5PA 1JY3N 3U1CA 2W6AA 1IFNA 3RK3C 3P8CD 1GDTA 1EDKA 3KDPB 2P1JA 1AFOA 1Q90D 3TF5A 3HD7D 2PGDA 1OZHA 1DX7A 3CLQA 1FJKA 2YKPA 2YXQB 3AEFC 5AW9B 2KLVA 1JMBA 1RQVA 2CPBA 5AW2B 4YXDC 1BGYE 4LC1A 2A06E 4TT3H 5GTIH 1L0LE 2DW3A 2IBZG 1GL2B 1NU1J 4JYBA 3LW5H 1PL5A 5KKZC 1VQPP 1VF5B 3QWOC 1KN7A 2A06G 1H0TA 1PGOA 2YKQA 1N7SC 1SQVK 1MFZA 3L36A 4ASWA 5GTHH 2O3JA 5B5EH 5KLVE 2BCCJ 3PHLA 1EXJA 5CMZA 3BRTB 5APVA 2WQYC 2J58A 3H1ID 4BXLA 1MFTA 1VQ7P 2Y9YA 4GOEA 5M1BA 4LLHA 1VQNP 3H1HJ 3A0BH
chains in the Genus database with same CATH topology
4AUWA 2P2UA 1T2KC 4W7ZA 5AVXB 3RK3D 3M9QA 1RE3C 2OYIA 1NKZB 1M1JA 2A45I 2WPRA 1FZCC 5APSA 1LTGC 1HTLC 3M0DC 3V4QA 1FU1A 1LGHB 1LTJC 5CCGD 1N73C 2VRSA 1N7LA 3M06A 1NO4A 3BVHA 1RE3A 3B8EB 3M0DA 3II6A 3A2AA 1NWQA 2WITA 3RK2B 2JEEA 2HODB 4GKGA 2XV5A 3OJAB 1JMMA 2M3BA 1NOHA 3KYQA 2A45H 5CCHC 5AW3B 1RE4C 1QL1A 1SLQA 2I1JA 4N78E 1M1JC 3RL0C 5AVRB 1LWUA 4LGDE 4KHXA 2HYNA 2XDJA 3MIWA 1H88A 1GU4A 1JY2O 3MD0A 3HUSA 3B5NA 3TYYA 1J1DC 2WPQA 1IK9A 3R2PA 2HLOA 2I1KA 1DEBA 2CPSA 2R5BA 4N6JA 1RE4A 2NPSC 2C9LY 1H8AA 2E43A 4WY4A 5CCHA 4IFFA 3L35A 1T8ZA 1L4AB 1LTSC 1SQQK 3CI9A 1KILB 1LT9B 3VYIA 2KSJA 2IFNA 1JNMA 2L5GB 1JY3P 1LTIC 1N7SA 4I2LC 2H43A 4EIJA 2Z5IA 1G1IA 3B5NC 3O8ZA 2KOGA 1EQ7A 4Y99B 1PFIA 1WT6A 3VOPA 2FFDB 1LWUC 2FKWB 4C46A 3SWFA 2XZRA 2Q3IA 4W80A 1CZQA 2OYIC 1N73A 3T97A 2P67A 1SP4A 1G1JA 1ZLLA 1FOSE 1L4AC 1HVVA 2IPPA 1IFJA 2YKOA 4HH2A 2Q7CA 2NPSB 1J1EC 2A45G 3HE5B 2OYHC 2N1TC 3TSIA 1FJPA 1FZFA 4C7NB 1KFMA 2BASA 3M0AA 3GHGC 5AVYB 1NU1K 3VMXA 1CSBA 1JY3O 1OWAA 2YO2A 1LWUB 2W27A 1T2KD 1FZAA 1HGZA 1RY3A 1GW4A 3H32B 1SFCB 3HTKB 1CI6A 4WY4B 1S9KE 1L0NK 1GTWA 2Q5UA 5AW8B 2R3CA 1JO5A 1JTHA 1GU5A 3NXSA 2OYIB 1CI6B 1RF0A 2M8RA 3HE5A 4N3YB 2Q9IA 2Z5HA 1FBMA 3L4FA 1RF1C 5KJ7D 3GHGB 2HPCA 5KTBA 1FZEA 5AVWB 3TNUA 3V2RA 5KJ7A 1XTGB 2GUVA 1IC2A 4C7NA 4XA4A 1X79B 5CCGC 2FXMA 2JJLA 2W6BA 1IFIA 1LTBC 1URQC 2WPSA 1KILD 5AVTB 3V2NA 5KLVK 3A5TA 1GD2E 2HG5D 1HUCA 3B5ND 5AW5B 2QM7A 2GUSA 1G2CA 5APUA 1Z56A 3C9IA 2N9BA 3N7NA 2WT7A 1X8YA 1GK4A 3V2PA 2O01H 3UIAA 2O1JA 1MUUA 1FZGA 1A02F 3P8MC 2HPCB 3I5CA 2N1TD 2ZXEB 3PP5A 2OYHA 1LT9A 1KILA 3U1AA 2WWWA 1SQXK 3RK2C 5BU5A 1SFCD 1J1DB 3VN0A 1KZUB 3M91A 1QL2A 3P32A 2NPSD 1KQLA 1NTMK 1SFCA 2HFED 1VDFA 3RK3B 1GZLA 1FAVA 3L37A 5APWA 1GL2C 4DZOA 1JTHB 3VTPC 2R5DA 3HD7B 4XE5B 1W2EA 5CCGA 4WB4A 3EFGA 2O1KA 3RL0B 3SWYA 1FDMA 2IX7C 3B5NB 3BATA 1GL2A 1MV8A 1RF1A 3HE4A 1H89A 4ZKUA 3BASA 3IFMA 5CJ4A 2C0XA 3LIEA 2KB7P 4WY4C 5AVVB 1SFCC 3HTKA 1YTZI 4IFMA 2Z4EA 1HBWA 1FOSF 5AW1B 1L4AD 1NHLA 5CCHD 3NMDA 3IR9A 5AW4B 2MJZA 5AVQB 4ZKPA 5AVZB 1NH4A 3MTUE 3HD7A 1AQ5A 2LKMA 1G2CB 1FZCA 2N1TB 2E42A 1N7SB 1J1EB 2OYHB 1T3JA 3H6PA 4C7RA 1YYCA 4JF7A 1A02J 1YTZT 4I6MC 3U59A 4WBAA 3KPEA 1NKNA 3TK1A 2XKMA 1S9KD 1ZR2A 1HWTC 2FFDC 1X9VA 1M7LA 4EOTA 3GHGA 5CHXA 3A3YB 3HRNA 3P8CE 4AYCA 4GIFA 4B86A 1M1JB 3G3ZA 4RESB 3M9HA 2H8PD 2R32A 3V5BA 2GM4A 2FFDA 5KJ7C 2QM8A 2YNYA 3KQGA 1GL2D 1ZR4A 1LT9C 1KILC 3E1IA 3VP9A 1LTJA 1JOCA 2P7JA 2WSEH 4W7YA 1ZV8A 5AVSB 3P7KA 4M3LA 5BVZA 1NAFA 3NTNA 3VMYA 4JYCA 2WT7B 3M9BA 2XNXA 1J2JB 4OH8B 5APTA 1RF1B 4WY4D 3HUSB 3MGNA 4I1LA 1HH0A 3HUSC 3OA7A 2J59M 4HYTB 2XU6A 3V2QA 3OAKA 1NTKK 1LTTC 3H32A 4O9BA 4Y99C 1IO4A 1SQPK 1JCCA 1SVFA 1T3UA 5AW0B 1URQB 2PAJA 1KFNA 1GK6A 5APYA 2POHA 3VP8A 3VMZA 1L0LK 2FYZA 3WMM0 5APQA 1WRGA 1JY2N 2YMYA 2KYVA 1SQBK 1MZ9A 1N2DC 1NTZK 3MUDA 1LTAC 3A7OA 1DH3A 1LTJB 5CJ0A 1OXZA 2IFMA 3HE4B 3BRVB 1JUNA 1HJBA 4N78D 5AW7B 1VPCA 1ZN5A 4DOJA 4IFDK 1IFMA 3N4XA 1IJDB 1JCDA 1N73B 2HODA 3LIDA 1URQA 2C0WA 2NPSA 3CL3D 2FYUK 5APXA 5AW6B 2ZFCA 1FZBA 4AQRD 1HGVA 2PP6A 2WTYA 4GT1A 5BU8B 3HD7C 2WZ7A 1E5WA 1RF0C 3EQ2A 3RK2D 2WSCH 1JY2P 1IFDA 2C9NY 2H7HA 2YO3A 1N7SD 1N86A 5AVUB 2OARA 1GW3A 1XTCC 2N1TA 3V4WA 1URQD 3TNUB 2KP8A 2WSFH 1L4AA 3RL0D 3NFQA 1JY3N 3U1CA 2W6AA 1IFNA 3P8CD 1GDTA 3KDPB 2P1JA 1AFOA 3HD7D 1DX7A 3CLQA 1FJKA 2YKPA 5AW9B 3RK3C 1FZCB 2KLVA 1CW5A 2CPBA 5AW2B 4LC1A 1GL2B 4JYBA 3LW5H 2YKQA 1N7SC 3L36A 1MFZA 1SQVK 5CMZA 3BRTB 5APVA 2J58A 4LLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N73 A;  2FFD C;  1LTJ B;  1M1J C;  2HPC B;  1T3U A;  3GHG A;  1LWU A;  1RE3 C;  1RF0 C;  1W2E A;  1LT9 B;  2HOD B;  2OYI A;  1M1J A;  1FZC B;  2OYH C;  1M1J B;  1JY3 P;  2A45 I;  2A45 G;  2XNX A;  1FZC A;  2OYH A;  1N73 B;  1FZC C;  1LT9 A;  2HOD A;  1JY2 P;  1RF0 A;  1JY2 O;  2OYI B;  2Q9I A;  1RF1 B;  2OYH B;  3HUS A;  1FZF A;  1N86 A;  2H43 A;  2OYI C;  3HUS B;  1RF1 A;  3GHG C;  1RF1 C;  3GHG B;  1JY2 N;  3HUS C;  2HPC A;  1LTJ C;  2A45 H;  1FZE A;  1JY3 O;  1N73 C;  2FFD A;  1FZB A;  2HLO A;  1LWU B;  3H32 A;  2Z4E A;  2FFD B;  1FZA A;  1RE4 A;  1FZG A;  1LWU C;  1RE4 C;  3H32 B;  3BVH A;  1LT9 C;  1RE3 A;  3E1I A;  1JY3 N;  1LTJ A; 
#chains in the Genus database with same CATH topology
 4AUW A;  1FC2 C;  2P2U A;  1EXI A;  1T2K C;  3CWB D;  1S3J A;  1P84 E;  2AEM A;  2JO1 A;  3FGA D;  4W7Z A;  3ZDM A;  4EI2 A;  5AVX B;  3RK3 D;  3CCR P;  3M9Q A;  1RE3 C;  1S4X A;  3K5B A;  3FXE A;  2OYI A;  1NTK E;  1SQX J;  1NKZ B;  1NTM E;  1M1J A;  2W83 C;  3JCU E;  2A45 I;  2WPR A;  1NTK J;  1VQ5 P;  1Q86 Q;  4R4M A;  2ZVO B;  1FZC C;  3CD6 P;  1LJ2 A;  1Y9B A;  1BE3 G;  5APS A;  1VQ4 P;  3L75 J;  1LTG C;  1NTM G;  1JNM A;  2IBZ I;  2W90 A;  4WWI A;  5E79 E;  3E7K A;  1L0N J;  4NPE A;  3CC7 P;  4WVZ A;  1HTL C;  1Q2N A;  1OW8 A;  1RHZ B;  3H1H E;  2ZXX A;  3M0D C;  1FU1 A;  1LGH B;  3L75 E;  1LTJ C;  3V4Q A;  1BSH A;  5CCG D;  1PGJ A;  1N73 C;  2VRS A;  1N7L A;  3M06 A;  2OTL P;  3S1K A;  1NO4 A;  1KB9 E;  3H1J G;  3BVH A;  1T6A A;  1SQX E;  1BCC E;  1RE3 A;  4U3F D;  2WPV B;  3L73 J;  3B8E B;  3L72 E;  1NU1 E;  3M0D A;  3II6 A;  3A2A A;  1VQO P;  1L0L J;  1NWQ A;  2WIT A;  3RK2 B;  2JEE A;  2HOD B;  2JR8 A;  4GKG A;  2LR2 A;  2WSS H;  3L72 G;  3GF7 A;  1KD1 Q;  2XV5 A;  1NTZ E;  2WMM A;  3TDK A;  3CC2 P;  2B88 A;  4R4L A;  3OJA B;  1JMM A;  3AEE C;  2M3B A;  1QGK B;  1KTM A;  1NOH A;  3O6Q B;  1BGY G;  4UB8 H;  1SQQ E;  1FDI A;  1KQG B;  3KYQ A;  3GW6 A;  4L73 A;  2A45 H;  4A7P A;  5CCH C;  1IK7 A;  5AW3 B;  1L0L D;  2OGU A;  1RE4 C;  1QL1 A;  1N8R Q;  1JM0 A;  1SLQ A;  2I1J A;  4N78 E;  1M1J C;  2QJK B;  3S4R A;  2Y0D A;  1HF9 A;  5KLI C;  3RL0 C;  5AVR B;  4OGQ C;  2LXC B;  1LWU A;  3CCM P;  1D7M A;  4LGD E;  3ABV C;  3SSU A;  4KHX A;  1JEK A;  2HYN A;  5KLI B;  2XDJ A;  1PP9 G;  1YQ3 C;  3MIW A;  2J5U A;  1H88 A;  3IF4 A;  4ZMD A;  1GU4 A;  1JY2 O;  3MD0 A;  3CWB E;  3H1J J;  3HUS A;  1SQQ J;  2OQQ A;  3B5N A;  2AXC A;  2KS1 A;  2QIW A;  3TYY A;  1J1D C;  3JSV C;  2WPQ A;  3PH0 A;  4PV1 D;  2BEQ D;  1IK9 A;  3RL0 g;  1K04 A;  1OVR A;  3R2P A;  2HLO A;  2I1K A;  1DEB A;  2CPS A;  2M5A B;  5CBO A;  2R5B A;  4N6J A;  3PJS K;  1NTZ J;  1RE4 A;  3EFF K;  3AEG C;  5KAI E;  2NPS C;  5L8R J;  4H13 D;  4YXW H;  3CCJ P;  3CCU P;  1H8A A;  2C9L Y;  2E43 A;  4WY4 A;  5CCH A;  1L0N E;  4IFF A;  2RKL A;  3H1H D;  2OTK E;  1T8Z A;  3L35 A;  1L4A B;  1LTS C;  1SQQ K;  2RMZ A;  3CI9 A;  5EFW B;  1LP1 B;  1KIL B;  1LT9 B;  3AEB C;  1SQP G;  2KSJ A;  3L73 E;  2IFN A;  3R4Y A;  3H1K D;  3VYI A;  5KAI H;  5KKZ B;  2L5G B;  1JY3 P;  1LTI C;  1SQX D;  2P58 A;  1USD A;  3FX0 A;  1YIJ P;  1N7S A;  4JQ0 D;  1KYO E;  2IYP A;  4I2L C;  3W68 A;  1NU1 D;  4EIJ A;  2FYU G;  2H43 A;  2Z5I A;  1G1I A;  3B5N C;  1YHQ P;  4IL6 X;  4IOI H;  3O8Z A;  3MZW B;  4OWF A;  2KOG A;  1EQ7 A;  4Y99 B;  1PFI A;  1WT6 A;  1BDC A;  3Q3D A;  2Y0E A;  2E74 D;  1SQP J;  1NTZ D;  2G8Y A;  1SQV D;  3L70 D;  4HB1 A;  4H0L B;  3VOP A;  2FFD B;  3AE1 C;  1LWU C;  1PPJ G;  4KT0 J;  2FKW B;  4C46 A;  3SWF A;  2XZR A;  2Q3I A;  4W80 A;  1CZQ A;  2OYI C;  1N73 A;  1DD3 A;  2P67 A;  3T97 A;  1SP4 A;  1AV1 A;  3BCC E;  3L71 G;  2ZYA A;  1G1J A;  1R5S A;  1H0T B;  1ZLL A;  1FOS E;  1L4A C;  2K9Y A;  1HVV A;  2IPP A;  1IFJ A;  2M3E A;  2YKO A;  1K8A Q;  1OFC X;  2A06 D;  4HH2 A;  2Q7C A;  4JPZ B;  3CPW O;  2NPS B;  1J1E C;  2A45 G;  3HE5 B;  1KQF B;  3WUT A;  2OYH C;  1LT1 A;  2N1T C;  3SFE C;  2BCC E;  4H13 B;  3TSI A;  3TGU D;  1FJP A;  1S2E A;  1FZF A;  1W5C E;  4C7N B;  1KV4 A;  1KFM A;  2BAS A;  4MN4 C;  5B66 H;  3M0A A;  3GHG C;  5AVY B;  1NU1 K;  1U57 A;  2V7Q J;  4D6T E;  3VMX A;  1CSB A;  1NYH A;  3Q2Y A;  1VF5 D;  1JY3 O;  1OWA A;  2YO2 A;  2IBZ D;  1P84 I;  1LWU B;  2W27 A;  3S9O A;  1T2K D;  1FZA A;  1HGZ A;  3ITK A;  1RY3 A;  2ITA A;  1GW4 A;  3H32 B;  4D6T G;  3FWN A;  1SFC B;  5B66 E;  1JUN A;  3HTK B;  3D71 A;  1CI6 A;  1S5L X;  1OIP A;  1WMK A;  4WY4 B;  1S9K E;  3AE3 C;  1L0N K;  1KOR A;  3USS A;  3GMA A;  1GTW A;  3B71 A;  3O6Q A;  2Q5U A;  4L75 A;  4TLF A;  1Q81 Q;  2FXO A;  5AW8 B;  1L0L G;  1OVU A;  3H1I G;  1UIX A;  2R3C A;  1JTH A;  3TGU G;  1ZME C;  1K73 Q;  4PJ0 H;  1JO5 A;  2AEF A;  1GU5 A;  4U7J A;  4UB6 H;  3L74 D;  3NXS A;  4K35 A;  2OYI B;  2OTJ P;  1CI6 B;  1RF0 A;  2M8R A;  3HE5 A;  4N3Y B;  2Q9I A;  2Z5H A;  3H1K J;  1SQB G;  1L2P A;  2BEZ F;  1FBM A;  1OVV A;  2M0B A;  2W6J H;  2ZT9 D;  3AE9 C;  3L4F A;  4L76 A;  4ASV A;  1FZC B;  2QRX A;  2KSE A;  1RF1 C;  5KJ7 D;  2KNC B;  3GHG B;  3L73 D;  1PP9 D;  3JC2 2;  2HPC A;  3H1K E;  4BRY B;  1FE6 A;  2V7Q H;  5KTB A;  4UB6 E;  2ZYG A;  1FZE A;  5AVW B;  3TGU J;  3TNU A;  3AE2 C;  3Q5S A;  1BCC D;  3V2R A;  5KJ7 A;  2KLU A;  1XTG B;  2GUV A;  1IC2 A;  4C7N A;  4XA4 A;  3H1K G;  1X79 B;  5CCG C;  1BE3 J;  2FXM A;  3CXH I;  1K05 A;  1PGQ A;  2JJL A;  4DT0 A;  2W6B A;  3Q1M A;  1ZXG A;  1IFI A;  1LTB C;  1NTK G;  1URQ C;  3VMA A;  2WPS A;  1KIL D;  4IL6 E;  5AVT B;  3CX5 H;  1W2B O;  3V2N A;  1SQV E;  2MKV A;  1AVY A;  3L70 E;  5KLV K;  4YPC A;  3A5T A;  1GD2 E;  2HG5 D;  1HUC A;  4U3F G;  3B5N D;  5AW5 B;  1M56 D;  3AEC C;  2QM7 A;  2GUS A;  1AJY A;  1G2C A;  2QJY B;  1Z56 A;  3C9I A;  5APU A;  1SQQ D;  5B5E E;  4RJT A;  4KJM A;  5GTH E;  1GMJ A;  2E74 B;  2QJP C;  3G6E P;  2BCC G;  1FDO A;  2N9B A;  2ZT9 C;  1EZV D;  2E75 D;  2OYO A;  3CXH E;  3N7N A;  4H0L D;  2WT7 A;  1X8Y A;  1ZW0 A;  1GK4 A;  2FYN C;  2FYU D;  3V2P A;  2O01 H;  2NRG A;  3UIA A;  2O1J A;  1MUU A;  1FZG A;  3AEA C;  3GF3 A;  2QJK C;  2FYN B;  1A02 F;  4EDF A;  4H44 D;  3OW2 O;  3P8M C;  2HPC B;  2KIK A;  3BCC J;  3I5C A;  4PD4 D;  1YBK A;  1NTZ G;  1KMI Z;  2N1T D;  2ZXE B;  1Y8A A;  3PP5 A;  4GOD A;  3IAO A;  3C8V A;  3L71 J;  3AE7 C;  3MUD C;  2OYH A;  2KZJ A;  1KIL A;  1LT9 A;  2IYO A;  3G9R A;  2WWW A;  3U1A A;  3KZI H;  1SQX K;  1NVO A;  3F89 A;  3RK2 C;  1VQ6 P;  2RH0 A;  4GDO A;  2AXT E;  4Z1M H;  5BU5 A;  1SFC D;  1J1D B;  3VN0 A;  1MKM A;  2I8D A;  1KZU B;  4ZNC A;  1RH5 B;  1QL2 A;  1SQB E;  1UII A;  2NPS D;  3M91 A;  1KQL A;  3P32 A;  3L74 E;  1NTM K;  4RKU J;  1KB9 I;  1Q7Y Q;  1PZQ A;  1SFC A;  2Q3E A;  2KS1 B;  3CX5 I;  2E75 C;  2HFE D;  1VDF A;  1VF5 C;  2KUB A;  3RK3 B;  3AE8 C;  1GZL A;  3L74 G;  1FAV A;  2D2C D;  2E76 B;  3L37 A;  4H44 B;  4U3F J;  2IDB A;  1PP9 E;  5APW A;  1GL2 C;  1QX8 A;  4DZO A;  1JTH B;  3WU2 E;  3VTP C;  2R5D A;  3CX5 D;  3HD7 B;  4XE5 B;  1BE3 E;  1W2E A;  5CCG A;  3G71 P;  2B87 B;  2SPZ A;  4WB4 A;  3C1L A;  3EFG A;  3RBZ A;  5CBN A;  2O1K A;  1NJI Q;  1ZRT D;  1KC8 Q;  5DJU B;  1BGY J;  4PV1 B;  1SQV G;  3L70 G;  3RL0 B;  3SWY A;  1DIP A;  1FDM A;  2IX7 C;  3B5N B;  3BAT A;  3G4S P;  3V6I A;  1GL2 A;  1MV8 A;  1RF1 A;  3HE4 A;  1H89 A;  5TJH A;  2XND H;  3KZI E;  4ZKU A;  1SQP D;  3BAS A;  1NAY A;  2QG4 A;  1IFP A;  3IFM A;  2C0X A;  1PV3 A;  3CWB J;  2KB7 P;  3LIE A;  4WY4 C;  5AVV B;  2QJY C;  1SFC C;  2K9J B;  2M5A A;  3HTK A;  1AVO A;  1YTZ I;  2E75 B;  4IFM A;  2Z4E A;  3CME P;  1HBW A;  2E74 C;  2QJP B;  2YIU B;  3BCC D;  1L4A D;  1NHL A;  5AW1 B;  3NMD A;  5CCH D;  3IR9 A;  5TIS H;  5AW4 B;  1YI2 P;  2WSC J;  3L73 G;  2E76 C;  2MJZ A;  4K3A A;  4HKZ H;  5AVQ B;  2JDI H;  1EZV E;  2GA1 A;  4PD4 H;  4ZKP A;  5AVZ B;  1NH4 A;  2JWA A;  1EDJ A;  2FY8 A;  1BCC G;  1P84 H;  2K9J A;  3HD7 A;  3MTU E;  2LKM A;  4XFJ A;  1AQ5 A;  1EDI A;  1PPJ D;  2BCC D;  3SWK A;  1CW5 A;  1R8E A;  1G2C B;  1FZC A;  1EZV I;  2N1T B;  2B87 A;  3IN6 A;  1N7S B;  3T97 B;  2E42 A;  1J1E B;  2OYH B;  1T3J A;  3H6P A;  2FXP A;  4C7R A;  4D6T J;  3CCE P;  1YYC A;  2KK7 A;  4JF7 A;  3SFD C;  4D6T D;  1A02 J;  1YTZ T;  3CXH H;  1VQM P;  4I6M C;  2PRR A;  3H1L E;  3U59 A;  1IZN B;  2IBZ E;  3AE4 C;  1VQL P;  1M8O B;  3W67 A;  4WBA A;  3KPE A;  1NKN A;  3TK1 A;  2B9B A;  2XKM A;  3FXD A;  1S9K D;  1ZR2 A;  1QLE D;  1HWT C;  2WVR A;  2FFD C;  2L91 A;  1EC5 A;  1ZP0 C;  3L74 J;  1BSN A;  1M7L A;  1X9V A;  2ZT9 B;  3KXD A;  5CJ4 A;  1SQB D;  4EOT A;  3GHG A;  2B89 A;  1LP1 A;  3A3Y B;  3HRN A;  2YXR B;  5CHX A;  1EDL A;  3LW5 J;  3P8C E;  4AYC A;  4GIF A;  4B86 A;  1S1C X;  4RO0 A;  1M1J B;  3G3Z A;  3PRJ A;  2QA4 P;  1OX3 A;  4L74 A;  1FOS F;  3I56 P;  1LNQ A;  2IZ0 A;  3MHV A;  4RES B;  3AE6 C;  5KAF E;  2ZVN B;  3M9H A;  2H8P D;  2R32 A;  4QMA A;  2WSE J;  3F5H A;  3V5B A;  3D70 A;  2O01 N;  2KXP B;  3CWB G;  2GM4 A;  2O01 J;  2KNC A;  1ZRT E;  5K5G B;  2FFD A;  1L0N G;  3PTZ A;  5KJ7 C;  2QM8 A;  5KLV D;  2YNY A;  3KQG A;  2FBW C;  1GL2 D;  5KAF H;  1ZR4 A;  3L75 G;  1KIL C;  1LT9 C;  4OGQ D;  4GOF A;  1KIL E;  3E1I A;  2R3S A;  1LTJ A;  3VP9 A;  1JOC A;  2P7J A;  2KZI A;  2WSE H;  4W7Y A;  1ZV8 A;  4BRY A;  5AVS B;  3P7K A;  4M3L A;  2AEJ A;  1R5L A;  5BVZ A;  3H1J E;  2G3A A;  3H1L J;  5C39 A;  2JKV A;  3WUU A;  1P84 D;  1NAF A;  3NTN A;  4OVN F;  4JYC A;  1DD4 A;  3VMY A;  2WT7 B;  3RK3 E;  1KYO I;  1KQS O;  1QVF O;  4EYY Q;  1EZV G;  2XNX A;  3M9B A;  2K1A A;  4I7Z C;  1YJN P;  3WUV A;  1J2J B;  1HJ0 A;  1NTK D;  2ZAE B;  4OH8 B;  5APT A;  1RF1 B;  4NPD A;  3CC4 P;  2FYU J;  1SS1 A;  4WY4 D;  3HUS B;  3MGN A;  3CXH D;  4I1L A;  2H89 C;  1M1K Q;  1HH0 A;  3AED C;  4CPG A;  1S72 P;  3HUS C;  2J59 M;  3OA7 A;  2RN0 A;  4HYT B;  1TU3 F;  2FYU E;  2XU6 A;  3V2Q A;  3OAK A;  1NTK K;  1U7J A;  3FWL A;  1LTT C;  4JBZ A;  3H32 A;  5TIS E;  1AA0 A;  3H1L G;  1K9M Q;  1SQQ G;  4O9B A;  4Y99 C;  2AXT H;  3CCQ P;  4PD4 E;  1YJ9 P;  3GLM A;  1IO4 A;  1SQP K;  5DJT B;  1JCC A;  1FS0 E;  1SVF A;  1KB9 D;  2Y9Z A;  1T3U A;  3Q5R A;  4BWN A;  4U3F E;  1M90 Q;  5E79 H;  4HJG H;  1OMI A;  1X22 A;  2E5T A;  1URQ B;  4NPF X;  5AW0 B;  3RGU A;  2PAJ A;  2K37 A;  1KFN A;  1GK6 A;  5APY A;  2POH A;  3BCC G;  3L71 E;  2CK3 H;  4I7Z B;  3CMA P;  1X0T A;  3VP8 A;  2PFX A;  3VMZ A;  1HJB A;  1L0L K;  1M57 D;  3B4S A;  2QEX P;  5GTI E;  1SQB J;  2FYZ A;  3WU2 H;  2QVA A;  1KYO H;  3WMM 0;  5APQ A;  1WRG A;  3QH9 A;  1JY2 N;  1BDD A;  1PIX A;  2E5Y A;  1OW7 A;  2KYV A;  2YMY A;  1PP9 J;  1SQB K;  4PD4 I;  1MZ9 A;  1PGP A;  3H1I J;  2YIU C;  1VQK P;  2QSI A;  1N2D C;  3PLN A;  5H2F E;  1NTZ K;  2YMK A;  3MUD A;  2N9Y B;  1LTA C;  3D6Y A;  3A7O A;  3AE5 C;  4IL6 H;  5CJ0 A;  1BGY D;  2K88 A;  1LTJ B;  2UWJ E;  1OXZ A;  2IFM A;  2P10 A;  3CX5 E;  1BE3 D;  3GG2 A;  3HE4 B;  3BRV B;  3MP7 B;  4OGQ B;  1YJW P;  3L72 J;  2V4H A;  3A0B E;  4N78 D;  1VPC A;  1ZN5 A;  5AW7 B;  4DOJ A;  1QVG O;  3RBX A;  1BCC J;  1IFM A;  3N4X A;  4IFD K;  1AQT A;  1JB0 J;  5H2F H;  1IJD B;  1JCD A;  1NGM B;  2QE7 H;  1VQ9 P;  1N73 B;  2HOD A;  3LID A;  1VL2 A;  1ZOY C;  3JCU H;  1DH3 A;  5KLV G;  3H1I E;  4PV1 C;  1SQP E;  4H0L C;  3H1J D;  1URQ A;  3H25 A;  3KHU A;  1QEX A;  3CCL P;  2C0W A;  2NPS A;  3CL3 D;  4YTP C;  2FYU K;  5APX A;  5AW6 B;  2ZFC A;  1FZB A;  4Y28 J;  1DEE G;  4AQR D;  2ZYD A;  2WSF J;  4H44 C;  2D2C B;  1NTM J;  2E76 D;  1HGV A;  1NTM D;  2LXB A;  2PP6 A;  2Q6Q A;  2WTY A;  4GT1 A;  5KLV J;  5BU8 B;  1SQV J;  2HR3 A;  3L70 J;  3HD7 C;  2Y0C A;  2WZ7 A;  1KB9 H;  1E5W A;  2W8Z A;  1PPJ E;  4H13 C;  1L0N D;  1S5L E;  1RF0 C;  1Y47 A;  2JWD A;  3A0H H;  1USE A;  3D6Z A;  2JP3 A;  4DCK A;  2K3R A;  2NZ2 A;  2Q1K A;  2R44 A;  3EQ2 A;  3L75 D;  3RK2 D;  2KI7 B;  2WSC H;  1JY2 P;  1IFD A;  3H1H G;  4PJ0 E;  3TGU E;  1VQ8 P;  2C9N Y;  2YO3 A;  3EWK A;  1N7S D;  1N86 A;  3H1L D;  4DJG A;  1OW6 A;  2H7H A;  5AVU B;  2OAR A;  1KYO D;  3A0H E;  1GW3 A;  1YQ4 C;  3E1R A;  1XTC C;  1S5L H;  2H88 C;  3L72 D;  1YIT P;  2N1T A;  3L71 D;  1Q82 Q;  1SQX G;  3V4W A;  4UB8 E;  3CCS P;  2D2C C;  2IZ1 A;  3CCV P;  1URQ D;  3TNU B;  1NU1 G;  3I55 P;  2KP8 A;  2WSF H;  1L4A A;  1U7M A;  1E79 H;  2ZJS E;  3NFQ A;  1RQU A;  3RL0 D;  3Q5P A;  1JY3 N;  3U1C A;  2W6A A;  1IFN A;  3RK3 C;  3P8C D;  1GDT A;  1EDK A;  3KDP B;  2P1J A;  1AFO A;  1Q90 D;  3TF5 A;  3HD7 D;  2PGD A;  1OZH A;  1DX7 A;  3CLQ A;  1FJK A;  2YKP A;  2YXQ B;  3AEF C;  5AW9 B;  2KLV A;  1JMB A;  1RQV A;  2CPB A;  5AW2 B;  4YXD C;  1BGY E;  4LC1 A;  2A06 E;  4TT3 H;  5GTI H;  1L0L E;  2DW3 A;  2IBZ G;  1GL2 B;  1NU1 J;  4JYB A;  3LW5 H;  1PL5 A;  5KKZ C;  1VQP P;  1VF5 B;  3QWO C;  1KN7 A;  2A06 G;  1H0T A;  1PGO A;  2YKQ A;  1N7S C;  1SQV K;  1MFZ A;  3L36 A;  4ASW A;  5GTH H;  2O3J A;  5B5E H;  5KLV E;  2BCC J;  3PHL A;  1EXJ A;  5CMZ A;  3BRT B;  5APV A;  2WQY C;  2J58 A;  3H1I D;  4BXL A;  1MFT A;  1VQ7 P;  2Y9Y A;  4GOE A;  5M1B A;  4LLH A;  1VQN P;  3H1H J;  3A0B H; 
#chains in the Genus database with same CATH homology
 4AUW A;  2P2U A;  1T2K C;  4W7Z A;  5AVX B;  3RK3 D;  3M9Q A;  1RE3 C;  2OYI A;  1NKZ B;  1M1J A;  2A45 I;  2WPR A;  1FZC C;  5APS A;  1LTG C;  1HTL C;  3M0D C;  3V4Q A;  1FU1 A;  1LGH B;  1LTJ C;  5CCG D;  1N73 C;  2VRS A;  1N7L A;  3M06 A;  1NO4 A;  3BVH A;  1RE3 A;  3B8E B;  3M0D A;  3II6 A;  3A2A A;  1NWQ A;  2WIT A;  3RK2 B;  2JEE A;  2HOD B;  4GKG A;  2XV5 A;  3OJA B;  1JMM A;  2M3B A;  1NOH A;  3KYQ A;  2A45 H;  5CCH C;  5AW3 B;  1RE4 C;  1QL1 A;  1SLQ A;  2I1J A;  4N78 E;  1M1J C;  3RL0 C;  5AVR B;  1LWU A;  4LGD E;  4KHX A;  2HYN A;  2XDJ A;  3MIW A;  1H88 A;  1GU4 A;  1JY2 O;  3MD0 A;  3HUS A;  3B5N A;  3TYY A;  1J1D C;  2WPQ A;  1IK9 A;  3R2P A;  2HLO A;  2I1K A;  1DEB A;  2CPS A;  2R5B A;  4N6J A;  1RE4 A;  2NPS C;  2C9L Y;  1H8A A;  2E43 A;  4WY4 A;  5CCH A;  4IFF A;  3L35 A;  1T8Z A;  1L4A B;  1LTS C;  1SQQ K;  3CI9 A;  1KIL B;  1LT9 B;  3VYI A;  2KSJ A;  2IFN A;  1JNM A;  2L5G B;  1JY3 P;  1LTI C;  1N7S A;  4I2L C;  2H43 A;  4EIJ A;  2Z5I A;  1G1I A;  3B5N C;  3O8Z A;  2KOG A;  1EQ7 A;  4Y99 B;  1PFI A;  1WT6 A;  3VOP A;  2FFD B;  1LWU C;  2FKW B;  4C46 A;  3SWF A;  2XZR A;  2Q3I A;  4W80 A;  1CZQ A;  2OYI C;  1N73 A;  3T97 A;  2P67 A;  1SP4 A;  1G1J A;  1ZLL A;  1FOS E;  1L4A C;  1HVV A;  2IPP A;  1IFJ A;  2YKO A;  4HH2 A;  2Q7C A;  2NPS B;  1J1E C;  2A45 G;  3HE5 B;  2OYH C;  2N1T C;  3TSI A;  1FJP A;  1FZF A;  4C7N B;  1KFM A;  2BAS A;  3M0A A;  3GHG C;  5AVY B;  1NU1 K;  3VMX A;  1CSB A;  1JY3 O;  1OWA A;  2YO2 A;  1LWU B;  2W27 A;  1T2K D;  1FZA A;  1HGZ A;  1RY3 A;  1GW4 A;  3H32 B;  1SFC B;  3HTK B;  1CI6 A;  4WY4 B;  1S9K E;  1L0N K;  1GTW A;  2Q5U A;  5AW8 B;  2R3C A;  1JO5 A;  1JTH A;  1GU5 A;  3NXS A;  2OYI B;  1CI6 B;  1RF0 A;  2M8R A;  3HE5 A;  4N3Y B;  2Q9I A;  2Z5H A;  1FBM A;  3L4F A;  1RF1 C;  5KJ7 D;  3GHG B;  2HPC A;  5KTB A;  1FZE A;  5AVW B;  3TNU A;  3V2R A;  5KJ7 A;  1XTG B;  2GUV A;  1IC2 A;  4C7N A;  4XA4 A;  1X79 B;  5CCG C;  2FXM A;  2JJL A;  2W6B A;  1IFI A;  1LTB C;  1URQ C;  2WPS A;  1KIL D;  5AVT B;  3V2N A;  5KLV K;  3A5T A;  1GD2 E;  2HG5 D;  1HUC A;  3B5N D;  5AW5 B;  2QM7 A;  2GUS A;  1G2C A;  5APU A;  1Z56 A;  3C9I A;  2N9B A;  3N7N A;  2WT7 A;  1X8Y A;  1GK4 A;  3V2P A;  2O01 H;  3UIA A;  2O1J A;  1MUU A;  1FZG A;  1A02 F;  3P8M C;  2HPC B;  3I5C A;  2N1T D;  2ZXE B;  3PP5 A;  2OYH A;  1LT9 A;  1KIL A;  3U1A A;  2WWW A;  1SQX K;  3RK2 C;  5BU5 A;  1SFC D;  1J1D B;  3VN0 A;  1KZU B;  3M91 A;  1QL2 A;  3P32 A;  2NPS D;  1KQL A;  1NTM K;  1SFC A;  2HFE D;  1VDF A;  3RK3 B;  1GZL A;  1FAV A;  3L37 A;  5APW A;  1GL2 C;  4DZO A;  1JTH B;  3VTP C;  2R5D A;  3HD7 B;  4XE5 B;  1W2E A;  5CCG A;  4WB4 A;  3EFG A;  2O1K A;  3RL0 B;  3SWY A;  1FDM A;  2IX7 C;  3B5N B;  3BAT A;  1GL2 A;  1MV8 A;  1RF1 A;  3HE4 A;  1H89 A;  4ZKU A;  3BAS A;  3IFM A;  5CJ4 A;  2C0X A;  3LIE A;  2KB7 P;  4WY4 C;  5AVV B;  1SFC C;  3HTK A;  1YTZ I;  4IFM A;  2Z4E A;  1HBW A;  1FOS F;  5AW1 B;  1L4A D;  1NHL A;  5CCH D;  3NMD A;  3IR9 A;  5AW4 B;  2MJZ A;  5AVQ B;  4ZKP A;  5AVZ B;  1NH4 A;  3MTU E;  3HD7 A;  1AQ5 A;  2LKM A;  1G2C B;  1FZC A;  2N1T B;  2E42 A;  1N7S B;  1J1E B;  2OYH B;  1T3J A;  3H6P A;  4C7R A;  1YYC A;  4JF7 A;  1A02 J;  1YTZ T;  4I6M C;  3U59 A;  4WBA A;  3KPE A;  1NKN A;  3TK1 A;  2XKM A;  1S9K D;  1ZR2 A;  1HWT C;  2FFD C;  1X9V A;  1M7L A;  4EOT A;  3GHG A;  5CHX A;  3A3Y B;  3HRN A;  3P8C E;  4AYC A;  4GIF A;  4B86 A;  1M1J B;  3G3Z A;  4RES B;  3M9H A;  2H8P D;  2R32 A;  3V5B A;  2GM4 A;  2FFD A;  5KJ7 C;  2QM8 A;  2YNY A;  3KQG A;  1GL2 D;  1ZR4 A;  1LT9 C;  1KIL C;  3E1I A;  3VP9 A;  1LTJ A;  1JOC A;  2P7J A;  2WSE H;  4W7Y A;  1ZV8 A;  5AVS B;  3P7K A;  4M3L A;  5BVZ A;  1NAF A;  3NTN A;  3VMY A;  4JYC A;  2WT7 B;  3M9B A;  2XNX A;  1J2J B;  4OH8 B;  5APT A;  1RF1 B;  4WY4 D;  3HUS B;  3MGN A;  4I1L A;  1HH0 A;  3HUS C;  3OA7 A;  2J59 M;  4HYT B;  2XU6 A;  3V2Q A;  3OAK A;  1NTK K;  1LTT C;  3H32 A;  4O9B A;  4Y99 C;  1IO4 A;  1SQP K;  1JCC A;  1SVF A;  1T3U A;  5AW0 B;  1URQ B;  2PAJ A;  1KFN A;  1GK6 A;  5APY A;  2POH A;  3VP8 A;  3VMZ A;  1L0L K;  2FYZ A;  3WMM 0;  5APQ A;  1WRG A;  1JY2 N;  2YMY A;  2KYV A;  1SQB K;  1MZ9 A;  1N2D C;  1NTZ K;  3MUD A;  1LTA C;  3A7O A;  1DH3 A;  1LTJ B;  5CJ0 A;  1OXZ A;  2IFM A;  3HE4 B;  3BRV B;  1JUN A;  1HJB A;  4N78 D;  5AW7 B;  1VPC A;  1ZN5 A;  4DOJ A;  4IFD K;  1IFM A;  3N4X A;  1IJD B;  1JCD A;  1N73 B;  2HOD A;  3LID A;  1URQ A;  2C0W A;  2NPS A;  3CL3 D;  2FYU K;  5APX A;  5AW6 B;  2ZFC A;  1FZB A;  4AQR D;  1HGV A;  2PP6 A;  2WTY A;  4GT1 A;  5BU8 B;  3HD7 C;  2WZ7 A;  1E5W A;  1RF0 C;  3EQ2 A;  3RK2 D;  2WSC H;  1JY2 P;  1IFD A;  2C9N Y;  2H7H A;  2YO3 A;  1N7S D;  1N86 A;  5AVU B;  2OAR A;  1GW3 A;  1XTC C;  2N1T A;  3V4W A;  1URQ D;  3TNU B;  2KP8 A;  2WSF H;  1L4A A;  3RL0 D;  3NFQ A;  1JY3 N;  3U1C A;  2W6A A;  1IFN A;  3P8C D;  1GDT A;  3KDP B;  2P1J A;  1AFO A;  3HD7 D;  1DX7 A;  3CLQ A;  1FJK A;  2YKP A;  5AW9 B;  3RK3 C;  1FZC B;  2KLV A;  1CW5 A;  2CPB A;  5AW2 B;  4LC1 A;  1GL2 B;  4JYB A;  3LW5 H;  2YKQ A;  1N7S C;  3L36 A;  1MFZ A;  1SQV K;  5CMZ A;  3BRT B;  5APV A;  2J58 A;  4LLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...