2XNXA

Bc1 fragment of streptococcal m1 protein in complex with human fibrinogen
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRINOGEN ALPHA CHAIN
publication title Streptococcal M1 Protein Constructs a Pathological Host Fibrinogen Network
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
total genus 20
structure length 74
sequence length 74
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2010-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2xnxA00
1FZFA 2OYIA 1LTJA 1LTJC 1RF0A 1RF0C 1JY2N 2HLOA 3H32B 1JY2O 2FFDA 2FFDC 1RF1A 1RF1C 1N73B 1JY2P 2HPCB 1FZBA 2HODB 3H32A 2OYHB 1M1JB 3HUSB 1FZCB 3GHGB 1T3UA 1FZAA 2HPCA 2H43A 3E1IA 1N73A 1LWUB 1LT9B 3BVHA 1W2EA 1N73C 2HODA 1FZEA 1M1JA 1M1JC 2OYHA 2OYHC 3HUSA 3HUSC 1FZCA 3GHGA 3GHGC 1FZCC 2XNXA 2OYIB 2Q9IA 1LTJB 1LT9A 1LT9C 1LWUA 1LWUC 1FZGA 1N86A 1JY3O 1RE3C 1RE3A 1RE4A 1JY3N 2A45I 2A45H 2FFDB 1RE4C 1RF1B 1JY3P 2Z4EA 2A45G 2OYIC
chains in the Genus database with same CATH superfamily
1VQLP 3L74G 3UIAA 1JY2N 1CSBA 1NAFA 4DT0A 4Y99C 3CXHD 2POHA 2VRSA 3FWNA 3P7KA 5APYA 4UB8H 4JBZA 3CX5D 3H1LJ 1Q90D 1N7SD 3TNUA 1N73B 1VQ8P 3M0DC 1FZBA 3BCCD 4H0LD 1LTIC 1FZCB 3LIEA 2XZRA 4I1LA 1YJNP 2HPCA 3O6QA 4AUWA 1MZ9A 2KLUA 2IBZD 2B88A 3FWLA 3HUSA 5KJ7C 2KS1B 3HD7D 1AA0A 5KLVE 3SWYA 5B5EE 1Y9BA 2A06G 1X9VA 1KC8Q 3ABVC 2E75D 2RKLA 3AEGC 1YI2P 2LR2A 3H1IJ 3ZDMA 3Q3DA 2H43A 2D2CD 1T6AA 3L71G 1S2EA 1SP4A 5C39A 3D6ZA 3L75E 2WSFJ 1AJYA 5E79H 1G1JA 2OTJP 2IX7C 2K88A 3C8VA 1PL5A 4DJGA 2W6AA 3FXEA 4H44B 3L74E 1AVYA 3RBXA 3Q5PA 1JMMA 1G1IA 2CPBA 4JF7A 3MUDC 3H25A 1SQXJ 1S5LE 2YO3A 2N9YB 4W7YA 4ZKPA 1XTGB 3IR9A 2KYVA 5APXA 1USEA 3BRTB 2QG4A 1BGYD 2WPSA 4U3FG 3SWKA 2R3CA 1NAYA 2R3SA 1LP1B 2O01N 3CPWO 3D6YA 2A06E 2E76C 1EC5A 3S4RA 2M3EA 2O01H 1QVGO 1NYHA 2HFED 5AW3B 3H1JJ 1T3UA 1MUUA 1HJ0A 4YTPC 2IZ0A 1SQXK 3L71E 1M1KQ 2A45H 1RE4C 2KNCB 4GOFA 3JCUE 2WT7A 4MN4C 4ASVA 3H1LG 1DIPA 3MZWB 1SQBD 4HKZH 3HTKB 3CC4P 1N7SB 2GUVA 3OW2O 2YKOA 4H0LB 1LT9A 1KYOH 3TGUD 1HBWA 4PJ0E 1KB9D 2ITAA 1DEEG 2RH0A 1G2CB 1RF0C 3BCCJ 3HD7B 2QSIA 3RBZA 5GTIH 3K5BA 1RH5B 3LW5H 2GM4A 2OARA 1DEBA 2KUBA 3H1IG 1ZR4A 1Z56A 1YTZT 2WPVB 1LJ2A 2R32A 2D2CB 2QRXA 2PAJA 2W6JH 1X0TA 3S1KA 4PD4H 5AVWB 4NPDA 1UIXA 2E5TA 1KZUB 1A02J 4U3FE 2FXPA 3SFEC 5H2FE 1E5WA 1FC2C 1U7MA 2Y0DA 1JOCA 2XDJA 2ZT9D 3D71A 3WU2H 3AE3C 1S3JA 1M8OB 1E79H 3RK2C 2Q3EA 1ZN5A 3V5BA 2V4HA 1NU1D 1N7LA 4M3LA 3IFMA 3FXDA 2YIUC 2J5UA 1LTTC 3BATA 3KYQA 1T8ZA 1L4AC 3GMAA 1SQXG 3H1LE 3P32A 3P8CD 2M0BA 3RK3D 2N1TC 4R4MA 2KSJA 3CC2P 1CZQA 1X22A 2IFNA 3M9QA 4H13B 5KJ7A 2KSEA 2BEZF 4WVZA 2BASA 2OGUA 5B5EH 2JJLA 3KHUA 4ZKUA 3A0BE 1SLQA 1H8AA 3CXHI 4O9BA 1BGYJ 2YXQB 3NTNA 1FJPA 1J1DC 3H1IE 5KLIB 3H1JG 5B66H 2GA1A 2KP8A 3CX5I 3ITKA 1FDIA 3JSVC 4I6MC 2H88C 5APTA 1QL2A 1OMIA 3GF7A 5KLVJ 2GUSA 2Y9YA 4UB6E 2LXBA 1LTJC 3B5NC 2G8YA 3OJAB 3BASA 2XKMA 1KYOI 1SQQD 2QA4P 4WB4A 1SQBJ 3BCCG 1X8YA 2K1AA 1YTZI 4HYTB 3CC7P 3MUDA 2HODA 3TGUJ 1YJ9P 1S5LX 1S5LH 1SQXE 4TT3H 2E74C 5KAFH 5KAIE 3MHVA 4K3AA 3AE4C 2QJYB 3GHGB 1IFDA 4IFFA 1ZRTD 1HF9A 1KILA 1CI6B 2XV5A 2K9JA 2MKVA 5AVUB 3OAKA 1LWUC 4B86A 2KOGA 1PGQA 4LGDE 1NOHA 1JMBA 3M9HA 1SQBK 3TK1A 2IPPA 1L2PA 2IYPA 3H1JE 5AW0B 1KQLA 1NGMB 3AEAC 5AW2B 3VTPC 3TF5A 3TYYA 5CMZA 1NU1J 1P84D 3EQ2A 5KJ7D 1NHLA 1EDIA 5K5GB 3CXHE 1BDDA 1PPJD 2NPSC 3RK3B 2J58A 1GMJA 3CX5E 4GDOA 1FZGA 1VQNP 1D7MA 1PV3A 1RF0A 3H32B 2FFDA 3BCCE 3V2PA 1YIJP 1L0LD 2BEQD 1BGYG 1EDJA 2KK7A 2IBZE 1S9KD 1M90Q 1DH3A 3M9BA 3TDKA 1NU1K 1ZMEC 2B87A 1OW6A 5KLVG 2P67A 3RL0C 1OVVA 2R5BA 4BRYB 1M1JB 1YQ4C 3GLMA 4OGQB 1KB9I 1Y47A 3A7OA 1KFNA 1SQBG 2WSSH 2Z5IA 3EWKA 1LTSC 1EZVD 4EYYQ 5CBOA 1VQ6P 1SQQJ 1T2KC 1L4AA 3TGUG 1AFOA 2Z5HA 3VN0A 3I5CA 2WSCJ 1FZFA 1GD2E 2N1TA 4RKUJ 2E76D 3PLNA 2YXRB 1QL1A 1A02F 4TLFA 2C0XA 2W27A 2M5AB 3C1LA 3HE5B 1GZLA 1KV4A 3KPEA 1W5CE 1BGYE 2AXTE 5AVQB 1FZCC 1SQQK 5APSA 2JEEA 4PV1C 5APQA 1NU1G 2KZJA 4UB6H 1Q82Q 1GDTA 1LTJA 3CCMP 4C46A 2WSFH 5DJTB 3TSIA 3B5NA 2E42A 2W90A 1SQPD 2LXCB 4AQRD 4IL6E 1FDOA 1DX7A 2QJKC 1RQVA 2P58A 3BRVB 3AE1C 1NO4A 3E7KA 1JB0J 3HE4A 4L73A 1JTHB 1JY2O 2NRGA 1SQBE 5AVXB 5EFWB 2H7HA 1LGHB 2H89C 2WPQA 3TGUE 1VQKP 1KB9E 3AE7C 1H0TA 3VMZA 3RGUA 5KAIH 3RK2D 2ZFCA 1K05A 4L74A 1SQVD 1JEKA 5KKZC 1HVVA 1SFCA 2QM7A 2FXMA 1LNQA 2OYHC 3USSA 2Y0CA 2UWJE 1LWUA 1K9MQ 3OA7A 2QEXP 2OYIC 1L4AD 2WPRA 1PP9D 1SVFA 2MJZA 1GL2A 2N1TD 2KZIA 1W2EA 1VDFA 1VQ5P 1KILC 1FS0E 1SQQG 1NU1E 4R4LA 4WY4C 3WUUA 1OW7A 4C7NB 3IN6A 3M0AA 3CXHH 2YNYA 1CW5A 2KLVA 1K73Q 2NPSA 3F89A 3AE9C 2FYUD 2ZVNB 3PTZA 3CX5H 4AYCA 2E76B 1BDCA 3P8CE 1PGPA 4W80A 3RK3E 5AW5B 3L73D 3D70A 1OVRA 3B5ND 3AE6C 4DOJA 3GW6A 5TJHA 4HJGH 1ZOYC 1R8EA 1P84I 2AEMA 5DJUB 1T3JA 1FAVA 2RN0A 2PFXA 1KQSO 1NJIQ 2FFDC 1RF1C 1K8AQ 4Y28J 3CCSP 1S72P 4YXDC 2IYOA 4YPCA 4A7PA 2E75B 5APWA 3H1HD 3KDPB 1SQPJ 2HLOA 1U7JA 2E74D 4EOTA 2K37A 4D6TD 1EXIA 1PPJG 1IFMA 2R5DA 2B87B 4HH2A 4GT1A 1SQQE 3R4YA 4ASWA 1RE3C 5AVTB 3A0HH 2Q5UA 2YO2A 1XTCC 3I56P 1Y8AA 2BCCD 2O1KA 4KHXA 1UIIA 3RK2B 3MIWA 3PJSK 1DD3A 1BCCE 1BSHA 2Q1KA 1BE3D 2QM8A 1SQPK 1SQVJ 1Q86Q 1EZVI 1ZRTE 2AXTH 1HWTC 1LTGC 3IF4A 1FZCA 2WSEJ 2L91A 2R44A 3L36A 4H13C 2NPSD 3Q2YA 2N1TB 1PP9J 1JNMA 1Q7YQ 1JY2P 2WZ7A 4IL6X 1ZR2A 1EZVG 5AVVB 1P84E 2ZYAA 1ZV8A 5KLIC 3EFGA 3TNUB 4ZNCA 3PRJA 1HGVA 1L0ND 4JPZB 1SQVK 2B9BA 1YYCA 2DW3A 3SSUA 3CMEP 2HPCB 3O6QB 2C0WA 3AE5C 1PPJE 3HUSB 2M3BA 2FYUJ 3RL0D 2IBZI 1N8RQ 1ZXGA 1LTJB 1KB9H 3V6IA 2YMKA 1LT1A 3L73J 3G9RA 2FKWB 2FYNC 3VOPA 1L0LE 1S9KE 2IBZG 3CMAP 1KD1Q 2OYHA 2HG5D 5GTHE 1BCCD 4KT0J 3U1AA 1J1EC 1KN7A 1T2KD 2OYIA 3Q5SA 2JR8A 4LC1A 3FGAD 4IFDK 3L37A 1SQPG 1YJWP 2FYUK 1KQGB 2QJYC 1H0TB 3H1HJ 1SFCC 3GHGC 1FOSE 4OVNF 1VF5C 4WY4A 2OTKE 1LP1A 2JKVA 4XA4A 2ZT9B 4HB1A 4D6TJ 4I7ZC 1EZVE 3MD0A 1GL2C 1JCCA 1FZEA 3L72D 2I1KA 2Q9IA 1WMKA 2P10A 1AV1A 2KI7B 3NMDA 3JCUH 2BCCJ 4XFJA 4PV1D 2KNCA 1SQVG 1NTMD 2IZ1A 5APUA 3B4SA 2CPSA 3VYIA 4WBAA 1M57D 2OQQA 2WTYA 3SFDC 1YHQP 3HTKA 3B8EB 1BE3J 2KXPB 3CWBD 1N7SA 5CCHC 4PJ0H 1FOSF 5AVSB 2IDBA 2YKPA 2QE7H 2Z4EA 1PP9G 3L70D 1RF1A 2KB7P 3H1KD 1NWQA 1G2CA 2JDIH 3WMM0 3HD7A 4K35A 3CI9A 1ZLLA 2Q6QA 1URQC 2WT7B 1VPCA 1WT6A 3R2PA 2M8RA 4JQ0D 1SQPE 3AEBC 2C9LY 5CBNA 1HTLC 1Q81Q 2YKQA 2N9BA 5H2FH 2CK3H 1LT9B 2FYUG 1M1JC 4Z1MH 5CHXA 1L0NJ 1RE3A 3RL0B 1NTKE 4OGQC 2QJPC 2WSCH 3L73G 4RESB 2NZ2A 4L76A 3V2RA 1J2JB 5AW7B 1GK4A 1VQ9P 5AW9B 2WITA 1KILD 3KQGA 1SQVE 1QLED 2XU6A 4WY4D 1VQOP 5APVA 1EDLA 3AE2C 1BCCJ 1H89A 3VMYA 1KFMA 3H1HG 4LLHA 1IO4A 3V2NA 1L0NK 1JCDA 1PP9E 2E5YA 1S1CX 3A0BH 4GOEA 4Y99B 2V7QJ 3JC22 4D6TG 4W7ZA 2Y9ZA 1GW4A 2QIWA 4BWNA 1DD4A 1N73C 1JUNA 1P84H 4WWIA 1YITP 1S4XA 1JY3N 3PP5A 4YXWH 2RMZA 5BU8B 3W67A 2B89A 2BCCG 3MP7B 3KZIE 3N4XA 3S9OA 3T97A 1OZHA 1NTZD 1FJKA 1R5SA 3L72J 2FYUE 4PV1B 3M91A 1IJDB 4GIFA 2XNXA 2SPZA 2YMYA 1N86A 1BE3G 3A2AA 2KIKA 3L73E 1FU1A 1KYOD 3CCEP 1NTMJ 1GK6A 1NTKD 3CCJP 3G71P 4OWFA 4N78D 3N7NA 5TISE 2QJKB 4N6JA 2Y0EA 1MFTA 3CWBJ 5B66E 5GTHH 2FY8A 1IK9A 2FYZA 1YQ3C 3L70J 1PGOA 1JO5A 5BU5A 5CCGC 3H1KJ 1VQ7P 4H44C 3MTUE 1L0LJ 1MV8A 4PD4D 5AVYB 1QEXA 3PHLA 3H1HE 3GHGA 5AW4B 2LKMA 1JY3O 2FBWC 1CI6A 1L0NG 5KKZB 3G6EP 1KORA 1NTMK 5M1BA 5AW1B 2AEFA 4D6TE 4JYCA 5L8RJ 2HODB 2OYHB 1WRGA 1M56D 2OYIB 1EDKA 1IFIA 1M7LA 3C9IA 5KAFE 2BCCE 4H13D 3AEDC 1L0LK 1FBMA 3G3ZA 1PZQA 1KILB 1PIXA 2K9JB 3SWFA 2OTLP 2I1JA 1IK7A 4WY4B 3V2QA 1BCCG 3Q5RA 1BE3E 4N3YB 5CCHA 2O3JA 2ZAEB 5KLVD 1RQUA 3H32A 2J59M 4ZMDA 4GODA 5AVRB 4JYBA 1GU4A 1AVOA 2WVRA 1URQA 1N7SC 4GKGA 4IFMA 1KTMA 3V4QA 2AXCA 4H0LC 2O1JA 3L75D 2O01J 1GTWA 2H8PD 2JWDA 4NPEA 1RY3A 1QX8A 4BRYA 3HD7C 3L72G 1M1JA 3CL3D 3NXSA 2XNDH 1L0NE 2E75C 2FFDB 1RF1B 2JWAA 2ZYDA 3L74D 4BXLA 1NTMG 1NTZJ 4NPFX 2D2CC 3V4WA 4DCKA 2K9YA 1KMIZ 3CWBG 1LTBC 1SFCD 1NTKJ 1VF5D 3L70G 2E43A 1X79B 3RL0g 1HH0A 3H1KG 1GW3A 1L0LG 2HYNA 1PFIA 3MGNA 3LW5J 1FZAA 1ZW0A 2AEJA 3GF3A 3VMXA 2WSEH 4C7RA 3KXDA 1GL2D 1OXZA 3H6PA 1TU3F 2M5AA 2A06D 3HE5A 2YIUB 1NTZK 1HUCA 3B71A 1L4AB 1VL2A 1N73A 1NKNA 2I8DA 2ZVOB 3BVHA 3L35A 4IOIH 3L71D 1Q2NA 1NTKK 2KS1A 5CCHD 3KZIH 3M0DA 3A5TA 2P7JA 4IL6H 1AQ5A 3L72E 3O8ZA 3VMAA 1OIPA 1GU5A 4UB8E 2Q3IA 1U57A 2OYOA 3U1CA 1URQD 1NTME 1J1DB 2Q7CA 4U7JA 5TISH 3AEEC 3F5HA 1JTHA 1SS1A 3CCQP 1AQTA 3CWBE 2ZXXA 5KTBA 3HUSC 1BSNA 2ZYGA 2JP3A 2A45I 2G3AA 3B5NB 3L70E 1JY3P 3T97B 5CCGA 1RHZB 3H1KE 2K3RA 4OGQD 3AE8C 3E1RA 3LIDA 4EDFA 1NKZB 1OX3A 4QMAA 4U3FD 1IFJA 2FYNB 1IZNB 3U59A 1OW8A 3HE4B 3WUVA 1N2DC 1W2BO 2A45G 3L75J 1IC2A 5E79E 2L5GB 1NTZG 3HRNA 1H88A 4KJMA 4OH8B 1QGKB 1ZP0C 1MFZA 1NVOA 1J1EB 2E74B 5KLVK 3L74J 1NTKG 3WUTA 4PD4I 3H1LD 1HJBA 4RJTA 1SFCB 2ZJSE 1IFPA 1OVUA 2ZT9C 3L4FA 1OFCX 4C7NA 1VF5B 3AEFC 1LWUB 4L75A 3QH9A 4CPGA 3CCUP 2WMMA 1KILE 2P2UA 1FE6A 3Q1MA 4I7ZB 3CLQA 1LTAC 1KQFB 1GL2B 4I2LC 1OWAA 3E1IA 2WWWA 3H1ID 3PH0A 2WQYC 2IFMA 3FX0A 1RE4A 3RK3C 2W6BA 5AW8B 5CJ0A 1EXJA 5CJ4A 1PGJA 2NPSB 3CCRP 3NFQA 4RO0A 1USDA 5AVZB 3L71J 3QWOC 3W68A 4EIJA 1VQPP 2PRRA 2QVAA 1QVFO 1NTZE 1R5LA 4EI2A 5CCGD 1YBKA 3II6A 1URQB 4H44D 3I55P 1VQ4P 1LT9C 1KYOE 1SQXD 1JM0A 3GG2A 1MKMA 4N78E 2C9NY 2P1JA 1HGZA 3VP9A 3G4SP 1VQMP 5GTIE 3M06A 1K04A 3P8MC 1FDMA 2QJPB 4DZOA 1EQ7A 2W8ZA 2W83C 3CD6P 2PP6A 3L75G 3CCVP 4PD4E 2V7QH 1IFNA 5BVZA 3IAOA 4U3FJ 2ZXEB 3EFFK 5AW6B 3CCLP 1NH4A 2FXOA 3A3YB 3H1JD 3VP8A 3WU2E 2HR3A 4XE5B 3AECC 2PGDA 3A0HE 2JO1A
chains in the Genus database with same CATH topology
3M9HA 3UIAA 1SQPK 1JY2N 1SQBK 3TK1A 1L0LK 2IPPA 1FBMA 3G3ZA 1CSBA 1NAFA 1KILB 4Y99C 1HWTC 2POHA 3SWFA 1LTGC 5AW0B 1KQLA 2I1JA 2VRSA 3P7KA 5AW2B 3VTPC 4WY4B 3V2QA 5APYA 1FZCA 3TYYA 5CMZA 4N3YB 5CCHA 3L36A 2NPSD 2N1TB 3EQ2A 5KJ7D 1NHLA 1N7SD 3TNUA 1JNMA 1N73B 1JY2P 2WZ7A 3M0DC 1FZBA 3H32A 2J59M 1LTIC 1FZCB 5AVRB 1ZR2A 4JYBA 3LIEA 2XZRA 4I1LA 2HPCA 5AVVB 4AUWA 1MZ9A 2NPSC 1GU4A 3RK3B 3HUSA 5KJ7C 2J58A 1ZV8A 1URQA 1N7SC 3EFGA 1FZGA 3HD7D 4GKGA 3TNUB 4IFMA 3SWYA 3V4QA 1HGVA 1X9VA 1RF0A 3H32B 1SQVK 2FFDA 2O1JA 1YYCA 2HPCB 3V2PA 2C0WA 1GTWA 3HUSB 2H8PD 2M3BA 3RL0D 1RY3A 1S9KD 2H43A 3HD7C 1M1JA 3CL3D 3NXSA 1LTJB 1DH3A 3M9BA 1NU1K 2FFDB 1RF1B 1SP4A 2FKWB 2P67A 3RL0C 3VOPA 2R5BA 1G1JA 2IX7C 3V4WA 1S9KE 1M1JB 2OYHA 2HG5D 2W6AA 1LTBC 1SFCD 3U1AA 1J1EC 1T2KD 2OYIA 4LC1A 3A7OA 2E43A 1X79B 1HH0A 4IFDK 3L37A 1GW3A 1KFNA 2Z5IA 1JMMA 1G1IA 2CPBA 2HYNA 1PFIA 3MGNA 1LTSC 2FYUK 1FZAA 4JF7A 1SFCC 3VMXA 2WSEH 3GHGC 1FOSE 1T2KC 1L4AA 4C7RA 1AFOA 1GL2D 2Z5HA 2YO3A 4WY4A 3VN0A 3I5CA 4W7YA 1OXZA 4ZKPA 4XA4A 3H6PA 1FZFA 1GD2E 1XTGB 3IR9A 2KYVA 3HE5A 1NTZK 2N1TA 1HUCA 5APXA 3BRTB 3MD0A 2WPSA 1L4AB 1N73A 1NKNA 3BVHA 2R3CA 1GL2C 1JCCA 1FZEA 1QL1A 2I1KA 1A02F 3L35A 2Q9IA 2C0XA 2W27A 3HE5B 3NMDA 1NTKK 1GZLA 5CCHD 3KPEA 3M0DA 5APUA 3A5TA 2O01H 2HFED 5AW3B 2P7JA 1AQ5A 2CPSA 3VYIA 1T3UA 3O8ZA 4WBAA 2WTYA 1MUUA 5AVQB 3HTKA 1FZCC 1SQQK 1SQXK 3B8EB 5APSA 1N7SA 2JEEA 1GU5A 5CCHC 2Q3IA 2A45H 5APQA 1RE4C 1FOSF 5AVSB 1GDTA 2YKPA 2Z4EA 2WT7A 3U1CA 1URQD 1LTJA 4C46A 2WSFH 3TSIA 3B5NA 2E42A 1J1DB 2Q7CA 1RF1A 2KB7P 1NWQA 1G2CA 4AQRD 1JTHA 3HTKB 3WMM0 1N7SB 3HD7A 1DX7A 2GUVA 3CI9A 1ZLLA 5KTBA 3HUSC 2YKOA 3BRVB 1URQC 2WT7B 1LT9A 1VPCA 1WT6A 1HBWA 1NO4A 2A45I 3R2PA 3B5NB 1JY3P 2M8RA 5CCGA 1G2CB 1RF0C 3HE4A 1JTHB 1JY2O 2C9LY 3HD7B 5AVXB 1HTLC 2YKQA 2H7HA 1LGHB 3LIDA 1NKZB 3LW5H 2GM4A 2WPQA 2OARA 2N9BA 1LT9B 1DEBA 1M1JC 1ZR4A 1Z56A 1IFJA 5CHXA 1YTZT 3U59A 2R32A 1RE3A 3HE4B 3RL0B 3VMZA 1N2DC 2PAJA 2A45G 2WSCH 3RK2D 1IC2A 2ZFCA 4RESB 3V2RA 1J2JB 2L5GB 3HRNA 5AVWB 1H88A 5AW7B 1HVVA 1KZUB 4OH8B 1A02J 1GK4A 1MFZA 1SFCA 1E5WA 2QM7A 1JOCA 2FXMA 1J1EB 2XDJA 2OYHC 5AW9B 3RK2C 1LWUA 1ZN5A 2WITA 3V5BA 5KLVK 3OA7A 1KILD 3KQGA 2OYIC 1L4AD 1N7LA 2WPRA 4M3LA 3IFMA 2XU6A 4WY4D 5APVA 1HJBA 1SFCB 1SVFA 3L4FA 4C7NA 2MJZA 1LTTC 1GL2A 3BATA 2N1TD 1LWUB 3KYQA 1W2EA 1VDFA 1T8ZA 1H89A 3VMYA 1KFMA 1KILC 1L4AC 4LLHA 1IO4A 3V2NA 2P2UA 1L0NK 1JCDA 4WY4C 3P32A 3P8CD 3CLQA 1LTAC 4Y99B 4C7NB 3RK3D 2N1TC 3M0AA 1GL2B 2YNYA 4I2LC 1CW5A 4W7ZA 2KSJA 1GW4A 1CZQA 2KLVA 1OWAA 2IFNA 3M9QA 3E1IA 1N73C 1JUNA 2NPSA 2WWWA 5KJ7A 4AYCA 2BASA 2IFMA 1RE4A 1JY3N 3PP5A 3P8CE 3RK3C 2JJLA 4W80A 4ZKUA 5BU8B 2W6BA 5AW8B 5CJ0A 5AW5B 1SLQA 5CJ4A 1H8AA 3N4XA 4O9BA 3T97A 2NPSB 1FJKA 3NFQA 3NTNA 1FJPA 1J1DC 3B5ND 4DOJA 5AVZB 3M91A 1IJDB 2KP8A 1T3JA 4GIFA 1FAVA 2XNXA 4I6MC 2YMYA 1N86A 4EIJA 5APTA 1QL2A 3A2AA 2GUSA 1FU1A 1GK6A 1LTJC 3B5NC 4N78D 2FFDC 1RF1C 3N7NA 5CCGD 4N6JA 3II6A 1URQB 3OJAB 3BASA 5APWA 1IK9A 2FYZA 1LT9C 2XKMA 3KDPB 1JO5A 5BU5A 4N78E 5CCGC 4WB4A 2HLOA 2C9NY 2P1JA 3MTUE 1HGZA 1MV8A 4EOTA 3VP9A 5AVYB 3M06A 1X8YA 1YTZI 1IFMA 4HYTB 2R5DA 3MUDA 3P8MC 2HODA 4HH2A 1FDMA 4GT1A 3GHGA 5AW4B 2LKMA 4DZOA 1EQ7A 1JY3O 1RE3C 5AVTB 1CI6A 2Q5UA 2YO2A 1XTCC 1NTMK 2PP6A 5AW1B 4JYCA 1IFNA 2O1KA 2HODB 4KHXA 2OYHB 5BVZA 1WRGA 2ZXEB 3GHGB 1IFDA 3RK2B 5AW6B 3MIWA 4IFFA 1NH4A 3A3YB 1KILA 3VP8A 2OYIB 1CI6B 2XV5A 5AVUB 1IFIA 3OAKA 1LWUC 1M7LA 4B86A 4XE5B 2KOGA 3C9IA 2QM8A 4LGDE 1NOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZF A;  2OYI A;  1LTJ A;  1LTJ C;  1RF0 A;  1RF0 C;  1JY2 N;  2HLO A;  3H32 B;  1JY2 O;  2FFD A;  2FFD C;  1RF1 A;  1RF1 C;  1N73 B;  1JY2 P;  2HPC B;  1FZB A;  2HOD B;  3H32 A;  2OYH B;  1M1J B;  3HUS B;  1FZC B;  3GHG B;  1T3U A;  1FZA A;  2HPC A;  2H43 A;  3E1I A;  1N73 A;  1LWU B;  1LT9 B;  3BVH A;  1W2E A;  1N73 C;  2HOD A;  1FZE A;  1M1J A;  1M1J C;  2OYH A;  2OYH C;  3HUS A;  3HUS C;  1FZC A;  3GHG A;  3GHG C;  1FZC C;  2XNX A;  2OYI B;  2Q9I A;  1LTJ B;  1LT9 A;  1LT9 C;  1LWU A;  1LWU C;  1FZG A;  1N86 A;  1JY3 O;  1RE3 C;  1RE3 A;  1RE4 A;  1JY3 N;  2A45 I;  2A45 H;  2FFD B;  1RE4 C;  1RF1 B;  1JY3 P;  2Z4E A;  2A45 G;  2OYI C; 
#chains in the Genus database with same CATH topology
 1VQL P;  3L74 G;  3UIA A;  1JY2 N;  1CSB A;  1NAF A;  4DT0 A;  4Y99 C;  3CXH D;  2POH A;  2VRS A;  3FWN A;  3P7K A;  5APY A;  4UB8 H;  4JBZ A;  3CX5 D;  3H1L J;  1Q90 D;  1N7S D;  3TNU A;  1N73 B;  1VQ8 P;  3M0D C;  1FZB A;  3BCC D;  4H0L D;  1LTI C;  1FZC B;  3LIE A;  2XZR A;  4I1L A;  1YJN P;  2HPC A;  3O6Q A;  4AUW A;  1MZ9 A;  2KLU A;  2IBZ D;  2B88 A;  3FWL A;  3HUS A;  5KJ7 C;  2KS1 B;  3HD7 D;  1AA0 A;  5KLV E;  3SWY A;  5B5E E;  1Y9B A;  2A06 G;  1X9V A;  1KC8 Q;  3ABV C;  2E75 D;  2RKL A;  3AEG C;  1YI2 P;  2LR2 A;  3H1I J;  3ZDM A;  3Q3D A;  2H43 A;  2D2C D;  1T6A A;  3L71 G;  1S2E A;  1SP4 A;  5C39 A;  3D6Z A;  3L75 E;  2WSF J;  1AJY A;  5E79 H;  1G1J A;  2OTJ P;  2IX7 C;  2K88 A;  3C8V A;  1PL5 A;  4DJG A;  2W6A A;  3FXE A;  4H44 B;  3L74 E;  1AVY A;  3RBX A;  3Q5P A;  1JMM A;  1G1I A;  2CPB A;  4JF7 A;  3MUD C;  3H25 A;  1SQX J;  1S5L E;  2YO3 A;  2N9Y B;  4W7Y A;  4ZKP A;  1XTG B;  3IR9 A;  2KYV A;  5APX A;  1USE A;  3BRT B;  2QG4 A;  1BGY D;  2WPS A;  4U3F G;  3SWK A;  2R3C A;  1NAY A;  2R3S A;  1LP1 B;  2O01 N;  3CPW O;  3D6Y A;  2A06 E;  2E76 C;  1EC5 A;  3S4R A;  2M3E A;  2O01 H;  1QVG O;  1NYH A;  2HFE D;  5AW3 B;  3H1J J;  1T3U A;  1MUU A;  1HJ0 A;  4YTP C;  2IZ0 A;  1SQX K;  3L71 E;  1M1K Q;  2A45 H;  1RE4 C;  2KNC B;  4GOF A;  3JCU E;  2WT7 A;  4MN4 C;  4ASV A;  3H1L G;  1DIP A;  3MZW B;  1SQB D;  4HKZ H;  3HTK B;  3CC4 P;  1N7S B;  2GUV A;  3OW2 O;  2YKO A;  4H0L B;  1LT9 A;  1KYO H;  3TGU D;  1HBW A;  4PJ0 E;  1KB9 D;  2ITA A;  1DEE G;  2RH0 A;  1G2C B;  1RF0 C;  3BCC J;  3HD7 B;  2QSI A;  3RBZ A;  5GTI H;  3K5B A;  1RH5 B;  3LW5 H;  2GM4 A;  2OAR A;  1DEB A;  2KUB A;  3H1I G;  1ZR4 A;  1Z56 A;  1YTZ T;  2WPV B;  1LJ2 A;  2R32 A;  2D2C B;  2QRX A;  2PAJ A;  2W6J H;  1X0T A;  3S1K A;  4PD4 H;  5AVW B;  4NPD A;  1UIX A;  2E5T A;  1KZU B;  1A02 J;  4U3F E;  2FXP A;  3SFE C;  5H2F E;  1E5W A;  1FC2 C;  1U7M A;  2Y0D A;  1JOC A;  2XDJ A;  2ZT9 D;  3D71 A;  3WU2 H;  3AE3 C;  1S3J A;  1M8O B;  1E79 H;  3RK2 C;  2Q3E A;  1ZN5 A;  3V5B A;  2V4H A;  1NU1 D;  1N7L A;  4M3L A;  3IFM A;  3FXD A;  2YIU C;  2J5U A;  1LTT C;  3BAT A;  3KYQ A;  1T8Z A;  1L4A C;  3GMA A;  1SQX G;  3H1L E;  3P32 A;  3P8C D;  2M0B A;  3RK3 D;  2N1T C;  4R4M A;  2KSJ A;  3CC2 P;  1CZQ A;  1X22 A;  2IFN A;  3M9Q A;  4H13 B;  5KJ7 A;  2KSE A;  2BEZ F;  4WVZ A;  2BAS A;  2OGU A;  5B5E H;  2JJL A;  3KHU A;  4ZKU A;  3A0B E;  1SLQ A;  1H8A A;  3CXH I;  4O9B A;  1BGY J;  2YXQ B;  3NTN A;  1FJP A;  1J1D C;  3H1I E;  5KLI B;  3H1J G;  5B66 H;  2GA1 A;  2KP8 A;  3CX5 I;  3ITK A;  1FDI A;  3JSV C;  4I6M C;  2H88 C;  5APT A;  1QL2 A;  1OMI A;  3GF7 A;  5KLV J;  2GUS A;  2Y9Y A;  4UB6 E;  2LXB A;  1LTJ C;  3B5N C;  2G8Y A;  3OJA B;  3BAS A;  2XKM A;  1KYO I;  1SQQ D;  2QA4 P;  4WB4 A;  1SQB J;  3BCC G;  1X8Y A;  2K1A A;  1YTZ I;  4HYT B;  3CC7 P;  3MUD A;  2HOD A;  3TGU J;  1YJ9 P;  1S5L X;  1S5L H;  1SQX E;  4TT3 H;  2E74 C;  5KAF H;  5KAI E;  3MHV A;  4K3A A;  3AE4 C;  2QJY B;  3GHG B;  1IFD A;  4IFF A;  1ZRT D;  1HF9 A;  1KIL A;  1CI6 B;  2XV5 A;  2K9J A;  2MKV A;  5AVU B;  3OAK A;  1LWU C;  4B86 A;  2KOG A;  1PGQ A;  4LGD E;  1NOH A;  1JMB A;  3M9H A;  1SQB K;  3TK1 A;  2IPP A;  1L2P A;  2IYP A;  3H1J E;  5AW0 B;  1KQL A;  1NGM B;  3AEA C;  5AW2 B;  3VTP C;  3TF5 A;  3TYY A;  5CMZ A;  1NU1 J;  1P84 D;  3EQ2 A;  5KJ7 D;  1NHL A;  1EDI A;  5K5G B;  3CXH E;  1BDD A;  1PPJ D;  2NPS C;  3RK3 B;  2J58 A;  1GMJ A;  3CX5 E;  4GDO A;  1FZG A;  1VQN P;  1D7M A;  1PV3 A;  1RF0 A;  3H32 B;  2FFD A;  3BCC E;  3V2P A;  1YIJ P;  1L0L D;  2BEQ D;  1BGY G;  1EDJ A;  2KK7 A;  2IBZ E;  1S9K D;  1M90 Q;  1DH3 A;  3M9B A;  3TDK A;  1NU1 K;  1ZME C;  2B87 A;  1OW6 A;  5KLV G;  2P67 A;  3RL0 C;  1OVV A;  2R5B A;  4BRY B;  1M1J B;  1YQ4 C;  3GLM A;  4OGQ B;  1KB9 I;  1Y47 A;  3A7O A;  1KFN A;  1SQB G;  2WSS H;  2Z5I A;  3EWK A;  1LTS C;  1EZV D;  4EYY Q;  5CBO A;  1VQ6 P;  1SQQ J;  1T2K C;  1L4A A;  3TGU G;  1AFO A;  2Z5H A;  3VN0 A;  3I5C A;  2WSC J;  1FZF A;  1GD2 E;  2N1T A;  4RKU J;  2E76 D;  3PLN A;  2YXR B;  1QL1 A;  1A02 F;  4TLF A;  2C0X A;  2W27 A;  2M5A B;  3C1L A;  3HE5 B;  1GZL A;  1KV4 A;  3KPE A;  1W5C E;  1BGY E;  2AXT E;  5AVQ B;  1FZC C;  1SQQ K;  5APS A;  2JEE A;  4PV1 C;  5APQ A;  1NU1 G;  2KZJ A;  4UB6 H;  1Q82 Q;  1GDT A;  1LTJ A;  3CCM P;  4C46 A;  2WSF H;  5DJT B;  3TSI A;  3B5N A;  2E42 A;  2W90 A;  1SQP D;  2LXC B;  4AQR D;  4IL6 E;  1FDO A;  1DX7 A;  2QJK C;  1RQV A;  2P58 A;  3BRV B;  3AE1 C;  1NO4 A;  3E7K A;  1JB0 J;  3HE4 A;  4L73 A;  1JTH B;  1JY2 O;  2NRG A;  1SQB E;  5AVX B;  5EFW B;  2H7H A;  1LGH B;  2H89 C;  2WPQ A;  3TGU E;  1VQK P;  1KB9 E;  3AE7 C;  1H0T A;  3VMZ A;  3RGU A;  5KAI H;  3RK2 D;  2ZFC A;  1K05 A;  4L74 A;  1SQV D;  1JEK A;  5KKZ C;  1HVV A;  1SFC A;  2QM7 A;  2FXM A;  1LNQ A;  2OYH C;  3USS A;  2Y0C A;  2UWJ E;  1LWU A;  1K9M Q;  3OA7 A;  2QEX P;  2OYI C;  1L4A D;  2WPR A;  1PP9 D;  1SVF A;  2MJZ A;  1GL2 A;  2N1T D;  2KZI A;  1W2E A;  1VDF A;  1VQ5 P;  1KIL C;  1FS0 E;  1SQQ G;  1NU1 E;  4R4L A;  4WY4 C;  3WUU A;  1OW7 A;  4C7N B;  3IN6 A;  3M0A A;  3CXH H;  2YNY A;  1CW5 A;  2KLV A;  1K73 Q;  2NPS A;  3F89 A;  3AE9 C;  2FYU D;  2ZVN B;  3PTZ A;  3CX5 H;  4AYC A;  2E76 B;  1BDC A;  3P8C E;  1PGP A;  4W80 A;  3RK3 E;  5AW5 B;  3L73 D;  3D70 A;  1OVR A;  3B5N D;  3AE6 C;  4DOJ A;  3GW6 A;  5TJH A;  4HJG H;  1ZOY C;  1R8E A;  1P84 I;  2AEM A;  5DJU B;  1T3J A;  1FAV A;  2RN0 A;  2PFX A;  1KQS O;  1NJI Q;  2FFD C;  1RF1 C;  1K8A Q;  4Y28 J;  3CCS P;  1S72 P;  4YXD C;  2IYO A;  4YPC A;  4A7P A;  2E75 B;  5APW A;  3H1H D;  3KDP B;  1SQP J;  2HLO A;  1U7J A;  2E74 D;  4EOT A;  2K37 A;  4D6T D;  1EXI A;  1PPJ G;  1IFM A;  2R5D A;  2B87 B;  4HH2 A;  4GT1 A;  1SQQ E;  3R4Y A;  4ASW A;  1RE3 C;  5AVT B;  3A0H H;  2Q5U A;  2YO2 A;  1XTC C;  3I56 P;  1Y8A A;  2BCC D;  2O1K A;  4KHX A;  1UII A;  3RK2 B;  3MIW A;  3PJS K;  1DD3 A;  1BCC E;  1BSH A;  2Q1K A;  1BE3 D;  2QM8 A;  1SQP K;  1SQV J;  1Q86 Q;  1EZV I;  1ZRT E;  2AXT H;  1HWT C;  1LTG C;  3IF4 A;  1FZC A;  2WSE J;  2L91 A;  2R44 A;  3L36 A;  4H13 C;  2NPS D;  3Q2Y A;  2N1T B;  1PP9 J;  1JNM A;  1Q7Y Q;  1JY2 P;  2WZ7 A;  4IL6 X;  1ZR2 A;  1EZV G;  5AVV B;  1P84 E;  2ZYA A;  1ZV8 A;  5KLI C;  3EFG A;  3TNU B;  4ZNC A;  3PRJ A;  1HGV A;  1L0N D;  4JPZ B;  1SQV K;  2B9B A;  1YYC A;  2DW3 A;  3SSU A;  3CME P;  2HPC B;  3O6Q B;  2C0W A;  3AE5 C;  1PPJ E;  3HUS B;  2M3B A;  2FYU J;  3RL0 D;  2IBZ I;  1N8R Q;  1ZXG A;  1LTJ B;  1KB9 H;  3V6I A;  2YMK A;  1LT1 A;  3L73 J;  3G9R A;  2FKW B;  2FYN C;  3VOP A;  1L0L E;  1S9K E;  2IBZ G;  3CMA P;  1KD1 Q;  2OYH A;  2HG5 D;  5GTH E;  1BCC D;  4KT0 J;  3U1A A;  1J1E C;  1KN7 A;  1T2K D;  2OYI A;  3Q5S A;  2JR8 A;  4LC1 A;  3FGA D;  4IFD K;  3L37 A;  1SQP G;  1YJW P;  2FYU K;  1KQG B;  2QJY C;  1H0T B;  3H1H J;  1SFC C;  3GHG C;  1FOS E;  4OVN F;  1VF5 C;  4WY4 A;  2OTK E;  1LP1 A;  2JKV A;  4XA4 A;  2ZT9 B;  4HB1 A;  4D6T J;  4I7Z C;  1EZV E;  3MD0 A;  1GL2 C;  1JCC A;  1FZE A;  3L72 D;  2I1K A;  2Q9I A;  1WMK A;  2P10 A;  1AV1 A;  2KI7 B;  3NMD A;  3JCU H;  2BCC J;  4XFJ A;  4PV1 D;  2KNC A;  1SQV G;  1NTM D;  2IZ1 A;  5APU A;  3B4S A;  2CPS A;  3VYI A;  4WBA A;  1M57 D;  2OQQ A;  2WTY A;  3SFD C;  1YHQ P;  3HTK A;  3B8E B;  1BE3 J;  2KXP B;  3CWB D;  1N7S A;  5CCH C;  4PJ0 H;  1FOS F;  5AVS B;  2IDB A;  2YKP A;  2QE7 H;  2Z4E A;  1PP9 G;  3L70 D;  1RF1 A;  2KB7 P;  3H1K D;  1NWQ A;  1G2C A;  2JDI H;  3WMM 0;  3HD7 A;  4K35 A;  3CI9 A;  1ZLL A;  2Q6Q A;  1URQ C;  2WT7 B;  1VPC A;  1WT6 A;  3R2P A;  2M8R A;  4JQ0 D;  1SQP E;  3AEB C;  2C9L Y;  5CBN A;  1HTL C;  1Q81 Q;  2YKQ A;  2N9B A;  5H2F H;  2CK3 H;  1LT9 B;  2FYU G;  1M1J C;  4Z1M H;  5CHX A;  1L0N J;  1RE3 A;  3RL0 B;  1NTK E;  4OGQ C;  2QJP C;  2WSC H;  3L73 G;  4RES B;  2NZ2 A;  4L76 A;  3V2R A;  1J2J B;  5AW7 B;  1GK4 A;  1VQ9 P;  5AW9 B;  2WIT A;  1KIL D;  3KQG A;  1SQV E;  1QLE D;  2XU6 A;  4WY4 D;  1VQO P;  5APV A;  1EDL A;  3AE2 C;  1BCC J;  1H89 A;  3VMY A;  1KFM A;  3H1H G;  4LLH A;  1IO4 A;  3V2N A;  1L0N K;  1JCD A;  1PP9 E;  2E5Y A;  1S1C X;  3A0B H;  4GOE A;  4Y99 B;  2V7Q J;  3JC2 2;  4D6T G;  4W7Z A;  2Y9Z A;  1GW4 A;  2QIW A;  4BWN A;  1DD4 A;  1N73 C;  1JUN A;  1P84 H;  4WWI A;  1YIT P;  1S4X A;  1JY3 N;  3PP5 A;  4YXW H;  2RMZ A;  5BU8 B;  3W67 A;  2B89 A;  2BCC G;  3MP7 B;  3KZI E;  3N4X A;  3S9O A;  3T97 A;  1OZH A;  1NTZ D;  1FJK A;  1R5S A;  3L72 J;  2FYU E;  4PV1 B;  3M91 A;  1IJD B;  4GIF A;  2XNX A;  2SPZ A;  2YMY A;  1N86 A;  1BE3 G;  3A2A A;  2KIK A;  3L73 E;  1FU1 A;  1KYO D;  3CCE P;  1NTM J;  1GK6 A;  1NTK D;  3CCJ P;  3G71 P;  4OWF A;  4N78 D;  3N7N A;  5TIS E;  2QJK B;  4N6J A;  2Y0E A;  1MFT A;  3CWB J;  5B66 E;  5GTH H;  2FY8 A;  1IK9 A;  2FYZ A;  1YQ3 C;  3L70 J;  1PGO A;  1JO5 A;  5BU5 A;  5CCG C;  3H1K J;  1VQ7 P;  4H44 C;  3MTU E;  1L0L J;  1MV8 A;  4PD4 D;  5AVY B;  1QEX A;  3PHL A;  3H1H E;  3GHG A;  5AW4 B;  2LKM A;  1JY3 O;  2FBW C;  1CI6 A;  1L0N G;  5KKZ B;  3G6E P;  1KOR A;  1NTM K;  5M1B A;  5AW1 B;  2AEF A;  4D6T E;  4JYC A;  5L8R J;  2HOD B;  2OYH B;  1WRG A;  1M56 D;  2OYI B;  1EDK A;  1IFI A;  1M7L A;  3C9I A;  5KAF E;  2BCC E;  4H13 D;  3AED C;  1L0L K;  1FBM A;  3G3Z A;  1PZQ A;  1KIL B;  1PIX A;  2K9J B;  3SWF A;  2OTL P;  2I1J A;  1IK7 A;  4WY4 B;  3V2Q A;  1BCC G;  3Q5R A;  1BE3 E;  4N3Y B;  5CCH A;  2O3J A;  2ZAE B;  5KLV D;  1RQU A;  3H32 A;  2J59 M;  4ZMD A;  4GOD A;  5AVR B;  4JYB A;  1GU4 A;  1AVO A;  2WVR A;  1URQ A;  1N7S C;  4GKG A;  4IFM A;  1KTM A;  3V4Q A;  2AXC A;  4H0L C;  2O1J A;  3L75 D;  2O01 J;  1GTW A;  2H8P D;  2JWD A;  4NPE A;  1RY3 A;  1QX8 A;  4BRY A;  3HD7 C;  3L72 G;  1M1J A;  3CL3 D;  3NXS A;  2XND H;  1L0N E;  2E75 C;  2FFD B;  1RF1 B;  2JWA A;  2ZYD A;  3L74 D;  4BXL A;  1NTM G;  1NTZ J;  4NPF X;  2D2C C;  3V4W A;  4DCK A;  2K9Y A;  1KMI Z;  3CWB G;  1LTB C;  1SFC D;  1NTK J;  1VF5 D;  3L70 G;  2E43 A;  1X79 B;  3RL0 g;  1HH0 A;  3H1K G;  1GW3 A;  1L0L G;  2HYN A;  1PFI A;  3MGN A;  3LW5 J;  1FZA A;  1ZW0 A;  2AEJ A;  3GF3 A;  3VMX A;  2WSE H;  4C7R A;  3KXD A;  1GL2 D;  1OXZ A;  3H6P A;  1TU3 F;  2M5A A;  2A06 D;  3HE5 A;  2YIU B;  1NTZ K;  1HUC A;  3B71 A;  1L4A B;  1VL2 A;  1N73 A;  1NKN A;  2I8D A;  2ZVO B;  3BVH A;  3L35 A;  4IOI H;  3L71 D;  1Q2N A;  1NTK K;  2KS1 A;  5CCH D;  3KZI H;  3M0D A;  3A5T A;  2P7J A;  4IL6 H;  1AQ5 A;  3L72 E;  3O8Z A;  3VMA A;  1OIP A;  1GU5 A;  4UB8 E;  2Q3I A;  1U57 A;  2OYO A;  3U1C A;  1URQ D;  1NTM E;  1J1D B;  2Q7C A;  4U7J A;  5TIS H;  3AEE C;  3F5H A;  1JTH A;  1SS1 A;  3CCQ P;  1AQT A;  3CWB E;  2ZXX A;  5KTB A;  3HUS C;  1BSN A;  2ZYG A;  2JP3 A;  2A45 I;  2G3A A;  3B5N B;  3L70 E;  1JY3 P;  3T97 B;  5CCG A;  1RHZ B;  3H1K E;  2K3R A;  4OGQ D;  3AE8 C;  3E1R A;  3LID A;  4EDF A;  1NKZ B;  1OX3 A;  4QMA A;  4U3F D;  1IFJ A;  2FYN B;  1IZN B;  3U59 A;  1OW8 A;  3HE4 B;  3WUV A;  1N2D C;  1W2B O;  2A45 G;  3L75 J;  1IC2 A;  5E79 E;  2L5G B;  1NTZ G;  3HRN A;  1H88 A;  4KJM A;  4OH8 B;  1QGK B;  1ZP0 C;  1MFZ A;  1NVO A;  1J1E B;  2E74 B;  5KLV K;  3L74 J;  1NTK G;  3WUT A;  4PD4 I;  3H1L D;  1HJB A;  4RJT A;  1SFC B;  2ZJS E;  1IFP A;  1OVU A;  2ZT9 C;  3L4F A;  1OFC X;  4C7N A;  1VF5 B;  3AEF C;  1LWU B;  4L75 A;  3QH9 A;  4CPG A;  3CCU P;  2WMM A;  1KIL E;  2P2U A;  1FE6 A;  3Q1M A;  4I7Z B;  3CLQ A;  1LTA C;  1KQF B;  1GL2 B;  4I2L C;  1OWA A;  3E1I A;  2WWW A;  3H1I D;  3PH0 A;  2WQY C;  2IFM A;  3FX0 A;  1RE4 A;  3RK3 C;  2W6B A;  5AW8 B;  5CJ0 A;  1EXJ A;  5CJ4 A;  1PGJ A;  2NPS B;  3CCR P;  3NFQ A;  4RO0 A;  1USD A;  5AVZ B;  3L71 J;  3QWO C;  3W68 A;  4EIJ A;  1VQP P;  2PRR A;  2QVA A;  1QVF O;  1NTZ E;  1R5L A;  4EI2 A;  5CCG D;  1YBK A;  3II6 A;  1URQ B;  4H44 D;  3I55 P;  1VQ4 P;  1LT9 C;  1KYO E;  1SQX D;  1JM0 A;  3GG2 A;  1MKM A;  4N78 E;  2C9N Y;  2P1J A;  1HGZ A;  3VP9 A;  3G4S P;  1VQM P;  5GTI E;  3M06 A;  1K04 A;  3P8M C;  1FDM A;  2QJP B;  4DZO A;  1EQ7 A;  2W8Z A;  2W83 C;  3CD6 P;  2PP6 A;  3L75 G;  3CCV P;  4PD4 E;  2V7Q H;  1IFN A;  5BVZ A;  3IAO A;  4U3F J;  2ZXE B;  3EFF K;  5AW6 B;  3CCL P;  1NH4 A;  2FXO A;  3A3Y B;  3H1J D;  3VP8 A;  3WU2 E;  2HR3 A;  4XE5 B;  3AEC C;  2PGD A;  3A0H E;  2JO1 A; 
#chains in the Genus database with same CATH homology
 3M9H A;  3UIA A;  1SQP K;  1JY2 N;  1SQB K;  3TK1 A;  1L0L K;  2IPP A;  1FBM A;  3G3Z A;  1CSB A;  1NAF A;  1KIL B;  4Y99 C;  1HWT C;  2POH A;  3SWF A;  1LTG C;  5AW0 B;  1KQL A;  2I1J A;  2VRS A;  3P7K A;  5AW2 B;  3VTP C;  4WY4 B;  3V2Q A;  5APY A;  1FZC A;  3TYY A;  5CMZ A;  4N3Y B;  5CCH A;  3L36 A;  2NPS D;  2N1T B;  3EQ2 A;  5KJ7 D;  1NHL A;  1N7S D;  3TNU A;  1JNM A;  1N73 B;  1JY2 P;  2WZ7 A;  3M0D C;  1FZB A;  3H32 A;  2J59 M;  1LTI C;  1FZC B;  5AVR B;  1ZR2 A;  4JYB A;  3LIE A;  2XZR A;  4I1L A;  2HPC A;  5AVV B;  4AUW A;  1MZ9 A;  2NPS C;  1GU4 A;  3RK3 B;  3HUS A;  5KJ7 C;  2J58 A;  1ZV8 A;  1URQ A;  1N7S C;  3EFG A;  1FZG A;  3HD7 D;  4GKG A;  3TNU B;  4IFM A;  3SWY A;  3V4Q A;  1HGV A;  1X9V A;  1RF0 A;  3H32 B;  1SQV K;  2FFD A;  2O1J A;  1YYC A;  2HPC B;  3V2P A;  2C0W A;  1GTW A;  3HUS B;  2H8P D;  2M3B A;  3RL0 D;  1RY3 A;  1S9K D;  2H43 A;  3HD7 C;  1M1J A;  3CL3 D;  3NXS A;  1LTJ B;  1DH3 A;  3M9B A;  1NU1 K;  2FFD B;  1RF1 B;  1SP4 A;  2FKW B;  2P67 A;  3RL0 C;  3VOP A;  2R5B A;  1G1J A;  2IX7 C;  3V4W A;  1S9K E;  1M1J B;  2OYH A;  2HG5 D;  2W6A A;  1LTB C;  1SFC D;  3U1A A;  1J1E C;  1T2K D;  2OYI A;  4LC1 A;  3A7O A;  2E43 A;  1X79 B;  1HH0 A;  4IFD K;  3L37 A;  1GW3 A;  1KFN A;  2Z5I A;  1JMM A;  1G1I A;  2CPB A;  2HYN A;  1PFI A;  3MGN A;  1LTS C;  2FYU K;  1FZA A;  4JF7 A;  1SFC C;  3VMX A;  2WSE H;  3GHG C;  1FOS E;  1T2K C;  1L4A A;  4C7R A;  1AFO A;  1GL2 D;  2Z5H A;  2YO3 A;  4WY4 A;  3VN0 A;  3I5C A;  4W7Y A;  1OXZ A;  4ZKP A;  4XA4 A;  3H6P A;  1FZF A;  1GD2 E;  1XTG B;  3IR9 A;  2KYV A;  3HE5 A;  1NTZ K;  2N1T A;  1HUC A;  5APX A;  3BRT B;  3MD0 A;  2WPS A;  1L4A B;  1N73 A;  1NKN A;  3BVH A;  2R3C A;  1GL2 C;  1JCC A;  1FZE A;  1QL1 A;  2I1K A;  1A02 F;  3L35 A;  2Q9I A;  2C0X A;  2W27 A;  3HE5 B;  3NMD A;  1NTK K;  1GZL A;  5CCH D;  3KPE A;  3M0D A;  5APU A;  3A5T A;  2O01 H;  2HFE D;  5AW3 B;  2P7J A;  1AQ5 A;  2CPS A;  3VYI A;  1T3U A;  3O8Z A;  4WBA A;  2WTY A;  1MUU A;  5AVQ B;  3HTK A;  1FZC C;  1SQQ K;  1SQX K;  3B8E B;  5APS A;  1N7S A;  2JEE A;  1GU5 A;  5CCH C;  2Q3I A;  2A45 H;  5APQ A;  1RE4 C;  1FOS F;  5AVS B;  1GDT A;  2YKP A;  2Z4E A;  2WT7 A;  3U1C A;  1URQ D;  1LTJ A;  4C46 A;  2WSF H;  3TSI A;  3B5N A;  2E42 A;  1J1D B;  2Q7C A;  1RF1 A;  2KB7 P;  1NWQ A;  1G2C A;  4AQR D;  1JTH A;  3HTK B;  3WMM 0;  1N7S B;  3HD7 A;  1DX7 A;  2GUV A;  3CI9 A;  1ZLL A;  5KTB A;  3HUS C;  2YKO A;  3BRV B;  1URQ C;  2WT7 B;  1LT9 A;  1VPC A;  1WT6 A;  1HBW A;  1NO4 A;  2A45 I;  3R2P A;  3B5N B;  1JY3 P;  2M8R A;  5CCG A;  1G2C B;  1RF0 C;  3HE4 A;  1JTH B;  1JY2 O;  2C9L Y;  3HD7 B;  5AVX B;  1HTL C;  2YKQ A;  2H7H A;  1LGH B;  3LID A;  1NKZ B;  3LW5 H;  2GM4 A;  2WPQ A;  2OAR A;  2N9B A;  1LT9 B;  1DEB A;  1M1J C;  1ZR4 A;  1Z56 A;  1IFJ A;  5CHX A;  1YTZ T;  3U59 A;  2R32 A;  1RE3 A;  3HE4 B;  3RL0 B;  3VMZ A;  1N2D C;  2PAJ A;  2A45 G;  2WSC H;  3RK2 D;  1IC2 A;  2ZFC A;  4RES B;  3V2R A;  1J2J B;  2L5G B;  3HRN A;  5AVW B;  1H88 A;  5AW7 B;  1HVV A;  1KZU B;  4OH8 B;  1A02 J;  1GK4 A;  1MFZ A;  1SFC A;  1E5W A;  2QM7 A;  1JOC A;  2FXM A;  1J1E B;  2XDJ A;  2OYH C;  5AW9 B;  3RK2 C;  1LWU A;  1ZN5 A;  2WIT A;  3V5B A;  5KLV K;  3OA7 A;  1KIL D;  3KQG A;  2OYI C;  1L4A D;  1N7L A;  2WPR A;  4M3L A;  3IFM A;  2XU6 A;  4WY4 D;  5APV A;  1HJB A;  1SFC B;  1SVF A;  3L4F A;  4C7N A;  2MJZ A;  1LTT C;  1GL2 A;  3BAT A;  2N1T D;  1LWU B;  3KYQ A;  1W2E A;  1VDF A;  1T8Z A;  1H89 A;  3VMY A;  1KFM A;  1KIL C;  1L4A C;  4LLH A;  1IO4 A;  3V2N A;  2P2U A;  1L0N K;  1JCD A;  4WY4 C;  3P32 A;  3P8C D;  3CLQ A;  1LTA C;  4Y99 B;  4C7N B;  3RK3 D;  2N1T C;  3M0A A;  1GL2 B;  2YNY A;  4I2L C;  1CW5 A;  4W7Z A;  2KSJ A;  1GW4 A;  1CZQ A;  2KLV A;  1OWA A;  2IFN A;  3M9Q A;  3E1I A;  1N73 C;  1JUN A;  2NPS A;  2WWW A;  5KJ7 A;  4AYC A;  2BAS A;  2IFM A;  1RE4 A;  1JY3 N;  3PP5 A;  3P8C E;  3RK3 C;  2JJL A;  4W80 A;  4ZKU A;  5BU8 B;  2W6B A;  5AW8 B;  5CJ0 A;  5AW5 B;  1SLQ A;  5CJ4 A;  1H8A A;  3N4X A;  4O9B A;  3T97 A;  2NPS B;  1FJK A;  3NFQ A;  3NTN A;  1FJP A;  1J1D C;  3B5N D;  4DOJ A;  5AVZ B;  3M91 A;  1IJD B;  2KP8 A;  1T3J A;  4GIF A;  1FAV A;  2XNX A;  4I6M C;  2YMY A;  1N86 A;  4EIJ A;  5APT A;  1QL2 A;  3A2A A;  2GUS A;  1FU1 A;  1GK6 A;  1LTJ C;  3B5N C;  4N78 D;  2FFD C;  1RF1 C;  3N7N A;  5CCG D;  4N6J A;  3II6 A;  1URQ B;  3OJA B;  3BAS A;  5APW A;  1IK9 A;  2FYZ A;  1LT9 C;  2XKM A;  3KDP B;  1JO5 A;  5BU5 A;  4N78 E;  5CCG C;  4WB4 A;  2HLO A;  2C9N Y;  2P1J A;  3MTU E;  1HGZ A;  1MV8 A;  4EOT A;  3VP9 A;  5AVY B;  3M06 A;  1X8Y A;  1YTZ I;  1IFM A;  4HYT B;  2R5D A;  3MUD A;  3P8M C;  2HOD A;  4HH2 A;  1FDM A;  4GT1 A;  3GHG A;  5AW4 B;  2LKM A;  4DZO A;  1EQ7 A;  1JY3 O;  1RE3 C;  5AVT B;  1CI6 A;  2Q5U A;  2YO2 A;  1XTC C;  1NTM K;  2PP6 A;  5AW1 B;  4JYC A;  1IFN A;  2O1K A;  2HOD B;  4KHX A;  2OYH B;  5BVZ A;  1WRG A;  2ZXE B;  3GHG B;  1IFD A;  3RK2 B;  5AW6 B;  3MIW A;  4IFF A;  1NH4 A;  3A3Y B;  1KIL A;  3VP8 A;  2OYI B;  1CI6 B;  2XV5 A;  5AVU B;  1IFI A;  3OAK A;  1LWU C;  1M7L A;  4B86 A;  4XE5 B;  2KOG A;  3C9I A;  2QM8 A;  4LGD E;  1NOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...