1LTGC

The arg7lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the a subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Arg7Lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the A subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
molecule keywords HEAT-LABILE ENTEROTOXIN
total genus 14
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1995-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltgC00
1HTLC 1LTSC 1LTAC 1LTIC 1LTGC 1LTTC 1XTCC 1LTBC
chains in the Genus database with same CATH superfamily
2Y0DA 3MD0A 2CPBA 1SVFA 3LW5J 5B66H 3AE3C 3P8CE 5KJ7D 2KK7A 2NPSC 2XKMA 1DEEG 1KYOD 1EZVG 1L4AA 4EI2A 1FJKA 1VQNP 2FYUD 4H13C 2UWJE 2E76D 3L37A 4N3YB 3WUVA 4JPZB 4L74A 5E79E 2GUVA 5APWA 3MHVA 3JSVC 3FGAD 1YJ9P 2R5DA 2O01H 5AVZB 3NMDA 2M0BA 4A7PA 3B5NA 1NTZE 1BCCJ 4WVZA 2WSEH 1NTKK 3HTKB 1T2KC 3M9BA 4L73A 1JM0A 2HYNA 1USDA 2Q3EA 4H0LD 3JC22 3ZDMA 3I55P 2W27A 3G6EP 4KT0J 3TSIA 1SQVG 2FYNB 4I1LA 2ITAA 2KS1B 3A7OA 1JB0J 3CL3D 3CCUP 1KB9D 1GW4A 1RQVA 2Y9YA 3D6ZA 3AEBC 3PH0A 1KB9I 4DCKA 2R44A 1GDTA 5KAFE 3L72D 2V4HA 1OVVA 2Q6QA 1L4AC 5L8RJ 2SPZA 3FWLA 3VMYA 1KB9H 2QRXA 3RL0B 1S3JA 5K5GB 2FYUG 3M91A 3WU2H 3F89A 2V7QH 1ZW0A 3RK2C 5AW4B 1LTGC 3Q3DA 1J1EB 1VQ4P 1NTKG 1GL2C 2HLOA 1YBKA 1NU1D 3GF3A 1NJIQ 2KSEA 1JMBA 4OGQD 1L0NE 2P1JA 4H44C 4R4MA 3U1CA 1JNMA 3L72G 1L4AD 2FXPA 5CCHA 1FZCA 4CPGA 2WPQA 1T3JA 3L73G 3CCLP 1NKZB 1ZV8A 2P10A 1QL1A 3H1HG 4OVNF 5CHXA 1PP9E 3AEGC 3PP5A 1BCCG 3C8VA 3H1KD 3L75D 1RF1C 1DD3A 2B88A 2WPRA 4U3FG 3N7NA 1X22A 2GA1A 1OZHA 4N6JA 1KD1Q 3P8MC 1Q90D 1RF1B 2OYHB 3H1JJ 5KLVG 3H1JE 3H1KJ 3H1HE 3L35A 2BCCJ 3L75J 3Q2YA 4D6TD 2WSFH 2KUBA 2O1JA 2XV5A 2ZVOB 3HUSB 1H89A 3B4SA 2WT7B 1N2DC 2JWDA 1FJPA 3O6QA 2A06D 3JCUH 2G3AA 4WY4A 3U59A 3L73J 3AE4C 2L91A 1M1KQ 2E42A 2P7JA 1DD4A 3AE5C 1IFJA 3C9IA 1JY3O 1R5SA 1J1EC 3L71E 4C7RA 1KV4A 3RK2B 3TNUB 5B66E 3H6PA 2AEMA 2B89A 1GL2A 3V2RA 1DH3A 3P8CD 1L4AB 3NTNA 1HJ0A 4C7NA 4GDOA 3W67A 2H88C 2KNCB 3L36A 5AW6B 3AE9C 2YXRB 2K9JB 3RK3D 1GTWA 1SQVK 3Q5PA 1YITP 2FYZA 3L70G 2WPSA 1AVOA 2HODA 5GTIE 5H2FH 2H89C 2IYOA 3V2NA 1YYCA 2G8YA 1L0LJ 1YTZI 3H1IG 3O8ZA 3T97B 3V5BA 4B86A 1VQ6P 2IBZG 2KLUA 3B5ND 1DIPA 1K8AQ 1RE3C 1VPCA 1S1CX 1RY3A 2N9YB 1M57D 3D71A 1PPJE 1UIIA 4WB4A 1NAFA 2IPPA 1URQC 2OYOA 2QM8A 5M1BA 1LT9C 3CI9A 1YQ3C 2BCCG 2XDJA 1GU4A 1BGYE 1VQ8P 1LWUC 1KILC 4H0LB 1NTKE 2P67A 2WITA 2D2CD 3AE7C 3HE5B 4Y99C 3B5NC 1YHQP 1IK9A 1L0NG 3WUUA 3E1RA 5EFWB 2IBZD 4H44D 3BCCG 1JY3P 2ZXEB 1EDKA 2NPSB 3C1LA 3A3YB 3TGUG 5CCHD 1SLQA 3CXHE 3V4WA 1KC8Q 2IDBA 2YO2A 2LXBA 1NTZK 3L71D 3IAOA 5AW2B 1FAVA 2D2CB 3R2PA 1PZQA 3E1IA 2PGDA 2N1TD 2WSCJ 1S9KE 2WZ7A 1N7SC 1AV1A 1MFZA 3CWBD 2IZ0A 1SQBE 3K5BA 1E5WA 1OW8A 3VMXA 1EC5A 1SQQG 2J5UA 3AE8C 3MP7B 5KLVK 2WTYA 1FZCB 3D6YA 3RK3E 5AW5B 4PJ0E 3QH9A 1SFCD 1HGZA 1RQUA 3H1KG 3L75G 4HJGH 5B5EH 4LLHA 1LTTC 3A0HE 3GHGC 1NTMK 1S5LH 3SWFA 1SQPE 3CPWO 2OYHA 1M8OB 2K3RA 2YIUB 1EXJA 2N1TA 2L5GB 1NTZD 2IFMA 2E76B 1P84I 5KLVE 1KFMA 3HUSA 4M3LA 1N7SB 3G4SP 3TYYA 4WWIA 2FXOA 3RGUA 4I2LC 2KYVA 4W7ZA 2WSSH 3GLMA 2WT7A 1NYHA 1URQD 2WMMA 3CCQP 1NGMB 1N73A 1P84H 1KYOH 4H13D 2R5BA 1PGOA 1SQBK 1BE3J 1NOHA 2Q5UA 4UB8H 1M1JB 3SSUA 1YJNP 1LP1A 2ZVNB 1KILE 1UIXA 2BEQD 2QJKC 3TNUA 4GKGA 1RE4A 1P84D 1N73C 2KP8A 4Y99B 2PAJA 1GL2D 2QSIA 1KILB 4C7NB 3I5CA 3AE1C 3AEFC 1USEA 4ZMDA 3RK2D 2RN0A 2K9JA 1XTGB 1URQB 3VP8A 3EQ2A 3W68A 1GMJA 3TDKA 4K3AA 5AVXB 4IFDK 1G1IA 3KZIE 3H32A 3MUDA 4HKZH 1N86A 1AQTA 1KQFB 1AQ5A 2OGUA 1ZR2A 2J59M 2HPCA 3GMAA 2YNYA 2KIKA 3CD6P 2E75C 3H1JG 3VMZA 1JCCA 1IO4A 2CPSA 2KI7B 1AA0A 2C0XA 4OGQB 4XFJA 4EYYQ 3KXDA 1BCCD 1NO4A 2CK3H 1U57A 1U7JA 3MIWA 1VDFA 3CX5D 4PD4H 4PV1B 2BCCD 2ZT9C 3Q5RA 1HJBA 5GTHE 3TGUJ 1FOSE 3KQGA 1LTJC 1BGYD 2W8ZA 3S4RA 2E43A 4DT0A 1BSHA 1L0ND 2J58A 2KSJA 5KAIE 1PV3A 2JEEA 3BCCD 1NTMD 3H1JD 3LW5H 2W83C 4JBZA 1LGHB 5C39A 2JWAA 2YXQB 1BE3G 1SQQK 1PGQA 2A06G 4D6TJ 3BCCE 1M56D 3Q5SA 1VQ9P 1GK6A 1OIPA 3CX5I 2ZYDA 1SQBJ 5AVVB 4W7YA 3V2QA 1MFTA 2W6BA 1KMIZ 2M5AB 3L71J 2JO1A 2NPSD 3CWBG 3HUSC 1LWUA 2K88A 4IL6E 1Y47A 3AEEC 5KLIC 1QGKB 3CCEP 2K1AA 1LT9A 2ZT9B 3PHLA 3H1HD 3VP9A 2N1TC 1T6AA 2YKOA 5AVWB 2OYIB 2XZRA 2OYHC 1WRGA 5TJHA 5BVZA 3CCJP 1Q82Q 1VQPP 1OVUA 2OARA 3USSA 1S5LE 3M0DA 3S1KA 1NU1K 3FWNA 2JDIH 5BU8B 1LTIC 1OWAA 2HG5D 2E74B 4BRYA 2GM4A 3CX5H 1FBMA 1FC2C 2ZT9D 4H44B 3S9OA 2Q3IA 1N7SA 3IFMA 3MGNA 2LKMA 1VQ5P 1FZAA 2QM7A 2ZFCA 4RESB 3CC2P 1PPJD 2YKPA 1N73B 2VRSA 1IFMA 3EWKA 5AVSB 4TLFA 2PP6A 3A2AA 4UB8E 2FFDB 2OYIC 3RL0C 1LTAC 1NTME 1OX3A 1M7LA 1BDCA 1M1JC 3AEDC 3RL0g 2A45G 2YMKA 5TISH 1H0TA 1SQBG 2MJZA 1NH4A 5APYA 3H1LD 1VQOP 1QEXA 1JY2P 1VQLP 1KILA 1SQPK 1IFPA 2IYPA 5APSA 4WBAA 1HUCA 1NU1G 1SFCC 2MKVA 2JP3A 3H1LE 1QVFO 2E76C 1URQA 4QMAA 3PJSK 5AW3B 3H1ID 5AW0B 5DJUB 1RE3A 2N9BA 2WSCH 1X0TA 3H1IE 2B87B 3G71P 1TU3F 2RMZA 2IBZE 4GOFA 2KS1A 3H1LG 5AVUB 2PFXA 1YI2P 3VOPA 1CSBA 2KZIA 2RH0A 4IFMA 4DZOA 2A06E 3H1HJ 2QG4A 3JCUE 3L72E 3KHUA 4K35A 1VF5B 1BCCE 2ZXXA 1LNQA 4LGDE 5CCHC 1FZCC 4H13B 3FXDA 1S5LX 4YTPC 1Q81Q 1KQGB 3IR9A 3FX0A 2LR2A 1SQPD 1Q2NA 2AXTH 2NZ2A 4IFFA 1JY2N 2D2CC 3L70J 4D6TG 1GU5A 1LTBC 4Y28J 3OJAB 1AFOA 4UB6E 1ZR4A 3HD7D 2H43A 2O1KA 1FDOA 1EQ7A 1JY3N 1VF5D 2R3CA 3L72J 3L74J 3MZWB 1BSNA 4KHXA 4ZNCA 1KORA 5E79H 5CBNA 1BE3E 5CMZA 2Z4EA 2E5TA 3CLQA 1MZ9A 4WY4C 4AUWA 3F5HA 2M5AA 3LIEA 4IL6H 1SQXK 5CJ0A 2YO3A 1R8EA 1N7SD 1PGPA 3B71A 3H25A 4JQ0D 3CCSP 2DW3A 2WSFJ 1SQQE 1HTLC 1W2BO 5CJ4A 1RF0C 2OTLP 4GODA 1L0NK 2WPVB 1K04A 1L0LD 1PPJG 2QEXP 1ZMEC 1SQVJ 1NVOA 3LIDA 1HWTC 2O01N 3A0BE 1NTZG 1SFCB 5KAFH 5APVA 1K9MQ 1EZVD 1ZN5A 1MUUA 4I7ZC 2WVRA 4ASWA 1SQXE 1CZQA 1VQ7P 3WU2E 3CCMP 1K73Q 1OXZA 1S4XA 1T8ZA 3CXHD 2Z5IA 3L70E 2FYUJ 2E74D 1OW7A 4YXWH 5CCGA 3AE6C 1IK7A 2ZAEB 2FFDA 2FFDC 3L74G 1Q86Q 2XNDH 1T2KD 5CCGC 3EFFK 3KPEA 3V6IA 3TGUD 4Z1MH 1NTMG 2RKLA 2Y0EA 2Z5HA 2KNCA 1H88A 1BE3D 3RK3C 1YIJP 2FYUE 3CXHI 2JJLA 3II6A 3P7KA 5KKZC 2FY8A 3WMM0 2HODB 4HH2A 4W80A 1HF9A 2K37A 1SQXJ 4EOTA 3PRJA 1J1DB 1NAYA 1ZOYC 3NXSA 3OA7A 4JYBA 1SQQD 1SQVE 1N7LA 5CBOA 2QIWA 3N4XA 5KLVJ 2H8PD 1VL2A 1RF0A 1SP4A 1ZRTE 3O6QB 4PD4E 1OVRA 1PIXA 1SQQJ 1RH5B 1X8YA 1ZP0C 5AVTB 2QE7H 3BRTB 5BU5A 3RBZA 1G1JA 1U7MA 4HYTB 2E5YA 2KLVA 5GTHH 5KLIB 3HE5A 1X9VA 3OAKA 4JYCA 3SFEC 1L2PA 1P84E 3R4YA 5CCGD 2ZYGA 3VMAA 2V7QJ 1LT1A 2NPSA 1KILD 3CXHH 5APXA 1GL2B 3BASA 3GF7A 2C9LY 1JEKA 5AVYB 1LTJA 3BRVB 4GIFA 1SQPJ 1WT6A 4TT3H 1JUNA 2M8RA 1KYOI 1FZEA 5AW8B 1VF5C 1ZXGA 2QA4P 2I1JA 4L75A 4U3FD 3RBXA 4RJTA 2E75D 1QVGO 2LXCB 2FBWC 2JKVA 3L73E 1FS0E 4HB1A 5AW7B 2Q1KA 1EDJA 2Y0CA 1GK4A 1HGVA 1W5CE 1PP9G 1Y9BA 4MN4C 4PV1C 5H2FE 1ZLLA 2WQYC 4OGQC 3T97A 1VQKP 1G2CB 1PGJA 1VQMP 2B9BA 1T3UA 2YMYA 2IFNA 1KZUB 2GUSA 3EFGA 1NHLA 2E75B 3FXEA 3MUDC 2FYNC 4NPDA 1SQXG 2KOGA 4U7JA 5AVRB 1EXIA 3KDPB 4O9BA 3CMEP 5KTBA 2WWWA 2C9NY 3BATA 4L76A 1FU1A 4EDFA 1BDDA 2Y9ZA 1A02F 3M9QA 1JO5A 1D7MA 3HD7A 1SFCA 2A45I 1ZRTD 4JF7A 4AQRD 1XTCC 5AW9B 2Q9IA 3VTPC 1IFNA 1KB9E 4D6TE 2QVAA 4YXDC 1OMIA 5DJTB 5KAIH 1FDMA 3PTZA 4EIJA 2WSEJ 4N78E 2IX7C 1N8RQ 3Q1MA 2KB7P 1FZBA 1M1JA 4RO0A 3D70A 4N78D 4R4LA 4I6MC 3L70D 3WUTA 1L0LK 1BGYG 4BXLA 5APUA 3L74D 1NKNA 3G9RA 1MV8A 3RL0D 2XU6A 2M3EA 1SQBD 4GT1A 1QLED 1JOCA 2E74C 2KXPB 5KJ7A 3CMAP 3L74E 4XA4A 3SWKA 3TF5A 4U3FE 2AXCA 3TGUE 1DX7A 5GTIH 3V4QA 1CI6A 1QX8A 1K05A 1HBWA 1JTHB 2POHA 2W6JH 1S72P 2YIUC 3H32B 1Q7YQ 5B5EE 3HE4B 3A0HH 2HPCB 3CCVP 3GHGB 3CC7P 3M0DC 2M3BA 2N1TB 2OTKE 3IF4A 2ZJSE 1FDIA 1EDLA 3KYQA 1KTMA 3A5TA 2QJPB 4IL6X 2BCCE 1YJWP 3ITKA 3G3ZA 1NTKD 2PRRA 3VYIA 1L0LG 1JY2O 1GZLA 3H1IJ 4PD4D 2JR8A 2O01J 2K9YA 3CC4P 1A02J 1KQSO 1LP1B 1NU1J 2AXTE 1SQPG 2QJYB 3M9HA 2BASA 4OWFA 2YKQA 4NPEA 1W2EA 4WY4D 3H1KE 3L75E 5APQA 3OW2O 2OQQA 1LTJB 1IFDA 3AE2C 3B8EB 2P2UA 3V2PA 1R5LA 1BGYJ 4YPCA 1L0NJ 2KZJA 3HD7C 4RKUJ 1FZFA 3B5NB 3BCCJ 3HTKA 4ZKUA 4GOEA 4C46A 1LWUB 4H0LC 2O3JA 3SWYA 1KQLA 1HVVA 4DOJA 1KN7A 3CCRP 1Z56A 1LT9B 4PJ0H 2AEJA 4LC1A 1J1DC 2OYIA 3PLNA 2R32A 2AEFA 1G2CA 2OTJP 3BVHA 1SS1A 2C0WA 1KFNA 1IJDB 5KKZB 1SQXD 4BWNA 2R3SA 1FZGA 3P32A 3RK3B 2BEZF 3M06A 2HFED 3UIAA 3VN0A 2FYUK 3I56P 1HH0A 2ZYAA 5KLVD 3A0BH 3MTUE 4DJGA 1Y8AA 1IZNB 4BRYB 3ABVC 5KJ7C 1GW3A 5AVQB 1FOSF 1E79H 3HD7B 1NWQA 1SQVD 1KYOE 1EDIA 1NU1E 2QJKB 3AECC 5AW1B 2NRGA 4PD4I 1S9KD 3QWOC 1QL2A 4UB6H 1RE4C 4IOIH 1GD2E 1AVYA 2HR3A 2QJYC 1MKMA 1CW5A 1LTSC 2W6AA 1IC2A 4PV1D 4I7ZB 1NTKJ 5TISE 1YQ4C 1H0TB 1PP9D 4NPFX 1H8AA 2H7HA 2FKWB 3E7KA 2W90A 1FE6A 2IZ1A 1IFIA 1NTZJ 1PL5A 4ZKPA 1PP9J 2QJPC 3M0AA 1J2JB 1DEBA 1OW6A 1EZVI 3KZIH 3U1AA 2A45H 2FXMA 1RF1A 1CI6B 1JCDA 1OFCX 1JTHA 1L0LE 3NFQA 4KJMA 2Q7CA 3HE4A 1PFIA 3H1LJ 1WMKA 3HRNA 4U3FJ 3GHGA 5APTA 1YTZT 2I8DA 2B87A 1RHZB 1LJ2A 3L73D 4OH8B 1X79B 3AEAC 3TK1A 1AJYA 3IN6A 1S2EA 2P58A 3CX5E 4WY4B 2XNXA 4AYCA 4ASVA 1EZVE 1JMMA 3L71G 3L4FA 3SFDC 3CWBJ 3GG2A 1NTMJ 2IBZI 3CWBE 2I1KA 3GW6A 1M90Q 4XE5B
chains in the Genus database with same CATH topology
3MD0A 2CPBA 1SVFA 3P8CE 5KJ7D 2NPSC 2XKMA 1L4AA 1FJKA 4N3YB 3L37A 2GUVA 5APWA 2R5DA 2O01H 5AVZB 3NMDA 3B5NA 2WSEH 1NTKK 3HTKB 1T2KC 3M9BA 2HYNA 2W27A 3TSIA 4I1LA 3A7OA 3CL3D 1GW4A 1GDTA 1L4AC 3VMYA 3RL0B 3M91A 3RK2C 5AW4B 1LTGC 1J1EB 1GL2C 2HLOA 2P1JA 3U1CA 1JNMA 1L4AD 5CCHA 1FZCA 2WPQA 1T3JA 1NKZB 1ZV8A 1QL1A 5CHXA 3PP5A 1RF1C 2WPRA 3N7NA 4N6JA 3P8MC 2OYHB 1RF1B 3L35A 2WSFH 2O1JA 2XV5A 3HUSB 1H89A 2WT7B 1N2DC 1FJPA 4WY4A 3U59A 2E42A 2P7JA 1IFJA 3C9IA 1JY3O 4C7RA 1J1EC 3RK2B 3TNUB 3H6PA 3V2RA 1GL2A 1DH3A 3P8CD 1L4AB 3NTNA 4C7NA 5AW6B 3L36A 3RK3D 1SQVK 2FYZA 2WPSA 2HODA 3V2NA 1GTWA 1YYCA 3V5BA 1YTZI 3O8ZA 4B86A 3B5ND 1RE3C 1VPCA 1RY3A 4WB4A 1NAFA 2IPPA 1URQC 2QM8A 1LT9C 3CI9A 2XDJA 1GU4A 1LWUC 1KILC 2P67A 2WITA 4Y99C 3HE5B 3B5NC 1IK9A 1JY3P 2ZXEB 2NPSB 3A3YB 5CCHD 1SLQA 3V4WA 2YO2A 1NTZK 5AW2B 1FAVA 3R2PA 3E1IA 2N1TD 1S9KE 2WZ7A 1N7SC 1MFZA 1E5WA 3VMXA 1FZCB 5KLVK 2WTYA 5AW5B 1SFCD 1HGZA 4LLHA 1LTTC 3SWFA 3GHGC 1NTMK 2OYHA 2N1TA 2L5GB 2IFMA 1KFMA 3HUSA 4M3LA 1N7SB 3TYYA 2WT7A 4I2LC 2KYVA 4W7ZA 1URQD 1N73A 2R5BA 1SQBK 2Q5UA 1NOHA 1M1JB 3TNUA 4GKGA 1RE4A 1N73C 2KP8A 4Y99B 2PAJA 1GL2D 1KILB 4C7NB 3I5CA 3RK2D 1XTGB 1URQB 3VP8A 3EQ2A 5AVXB 4IFDK 1G1IA 3H32A 3MUDA 1AQ5A 1N86A 2HPCA 1ZR2A 2J59M 2YNYA 3VMZA 1JCCA 1IO4A 2CPSA 2C0XA 1NO4A 3MIWA 2OYIC 1VDFA 1HJBA 1FOSE 3KQGA 1LTJC 2E43A 2J58A 2KSJA 2JEEA 3LW5H 1LGHB 1SQQK 1GK6A 3V2QA 5AVVB 4W7YA 2W6BA 2NPSD 3HUSC 1LWUA 1LT9A 3VP9A 2N1TC 5AVWB 2YKOA 2OYIB 2XZRA 2OYHC 1WRGA 5BVZA 2OARA 3M0DA 1NU1K 5BU8B 1LTIC 1OWAA 2HG5D 2GM4A 1FBMA 3MGNA 1N7SA 2Q3IA 3IFMA 2LKMA 2ZFCA 1FZAA 2QM7A 4RESB 2YKPA 1N73B 2VRSA 1IFMA 5AVSB 2FFDB 2PP6A 3A2AA 3RL0C 1LTAC 1M7LA 1M1JC 2A45G 2MJZA 1NH4A 5APYA 1JY2P 1KILA 1SQPK 5APSA 4WBAA 1HUCA 1SFCC 1URQA 5AW3B 5AW0B 1RE3A 2N9BA 2WSCH 5AVUB 3VOPA 1CSBA 4IFMA 4DZOA 4LGDE 5CCHC 1FZCC 3IR9A 4IFFA 1S9KD 1JY2N 1GU5A 1LTBC 3OJAB 1AFOA 1ZR4A 3HD7D 2H43A 2O1KA 2R3CA 1EQ7A 1JY3N 4KHXA 2Z4EA 5CMZA 3CLQA 1MZ9A 4WY4C 4AUWA 3LIEA 5CJ0A 1SQXK 2YO3A 1N7SD 1HTLC 5CJ4A 1RF0C 1L0NK 3LIDA 1HWTC 1SFCB 5APVA 1ZN5A 1MUUA 1CZQA 1OXZA 1T8ZA 5CCGA 2Z5IA 2FFDA 2FFDC 1T2KD 5CCGC 3KPEA 1H88A 2Z5HA 3RK3C 2JJLA 3II6A 3P7KA 3WMM0 2HODB 4HH2A 4W80A 4EOTA 1J1DB 3NXSA 3OA7A 4JYBA 1N7LA 3N4XA 2H8PD 1RF0A 1SP4A 1X8YA 5AVTB 3BRTB 1G1JA 4HYTB 2KLVA 3HE5A 1X9VA 3OAKA 4JYCA 5CCGD 2NPSA 1KILD 5APXA 1GL2B 3BASA 2C9LY 5AVYB 1LTJA 3BRVB 4GIFA 1WT6A 1JUNA 2M8RA 5AW8B 1FZEA 2I1JA 5AW7B 1GK4A 1HGVA 3T97A 1ZLLA 1G2CB 2YMYA 1T3UA 2IFNA 1KZUB 3EFGA 2GUSA 1NHLA 5AVRB 2KOGA 3KDPB 4O9BA 5KTBA 2WWWA 2C9NY 3BATA 1FU1A 1A02F 3M9QA 1JO5A 3HD7A 1SFCA 2A45I 4AQRD 4JF7A 2Q9IA 1XTCC 5AW9B 3VTPC 1IFNA 1FDMA 4EIJA 4N78E 2IX7C 2KB7P 1FZBA 1M1JA 4N78D 4I6MC 1L0LK 5APUA 1NKNA 1MV8A 3RL0D 2XU6A 4GT1A 1JOCA 5KJ7A 4XA4A 1DX7A 3V4QA 1CI6A 1HBWA 1JTHB 2POHA 3H32B 3HE4B 2HPCB 3GHGB 3M0DC 2M3BA 2N1TB 3KYQA 3A5TA 3G3ZA 3VYIA 1JY2O 1GZLA 1A02J 3M9HA 2BASA 2YKQA 1W2EA 4WY4D 5APQA 3V2PA 1LTJB 1IFDA 3B8EB 2P2UA 3HD7C 1FZFA 3B5NB 3HTKA 4ZKUA 4C46A 1LWUB 3SWYA 1KQLA 1HVVA 4DOJA 1Z56A 1LT9B 4LC1A 1J1DC 2OYIA 2R32A 1G2CA 3BVHA 2C0WA 1KFNA 1IJDB 1FZGA 3P32A 3RK3B 3M06A 3UIAA 2HFED 3VN0A 2FYUK 1HH0A 3MTUE 5KJ7C 1FOSF 1GW3A 5AVQB 3HD7B 1NWQA 5AW1B 1QL2A 1RE4C 1GD2E 1CW5A 1LTSC 2W6AA 1IC2A 1H8AA 2H7HA 2FKWB 1IFIA 4ZKPA 3M0AA 1J2JB 1DEBA 3U1AA 2A45H 2FXMA 1RF1A 1CI6B 1JCDA 1JTHA 3NFQA 2Q7CA 3HE4A 1PFIA 3HRNA 3GHGA 5APTA 1YTZT 4OH8B 1X79B 3TK1A 4WY4B 5BU5A 2XNXA 4AYCA 1JMMA 3L4FA 2I1KA 4XE5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTL C;  1LTS C;  1LTA C;  1LTI C;  1LTG C;  1LTT C;  1XTC C;  1LTB C; 
#chains in the Genus database with same CATH topology
 2Y0D A;  3MD0 A;  2CPB A;  1SVF A;  3LW5 J;  5B66 H;  3AE3 C;  3P8C E;  5KJ7 D;  2KK7 A;  2NPS C;  2XKM A;  1DEE G;  1KYO D;  1EZV G;  1L4A A;  4EI2 A;  1FJK A;  1VQN P;  2FYU D;  4H13 C;  2UWJ E;  2E76 D;  3L37 A;  4N3Y B;  3WUV A;  4JPZ B;  4L74 A;  5E79 E;  2GUV A;  5APW A;  3MHV A;  3JSV C;  3FGA D;  1YJ9 P;  2R5D A;  2O01 H;  5AVZ B;  3NMD A;  2M0B A;  4A7P A;  3B5N A;  1NTZ E;  1BCC J;  4WVZ A;  2WSE H;  1NTK K;  3HTK B;  1T2K C;  3M9B A;  4L73 A;  1JM0 A;  2HYN A;  1USD A;  2Q3E A;  4H0L D;  3JC2 2;  3ZDM A;  3I55 P;  2W27 A;  3G6E P;  4KT0 J;  3TSI A;  1SQV G;  2FYN B;  4I1L A;  2ITA A;  2KS1 B;  3A7O A;  1JB0 J;  3CL3 D;  3CCU P;  1KB9 D;  1GW4 A;  1RQV A;  2Y9Y A;  3D6Z A;  3AEB C;  3PH0 A;  1KB9 I;  4DCK A;  2R44 A;  1GDT A;  5KAF E;  3L72 D;  2V4H A;  1OVV A;  2Q6Q A;  1L4A C;  5L8R J;  2SPZ A;  3FWL A;  3VMY A;  1KB9 H;  2QRX A;  3RL0 B;  1S3J A;  5K5G B;  2FYU G;  3M91 A;  3WU2 H;  3F89 A;  2V7Q H;  1ZW0 A;  3RK2 C;  5AW4 B;  1LTG C;  3Q3D A;  1J1E B;  1VQ4 P;  1NTK G;  1GL2 C;  2HLO A;  1YBK A;  1NU1 D;  3GF3 A;  1NJI Q;  2KSE A;  1JMB A;  4OGQ D;  1L0N E;  2P1J A;  4H44 C;  4R4M A;  3U1C A;  1JNM A;  3L72 G;  1L4A D;  2FXP A;  5CCH A;  1FZC A;  4CPG A;  2WPQ A;  1T3J A;  3L73 G;  3CCL P;  1NKZ B;  1ZV8 A;  2P10 A;  1QL1 A;  3H1H G;  4OVN F;  5CHX A;  1PP9 E;  3AEG C;  3PP5 A;  1BCC G;  3C8V A;  3H1K D;  3L75 D;  1RF1 C;  1DD3 A;  2B88 A;  2WPR A;  4U3F G;  3N7N A;  1X22 A;  2GA1 A;  1OZH A;  4N6J A;  1KD1 Q;  3P8M C;  1Q90 D;  1RF1 B;  2OYH B;  3H1J J;  5KLV G;  3H1J E;  3H1K J;  3H1H E;  3L35 A;  2BCC J;  3L75 J;  3Q2Y A;  4D6T D;  2WSF H;  2KUB A;  2O1J A;  2XV5 A;  2ZVO B;  3HUS B;  1H89 A;  3B4S A;  2WT7 B;  1N2D C;  2JWD A;  1FJP A;  3O6Q A;  2A06 D;  3JCU H;  2G3A A;  4WY4 A;  3U59 A;  3L73 J;  3AE4 C;  2L91 A;  1M1K Q;  2E42 A;  2P7J A;  1DD4 A;  3AE5 C;  1IFJ A;  3C9I A;  1JY3 O;  1R5S A;  1J1E C;  3L71 E;  4C7R A;  1KV4 A;  3RK2 B;  3TNU B;  5B66 E;  3H6P A;  2AEM A;  2B89 A;  1GL2 A;  3V2R A;  1DH3 A;  3P8C D;  1L4A B;  3NTN A;  1HJ0 A;  4C7N A;  4GDO A;  3W67 A;  2H88 C;  2KNC B;  3L36 A;  5AW6 B;  3AE9 C;  2YXR B;  2K9J B;  3RK3 D;  1GTW A;  1SQV K;  3Q5P A;  1YIT P;  2FYZ A;  3L70 G;  2WPS A;  1AVO A;  2HOD A;  5GTI E;  5H2F H;  2H89 C;  2IYO A;  3V2N A;  1YYC A;  2G8Y A;  1L0L J;  1YTZ I;  3H1I G;  3O8Z A;  3T97 B;  3V5B A;  4B86 A;  1VQ6 P;  2IBZ G;  2KLU A;  3B5N D;  1DIP A;  1K8A Q;  1RE3 C;  1VPC A;  1S1C X;  1RY3 A;  2N9Y B;  1M57 D;  3D71 A;  1PPJ E;  1UII A;  4WB4 A;  1NAF A;  2IPP A;  1URQ C;  2OYO A;  2QM8 A;  5M1B A;  1LT9 C;  3CI9 A;  1YQ3 C;  2BCC G;  2XDJ A;  1GU4 A;  1BGY E;  1VQ8 P;  1LWU C;  1KIL C;  4H0L B;  1NTK E;  2P67 A;  2WIT A;  2D2C D;  3AE7 C;  3HE5 B;  4Y99 C;  3B5N C;  1YHQ P;  1IK9 A;  1L0N G;  3WUU A;  3E1R A;  5EFW B;  2IBZ D;  4H44 D;  3BCC G;  1JY3 P;  2ZXE B;  1EDK A;  2NPS B;  3C1L A;  3A3Y B;  3TGU G;  5CCH D;  1SLQ A;  3CXH E;  3V4W A;  1KC8 Q;  2IDB A;  2YO2 A;  2LXB A;  1NTZ K;  3L71 D;  3IAO A;  5AW2 B;  1FAV A;  2D2C B;  3R2P A;  1PZQ A;  3E1I A;  2PGD A;  2N1T D;  2WSC J;  1S9K E;  2WZ7 A;  1N7S C;  1AV1 A;  1MFZ A;  3CWB D;  2IZ0 A;  1SQB E;  3K5B A;  1E5W A;  1OW8 A;  3VMX A;  1EC5 A;  1SQQ G;  2J5U A;  3AE8 C;  3MP7 B;  5KLV K;  2WTY A;  1FZC B;  3D6Y A;  3RK3 E;  5AW5 B;  4PJ0 E;  3QH9 A;  1SFC D;  1HGZ A;  1RQU A;  3H1K G;  3L75 G;  4HJG H;  5B5E H;  4LLH A;  1LTT C;  3A0H E;  3GHG C;  1NTM K;  1S5L H;  3SWF A;  1SQP E;  3CPW O;  2OYH A;  1M8O B;  2K3R A;  2YIU B;  1EXJ A;  2N1T A;  2L5G B;  1NTZ D;  2IFM A;  2E76 B;  1P84 I;  5KLV E;  1KFM A;  3HUS A;  4M3L A;  1N7S B;  3G4S P;  3TYY A;  4WWI A;  2FXO A;  3RGU A;  4I2L C;  2KYV A;  4W7Z A;  2WSS H;  3GLM A;  2WT7 A;  1NYH A;  1URQ D;  2WMM A;  3CCQ P;  1NGM B;  1N73 A;  1P84 H;  1KYO H;  4H13 D;  2R5B A;  1PGO A;  1SQB K;  1BE3 J;  1NOH A;  2Q5U A;  4UB8 H;  1M1J B;  3SSU A;  1YJN P;  1LP1 A;  2ZVN B;  1KIL E;  1UIX A;  2BEQ D;  2QJK C;  3TNU A;  4GKG A;  1RE4 A;  1P84 D;  1N73 C;  2KP8 A;  4Y99 B;  2PAJ A;  1GL2 D;  2QSI A;  1KIL B;  4C7N B;  3I5C A;  3AE1 C;  3AEF C;  1USE A;  4ZMD A;  3RK2 D;  2RN0 A;  2K9J A;  1XTG B;  1URQ B;  3VP8 A;  3EQ2 A;  3W68 A;  1GMJ A;  3TDK A;  4K3A A;  5AVX B;  4IFD K;  1G1I A;  3KZI E;  3H32 A;  3MUD A;  4HKZ H;  1N86 A;  1AQT A;  1KQF B;  1AQ5 A;  2OGU A;  1ZR2 A;  2J59 M;  2HPC A;  3GMA A;  2YNY A;  2KIK A;  3CD6 P;  2E75 C;  3H1J G;  3VMZ A;  1JCC A;  1IO4 A;  2CPS A;  2KI7 B;  1AA0 A;  2C0X A;  4OGQ B;  4XFJ A;  4EYY Q;  3KXD A;  1BCC D;  1NO4 A;  2CK3 H;  1U57 A;  1U7J A;  3MIW A;  1VDF A;  3CX5 D;  4PD4 H;  4PV1 B;  2BCC D;  2ZT9 C;  3Q5R A;  1HJB A;  5GTH E;  3TGU J;  1FOS E;  3KQG A;  1LTJ C;  1BGY D;  2W8Z A;  3S4R A;  2E43 A;  4DT0 A;  1BSH A;  1L0N D;  2J58 A;  2KSJ A;  5KAI E;  1PV3 A;  2JEE A;  3BCC D;  1NTM D;  3H1J D;  3LW5 H;  2W83 C;  4JBZ A;  1LGH B;  5C39 A;  2JWA A;  2YXQ B;  1BE3 G;  1SQQ K;  1PGQ A;  2A06 G;  4D6T J;  3BCC E;  1M56 D;  3Q5S A;  1VQ9 P;  1GK6 A;  1OIP A;  3CX5 I;  2ZYD A;  1SQB J;  5AVV B;  4W7Y A;  3V2Q A;  1MFT A;  2W6B A;  1KMI Z;  2M5A B;  3L71 J;  2JO1 A;  2NPS D;  3CWB G;  3HUS C;  1LWU A;  2K88 A;  4IL6 E;  1Y47 A;  3AEE C;  5KLI C;  1QGK B;  3CCE P;  2K1A A;  1LT9 A;  2ZT9 B;  3PHL A;  3H1H D;  3VP9 A;  2N1T C;  1T6A A;  2YKO A;  5AVW B;  2OYI B;  2XZR A;  2OYH C;  1WRG A;  5TJH A;  5BVZ A;  3CCJ P;  1Q82 Q;  1VQP P;  1OVU A;  2OAR A;  3USS A;  1S5L E;  3M0D A;  3S1K A;  1NU1 K;  3FWN A;  2JDI H;  5BU8 B;  1LTI C;  1OWA A;  2HG5 D;  2E74 B;  4BRY A;  2GM4 A;  3CX5 H;  1FBM A;  1FC2 C;  2ZT9 D;  4H44 B;  3S9O A;  2Q3I A;  1N7S A;  3IFM A;  3MGN A;  2LKM A;  1VQ5 P;  1FZA A;  2QM7 A;  2ZFC A;  4RES B;  3CC2 P;  1PPJ D;  2YKP A;  1N73 B;  2VRS A;  1IFM A;  3EWK A;  5AVS B;  4TLF A;  2PP6 A;  3A2A A;  4UB8 E;  2FFD B;  2OYI C;  3RL0 C;  1LTA C;  1NTM E;  1OX3 A;  1M7L A;  1BDC A;  1M1J C;  3AED C;  3RL0 g;  2A45 G;  2YMK A;  5TIS H;  1H0T A;  1SQB G;  2MJZ A;  1NH4 A;  5APY A;  3H1L D;  1VQO P;  1QEX A;  1JY2 P;  1VQL P;  1KIL A;  1SQP K;  1IFP A;  2IYP A;  5APS A;  4WBA A;  1HUC A;  1NU1 G;  1SFC C;  2MKV A;  2JP3 A;  3H1L E;  1QVF O;  2E76 C;  1URQ A;  4QMA A;  3PJS K;  5AW3 B;  3H1I D;  5AW0 B;  5DJU B;  1RE3 A;  2N9B A;  2WSC H;  1X0T A;  3H1I E;  2B87 B;  3G71 P;  1TU3 F;  2RMZ A;  2IBZ E;  4GOF A;  2KS1 A;  3H1L G;  5AVU B;  2PFX A;  1YI2 P;  3VOP A;  1CSB A;  2KZI A;  2RH0 A;  4IFM A;  4DZO A;  2A06 E;  3H1H J;  2QG4 A;  3JCU E;  3L72 E;  3KHU A;  4K35 A;  1VF5 B;  1BCC E;  2ZXX A;  1LNQ A;  4LGD E;  5CCH C;  1FZC C;  4H13 B;  3FXD A;  1S5L X;  4YTP C;  1Q81 Q;  1KQG B;  3IR9 A;  3FX0 A;  2LR2 A;  1SQP D;  1Q2N A;  2AXT H;  2NZ2 A;  4IFF A;  1JY2 N;  2D2C C;  3L70 J;  4D6T G;  1GU5 A;  1LTB C;  4Y28 J;  3OJA B;  1AFO A;  4UB6 E;  1ZR4 A;  3HD7 D;  2H43 A;  2O1K A;  1FDO A;  1EQ7 A;  1JY3 N;  1VF5 D;  2R3C A;  3L72 J;  3L74 J;  3MZW B;  1BSN A;  4KHX A;  4ZNC A;  1KOR A;  5E79 H;  5CBN A;  1BE3 E;  5CMZ A;  2Z4E A;  2E5T A;  3CLQ A;  1MZ9 A;  4WY4 C;  4AUW A;  3F5H A;  2M5A A;  3LIE A;  4IL6 H;  1SQX K;  5CJ0 A;  2YO3 A;  1R8E A;  1N7S D;  1PGP A;  3B71 A;  3H25 A;  4JQ0 D;  3CCS P;  2DW3 A;  2WSF J;  1SQQ E;  1HTL C;  1W2B O;  5CJ4 A;  1RF0 C;  2OTL P;  4GOD A;  1L0N K;  2WPV B;  1K04 A;  1L0L D;  1PPJ G;  2QEX P;  1ZME C;  1SQV J;  1NVO A;  3LID A;  1HWT C;  2O01 N;  3A0B E;  1NTZ G;  1SFC B;  5KAF H;  5APV A;  1K9M Q;  1EZV D;  1ZN5 A;  1MUU A;  4I7Z C;  2WVR A;  4ASW A;  1SQX E;  1CZQ A;  1VQ7 P;  3WU2 E;  3CCM P;  1K73 Q;  1OXZ A;  1S4X A;  1T8Z A;  3CXH D;  2Z5I A;  3L70 E;  2FYU J;  2E74 D;  1OW7 A;  4YXW H;  5CCG A;  3AE6 C;  1IK7 A;  2ZAE B;  2FFD A;  2FFD C;  3L74 G;  1Q86 Q;  2XND H;  1T2K D;  5CCG C;  3EFF K;  3KPE A;  3V6I A;  3TGU D;  4Z1M H;  1NTM G;  2RKL A;  2Y0E A;  2Z5H A;  2KNC A;  1H88 A;  1BE3 D;  3RK3 C;  1YIJ P;  2FYU E;  3CXH I;  2JJL A;  3II6 A;  3P7K A;  5KKZ C;  2FY8 A;  3WMM 0;  2HOD B;  4HH2 A;  4W80 A;  1HF9 A;  2K37 A;  1SQX J;  4EOT A;  3PRJ A;  1J1D B;  1NAY A;  1ZOY C;  3NXS A;  3OA7 A;  4JYB A;  1SQQ D;  1SQV E;  1N7L A;  5CBO A;  2QIW A;  3N4X A;  5KLV J;  2H8P D;  1VL2 A;  1RF0 A;  1SP4 A;  1ZRT E;  3O6Q B;  4PD4 E;  1OVR A;  1PIX A;  1SQQ J;  1RH5 B;  1X8Y A;  1ZP0 C;  5AVT B;  2QE7 H;  3BRT B;  5BU5 A;  3RBZ A;  1G1J A;  1U7M A;  4HYT B;  2E5Y A;  2KLV A;  5GTH H;  5KLI B;  3HE5 A;  1X9V A;  3OAK A;  4JYC A;  3SFE C;  1L2P A;  1P84 E;  3R4Y A;  5CCG D;  2ZYG A;  3VMA A;  2V7Q J;  1LT1 A;  2NPS A;  1KIL D;  3CXH H;  5APX A;  1GL2 B;  3BAS A;  3GF7 A;  2C9L Y;  1JEK A;  5AVY B;  1LTJ A;  3BRV B;  4GIF A;  1SQP J;  1WT6 A;  4TT3 H;  1JUN A;  2M8R A;  1KYO I;  1FZE A;  5AW8 B;  1VF5 C;  1ZXG A;  2QA4 P;  2I1J A;  4L75 A;  4U3F D;  3RBX A;  4RJT A;  2E75 D;  1QVG O;  2LXC B;  2FBW C;  2JKV A;  3L73 E;  1FS0 E;  4HB1 A;  5AW7 B;  2Q1K A;  1EDJ A;  2Y0C A;  1GK4 A;  1HGV A;  1W5C E;  1PP9 G;  1Y9B A;  4MN4 C;  4PV1 C;  5H2F E;  1ZLL A;  2WQY C;  4OGQ C;  3T97 A;  1VQK P;  1G2C B;  1PGJ A;  1VQM P;  2B9B A;  1T3U A;  2YMY A;  2IFN A;  1KZU B;  2GUS A;  3EFG A;  1NHL A;  2E75 B;  3FXE A;  3MUD C;  2FYN C;  4NPD A;  1SQX G;  2KOG A;  4U7J A;  5AVR B;  1EXI A;  3KDP B;  4O9B A;  3CME P;  5KTB A;  2WWW A;  2C9N Y;  3BAT A;  4L76 A;  1FU1 A;  4EDF A;  1BDD A;  2Y9Z A;  1A02 F;  3M9Q A;  1JO5 A;  1D7M A;  3HD7 A;  1SFC A;  2A45 I;  1ZRT D;  4JF7 A;  4AQR D;  1XTC C;  5AW9 B;  2Q9I A;  3VTP C;  1IFN A;  1KB9 E;  4D6T E;  2QVA A;  4YXD C;  1OMI A;  5DJT B;  5KAI H;  1FDM A;  3PTZ A;  4EIJ A;  2WSE J;  4N78 E;  2IX7 C;  1N8R Q;  3Q1M A;  2KB7 P;  1FZB A;  1M1J A;  4RO0 A;  3D70 A;  4N78 D;  4R4L A;  4I6M C;  3L70 D;  3WUT A;  1L0L K;  1BGY G;  4BXL A;  5APU A;  3L74 D;  1NKN A;  3G9R A;  1MV8 A;  3RL0 D;  2XU6 A;  2M3E A;  1SQB D;  4GT1 A;  1QLE D;  1JOC A;  2E74 C;  2KXP B;  5KJ7 A;  3CMA P;  3L74 E;  4XA4 A;  3SWK A;  3TF5 A;  4U3F E;  2AXC A;  3TGU E;  1DX7 A;  5GTI H;  3V4Q A;  1CI6 A;  1QX8 A;  1K05 A;  1HBW A;  1JTH B;  2POH A;  2W6J H;  1S72 P;  2YIU C;  3H32 B;  1Q7Y Q;  5B5E E;  3HE4 B;  3A0H H;  2HPC B;  3CCV P;  3GHG B;  3CC7 P;  3M0D C;  2M3B A;  2N1T B;  2OTK E;  3IF4 A;  2ZJS E;  1FDI A;  1EDL A;  3KYQ A;  1KTM A;  3A5T A;  2QJP B;  4IL6 X;  2BCC E;  1YJW P;  3ITK A;  3G3Z A;  1NTK D;  2PRR A;  3VYI A;  1L0L G;  1JY2 O;  1GZL A;  3H1I J;  4PD4 D;  2JR8 A;  2O01 J;  2K9Y A;  3CC4 P;  1A02 J;  1KQS O;  1LP1 B;  1NU1 J;  2AXT E;  1SQP G;  2QJY B;  3M9H A;  2BAS A;  4OWF A;  2YKQ A;  4NPE A;  1W2E A;  4WY4 D;  3H1K E;  3L75 E;  5APQ A;  3OW2 O;  2OQQ A;  1LTJ B;  1IFD A;  3AE2 C;  3B8E B;  2P2U A;  3V2P A;  1R5L A;  1BGY J;  4YPC A;  1L0N J;  2KZJ A;  3HD7 C;  4RKU J;  1FZF A;  3B5N B;  3BCC J;  3HTK A;  4ZKU A;  4GOE A;  4C46 A;  1LWU B;  4H0L C;  2O3J A;  3SWY A;  1KQL A;  1HVV A;  4DOJ A;  1KN7 A;  3CCR P;  1Z56 A;  1LT9 B;  4PJ0 H;  2AEJ A;  4LC1 A;  1J1D C;  2OYI A;  3PLN A;  2R32 A;  2AEF A;  1G2C A;  2OTJ P;  3BVH A;  1SS1 A;  2C0W A;  1KFN A;  1IJD B;  5KKZ B;  1SQX D;  4BWN A;  2R3S A;  1FZG A;  3P32 A;  3RK3 B;  2BEZ F;  3M06 A;  2HFE D;  3UIA A;  3VN0 A;  2FYU K;  3I56 P;  1HH0 A;  2ZYA A;  5KLV D;  3A0B H;  3MTU E;  4DJG A;  1Y8A A;  1IZN B;  4BRY B;  3ABV C;  5KJ7 C;  1GW3 A;  5AVQ B;  1FOS F;  1E79 H;  3HD7 B;  1NWQ A;  1SQV D;  1KYO E;  1EDI A;  1NU1 E;  2QJK B;  3AEC C;  5AW1 B;  2NRG A;  4PD4 I;  1S9K D;  3QWO C;  1QL2 A;  4UB6 H;  1RE4 C;  4IOI H;  1GD2 E;  1AVY A;  2HR3 A;  2QJY C;  1MKM A;  1CW5 A;  1LTS C;  2W6A A;  1IC2 A;  4PV1 D;  4I7Z B;  1NTK J;  5TIS E;  1YQ4 C;  1H0T B;  1PP9 D;  4NPF X;  1H8A A;  2H7H A;  2FKW B;  3E7K A;  2W90 A;  1FE6 A;  2IZ1 A;  1IFI A;  1NTZ J;  1PL5 A;  4ZKP A;  1PP9 J;  2QJP C;  3M0A A;  1J2J B;  1DEB A;  1OW6 A;  1EZV I;  3KZI H;  3U1A A;  2A45 H;  2FXM A;  1RF1 A;  1CI6 B;  1JCD A;  1OFC X;  1JTH A;  1L0L E;  3NFQ A;  4KJM A;  2Q7C A;  3HE4 A;  1PFI A;  3H1L J;  1WMK A;  3HRN A;  4U3F J;  3GHG A;  5APT A;  1YTZ T;  2I8D A;  2B87 A;  1RHZ B;  1LJ2 A;  3L73 D;  4OH8 B;  1X79 B;  3AEA C;  3TK1 A;  1AJY A;  3IN6 A;  1S2E A;  2P58 A;  3CX5 E;  4WY4 B;  2XNX A;  4AYC A;  4ASV A;  1EZV E;  1JMM A;  3L71 G;  3L4F A;  3SFD C;  3CWB J;  3GG2 A;  1NTM J;  2IBZ I;  3CWB E;  2I1K A;  3GW6 A;  1M90 Q;  4XE5 B; 
#chains in the Genus database with same CATH homology
 3MD0 A;  2CPB A;  1SVF A;  3P8C E;  5KJ7 D;  2NPS C;  2XKM A;  1L4A A;  1FJK A;  4N3Y B;  3L37 A;  2GUV A;  5APW A;  2R5D A;  2O01 H;  5AVZ B;  3NMD A;  3B5N A;  2WSE H;  1NTK K;  3HTK B;  1T2K C;  3M9B A;  2HYN A;  2W27 A;  3TSI A;  4I1L A;  3A7O A;  3CL3 D;  1GW4 A;  1GDT A;  1L4A C;  3VMY A;  3RL0 B;  3M91 A;  3RK2 C;  5AW4 B;  1LTG C;  1J1E B;  1GL2 C;  2HLO A;  2P1J A;  3U1C A;  1JNM A;  1L4A D;  5CCH A;  1FZC A;  2WPQ A;  1T3J A;  1NKZ B;  1ZV8 A;  1QL1 A;  5CHX A;  3PP5 A;  1RF1 C;  2WPR A;  3N7N A;  4N6J A;  3P8M C;  2OYH B;  1RF1 B;  3L35 A;  2WSF H;  2O1J A;  2XV5 A;  3HUS B;  1H89 A;  2WT7 B;  1N2D C;  1FJP A;  4WY4 A;  3U59 A;  2E42 A;  2P7J A;  1IFJ A;  3C9I A;  1JY3 O;  4C7R A;  1J1E C;  3RK2 B;  3TNU B;  3H6P A;  3V2R A;  1GL2 A;  1DH3 A;  3P8C D;  1L4A B;  3NTN A;  4C7N A;  5AW6 B;  3L36 A;  3RK3 D;  1SQV K;  2FYZ A;  2WPS A;  2HOD A;  3V2N A;  1GTW A;  1YYC A;  3V5B A;  1YTZ I;  3O8Z A;  4B86 A;  3B5N D;  1RE3 C;  1VPC A;  1RY3 A;  4WB4 A;  1NAF A;  2IPP A;  1URQ C;  2QM8 A;  1LT9 C;  3CI9 A;  2XDJ A;  1GU4 A;  1LWU C;  1KIL C;  2P67 A;  2WIT A;  4Y99 C;  3HE5 B;  3B5N C;  1IK9 A;  1JY3 P;  2ZXE B;  2NPS B;  3A3Y B;  5CCH D;  1SLQ A;  3V4W A;  2YO2 A;  1NTZ K;  5AW2 B;  1FAV A;  3R2P A;  3E1I A;  2N1T D;  1S9K E;  2WZ7 A;  1N7S C;  1MFZ A;  1E5W A;  3VMX A;  1FZC B;  5KLV K;  2WTY A;  5AW5 B;  1SFC D;  1HGZ A;  4LLH A;  1LTT C;  3SWF A;  3GHG C;  1NTM K;  2OYH A;  2N1T A;  2L5G B;  2IFM A;  1KFM A;  3HUS A;  4M3L A;  1N7S B;  3TYY A;  2WT7 A;  4I2L C;  2KYV A;  4W7Z A;  1URQ D;  1N73 A;  2R5B A;  1SQB K;  2Q5U A;  1NOH A;  1M1J B;  3TNU A;  4GKG A;  1RE4 A;  1N73 C;  2KP8 A;  4Y99 B;  2PAJ A;  1GL2 D;  1KIL B;  4C7N B;  3I5C A;  3RK2 D;  1XTG B;  1URQ B;  3VP8 A;  3EQ2 A;  5AVX B;  4IFD K;  1G1I A;  3H32 A;  3MUD A;  1AQ5 A;  1N86 A;  2HPC A;  1ZR2 A;  2J59 M;  2YNY A;  3VMZ A;  1JCC A;  1IO4 A;  2CPS A;  2C0X A;  1NO4 A;  3MIW A;  2OYI C;  1VDF A;  1HJB A;  1FOS E;  3KQG A;  1LTJ C;  2E43 A;  2J58 A;  2KSJ A;  2JEE A;  3LW5 H;  1LGH B;  1SQQ K;  1GK6 A;  3V2Q A;  5AVV B;  4W7Y A;  2W6B A;  2NPS D;  3HUS C;  1LWU A;  1LT9 A;  3VP9 A;  2N1T C;  5AVW B;  2YKO A;  2OYI B;  2XZR A;  2OYH C;  1WRG A;  5BVZ A;  2OAR A;  3M0D A;  1NU1 K;  5BU8 B;  1LTI C;  1OWA A;  2HG5 D;  2GM4 A;  1FBM A;  3MGN A;  1N7S A;  2Q3I A;  3IFM A;  2LKM A;  2ZFC A;  1FZA A;  2QM7 A;  4RES B;  2YKP A;  1N73 B;  2VRS A;  1IFM A;  5AVS B;  2FFD B;  2PP6 A;  3A2A A;  3RL0 C;  1LTA C;  1M7L A;  1M1J C;  2A45 G;  2MJZ A;  1NH4 A;  5APY A;  1JY2 P;  1KIL A;  1SQP K;  5APS A;  4WBA A;  1HUC A;  1SFC C;  1URQ A;  5AW3 B;  5AW0 B;  1RE3 A;  2N9B A;  2WSC H;  5AVU B;  3VOP A;  1CSB A;  4IFM A;  4DZO A;  4LGD E;  5CCH C;  1FZC C;  3IR9 A;  4IFF A;  1S9K D;  1JY2 N;  1GU5 A;  1LTB C;  3OJA B;  1AFO A;  1ZR4 A;  3HD7 D;  2H43 A;  2O1K A;  2R3C A;  1EQ7 A;  1JY3 N;  4KHX A;  2Z4E A;  5CMZ A;  3CLQ A;  1MZ9 A;  4WY4 C;  4AUW A;  3LIE A;  5CJ0 A;  1SQX K;  2YO3 A;  1N7S D;  1HTL C;  5CJ4 A;  1RF0 C;  1L0N K;  3LID A;  1HWT C;  1SFC B;  5APV A;  1ZN5 A;  1MUU A;  1CZQ A;  1OXZ A;  1T8Z A;  5CCG A;  2Z5I A;  2FFD A;  2FFD C;  1T2K D;  5CCG C;  3KPE A;  1H88 A;  2Z5H A;  3RK3 C;  2JJL A;  3II6 A;  3P7K A;  3WMM 0;  2HOD B;  4HH2 A;  4W80 A;  4EOT A;  1J1D B;  3NXS A;  3OA7 A;  4JYB A;  1N7L A;  3N4X A;  2H8P D;  1RF0 A;  1SP4 A;  1X8Y A;  5AVT B;  3BRT B;  1G1J A;  4HYT B;  2KLV A;  3HE5 A;  1X9V A;  3OAK A;  4JYC A;  5CCG D;  2NPS A;  1KIL D;  5APX A;  1GL2 B;  3BAS A;  2C9L Y;  5AVY B;  1LTJ A;  3BRV B;  4GIF A;  1WT6 A;  1JUN A;  2M8R A;  5AW8 B;  1FZE A;  2I1J A;  5AW7 B;  1GK4 A;  1HGV A;  3T97 A;  1ZLL A;  1G2C B;  2YMY A;  1T3U A;  2IFN A;  1KZU B;  3EFG A;  2GUS A;  1NHL A;  5AVR B;  2KOG A;  3KDP B;  4O9B A;  5KTB A;  2WWW A;  2C9N Y;  3BAT A;  1FU1 A;  1A02 F;  3M9Q A;  1JO5 A;  3HD7 A;  1SFC A;  2A45 I;  4AQR D;  4JF7 A;  2Q9I A;  1XTC C;  5AW9 B;  3VTP C;  1IFN A;  1FDM A;  4EIJ A;  4N78 E;  2IX7 C;  2KB7 P;  1FZB A;  1M1J A;  4N78 D;  4I6M C;  1L0L K;  5APU A;  1NKN A;  1MV8 A;  3RL0 D;  2XU6 A;  4GT1 A;  1JOC A;  5KJ7 A;  4XA4 A;  1DX7 A;  3V4Q A;  1CI6 A;  1HBW A;  1JTH B;  2POH A;  3H32 B;  3HE4 B;  2HPC B;  3GHG B;  3M0D C;  2M3B A;  2N1T B;  3KYQ A;  3A5T A;  3G3Z A;  3VYI A;  1JY2 O;  1GZL A;  1A02 J;  3M9H A;  2BAS A;  2YKQ A;  1W2E A;  4WY4 D;  5APQ A;  3V2P A;  1LTJ B;  1IFD A;  3B8E B;  2P2U A;  3HD7 C;  1FZF A;  3B5N B;  3HTK A;  4ZKU A;  4C46 A;  1LWU B;  3SWY A;  1KQL A;  1HVV A;  4DOJ A;  1Z56 A;  1LT9 B;  4LC1 A;  1J1D C;  2OYI A;  2R32 A;  1G2C A;  3BVH A;  2C0W A;  1KFN A;  1IJD B;  1FZG A;  3P32 A;  3RK3 B;  3M06 A;  3UIA A;  2HFE D;  3VN0 A;  2FYU K;  1HH0 A;  3MTU E;  5KJ7 C;  1FOS F;  1GW3 A;  5AVQ B;  3HD7 B;  1NWQ A;  5AW1 B;  1QL2 A;  1RE4 C;  1GD2 E;  1CW5 A;  1LTS C;  2W6A A;  1IC2 A;  1H8A A;  2H7H A;  2FKW B;  1IFI A;  4ZKP A;  3M0A A;  1J2J B;  1DEB A;  3U1A A;  2A45 H;  2FXM A;  1RF1 A;  1CI6 B;  1JCD A;  1JTH A;  3NFQ A;  2Q7C A;  3HE4 A;  1PFI A;  3HRN A;  3GHG A;  5APT A;  1YTZ T;  4OH8 B;  1X79 B;  3TK1 A;  4WY4 B;  5BU5 A;  2XNX A;  4AYC A;  1JMM A;  3L4F A;  2I1K A;  4XE5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...