1LTGC

The arg7lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the a subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title The Arg7Lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the A subunit.
pubmed doi rcsb
source organism Escherichia coli
total genus 14
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1995-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltgC00
1LTTC 1LTBC 1LTIC 1XTCC 1LTAC 1HTLC 1LTSC 1LTGC
chains in the Genus database with same CATH superfamily
2QJKC 5APWA 2QJPB 1BGYG 3SWFA 2KB7P 2E5YA 1HGZA 3HUSC 1H88A 1JUNA 2E76C 1ZXGA 3BRTB 3D71A 3B5NB 1M56D 1L0LJ 5KAFE 5AVRB 5GTHE 3CMAP 1OVRA 1JY2N 3QWOC 2K9JB 2W6BA 1WT6A 3IR9A 1Y9BA 3L74G 1S9KD 3Q5SA 1SFCD 1NTZK 1PGPA 2WSSH 3TK1A 4H0LB 4QMAA 1DEBA 1R5LA 1Z56A 5KAIH 1XTGB 1W2EA 1JTHB 2V7QJ 1QVGO 4R4LA 3KPEA 1SQVD 3Q5PA 1OVVA 3BRVB 2A06D 1VL2A 1SLQA 4TT3H 1LWUC 2O3JA 1LP1B 2MJZA 1N73C 1KZUB 5APYA 5KLVE 2QE7H 3CXHI 2WMMA 1BCCG 5CBNA 2Z5IA 2Z4EA 1YHQP 1HJ0A 3RGUA 3K5BA 1RF1B 2NPSB 3V2QA 4BRYA 4ASWA 3H32B 1K8AQ 3I55P 2JR8A 2Q3EA 3MZWB 1GL2B 5AW3B 1L0LE 3HD7A 1JMMA 4I6MC 2QG4A 1YI2P 2JWDA 1LT9C 5AW9B 3AEFC 2JJLA 2JWAA 3AEGC 1L0NK 1VQNP 2KS1B 1S5LE 5GTIE 4WY4C 2YXQB 3RK3D 1NU1K 3KZIE 4AQRD 2C9NY 3HUSB 5CBOA 3D6ZA 2E76B 2XU6A 3CMEP 4B86A 2O01H 2BEZF 3H1HD 3CC7P 1YJNP 2CPBA 3TGUG 1M90Q 1OXZA 3EWKA 1NH4A 4GIFA 3H32A 4GOEA 3SWYA 1TU3F 5GTHH 5KAFH 1FS0E 4JQ0D 1NTMK 2I8DA 2E42A 2KUBA 1L4AD 3U1CA 4JYBA 2KLVA 3L73J 2YKPA 3VMZA 1LWUB 1JY2O 2Q5UA 1VQ6P 2A06G 3JSVC 5AVXB 3Q3DA 1N73B 2KNCA 1CZQA 3HTKB 1BGYE 2OGUA 2QIWA 1PPJE 5CMZA 1VQ4P 1BSNA 4H44D 3IFMA 1VQLP 1NTKK 4PD4I 3L70G 3MTUE 4JF7A 1BDDA 1ZW0A 3KYQA 1AA0A 2R5DA 2K88A 1NGMB 2IYOA 3P7KA 2M5AB 3CWBJ 3WUTA 5CCHA 3CCVP 1JCCA 1HF9A 1LT9B 2W8ZA 5APQA 1LTBC 1EZVD 2QM8A 2JDIH 1BE3G 2O1KA 2B89A 1MUUA 4WBAA 4EYYQ 4Y99C 4JYCA 2DW3A 3RK2D 3E1IA 4WY4B 3VOPA 1BCCE 3SFDC 3L71J 1NYHA 2H8PD 4H13C 3VTPC 1IFJA 2P7JA 3L73E 1KB9E 3CCEP 1PIXA 3C8VA 2J5UA 2L5GB 3C1LA 2QA4P 2J58A 1S5LH 2V7QH 5GTIH 2FYUG 1SQPD 3KZIH 3SSUA 1BDCA 1D7MA 2YKOA 2JP3A 2M3BA 1HH0A 4PJ0E 2RKLA 2E76D 4DT0A 1CI6B 2M5AA 1IK7A 4GOFA 2ZT9D 3A2AA 2R32A 5K5GB 1L0LD 1HJBA 5H2FE 3P32A 2K37A 1SQVK 1H0TB 1K9MQ 4N78E 2D2CD 3VN0A 2OTJP 3FX0A 4R4MA 3CWBE 1SQXJ 1LGHB 3VMYA 3P8CE 2Q6QA 3RL0C 3V5BA 1KQFB 1JOCA 5KJ7A 1S72P 3TGUE 3ITKA 4IFMA 2YMYA 2Q3IA 3L71E 1SQBD 3CC4P 1EDIA 3EFFK 4HB1A 1PV3A 5CCGA 2H88C 5AW0B 3H1IJ 2YMKA 1G2CB 2VRSA 1QX8A 3CX5E 1PGJA 2GA1A 1VQ8P 1NWQA 3M9BA 4I2LC 4HH2A 1NKZB 2QJPC 4Y99B 1EZVG 2IDBA 1NAFA 3PP5A 3H1LG 2WSCJ 2C0WA 3W67A 1OWAA 1Y8AA 2R5BA 4PD4H 1AQTA 1LJ2A 1KMIZ 4H13B 5AW7B 4D6TG 1P84I 1PPJD 3BCCJ 4JBZA 1SQQJ 3USSA 5AVUB 3SWKA 5DJTB 1NOHA 1LTIC 5CJ4A 1JO5A 1GK6A 2O01J 1YTZT 1NTZG 1FJKA 4OVNF 1SQXE 3P8MC 3L75G 4DCKA 1Q86Q 2IBZG 3HD7C 2IPPA 4TLFA 1OW8A 3CI9A 2ZVOB 1DIPA 2Y0EA 4Y28J 4IOIH 1Q90D 3G3ZA 1J1DC 4KJMA 3H1JJ 3RBZA 1XTCC 1BSHA 1KTMA 2B88A 1EC5A 1QGKB 1KYOD 4KHXA 2E74D 1R8EA 2P2UA 4PJ0H 1SS1A 3L35A 3AE8C 2FKWB 2W6AA 3II6A 3CD6P 3AE5C 3RL0B 3M9QA 5H2FH 4C7RA 3VMXA 2L91A 1SFCA 3N4XA 1MV8A 2MKVA 1KB9D 2HFED 3BVHA 3A0BE 2HR3A 4XA4A 1T2KD 3TNUB 3UIAA 4IL6X 2Q7CA 1AVYA 1NHLA 2KK7A 1DD3A 3T97B 1OW6A 4U3FG 1JMBA 2ZAEB 1FOSF 1SQBG 3E1RA 1SQQE 5APSA 4RJTA 2WT7A 2HLOA 2HODA 1GMJA 1L0NG 4IFFA 2WSEH 3FXDA 4GKGA 3U1AA 2O1JA 3CC2P 5AW1B 1NU1G 4M3LA 4N78D 4MN4C 3O6QA 3CWBD 2OYIA 4OGQD 3P8CD 2IZ1A 2POHA 2YKQA 3CX5H 3H1JE 1LTAC 4BRYB 1M1JA 1VQ9P 1RY3A 1FDMA 3SFEC 4UB8E 3G6EP 1EZVI 3A3YB 3MIWA 1QEXA 2KZIA 1LTTC 3L72G 3CPWO 5CCHC 3HD7B 1MZ9A 2PAJA 3IF4A 3TNUA 3TF5A 1SQPK 1S1CX 1NTMG 1GU4A 4WVZA 3TYYA 4H13D 3T97A 1KC8Q 2ZYDA 3R2PA 1J1DB 4UB6E 4LLHA 1USEA 3V2NA 1EDJA 3VP9A 1GDTA 2ZFCA 4W7ZA 2BCCG 1FZGA 1L0LK 1VQ5P 2IBZI 1HBWA 3CX5D 2JEEA 2WITA 4GDOA 4RO0A 2WPRA 3M0DA 1IZNB 3FGAD 5AVSB 1NTKG 1ZR4A 2WTYA 2WVRA 3A7OA 3OAKA 3CCJP 3LW5H 3HE4B 5AVTB 3H1KG 1W5CE 2Y0CA 3L75E 3GHGA 1Q81Q 1PP9J 3GLMA 2KI7B 3CXHE 2C9LY 2BASA 1SQXD 1BGYJ 3A5TA 1OX3A 3MUDA 4CPGA 4ZKUA 3HRNA 1SQBK 1OZHA 2YNYA 4ZMDA 3NFQA 2A45G 3A0BH 3IAOA 1S3JA 2KNCB 2P67A 2WSCH 4OH8B 3L74J 1FDOA 1G1JA 3D6YA 1FC2C 1IFMA 1HUCA 3A0HE 2QVAA 3G4SP 4W80A 2M8RA 5AW5B 5KJ7C 4PV1D 3H1ID 3HE5A 5AVYB 3C9IA 2G8YA 2XKMA 2KSEA 3HE4A 1QLED 2I1JA 5CCGC 2BCCJ 1JY2P 1PFIA 4L74A 3NMDA 1M1KQ 3B5ND 1BCCJ 2W27A 1KQSO 1JB0J 2QRXA 3D70A 1HVVA 1S2EA 3FWLA 3BCCD 1JNMA 2WSFJ 1SQVG 4N3YB 2YXRB 4UB8H 3V6IA 1R5SA 2YIUB 1KV4A 1PP9E 2IZ0A 4RKUJ 4H0LD 1MFZA 1YTZI 1IC2A 3AE6C 3HD7D 1NU1E 3CCUP 4DOJA 2G3AA 2Y9YA 1X8YA 4NPDA 1N7SA 4UB6H 4EDFA 2NZ2A 3L74E 2E75C 3AEBC 2OYHA 1VF5C 3H1JD 2ITAA 2PP6A 1FJPA 1EXIA 1GU5A 3VP8A 4YPCA 1PGQA 1JY3P 1N7LA 5CHXA 3CCLP 1RQVA 1WMKA 2R3SA 2R3CA 3QH9A 1OIPA 4PD4E 2FFDB 1QVFO 2NPSD 4ASVA 3CXHH 2BCCE 2Y9ZA 5AW2B 3H25A 3TGUJ 5APTA 1A02F 1GL2D 3H6PA 1PZQA 2WSEJ 2K9YA 1DX7A 5KLVD 3OW2O 3M9HA 5AVQB 1SFCC 4EI2A 3Q1MA 2YO2A 2A45I 1RF0A 1ZOYC 1VQ7P 2ZXEB 1DH3A 2OQQA 3A0HH 3EQ2A 3H1HG 1S5LX 2OTKE 2AEMA 1KILB 1J2JB 4C46A 1ZN5A 3KHUA 1ZMEC 1SP4A 3KQGA 1IFIA 3CXHD 2OYOA 3L36A 5TISH 2FFDA 3L70J 3CL3D 4NPEA 4BXLA 4BWNA 1GW3A 2XDJA 3CCSP 2OYIC 5C39A 3L37A 2Z5HA 2N1TB 1M1JC 1MKMA 2AXTE 3GF3A 1GW4A 2XNDH 2OARA 2E75B 1URQA 4N6JA 1BE3J 1VF5B 3V4WA 2B87B 3LW5J 1IK9A 1KILA 1ZR2A 1YITP 1SQXK 3CCMP 1KQLA 1SQVE 4EIJA 3RK3C 3IN6A 2A06E 3B4SA 1OW7A 1T3JA 5AW4B 2FYUJ 1PGOA 2Y0DA 3M0DC 2KLUA 1T3UA 1BGYD 3KXDA 4LC1A 1M8OB 1SFCB 3GW6A 3MP7B 2N1TA 3Q2YA 2ZYAA 3L70E 3GHGC 1EXJA 1OVUA 2Q9IA 2J59M 2HPCA 2XNXA 3F5HA 3L74D 1K04A 4WY4D 1SVFA 3MUDC 2B87A 3PH0A 1U57A 3LIDA 1G1IA 2WSFH 1SQPG 2WT7B 2HODB 1P84E 2FXPA 2KSJA 1BE3E 2WZ7A 2AXCA 5AVWB 3I5CA 1W2BO 1Q7YQ 4PD4D 1L0LG 4H44C 3O6QB 4XE5B 5CCGD 1SQQK 2AEJA 1YJWP 2QJYC 2OYIB 1FZAA 3AE2C 1NO4A 1BCCD 1HTLC 2GM4A 5APXA 1M1JB 3RK3E 3JCUE 4YTPC 2V4HA 2HYNA 2KYVA 1LTGC 1VPCA 3L73D 5AW8B 2FYUE 3PLNA 1RE3A 2WPVB 3PRJA 1EDKA 2FY8A 2AXTH 1LTSC 5TJHA 2IFNA 3H1LJ 2P58A 3TSIA 1QL2A 4IL6H 3WU2H 4D6TJ 1IO4A 5BU8B 5KLIC 1VF5D 3RK3B 1N8RQ 2R44A 3R4YA 1NTZJ 3L75J 2YO3A 4U7JA 2XV5A 1N7SC 3OJAB 3M06A 2FXOA 1NVOA 5AVVB 1E5WA 2OYHC 5KLVK 3S1KA 3GHGB 1S4XA 3S9OA 1PPJG 2SPZA 1L2PA 1Y47A 2ZT9C 1VQOP 3G71P 1IJDB 3TGUD 1L4AB 5E79E 2ZYGA 1FZEA 3L71D 1ZRTE 2H7HA 2N9BA 4HYTB 2KP8A 2D2CC 1J1EB 2CK3H 2YIUC 4GODA 4O9BA 1FZCA 1EZVE 3FWNA 2P1JA 1LTJB 4H44B 1YQ4C 3H1LE 1CW5A 1KN7A 2QJYB 1P84H 4GT1A 1RF0C 3PTZA 2K1AA 3JC22 4D6TE 4U3FJ 3HE5B 2Q1KA 3EFGA 1SQBJ 5L8RJ 1NTZE 1L0NJ 3L70D 1JY3N 1NAYA 2IBZE 2AEFA 3AEEC 5B5EE 1GD2E 3L73G 1RE4A 3B5NA 1UIXA 3RL0D 3NXSA 3VYIA 1FAVA 3JCUH 1SQPE 1NU1J 2LKMA 1L4AA 5KTBA 4I7ZC 2K9JA 2FYZA 1PL5A 2FFDC 1AJYA 3RK2B 1P84D 2P10A 5KLIB 4DZOA 4L73A 1BE3D 3WUVA 1JTHA 1RH5B 1LTJA 3AE9C 3L72J 1X22A 1NJIQ 2PGDA 1N7SB 1YBKA 4A7PA 1LP1A 2WPSA 1NTMJ 1URQC 2QJKB 2OYHB 3WMM0 2PFXA 3CWBG 5TISE 1VQMP 2LR2A 3TDKA 3MD0A 4HKZH 1USDA 2IX7C 1UIIA 2ZT9B 1KILC 2FYUD 4ZNCA 1VQKP 5KKZC 1RF1A 2N9YB 4U3FE 1SQBE 1U7JA 2KIKA 1K05A 2NPSA 2E74C 2WQYC 3AE3C 1NTKJ 2D2CB 3L71G 1L0NE 3GF7A 1YIJP 1SQQD 4AUWA 4ZKPA 3H1KJ 5E79H 4IFDK 1GL2A 2LXBA 2OTLP 4NPFX 3E7KA 4OWFA 1N86A 1X79B 3G9RA 2N1TC 2W83C 1IFDA 1FOSE 2IYPA 2KS1A 4I1LA 2NRGA 1T2KC 1AVOA 3PHLA 5B66E 1E79H 3GG2A 1OMIA 3HUSA 3L72E 3GMAA 1QL1A 4W7YA 3N7NA 1KFNA 1KYOI 2CPSA 1NTME 3V4QA 2LXCB 2M3EA 4I7ZB 5AW6B 3M91A 1SQXG 1WRGA 1ZRTD 2JKVA 5APVA 3KDPB 1LT1A 3M0AA 1KILE 5B5EH 1HGVA 2IFMA 1JCDA 1FDIA 3AE4C 1AV1A 4OGQC 4C7NB 2QM7A 4JPZB 2QSIA 1KB9I 1JY3O 1KYOE 1FU1A 5APUA 1JEKA 1GTWA 1RQUA 3H1LD 1NTKE 4WWIA 1T8ZA 1LWUA 1URQB 3U59A 3BASA 1JM0A 1N73A 1RE3C 4D6TD 2HG5D 3H1KE 3HTKA 2ZXXA 1SQVJ 2PRRA 3H1IG 1YQ3C 1MFTA 1VDFA 5EFWB 1ZLLA 1NTZD 2QEXP 1N2DC 1HWTC 3L75D 3V2RA 2IBZD 5KKZB 1N7SD 4Z1MH 5DJUB 1Q2NA 1M57D 5BVZA 1IFNA 2KOGA 4EOTA 2GUVA 1CSBA 2E74B 2UWJE 1GK4A 3AEAC 5AVZB 4YXDC 4KT0J 3CCQP 3S4RA 3BCCG 3RL0g 1FE6A 3ZDMA 1SQQG 5CCHD 4C7NA 3AEDC 1LT9A 1DEEG 2C0XA 2XZRA 2H43A 1KQGB 1ZP0C 3VMAA 1K73Q 4AYCA 2HPCB 4IL6E 4L76A 2FYNC 2W6JH 3WU2E 4WY4A 1T6AA 3Q5RA 3B71A 2FBWC 1S9KE 2ZJSE 3H1JG 3L4FA 3O8ZA 2KXPB 3CCRP 4DJGA 4RESB 3CX5I 3B8EB 4U3FD 5B66H 3I56P 3MGNA 1FZCC 1DD4A 2K3RA 5M1BA 3V2PA 1U7MA 4XFJA 1L0ND 2E5TA 4OGQB 1PP9D 1CI6A 4PV1C 3H1HJ 3OA7A 3RBXA 1AQ5A 2H89C 1A02J 1NU1D 3LIEA 1RHZB 1Q82Q 3CLQA 5KLVG 1H0TA 1FBMA 1KFMA 5BU5A 2I1KA 2WWWA 1KD1Q 1RE4C 3B5NC 1KYOH 5KAIE 2RH0A 1L4AC 1LNQA 3L72D 1EDLA 3BATA 5KJ7D 2RN0A 2FYUK 3FXEA 1URQD 4H0LC 1NTMD 3MHVA 1J1EC 4HJGH 1OFCX 2E43A 3PJSK 1KB9H 1LTJC 3AE1C 1AFOA 1X9VA 1KILD 2BCCD 1NKNA 4K35A 1EQ7A 1G2CA 2A45H 1IFPA 2GUSA 3NTNA 1FZBA 4YXWH 1KORA 1M7LA 1NTKD 3ABVC 2FYNB 2ZVNB 3H1IE 3H1HE 3AE7C 3H1KD 1RF1C 4K3AA 5CJ0A 1X0TA 1H89A 2JO1A 1ZV8A 2O01N 2NPSC 1H8AA 2N1TD 2FXMA 4WB4A 3RK2C 2E75D 3AECC 3WUUA 1FZCB 2KZJA 1YYCA 1GL2C 5KLVJ 1YJ9P 3F89A 2RMZA 3BCCE 2W90A 2B9BA 4LGDE 2M0BA 4PV1B 4L75A 2BEQD 3W68A 1GZLA 1VQPP 1FZFA 1SQPJ 1PP9G 2WPQA
chains in the Genus database with same CATH topology
1DX7A 1NAFA 5APWA 3PP5A 2WPSA 3M9HA 3SWFA 2C0WA 2KB7P 1URQC 5AVQB 1HGZA 1OWAA 1SFCC 2OYHB 3HUSC 3WMM0 2R5BA 1H88A 2YO2A 1JUNA 2A45I 1RF0A 5AW7B 3BRTB 3MD0A 3B5NB 2ZXEB 1DH3A 2IX7C 5AVUB 5AVRB 1NOHA 1JY2N 1LTIC 3EQ2A 5CJ4A 1JO5A 1KILC 1GK6A 2W6BA 1WT6A 3IR9A 1YTZT 1FJKA 1S9KD 3P8MC 1RF1A 1SFCD 1KILB 1NTZK 1J2JB 1N7SB 4C46A 1ZN5A 3HD7C 3TK1A 1SP4A 3KQGA 1IFIA 1DEBA 2IPPA 2NPSA 1Z56A 3L36A 1XTGB 1W2EA 1JTHB 3CI9A 3KPEA 4AUWA 3BRVB 4ZKPA 2FFDA 3CL3D 4IFDK 3G3ZA 1J1DC 1GL2A 1XTCC 1SLQA 1LWUC 2MJZA 4KHXA 2P2UA 1GW3A 1N86A 2XDJA 3L35A 1X79B 1N73C 2OYIC 2N1TC 1KZUB 5APYA 1IFDA 3L37A 2FKWB 2W6AA 1FOSE 3II6A 2Z5HA 2N1TB 3RL0B 1M1JC 3M9QA 1GW4A 4I1LA 3VMXA 4C7RA 2Z5IA 2Z4EA 1T2KC 2OARA 1URQA 1RF1B 4N6JA 1SFCA 3N4XA 3HUSA 1MV8A 1QL1A 3V4WA 4W7YA 2HFED 3BVHA 3N7NA 1KFNA 2NPSB 3V2QA 2CPSA 3V4QA 4XA4A 3H32B 1T2KD 3TNUB 3UIAA 1IK9A 5AW6B 1KILA 3M91A 2Q7CA 1WRGA 1NHLA 5APVA 1ZR2A 3KDPB 1SQXK 1GL2B 5AW3B 1FOSF 3HD7A 1KQLA 3M0AA 1JMMA 4I6MC 5APSA 2WT7A 4EIJA 1HGVA 3RK3C 2HLOA 2IFMA 1LT9C 2HODA 1JCDA 4C7NB 2QM7A 1T3JA 5AW9B 4IFFA 2JJLA 2WSEH 5AW4B 4GKGA 1L0NK 1JY3O 3U1AA 1FU1A 5APUA 3M0DC 1GTWA 2O1JA 1T3UA 5AW1B 4M3LA 1T8ZA 4N78D 1LWUA 4WY4C 4LC1A 3RK3D 1URQB 1NU1K 4AQRD 2C9NY 3U59A 1SFCB 3BASA 3HUSB 1N73A 2OYIA 2N1TA 3P8CD 1RE3C 2HG5D 3HTKA 2POHA 2YKQA 2XU6A 3GHGC 4B86A 1LTAC 2O01H 1M1JA 2Q9IA 1RY3A 1VDFA 2J59M 2HPCA 2XNXA 1ZLLA 1FDMA 1N2DC 1HWTC 2CPBA 4WY4D 3V2RA 1SVFA 1N7SD 3A3YB 3MIWA 1LTTC 1OXZA 3LIDA 1G1IA 2WSFH 5BVZA 5CCHC 3HD7B 1IFNA 1NH4A 1MZ9A 2KOGA 4GIFA 4EOTA 2PAJA 2WT7B 2GUVA 1CSBA 3H32A 3SWYA 3TNUA 1SQPK 2HODB 1GU4A 3TYYA 1GK4A 3T97A 2KSJA 2WZ7A 1NTMK 5AVZB 5AVWB 3I5CA 2E42A 3R2PA 1L4AD 3U1CA 4JYBA 1J1DB 2KLVA 4LLHA 5CCHD 2YKPA 3V2NA 3VMZA 3VP9A 4C7NA 1LWUB 1GDTA 1JY2O 2ZFCA 4W7ZA 4XE5B 2Q5UA 5CCGD 1L0LK 1SQQK 1FZGA 1LT9A 5AVXB 2C0XA 1HBWA 2JEEA 1N73B 2OYIB 2XZRA 2H43A 1FZAA 1CZQA 3HTKB 1NO4A 2WITA 1HTLC 2GM4A 5APXA 1M1JB 4AYCA 2WPRA 3M0DA 2HPCB 5AVSB 5CMZA 2HYNA 1ZR4A 2KYVA 2WTYA 1LTGC 3A7OA 1VPCA 4WY4A 3OAKA 3IFMA 1NTKK 3LW5H 3HE4B 5AW8B 5AVTB 1S9KE 1RE3A 3L4FA 3GHGA 3O8ZA 3MTUE 4JF7A 1LTSC 4RESB 2IFNA 2C9LY 2BASA 3B8EB 3KYQA 3A5TA 2R5DA 3MGNA 1FZCC 3P7KA 3MUDA 3TSIA 4ZKUA 1QL2A 3HRNA 1SQBK 5CCHA 3V2PA 1JCCA 1IO4A 2YNYA 5BU8B 3NFQA 2A45G 3RK3B 1LT9B 5APQA 1LTBC 2P67A 2QM8A 2WSCH 1CI6A 4OH8B 2O1KA 3OA7A 1MUUA 1G1JA 1AQ5A 4WBAA 1A02J 1IFMA 2YO3A 4Y99C 4JYCA 1HUCA 3LIEA 2XV5A 1N7SC 3OJAB 3M06A 3RK2D 3CLQA 3E1IA 4WY4B 3VOPA 5AVVB 4W80A 1E5WA 2OYHC 1FBMA 2M8RA 1KFMA 5AW5B 5BU5A 5KJ7C 2H8PD 2I1KA 5KLVK 2WWWA 3GHGB 3VTPC 1IFJA 1RE4C 2P7JA 3B5NC 3HE5A 5AVYB 3C9IA 2XKMA 2L5GB 1L4AC 3HE4A 2J58A 1IJDB 2I1JA 1L4AB 1FZEA 5CCGC 3BATA 1JY2P 5KJ7D 1PFIA 3NMDA 2FYUK 2H7HA 1URQD 2YKOA 2M3BA 2N9BA 1HH0A 4HYTB 1J1EC 2KP8A 3B5ND 2W27A 2E43A 1CI6B 1HVVA 1J1EB 3A2AA 1JNMA 1LTJC 4N3YB 2R32A 4O9BA 1FZCA 1HJBA 1AFOA 3P32A 1GL2D 1X9VA 1KILD 1SQVK 2P1JA 1LTJB 1MFZA 1NKNA 1YTZI 1EQ7A 1G2CA 1CW5A 1IC2A 2A45H 4N78E 3HD7D 2GUSA 3VN0A 3NTNA 1FZBA 1LGHB 3VMYA 4GT1A 4DOJA 1RF0C 3P8CE 3HE5B 3RL0C 1M7LA 3EFGA 1X8YA 3V5BA 1N7SA 1RF1C 1JOCA 2OYHA 5KJ7A 5CJ0A 1JY3N 2PP6A 1FJPA 1H89A 3VP8A 1GU5A 1ZV8A 1GD2E 1JY3P 1RE4A 1N7LA 2NPSC 3B5NA 1H8AA 5CHXA 2N1TD 3RL0D 3NXSA 3VYIA 1FAVA 4IFMA 2FXMA 2YMYA 2Q3IA 2LKMA 1L4AA 5KTBA 4WB4A 2FYZA 3RK2C 1FZCB 2R3CA 2FFDC 1YYCA 5CCGA 1GL2C 5AW0B 3RK2B 2FFDB 2NPSD 1G2CB 4DZOA 2VRSA 4LGDE 1JTHA 5AW2B 1NWQA 1LTJA 3M9BA 4I2LC 5APTA 1GZLA 4HH2A 1NKZB 4Y99B 1FZFA 1A02F 3H6PA 2WPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTT C;  1LTB C;  1LTI C;  1XTC C;  1LTA C;  1HTL C;  1LTS C;  1LTG C; 
#chains in the Genus database with same CATH topology
 2QJK C;  5APW A;  2QJP B;  1BGY G;  3SWF A;  2KB7 P;  2E5Y A;  1HGZ A;  3HUS C;  1H88 A;  1JUN A;  2E76 C;  1ZXG A;  3BRT B;  3D71 A;  3B5N B;  1M56 D;  1L0L J;  5KAF E;  5AVR B;  5GTH E;  3CMA P;  1OVR A;  1JY2 N;  3QWO C;  2K9J B;  2W6B A;  1WT6 A;  3IR9 A;  1Y9B A;  3L74 G;  1S9K D;  3Q5S A;  1SFC D;  1NTZ K;  1PGP A;  2WSS H;  3TK1 A;  4H0L B;  4QMA A;  1DEB A;  1R5L A;  1Z56 A;  5KAI H;  1XTG B;  1W2E A;  1JTH B;  2V7Q J;  1QVG O;  4R4L A;  3KPE A;  1SQV D;  3Q5P A;  1OVV A;  3BRV B;  2A06 D;  1VL2 A;  1SLQ A;  4TT3 H;  1LWU C;  2O3J A;  1LP1 B;  2MJZ A;  1N73 C;  1KZU B;  5APY A;  5KLV E;  2QE7 H;  3CXH I;  2WMM A;  1BCC G;  5CBN A;  2Z5I A;  2Z4E A;  1YHQ P;  1HJ0 A;  3RGU A;  3K5B A;  1RF1 B;  2NPS B;  3V2Q A;  4BRY A;  4ASW A;  3H32 B;  1K8A Q;  3I55 P;  2JR8 A;  2Q3E A;  3MZW B;  1GL2 B;  5AW3 B;  1L0L E;  3HD7 A;  1JMM A;  4I6M C;  2QG4 A;  1YI2 P;  2JWD A;  1LT9 C;  5AW9 B;  3AEF C;  2JJL A;  2JWA A;  3AEG C;  1L0N K;  1VQN P;  2KS1 B;  1S5L E;  5GTI E;  4WY4 C;  2YXQ B;  3RK3 D;  1NU1 K;  3KZI E;  4AQR D;  2C9N Y;  3HUS B;  5CBO A;  3D6Z A;  2E76 B;  2XU6 A;  3CME P;  4B86 A;  2O01 H;  2BEZ F;  3H1H D;  3CC7 P;  1YJN P;  2CPB A;  3TGU G;  1M90 Q;  1OXZ A;  3EWK A;  1NH4 A;  4GIF A;  3H32 A;  4GOE A;  3SWY A;  1TU3 F;  5GTH H;  5KAF H;  1FS0 E;  4JQ0 D;  1NTM K;  2I8D A;  2E42 A;  2KUB A;  1L4A D;  3U1C A;  4JYB A;  2KLV A;  3L73 J;  2YKP A;  3VMZ A;  1LWU B;  1JY2 O;  2Q5U A;  1VQ6 P;  2A06 G;  3JSV C;  5AVX B;  3Q3D A;  1N73 B;  2KNC A;  1CZQ A;  3HTK B;  1BGY E;  2OGU A;  2QIW A;  1PPJ E;  5CMZ A;  1VQ4 P;  1BSN A;  4H44 D;  3IFM A;  1VQL P;  1NTK K;  4PD4 I;  3L70 G;  3MTU E;  4JF7 A;  1BDD A;  1ZW0 A;  3KYQ A;  1AA0 A;  2R5D A;  2K88 A;  1NGM B;  2IYO A;  3P7K A;  2M5A B;  3CWB J;  3WUT A;  5CCH A;  3CCV P;  1JCC A;  1HF9 A;  1LT9 B;  2W8Z A;  5APQ A;  1LTB C;  1EZV D;  2QM8 A;  2JDI H;  1BE3 G;  2O1K A;  2B89 A;  1MUU A;  4WBA A;  4EYY Q;  4Y99 C;  4JYC A;  2DW3 A;  3RK2 D;  3E1I A;  4WY4 B;  3VOP A;  1BCC E;  3SFD C;  3L71 J;  1NYH A;  2H8P D;  4H13 C;  3VTP C;  1IFJ A;  2P7J A;  3L73 E;  1KB9 E;  3CCE P;  1PIX A;  3C8V A;  2J5U A;  2L5G B;  3C1L A;  2QA4 P;  2J58 A;  1S5L H;  2V7Q H;  5GTI H;  2FYU G;  1SQP D;  3KZI H;  3SSU A;  1BDC A;  1D7M A;  2YKO A;  2JP3 A;  2M3B A;  1HH0 A;  4PJ0 E;  2RKL A;  2E76 D;  4DT0 A;  1CI6 B;  2M5A A;  1IK7 A;  4GOF A;  2ZT9 D;  3A2A A;  2R32 A;  5K5G B;  1L0L D;  1HJB A;  5H2F E;  3P32 A;  2K37 A;  1SQV K;  1H0T B;  1K9M Q;  4N78 E;  2D2C D;  3VN0 A;  2OTJ P;  3FX0 A;  4R4M A;  3CWB E;  1SQX J;  1LGH B;  3VMY A;  3P8C E;  2Q6Q A;  3RL0 C;  3V5B A;  1KQF B;  1JOC A;  5KJ7 A;  1S72 P;  3TGU E;  3ITK A;  4IFM A;  2YMY A;  2Q3I A;  3L71 E;  1SQB D;  3CC4 P;  1EDI A;  3EFF K;  4HB1 A;  1PV3 A;  5CCG A;  2H88 C;  5AW0 B;  3H1I J;  2YMK A;  1G2C B;  2VRS A;  1QX8 A;  3CX5 E;  1PGJ A;  2GA1 A;  1VQ8 P;  1NWQ A;  3M9B A;  4I2L C;  4HH2 A;  1NKZ B;  2QJP C;  4Y99 B;  1EZV G;  2IDB A;  1NAF A;  3PP5 A;  3H1L G;  2WSC J;  2C0W A;  3W67 A;  1OWA A;  1Y8A A;  2R5B A;  4PD4 H;  1AQT A;  1LJ2 A;  1KMI Z;  4H13 B;  5AW7 B;  4D6T G;  1P84 I;  1PPJ D;  3BCC J;  4JBZ A;  1SQQ J;  3USS A;  5AVU B;  3SWK A;  5DJT B;  1NOH A;  1LTI C;  5CJ4 A;  1JO5 A;  1GK6 A;  2O01 J;  1YTZ T;  1NTZ G;  1FJK A;  4OVN F;  1SQX E;  3P8M C;  3L75 G;  4DCK A;  1Q86 Q;  2IBZ G;  3HD7 C;  2IPP A;  4TLF A;  1OW8 A;  3CI9 A;  2ZVO B;  1DIP A;  2Y0E A;  4Y28 J;  4IOI H;  1Q90 D;  3G3Z A;  1J1D C;  4KJM A;  3H1J J;  3RBZ A;  1XTC C;  1BSH A;  1KTM A;  2B88 A;  1EC5 A;  1QGK B;  1KYO D;  4KHX A;  2E74 D;  1R8E A;  2P2U A;  4PJ0 H;  1SS1 A;  3L35 A;  3AE8 C;  2FKW B;  2W6A A;  3II6 A;  3CD6 P;  3AE5 C;  3RL0 B;  3M9Q A;  5H2F H;  4C7R A;  3VMX A;  2L91 A;  1SFC A;  3N4X A;  1MV8 A;  2MKV A;  1KB9 D;  2HFE D;  3BVH A;  3A0B E;  2HR3 A;  4XA4 A;  1T2K D;  3TNU B;  3UIA A;  4IL6 X;  2Q7C A;  1AVY A;  1NHL A;  2KK7 A;  1DD3 A;  3T97 B;  1OW6 A;  4U3F G;  1JMB A;  2ZAE B;  1FOS F;  1SQB G;  3E1R A;  1SQQ E;  5APS A;  4RJT A;  2WT7 A;  2HLO A;  2HOD A;  1GMJ A;  1L0N G;  4IFF A;  2WSE H;  3FXD A;  4GKG A;  3U1A A;  2O1J A;  3CC2 P;  5AW1 B;  1NU1 G;  4M3L A;  4N78 D;  4MN4 C;  3O6Q A;  3CWB D;  2OYI A;  4OGQ D;  3P8C D;  2IZ1 A;  2POH A;  2YKQ A;  3CX5 H;  3H1J E;  1LTA C;  4BRY B;  1M1J A;  1VQ9 P;  1RY3 A;  1FDM A;  3SFE C;  4UB8 E;  3G6E P;  1EZV I;  3A3Y B;  3MIW A;  1QEX A;  2KZI A;  1LTT C;  3L72 G;  3CPW O;  5CCH C;  3HD7 B;  1MZ9 A;  2PAJ A;  3IF4 A;  3TNU A;  3TF5 A;  1SQP K;  1S1C X;  1NTM G;  1GU4 A;  4WVZ A;  3TYY A;  4H13 D;  3T97 A;  1KC8 Q;  2ZYD A;  3R2P A;  1J1D B;  4UB6 E;  4LLH A;  1USE A;  3V2N A;  1EDJ A;  3VP9 A;  1GDT A;  2ZFC A;  4W7Z A;  2BCC G;  1FZG A;  1L0L K;  1VQ5 P;  2IBZ I;  1HBW A;  3CX5 D;  2JEE A;  2WIT A;  4GDO A;  4RO0 A;  2WPR A;  3M0D A;  1IZN B;  3FGA D;  5AVS B;  1NTK G;  1ZR4 A;  2WTY A;  2WVR A;  3A7O A;  3OAK A;  3CCJ P;  3LW5 H;  3HE4 B;  5AVT B;  3H1K G;  1W5C E;  2Y0C A;  3L75 E;  3GHG A;  1Q81 Q;  1PP9 J;  3GLM A;  2KI7 B;  3CXH E;  2C9L Y;  2BAS A;  1SQX D;  1BGY J;  3A5T A;  1OX3 A;  3MUD A;  4CPG A;  4ZKU A;  3HRN A;  1SQB K;  1OZH A;  2YNY A;  4ZMD A;  3NFQ A;  2A45 G;  3A0B H;  3IAO A;  1S3J A;  2KNC B;  2P67 A;  2WSC H;  4OH8 B;  3L74 J;  1FDO A;  1G1J A;  3D6Y A;  1FC2 C;  1IFM A;  1HUC A;  3A0H E;  2QVA A;  3G4S P;  4W80 A;  2M8R A;  5AW5 B;  5KJ7 C;  4PV1 D;  3H1I D;  3HE5 A;  5AVY B;  3C9I A;  2G8Y A;  2XKM A;  2KSE A;  3HE4 A;  1QLE D;  2I1J A;  5CCG C;  2BCC J;  1JY2 P;  1PFI A;  4L74 A;  3NMD A;  1M1K Q;  3B5N D;  1BCC J;  2W27 A;  1KQS O;  1JB0 J;  2QRX A;  3D70 A;  1HVV A;  1S2E A;  3FWL A;  3BCC D;  1JNM A;  2WSF J;  1SQV G;  4N3Y B;  2YXR B;  4UB8 H;  3V6I A;  1R5S A;  2YIU B;  1KV4 A;  1PP9 E;  2IZ0 A;  4RKU J;  4H0L D;  1MFZ A;  1YTZ I;  1IC2 A;  3AE6 C;  3HD7 D;  1NU1 E;  3CCU P;  4DOJ A;  2G3A A;  2Y9Y A;  1X8Y A;  4NPD A;  1N7S A;  4UB6 H;  4EDF A;  2NZ2 A;  3L74 E;  2E75 C;  3AEB C;  2OYH A;  1VF5 C;  3H1J D;  2ITA A;  2PP6 A;  1FJP A;  1EXI A;  1GU5 A;  3VP8 A;  4YPC A;  1PGQ A;  1JY3 P;  1N7L A;  5CHX A;  3CCL P;  1RQV A;  1WMK A;  2R3S A;  2R3C A;  3QH9 A;  1OIP A;  4PD4 E;  2FFD B;  1QVF O;  2NPS D;  4ASV A;  3CXH H;  2BCC E;  2Y9Z A;  5AW2 B;  3H25 A;  3TGU J;  5APT A;  1A02 F;  1GL2 D;  3H6P A;  1PZQ A;  2WSE J;  2K9Y A;  1DX7 A;  5KLV D;  3OW2 O;  3M9H A;  5AVQ B;  1SFC C;  4EI2 A;  3Q1M A;  2YO2 A;  2A45 I;  1RF0 A;  1ZOY C;  1VQ7 P;  2ZXE B;  1DH3 A;  2OQQ A;  3A0H H;  3EQ2 A;  3H1H G;  1S5L X;  2OTK E;  2AEM A;  1KIL B;  1J2J B;  4C46 A;  1ZN5 A;  3KHU A;  1ZME C;  1SP4 A;  3KQG A;  1IFI A;  3CXH D;  2OYO A;  3L36 A;  5TIS H;  2FFD A;  3L70 J;  3CL3 D;  4NPE A;  4BXL A;  4BWN A;  1GW3 A;  2XDJ A;  3CCS P;  2OYI C;  5C39 A;  3L37 A;  2Z5H A;  2N1T B;  1M1J C;  1MKM A;  2AXT E;  3GF3 A;  1GW4 A;  2XND H;  2OAR A;  2E75 B;  1URQ A;  4N6J A;  1BE3 J;  1VF5 B;  3V4W A;  2B87 B;  3LW5 J;  1IK9 A;  1KIL A;  1ZR2 A;  1YIT P;  1SQX K;  3CCM P;  1KQL A;  1SQV E;  4EIJ A;  3RK3 C;  3IN6 A;  2A06 E;  3B4S A;  1OW7 A;  1T3J A;  5AW4 B;  2FYU J;  1PGO A;  2Y0D A;  3M0D C;  2KLU A;  1T3U A;  1BGY D;  3KXD A;  4LC1 A;  1M8O B;  1SFC B;  3GW6 A;  3MP7 B;  2N1T A;  3Q2Y A;  2ZYA A;  3L70 E;  3GHG C;  1EXJ A;  1OVU A;  2Q9I A;  2J59 M;  2HPC A;  2XNX A;  3F5H A;  3L74 D;  1K04 A;  4WY4 D;  1SVF A;  3MUD C;  2B87 A;  3PH0 A;  1U57 A;  3LID A;  1G1I A;  2WSF H;  1SQP G;  2WT7 B;  2HOD B;  1P84 E;  2FXP A;  2KSJ A;  1BE3 E;  2WZ7 A;  2AXC A;  5AVW B;  3I5C A;  1W2B O;  1Q7Y Q;  4PD4 D;  1L0L G;  4H44 C;  3O6Q B;  4XE5 B;  5CCG D;  1SQQ K;  2AEJ A;  1YJW P;  2QJY C;  2OYI B;  1FZA A;  3AE2 C;  1NO4 A;  1BCC D;  1HTL C;  2GM4 A;  5APX A;  1M1J B;  3RK3 E;  3JCU E;  4YTP C;  2V4H A;  2HYN A;  2KYV A;  1LTG C;  1VPC A;  3L73 D;  5AW8 B;  2FYU E;  3PLN A;  1RE3 A;  2WPV B;  3PRJ A;  1EDK A;  2FY8 A;  2AXT H;  1LTS C;  5TJH A;  2IFN A;  3H1L J;  2P58 A;  3TSI A;  1QL2 A;  4IL6 H;  3WU2 H;  4D6T J;  1IO4 A;  5BU8 B;  5KLI C;  1VF5 D;  3RK3 B;  1N8R Q;  2R44 A;  3R4Y A;  1NTZ J;  3L75 J;  2YO3 A;  4U7J A;  2XV5 A;  1N7S C;  3OJA B;  3M06 A;  2FXO A;  1NVO A;  5AVV B;  1E5W A;  2OYH C;  5KLV K;  3S1K A;  3GHG B;  1S4X A;  3S9O A;  1PPJ G;  2SPZ A;  1L2P A;  1Y47 A;  2ZT9 C;  1VQO P;  3G71 P;  1IJD B;  3TGU D;  1L4A B;  5E79 E;  2ZYG A;  1FZE A;  3L71 D;  1ZRT E;  2H7H A;  2N9B A;  4HYT B;  2KP8 A;  2D2C C;  1J1E B;  2CK3 H;  2YIU C;  4GOD A;  4O9B A;  1FZC A;  1EZV E;  3FWN A;  2P1J A;  1LTJ B;  4H44 B;  1YQ4 C;  3H1L E;  1CW5 A;  1KN7 A;  2QJY B;  1P84 H;  4GT1 A;  1RF0 C;  3PTZ A;  2K1A A;  3JC2 2;  4D6T E;  4U3F J;  3HE5 B;  2Q1K A;  3EFG A;  1SQB J;  5L8R J;  1NTZ E;  1L0N J;  3L70 D;  1JY3 N;  1NAY A;  2IBZ E;  2AEF A;  3AEE C;  5B5E E;  1GD2 E;  3L73 G;  1RE4 A;  3B5N A;  1UIX A;  3RL0 D;  3NXS A;  3VYI A;  1FAV A;  3JCU H;  1SQP E;  1NU1 J;  2LKM A;  1L4A A;  5KTB A;  4I7Z C;  2K9J A;  2FYZ A;  1PL5 A;  2FFD C;  1AJY A;  3RK2 B;  1P84 D;  2P10 A;  5KLI B;  4DZO A;  4L73 A;  1BE3 D;  3WUV A;  1JTH A;  1RH5 B;  1LTJ A;  3AE9 C;  3L72 J;  1X22 A;  1NJI Q;  2PGD A;  1N7S B;  1YBK A;  4A7P A;  1LP1 A;  2WPS A;  1NTM J;  1URQ C;  2QJK B;  2OYH B;  3WMM 0;  2PFX A;  3CWB G;  5TIS E;  1VQM P;  2LR2 A;  3TDK A;  3MD0 A;  4HKZ H;  1USD A;  2IX7 C;  1UII A;  2ZT9 B;  1KIL C;  2FYU D;  4ZNC A;  1VQK P;  5KKZ C;  1RF1 A;  2N9Y B;  4U3F E;  1SQB E;  1U7J A;  2KIK A;  1K05 A;  2NPS A;  2E74 C;  2WQY C;  3AE3 C;  1NTK J;  2D2C B;  3L71 G;  1L0N E;  3GF7 A;  1YIJ P;  1SQQ D;  4AUW A;  4ZKP A;  3H1K J;  5E79 H;  4IFD K;  1GL2 A;  2LXB A;  2OTL P;  4NPF X;  3E7K A;  4OWF A;  1N86 A;  1X79 B;  3G9R A;  2N1T C;  2W83 C;  1IFD A;  1FOS E;  2IYP A;  2KS1 A;  4I1L A;  2NRG A;  1T2K C;  1AVO A;  3PHL A;  5B66 E;  1E79 H;  3GG2 A;  1OMI A;  3HUS A;  3L72 E;  3GMA A;  1QL1 A;  4W7Y A;  3N7N A;  1KFN A;  1KYO I;  2CPS A;  1NTM E;  3V4Q A;  2LXC B;  2M3E A;  4I7Z B;  5AW6 B;  3M91 A;  1SQX G;  1WRG A;  1ZRT D;  2JKV A;  5APV A;  3KDP B;  1LT1 A;  3M0A A;  1KIL E;  5B5E H;  1HGV A;  2IFM A;  1JCD A;  1FDI A;  3AE4 C;  1AV1 A;  4OGQ C;  4C7N B;  2QM7 A;  4JPZ B;  2QSI A;  1KB9 I;  1JY3 O;  1KYO E;  1FU1 A;  5APU A;  1JEK A;  1GTW A;  1RQU A;  3H1L D;  1NTK E;  4WWI A;  1T8Z A;  1LWU A;  1URQ B;  3U59 A;  3BAS A;  1JM0 A;  1N73 A;  1RE3 C;  4D6T D;  2HG5 D;  3H1K E;  3HTK A;  2ZXX A;  1SQV J;  2PRR A;  3H1I G;  1YQ3 C;  1MFT A;  1VDF A;  5EFW B;  1ZLL A;  1NTZ D;  2QEX P;  1N2D C;  1HWT C;  3L75 D;  3V2R A;  2IBZ D;  5KKZ B;  1N7S D;  4Z1M H;  5DJU B;  1Q2N A;  1M57 D;  5BVZ A;  1IFN A;  2KOG A;  4EOT A;  2GUV A;  1CSB A;  2E74 B;  2UWJ E;  1GK4 A;  3AEA C;  5AVZ B;  4YXD C;  4KT0 J;  3CCQ P;  3S4R A;  3BCC G;  3RL0 g;  1FE6 A;  3ZDM A;  1SQQ G;  5CCH D;  4C7N A;  3AED C;  1LT9 A;  1DEE G;  2C0X A;  2XZR A;  2H43 A;  1KQG B;  1ZP0 C;  3VMA A;  1K73 Q;  4AYC A;  2HPC B;  4IL6 E;  4L76 A;  2FYN C;  2W6J H;  3WU2 E;  4WY4 A;  1T6A A;  3Q5R A;  3B71 A;  2FBW C;  1S9K E;  2ZJS E;  3H1J G;  3L4F A;  3O8Z A;  2KXP B;  3CCR P;  4DJG A;  4RES B;  3CX5 I;  3B8E B;  4U3F D;  5B66 H;  3I56 P;  3MGN A;  1FZC C;  1DD4 A;  2K3R A;  5M1B A;  3V2P A;  1U7M A;  4XFJ A;  1L0N D;  2E5T A;  4OGQ B;  1PP9 D;  1CI6 A;  4PV1 C;  3H1H J;  3OA7 A;  3RBX A;  1AQ5 A;  2H89 C;  1A02 J;  1NU1 D;  3LIE A;  1RHZ B;  1Q82 Q;  3CLQ A;  5KLV G;  1H0T A;  1FBM A;  1KFM A;  5BU5 A;  2I1K A;  2WWW A;  1KD1 Q;  1RE4 C;  3B5N C;  1KYO H;  5KAI E;  2RH0 A;  1L4A C;  1LNQ A;  3L72 D;  1EDL A;  3BAT A;  5KJ7 D;  2RN0 A;  2FYU K;  3FXE A;  1URQ D;  4H0L C;  1NTM D;  3MHV A;  1J1E C;  4HJG H;  1OFC X;  2E43 A;  3PJS K;  1KB9 H;  1LTJ C;  3AE1 C;  1AFO A;  1X9V A;  1KIL D;  2BCC D;  1NKN A;  4K35 A;  1EQ7 A;  1G2C A;  2A45 H;  1IFP A;  2GUS A;  3NTN A;  1FZB A;  4YXW H;  1KOR A;  1M7L A;  1NTK D;  3ABV C;  2FYN B;  2ZVN B;  3H1I E;  3H1H E;  3AE7 C;  3H1K D;  1RF1 C;  4K3A A;  5CJ0 A;  1X0T A;  1H89 A;  2JO1 A;  1ZV8 A;  2O01 N;  2NPS C;  1H8A A;  2N1T D;  2FXM A;  4WB4 A;  3RK2 C;  2E75 D;  3AEC C;  3WUU A;  1FZC B;  2KZJ A;  1YYC A;  1GL2 C;  5KLV J;  1YJ9 P;  3F89 A;  2RMZ A;  3BCC E;  2W90 A;  2B9B A;  4LGD E;  2M0B A;  4PV1 B;  4L75 A;  2BEQ D;  3W68 A;  1GZL A;  1VQP P;  1FZF A;  1SQP J;  1PP9 G;  2WPQ A; 
#chains in the Genus database with same CATH homology
 1DX7 A;  1NAF A;  5APW A;  3PP5 A;  2WPS A;  3M9H A;  3SWF A;  2C0W A;  2KB7 P;  1URQ C;  5AVQ B;  1HGZ A;  1OWA A;  1SFC C;  2OYH B;  3HUS C;  3WMM 0;  2R5B A;  1H88 A;  2YO2 A;  1JUN A;  2A45 I;  1RF0 A;  5AW7 B;  3BRT B;  3MD0 A;  3B5N B;  2ZXE B;  1DH3 A;  2IX7 C;  5AVU B;  5AVR B;  1NOH A;  1JY2 N;  1LTI C;  3EQ2 A;  5CJ4 A;  1JO5 A;  1KIL C;  1GK6 A;  2W6B A;  1WT6 A;  3IR9 A;  1YTZ T;  1FJK A;  1S9K D;  3P8M C;  1RF1 A;  1SFC D;  1KIL B;  1NTZ K;  1J2J B;  1N7S B;  4C46 A;  1ZN5 A;  3HD7 C;  3TK1 A;  1SP4 A;  3KQG A;  1IFI A;  1DEB A;  2IPP A;  2NPS A;  1Z56 A;  3L36 A;  1XTG B;  1W2E A;  1JTH B;  3CI9 A;  3KPE A;  4AUW A;  3BRV B;  4ZKP A;  2FFD A;  3CL3 D;  4IFD K;  3G3Z A;  1J1D C;  1GL2 A;  1XTC C;  1SLQ A;  1LWU C;  2MJZ A;  4KHX A;  2P2U A;  1GW3 A;  1N86 A;  2XDJ A;  3L35 A;  1X79 B;  1N73 C;  2OYI C;  2N1T C;  1KZU B;  5APY A;  1IFD A;  3L37 A;  2FKW B;  2W6A A;  1FOS E;  3II6 A;  2Z5H A;  2N1T B;  3RL0 B;  1M1J C;  3M9Q A;  1GW4 A;  4I1L A;  3VMX A;  4C7R A;  2Z5I A;  2Z4E A;  1T2K C;  2OAR A;  1URQ A;  1RF1 B;  4N6J A;  1SFC A;  3N4X A;  3HUS A;  1MV8 A;  1QL1 A;  3V4W A;  4W7Y A;  2HFE D;  3BVH A;  3N7N A;  1KFN A;  2NPS B;  3V2Q A;  2CPS A;  3V4Q A;  4XA4 A;  3H32 B;  1T2K D;  3TNU B;  3UIA A;  1IK9 A;  5AW6 B;  1KIL A;  3M91 A;  2Q7C A;  1WRG A;  1NHL A;  5APV A;  1ZR2 A;  3KDP B;  1SQX K;  1GL2 B;  5AW3 B;  1FOS F;  3HD7 A;  1KQL A;  3M0A A;  1JMM A;  4I6M C;  5APS A;  2WT7 A;  4EIJ A;  1HGV A;  3RK3 C;  2HLO A;  2IFM A;  1LT9 C;  2HOD A;  1JCD A;  4C7N B;  2QM7 A;  1T3J A;  5AW9 B;  4IFF A;  2JJL A;  2WSE H;  5AW4 B;  4GKG A;  1L0N K;  1JY3 O;  3U1A A;  1FU1 A;  5APU A;  3M0D C;  1GTW A;  2O1J A;  1T3U A;  5AW1 B;  4M3L A;  1T8Z A;  4N78 D;  1LWU A;  4WY4 C;  4LC1 A;  3RK3 D;  1URQ B;  1NU1 K;  4AQR D;  2C9N Y;  3U59 A;  1SFC B;  3BAS A;  3HUS B;  1N73 A;  2OYI A;  2N1T A;  3P8C D;  1RE3 C;  2HG5 D;  3HTK A;  2POH A;  2YKQ A;  2XU6 A;  3GHG C;  4B86 A;  1LTA C;  2O01 H;  1M1J A;  2Q9I A;  1RY3 A;  1VDF A;  2J59 M;  2HPC A;  2XNX A;  1ZLL A;  1FDM A;  1N2D C;  1HWT C;  2CPB A;  4WY4 D;  3V2R A;  1SVF A;  1N7S D;  3A3Y B;  3MIW A;  1LTT C;  1OXZ A;  3LID A;  1G1I A;  2WSF H;  5BVZ A;  5CCH C;  3HD7 B;  1IFN A;  1NH4 A;  1MZ9 A;  2KOG A;  4GIF A;  4EOT A;  2PAJ A;  2WT7 B;  2GUV A;  1CSB A;  3H32 A;  3SWY A;  3TNU A;  1SQP K;  2HOD B;  1GU4 A;  3TYY A;  1GK4 A;  3T97 A;  2KSJ A;  2WZ7 A;  1NTM K;  5AVZ B;  5AVW B;  3I5C A;  2E42 A;  3R2P A;  1L4A D;  3U1C A;  4JYB A;  1J1D B;  2KLV A;  4LLH A;  5CCH D;  2YKP A;  3V2N A;  3VMZ A;  3VP9 A;  4C7N A;  1LWU B;  1GDT A;  1JY2 O;  2ZFC A;  4W7Z A;  4XE5 B;  2Q5U A;  5CCG D;  1L0L K;  1SQQ K;  1FZG A;  1LT9 A;  5AVX B;  2C0X A;  1HBW A;  2JEE A;  1N73 B;  2OYI B;  2XZR A;  2H43 A;  1FZA A;  1CZQ A;  3HTK B;  1NO4 A;  2WIT A;  1HTL C;  2GM4 A;  5APX A;  1M1J B;  4AYC A;  2WPR A;  3M0D A;  2HPC B;  5AVS B;  5CMZ A;  2HYN A;  1ZR4 A;  2KYV A;  2WTY A;  1LTG C;  3A7O A;  1VPC A;  4WY4 A;  3OAK A;  3IFM A;  1NTK K;  3LW5 H;  3HE4 B;  5AW8 B;  5AVT B;  1S9K E;  1RE3 A;  3L4F A;  3GHG A;  3O8Z A;  3MTU E;  4JF7 A;  1LTS C;  4RES B;  2IFN A;  2C9L Y;  2BAS A;  3B8E B;  3KYQ A;  3A5T A;  2R5D A;  3MGN A;  1FZC C;  3P7K A;  3MUD A;  3TSI A;  4ZKU A;  1QL2 A;  3HRN A;  1SQB K;  5CCH A;  3V2P A;  1JCC A;  1IO4 A;  2YNY A;  5BU8 B;  3NFQ A;  2A45 G;  3RK3 B;  1LT9 B;  5APQ A;  1LTB C;  2P67 A;  2QM8 A;  2WSC H;  1CI6 A;  4OH8 B;  2O1K A;  3OA7 A;  1MUU A;  1G1J A;  1AQ5 A;  4WBA A;  1A02 J;  1IFM A;  2YO3 A;  4Y99 C;  4JYC A;  1HUC A;  3LIE A;  2XV5 A;  1N7S C;  3OJA B;  3M06 A;  3RK2 D;  3CLQ A;  3E1I A;  4WY4 B;  3VOP A;  5AVV B;  4W80 A;  1E5W A;  2OYH C;  1FBM A;  2M8R A;  1KFM A;  5AW5 B;  5BU5 A;  5KJ7 C;  2H8P D;  2I1K A;  5KLV K;  2WWW A;  3GHG B;  3VTP C;  1IFJ A;  1RE4 C;  2P7J A;  3B5N C;  3HE5 A;  5AVY B;  3C9I A;  2XKM A;  2L5G B;  1L4A C;  3HE4 A;  2J58 A;  1IJD B;  2I1J A;  1L4A B;  1FZE A;  5CCG C;  3BAT A;  1JY2 P;  5KJ7 D;  1PFI A;  3NMD A;  2FYU K;  2H7H A;  1URQ D;  2YKO A;  2M3B A;  2N9B A;  1HH0 A;  4HYT B;  1J1E C;  2KP8 A;  3B5N D;  2W27 A;  2E43 A;  1CI6 B;  1HVV A;  1J1E B;  3A2A A;  1JNM A;  1LTJ C;  4N3Y B;  2R32 A;  4O9B A;  1FZC A;  1HJB A;  1AFO A;  3P32 A;  1GL2 D;  1X9V A;  1KIL D;  1SQV K;  2P1J A;  1LTJ B;  1MFZ A;  1NKN A;  1YTZ I;  1EQ7 A;  1G2C A;  1CW5 A;  1IC2 A;  2A45 H;  4N78 E;  3HD7 D;  2GUS A;  3VN0 A;  3NTN A;  1FZB A;  1LGH B;  3VMY A;  4GT1 A;  4DOJ A;  1RF0 C;  3P8C E;  3HE5 B;  3RL0 C;  1M7L A;  3EFG A;  1X8Y A;  3V5B A;  1N7S A;  1RF1 C;  1JOC A;  2OYH A;  5KJ7 A;  5CJ0 A;  1JY3 N;  2PP6 A;  1FJP A;  1H89 A;  3VP8 A;  1GU5 A;  1ZV8 A;  1GD2 E;  1JY3 P;  1RE4 A;  1N7L A;  2NPS C;  3B5N A;  1H8A A;  5CHX A;  2N1T D;  3RL0 D;  3NXS A;  3VYI A;  1FAV A;  4IFM A;  2FXM A;  2YMY A;  2Q3I A;  2LKM A;  1L4A A;  5KTB A;  4WB4 A;  2FYZ A;  3RK2 C;  1FZC B;  2R3C A;  2FFD C;  1YYC A;  5CCG A;  1GL2 C;  5AW0 B;  3RK2 B;  2FFD B;  2NPS D;  1G2C B;  4DZO A;  2VRS A;  4LGD E;  1JTH A;  5AW2 B;  1NWQ A;  1LTJ A;  3M9B A;  4I2L C;  5APT A;  1GZL A;  4HH2 A;  1NKZ B;  4Y99 B;  1FZF A;  1A02 F;  3H6P A;  2WPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...