1LTGC

The arg7lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the a subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title The Arg7Lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the A subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 14
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1995-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltgC00
1LTBC 1HTLC 1LTIC 1XTCC 1LTGC 1LTTC 1LTSC 1LTAC
chains in the Genus database with same CATH superfamily
1L0LE 2OYIA 2R44A 2KLUA 3I56P 3JSVC 2KNCB 4ZKPA 3VP8A 2AXCA 2FYZA 3L4FA 4AQRD 4ASWA 1IC2A 5AVRB 1VQOP 2QJPC 2WZ7A 2G3AA 2B88A 3Q5SA 4PJ0E 1AVOA 4L76A 3S4RA 1S2EA 1M56D 1VQNP 2BASA 5APSA 1SQQE 3Q1MA 2IDBA 2WPSA 4ZMDA 3LIDA 2W83C 3I55P 4GT1A 1GL2B 1NYHA 1OW8A 3GHGC 1CZQA 5APQA 3KDPB 1Q7YQ 1LTJA 1JNMA 4EIJA 3H1LG 1KQSO 3RL0D 1AA0A 1FBMA 3CI9A 3L72G 4D6TD 1EQ7A 1ZP0C 2WTYA 2AXTH 3PLNA 3CMEP 5APWA 4UB6E 3P7KA 2E75C 3VP9A 3L74E 5CCGD 2YXQB 2JKVA 1GU5A 2M5AA 3K5BA 2QRXA 1P84E 1NAFA 1SFCB 1VF5B 5APUA 3GMAA 2KIKA 2WSEJ 1FZCB 1GU4A 2ZYDA 1N2DC 1L2PA 1PV3A 3FXEA 3HD7D 3HTKA 3D70A 1KD1Q 3E1IA 1RQVA 3T97B 3M0DC 4WY4B 2DW3A 1QVFO 1SQPK 1N7SA 2P58A 1KQLA 1EZVI 2W6JH 1NO4A 2WQYC 1EXJA 3V5BA 5AW1B 2JR8A 1SQPG 3E1RA 3SWKA 1LTSC 1PP9E 1R5SA 1LTAC 1YTZT 2K9JB 1JO5A 3AEGC 2W8ZA 1T2KD 3L75E 1VQ4P 2XNXA 3CWBE 2WITA 2QE7H 1NTZK 3VMAA 2FYUE 3MHVA 3TSIA 1MFZA 4U7JA 1AV1A 5KAIE 3L71E 1ZRTE 3HE5A 1NTZG 1L4AC 5K5GB 1G1IA 1HGVA 2IFNA 4IFFA 1L0LJ 1Y8AA 3U1AA 1BE3J 2B87A 3B4SA 1RE3A 3NMDA 2CK3H 3H1IG 1YIJP 1SQXJ 2HG5D 1IO4A 2KS1A 3O6QA 3RBZA 2KK7A 1GTWA 2FXPA 2Z5IA 1QX8A 1WMKA 4HYTB 2QG4A 4L73A 3USSA 1JMMA 1HVVA 3H1JD 2N1TD 2OGUA 5KKZC 1OXZA 4NPFX 1DH3A 1IZNB 3L70G 2OYOA 1TU3F 2BEZF 3P8MC 3TYYA 3AEAC 1DX7A 4I7ZC 1IFPA 2PRRA 3GHGB 1JCDA 5KTBA 5AW9B 3WU2E 1Q86Q 1RY3A 2RN0A 1MV8A 1PZQA 3VN0A 2I1JA 4OGQC 3OA7A 3FGAD 1WT6A 1N7SD 2Q9IA 1GW3A 1AQTA 1NTME 3CCMP 1IFJA 2PP6A 2KI7B 2ZT9D 1KILB 2E74C 1KFMA 2IYOA 2D2CD 4DT0A 1RF0A 5KAIH 1PGOA 1Q90D 4DOJA 1DEEG 2KZJA 4D6TE 5KJ7A 3A0HE 2K37A 2JEEA 2IX7C 1AQ5A 3AE9C 3RK2B 3V2PA 1U7MA 3TGUJ 2NPSD 1SLQA 1BCCG 3ZDMA 3WMM0 2E76C 4EOTA 3IR9A 3L70D 2FFDC 1X0TA 1ZMEC 3L75J 5AVVB 1LTJB 2HYNA 1QLED 4WVZA 5E79H 1LJ2A 2N9YB 1LWUA 3L71J 4JF7A 1BE3D 1FS0E 1Z56A 3MD0A 5APXA 3M91A 3TNUB 1OMIA 2Y9ZA 1SQXD 3L35A 2FXOA 2M5AB 2XDJA 4C46A 3WU2H 1EZVD 1KILE 1YJWP 4AUWA 2Q5UA 4R4LA 2O01H 4CPGA 3BCCG 4AYCA 3EFFK 4NPDA 1CI6A 1KN7A 2YKQA 2JP3A 3L72E 1KC8Q 2RMZA 4IL6E 1X22A 5BU8B 2KB7P 2IBZD 2A45I 3WUUA 1AFOA 4H44C 1GL2C 1RE4A 1OX3A 4XFJA 4HJGH 1NTKD 1SQVK 2XZRA 4N6JA 2NRGA 1DEBA 3EFGA 1SQVG 3FXDA 2W27A 2A45H 2O01J 3HUSC 1PIXA 1L0NK 1ZLLA 2IZ1A 2WSSH 1PL5A 1M1JC 1PFIA 3C8VA 5KAFH 3A7OA 2UWJE 1FDOA 3R4YA 1PGPA 1GMJA 2E5TA 1L0NG 2OTLP 3M9HA 1SFCC 1VF5C 1SQPE 1YITP 1FZCC 5TISH 1Q81Q 5CCHC 1URQB 4GODA 3B5ND 4RO0A 3BCCD 3L73D 5APYA 2SPZA 4WY4C 3CCRP 2QM7A 3V2QA 2KS1B 1H0TA 2B9BA 2I1KA 1LT1A 5CCGA 1NTZE 2HPCB 3A3YB 3OJAB 1LNQA 1ZXGA 3Q2YA 1ZV8A 3IFMA 5B66E 2K3RA 1HTLC 3M9QA 1KFNA 4LC1A 1JMBA 2ZVOB 3H1IE 2ZFCA 2ZVNB 2FFDB 3CMAP 3HD7A 1SQVD 2KSEA 3H1HJ 2YKOA 2E5YA 1GDTA 2LXBA 1DD3A 1FOSE 1XTCC 1S3JA 4D6TG 3D6ZA 1YYCA 1NU1D 3S9OA 4BXLA 2ZAEB 1PGJA 5CBOA 3AE3C 5DJUB 2WVRA 3EQ2A 4YTPC 4DCKA 4PD4I 3SFDC 3V4QA 4H13B 3M0AA 5KLVJ 1EDJA 1S72P 2BCCD 2Z4EA 3L70E 1SQBK 1LT9A 3RL0C 4PD4H 3W67A 3H1LJ 5AVWB 5CJ4A 1YJ9P 4PV1B 5H2FH 3SSUA 3V2NA 2Q3IA 1H88A 1FZGA 2XV5A 2ITAA 2YO3A 1IFDA 3VMZA 4L75A 4RKUJ 1W2BO 1USEA 1VQ9P 2WT7A 1GD2E 4H0LB 1GK4A 4H44B 3ABVC 3OW2O 2OTJP 3B8EB 4JPZB 1SP4A 1QVGO 1JY3P 2QJYB 3LIEA 2OYHA 4U3FJ 2M3BA 2Y0EA 1QL2A 3H1KJ 1BGYJ 2OTKE 2GA1A 3HUSB 4KHXA 1LWUB 3RGUA 5B66H 2N1TA 3CCSP 2YMYA 1M1JB 1SQPJ 1BCCE 1KILC 2IPPA 5AW6B 1T6AA 3CCJP 3M06A 1EC5A 4MN4C 1YHQP 3ITKA 3PRJA 1CI6B 1SQBD 1YJNP 2PFXA 1KV4A 3NXSA 4WB4A 2O1KA 3CC7P 1K9MQ 1NGMB 3RK2C 2YO2A 4N78E 3H1JG 3N4XA 3PH0A 3G6EP 4JYCA 3H1HD 3CX5D 1RF1A 1LTJC 3G9RA 4N3YB 1KYOE 3BCCE 4PJ0H 2E75D 1S5LE 3HE4A 5KLVD 4I1LA 1YBKA 1JY3O 3CCQP 1LTGC 2WPRA 1HJ0A 4BWNA 1OW7A 1CW5A 1HF9A 4Y28J 5CMZA 1NKZB 3AEEC 1IFIA 4Z1MH 3Q5PA 3L36A 1Y9BA 2H89C 4BRYA 2NPSA 3CXHE 3BRVB 1KZUB 2K1AA 3MUDA 2W6AA 1N73A 1VPCA 1EXIA 1M90Q 1P84I 1KB9D 2JDIH 2YXRB 3P8CE 1OVUA 1SQVE 1S9KE 1X79B 3RL0B 3VTPC 4UB6H 4C7NB 4IFMA 3C1LA 1K8AQ 1N7SC 1H0TB 1G2CA 1P84H 1LP1A 1SQQJ 4OWFA 3U1CA 2O1JA 1L0NE 1GZLA 3CPWO 3KXDA 1MFTA 2BCCE 2WPVB 1AJYA 4U3FD 2D2CC 5AW8B 3H1KD 1J2JB 1BGYD 1N86A 1QGKB 1L0LK 5BU5A 1IK7A 2WSFH 4C7RA 1FZAA 3HD7B 4EYYQ 1FAVA 1L4AD 2R5DA 2V4HA 5APTA 5GTHE 3BATA 1WRGA 1SQXK 1K04A 1BE3G 5DJTB 5AW5B 1NH4A 3L74J 2KOGA 1X9VA 1VDFA 4JBZA 1SQXG 2PGDA 1HH0A 1URQC 1U7JA 3CXHI 3FWNA 1JTHA 2P7JA 1EZVG 1RE3C 1S5LH 3GF7A 1NAYA 2OYIB 3PHLA 1LT9B 2CPSA 1W2EA 2QVAA 1J1DB 5AW2B 4YXWH 5B5EE 1PPJD 3CXHH 3NTNA 2WSFJ 2KNCA 1K73Q 1NTKK 1W5CE 4GKGA 2IBZG 4K3AA 2ZXEB 5BVZA 1BSHA 1IK9A 1PP9J 1NTKG 2JJLA 1GK6A 3A2AA 3B5NA 1YQ4C 3PJSK 1JY2N 1VQ6P 4OGQD 3CWBJ 3RK3D 1M1KQ 1CSBA 1LTBC 3F89A 2L5GB 2FYUJ 3WUTA 4H13C 1L0LD 2YIUC 4K35A 3FX0A 3CCVP 2E74D 2N1TB 2Y9YA 2H88C 1M7LA 2FYNC 2KYVA 3S1KA 3W68A 2PAJA 1OW6A 3H25A 1RF0C 1FC2C 4IOIH 4PV1C 3L73G 3KQGA 4Y99B 3TGUG 1SQQD 2B89A 1UIXA 3JC22 3GW6A 2HR3A 5CBNA 4XE5B 5KJ7C 3HTKB 1EDIA 1M57D 2E76D 3BVHA 3N7NA 3LW5H 4JQ0D 3CCEP 1L0NJ 3AE8C 1N7SB 3CC2P 4H0LC 3T97A 3CD6P 3EWKA 2ZT9B 1VQKP 1YTZI 1NU1K 1RF1B 1EDLA 2JWAA 2QJYC 4KT0J 2D2CB 5AVSB 3A0HH 2QIWA 3B71A 3L74D 5CJ0A 4ZKUA 4W7ZA 1NU1G 3H32A 2K9JA 3HE4B 2W90A 1LWUC 2LXCB 1OWAA 1HBWA 1H89A 2WMMA 2KP8A 1LGHB 3H1JE 1FDIA 3HE5B 3LW5J 4BRYB 2NPSB 3V2RA 1G1JA 2BCCG 1NTMJ 4YPCA 3AE5C 5AVZB 2B87B 2N9BA 3MZWB 2XNDH 4D6TJ 3TGUD 2GM4A 1GL2D 1PP9D 3RBXA 2OARA 1N7LA 3O6QB 3IN6A 4DJGA 1FJKA 2L91A 2FXMA 3L75D 1LP1B 1RE4C 3R2PA 1T8ZA 3CWBD 4WBAA 3JCUE 1S5LX 4QMAA 2FYUD 3E7KA 2IYPA 3PTZA 3GLMA 3AE7C 3L71D 1SVFA 1ZRTD 1Q2NA 4IL6H 3FWLA 1OFCX 1VL2A 2XU6A 1DIPA 2AXTE 1PPJE 2QM8A 1SFCD 1VF5D 1QL1A 5CCHD 2IZ0A 3GHGA 1UIIA 1AVYA 1LTIC 2YIUB 4RJTA 1ZR4A 1VQ7P 1JTHB 5AVQB 4WY4D 2R3CA 2FYNB 3MGNA 1OVVA 2QA4P 1RHZB 3RK3E 4GOEA 1SQBG 1OIPA 5TJHA 5L8RJ 3L72J 2Y0CA 4LGDE 4OH8B 2QJKB 1OZHA 3G71P 2XKMA 1BE3E 5CCGC 3BRTB 1BDCA 2R32A 3CL3D 1DD4A 1FZEA 1VQMP 3H1HG 1SQXE 2QEXP 1A02J 2K9YA 2YMKA 3O8ZA 1EZVE 1S1CX 2H7HA 2E42A 2ZXXA 3B5NB 5KLVK 3M0DA 3SFEC 3HD7C 1USDA 3GG2A 1RQUA 3G3ZA 2WSEH 5KLVG 1Q82Q 4GDOA 2WPQA 3MIWA 1IFMA 1JEKA 4M3LA 1NTMD 3VMYA 4OVNF 3F5HA 3JCUH 3H1JJ 2AEFA 2Q6QA 2IBZE 2C9NY 3HRNA 2P2UA 1NTKE 3TK1A 2OYIC 1T2KC 1LT9C 3G4SP 1H8AA 1VQPP 1J1DC 4YXDC 3TNUA 4W7YA 1NVOA 1L4AA 2P10A 3AEFC 1FU1A 5GTIE 3AEDC 3IAOA 2HODA 2O3JA 1NTZJ 3TF5A 2IFMA 3SWFA 2H43A 2A06G 1FZBA 3KPEA 4U3FG 2FY8A 3H1KG 1BGYG 3H1IJ 1IFNA 4NPEA 4A7PA 2P1JA 2Q1KA 3L73E 2OYHC 1OVRA 2RKLA 2FKWB 3TGUE 3Q3DA 1GW4A 2O01N 3H32B 4HH2A 1KILD 1QEXA 2N1TC 2KZIA 3NFQA 1T3JA 1KTMA 5AVXB 3H1LD 1U57A 2IBZI 3L70J 3L72D 4UB8E 1HUCA 2FBWC 2GUVA 4IL6X 4Y99C 3VMXA 1JY3N 3RK2D 5CHXA 1PPJG 4WWIA 2YKPA 4ZNCA 1NU1E 1URQA 2C9LY 5C39A 3CCUP 3OAKA 1K05A 2ZJSE 1JY2P 2KSJA 2K88A 2POHA 1NHLA 2ZT9C 1FZFA 2A06D 4TT3H 1RF1C 4PD4D 2QJPB 1ZOYC 5GTIH 3H6PA 4GIFA 2HPCA 2KLVA 1KQGB 5E79E 2KUBA 2JWDA 1MKMA 2VRSA 1KYOI 3D6YA 1SQPD 1FJPA 1L0LG 1JOCA 3A5TA 2FFDA 2NPSC 1IJDB 3BASA 1LTTC 3IF4A 1VQ8P 3MUDC 1BCCJ 4B86A 4R4MA 1N73C 1NTKJ 2G8YA 1KYOH 3V6IA 1NJIQ 1BDDA 1S4XA 1SQQK 2J58A 3RK3C 5KLIC 2BEQD 3QH9A 3SWYA 2MJZA 1SQQG 1NTZD 1YI2P 1R8EA 2E75B 1MZ9A 3WUVA 2YNYA 1R5LA 5AW4B 4UB8H 3H1ID 4ASVA 3GF3A 1JY2O 1J1EC 1ZN5A 2WT7B 1YQ3C 2I8DA 2C0XA 2LR2A 3UIAA 4TLFA 3BCCJ 3L73J 3II6A 4I6MC 3L74G 2M3EA 2MKVA 1JB0J 4KJMA 1EDKA 5AW7B 1SQBE 1HJBA 1GL2A 3A0BE 1HWTC 2KXPB 2OYHB 3KHUA 5KAFE 4LLHA 1URQD 3VOPA 3AE6C 2ZYAA 1SS1A 1BSNA 4DZOA 5TISE 3I5CA 1T3UA 2WSCH 3H1HE 3L37A 4EI2A 3HUSA 3CX5E 1E79H 2H8PD 5GTHH 1SQVJ 1M1JA 2HFED 3AECC 3AE2C 5AVTB 2M8RA 1NU1J 2QJKC 5KLVE 3D71A 1L4AB 2V7QH 1PP9G 1SFCA 1FZCA 2AEJA 5CCHA 1JCCA 1KORA 2FYUK 2HODB 3L75G 3CLQA 4IFDK 2R3SA 3AE4C 3H1LE 2BCCJ 3CWBG 2J5UA 1FDMA 1Y47A 3B5NC 2FYUG 4WY4A 1A02F 2WSCJ 5B5EH 1M8OB 3L71G 1KB9E 2RH0A 4H13D 1KMIZ 5AW3B 3KZIE 1BCCD 1X8YA 2M0BA 5KKZB 5AW0B 1P84D 1NOHA 2AEMA 2Q7CA 2V7QJ 1ZW0A 3KYQA 2Q3EA 4PV1D 4I7ZB 2A06E 2W6BA 2GUSA 1NWQA 4U3FE 2CPBA 3PP5A 1N73B 4PD4E 5KJ7D 2Z5HA 3H1KE 1BGYE 4I2LC 3A0BH 3CX5I 4N78D 5H2FE 1XTGB 3V4WA 4OGQB 2LKMA 3RK3B 1MUUA 5KLIB 4W80A 3MTUE 4H0LD 3Q5RA 2ZYGA 4H44D 1JM0A 1JUNA 1VQ5P 3TDKA 4JYBA 1NKNA 2WWWA 4GOFA 1VQLP 3AEBC 3CX5H 3P32A 1G2CB 1KYOD 2E74B 2QSIA 2C0WA 1PGQA 4C7NA 2J59M 3C9IA 1J1EB 3RL0g 1E5WA 3MP7B 3QWOC 2P67A 1NTMK 2Y0DA 1KB9I 1SQBJ 4L74A 3CXHD 1RH5B 3CC4P 4XA4A 1NTMG 1FOSF 2E76B 3AE1C 3VYIA 2JO1A 4O9BA 3P8CD 5AVUB 2OQQA 1ZR2A 1S9KD 1KB9H 3CCLP 1HGZA 4EDFA 2HLOA 2NZ2A 5AVYB 5EFWB 5APVA 3KZIH 3M9BA 4HKZH 1N8RQ 4RESB 2E43A 2A45G 1KQFB 5M1BA 3U59A 1L0ND 1FE6A 4HB1A 1D7MA 1KILA 2R5BA
chains in the Genus database with same CATH topology
1GW4A 1LT9B 2CPSA 1DEBA 1W2EA 2OYIA 1J1DB 3EFGA 5AW2B 3H32B 4HH2A 2W27A 2A45H 1KILD 4ZKPA 2N1TC 3VP8A 3NTNA 3HUSC 2FYZA 3L4FA 1L0NK 4AQRD 1ZLLA 1NTKK 1IC2A 4GKGA 5AVRB 3NFQA 1T3JA 5AVXB 2ZXEB 1M1JC 2WZ7A 1PFIA 5BVZA 3A7OA 1IK9A 1HUCA 2GUVA 2JJLA 3M9HA 1GK6A 3A2AA 4Y99C 3VMXA 3B5NA 1SFCC 2BASA 5APSA 1JY2N 1JY3N 3RK2D 1FZCC 2WPSA 5CCHC 5CHXA 1URQB 3LIDA 3B5ND 4GT1A 1GL2B 2YKPA 3RK3D 1URQA 3GHGC 1CZQA 5APQA 1LTBC 1CSBA 2C9LY 3KDPB 2L5GB 1LTJA 5APYA 1JNMA 3OAKA 4WY4C 4EIJA 1JY2P 2KSJA 2QM7A 3V2QA 3RL0D 2POHA 1FBMA 3CI9A 2I1KA 1NHLA 1EQ7A 2N1TB 1FZFA 2WTYA 5CCGA 1RF1C 2HPCB 1M7LA 2KYVA 3A3YB 5APWA 3OJAB 3P7KA 3VP9A 2PAJA 3H6PA 4GIFA 5CCGD 2HPCA 1GU5A 2KLVA 1ZV8A 3IFMA 1HTLC 3M9QA 1RF0C 2VRSA 1KFNA 3KQGA 4Y99B 1NAFA 1SFCB 4LC1A 5APUA 2ZFCA 1FJPA 2FFDB 1FZCB 3HD7A 1GU4A 4XE5B 5KJ7C 2YKOA 1GDTA 1JOCA 1N2DC 3HTKB 3A5TA 1FOSE 2FFDA 1XTCC 2NPSC 3N7NA 3BVHA 3LW5H 1YYCA 1IJDB 3BASA 3HD7D 1LTTC 3HTKA 4B86A 1N73C 3E1IA 3EQ2A 1N7SB 3M0DC 4WY4B 3V4QA 1SQPK 1SQQK 1N7SA 1KQLA 3M0AA 3T97A 2J58A 1NO4A 3RK3C 3V5BA 2Z4EA 5AW1B 3SWYA 1YTZI 1NU1K 1RF1B 2MJZA 1SQBK 5AVSB 1LTSC 1LTAC 1YTZT 1JO5A 5CJ0A 4ZKUA 1LT9A 3RL0C 4W7ZA 5AVWB 3H32A 5CJ4A 1MZ9A 3HE4B 2YNYA 1T2KD 1LWUC 3V2NA 1OWAA 2Q3IA 5AW4B 1HBWA 2XNXA 1H89A 2KP8A 1H88A 2WITA 1FZGA 2XV5A 1JY2O 1NTZK 2YO3A 1IFDA 1J1EC 3VMZA 1LGHB 3TSIA 1ZN5A 1MFZA 3HE5B 2WT7B 2NPSB 3V2RA 1G1JA 2C0XA 3HE5A 2WT7A 3UIAA 1L4AC 1GD2E 5AVZB 3II6A 1GK4A 4I6MC 1G1IA 1HGVA 2IFNA 4IFFA 5AW7B 2N9BA 3U1AA 1HJBA 1GL2A 3B8EB 1HWTC 2OYHB 1SP4A 3NMDA 1RE3A 4LLHA 1URQD 1JY3P 3VOPA 2GM4A 3LIEA 1GL2D 2OYHA 2OARA 1N7LA 2HG5D 2M3BA 1IO4A 1QL2A 4DZOA 1FJKA 3HUSB 3I5CA 1T3UA 2WSCH 4KHXA 1GTWA 2FXMA 1LWUB 3L37A 1RE4C 2N1TA 2Z5IA 3R2PA 4HYTB 3HUSA 1T8ZA 4WBAA 2YMYA 1M1JB 1JMMA 1HVVA 2H8PD 2N1TD 1KILC 2IPPA 5AW6B 1OXZA 1M1JA 2HFED 1DH3A 3M06A 5AVTB 1SVFA 2M8RA 1L4AB 1SFCA 2XU6A 3P8MC 3TYYA 1FZCA 1DX7A 2QM8A 5CCHA 1JCCA 1CI6B 3GHGB 1SFCD 1JCDA 5KTBA 5AW9B 2FYUK 2HODB 3NXSA 4WB4A 2O1KA 3CLQA 4IFDK 1QL1A 1RY3A 5CCHD 3GHGA 3RK2C 1MV8A 2YO2A 1LTIC 3VN0A 4N78E 2I1JA 1FDMA 3B5NC 3N4XA 4WY4A 3OA7A 1ZR4A 4JYCA 1A02F 1WT6A 1N7SD 1JTHB 5AVQB 4WY4D 2Q9IA 2R3CA 1GW3A 3MGNA 5AW3B 1RF1A 1LTJC 1IFJA 2PP6A 1X8YA 1KILB 4N3YB 1KFMA 5AW0B 1NOHA 4LGDE 1RF0A 4OH8B 3HE4A 2Q7CA 4I1LA 3KYQA 1JY3O 2XKMA 1LTGC 2WPRA 5CCGC 3BRTB 4DOJA 2R32A 3CL3D 1CW5A 1FZEA 5KJ7A 5CMZA 1NKZB 1IFIA 2JEEA 2IX7C 2W6BA 3L36A 2GUSA 1NWQA 1AQ5A 2CPBA 2NPSA 3PP5A 1N73B 1A02J 3BRVB 1KZUB 5KJ7D 2Z5HA 3RK2B 3O8ZA 4I2LC 3V2PA 3MUDA 4N78D 2W6AA 1N73A 2H7HA 1XTGB 2E42A 3V4WA 3B5NB 2NPSD 5KLVK 3M0DA 2LKMA 1SLQA 3WMM0 4EOTA 3RK3B 1MUUA 1VPCA 3HD7C 3IR9A 3MTUE 4W80A 3G3ZA 2FFDC 2WSEH 3P8CE 2WPQA 1JUNA 1S9KE 3MIWA 1IFMA 1X79B 4JYBA 1NKNA 4M3LA 5AVVB 3VMYA 3RL0B 2WWWA 1LTJB 3VTPC 4C7NB 4IFMA 3P32A 1G2CB 2HYNA 1N7SC 2C0WA 4C7NA 2J59M 1G2CA 2C9NY 1LWUA 3U1CA 3C9IA 4JF7A 1J1EB 2O1JA 1E5WA 3HRNA 1GZLA 2P2UA 1Z56A 3MD0A 5APXA 3TK1A 2P67A 2OYIC 1NTMK 1T2KC 3M91A 3TNUB 1LT9C 3L35A 1H8AA 2XDJA 1J1DC 5AW8B 1J2JB 4XA4A 4C46A 3TNUA 1N86A 4W7YA 4AUWA 2Q5UA 1L4AA 2O01H 1FOSF 1L0LK 5BU5A 1FU1A 4C7RA 2WSFH 1FZAA 3HD7B 3VYIA 4AYCA 1FAVA 1L4AD 1CI6A 2R5DA 5APTA 2YKQA 4O9BA 3BATA 3P8CD 2HODA 5AVUB 1WRGA 1ZR2A 1S9KD 1SQXK 1HGZA 2IFMA 5AW5B 2HLOA 3SWFA 1NH4A 5AVYB 5BU8B 2KOGA 1X9VA 2H43A 1FZBA 1VDFA 2KB7P 5APVA 3M9BA 3KPEA 4RESB 2E43A 2A45G 1HH0A 1URQC 2A45I 1JTHA 2P7JA 1AFOA 1GL2C 1IFNA 3U59A 1RE4A 1RE3C 2P1JA 1SQVK 2OYHC 2OYIB 2XZRA 2FKWB 1KILA 4N6JA 2R5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTB C;  1HTL C;  1LTI C;  1XTC C;  1LTG C;  1LTT C;  1LTS C;  1LTA C; 
#chains in the Genus database with same CATH topology
 1L0L E;  2OYI A;  2R44 A;  2KLU A;  3I56 P;  3JSV C;  2KNC B;  4ZKP A;  3VP8 A;  2AXC A;  2FYZ A;  3L4F A;  4AQR D;  4ASW A;  1IC2 A;  5AVR B;  1VQO P;  2QJP C;  2WZ7 A;  2G3A A;  2B88 A;  3Q5S A;  4PJ0 E;  1AVO A;  4L76 A;  3S4R A;  1S2E A;  1M56 D;  1VQN P;  2BAS A;  5APS A;  1SQQ E;  3Q1M A;  2IDB A;  2WPS A;  4ZMD A;  3LID A;  2W83 C;  3I55 P;  4GT1 A;  1GL2 B;  1NYH A;  1OW8 A;  3GHG C;  1CZQ A;  5APQ A;  3KDP B;  1Q7Y Q;  1LTJ A;  1JNM A;  4EIJ A;  3H1L G;  1KQS O;  3RL0 D;  1AA0 A;  1FBM A;  3CI9 A;  3L72 G;  4D6T D;  1EQ7 A;  1ZP0 C;  2WTY A;  2AXT H;  3PLN A;  3CME P;  5APW A;  4UB6 E;  3P7K A;  2E75 C;  3VP9 A;  3L74 E;  5CCG D;  2YXQ B;  2JKV A;  1GU5 A;  2M5A A;  3K5B A;  2QRX A;  1P84 E;  1NAF A;  1SFC B;  1VF5 B;  5APU A;  3GMA A;  2KIK A;  2WSE J;  1FZC B;  1GU4 A;  2ZYD A;  1N2D C;  1L2P A;  1PV3 A;  3FXE A;  3HD7 D;  3HTK A;  3D70 A;  1KD1 Q;  3E1I A;  1RQV A;  3T97 B;  3M0D C;  4WY4 B;  2DW3 A;  1QVF O;  1SQP K;  1N7S A;  2P58 A;  1KQL A;  1EZV I;  2W6J H;  1NO4 A;  2WQY C;  1EXJ A;  3V5B A;  5AW1 B;  2JR8 A;  1SQP G;  3E1R A;  3SWK A;  1LTS C;  1PP9 E;  1R5S A;  1LTA C;  1YTZ T;  2K9J B;  1JO5 A;  3AEG C;  2W8Z A;  1T2K D;  3L75 E;  1VQ4 P;  2XNX A;  3CWB E;  2WIT A;  2QE7 H;  1NTZ K;  3VMA A;  2FYU E;  3MHV A;  3TSI A;  1MFZ A;  4U7J A;  1AV1 A;  5KAI E;  3L71 E;  1ZRT E;  3HE5 A;  1NTZ G;  1L4A C;  5K5G B;  1G1I A;  1HGV A;  2IFN A;  4IFF A;  1L0L J;  1Y8A A;  3U1A A;  1BE3 J;  2B87 A;  3B4S A;  1RE3 A;  3NMD A;  2CK3 H;  3H1I G;  1YIJ P;  1SQX J;  2HG5 D;  1IO4 A;  2KS1 A;  3O6Q A;  3RBZ A;  2KK7 A;  1GTW A;  2FXP A;  2Z5I A;  1QX8 A;  1WMK A;  4HYT B;  2QG4 A;  4L73 A;  3USS A;  1JMM A;  1HVV A;  3H1J D;  2N1T D;  2OGU A;  5KKZ C;  1OXZ A;  4NPF X;  1DH3 A;  1IZN B;  3L70 G;  2OYO A;  1TU3 F;  2BEZ F;  3P8M C;  3TYY A;  3AEA C;  1DX7 A;  4I7Z C;  1IFP A;  2PRR A;  3GHG B;  1JCD A;  5KTB A;  5AW9 B;  3WU2 E;  1Q86 Q;  1RY3 A;  2RN0 A;  1MV8 A;  1PZQ A;  3VN0 A;  2I1J A;  4OGQ C;  3OA7 A;  3FGA D;  1WT6 A;  1N7S D;  2Q9I A;  1GW3 A;  1AQT A;  1NTM E;  3CCM P;  1IFJ A;  2PP6 A;  2KI7 B;  2ZT9 D;  1KIL B;  2E74 C;  1KFM A;  2IYO A;  2D2C D;  4DT0 A;  1RF0 A;  5KAI H;  1PGO A;  1Q90 D;  4DOJ A;  1DEE G;  2KZJ A;  4D6T E;  5KJ7 A;  3A0H E;  2K37 A;  2JEE A;  2IX7 C;  1AQ5 A;  3AE9 C;  3RK2 B;  3V2P A;  1U7M A;  3TGU J;  2NPS D;  1SLQ A;  1BCC G;  3ZDM A;  3WMM 0;  2E76 C;  4EOT A;  3IR9 A;  3L70 D;  2FFD C;  1X0T A;  1ZME C;  3L75 J;  5AVV B;  1LTJ B;  2HYN A;  1QLE D;  4WVZ A;  5E79 H;  1LJ2 A;  2N9Y B;  1LWU A;  3L71 J;  4JF7 A;  1BE3 D;  1FS0 E;  1Z56 A;  3MD0 A;  5APX A;  3M91 A;  3TNU B;  1OMI A;  2Y9Z A;  1SQX D;  3L35 A;  2FXO A;  2M5A B;  2XDJ A;  4C46 A;  3WU2 H;  1EZV D;  1KIL E;  1YJW P;  4AUW A;  2Q5U A;  4R4L A;  2O01 H;  4CPG A;  3BCC G;  4AYC A;  3EFF K;  4NPD A;  1CI6 A;  1KN7 A;  2YKQ A;  2JP3 A;  3L72 E;  1KC8 Q;  2RMZ A;  4IL6 E;  1X22 A;  5BU8 B;  2KB7 P;  2IBZ D;  2A45 I;  3WUU A;  1AFO A;  4H44 C;  1GL2 C;  1RE4 A;  1OX3 A;  4XFJ A;  4HJG H;  1NTK D;  1SQV K;  2XZR A;  4N6J A;  2NRG A;  1DEB A;  3EFG A;  1SQV G;  3FXD A;  2W27 A;  2A45 H;  2O01 J;  3HUS C;  1PIX A;  1L0N K;  1ZLL A;  2IZ1 A;  2WSS H;  1PL5 A;  1M1J C;  1PFI A;  3C8V A;  5KAF H;  3A7O A;  2UWJ E;  1FDO A;  3R4Y A;  1PGP A;  1GMJ A;  2E5T A;  1L0N G;  2OTL P;  3M9H A;  1SFC C;  1VF5 C;  1SQP E;  1YIT P;  1FZC C;  5TIS H;  1Q81 Q;  5CCH C;  1URQ B;  4GOD A;  3B5N D;  4RO0 A;  3BCC D;  3L73 D;  5APY A;  2SPZ A;  4WY4 C;  3CCR P;  2QM7 A;  3V2Q A;  2KS1 B;  1H0T A;  2B9B A;  2I1K A;  1LT1 A;  5CCG A;  1NTZ E;  2HPC B;  3A3Y B;  3OJA B;  1LNQ A;  1ZXG A;  3Q2Y A;  1ZV8 A;  3IFM A;  5B66 E;  2K3R A;  1HTL C;  3M9Q A;  1KFN A;  4LC1 A;  1JMB A;  2ZVO B;  3H1I E;  2ZFC A;  2ZVN B;  2FFD B;  3CMA P;  3HD7 A;  1SQV D;  2KSE A;  3H1H J;  2YKO A;  2E5Y A;  1GDT A;  2LXB A;  1DD3 A;  1FOS E;  1XTC C;  1S3J A;  4D6T G;  3D6Z A;  1YYC A;  1NU1 D;  3S9O A;  4BXL A;  2ZAE B;  1PGJ A;  5CBO A;  3AE3 C;  5DJU B;  2WVR A;  3EQ2 A;  4YTP C;  4DCK A;  4PD4 I;  3SFD C;  3V4Q A;  4H13 B;  3M0A A;  5KLV J;  1EDJ A;  1S72 P;  2BCC D;  2Z4E A;  3L70 E;  1SQB K;  1LT9 A;  3RL0 C;  4PD4 H;  3W67 A;  3H1L J;  5AVW B;  5CJ4 A;  1YJ9 P;  4PV1 B;  5H2F H;  3SSU A;  3V2N A;  2Q3I A;  1H88 A;  1FZG A;  2XV5 A;  2ITA A;  2YO3 A;  1IFD A;  3VMZ A;  4L75 A;  4RKU J;  1W2B O;  1USE A;  1VQ9 P;  2WT7 A;  1GD2 E;  4H0L B;  1GK4 A;  4H44 B;  3ABV C;  3OW2 O;  2OTJ P;  3B8E B;  4JPZ B;  1SP4 A;  1QVG O;  1JY3 P;  2QJY B;  3LIE A;  2OYH A;  4U3F J;  2M3B A;  2Y0E A;  1QL2 A;  3H1K J;  1BGY J;  2OTK E;  2GA1 A;  3HUS B;  4KHX A;  1LWU B;  3RGU A;  5B66 H;  2N1T A;  3CCS P;  2YMY A;  1M1J B;  1SQP J;  1BCC E;  1KIL C;  2IPP A;  5AW6 B;  1T6A A;  3CCJ P;  3M06 A;  1EC5 A;  4MN4 C;  1YHQ P;  3ITK A;  3PRJ A;  1CI6 B;  1SQB D;  1YJN P;  2PFX A;  1KV4 A;  3NXS A;  4WB4 A;  2O1K A;  3CC7 P;  1K9M Q;  1NGM B;  3RK2 C;  2YO2 A;  4N78 E;  3H1J G;  3N4X A;  3PH0 A;  3G6E P;  4JYC A;  3H1H D;  3CX5 D;  1RF1 A;  1LTJ C;  3G9R A;  4N3Y B;  1KYO E;  3BCC E;  4PJ0 H;  2E75 D;  1S5L E;  3HE4 A;  5KLV D;  4I1L A;  1YBK A;  1JY3 O;  3CCQ P;  1LTG C;  2WPR A;  1HJ0 A;  4BWN A;  1OW7 A;  1CW5 A;  1HF9 A;  4Y28 J;  5CMZ A;  1NKZ B;  3AEE C;  1IFI A;  4Z1M H;  3Q5P A;  3L36 A;  1Y9B A;  2H89 C;  4BRY A;  2NPS A;  3CXH E;  3BRV B;  1KZU B;  2K1A A;  3MUD A;  2W6A A;  1N73 A;  1VPC A;  1EXI A;  1M90 Q;  1P84 I;  1KB9 D;  2JDI H;  2YXR B;  3P8C E;  1OVU A;  1SQV E;  1S9K E;  1X79 B;  3RL0 B;  3VTP C;  4UB6 H;  4C7N B;  4IFM A;  3C1L A;  1K8A Q;  1N7S C;  1H0T B;  1G2C A;  1P84 H;  1LP1 A;  1SQQ J;  4OWF A;  3U1C A;  2O1J A;  1L0N E;  1GZL A;  3CPW O;  3KXD A;  1MFT A;  2BCC E;  2WPV B;  1AJY A;  4U3F D;  2D2C C;  5AW8 B;  3H1K D;  1J2J B;  1BGY D;  1N86 A;  1QGK B;  1L0L K;  5BU5 A;  1IK7 A;  2WSF H;  4C7R A;  1FZA A;  3HD7 B;  4EYY Q;  1FAV A;  1L4A D;  2R5D A;  2V4H A;  5APT A;  5GTH E;  3BAT A;  1WRG A;  1SQX K;  1K04 A;  1BE3 G;  5DJT B;  5AW5 B;  1NH4 A;  3L74 J;  2KOG A;  1X9V A;  1VDF A;  4JBZ A;  1SQX G;  2PGD A;  1HH0 A;  1URQ C;  1U7J A;  3CXH I;  3FWN A;  1JTH A;  2P7J A;  1EZV G;  1RE3 C;  1S5L H;  3GF7 A;  1NAY A;  2OYI B;  3PHL A;  1LT9 B;  2CPS A;  1W2E A;  2QVA A;  1J1D B;  5AW2 B;  4YXW H;  5B5E E;  1PPJ D;  3CXH H;  3NTN A;  2WSF J;  2KNC A;  1K73 Q;  1NTK K;  1W5C E;  4GKG A;  2IBZ G;  4K3A A;  2ZXE B;  5BVZ A;  1BSH A;  1IK9 A;  1PP9 J;  1NTK G;  2JJL A;  1GK6 A;  3A2A A;  3B5N A;  1YQ4 C;  3PJS K;  1JY2 N;  1VQ6 P;  4OGQ D;  3CWB J;  3RK3 D;  1M1K Q;  1CSB A;  1LTB C;  3F89 A;  2L5G B;  2FYU J;  3WUT A;  4H13 C;  1L0L D;  2YIU C;  4K35 A;  3FX0 A;  3CCV P;  2E74 D;  2N1T B;  2Y9Y A;  2H88 C;  1M7L A;  2FYN C;  2KYV A;  3S1K A;  3W68 A;  2PAJ A;  1OW6 A;  3H25 A;  1RF0 C;  1FC2 C;  4IOI H;  4PV1 C;  3L73 G;  3KQG A;  4Y99 B;  3TGU G;  1SQQ D;  2B89 A;  1UIX A;  3JC2 2;  3GW6 A;  2HR3 A;  5CBN A;  4XE5 B;  5KJ7 C;  3HTK B;  1EDI A;  1M57 D;  2E76 D;  3BVH A;  3N7N A;  3LW5 H;  4JQ0 D;  3CCE P;  1L0N J;  3AE8 C;  1N7S B;  3CC2 P;  4H0L C;  3T97 A;  3CD6 P;  3EWK A;  2ZT9 B;  1VQK P;  1YTZ I;  1NU1 K;  1RF1 B;  1EDL A;  2JWA A;  2QJY C;  4KT0 J;  2D2C B;  5AVS B;  3A0H H;  2QIW A;  3B71 A;  3L74 D;  5CJ0 A;  4ZKU A;  4W7Z A;  1NU1 G;  3H32 A;  2K9J A;  3HE4 B;  2W90 A;  1LWU C;  2LXC B;  1OWA A;  1HBW A;  1H89 A;  2WMM A;  2KP8 A;  1LGH B;  3H1J E;  1FDI A;  3HE5 B;  3LW5 J;  4BRY B;  2NPS B;  3V2R A;  1G1J A;  2BCC G;  1NTM J;  4YPC A;  3AE5 C;  5AVZ B;  2B87 B;  2N9B A;  3MZW B;  2XND H;  4D6T J;  3TGU D;  2GM4 A;  1GL2 D;  1PP9 D;  3RBX A;  2OAR A;  1N7L A;  3O6Q B;  3IN6 A;  4DJG A;  1FJK A;  2L91 A;  2FXM A;  3L75 D;  1LP1 B;  1RE4 C;  3R2P A;  1T8Z A;  3CWB D;  4WBA A;  3JCU E;  1S5L X;  4QMA A;  2FYU D;  3E7K A;  2IYP A;  3PTZ A;  3GLM A;  3AE7 C;  3L71 D;  1SVF A;  1ZRT D;  1Q2N A;  4IL6 H;  3FWL A;  1OFC X;  1VL2 A;  2XU6 A;  1DIP A;  2AXT E;  1PPJ E;  2QM8 A;  1SFC D;  1VF5 D;  1QL1 A;  5CCH D;  2IZ0 A;  3GHG A;  1UII A;  1AVY A;  1LTI C;  2YIU B;  4RJT A;  1ZR4 A;  1VQ7 P;  1JTH B;  5AVQ B;  4WY4 D;  2R3C A;  2FYN B;  3MGN A;  1OVV A;  2QA4 P;  1RHZ B;  3RK3 E;  4GOE A;  1SQB G;  1OIP A;  5TJH A;  5L8R J;  3L72 J;  2Y0C A;  4LGD E;  4OH8 B;  2QJK B;  1OZH A;  3G71 P;  2XKM A;  1BE3 E;  5CCG C;  3BRT B;  1BDC A;  2R32 A;  3CL3 D;  1DD4 A;  1FZE A;  1VQM P;  3H1H G;  1SQX E;  2QEX P;  1A02 J;  2K9Y A;  2YMK A;  3O8Z A;  1EZV E;  1S1C X;  2H7H A;  2E42 A;  2ZXX A;  3B5N B;  5KLV K;  3M0D A;  3SFE C;  3HD7 C;  1USD A;  3GG2 A;  1RQU A;  3G3Z A;  2WSE H;  5KLV G;  1Q82 Q;  4GDO A;  2WPQ A;  3MIW A;  1IFM A;  1JEK A;  4M3L A;  1NTM D;  3VMY A;  4OVN F;  3F5H A;  3JCU H;  3H1J J;  2AEF A;  2Q6Q A;  2IBZ E;  2C9N Y;  3HRN A;  2P2U A;  1NTK E;  3TK1 A;  2OYI C;  1T2K C;  1LT9 C;  3G4S P;  1H8A A;  1VQP P;  1J1D C;  4YXD C;  3TNU A;  4W7Y A;  1NVO A;  1L4A A;  2P10 A;  3AEF C;  1FU1 A;  5GTI E;  3AED C;  3IAO A;  2HOD A;  2O3J A;  1NTZ J;  3TF5 A;  2IFM A;  3SWF A;  2H43 A;  2A06 G;  1FZB A;  3KPE A;  4U3F G;  2FY8 A;  3H1K G;  1BGY G;  3H1I J;  1IFN A;  4NPE A;  4A7P A;  2P1J A;  2Q1K A;  3L73 E;  2OYH C;  1OVR A;  2RKL A;  2FKW B;  3TGU E;  3Q3D A;  1GW4 A;  2O01 N;  3H32 B;  4HH2 A;  1KIL D;  1QEX A;  2N1T C;  2KZI A;  3NFQ A;  1T3J A;  1KTM A;  5AVX B;  3H1L D;  1U57 A;  2IBZ I;  3L70 J;  3L72 D;  4UB8 E;  1HUC A;  2FBW C;  2GUV A;  4IL6 X;  4Y99 C;  3VMX A;  1JY3 N;  3RK2 D;  5CHX A;  1PPJ G;  4WWI A;  2YKP A;  4ZNC A;  1NU1 E;  1URQ A;  2C9L Y;  5C39 A;  3CCU P;  3OAK A;  1K05 A;  2ZJS E;  1JY2 P;  2KSJ A;  2K88 A;  2POH A;  1NHL A;  2ZT9 C;  1FZF A;  2A06 D;  4TT3 H;  1RF1 C;  4PD4 D;  2QJP B;  1ZOY C;  5GTI H;  3H6P A;  4GIF A;  2HPC A;  2KLV A;  1KQG B;  5E79 E;  2KUB A;  2JWD A;  1MKM A;  2VRS A;  1KYO I;  3D6Y A;  1SQP D;  1FJP A;  1L0L G;  1JOC A;  3A5T A;  2FFD A;  2NPS C;  1IJD B;  3BAS A;  1LTT C;  3IF4 A;  1VQ8 P;  3MUD C;  1BCC J;  4B86 A;  4R4M A;  1N73 C;  1NTK J;  2G8Y A;  1KYO H;  3V6I A;  1NJI Q;  1BDD A;  1S4X A;  1SQQ K;  2J58 A;  3RK3 C;  5KLI C;  2BEQ D;  3QH9 A;  3SWY A;  2MJZ A;  1SQQ G;  1NTZ D;  1YI2 P;  1R8E A;  2E75 B;  1MZ9 A;  3WUV A;  2YNY A;  1R5L A;  5AW4 B;  4UB8 H;  3H1I D;  4ASV A;  3GF3 A;  1JY2 O;  1J1E C;  1ZN5 A;  2WT7 B;  1YQ3 C;  2I8D A;  2C0X A;  2LR2 A;  3UIA A;  4TLF A;  3BCC J;  3L73 J;  3II6 A;  4I6M C;  3L74 G;  2M3E A;  2MKV A;  1JB0 J;  4KJM A;  1EDK A;  5AW7 B;  1SQB E;  1HJB A;  1GL2 A;  3A0B E;  1HWT C;  2KXP B;  2OYH B;  3KHU A;  5KAF E;  4LLH A;  1URQ D;  3VOP A;  3AE6 C;  2ZYA A;  1SS1 A;  1BSN A;  4DZO A;  5TIS E;  3I5C A;  1T3U A;  2WSC H;  3H1H E;  3L37 A;  4EI2 A;  3HUS A;  3CX5 E;  1E79 H;  2H8P D;  5GTH H;  1SQV J;  1M1J A;  2HFE D;  3AEC C;  3AE2 C;  5AVT B;  2M8R A;  1NU1 J;  2QJK C;  5KLV E;  3D71 A;  1L4A B;  2V7Q H;  1PP9 G;  1SFC A;  1FZC A;  2AEJ A;  5CCH A;  1JCC A;  1KOR A;  2FYU K;  2HOD B;  3L75 G;  3CLQ A;  4IFD K;  2R3S A;  3AE4 C;  3H1L E;  2BCC J;  3CWB G;  2J5U A;  1FDM A;  1Y47 A;  3B5N C;  2FYU G;  4WY4 A;  1A02 F;  2WSC J;  5B5E H;  1M8O B;  3L71 G;  1KB9 E;  2RH0 A;  4H13 D;  1KMI Z;  5AW3 B;  3KZI E;  1BCC D;  1X8Y A;  2M0B A;  5KKZ B;  5AW0 B;  1P84 D;  1NOH A;  2AEM A;  2Q7C A;  2V7Q J;  1ZW0 A;  3KYQ A;  2Q3E A;  4PV1 D;  4I7Z B;  2A06 E;  2W6B A;  2GUS A;  1NWQ A;  4U3F E;  2CPB A;  3PP5 A;  1N73 B;  4PD4 E;  5KJ7 D;  2Z5H A;  3H1K E;  1BGY E;  4I2L C;  3A0B H;  3CX5 I;  4N78 D;  5H2F E;  1XTG B;  3V4W A;  4OGQ B;  2LKM A;  3RK3 B;  1MUU A;  5KLI B;  4W80 A;  3MTU E;  4H0L D;  3Q5R A;  2ZYG A;  4H44 D;  1JM0 A;  1JUN A;  1VQ5 P;  3TDK A;  4JYB A;  1NKN A;  2WWW A;  4GOF A;  1VQL P;  3AEB C;  3CX5 H;  3P32 A;  1G2C B;  1KYO D;  2E74 B;  2QSI A;  2C0W A;  1PGQ A;  4C7N A;  2J59 M;  3C9I A;  1J1E B;  3RL0 g;  1E5W A;  3MP7 B;  3QWO C;  2P67 A;  1NTM K;  2Y0D A;  1KB9 I;  1SQB J;  4L74 A;  3CXH D;  1RH5 B;  3CC4 P;  4XA4 A;  1NTM G;  1FOS F;  2E76 B;  3AE1 C;  3VYI A;  2JO1 A;  4O9B A;  3P8C D;  5AVU B;  2OQQ A;  1ZR2 A;  1S9K D;  1KB9 H;  3CCL P;  1HGZ A;  4EDF A;  2HLO A;  2NZ2 A;  5AVY B;  5EFW B;  5APV A;  3KZI H;  3M9B A;  4HKZ H;  1N8R Q;  4RES B;  2E43 A;  2A45 G;  1KQF B;  5M1B A;  3U59 A;  1L0N D;  1FE6 A;  4HB1 A;  1D7M A;  1KIL A;  2R5B A; 
#chains in the Genus database with same CATH homology
 1GW4 A;  1LT9 B;  2CPS A;  1DEB A;  1W2E A;  2OYI A;  1J1D B;  3EFG A;  5AW2 B;  3H32 B;  4HH2 A;  2W27 A;  2A45 H;  1KIL D;  4ZKP A;  2N1T C;  3VP8 A;  3NTN A;  3HUS C;  2FYZ A;  3L4F A;  1L0N K;  4AQR D;  1ZLL A;  1NTK K;  1IC2 A;  4GKG A;  5AVR B;  3NFQ A;  1T3J A;  5AVX B;  2ZXE B;  1M1J C;  2WZ7 A;  1PFI A;  5BVZ A;  3A7O A;  1IK9 A;  1HUC A;  2GUV A;  2JJL A;  3M9H A;  1GK6 A;  3A2A A;  4Y99 C;  3VMX A;  3B5N A;  1SFC C;  2BAS A;  5APS A;  1JY2 N;  1JY3 N;  3RK2 D;  1FZC C;  2WPS A;  5CCH C;  5CHX A;  1URQ B;  3LID A;  3B5N D;  4GT1 A;  1GL2 B;  2YKP A;  3RK3 D;  1URQ A;  3GHG C;  1CZQ A;  5APQ A;  1LTB C;  1CSB A;  2C9L Y;  3KDP B;  2L5G B;  1LTJ A;  5APY A;  1JNM A;  3OAK A;  4WY4 C;  4EIJ A;  1JY2 P;  2KSJ A;  2QM7 A;  3V2Q A;  3RL0 D;  2POH A;  1FBM A;  3CI9 A;  2I1K A;  1NHL A;  1EQ7 A;  2N1T B;  1FZF A;  2WTY A;  5CCG A;  1RF1 C;  2HPC B;  1M7L A;  2KYV A;  3A3Y B;  5APW A;  3OJA B;  3P7K A;  3VP9 A;  2PAJ A;  3H6P A;  4GIF A;  5CCG D;  2HPC A;  1GU5 A;  2KLV A;  1ZV8 A;  3IFM A;  1HTL C;  3M9Q A;  1RF0 C;  2VRS A;  1KFN A;  3KQG A;  4Y99 B;  1NAF A;  1SFC B;  4LC1 A;  5APU A;  2ZFC A;  1FJP A;  2FFD B;  1FZC B;  3HD7 A;  1GU4 A;  4XE5 B;  5KJ7 C;  2YKO A;  1GDT A;  1JOC A;  1N2D C;  3HTK B;  3A5T A;  1FOS E;  2FFD A;  1XTC C;  2NPS C;  3N7N A;  3BVH A;  3LW5 H;  1YYC A;  1IJD B;  3BAS A;  3HD7 D;  1LTT C;  3HTK A;  4B86 A;  1N73 C;  3E1I A;  3EQ2 A;  1N7S B;  3M0D C;  4WY4 B;  3V4Q A;  1SQP K;  1SQQ K;  1N7S A;  1KQL A;  3M0A A;  3T97 A;  2J58 A;  1NO4 A;  3RK3 C;  3V5B A;  2Z4E A;  5AW1 B;  3SWY A;  1YTZ I;  1NU1 K;  1RF1 B;  2MJZ A;  1SQB K;  5AVS B;  1LTS C;  1LTA C;  1YTZ T;  1JO5 A;  5CJ0 A;  4ZKU A;  1LT9 A;  3RL0 C;  4W7Z A;  5AVW B;  3H32 A;  5CJ4 A;  1MZ9 A;  3HE4 B;  2YNY A;  1T2K D;  1LWU C;  3V2N A;  1OWA A;  2Q3I A;  5AW4 B;  1HBW A;  2XNX A;  1H89 A;  2KP8 A;  1H88 A;  2WIT A;  1FZG A;  2XV5 A;  1JY2 O;  1NTZ K;  2YO3 A;  1IFD A;  1J1E C;  3VMZ A;  1LGH B;  3TSI A;  1ZN5 A;  1MFZ A;  3HE5 B;  2WT7 B;  2NPS B;  3V2R A;  1G1J A;  2C0X A;  3HE5 A;  2WT7 A;  3UIA A;  1L4A C;  1GD2 E;  5AVZ B;  3II6 A;  1GK4 A;  4I6M C;  1G1I A;  1HGV A;  2IFN A;  4IFF A;  5AW7 B;  2N9B A;  3U1A A;  1HJB A;  1GL2 A;  3B8E B;  1HWT C;  2OYH B;  1SP4 A;  3NMD A;  1RE3 A;  4LLH A;  1URQ D;  1JY3 P;  3VOP A;  2GM4 A;  3LIE A;  1GL2 D;  2OYH A;  2OAR A;  1N7L A;  2HG5 D;  2M3B A;  1IO4 A;  1QL2 A;  4DZO A;  1FJK A;  3HUS B;  3I5C A;  1T3U A;  2WSC H;  4KHX A;  1GTW A;  2FXM A;  1LWU B;  3L37 A;  1RE4 C;  2N1T A;  2Z5I A;  3R2P A;  4HYT B;  3HUS A;  1T8Z A;  4WBA A;  2YMY A;  1M1J B;  1JMM A;  1HVV A;  2H8P D;  2N1T D;  1KIL C;  2IPP A;  5AW6 B;  1OXZ A;  1M1J A;  2HFE D;  1DH3 A;  3M06 A;  5AVT B;  1SVF A;  2M8R A;  1L4A B;  1SFC A;  2XU6 A;  3P8M C;  3TYY A;  1FZC A;  1DX7 A;  2QM8 A;  5CCH A;  1JCC A;  1CI6 B;  3GHG B;  1SFC D;  1JCD A;  5KTB A;  5AW9 B;  2FYU K;  2HOD B;  3NXS A;  4WB4 A;  2O1K A;  3CLQ A;  4IFD K;  1QL1 A;  1RY3 A;  5CCH D;  3GHG A;  3RK2 C;  1MV8 A;  2YO2 A;  1LTI C;  3VN0 A;  4N78 E;  2I1J A;  1FDM A;  3B5N C;  3N4X A;  4WY4 A;  3OA7 A;  1ZR4 A;  4JYC A;  1A02 F;  1WT6 A;  1N7S D;  1JTH B;  5AVQ B;  4WY4 D;  2Q9I A;  2R3C A;  1GW3 A;  3MGN A;  5AW3 B;  1RF1 A;  1LTJ C;  1IFJ A;  2PP6 A;  1X8Y A;  1KIL B;  4N3Y B;  1KFM A;  5AW0 B;  1NOH A;  4LGD E;  1RF0 A;  4OH8 B;  3HE4 A;  2Q7C A;  4I1L A;  3KYQ A;  1JY3 O;  2XKM A;  1LTG C;  2WPR A;  5CCG C;  3BRT B;  4DOJ A;  2R32 A;  3CL3 D;  1CW5 A;  1FZE A;  5KJ7 A;  5CMZ A;  1NKZ B;  1IFI A;  2JEE A;  2IX7 C;  2W6B A;  3L36 A;  2GUS A;  1NWQ A;  1AQ5 A;  2CPB A;  2NPS A;  3PP5 A;  1N73 B;  1A02 J;  3BRV B;  1KZU B;  5KJ7 D;  2Z5H A;  3RK2 B;  3O8Z A;  4I2L C;  3V2P A;  3MUD A;  4N78 D;  2W6A A;  1N73 A;  2H7H A;  1XTG B;  2E42 A;  3V4W A;  3B5N B;  2NPS D;  5KLV K;  3M0D A;  2LKM A;  1SLQ A;  3WMM 0;  4EOT A;  3RK3 B;  1MUU A;  1VPC A;  3HD7 C;  3IR9 A;  3MTU E;  4W80 A;  3G3Z A;  2FFD C;  2WSE H;  3P8C E;  2WPQ A;  1JUN A;  1S9K E;  3MIW A;  1IFM A;  1X79 B;  4JYB A;  1NKN A;  4M3L A;  5AVV B;  3VMY A;  3RL0 B;  2WWW A;  1LTJ B;  3VTP C;  4C7N B;  4IFM A;  3P32 A;  1G2C B;  2HYN A;  1N7S C;  2C0W A;  4C7N A;  2J59 M;  1G2C A;  2C9N Y;  1LWU A;  3U1C A;  3C9I A;  4JF7 A;  1J1E B;  2O1J A;  1E5W A;  3HRN A;  1GZL A;  2P2U A;  1Z56 A;  3MD0 A;  5APX A;  3TK1 A;  2P67 A;  2OYI C;  1NTM K;  1T2K C;  3M91 A;  3TNU B;  1LT9 C;  3L35 A;  1H8A A;  2XDJ A;  1J1D C;  5AW8 B;  1J2J B;  4XA4 A;  4C46 A;  3TNU A;  1N86 A;  4W7Y A;  4AUW A;  2Q5U A;  1L4A A;  2O01 H;  1FOS F;  1L0L K;  5BU5 A;  1FU1 A;  4C7R A;  2WSF H;  1FZA A;  3HD7 B;  3VYI A;  4AYC A;  1FAV A;  1L4A D;  1CI6 A;  2R5D A;  5APT A;  2YKQ A;  4O9B A;  3BAT A;  3P8C D;  2HOD A;  5AVU B;  1WRG A;  1ZR2 A;  1S9K D;  1SQX K;  1HGZ A;  2IFM A;  5AW5 B;  2HLO A;  3SWF A;  1NH4 A;  5AVY B;  5BU8 B;  2KOG A;  1X9V A;  2H43 A;  1FZB A;  1VDF A;  2KB7 P;  5APV A;  3M9B A;  3KPE A;  4RES B;  2E43 A;  2A45 G;  1HH0 A;  1URQ C;  2A45 I;  1JTH A;  2P7J A;  1AFO A;  1GL2 C;  1IFN A;  3U59 A;  1RE4 A;  1RE3 C;  2P1J A;  1SQV K;  2OYH C;  2OYI B;  2XZR A;  2FKW B;  1KIL A;  4N6J A;  2R5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...