1LTGC

The arg7lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the a subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title The Arg7Lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the A subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 14
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1995-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltgC00
1XTCC 1LTSC 1LTTC 1LTGC 1LTAC 1HTLC 1LTIC 1LTBC
chains in the Genus database with same CATH superfamily
2OYIA 3OA7A 3RL0C 3L71J 2QJYB 2KNCA 1J1EC 2JKVA 1Q2NA 2K88A 1NTZG 1M8OB 3H1IG 4Y28J 3CCEP 1N7LA 5KLVD 2R44A 1R8EA 1SQVK 3EWKA 1Y9BA 2A45G 2FYUE 1VQKP 3G3ZA 2NPSB 4XE5B 3L70E 1BE3J 2YNYA 3HUSA 4PD4H 1VQLP 5AW6B 2WT7B 1VF5D 2NPSA 1IC2A 1YQ4C 1M1JA 1JTHA 4I7ZC 5DJUB 1PIXA 3MD0A 2I1JA 4DZOA 2QJKC 2P1JA 1BGYE 4K3AA 3H1LE 1AFOA 5L8RJ 5BU5A 1HJBA 4IFDK 2FXOA 3V5BA 1Y47A 1ZP0C 2YO3A 4AUWA 3A2AA 3V2QA 3HE5B 1GW4A 2YO2A 1RE4A 1L0LJ 1OXZA 3PLNA 1Y8AA 2WSSH 3TYYA 1SQXE 2FFDB 1VQ9P 2ZXXA 3A7OA 2IPPA 1LWUC 3P8MC 1N7SC 2W6BA 3SFDC 1KFNA 3H1KE 3K5BA 1K9MQ 1X79B 1J1DC 1GDTA 5AVUB 3R2PA 4LLHA 3TGUG 1NOHA 2KLUA 2R5DA 4GT1A 4EIJA 3AE6C 2LR2A 5KLVE 3H1HD 1MUUA 1VPCA 3KQGA 3NFQA 1KYOD 3IAOA 3MIWA 2OARA 1PP9G 3VP9A 3RK2D 1T3JA 1LTSC 1SQPD 2Z4EA 3AE3C 3AEBC 1D7MA 2R5BA 5KKZC 3ABVC 4R4MA 5AVZB 3RK2C 5APXA 5APVA 2SPZA 1OVUA 4XFJA 3AE8C 3CWBG 2O1KA 2Q1KA 1BDDA 5AVWB 2A45I 1U7MA 3OJAB 1H0TB 3BCCJ 2N1TD 1JNMA 5APUA 2W6AA 2HPCB 3L75J 3HD7C 4N3YB 4OGQB 1ZR2A 2OYHC 2KS1B 4C7NA 1YTZI 2MKVA 2QG4A 3GHGC 2C0WA 3H25A 3A0BE 1M56D 1S5LH 2HPCA 1L0ND 1IK7A 3IFMA 1VQNP 3WUTA 1MFZA 2KS1A 4GODA 4ZNCA 2FXPA 1EXIA 3KPEA 1L4AC 1PFIA 2HODB 1CI6B 2R32A 2AXTH 4KT0J 3VTPC 1HJ0A 2OTKE 1QL2A 2NZ2A 5GTHH 1IO4A 2IZ0A 3I5CA 4RJTA 1VF5B 3CC4P 2E75C 1HUCA 1KYOE 2HODA 1CI6A 2UWJE 3RBXA 5GTIE 1QL1A 1RF0C 4ASWA 2PGDA 1DEBA 1VQOP 2FYZA 2BEQD 3U1AA 3CCQP 1GMJA 1NTZJ 2FY8A 1NHLA 3H1IJ 2ZFCA 4JYCA 2E76D 1KFMA 3H32B 5AW3B 2E5YA 1AA0A 3TNUB 2QJPC 3CD6P 1J2JB 3CX5D 1SQBK 2YXQB 3RGUA 3D71A 3AEAC 1N8RQ 3TNUA 2PFXA 2YIUC 1CZQA 4UB6E 1DH3A 1FZCB 1LWUA 2IZ1A 4LGDE 3RK3D 2OYOA 1S3JA 1EZVD 2I8DA 4A7PA 3JSVC 3M9QA 3GG2A 1EXJA 1BCCG 4U3FG 1RY3A 1FZCA 1LP1B 5KAFH 3L73J 1SQVJ 1IFDA 1T6AA 1KB9H 1PPJD 5E79H 1SQBG 5APWA 3KZIH 1USDA 3UIAA 2IFMA 3CCMP 1Q82Q 1DIPA 1L0LE 1FZGA 1NTMG 2H89C 1GD2E 3FXDA 1OIPA 1IZNB 2YKOA 1AQTA 1LGHB 5APTA 2KOGA 1IFJA 3TGUJ 5KTBA 1NTKK 2BCCG 3V4QA 1GL2D 1DD3A 2N1TB 3CI9A 2Q6QA 3L72D 3W67A 1PP9J 3CX5E 1NU1K 2OYHA 1NAYA 1URQB 5KAIH 2D2CD 4GDOA 1FZAA 3LIEA 2A06E 2POHA 2N1TA 1FZEA 2E74D 4HJGH 5CCHD 2E5TA 2D2CC 3RK3E 1QVFO 3CWBJ 3RBZA 1ZMEC 1EZVE 2E74C 3B71A 2QVAA 1KTMA 5CCGD 3D70A 3L74D 2FYNB 1NTKG 3QH9A 1KQSO 3V6IA 4BWNA 1OW7A 3VP8A 4PD4E 3CCLP 1GW3A 1OW6A 2XNDH 1HGVA 1SQQK 3MZWB 1PPJE 2JWAA 2RH0A 2PAJA 1RF0A 3G71P 4D6TD 1K04A 1YHQP 1PGPA 3L75E 1M1KQ 1JY3O 3M06A 3BVHA 2IDBA 1JM0A 2JR8A 2E76B 5APQA 3CXHI 1VQ5P 5CHXA 3RL0g 2CK3H 1JO5A 1HH0A 2XNXA 3H6PA 1P84I 2GM4A 2IFNA 1USEA 2KZJA 5BU8B 2XV5A 1ZOYC 2WTYA 1Q90D 4BRYB 4WVZA 4OH8B 5B66H 2R3SA 3L72E 1LTJB 3RK3B 1SQXD 3RL0D 2KNCB 3AEFC 2FYUK 1RQVA 1S4XA 1RF1C 1ZRTE 1OZHA 3P7KA 3IR9A 1G1IA 4DT0A 2KIKA 4KJMA 2WPQA 1GK4A 1LTJA 3H1JG 2LKMA 2CPSA 1FOSF 2IBZG 3HUSB 3P8CE 3L37A 2W8ZA 3AE2C 4IFFA 3L74E 3M9BA 1UIXA 3R4YA 1EQ7A 2BASA 2O3JA 1JY2P 4GIFA 1QVGO 1M1JB 1KZUB 1FS0E 3LIDA 2Y9ZA 3G9RA 2FKWB 1JTHB 2W83C 2GUVA 4TLFA 4W80A 2W27A 2OTLP 2PP6A 2RMZA 3VMZA 2FYUG 4JQ0D 1BCCJ 4I6MC 4U3FJ 4D6TE 3L70G 2Q3IA 5TISH 2H8PD 1GL2B 1N73C 1HWTC 1PZQA 1KILD 1M7LA 1AQ5A 1SQBJ 2Y0EA 3II6A 3TDKA 5TJHA 4HB1A 3L73E 2N9BA 5BVZA 1SQVE 4R4LA 4YTPC 1GL2A 1NGMB 1SS1A 1N7SD 1KILC 1BGYG 1S5LE 4WY4D 3SSUA 1YJWP 5KLVK 3EFFK 3H1LG 4H13C 1BSHA 4HYTB 4WWIA 3TSIA 1KB9D 2BCCJ 1KD1Q 2P7JA 2HFED 2WMMA 2O01J 4PV1B 4WY4C 1E79H 2AXTE 5CCHA 3TGUE 4PJ0H 4L73A 1OFCX 1Q7YQ 1K73Q 5GTHE 2L91A 1NYHA 3H1KG 3PJSK 5CCGA 3MUDA 2ZVOB 1RHZB 1OWAA 4M3LA 4EI2A 2XU6A 1K8AQ 1OVRA 2A45H 3E1RA 3WU2H 3A0HH 1DX7A 1GK6A 3M91A 2ZAEB 2YMKA 1KQFB 4W7YA 3M0DA 5AVTB 3Q3DA 2R3CA 5KLVG 2KI7B 4XA4A 3L71D 1NKZB 1LTGC 1NTKJ 1YJ9P 2IBZI 3IF4A 1H88A 1GU5A 1XTGB 1FDMA 3B5ND 3HD7D 5AW7B 2W90A 4C7NB 3NTNA 2JEEA 1KILE 3RL0B 1J1EB 5CMZA 1BE3D 1NU1J 4IL6H 1JY2N 1RF1A 3B5NC 4DJGA 4MN4C 1VQ6P 2QM8A 1LTTC 2ZXEB 1LTAC 1DD4A 3CCJP 1YITP 2WZ7A 2KSEA 1FZFA 1K05A 5KAFE 1L4AD 3L35A 2C9LY 2Q9IA 1EDLA 1GTWA 4H0LC 3GF7A 1AV1A 3F89A 1KB9E 5H2FH 1LT9C 1JY3P 5KJ7C 5E79E 3SFEC 3KZIE 1SQPK 1T8ZA 2E75D 2AEJA 1PV3A 2QRXA 2I1KA 3HE4B 3JC22 1SLQA 3V2RA 4I7ZB 1L0LD 1SQQJ 5APYA 2QJKB 2E43A 5AW1B 3Q5PA 1VDFA 3CCVP 2KUBA 4DOJA 3AEGC 3HE4A 1T2KC 1RH5B 1NO4A 1N73A 4ZKUA 2XKMA 4WB4A 5AW2B 3H1HG 1OX3A 2JJLA 3VOPA 3L71E 1X22A 5CJ4A 1KMIZ 5KAIE 3V4WA 3M9HA 3JCUH 1LWUB 1N7SB 2QA4P 1YBKA 2B88A 1SQPG 1J1DB 1KILA 1L0NK 2A06D 2P67A 3FXEA 1NTMK 2WPSA 4H44D 2B89A 3T97A 1R5LA 4IOIH 2FYUJ 1BE3E 4IL6X 1N7SA 3L70J 3WUUA 1SVFA 3IN6A 4WY4A 4Y99C 3KYQA 1MFTA 4H44C 1W2BO 4ZKPA 2Y9YA 1FC2C 2H7HA 5EFWB 1NWQA 2OQQA 4PD4D 1Z56A 2J58A 2KYVA 2H43A 2KB7P 5KKZB 3BCCD 2ZT9D 1SFCC 1SQBE 1NU1D 3RK2B 2OYIC 3GF3A 3H1LJ 3L75D 1KQLA 2K9YA 4YPCA 3SWFA 4RESB 1L0NG 3O6QB 3PH0A 2HLOA 3FWLA 4JF7A 2N9YB 2WSCH 2ZT9C 1KN7A 2Q5UA 1A02F 4GOEA 4IFMA 1FJPA 2QJYC 1VQ8P 3O6QA 3HD7B 3Q5RA 4AYCA 2OYHB 3MGNA 1R5SA 3GHGB 5B66E 1JCCA 1JY3N 2K9JB 3CMEP 4C7RA 1NKNA 4RO0A 1ZXGA 2FBWC 2NPSC 2W6JH 3B5NA 3HD7A 3VYIA 3ITKA 2WWWA 1SQQD 5AW5B 1Q86Q 3BRVB 1ZRTD 2HR3A 3GHGA 1EDIA 2K9JA 5M1BA 3HTKA 5KLVJ 1MZ9A 1FE6A 1L4AB 4EDFA 1ZN5A 4YXWH 2JO1A 1NTZD 3H1ID 1LT9A 5AVRB 1EDKA 1KYOI 2GA1A 3P8CD 3CCRP 1L4AA 2CPBA 5APSA 2J59M 1LT1A 3V2NA 5CBNA 1G1JA 4NPEA 2WQYC 3CXHH 5K5GB 3P32A 3B8EB 2M3BA 1ZW0A 1EZVG 4DCKA 4CPGA 2AEMA 1P84H 3CL3D 2K3RA 3BCCE 4N6JA 1NU1E 2QJPB 1U57A 1HGZA 5TISE 4NPFX 3PP5A 1H89A 2FFDC 2C9NY 1T3UA 3S1KA 3OW2O 4PV1C 2VRSA 3CCSP 3D6ZA 1PPJG 2HG5D 2YIUB 1YJNP 1VL2A 5DJTB 3CLQA 3CMAP 3L73D 3AE4C 1SQVD 3WUVA 3WMM0 2WSCJ 3I56P 3AEDC 1JCDA 3AEEC 1UIIA 2O01H 1KORA 1A02J 4EOTA 2YMYA 4AQRD 1NJIQ 3PTZA 1SQQE 1NVOA 4YXDC 2E42A 1G2CB 4PJ0E 3KXDA 3H1HJ 3TGUD 3L72G 1WT6A 3NMDA 3EQ2A 1YI2P 1FZBA 1NTZE 2ZYAA 5AVVB 1W5CE 3H1IE 2J5UA 2IBZE 1G2CA 1SQPJ 4JYBA 4OGQD 4OVNF 3CC2P 2WSFH 3VMXA 4I2LC 3NXSA 4U7JA 2MJZA 3WU2E 3A0HE 1PP9D 5AW8B 1QGKB 1RE3C 2KXPB 1S9KD 1IJDB 4OGQC 1FDOA 1HF9A 2WPVB 1RQUA 2V4HA 3D6YA 3S9OA 3AE7C 2ZYDA 1LNQA 3L74G 1Q81Q 1CSBA 3CX5I 2KK7A 3CWBD 1SQXK 4GKGA 3TK1A 2M0BA 4WBAA 1IK9A 2JDIH 3CPWO 4IL6E 5CBOA 4D6TG 3E1IA 3BASA 4JPZB 2DW3A 1N2DC 2D2CB 3N4XA 1EZVI 1YTZT 4H13D 1L0NJ 4Z1MH 1E5WA 2WSEH 2E74B 3EFGA 1EDJA 2WT7A 1NTMJ 1VF5C 3M0AA 1LTIC 4I1LA 4HKZH 4C46A 3VMAA 2LXCB 4PD4I 3ZDMA 3L73G 5H2FE 1SQVG 3KDPB 2P58A 5B5EH 3SWKA 3N7NA 4ZMDA 2K37A 1WMKA 1QX8A 2WPRA 4UB8H 1SQXG 3HE5A 2Z5HA 4ASVA 3L4FA 1PP9E 2M5AB 3S4RA 2FFDA 5AVQB 1FZCC 4LC1A 2V7QH 5AVXB 1S9KE 3MP7B 2YKQA 4N78D 4B86A 1AJYA 2WSFJ 1VQMP 1OW8A 4EYYQ 2ITAA 1FAVA 2M5AA 3JCUE 3CC7P 2JP3A 3CWBE 1RF1B 5KLIB 1BSNA 4L76A 3O8ZA 2P10A 1M90Q 2H88C 1HTLC 2B87B 3G6EP 3VN0A 3C9IA 4H0LD 3GLMA 1CW5A 2JWDA 4NPDA 5KJ7D 1BCCD 4U3FD 3CXHD 4JBZA 5AVSB 2KSJA 3Q2YA 2B87A 1IFIA 1FU1A 1JB0J 1P84D 1AVYA 2WSEJ 1WRGA 3AECC 1JUNA 1URQD 3V2PA 1H0TA 2N1TC 2QSIA 1KC8Q 1SQBD 1RE3A 5C39A 3A3YB 3I55P 3KHUA 1YQ3C 1T2KD 1URQC 3USSA 1NTMD 5AW4B 1N73B 2OGUA 1BDCA 1FBMA 1EC5A 1VQ7P 1W2EA 4BXLA 3HRNA 4OWFA 1KV4A 2GUSA 2LXBA 4HH2A 3L72J 2KP8A 3H1JJ 3B4SA 2BCCD 3U1CA 1LTBC 3H1HE 1GZLA 4N78E 1KILB 3L36A 5AVYB 2WVRA 3GMAA 2FYNC 4H13B 3T97B 2V7QJ 2P2UA 1SQPE 1MV8A 1HBWA 2OTJP 2AXCA 4WY4B 1JY2O 3OAKA 3L71G 3L74J 3FGAD 2RKLA 2G3AA 1XTCC 1PGOA 2PRRA 2E76C 4K35A 2IYPA 3LW5H 1IFPA 1YIJP 5AW9B 3H32A 1L0LK 1ZLLA 1BCCE 4U3FE 3CXHE 3FWNA 1MKMA 1NTKD 4L75A 2O1JA 1SFCD 4D6TJ 1BE3G 2B9BA 2XDJA 1P84E 4TT3H 1VQPP 3C8VA 1QLED 1BGYJ 4W7ZA 1S5LX 2M3EA 1LTJC 3RK3C 4RKUJ 3A0BH 1L0NE 2YKPA 1S72P 5AW0B 1YYCA 1NTME 1N86A 1PGQA 1X8YA 3BATA 1L2PA 1LP1A 1PGJA 1VQ4P 4GOFA 1S1CX 2NPSD 3B5NB 2C0XA 1SQXJ 3TF5A 2BCCE 1OMIA 1L0LG 3U59A 1GU4A 3MHVA 3H1KJ 3HUSC 3C1LA 3HTKB 1AVOA 1IFMA 1KYOH 4KHXA 1ZV8A 1HVVA 5GTIH 1M1JC 1KB9I 4O9BA 4H0LB 2ZJSE 2NRGA 3QWOC 1JMMA 1LT9B 2WITA 1OVVA 1X0TA 2L5GB 2ZYGA 1JOCA 1SP4A 1KQGB 3H1JD 1FJKA 2QEXP 3AE9C 2IYOA 3BRTB 1S2EA 2ZVNB 1FOSE 2IBZD 1GL2C 5KJ7A 2Y0DA 2Q3EA 2RN0A 2E75B 3Q1MA 2A06G 1IFNA 1RE4C 2HYNA 4L74A 1PL5A 1NTKE 1DEEG 3PHLA 2QM7A 2Z5IA 1URQA 3CCUP 4UB6H 3Q5SA 3SWYA 3LW5J 2M8RA 2Q7CA 2FYUD 4PV1D 3GW6A 5CCHC 2AEFA 3L70D 3E7KA 1JEKA 1TU3F 2YXRB 1ZR4A 1QEXA 3AE1C 5CCGC 3MUDC 4QMAA 3BCCG 1NU1G 3A5TA 3F5HA 2QIWA 3L75G 2G8YA 3AE5C 2BEZF 3G4SP 1U7JA 4Y99B 2KLVA 1NTZK 3M0DC 1M57D 2KZIA 1JMBA 4H44B 1BGYD 1LJ2A 2QE7H 3H1LD 5B5EE 5CJ0A 3MTUE 2XZRA 3W68A 1FDIA 1SFCB 2Y0CA 2K1AA 2IX7C 4UB8E 1X9VA 2FXMA 2OYIB 3PRJA 3H1JE 1SQQG 3FX0A 1NH4A 3H1KD 5KLIC 3CX5H 2ZT9B 3VMYA 1NAFA 4BRYA 1H8AA 1SFCA 2O01N
chains in the Genus database with same CATH topology
1NU1K 5AVXB 5CJ4A 1URQB 2OYHA 1S9KE 2OYIA 3OA7A 3RL0C 2YKQA 1J1EC 4N78D 1FZAA 3LIEA 2POHA 3V4WA 2N1TA 4B86A 3M9HA 1FZEA 1LWUB 1N7SB 1FAVA 1J1DB 1KILA 1N7LA 1L0NK 5CCHD 1SQVK 2P67A 1RF1B 1NTMK 2A45G 2WPSA 3G3ZA 2NPSB 3T97A 4XE5B 1N7SA 5CCGD 2YNYA 3O8ZA 3HUSA 1SVFA 1HTLC 4WY4A 4Y99C 3KYQA 5AW6B 3VP8A 2WT7B 4ZKPA 3VN0A 3C9IA 2NPSA 1IC2A 1GW3A 1M1JA 2H7HA 1HGVA 1SQQK 1CW5A 5KJ7D 1NWQA 1JTHA 2PAJA 1Z56A 2J58A 1RF0A 5AVSB 2KSJA 2KYVA 2H43A 3MD0A 2I1JA 2KB7P 1IFIA 4DZOA 1FU1A 1JY3O 2P1JA 3M06A 1SFCC 3RK2B 3BVHA 1WRGA 1AFOA 5APQA 5BU5A 1HJBA 2OYIC 1JUNA 1URQD 4IFDK 1KQLA 3V5BA 3SWFA 4RESB 2YO3A 3V2PA 4AUWA 2N1TC 5CHXA 3A2AA 3V2QA 3HE5B 2HLOA 1GW4A 4JF7A 1JO5A 1HH0A 2XNXA 2YO2A 3H6PA 1RE3A 1RE4A 2GM4A 2WSCH 3A3YB 1OXZA 2IFNA 5BU8B 2Q5UA 1A02F 1T2KD 1URQC 5AW4B 1N73B 4IFMA 2XV5A 1FJPA 3TYYA 2WTYA 1FBMA 2FFDB 3HD7B 3A7OA 2IPPA 1LWUC 3P8MC 1N7SC 2W6BA 4OH8B 4AYCA 1KFNA 1W2EA 2OYHB 3MGNA 1X79B 3HRNA 1J1DC 1LTJB 3RK3B 1GDTA 3RL0D 2GUSA 3GHGB 4HH2A 2KP8A 5AVUB 1JCCA 1JY3N 3R2PA 2FYUK 4C7RA 4LLHA 1NKNA 1RF1C 3U1CA 1LTBC 3P7KA 2NPSC 3IR9A 1NOHA 2R5DA 1GZLA 3B5NA 1KILB 3L36A 4GT1A 4N78E 5AVYB 3HD7A 3VYIA 1G1IA 2WWWA 4EIJA 5AW5B 2WPQA 1GK4A 3BRVB 1LTJA 3GHGA 1MUUA 1VPCA 2LKMA 3HTKA 3KQGA 3NFQA 3MIWA 1MZ9A 1L4AB 2OARA 2CPSA 2P2UA 1MV8A 1FOSF 1HBWA 3HUSB 1ZN5A 3VP9A 3RK2D 3P8CE 3L37A 4WY4B 1T3JA 1JY2O 3OAKA 4IFFA 1LTSC 3M9BA 1LT9A 5AVRB 2Z4EA 1EQ7A 2BASA 1JY2P 3P8CD 4GIFA 2R5BA 1M1JB 1L4AA 2CPBA 1KZUB 5APSA 3LIDA 2J59M 3V2NA 1XTCC 1G1JA 5AVZB 3RK2C 2FKWB 1JTHB 5APXA 5APVA 3LW5H 2GUVA 5AW9B 4W80A 3H32A 1L0LK 1ZLLA 2W27A 3P32A 2PP6A 3B8EB 2O1KA 2M3BA 3VMZA 2O1JA 5AVWB 1SFCD 4I6MC 2A45I 3CL3D 3OJAB 2Q3IA 4N6JA 2H8PD 2XDJA 1GL2B 2N1TD 1JNMA 5APUA 1N73C 1HGZA 1HWTC 3PP5A 2W6AA 2HPCB 1H89A 2FFDC 3HD7C 1KILD 4N3YB 2C9NY 1T3UA 1M7LA 1ZR2A 2OYHC 1AQ5A 4W7ZA 4C7NA 1YTZI 3II6A 1LTJC 3RK3C 3GHGC 2VRSA 2YKPA 2C0WA 2N9BA 5BVZA 5AW0B 2HG5D 1GL2A 1YYCA 1N7SD 3CLQA 1N86A 2HPCA 1KILC 3IFMA 1X8YA 3BATA 4WY4D 5KLVK 1MFZA 3WMM0 1JCDA 4HYTB 2NPSD 3B5NB 2O01H 2C0XA 3KPEA 1L4AC 1PFIA 1A02J 2HODB 1CI6B 4EOTA 3TSIA 2YMYA 3U59A 2R32A 2P7JA 1GU4A 3HUSC 2HFED 4AQRD 4WY4C 3VTPC 3HTKB 5CCHA 1QL2A 1IO4A 1IFMA 4KHXA 2E42A 1G2CB 3I5CA 1ZV8A 1HVVA 1M1JC 1HUCA 4O9BA 2HODA 1CI6A 5CCGA 1QL1A 1JMMA 1LT9B 3MUDA 2WITA 1WT6A 1RF0C 3NMDA 1OWAA 3EQ2A 4M3LA 1FZBA 1DEBA 2FYZA 5AVVB 3U1AA 2XU6A 2L5GB 1JOCA 1SP4A 1G2CA 1NHLA 2A45H 2ZFCA 1FJKA 4JYBA 3BRTB 4JYCA 2WSFH 3VMXA 1DX7A 1GK6A 4I2LC 1KFMA 3NXSA 3H32B 3M91A 1FOSE 5AW3B 2MJZA 3TNUB 4W7YA 3M0DA 5AVTB 1GL2C 2R3CA 5KJ7A 5AW8B 1J2JB 4XA4A 1RE3C 1IFNA 1RE4C 1SQBK 2HYNA 1NKZB 1S9KD 1IJDB 1LTGC 2QM7A 2Z5IA 1H88A 1URQA 1GU5A 1XTGB 3TNUA 1FDMA 3B5ND 1CSBA 3SWYA 3HD7D 1CZQA 5AW7B 2M8RA 1DH3A 4C7NB 1FZCB 1LWUA 3NTNA 2JEEA 4LGDE 3RK3D 2Q7CA 3RL0B 1SQXK 5CCHC 1J1EB 5CMZA 4GKGA 3TK1A 1JY2N 1RF1A 3M9QA 3B5NC 4WBAA 1IK9A 1RY3A 2QM8A 1ZR4A 1LTTC 3E1IA 5CCGC 3BASA 2ZXEB 1FZCA 1LTAC 1N2DC 3N4XA 2WZ7A 1YTZT 1FZFA 1E5WA 2WSEH 3A5TA 1L4AD 1IFDA 3L35A 2C9LY 3EFGA 2WT7A 2Q9IA 3M0AA 1LTIC 4I1LA 1GTWA 5APWA 4C46A 4Y99B 1LT9C 3UIAA 2IFMA 2KLVA 1NTZK 3M0DC 1JY3P 5KJ7C 1SQPK 1T8ZA 3KDPB 1FZGA 2I1KA 1GD2E 3HE4B 3N7NA 1SLQA 5CJ0A 3MTUE 2YKOA 3V2RA 1LGHB 5APTA 2KOGA 1IFJA 2WPRA 2XZRA 5APYA 5KTBA 2E43A 5AW1B 1NTKK 1SFCB 3HE5A 1VDFA 2Z5HA 2IX7C 1X9VA 2FXMA 2OYIB 4DOJA 3HE4A 3V4QA 3L4FA 1T2KC 1GL2D 2N1TB 3CI9A 1NO4A 1N73A 1NH4A 4ZKUA 2XKMA 4WB4A 3VMYA 1NAFA 2FFDA 5AW2B 5AVQB 1H8AA 1SFCA 1FZCC 2JJLA 4LC1A 3VOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XTC C;  1LTS C;  1LTT C;  1LTG C;  1LTA C;  1HTL C;  1LTI C;  1LTB C; 
#chains in the Genus database with same CATH topology
 2OYI A;  3OA7 A;  3RL0 C;  3L71 J;  2QJY B;  2KNC A;  1J1E C;  2JKV A;  1Q2N A;  2K88 A;  1NTZ G;  1M8O B;  3H1I G;  4Y28 J;  3CCE P;  1N7L A;  5KLV D;  2R44 A;  1R8E A;  1SQV K;  3EWK A;  1Y9B A;  2A45 G;  2FYU E;  1VQK P;  3G3Z A;  2NPS B;  4XE5 B;  3L70 E;  1BE3 J;  2YNY A;  3HUS A;  4PD4 H;  1VQL P;  5AW6 B;  2WT7 B;  1VF5 D;  2NPS A;  1IC2 A;  1YQ4 C;  1M1J A;  1JTH A;  4I7Z C;  5DJU B;  1PIX A;  3MD0 A;  2I1J A;  4DZO A;  2QJK C;  2P1J A;  1BGY E;  4K3A A;  3H1L E;  1AFO A;  5L8R J;  5BU5 A;  1HJB A;  4IFD K;  2FXO A;  3V5B A;  1Y47 A;  1ZP0 C;  2YO3 A;  4AUW A;  3A2A A;  3V2Q A;  3HE5 B;  1GW4 A;  2YO2 A;  1RE4 A;  1L0L J;  1OXZ A;  3PLN A;  1Y8A A;  2WSS H;  3TYY A;  1SQX E;  2FFD B;  1VQ9 P;  2ZXX A;  3A7O A;  2IPP A;  1LWU C;  3P8M C;  1N7S C;  2W6B A;  3SFD C;  1KFN A;  3H1K E;  3K5B A;  1K9M Q;  1X79 B;  1J1D C;  1GDT A;  5AVU B;  3R2P A;  4LLH A;  3TGU G;  1NOH A;  2KLU A;  2R5D A;  4GT1 A;  4EIJ A;  3AE6 C;  2LR2 A;  5KLV E;  3H1H D;  1MUU A;  1VPC A;  3KQG A;  3NFQ A;  1KYO D;  3IAO A;  3MIW A;  2OAR A;  1PP9 G;  3VP9 A;  3RK2 D;  1T3J A;  1LTS C;  1SQP D;  2Z4E A;  3AE3 C;  3AEB C;  1D7M A;  2R5B A;  5KKZ C;  3ABV C;  4R4M A;  5AVZ B;  3RK2 C;  5APX A;  5APV A;  2SPZ A;  1OVU A;  4XFJ A;  3AE8 C;  3CWB G;  2O1K A;  2Q1K A;  1BDD A;  5AVW B;  2A45 I;  1U7M A;  3OJA B;  1H0T B;  3BCC J;  2N1T D;  1JNM A;  5APU A;  2W6A A;  2HPC B;  3L75 J;  3HD7 C;  4N3Y B;  4OGQ B;  1ZR2 A;  2OYH C;  2KS1 B;  4C7N A;  1YTZ I;  2MKV A;  2QG4 A;  3GHG C;  2C0W A;  3H25 A;  3A0B E;  1M56 D;  1S5L H;  2HPC A;  1L0N D;  1IK7 A;  3IFM A;  1VQN P;  3WUT A;  1MFZ A;  2KS1 A;  4GOD A;  4ZNC A;  2FXP A;  1EXI A;  3KPE A;  1L4A C;  1PFI A;  2HOD B;  1CI6 B;  2R32 A;  2AXT H;  4KT0 J;  3VTP C;  1HJ0 A;  2OTK E;  1QL2 A;  2NZ2 A;  5GTH H;  1IO4 A;  2IZ0 A;  3I5C A;  4RJT A;  1VF5 B;  3CC4 P;  2E75 C;  1HUC A;  1KYO E;  2HOD A;  1CI6 A;  2UWJ E;  3RBX A;  5GTI E;  1QL1 A;  1RF0 C;  4ASW A;  2PGD A;  1DEB A;  1VQO P;  2FYZ A;  2BEQ D;  3U1A A;  3CCQ P;  1GMJ A;  1NTZ J;  2FY8 A;  1NHL A;  3H1I J;  2ZFC A;  4JYC A;  2E76 D;  1KFM A;  3H32 B;  5AW3 B;  2E5Y A;  1AA0 A;  3TNU B;  2QJP C;  3CD6 P;  1J2J B;  3CX5 D;  1SQB K;  2YXQ B;  3RGU A;  3D71 A;  3AEA C;  1N8R Q;  3TNU A;  2PFX A;  2YIU C;  1CZQ A;  4UB6 E;  1DH3 A;  1FZC B;  1LWU A;  2IZ1 A;  4LGD E;  3RK3 D;  2OYO A;  1S3J A;  1EZV D;  2I8D A;  4A7P A;  3JSV C;  3M9Q A;  3GG2 A;  1EXJ A;  1BCC G;  4U3F G;  1RY3 A;  1FZC A;  1LP1 B;  5KAF H;  3L73 J;  1SQV J;  1IFD A;  1T6A A;  1KB9 H;  1PPJ D;  5E79 H;  1SQB G;  5APW A;  3KZI H;  1USD A;  3UIA A;  2IFM A;  3CCM P;  1Q82 Q;  1DIP A;  1L0L E;  1FZG A;  1NTM G;  2H89 C;  1GD2 E;  3FXD A;  1OIP A;  1IZN B;  2YKO A;  1AQT A;  1LGH B;  5APT A;  2KOG A;  1IFJ A;  3TGU J;  5KTB A;  1NTK K;  2BCC G;  3V4Q A;  1GL2 D;  1DD3 A;  2N1T B;  3CI9 A;  2Q6Q A;  3L72 D;  3W67 A;  1PP9 J;  3CX5 E;  1NU1 K;  2OYH A;  1NAY A;  1URQ B;  5KAI H;  2D2C D;  4GDO A;  1FZA A;  3LIE A;  2A06 E;  2POH A;  2N1T A;  1FZE A;  2E74 D;  4HJG H;  5CCH D;  2E5T A;  2D2C C;  3RK3 E;  1QVF O;  3CWB J;  3RBZ A;  1ZME C;  1EZV E;  2E74 C;  3B71 A;  2QVA A;  1KTM A;  5CCG D;  3D70 A;  3L74 D;  2FYN B;  1NTK G;  3QH9 A;  1KQS O;  3V6I A;  4BWN A;  1OW7 A;  3VP8 A;  4PD4 E;  3CCL P;  1GW3 A;  1OW6 A;  2XND H;  1HGV A;  1SQQ K;  3MZW B;  1PPJ E;  2JWA A;  2RH0 A;  2PAJ A;  1RF0 A;  3G71 P;  4D6T D;  1K04 A;  1YHQ P;  1PGP A;  3L75 E;  1M1K Q;  1JY3 O;  3M06 A;  3BVH A;  2IDB A;  1JM0 A;  2JR8 A;  2E76 B;  5APQ A;  3CXH I;  1VQ5 P;  5CHX A;  3RL0 g;  2CK3 H;  1JO5 A;  1HH0 A;  2XNX A;  3H6P A;  1P84 I;  2GM4 A;  2IFN A;  1USE A;  2KZJ A;  5BU8 B;  2XV5 A;  1ZOY C;  2WTY A;  1Q90 D;  4BRY B;  4WVZ A;  4OH8 B;  5B66 H;  2R3S A;  3L72 E;  1LTJ B;  3RK3 B;  1SQX D;  3RL0 D;  2KNC B;  3AEF C;  2FYU K;  1RQV A;  1S4X A;  1RF1 C;  1ZRT E;  1OZH A;  3P7K A;  3IR9 A;  1G1I A;  4DT0 A;  2KIK A;  4KJM A;  2WPQ A;  1GK4 A;  1LTJ A;  3H1J G;  2LKM A;  2CPS A;  1FOS F;  2IBZ G;  3HUS B;  3P8C E;  3L37 A;  2W8Z A;  3AE2 C;  4IFF A;  3L74 E;  3M9B A;  1UIX A;  3R4Y A;  1EQ7 A;  2BAS A;  2O3J A;  1JY2 P;  4GIF A;  1QVG O;  1M1J B;  1KZU B;  1FS0 E;  3LID A;  2Y9Z A;  3G9R A;  2FKW B;  1JTH B;  2W83 C;  2GUV A;  4TLF A;  4W80 A;  2W27 A;  2OTL P;  2PP6 A;  2RMZ A;  3VMZ A;  2FYU G;  4JQ0 D;  1BCC J;  4I6M C;  4U3F J;  4D6T E;  3L70 G;  2Q3I A;  5TIS H;  2H8P D;  1GL2 B;  1N73 C;  1HWT C;  1PZQ A;  1KIL D;  1M7L A;  1AQ5 A;  1SQB J;  2Y0E A;  3II6 A;  3TDK A;  5TJH A;  4HB1 A;  3L73 E;  2N9B A;  5BVZ A;  1SQV E;  4R4L A;  4YTP C;  1GL2 A;  1NGM B;  1SS1 A;  1N7S D;  1KIL C;  1BGY G;  1S5L E;  4WY4 D;  3SSU A;  1YJW P;  5KLV K;  3EFF K;  3H1L G;  4H13 C;  1BSH A;  4HYT B;  4WWI A;  3TSI A;  1KB9 D;  2BCC J;  1KD1 Q;  2P7J A;  2HFE D;  2WMM A;  2O01 J;  4PV1 B;  4WY4 C;  1E79 H;  2AXT E;  5CCH A;  3TGU E;  4PJ0 H;  4L73 A;  1OFC X;  1Q7Y Q;  1K73 Q;  5GTH E;  2L91 A;  1NYH A;  3H1K G;  3PJS K;  5CCG A;  3MUD A;  2ZVO B;  1RHZ B;  1OWA A;  4M3L A;  4EI2 A;  2XU6 A;  1K8A Q;  1OVR A;  2A45 H;  3E1R A;  3WU2 H;  3A0H H;  1DX7 A;  1GK6 A;  3M91 A;  2ZAE B;  2YMK A;  1KQF B;  4W7Y A;  3M0D A;  5AVT B;  3Q3D A;  2R3C A;  5KLV G;  2KI7 B;  4XA4 A;  3L71 D;  1NKZ B;  1LTG C;  1NTK J;  1YJ9 P;  2IBZ I;  3IF4 A;  1H88 A;  1GU5 A;  1XTG B;  1FDM A;  3B5N D;  3HD7 D;  5AW7 B;  2W90 A;  4C7N B;  3NTN A;  2JEE A;  1KIL E;  3RL0 B;  1J1E B;  5CMZ A;  1BE3 D;  1NU1 J;  4IL6 H;  1JY2 N;  1RF1 A;  3B5N C;  4DJG A;  4MN4 C;  1VQ6 P;  2QM8 A;  1LTT C;  2ZXE B;  1LTA C;  1DD4 A;  3CCJ P;  1YIT P;  2WZ7 A;  2KSE A;  1FZF A;  1K05 A;  5KAF E;  1L4A D;  3L35 A;  2C9L Y;  2Q9I A;  1EDL A;  1GTW A;  4H0L C;  3GF7 A;  1AV1 A;  3F89 A;  1KB9 E;  5H2F H;  1LT9 C;  1JY3 P;  5KJ7 C;  5E79 E;  3SFE C;  3KZI E;  1SQP K;  1T8Z A;  2E75 D;  2AEJ A;  1PV3 A;  2QRX A;  2I1K A;  3HE4 B;  3JC2 2;  1SLQ A;  3V2R A;  4I7Z B;  1L0L D;  1SQQ J;  5APY A;  2QJK B;  2E43 A;  5AW1 B;  3Q5P A;  1VDF A;  3CCV P;  2KUB A;  4DOJ A;  3AEG C;  3HE4 A;  1T2K C;  1RH5 B;  1NO4 A;  1N73 A;  4ZKU A;  2XKM A;  4WB4 A;  5AW2 B;  3H1H G;  1OX3 A;  2JJL A;  3VOP A;  3L71 E;  1X22 A;  5CJ4 A;  1KMI Z;  5KAI E;  3V4W A;  3M9H A;  3JCU H;  1LWU B;  1N7S B;  2QA4 P;  1YBK A;  2B88 A;  1SQP G;  1J1D B;  1KIL A;  1L0N K;  2A06 D;  2P67 A;  3FXE A;  1NTM K;  2WPS A;  4H44 D;  2B89 A;  3T97 A;  1R5L A;  4IOI H;  2FYU J;  1BE3 E;  4IL6 X;  1N7S A;  3L70 J;  3WUU A;  1SVF A;  3IN6 A;  4WY4 A;  4Y99 C;  3KYQ A;  1MFT A;  4H44 C;  1W2B O;  4ZKP A;  2Y9Y A;  1FC2 C;  2H7H A;  5EFW B;  1NWQ A;  2OQQ A;  4PD4 D;  1Z56 A;  2J58 A;  2KYV A;  2H43 A;  2KB7 P;  5KKZ B;  3BCC D;  2ZT9 D;  1SFC C;  1SQB E;  1NU1 D;  3RK2 B;  2OYI C;  3GF3 A;  3H1L J;  3L75 D;  1KQL A;  2K9Y A;  4YPC A;  3SWF A;  4RES B;  1L0N G;  3O6Q B;  3PH0 A;  2HLO A;  3FWL A;  4JF7 A;  2N9Y B;  2WSC H;  2ZT9 C;  1KN7 A;  2Q5U A;  1A02 F;  4GOE A;  4IFM A;  1FJP A;  2QJY C;  1VQ8 P;  3O6Q A;  3HD7 B;  3Q5R A;  4AYC A;  2OYH B;  3MGN A;  1R5S A;  3GHG B;  5B66 E;  1JCC A;  1JY3 N;  2K9J B;  3CME P;  4C7R A;  1NKN A;  4RO0 A;  1ZXG A;  2FBW C;  2NPS C;  2W6J H;  3B5N A;  3HD7 A;  3VYI A;  3ITK A;  2WWW A;  1SQQ D;  5AW5 B;  1Q86 Q;  3BRV B;  1ZRT D;  2HR3 A;  3GHG A;  1EDI A;  2K9J A;  5M1B A;  3HTK A;  5KLV J;  1MZ9 A;  1FE6 A;  1L4A B;  4EDF A;  1ZN5 A;  4YXW H;  2JO1 A;  1NTZ D;  3H1I D;  1LT9 A;  5AVR B;  1EDK A;  1KYO I;  2GA1 A;  3P8C D;  3CCR P;  1L4A A;  2CPB A;  5APS A;  2J59 M;  1LT1 A;  3V2N A;  5CBN A;  1G1J A;  4NPE A;  2WQY C;  3CXH H;  5K5G B;  3P32 A;  3B8E B;  2M3B A;  1ZW0 A;  1EZV G;  4DCK A;  4CPG A;  2AEM A;  1P84 H;  3CL3 D;  2K3R A;  3BCC E;  4N6J A;  1NU1 E;  2QJP B;  1U57 A;  1HGZ A;  5TIS E;  4NPF X;  3PP5 A;  1H89 A;  2FFD C;  2C9N Y;  1T3U A;  3S1K A;  3OW2 O;  4PV1 C;  2VRS A;  3CCS P;  3D6Z A;  1PPJ G;  2HG5 D;  2YIU B;  1YJN P;  1VL2 A;  5DJT B;  3CLQ A;  3CMA P;  3L73 D;  3AE4 C;  1SQV D;  3WUV A;  3WMM 0;  2WSC J;  3I56 P;  3AED C;  1JCD A;  3AEE C;  1UII A;  2O01 H;  1KOR A;  1A02 J;  4EOT A;  2YMY A;  4AQR D;  1NJI Q;  3PTZ A;  1SQQ E;  1NVO A;  4YXD C;  2E42 A;  1G2C B;  4PJ0 E;  3KXD A;  3H1H J;  3TGU D;  3L72 G;  1WT6 A;  3NMD A;  3EQ2 A;  1YI2 P;  1FZB A;  1NTZ E;  2ZYA A;  5AVV B;  1W5C E;  3H1I E;  2J5U A;  2IBZ E;  1G2C A;  1SQP J;  4JYB A;  4OGQ D;  4OVN F;  3CC2 P;  2WSF H;  3VMX A;  4I2L C;  3NXS A;  4U7J A;  2MJZ A;  3WU2 E;  3A0H E;  1PP9 D;  5AW8 B;  1QGK B;  1RE3 C;  2KXP B;  1S9K D;  1IJD B;  4OGQ C;  1FDO A;  1HF9 A;  2WPV B;  1RQU A;  2V4H A;  3D6Y A;  3S9O A;  3AE7 C;  2ZYD A;  1LNQ A;  3L74 G;  1Q81 Q;  1CSB A;  3CX5 I;  2KK7 A;  3CWB D;  1SQX K;  4GKG A;  3TK1 A;  2M0B A;  4WBA A;  1IK9 A;  2JDI H;  3CPW O;  4IL6 E;  5CBO A;  4D6T G;  3E1I A;  3BAS A;  4JPZ B;  2DW3 A;  1N2D C;  2D2C B;  3N4X A;  1EZV I;  1YTZ T;  4H13 D;  1L0N J;  4Z1M H;  1E5W A;  2WSE H;  2E74 B;  3EFG A;  1EDJ A;  2WT7 A;  1NTM J;  1VF5 C;  3M0A A;  1LTI C;  4I1L A;  4HKZ H;  4C46 A;  3VMA A;  2LXC B;  4PD4 I;  3ZDM A;  3L73 G;  5H2F E;  1SQV G;  3KDP B;  2P58 A;  5B5E H;  3SWK A;  3N7N A;  4ZMD A;  2K37 A;  1WMK A;  1QX8 A;  2WPR A;  4UB8 H;  1SQX G;  3HE5 A;  2Z5H A;  4ASV A;  3L4F A;  1PP9 E;  2M5A B;  3S4R A;  2FFD A;  5AVQ B;  1FZC C;  4LC1 A;  2V7Q H;  5AVX B;  1S9K E;  3MP7 B;  2YKQ A;  4N78 D;  4B86 A;  1AJY A;  2WSF J;  1VQM P;  1OW8 A;  4EYY Q;  2ITA A;  1FAV A;  2M5A A;  3JCU E;  3CC7 P;  2JP3 A;  3CWB E;  1RF1 B;  5KLI B;  1BSN A;  4L76 A;  3O8Z A;  2P10 A;  1M90 Q;  2H88 C;  1HTL C;  2B87 B;  3G6E P;  3VN0 A;  3C9I A;  4H0L D;  3GLM A;  1CW5 A;  2JWD A;  4NPD A;  5KJ7 D;  1BCC D;  4U3F D;  3CXH D;  4JBZ A;  5AVS B;  2KSJ A;  3Q2Y A;  2B87 A;  1IFI A;  1FU1 A;  1JB0 J;  1P84 D;  1AVY A;  2WSE J;  1WRG A;  3AEC C;  1JUN A;  1URQ D;  3V2P A;  1H0T A;  2N1T C;  2QSI A;  1KC8 Q;  1SQB D;  1RE3 A;  5C39 A;  3A3Y B;  3I55 P;  3KHU A;  1YQ3 C;  1T2K D;  1URQ C;  3USS A;  1NTM D;  5AW4 B;  1N73 B;  2OGU A;  1BDC A;  1FBM A;  1EC5 A;  1VQ7 P;  1W2E A;  4BXL A;  3HRN A;  4OWF A;  1KV4 A;  2GUS A;  2LXB A;  4HH2 A;  3L72 J;  2KP8 A;  3H1J J;  3B4S A;  2BCC D;  3U1C A;  1LTB C;  3H1H E;  1GZL A;  4N78 E;  1KIL B;  3L36 A;  5AVY B;  2WVR A;  3GMA A;  2FYN C;  4H13 B;  3T97 B;  2V7Q J;  2P2U A;  1SQP E;  1MV8 A;  1HBW A;  2OTJ P;  2AXC A;  4WY4 B;  1JY2 O;  3OAK A;  3L71 G;  3L74 J;  3FGA D;  2RKL A;  2G3A A;  1XTC C;  1PGO A;  2PRR A;  2E76 C;  4K35 A;  2IYP A;  3LW5 H;  1IFP A;  1YIJ P;  5AW9 B;  3H32 A;  1L0L K;  1ZLL A;  1BCC E;  4U3F E;  3CXH E;  3FWN A;  1MKM A;  1NTK D;  4L75 A;  2O1J A;  1SFC D;  4D6T J;  1BE3 G;  2B9B A;  2XDJ A;  1P84 E;  4TT3 H;  1VQP P;  3C8V A;  1QLE D;  1BGY J;  4W7Z A;  1S5L X;  2M3E A;  1LTJ C;  3RK3 C;  4RKU J;  3A0B H;  1L0N E;  2YKP A;  1S72 P;  5AW0 B;  1YYC A;  1NTM E;  1N86 A;  1PGQ A;  1X8Y A;  3BAT A;  1L2P A;  1LP1 A;  1PGJ A;  1VQ4 P;  4GOF A;  1S1C X;  2NPS D;  3B5N B;  2C0X A;  1SQX J;  3TF5 A;  2BCC E;  1OMI A;  1L0L G;  3U59 A;  1GU4 A;  3MHV A;  3H1K J;  3HUS C;  3C1L A;  3HTK B;  1AVO A;  1IFM A;  1KYO H;  4KHX A;  1ZV8 A;  1HVV A;  5GTI H;  1M1J C;  1KB9 I;  4O9B A;  4H0L B;  2ZJS E;  2NRG A;  3QWO C;  1JMM A;  1LT9 B;  2WIT A;  1OVV A;  1X0T A;  2L5G B;  2ZYG A;  1JOC A;  1SP4 A;  1KQG B;  3H1J D;  1FJK A;  2QEX P;  3AE9 C;  2IYO A;  3BRT B;  1S2E A;  2ZVN B;  1FOS E;  2IBZ D;  1GL2 C;  5KJ7 A;  2Y0D A;  2Q3E A;  2RN0 A;  2E75 B;  3Q1M A;  2A06 G;  1IFN A;  1RE4 C;  2HYN A;  4L74 A;  1PL5 A;  1NTK E;  1DEE G;  3PHL A;  2QM7 A;  2Z5I A;  1URQ A;  3CCU P;  4UB6 H;  3Q5S A;  3SWY A;  3LW5 J;  2M8R A;  2Q7C A;  2FYU D;  4PV1 D;  3GW6 A;  5CCH C;  2AEF A;  3L70 D;  3E7K A;  1JEK A;  1TU3 F;  2YXR B;  1ZR4 A;  1QEX A;  3AE1 C;  5CCG C;  3MUD C;  4QMA A;  3BCC G;  1NU1 G;  3A5T A;  3F5H A;  2QIW A;  3L75 G;  2G8Y A;  3AE5 C;  2BEZ F;  3G4S P;  1U7J A;  4Y99 B;  2KLV A;  1NTZ K;  3M0D C;  1M57 D;  2KZI A;  1JMB A;  4H44 B;  1BGY D;  1LJ2 A;  2QE7 H;  3H1L D;  5B5E E;  5CJ0 A;  3MTU E;  2XZR A;  3W68 A;  1FDI A;  1SFC B;  2Y0C A;  2K1A A;  2IX7 C;  4UB8 E;  1X9V A;  2FXM A;  2OYI B;  3PRJ A;  3H1J E;  1SQQ G;  3FX0 A;  1NH4 A;  3H1K D;  5KLI C;  3CX5 H;  2ZT9 B;  3VMY A;  1NAF A;  4BRY A;  1H8A A;  1SFC A;  2O01 N; 
#chains in the Genus database with same CATH homology
 1NU1 K;  5AVX B;  5CJ4 A;  1URQ B;  2OYH A;  1S9K E;  2OYI A;  3OA7 A;  3RL0 C;  2YKQ A;  1J1E C;  4N78 D;  1FZA A;  3LIE A;  2POH A;  3V4W A;  2N1T A;  4B86 A;  3M9H A;  1FZE A;  1LWU B;  1N7S B;  1FAV A;  1J1D B;  1KIL A;  1N7L A;  1L0N K;  5CCH D;  1SQV K;  2P67 A;  1RF1 B;  1NTM K;  2A45 G;  2WPS A;  3G3Z A;  2NPS B;  3T97 A;  4XE5 B;  1N7S A;  5CCG D;  2YNY A;  3O8Z A;  3HUS A;  1SVF A;  1HTL C;  4WY4 A;  4Y99 C;  3KYQ A;  5AW6 B;  3VP8 A;  2WT7 B;  4ZKP A;  3VN0 A;  3C9I A;  2NPS A;  1IC2 A;  1GW3 A;  1M1J A;  2H7H A;  1HGV A;  1SQQ K;  1CW5 A;  5KJ7 D;  1NWQ A;  1JTH A;  2PAJ A;  1Z56 A;  2J58 A;  1RF0 A;  5AVS B;  2KSJ A;  2KYV A;  2H43 A;  3MD0 A;  2I1J A;  2KB7 P;  1IFI A;  4DZO A;  1FU1 A;  1JY3 O;  2P1J A;  3M06 A;  1SFC C;  3RK2 B;  3BVH A;  1WRG A;  1AFO A;  5APQ A;  5BU5 A;  1HJB A;  2OYI C;  1JUN A;  1URQ D;  4IFD K;  1KQL A;  3V5B A;  3SWF A;  4RES B;  2YO3 A;  3V2P A;  4AUW A;  2N1T C;  5CHX A;  3A2A A;  3V2Q A;  3HE5 B;  2HLO A;  1GW4 A;  4JF7 A;  1JO5 A;  1HH0 A;  2XNX A;  2YO2 A;  3H6P A;  1RE3 A;  1RE4 A;  2GM4 A;  2WSC H;  3A3Y B;  1OXZ A;  2IFN A;  5BU8 B;  2Q5U A;  1A02 F;  1T2K D;  1URQ C;  5AW4 B;  1N73 B;  4IFM A;  2XV5 A;  1FJP A;  3TYY A;  2WTY A;  1FBM A;  2FFD B;  3HD7 B;  3A7O A;  2IPP A;  1LWU C;  3P8M C;  1N7S C;  2W6B A;  4OH8 B;  4AYC A;  1KFN A;  1W2E A;  2OYH B;  3MGN A;  1X79 B;  3HRN A;  1J1D C;  1LTJ B;  3RK3 B;  1GDT A;  3RL0 D;  2GUS A;  3GHG B;  4HH2 A;  2KP8 A;  5AVU B;  1JCC A;  1JY3 N;  3R2P A;  2FYU K;  4C7R A;  4LLH A;  1NKN A;  1RF1 C;  3U1C A;  1LTB C;  3P7K A;  2NPS C;  3IR9 A;  1NOH A;  2R5D A;  1GZL A;  3B5N A;  1KIL B;  3L36 A;  4GT1 A;  4N78 E;  5AVY B;  3HD7 A;  3VYI A;  1G1I A;  2WWW A;  4EIJ A;  5AW5 B;  2WPQ A;  1GK4 A;  3BRV B;  1LTJ A;  3GHG A;  1MUU A;  1VPC A;  2LKM A;  3HTK A;  3KQG A;  3NFQ A;  3MIW A;  1MZ9 A;  1L4A B;  2OAR A;  2CPS A;  2P2U A;  1MV8 A;  1FOS F;  1HBW A;  3HUS B;  1ZN5 A;  3VP9 A;  3RK2 D;  3P8C E;  3L37 A;  4WY4 B;  1T3J A;  1JY2 O;  3OAK A;  4IFF A;  1LTS C;  3M9B A;  1LT9 A;  5AVR B;  2Z4E A;  1EQ7 A;  2BAS A;  1JY2 P;  3P8C D;  4GIF A;  2R5B A;  1M1J B;  1L4A A;  2CPB A;  1KZU B;  5APS A;  3LID A;  2J59 M;  3V2N A;  1XTC C;  1G1J A;  5AVZ B;  3RK2 C;  2FKW B;  1JTH B;  5APX A;  5APV A;  3LW5 H;  2GUV A;  5AW9 B;  4W80 A;  3H32 A;  1L0L K;  1ZLL A;  2W27 A;  3P32 A;  2PP6 A;  3B8E B;  2O1K A;  2M3B A;  3VMZ A;  2O1J A;  5AVW B;  1SFC D;  4I6M C;  2A45 I;  3CL3 D;  3OJA B;  2Q3I A;  4N6J A;  2H8P D;  2XDJ A;  1GL2 B;  2N1T D;  1JNM A;  5APU A;  1N73 C;  1HGZ A;  1HWT C;  3PP5 A;  2W6A A;  2HPC B;  1H89 A;  2FFD C;  3HD7 C;  1KIL D;  4N3Y B;  2C9N Y;  1T3U A;  1M7L A;  1ZR2 A;  2OYH C;  1AQ5 A;  4W7Z A;  4C7N A;  1YTZ I;  3II6 A;  1LTJ C;  3RK3 C;  3GHG C;  2VRS A;  2YKP A;  2C0W A;  2N9B A;  5BVZ A;  5AW0 B;  2HG5 D;  1GL2 A;  1YYC A;  1N7S D;  3CLQ A;  1N86 A;  2HPC A;  1KIL C;  3IFM A;  1X8Y A;  3BAT A;  4WY4 D;  5KLV K;  1MFZ A;  3WMM 0;  1JCD A;  4HYT B;  2NPS D;  3B5N B;  2O01 H;  2C0X A;  3KPE A;  1L4A C;  1PFI A;  1A02 J;  2HOD B;  1CI6 B;  4EOT A;  3TSI A;  2YMY A;  3U59 A;  2R32 A;  2P7J A;  1GU4 A;  3HUS C;  2HFE D;  4AQR D;  4WY4 C;  3VTP C;  3HTK B;  5CCH A;  1QL2 A;  1IO4 A;  1IFM A;  4KHX A;  2E42 A;  1G2C B;  3I5C A;  1ZV8 A;  1HVV A;  1M1J C;  1HUC A;  4O9B A;  2HOD A;  1CI6 A;  5CCG A;  1QL1 A;  1JMM A;  1LT9 B;  3MUD A;  2WIT A;  1WT6 A;  1RF0 C;  3NMD A;  1OWA A;  3EQ2 A;  4M3L A;  1FZB A;  1DEB A;  2FYZ A;  5AVV B;  3U1A A;  2XU6 A;  2L5G B;  1JOC A;  1SP4 A;  1G2C A;  1NHL A;  2A45 H;  2ZFC A;  1FJK A;  4JYB A;  3BRT B;  4JYC A;  2WSF H;  3VMX A;  1DX7 A;  1GK6 A;  4I2L C;  1KFM A;  3NXS A;  3H32 B;  3M91 A;  1FOS E;  5AW3 B;  2MJZ A;  3TNU B;  4W7Y A;  3M0D A;  5AVT B;  1GL2 C;  2R3C A;  5KJ7 A;  5AW8 B;  1J2J B;  4XA4 A;  1RE3 C;  1IFN A;  1RE4 C;  1SQB K;  2HYN A;  1NKZ B;  1S9K D;  1IJD B;  1LTG C;  2QM7 A;  2Z5I A;  1H88 A;  1URQ A;  1GU5 A;  1XTG B;  3TNU A;  1FDM A;  3B5N D;  1CSB A;  3SWY A;  3HD7 D;  1CZQ A;  5AW7 B;  2M8R A;  1DH3 A;  4C7N B;  1FZC B;  1LWU A;  3NTN A;  2JEE A;  4LGD E;  3RK3 D;  2Q7C A;  3RL0 B;  1SQX K;  5CCH C;  1J1E B;  5CMZ A;  4GKG A;  3TK1 A;  1JY2 N;  1RF1 A;  3M9Q A;  3B5N C;  4WBA A;  1IK9 A;  1RY3 A;  2QM8 A;  1ZR4 A;  1LTT C;  3E1I A;  5CCG C;  3BAS A;  2ZXE B;  1FZC A;  1LTA C;  1N2D C;  3N4X A;  2WZ7 A;  1YTZ T;  1FZF A;  1E5W A;  2WSE H;  3A5T A;  1L4A D;  1IFD A;  3L35 A;  2C9L Y;  3EFG A;  2WT7 A;  2Q9I A;  3M0A A;  1LTI C;  4I1L A;  1GTW A;  5APW A;  4C46 A;  4Y99 B;  1LT9 C;  3UIA A;  2IFM A;  2KLV A;  1NTZ K;  3M0D C;  1JY3 P;  5KJ7 C;  1SQP K;  1T8Z A;  3KDP B;  1FZG A;  2I1K A;  1GD2 E;  3HE4 B;  3N7N A;  1SLQ A;  5CJ0 A;  3MTU E;  2YKO A;  3V2R A;  1LGH B;  5APT A;  2KOG A;  1IFJ A;  2WPR A;  2XZR A;  5APY A;  5KTB A;  2E43 A;  5AW1 B;  1NTK K;  1SFC B;  3HE5 A;  1VDF A;  2Z5H A;  2IX7 C;  1X9V A;  2FXM A;  2OYI B;  4DOJ A;  3HE4 A;  3V4Q A;  3L4F A;  1T2K C;  1GL2 D;  2N1T B;  3CI9 A;  1NO4 A;  1N73 A;  1NH4 A;  4ZKU A;  2XKM A;  4WB4 A;  3VMY A;  1NAF A;  2FFD A;  5AW2 B;  5AVQ B;  1H8A A;  1SFC A;  1FZC C;  2JJL A;  4LC1 A;  3VOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...