1FZAA

Crystal structure of fibrinogen fragment d
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
85
structure length
85
Chain Sequence
VSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRINOGEN
publication title Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 30
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzaA00
1RE4C 1LWUB 3HUSA 2OYIA 1RE3A 1RF1C 1FZCC 2OYHC 1FZGA 1LTJC 1RE4A 2A45G 1JY3N 1LT9B 3BVHA 2HPCB 1FZFA 3GHGC 3HUSB 1RF1A 1FZCA 1JY3P 2OYHA 2OYIB 1LTJA 3GHGA 2FFDC 1M1JC 1JY3O 1RF1B 1JY2N 3H32A 1M1JA 3E1IA 1FZCB 2OYHB 1N73C 1LTJB 2FFDA 3GHGB 1RF0C 1JY2P 2XNXA 2A45I 2HODA 1T3UA 2HLOA 1LWUC 1N73A 1JY2O 1W2EA 1M1JB 1RF0A 3H32B 2H43A 1N86A 2Q9IA 2FFDB 1LT9C 1LWUA 2HODB 3HUSC 1N73B 1FZEA 1FZAA 1LT9A 1RE3C 2A45H 2HPCA 2OYIC 2Z4EA 1FZBA
chains in the Genus database with same CATH superfamily
3BASA 1GW4A 2NPSC 3D6YA 1YI2P 2YIUB 1ZV8A 2KOGA 3WU2E 1N8RQ 5B5EE 5APWA 2P7JA 1PPJE 1HF9A 1VDFA 1RF0A 3H1HG 3TNUB 5GTHE 3FWNA 1JY3N 3P8CD 4IL6X 2JDIH 1U7MA 1X0TA 4RJTA 4AQRD 3RL0g 3CXHH 3WUVA 1IK9A 3M0DA 1LTBC 5APYA 4WVZA 1FZBA 1LP1A 3HD7C 5AW4B 3G3ZA 2HG5D 3IN6A 3A0BH 3SFEC 1N73A 1N7LA 2I1KA 2Q1KA 3H1JE 1NTMJ 3CLQA 1RF1C 1BE3J 1L0LE 3IAOA 1SQQG 1N2DC 3VOPA 1J2JB 2B89A 2K9YA 2Q9IA 5GTIH 4IL6H 2FYZA 1FAVA 1PPJG 3L70D 2JWAA 5AVYB 5AVSB 2D2CC 2WT7B 5AW1B 1K8AQ 3NXSA 1IJDB 1IFJA 2W6BA 2H43A 4Y99C 1DD3A 1S2EA 2O01H 2LKMA 2GUSA 3H1LJ 1RE4C 1NU1J 5KJ7A 3MD0A 3B8EB 4C46A 1A02F 1IFIA 2CPSA 1M90Q 2E74C 2LXBA 2JR8A 2O1KA 3A0HH 2WMMA 1NTMK 3H1JG 1LTAC 1AQ5A 3S1KA 2XNDH 1NTKJ 1HBWA 1FE6A 1L0LG 5KLVD 1EZVI 1QL2A 3E7KA 5APVA 2HPCA 4N78E 3M0AA 1GW3A 2JP3A 3AE9C 3RK2D 2FBWC 2OYIB 1NGMB 2ZT9C 1NKZB 3TF5A 1OVVA 4OGQD 3KXDA 3EQ2A 2ZVOB 3UIAA 2OTLP 2PP6A 3L75J 3CWBE 1L0ND 3RK2B 3KQGA 2NPSD 2Q7CA 1QEXA 4RO0A 1QX8A 1HGVA 1OVRA 4WY4A 3B5NC 3T97A 4OGQB 3C1LA 3Q3DA 1LT9B 4MN4C 1NU1K 2AEMA 3EFFK 5AW5B 4CPGA 5KAIE 1FOSF 3CX5D 2NPSB 3CCRP 2J5UA 3Q1MA 4UB8H 4N3YB 1R5SA 3JCUH 2B88A 2WSCJ 3VP9A 1PV3A 5AVVB 2PGDA 4H44D 2Q3IA 2BCCE 4PD4I 3H1HD 1NTKK 3AEBC 2IBZD 2P67A 1UIIA 2E75C 2H7HA 1RE4A 1S9KE 4C7RA 1FJKA 3LIDA 2XV5A 1FS0E 3VN0A 5AVXB 5AW8B 1KV4A 4H0LC 1JTHA 3LW5J 2WWWA 1KORA 2ZYGA 3CWBG 1PL5A 2VRSA 1CZQA 4U3FJ 2WPRA 5APTA 2DW3A 4ZNCA 1GZLA 3TGUE 1N7SA 1NTME 1BE3E 1FZEA 1DD4A 1YBKA 2YMYA 5L8RJ 2YXRB 1LT1A 3WUUA 1T8ZA 2D2CD 4GDOA 3CCEP 2SPZA 2FYUD 1SQQD 3GLMA 2H8PD 2HLOA 3AECC 3W68A 2D2CB 3PHLA 5AVWB 1LTSC 1SFCC 2WPSA 4IFMA 2BCCG 1Q81Q 2B87A 3CCSP 2FYUJ 1RY3A 1BCCJ 2KIKA 2K1AA 2O1JA 3HE5B 3H1LE 5GTIE 2QA4P 3N7NA 4IL6E 1NU1E 1PZQA 1L4AD 1VQNP 1YJWP 2E74B 4W7ZA 2GM4A 4B86A 3RL0D 2K9JA 5KLIC 3R4YA 1SVFA 3A3YB 1L4AB 2W90A 1IK7A 3I55P 3MGNA 3RL0B 4PD4H 4EYYQ 1OMIA 4ASWA 3TGUG 1NTMG 1BE3G 1NTKE 1IZNB 4JPZB 4NPDA 2AXCA 1L0LD 1M8OB 2JEEA 3A0HE 2E5YA 2Q5UA 4D6TD 2J58A 2OYHA 3L74D 3Q5SA 3B5NB 3N4XA 3L75E 1J1DB 3L35A 1OFCX 3AEEC 4D6TJ 2Q6QA 3MZWB 3O8ZA 1P84D 3H1LG 3SWKA 1NU1G 1X22A 4BRYB 1QGKB 3CCLP 1URQA 3L37A 1M56D 2E75D 1KZUB 2KSEA 1VPCA 1LGHB 1TU3F 1NAFA 3AE8C 2KNCB 1LTJC 1VF5C 3O6QA 3Q5PA 2ZXXA 2E75B 2E76C 3V2RA 3A2AA 1QVGO 4UB8E 5AW0B 2QM7A 1D7MA 1ZMEC 3JCUE 1ZN5A 4I2LC 1ZR4A 5CJ0A 2A06D 2R3CA 1CI6B 1JY3O 1JM0A 3R2PA 1SQXG 1CSBA 3HTKB 2IX7C 1VQ6P 2HODB 3L75G 4U3FE 2OYIC 3CPWO 2XZRA 4XA4A 3JSVC 1R5LA 2FKWB 1FZFA 5CCGD 2K37A 1DIPA 1W2BO 1YYCA 3RK2C 1NTZJ 3ZDMA 4RESB 1SFCD 1VQ8P 4OGQC 4DCKA 2L5GB 4XE5B 3HUSA 3MUDA 3AE2C 2C9LY 2WSSH 1SFCB 3H1IE 3OAKA 3MIWA 1SQPK 2KK7A 1FOSE 1S1CX 3PRJA 1J1EC 3G4SP 3FGAD 2KYVA 4HB1A 1KTMA 1EZVE 2BCCD 1Q7YQ 2GA1A 4HYTB 2WT7A 1FDOA 1YIJP 1VQOP 3V6IA 3GHGB 4DOJA 2ZYAA 2YO2A 3AEDC 1VL2A 3K5BA 5KLIB 4IFFA 4H44C 2HYNA 4TLFA 1ZRTE 4W80A 1ZW0A 5TJHA 1HJ0A 2I8DA 2NZ2A 2Y0CA 2Y0DA 3L73E 2N1TD 4U3FG 2OYOA 5E79H 2E42A 1NTZK 3BCCD 2YXQB 1L2PA 4K35A 3CX5I 3CXHD 2N1TB 4BXLA 3RK3C 1JEKA 1OX3A 2K3RA 2BEZF 2M5AB 3EWKA 3GMAA 3BVHA 2M3EA 1MFTA 1PIXA 3V4WA 4BWNA 5B66H 1T3JA 3CCQP 5K5GB 3G71P 1YJNP 3H1IG 1USDA 4PD4E 2Q3EA 2YKQA 1JCCA 3RBXA 2Z5IA 2OTJP 1K04A 2OYIA 1GL2C 1RE3A 2AEJA 3CCUP 2IBZI 1SLQA 1EZVG 3PJSK 4JBZA 1G1JA 3V4QA 3QH9A 4IFDK 4DJGA 1SP4A 5AW6B 1UIXA 4EI2A 3L70J 1LT9A 2JWDA 1VF5D 1Q86Q 4AUWA 4OH8B 2NPSA 2E76D 1HTLC 3AE5C 1LTJB 3V2NA 1OW8A 1VF5B 3L73G 2QJKB 2KXPB 5AW2B 1EDKA 2E76B 1SQPE 1EDJA 1L4AC 5CBOA 3L72D 2FXPA 3BRVB 1JCDA 1PP9E 1YTZT 4L76A 3RL0C 2XNXA 1KILD 1AVYA 1SQBD 1GD2E 4OWFA 3D70A 1FBMA 2FYNC 3L72J 5M1BA 1SQVD 3A5TA 1GDTA 1H0TB 1FZGA 3H1KE 1KILB 1SS1A 1BGYD 3OJAB 3ITKA 2QE7H 1FDMA 1USEA 3HD7A 1DEBA 1SQXD 5KLVJ 1T2KD 1EC5A 4Z1MH 2YKPA 2HFED 4L73A 3CI9A 1ZP0C 1J1DC 2WSCH 2WQYC 1NTZE 1RF1A 2KUBA 2NRGA 1M7LA 1JY2P 4EDFA 1L0NJ 3AE1C 3L71E 2AXTH 5CHXA 3H32B 2KLVA 1BDDA 3D71A 3KZIE 1AFOA 3IR9A 1J1EB 3H6PA 1DH3A 1SQPG 1FU1A 3CMAP 3MHVA 3Q5RA 1OXZA 1T3UA 1PP9G 2RH0A 3LW5H 2WVRA 3HE5A 4H44B 2QIWA 5CJ4A 2KB7P 3H1HJ 3H1KG 1LWUC 5KLVK 3P8CE 4WWIA 3RK3D 2WSEH 4PJ0H 1OIPA 1L4AA 4PV1D 1YQ3C 1K05A 1M1JC 1P84I 3RK3B 3VP8A 1Q82Q 4O9BA 3C9IA 1KB9D 4WY4D 1ZLLA 1NTZG 3F5HA 1NYHA 3VTPC 1L0NK 1GL2D 2FXMA 4JYBA 3HE4B 4N6JA 1DEEG 1KYOD 5AW9B 1U7JA 3L71G 3BRTB 2WSEJ 5E79E 3CC4P 3V2PA 1GL2B 2W83C 5CCGC 3U1AA 1PGJA 3H1ID 4LLHA 4H13C 2BEQD 1PPJD 5B66E 3B5NA 2O01N 2P1JA 1SQQJ 3TK1A 3SSUA 2IPPA 3B71A 1H8AA 1QVFO 4XFJA 1X9VA 1VQ4P 4DZOA 1FC2C 1HUCA 3V5BA 1FZCC 3GHGC 1Y47A 2JKVA 1G2CB 1H88A 3L73D 2G3AA 2ZAEB 2R32A 2WZ7A 5KAFH 2KNCA 2M3BA 2Z5HA 2KS1B 3KHUA 1Z56A 3H1JD 2FFDC 1N7SD 2FYNB 3KPEA 1IFNA 1JY2N 2PRRA 4W7YA 5C39A 2A45I 2KSJA 3G6EP 2N1TC 1GMJA 2P10A 5AVQB 2K88A 3NTNA 3H1JJ 3VMYA 1S72P 3II6A 4K3AA 5KLVE 3HTKA 2FYUK 1SQQK 2O3JA 2XDJA 1VQ7P 2V4HA 4C7NB 1IO4A 1L0LJ 2HODA 3V2QA 1P84H 2KLUA 5CMZA 4ZKPA 1QL1A 3P8MC 3VMZA 2Y9YA 4ZMDA 5KKZC 4Y28J 3L74J 4GOEA 4JF7A 1L0NE 1LTGC 1RF0C 5CCGA 3GG2A 1HWTC 5AW7B 1GK4A 3CX5E 1SFCA 4WB4A 3CXHI 5APUA 3CC7P 1JNMA 5AVRB 1SQPD 2QJKC 2AXTE 4A7PA 2QEXP 3M0DC 3TNUA 1IFDA 1NTKG 1LJ2A 2H89C 1LWUB 3FXEA 1KQSO 1GU4A 4GOFA 2KZIA 3GHGA 3CCMP 2IBZE 3PTZA 4N78D 4WBAA 1GK6A 1N73C 3H1KD 1S3JA 5KLVG 1M1JB 4LC1A 2FXOA 3M9HA 1KILC 3AE6C 4HKZH 2M8RA 2JJLA 3CWBD 3KZIH 1AV1A 1LTIC 2MJZA 3B4SA 4L75A 1R8EA 1E79H 2WSFJ 2N1TA 4H13D 2CPBA 3L36A 1NVOA 1KD1Q 3NFQA 4PJ0E 3PH0A 2C0XA 1T2KC 1S5LH 1BDCA 2UWJE 1Y9BA 2JO1A 3CCJP 1HH0A 4H13B 1NH4A 4I1LA 2H88C 2C0WA 1VQMP 2FYUE 1SQQE 5KJ7C 5TISH 1BCCE 2IFNA 3U1CA 2M0BA 3W67A 1HJBA 2FY8A 1M1KQ 1HGZA 1FZCB 5AVZB 3O6QB 1S9KD 1LNQA 1LTTC 2P58A 2IBZG 1NAYA 1PGPA 4GODA 2BCCJ 2IZ1A 4YTPC 1KQGB 2CK3H 1LTJA 1WRGA 2XU6A 3AEGC 5CCHD 3CCVP 2FFDB 1EQ7A 1JUNA 2IYPA 2L91A 4UB6E 3TSIA 3TGUD 1KQLA 1NTMD 1BE3D 1X8YA 4QMAA 3A7OA 4DT0A 3VYIA 2HR3A 4ASVA 2WTYA 3BCCJ 4PV1C 5KAFE 4AYCA 2WPVB 4WY4C 1H0TA 3G9RA 3USSA 1DX7A 1KILA 5APSA 3TGUJ 1YJ9P 1Q2NA 5DJUB 3HUSB 4NPFX 2N9YB 1YTZI 1WT6A 2FYUG 4YXWH 1BCCG 3M9QA 5KKZB 2IZ0A 1OWAA 4I6MC 4D6TE 5CBNA 2C9NY 3L74E 3H1LD 3GF7A 1NU1D 2KP8A 1MKMA 1OVUA 3H32A 1P84E 3QWOC 1KB9I 4I7ZC 3PLNA 2QJYC 1AQTA 3P7KA 1EDIA 1KYOI 1LP1B 3F89A 3AE4C 2Y0EA 2ZJSE 1NTKD 3RGUA 1N73B 2O01J 1FZAA 2POHA 2Z4EA 2W8ZA 2V7QH 3GF3A 1SQBJ 1N7SC 1OW7A 1G1IA 2A06E 2KZJA 1SQVJ 3L75D 4D6TG 3WUTA 1BGYJ 2W6AA 1OZHA 3CD6P 3CX5H 1KFNA 2RKLA 3FXDA 1K73Q 1FJPA 3L74G 4OVNF 1SQXJ 1PFIA 2QG4A 2V7QJ 2RMZA 5H2FE 3HE4A 1N86A 5KJ7D 1Q90D 1YHQP 4YPCA 3VMXA 2OTKE 2R5DA 1K9MQ 1JMBA 1NKNA 4YXDC 1GL2A 2OQQA 3VMAA 1KQFB 1KC8Q 1AVOA 1KMIZ 1WMKA 1S5LE 1YITP 3IFMA 3SWFA 1KN7A 1HVVA 2QSIA 3P32A 1AJYA 5BU8B 3EFGA 1SQBK 2OGUA 5TISE 2IDBA 1A02J 3KDPB 3HD7D 1SQVK 2R44A 5KTBA 2HPCB 2A06G 1T6AA 1KB9H 5AVUB 1G2CA 1KFMA 4U3FD 3S9OA 1S4XA 1SQXK 3HD7B 1EXIA 1E5WA 2WITA 1KYOH 5DJTB 4ZKUA 3OW2O 2KS1A 4PV1B 2W6JH 2OYHC 3AE7C 5APXA 4L74A 3BCCE 3HRNA 4WY4B 4EIJA 3T97B 1ZR2A 1JOCA 1RF1B 3CXHE 3WU2H 1IFPA 3M9BA 1XTCC 5B5EH 2WPQA 1JY2O 3C8VA 1NJIQ 2QJPC 4M3LA 1VQ9P 3OA7A 5BU5A 5GTHH 1MV8A 2A45G 1IFMA 2KI7B 3A0BE 1XTGB 4C7NA 1FDIA 4LGDE 1NOHA 2OARA 1EZVD 2R3SA 1BCCD 5AVTB 3E1IA 3H1IJ 1URQC 3MP7B 3RBZA 1RHZB 3L70E 5EFWB 2YIUC 5APQA 1BSHA 2IYOA 3TYYA 4UB6H 4Y99B 2PAJA 3I5CA 3BATA 4BRYA 1RQUA 1JMMA 2E74D 4GKGA 1ZRTD 3GW6A 4I7ZB 4GIFA 4KJMA 2QJYB 4GT1A 3IF4A 3AEFC 2E5TA 2I1JA 1JTHB 2YMKA 4IOIH 2G8YA 3SWYA 3L73J 1PGOA 3BCCG 3S4RA 1W5CE 3L72E 2ZYDA 1LWUA 3SFDC 5CCHC 1YQ4C 2ZVNB 1N7SB 3E1RA 1IC2A 4TT3H 1AA0A 2LXCB 2ZT9D 3CC2P 1CI6A 1KILE 1SQBE 1U57A 4PD4D 1JY3P 4JYCA 1RH5B 3D6ZA 1M1JA 3PP5A 1SQVE 3L4FA 4KT0J 3TDKA 2ZT9B 2W27A 3B5ND 1EDLA 1BGYE 2Y9ZA 2N9BA 3HUSC 3MUDC 5AW3B 1SQXE 1QLED 1NO4A 3L70G 3M91A 4U7JA 3AEAC 2B87B 1VQ5P 1ZXGA 3KYQA 2XKMA 2ZXEB 1GTWA 1MUUA 1Y8AA 5BVZA 1M57D 3H25A 1BSNA 3I56P 4HJGH 1VQLP 2YKOA 1GU5A 4KHXA 2K9JB 2LR2A 2IFMA 2E43A 1S5LX 1NHLA 1ZOYC 1PP9D 2QVAA 2RN0A 2YNYA 2B9BA 2R5BA 3WMM0 2J59M 3FX0A 3L72G 3FWLA 4HH2A 1FZCA 1SQPJ 3H1HE 3CL3D 1MZ9A 2ZFCA 4H0LD 3ABVC 1SQBG 4NPEA 1PP9J 2WSFH 1L0LK 5H2FH 1SQVG 2BASA 2AEFA 2P2UA 4H0LB 1BGYG 3H1KJ 3RK3E 2ITAA 1VQPP 1JB0J 2OYHB 5KAIH 2FFDA 3JC22 1EXJA 2QM8A 2PFXA 3M06A 1H89A 1NTZD 1W2EA 1CW5A 1JO5A 1L0NG 3NMDA 4EOTA 2MKVA 3AE3C 3U59A 1RE3C 2A45H 3MTUE 2QRXA 2M5AA 3CWBJ 5CCHA 4R4MA 3L71D 1KB9E 2QJPB 3Q2YA 1RQVA 1MFZA 1OW6A 2YO3A 1URQD 3CMEP 1PGQA 1KYOE 3LIEA 4R4LA 4JQ0D 1X79B 1VQKP 1LT9C 4RKUJ 2GUVA 3L71J 1URQB 1NWQA
chains in the Genus database with same CATH topology
3BASA 1GW4A 2NPSC 2OYHA 1L4AA 1ZV8A 2KOGA 1M1JC 3P7KA 3B5NB 3N4XA 3RK3B 1J1DB 5APWA 3VP8A 2P7JA 3L35A 4O9BA 3C9IA 4WY4D 1ZLLA 3VTPC 1VDFA 1RF0A 1L0NK 3TNUB 1GL2D 2FXMA 4JYBA 3HE4B 4N6JA 1N73B 1FZAA 2POHA 3O8ZA 2Z4EA 5AW9B 3BRTB 1JY3N 3P8CD 3V2PA 1GL2B 5CCGC 4AQRD 3U1AA 1N7SC 1URQA 3L37A 1IK9A 1G1IA 3M0DA 1LTBC 4LLHA 1KZUB 5APYA 1VPCA 1FZBA 1LGHB 1NAFA 2W6AA 1LTJC 3B5NA 1KFNA 3HD7C 2P1JA 5AW4B 1FJPA 3TK1A 1PFIA 2IPPA 3G3ZA 2HG5D 1H8AA 3V2RA 3HE4A 3A2AA 1N73A 1X9VA 1N86A 5KJ7D 4DZOA 5AW0B 1N7LA 2I1KA 2QM7A 3VMXA 1HUCA 1ZN5A 3V5BA 2R5DA 3CLQA 1RF1C 1FZCC 1NKNA 4I2LC 1ZR4A 5CJ0A 3GHGC 1GL2A 2R3CA 1CI6B 1JY3O 3R2PA 1N2DC 1G2CB 1H88A 1CSBA 3HTKB 3VOPA 1J2JB 2IX7C 2Q9IA 2R32A 2WZ7A 2HODB 2OYIC 2FYZA 3IFMA 2M3BA 1FAVA 2XZRA 2Z5HA 3SWFA 4XA4A 2FKWB 1FZFA 1Z56A 5CCGD 2FFDC 1N7SD 1HVVA 5AVYB 5AVSB 3KPEA 3P32A 1IFNA 1YYCA 5AW1B 2WT7B 1JY2N 5BU8B 3RK2C 4W7YA 3NXSA 3EFGA 1SQBK 2A45I 1IJDB 2KSJA 2N1TC 1IFJA 4RESB 1SFCD 2W6BA 2H43A 4Y99C 2L5GB 2O01H 4XE5B 2LKMA 2GUSA 1A02J 3KDPB 3HD7D 5AVQB 3NTNA 1SQVK 1RE4C 3HUSA 3MUDA 3VMYA 5KTBA 2C9LY 5KJ7A 2HPCB 3II6A 3MD0A 1SFCB 3OAKA 5AVUB 1G2CA 3MIWA 3B8EB 1KFMA 3HTKA 2FYUK 1SQQK 2XDJA 1SQXK 4C46A 1SQPK 1A02F 4C7NB 1IFIA 2CPSA 3HD7B 1IO4A 1FOSE 2HODA 3V2QA 1E5WA 5CMZA 2WITA 4ZKPA 1QL1A 3P8MC 3VMZA 2O1KA 4ZKUA 1J1EC 2KYVA 2OYHC 5APXA 4HYTB 2WT7A 1NTMK 4JF7A 3HRNA 4WY4B 4EIJA 1LTAC 1ZR2A 1JOCA 1LTGC 1RF1B 1AQ5A 3GHGB 1RF0C 3M9BA 4DOJA 1HBWA 1XTCC 2WPQA 5CCGA 1JY2O 2YO2A 1QL2A 4IFFA 4M3LA 1HWTC 5AW7B 2HYNA 3OA7A 5BU5A 5APVA 2HPCA 1GK4A 4N78E 1MV8A 3M0AA 4W80A 1SFCA 1GW3A 4WB4A 2A45G 1IFMA 3RK2D 1XTGB 4C7NA 2OYIB 4LGDE 5APUA 2N1TD 1NOHA 2OARA 1JNMA 5AVTB 1NKZB 5AVRB 3E1IA 1URQC 2E42A 3EQ2A 3M0DC 1NTZK 3TNUA 3UIAA 1IFDA 2PP6A 3RK2B 3KQGA 2NPSD 2Q7CA 1HGVA 2N1TB 5APQA 3TYYA 4WY4A 3B5NC 1LWUB 3T97A 3RK3C 4Y99B 2PAJA 1LT9B 3BVHA 1GU4A 3I5CA 1NU1K 3BATA 5AW5B 3GHGA 3V4WA 1JMMA 1FOSF 1T3JA 4N78D 4GKGA 1GK6A 4WBAA 2NPSB 1N73C 4GIFA 1M1JB 4GT1A 4LC1A 3M9HA 1KILC 2YKQA 1JCCA 2I1JA 4N3YB 2Z5IA 2OYIA 1JTHB 1GL2C 1RE3A 2M8RA 2JJLA 1LTIC 2MJZA 1SLQA 3VP9A 3SWYA 5AVVB 2Q3IA 1G1JA 3V4QA 1NTKK 2N1TA 4IFDK 2P67A 1LWUA 1SP4A 2CPBA 5AW6B 3L36A 5CCHC 3NFQA 1LT9A 1N7SB 2C0XA 1IC2A 1T2KC 2H7HA 1CI6A 1RE4A 1S9KE 4AUWA 4C7RA 4OH8B 1FJKA 2NPSA 1JY3P 4JYCA 3LIDA 2XV5A 1HH0A 1HTLC 3VN0A 1M1JA 3PP5A 1LTJB 3V2NA 1NH4A 3L4FA 5AVXB 5AW8B 4I1LA 2W27A 3B5ND 2C0WA 1JTHA 2N9BA 3HUSC 5AW2B 5AW3B 5KJ7C 3U1CA 2IFNA 2WWWA 1NO4A 3M91A 2VRSA 1L4AC 1CZQA 1HJBA 3BRVB 1JCDA 1HGZA 1YTZT 2WPRA 1FZCB 5APTA 3RL0C 5AVZB 2XNXA 1KILD 1S9KD 3KYQA 2XKMA 1LTTC 1GD2E 2ZXEB 1GZLA 1GTWA 1MUUA 1N7SA 1FBMA 5BVZA 1FZEA 2YMYA 3A5TA 1GDTA 1FZGA 1T8ZA 1KILB 2YKOA 1GU5A 3OJAB 1LTJA 4KHXA 1FDMA 3HD7A 1DEBA 1WRGA 2H8PD 2IFMA 2XU6A 2E43A 5CCHD 2HLOA 1NHLA 2FFDB 1EQ7A 1JUNA 1T2KD 5AVWB 1LTSC 1SFCC 2YKPA 2HFED 2YNYA 2WPSA 4IFMA 2R5BA 3WMM0 2J59M 3CI9A 1J1DC 2WSCH 3TSIA 1KQLA 4HH2A 1RY3A 1RF1A 1FZCA 1X8YA 3A7OA 1M7LA 3CL3D 3VYIA 1MZ9A 2O1JA 2ZFCA 3HE5B 2WTYA 1JY2P 2WSFH 5CHXA 3H32B 3N7NA 4AYCA 2KLVA 1L0LK 4WY4C 1L4AD 1DX7A 1KILA 5APSA 1AFOA 2BASA 2P2UA 3IR9A 4W7ZA 2GM4A 4B86A 3HUSB 1J1EB 3RL0D 3H6PA 1DH3A 1YTZI 1WT6A 1SVFA 3A3YB 1FU1A 3M9QA 2OYHB 1L4AB 2FFDA 1OWAA 4I6MC 2QM8A 1OXZA 1T3UA 3M06A 3MGNA 1H89A 1W2EA 1CW5A 1JO5A 3NMDA 4EOTA 3LW5H 3RL0B 2C9NY 3U59A 1RE3C 2A45H 3MTUE 5CCHA 1MFZA 3HE5A 2YO3A 2KP8A 1URQD 5CJ4A 3H32A 2KB7P 3LIEA 1LWUC 5KLVK 1X79B 3P8CE 2JEEA 1LT9C 3RK3D 2GUVA 2Q5UA 1URQB 1NWQA 2WSEH 2J58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RE4 C;  1LWU B;  3HUS A;  2OYI A;  1RE3 A;  1RF1 C;  1FZC C;  2OYH C;  1FZG A;  1LTJ C;  1RE4 A;  2A45 G;  1JY3 N;  1LT9 B;  3BVH A;  2HPC B;  1FZF A;  3GHG C;  3HUS B;  1RF1 A;  1FZC A;  1JY3 P;  2OYH A;  2OYI B;  1LTJ A;  3GHG A;  2FFD C;  1M1J C;  1JY3 O;  1RF1 B;  1JY2 N;  3H32 A;  1M1J A;  3E1I A;  1FZC B;  2OYH B;  1N73 C;  1LTJ B;  2FFD A;  3GHG B;  1RF0 C;  1JY2 P;  2XNX A;  2A45 I;  2HOD A;  1T3U A;  2HLO A;  1LWU C;  1N73 A;  1JY2 O;  1W2E A;  1M1J B;  1RF0 A;  3H32 B;  2H43 A;  1N86 A;  2Q9I A;  2FFD B;  1LT9 C;  1LWU A;  2HOD B;  3HUS C;  1N73 B;  1FZE A;  1FZA A;  1LT9 A;  1RE3 C;  2A45 H;  2HPC A;  2OYI C;  2Z4E A;  1FZB A; 
#chains in the Genus database with same CATH topology
 3BAS A;  1GW4 A;  2NPS C;  3D6Y A;  1YI2 P;  2YIU B;  1ZV8 A;  2KOG A;  3WU2 E;  1N8R Q;  5B5E E;  5APW A;  2P7J A;  1PPJ E;  1HF9 A;  1VDF A;  1RF0 A;  3H1H G;  3TNU B;  5GTH E;  3FWN A;  1JY3 N;  3P8C D;  4IL6 X;  2JDI H;  1U7M A;  1X0T A;  4RJT A;  4AQR D;  3RL0 g;  3CXH H;  3WUV A;  1IK9 A;  3M0D A;  1LTB C;  5APY A;  4WVZ A;  1FZB A;  1LP1 A;  3HD7 C;  5AW4 B;  3G3Z A;  2HG5 D;  3IN6 A;  3A0B H;  3SFE C;  1N73 A;  1N7L A;  2I1K A;  2Q1K A;  3H1J E;  1NTM J;  3CLQ A;  1RF1 C;  1BE3 J;  1L0L E;  3IAO A;  1SQQ G;  1N2D C;  3VOP A;  1J2J B;  2B89 A;  2K9Y A;  2Q9I A;  5GTI H;  4IL6 H;  2FYZ A;  1FAV A;  1PPJ G;  3L70 D;  2JWA A;  5AVY B;  5AVS B;  2D2C C;  2WT7 B;  5AW1 B;  1K8A Q;  3NXS A;  1IJD B;  1IFJ A;  2W6B A;  2H43 A;  4Y99 C;  1DD3 A;  1S2E A;  2O01 H;  2LKM A;  2GUS A;  3H1L J;  1RE4 C;  1NU1 J;  5KJ7 A;  3MD0 A;  3B8E B;  4C46 A;  1A02 F;  1IFI A;  2CPS A;  1M90 Q;  2E74 C;  2LXB A;  2JR8 A;  2O1K A;  3A0H H;  2WMM A;  1NTM K;  3H1J G;  1LTA C;  1AQ5 A;  3S1K A;  2XND H;  1NTK J;  1HBW A;  1FE6 A;  1L0L G;  5KLV D;  1EZV I;  1QL2 A;  3E7K A;  5APV A;  2HPC A;  4N78 E;  3M0A A;  1GW3 A;  2JP3 A;  3AE9 C;  3RK2 D;  2FBW C;  2OYI B;  1NGM B;  2ZT9 C;  1NKZ B;  3TF5 A;  1OVV A;  4OGQ D;  3KXD A;  3EQ2 A;  2ZVO B;  3UIA A;  2OTL P;  2PP6 A;  3L75 J;  3CWB E;  1L0N D;  3RK2 B;  3KQG A;  2NPS D;  2Q7C A;  1QEX A;  4RO0 A;  1QX8 A;  1HGV A;  1OVR A;  4WY4 A;  3B5N C;  3T97 A;  4OGQ B;  3C1L A;  3Q3D A;  1LT9 B;  4MN4 C;  1NU1 K;  2AEM A;  3EFF K;  5AW5 B;  4CPG A;  5KAI E;  1FOS F;  3CX5 D;  2NPS B;  3CCR P;  2J5U A;  3Q1M A;  4UB8 H;  4N3Y B;  1R5S A;  3JCU H;  2B88 A;  2WSC J;  3VP9 A;  1PV3 A;  5AVV B;  2PGD A;  4H44 D;  2Q3I A;  2BCC E;  4PD4 I;  3H1H D;  1NTK K;  3AEB C;  2IBZ D;  2P67 A;  1UII A;  2E75 C;  2H7H A;  1RE4 A;  1S9K E;  4C7R A;  1FJK A;  3LID A;  2XV5 A;  1FS0 E;  3VN0 A;  5AVX B;  5AW8 B;  1KV4 A;  4H0L C;  1JTH A;  3LW5 J;  2WWW A;  1KOR A;  2ZYG A;  3CWB G;  1PL5 A;  2VRS A;  1CZQ A;  4U3F J;  2WPR A;  5APT A;  2DW3 A;  4ZNC A;  1GZL A;  3TGU E;  1N7S A;  1NTM E;  1BE3 E;  1FZE A;  1DD4 A;  1YBK A;  2YMY A;  5L8R J;  2YXR B;  1LT1 A;  3WUU A;  1T8Z A;  2D2C D;  4GDO A;  3CCE P;  2SPZ A;  2FYU D;  1SQQ D;  3GLM A;  2H8P D;  2HLO A;  3AEC C;  3W68 A;  2D2C B;  3PHL A;  5AVW B;  1LTS C;  1SFC C;  2WPS A;  4IFM A;  2BCC G;  1Q81 Q;  2B87 A;  3CCS P;  2FYU J;  1RY3 A;  1BCC J;  2KIK A;  2K1A A;  2O1J A;  3HE5 B;  3H1L E;  5GTI E;  2QA4 P;  3N7N A;  4IL6 E;  1NU1 E;  1PZQ A;  1L4A D;  1VQN P;  1YJW P;  2E74 B;  4W7Z A;  2GM4 A;  4B86 A;  3RL0 D;  2K9J A;  5KLI C;  3R4Y A;  1SVF A;  3A3Y B;  1L4A B;  2W90 A;  1IK7 A;  3I55 P;  3MGN A;  3RL0 B;  4PD4 H;  4EYY Q;  1OMI A;  4ASW A;  3TGU G;  1NTM G;  1BE3 G;  1NTK E;  1IZN B;  4JPZ B;  4NPD A;  2AXC A;  1L0L D;  1M8O B;  2JEE A;  3A0H E;  2E5Y A;  2Q5U A;  4D6T D;  2J58 A;  2OYH A;  3L74 D;  3Q5S A;  3B5N B;  3N4X A;  3L75 E;  1J1D B;  3L35 A;  1OFC X;  3AEE C;  4D6T J;  2Q6Q A;  3MZW B;  3O8Z A;  1P84 D;  3H1L G;  3SWK A;  1NU1 G;  1X22 A;  4BRY B;  1QGK B;  3CCL P;  1URQ A;  3L37 A;  1M56 D;  2E75 D;  1KZU B;  2KSE A;  1VPC A;  1LGH B;  1TU3 F;  1NAF A;  3AE8 C;  2KNC B;  1LTJ C;  1VF5 C;  3O6Q A;  3Q5P A;  2ZXX A;  2E75 B;  2E76 C;  3V2R A;  3A2A A;  1QVG O;  4UB8 E;  5AW0 B;  2QM7 A;  1D7M A;  1ZME C;  3JCU E;  1ZN5 A;  4I2L C;  1ZR4 A;  5CJ0 A;  2A06 D;  2R3C A;  1CI6 B;  1JY3 O;  1JM0 A;  3R2P A;  1SQX G;  1CSB A;  3HTK B;  2IX7 C;  1VQ6 P;  2HOD B;  3L75 G;  4U3F E;  2OYI C;  3CPW O;  2XZR A;  4XA4 A;  3JSV C;  1R5L A;  2FKW B;  1FZF A;  5CCG D;  2K37 A;  1DIP A;  1W2B O;  1YYC A;  3RK2 C;  1NTZ J;  3ZDM A;  4RES B;  1SFC D;  1VQ8 P;  4OGQ C;  4DCK A;  2L5G B;  4XE5 B;  3HUS A;  3MUD A;  3AE2 C;  2C9L Y;  2WSS H;  1SFC B;  3H1I E;  3OAK A;  3MIW A;  1SQP K;  2KK7 A;  1FOS E;  1S1C X;  3PRJ A;  1J1E C;  3G4S P;  3FGA D;  2KYV A;  4HB1 A;  1KTM A;  1EZV E;  2BCC D;  1Q7Y Q;  2GA1 A;  4HYT B;  2WT7 A;  1FDO A;  1YIJ P;  1VQO P;  3V6I A;  3GHG B;  4DOJ A;  2ZYA A;  2YO2 A;  3AED C;  1VL2 A;  3K5B A;  5KLI B;  4IFF A;  4H44 C;  2HYN A;  4TLF A;  1ZRT E;  4W80 A;  1ZW0 A;  5TJH A;  1HJ0 A;  2I8D A;  2NZ2 A;  2Y0C A;  2Y0D A;  3L73 E;  2N1T D;  4U3F G;  2OYO A;  5E79 H;  2E42 A;  1NTZ K;  3BCC D;  2YXQ B;  1L2P A;  4K35 A;  3CX5 I;  3CXH D;  2N1T B;  4BXL A;  3RK3 C;  1JEK A;  1OX3 A;  2K3R A;  2BEZ F;  2M5A B;  3EWK A;  3GMA A;  3BVH A;  2M3E A;  1MFT A;  1PIX A;  3V4W A;  4BWN A;  5B66 H;  1T3J A;  3CCQ P;  5K5G B;  3G71 P;  1YJN P;  3H1I G;  1USD A;  4PD4 E;  2Q3E A;  2YKQ A;  1JCC A;  3RBX A;  2Z5I A;  2OTJ P;  1K04 A;  2OYI A;  1GL2 C;  1RE3 A;  2AEJ A;  3CCU P;  2IBZ I;  1SLQ A;  1EZV G;  3PJS K;  4JBZ A;  1G1J A;  3V4Q A;  3QH9 A;  4IFD K;  4DJG A;  1SP4 A;  5AW6 B;  1UIX A;  4EI2 A;  3L70 J;  1LT9 A;  2JWD A;  1VF5 D;  1Q86 Q;  4AUW A;  4OH8 B;  2NPS A;  2E76 D;  1HTL C;  3AE5 C;  1LTJ B;  3V2N A;  1OW8 A;  1VF5 B;  3L73 G;  2QJK B;  2KXP B;  5AW2 B;  1EDK A;  2E76 B;  1SQP E;  1EDJ A;  1L4A C;  5CBO A;  3L72 D;  2FXP A;  3BRV B;  1JCD A;  1PP9 E;  1YTZ T;  4L76 A;  3RL0 C;  2XNX A;  1KIL D;  1AVY A;  1SQB D;  1GD2 E;  4OWF A;  3D70 A;  1FBM A;  2FYN C;  3L72 J;  5M1B A;  1SQV D;  3A5T A;  1GDT A;  1H0T B;  1FZG A;  3H1K E;  1KIL B;  1SS1 A;  1BGY D;  3OJA B;  3ITK A;  2QE7 H;  1FDM A;  1USE A;  3HD7 A;  1DEB A;  1SQX D;  5KLV J;  1T2K D;  1EC5 A;  4Z1M H;  2YKP A;  2HFE D;  4L73 A;  3CI9 A;  1ZP0 C;  1J1D C;  2WSC H;  2WQY C;  1NTZ E;  1RF1 A;  2KUB A;  2NRG A;  1M7L A;  1JY2 P;  4EDF A;  1L0N J;  3AE1 C;  3L71 E;  2AXT H;  5CHX A;  3H32 B;  2KLV A;  1BDD A;  3D71 A;  3KZI E;  1AFO A;  3IR9 A;  1J1E B;  3H6P A;  1DH3 A;  1SQP G;  1FU1 A;  3CMA P;  3MHV A;  3Q5R A;  1OXZ A;  1T3U A;  1PP9 G;  2RH0 A;  3LW5 H;  2WVR A;  3HE5 A;  4H44 B;  2QIW A;  5CJ4 A;  2KB7 P;  3H1H J;  3H1K G;  1LWU C;  5KLV K;  3P8C E;  4WWI A;  3RK3 D;  2WSE H;  4PJ0 H;  1OIP A;  1L4A A;  4PV1 D;  1YQ3 C;  1K05 A;  1M1J C;  1P84 I;  3RK3 B;  3VP8 A;  1Q82 Q;  4O9B A;  3C9I A;  1KB9 D;  4WY4 D;  1ZLL A;  1NTZ G;  3F5H A;  1NYH A;  3VTP C;  1L0N K;  1GL2 D;  2FXM A;  4JYB A;  3HE4 B;  4N6J A;  1DEE G;  1KYO D;  5AW9 B;  1U7J A;  3L71 G;  3BRT B;  2WSE J;  5E79 E;  3CC4 P;  3V2P A;  1GL2 B;  2W83 C;  5CCG C;  3U1A A;  1PGJ A;  3H1I D;  4LLH A;  4H13 C;  2BEQ D;  1PPJ D;  5B66 E;  3B5N A;  2O01 N;  2P1J A;  1SQQ J;  3TK1 A;  3SSU A;  2IPP A;  3B71 A;  1H8A A;  1QVF O;  4XFJ A;  1X9V A;  1VQ4 P;  4DZO A;  1FC2 C;  1HUC A;  3V5B A;  1FZC C;  3GHG C;  1Y47 A;  2JKV A;  1G2C B;  1H88 A;  3L73 D;  2G3A A;  2ZAE B;  2R32 A;  2WZ7 A;  5KAF H;  2KNC A;  2M3B A;  2Z5H A;  2KS1 B;  3KHU A;  1Z56 A;  3H1J D;  2FFD C;  1N7S D;  2FYN B;  3KPE A;  1IFN A;  1JY2 N;  2PRR A;  4W7Y A;  5C39 A;  2A45 I;  2KSJ A;  3G6E P;  2N1T C;  1GMJ A;  2P10 A;  5AVQ B;  2K88 A;  3NTN A;  3H1J J;  3VMY A;  1S72 P;  3II6 A;  4K3A A;  5KLV E;  3HTK A;  2FYU K;  1SQQ K;  2O3J A;  2XDJ A;  1VQ7 P;  2V4H A;  4C7N B;  1IO4 A;  1L0L J;  2HOD A;  3V2Q A;  1P84 H;  2KLU A;  5CMZ A;  4ZKP A;  1QL1 A;  3P8M C;  3VMZ A;  2Y9Y A;  4ZMD A;  5KKZ C;  4Y28 J;  3L74 J;  4GOE A;  4JF7 A;  1L0N E;  1LTG C;  1RF0 C;  5CCG A;  3GG2 A;  1HWT C;  5AW7 B;  1GK4 A;  3CX5 E;  1SFC A;  4WB4 A;  3CXH I;  5APU A;  3CC7 P;  1JNM A;  5AVR B;  1SQP D;  2QJK C;  2AXT E;  4A7P A;  2QEX P;  3M0D C;  3TNU A;  1IFD A;  1NTK G;  1LJ2 A;  2H89 C;  1LWU B;  3FXE A;  1KQS O;  1GU4 A;  4GOF A;  2KZI A;  3GHG A;  3CCM P;  2IBZ E;  3PTZ A;  4N78 D;  4WBA A;  1GK6 A;  1N73 C;  3H1K D;  1S3J A;  5KLV G;  1M1J B;  4LC1 A;  2FXO A;  3M9H A;  1KIL C;  3AE6 C;  4HKZ H;  2M8R A;  2JJL A;  3CWB D;  3KZI H;  1AV1 A;  1LTI C;  2MJZ A;  3B4S A;  4L75 A;  1R8E A;  1E79 H;  2WSF J;  2N1T A;  4H13 D;  2CPB A;  3L36 A;  1NVO A;  1KD1 Q;  3NFQ A;  4PJ0 E;  3PH0 A;  2C0X A;  1T2K C;  1S5L H;  1BDC A;  2UWJ E;  1Y9B A;  2JO1 A;  3CCJ P;  1HH0 A;  4H13 B;  1NH4 A;  4I1L A;  2H88 C;  2C0W A;  1VQM P;  2FYU E;  1SQQ E;  5KJ7 C;  5TIS H;  1BCC E;  2IFN A;  3U1C A;  2M0B A;  3W67 A;  1HJB A;  2FY8 A;  1M1K Q;  1HGZ A;  1FZC B;  5AVZ B;  3O6Q B;  1S9K D;  1LNQ A;  1LTT C;  2P58 A;  2IBZ G;  1NAY A;  1PGP A;  4GOD A;  2BCC J;  2IZ1 A;  4YTP C;  1KQG B;  2CK3 H;  1LTJ A;  1WRG A;  2XU6 A;  3AEG C;  5CCH D;  3CCV P;  2FFD B;  1EQ7 A;  1JUN A;  2IYP A;  2L91 A;  4UB6 E;  3TSI A;  3TGU D;  1KQL A;  1NTM D;  1BE3 D;  1X8Y A;  4QMA A;  3A7O A;  4DT0 A;  3VYI A;  2HR3 A;  4ASV A;  2WTY A;  3BCC J;  4PV1 C;  5KAF E;  4AYC A;  2WPV B;  4WY4 C;  1H0T A;  3G9R A;  3USS A;  1DX7 A;  1KIL A;  5APS A;  3TGU J;  1YJ9 P;  1Q2N A;  5DJU B;  3HUS B;  4NPF X;  2N9Y B;  1YTZ I;  1WT6 A;  2FYU G;  4YXW H;  1BCC G;  3M9Q A;  5KKZ B;  2IZ0 A;  1OWA A;  4I6M C;  4D6T E;  5CBN A;  2C9N Y;  3L74 E;  3H1L D;  3GF7 A;  1NU1 D;  2KP8 A;  1MKM A;  1OVU A;  3H32 A;  1P84 E;  3QWO C;  1KB9 I;  4I7Z C;  3PLN A;  2QJY C;  1AQT A;  3P7K A;  1EDI A;  1KYO I;  1LP1 B;  3F89 A;  3AE4 C;  2Y0E A;  2ZJS E;  1NTK D;  3RGU A;  1N73 B;  2O01 J;  1FZA A;  2POH A;  2Z4E A;  2W8Z A;  2V7Q H;  3GF3 A;  1SQB J;  1N7S C;  1OW7 A;  1G1I A;  2A06 E;  2KZJ A;  1SQV J;  3L75 D;  4D6T G;  3WUT A;  1BGY J;  2W6A A;  1OZH A;  3CD6 P;  3CX5 H;  1KFN A;  2RKL A;  3FXD A;  1K73 Q;  1FJP A;  3L74 G;  4OVN F;  1SQX J;  1PFI A;  2QG4 A;  2V7Q J;  2RMZ A;  5H2F E;  3HE4 A;  1N86 A;  5KJ7 D;  1Q90 D;  1YHQ P;  4YPC A;  3VMX A;  2OTK E;  2R5D A;  1K9M Q;  1JMB A;  1NKN A;  4YXD C;  1GL2 A;  2OQQ A;  3VMA A;  1KQF B;  1KC8 Q;  1AVO A;  1KMI Z;  1WMK A;  1S5L E;  1YIT P;  3IFM A;  3SWF A;  1KN7 A;  1HVV A;  2QSI A;  3P32 A;  1AJY A;  5BU8 B;  3EFG A;  1SQB K;  2OGU A;  5TIS E;  2IDB A;  1A02 J;  3KDP B;  3HD7 D;  1SQV K;  2R44 A;  5KTB A;  2HPC B;  2A06 G;  1T6A A;  1KB9 H;  5AVU B;  1G2C A;  1KFM A;  4U3F D;  3S9O A;  1S4X A;  1SQX K;  3HD7 B;  1EXI A;  1E5W A;  2WIT A;  1KYO H;  5DJT B;  4ZKU A;  3OW2 O;  2KS1 A;  4PV1 B;  2W6J H;  2OYH C;  3AE7 C;  5APX A;  4L74 A;  3BCC E;  3HRN A;  4WY4 B;  4EIJ A;  3T97 B;  1ZR2 A;  1JOC A;  1RF1 B;  3CXH E;  3WU2 H;  1IFP A;  3M9B A;  1XTC C;  5B5E H;  2WPQ A;  1JY2 O;  3C8V A;  1NJI Q;  2QJP C;  4M3L A;  1VQ9 P;  3OA7 A;  5BU5 A;  5GTH H;  1MV8 A;  2A45 G;  1IFM A;  2KI7 B;  3A0B E;  1XTG B;  4C7N A;  1FDI A;  4LGD E;  1NOH A;  2OAR A;  1EZV D;  2R3S A;  1BCC D;  5AVT B;  3E1I A;  3H1I J;  1URQ C;  3MP7 B;  3RBZ A;  1RHZ B;  3L70 E;  5EFW B;  2YIU C;  5APQ A;  1BSH A;  2IYO A;  3TYY A;  4UB6 H;  4Y99 B;  2PAJ A;  3I5C A;  3BAT A;  4BRY A;  1RQU A;  1JMM A;  2E74 D;  4GKG A;  1ZRT D;  3GW6 A;  4I7Z B;  4GIF A;  4KJM A;  2QJY B;  4GT1 A;  3IF4 A;  3AEF C;  2E5T A;  2I1J A;  1JTH B;  2YMK A;  4IOI H;  2G8Y A;  3SWY A;  3L73 J;  1PGO A;  3BCC G;  3S4R A;  1W5C E;  3L72 E;  2ZYD A;  1LWU A;  3SFD C;  5CCH C;  1YQ4 C;  2ZVN B;  1N7S B;  3E1R A;  1IC2 A;  4TT3 H;  1AA0 A;  2LXC B;  2ZT9 D;  3CC2 P;  1CI6 A;  1KIL E;  1SQB E;  1U57 A;  4PD4 D;  1JY3 P;  4JYC A;  1RH5 B;  3D6Z A;  1M1J A;  3PP5 A;  1SQV E;  3L4F A;  4KT0 J;  3TDK A;  2ZT9 B;  2W27 A;  3B5N D;  1EDL A;  1BGY E;  2Y9Z A;  2N9B A;  3HUS C;  3MUD C;  5AW3 B;  1SQX E;  1QLE D;  1NO4 A;  3L70 G;  3M91 A;  4U7J A;  3AEA C;  2B87 B;  1VQ5 P;  1ZXG A;  3KYQ A;  2XKM A;  2ZXE B;  1GTW A;  1MUU A;  1Y8A A;  5BVZ A;  1M57 D;  3H25 A;  1BSN A;  3I56 P;  4HJG H;  1VQL P;  2YKO A;  1GU5 A;  4KHX A;  2K9J B;  2LR2 A;  2IFM A;  2E43 A;  1S5L X;  1NHL A;  1ZOY C;  1PP9 D;  2QVA A;  2RN0 A;  2YNY A;  2B9B A;  2R5B A;  3WMM 0;  2J59 M;  3FX0 A;  3L72 G;  3FWL A;  4HH2 A;  1FZC A;  1SQP J;  3H1H E;  3CL3 D;  1MZ9 A;  2ZFC A;  4H0L D;  3ABV C;  1SQB G;  4NPE A;  1PP9 J;  2WSF H;  1L0L K;  5H2F H;  1SQV G;  2BAS A;  2AEF A;  2P2U A;  4H0L B;  1BGY G;  3H1K J;  3RK3 E;  2ITA A;  1VQP P;  1JB0 J;  2OYH B;  5KAI H;  2FFD A;  3JC2 2;  1EXJ A;  2QM8 A;  2PFX A;  3M06 A;  1H89 A;  1NTZ D;  1W2E A;  1CW5 A;  1JO5 A;  1L0N G;  3NMD A;  4EOT A;  2MKV A;  3AE3 C;  3U59 A;  1RE3 C;  2A45 H;  3MTU E;  2QRX A;  2M5A A;  3CWB J;  5CCH A;  4R4M A;  3L71 D;  1KB9 E;  2QJP B;  3Q2Y A;  1RQV A;  1MFZ A;  1OW6 A;  2YO3 A;  1URQ D;  3CME P;  1PGQ A;  1KYO E;  3LIE A;  4R4L A;  4JQ0 D;  1X79 B;  1VQK P;  1LT9 C;  4RKU J;  2GUV A;  3L71 J;  1URQ B;  1NWQ A; 
#chains in the Genus database with same CATH homology
 3BAS A;  1GW4 A;  2NPS C;  2OYH A;  1L4A A;  1ZV8 A;  2KOG A;  1M1J C;  3P7K A;  3B5N B;  3N4X A;  3RK3 B;  1J1D B;  5APW A;  3VP8 A;  2P7J A;  3L35 A;  4O9B A;  3C9I A;  4WY4 D;  1ZLL A;  3VTP C;  1VDF A;  1RF0 A;  1L0N K;  3TNU B;  1GL2 D;  2FXM A;  4JYB A;  3HE4 B;  4N6J A;  1N73 B;  1FZA A;  2POH A;  3O8Z A;  2Z4E A;  5AW9 B;  3BRT B;  1JY3 N;  3P8C D;  3V2P A;  1GL2 B;  5CCG C;  4AQR D;  3U1A A;  1N7S C;  1URQ A;  3L37 A;  1IK9 A;  1G1I A;  3M0D A;  1LTB C;  4LLH A;  1KZU B;  5APY A;  1VPC A;  1FZB A;  1LGH B;  1NAF A;  2W6A A;  1LTJ C;  3B5N A;  1KFN A;  3HD7 C;  2P1J A;  5AW4 B;  1FJP A;  3TK1 A;  1PFI A;  2IPP A;  3G3Z A;  2HG5 D;  1H8A A;  3V2R A;  3HE4 A;  3A2A A;  1N73 A;  1X9V A;  1N86 A;  5KJ7 D;  4DZO A;  5AW0 B;  1N7L A;  2I1K A;  2QM7 A;  3VMX A;  1HUC A;  1ZN5 A;  3V5B A;  2R5D A;  3CLQ A;  1RF1 C;  1FZC C;  1NKN A;  4I2L C;  1ZR4 A;  5CJ0 A;  3GHG C;  1GL2 A;  2R3C A;  1CI6 B;  1JY3 O;  3R2P A;  1N2D C;  1G2C B;  1H88 A;  1CSB A;  3HTK B;  3VOP A;  1J2J B;  2IX7 C;  2Q9I A;  2R32 A;  2WZ7 A;  2HOD B;  2OYI C;  2FYZ A;  3IFM A;  2M3B A;  1FAV A;  2XZR A;  2Z5H A;  3SWF A;  4XA4 A;  2FKW B;  1FZF A;  1Z56 A;  5CCG D;  2FFD C;  1N7S D;  1HVV A;  5AVY B;  5AVS B;  3KPE A;  3P32 A;  1IFN A;  1YYC A;  5AW1 B;  2WT7 B;  1JY2 N;  5BU8 B;  3RK2 C;  4W7Y A;  3NXS A;  3EFG A;  1SQB K;  2A45 I;  1IJD B;  2KSJ A;  2N1T C;  1IFJ A;  4RES B;  1SFC D;  2W6B A;  2H43 A;  4Y99 C;  2L5G B;  2O01 H;  4XE5 B;  2LKM A;  2GUS A;  1A02 J;  3KDP B;  3HD7 D;  5AVQ B;  3NTN A;  1SQV K;  1RE4 C;  3HUS A;  3MUD A;  3VMY A;  5KTB A;  2C9L Y;  5KJ7 A;  2HPC B;  3II6 A;  3MD0 A;  1SFC B;  3OAK A;  5AVU B;  1G2C A;  3MIW A;  3B8E B;  1KFM A;  3HTK A;  2FYU K;  1SQQ K;  2XDJ A;  1SQX K;  4C46 A;  1SQP K;  1A02 F;  4C7N B;  1IFI A;  2CPS A;  3HD7 B;  1IO4 A;  1FOS E;  2HOD A;  3V2Q A;  1E5W A;  5CMZ A;  2WIT A;  4ZKP A;  1QL1 A;  3P8M C;  3VMZ A;  2O1K A;  4ZKU A;  1J1E C;  2KYV A;  2OYH C;  5APX A;  4HYT B;  2WT7 A;  1NTM K;  4JF7 A;  3HRN A;  4WY4 B;  4EIJ A;  1LTA C;  1ZR2 A;  1JOC A;  1LTG C;  1RF1 B;  1AQ5 A;  3GHG B;  1RF0 C;  3M9B A;  4DOJ A;  1HBW A;  1XTC C;  2WPQ A;  5CCG A;  1JY2 O;  2YO2 A;  1QL2 A;  4IFF A;  4M3L A;  1HWT C;  5AW7 B;  2HYN A;  3OA7 A;  5BU5 A;  5APV A;  2HPC A;  1GK4 A;  4N78 E;  1MV8 A;  3M0A A;  4W80 A;  1SFC A;  1GW3 A;  4WB4 A;  2A45 G;  1IFM A;  3RK2 D;  1XTG B;  4C7N A;  2OYI B;  4LGD E;  5APU A;  2N1T D;  1NOH A;  2OAR A;  1JNM A;  5AVT B;  1NKZ B;  5AVR B;  3E1I A;  1URQ C;  2E42 A;  3EQ2 A;  3M0D C;  1NTZ K;  3TNU A;  3UIA A;  1IFD A;  2PP6 A;  3RK2 B;  3KQG A;  2NPS D;  2Q7C A;  1HGV A;  2N1T B;  5APQ A;  3TYY A;  4WY4 A;  3B5N C;  1LWU B;  3T97 A;  3RK3 C;  4Y99 B;  2PAJ A;  1LT9 B;  3BVH A;  1GU4 A;  3I5C A;  1NU1 K;  3BAT A;  5AW5 B;  3GHG A;  3V4W A;  1JMM A;  1FOS F;  1T3J A;  4N78 D;  4GKG A;  1GK6 A;  4WBA A;  2NPS B;  1N73 C;  4GIF A;  1M1J B;  4GT1 A;  4LC1 A;  3M9H A;  1KIL C;  2YKQ A;  1JCC A;  2I1J A;  4N3Y B;  2Z5I A;  2OYI A;  1JTH B;  1GL2 C;  1RE3 A;  2M8R A;  2JJL A;  1LTI C;  2MJZ A;  1SLQ A;  3VP9 A;  3SWY A;  5AVV B;  2Q3I A;  1G1J A;  3V4Q A;  1NTK K;  2N1T A;  4IFD K;  2P67 A;  1LWU A;  1SP4 A;  2CPB A;  5AW6 B;  3L36 A;  5CCH C;  3NFQ A;  1LT9 A;  1N7S B;  2C0X A;  1IC2 A;  1T2K C;  2H7H A;  1CI6 A;  1RE4 A;  1S9K E;  4AUW A;  4C7R A;  4OH8 B;  1FJK A;  2NPS A;  1JY3 P;  4JYC A;  3LID A;  2XV5 A;  1HH0 A;  1HTL C;  3VN0 A;  1M1J A;  3PP5 A;  1LTJ B;  3V2N A;  1NH4 A;  3L4F A;  5AVX B;  5AW8 B;  4I1L A;  2W27 A;  3B5N D;  2C0W A;  1JTH A;  2N9B A;  3HUS C;  5AW2 B;  5AW3 B;  5KJ7 C;  3U1C A;  2IFN A;  2WWW A;  1NO4 A;  3M91 A;  2VRS A;  1L4A C;  1CZQ A;  1HJB A;  3BRV B;  1JCD A;  1HGZ A;  1YTZ T;  2WPR A;  1FZC B;  5APT A;  3RL0 C;  5AVZ B;  2XNX A;  1KIL D;  1S9K D;  3KYQ A;  2XKM A;  1LTT C;  1GD2 E;  2ZXE B;  1GZL A;  1GTW A;  1MUU A;  1N7S A;  1FBM A;  5BVZ A;  1FZE A;  2YMY A;  3A5T A;  1GDT A;  1FZG A;  1T8Z A;  1KIL B;  2YKO A;  1GU5 A;  3OJA B;  1LTJ A;  4KHX A;  1FDM A;  3HD7 A;  1DEB A;  1WRG A;  2H8P D;  2IFM A;  2XU6 A;  2E43 A;  5CCH D;  2HLO A;  1NHL A;  2FFD B;  1EQ7 A;  1JUN A;  1T2K D;  5AVW B;  1LTS C;  1SFC C;  2YKP A;  2HFE D;  2YNY A;  2WPS A;  4IFM A;  2R5B A;  3WMM 0;  2J59 M;  3CI9 A;  1J1D C;  2WSC H;  3TSI A;  1KQL A;  4HH2 A;  1RY3 A;  1RF1 A;  1FZC A;  1X8Y A;  3A7O A;  1M7L A;  3CL3 D;  3VYI A;  1MZ9 A;  2O1J A;  2ZFC A;  3HE5 B;  2WTY A;  1JY2 P;  2WSF H;  5CHX A;  3H32 B;  3N7N A;  4AYC A;  2KLV A;  1L0L K;  4WY4 C;  1L4A D;  1DX7 A;  1KIL A;  5APS A;  1AFO A;  2BAS A;  2P2U A;  3IR9 A;  4W7Z A;  2GM4 A;  4B86 A;  3HUS B;  1J1E B;  3RL0 D;  3H6P A;  1DH3 A;  1YTZ I;  1WT6 A;  1SVF A;  3A3Y B;  1FU1 A;  3M9Q A;  2OYH B;  1L4A B;  2FFD A;  1OWA A;  4I6M C;  2QM8 A;  1OXZ A;  1T3U A;  3M06 A;  3MGN A;  1H89 A;  1W2E A;  1CW5 A;  1JO5 A;  3NMD A;  4EOT A;  3LW5 H;  3RL0 B;  2C9N Y;  3U59 A;  1RE3 C;  2A45 H;  3MTU E;  5CCH A;  1MFZ A;  3HE5 A;  2YO3 A;  2KP8 A;  1URQ D;  5CJ4 A;  3H32 A;  2KB7 P;  3LIE A;  1LWU C;  5KLV K;  1X79 B;  3P8C E;  2JEE A;  1LT9 C;  3RK3 D;  2GUV A;  2Q5U A;  1URQ B;  1NWQ A;  2WSE H;  2J58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...