1FZAA

Crystal structure of fibrinogen fragment d
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
85
structure length
85
Chain Sequence
b'VSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRINOGEN
publication title Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 30
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzaA00
1FZBA 1FZAA 1N73A 3BVHA 1RF1B 2OYIB 1JY3P 2FFDA 3H32A 3HUSB 1LT9C 1M1JA 1JY3N 1FZFA 1JY2P 3GHGA 2OYHA 1N73B 2FFDB 1RE4A 1RF0C 1RE3A 2A45I 1LWUA 3H32B 2XNXA 1JY2N 1M1JB 1FZCA 2OYIC 1T3UA 1RF1C 1LTJA 3GHGB 2OYHB 2A45H 3E1IA 3HUSC 1LWUB 1FZCB 1LT9A 1N73C 2Q9IA 1LTJB 1JY3O 2FFDC 2H43A 1M1JC 2HODA 1W2EA 2HPCA 1FZEA 1LT9B 1RF0A 1JY2O 2A45G 2OYHC 2OYIA 3GHGC 1RE3C 2HLOA 1LWUC 1RE4C 1RF1A 1N86A 2HODB 2HPCB 3HUSA 1FZGA 1FZCC 1LTJC 2Z4EA
chains in the Genus database with same CATH superfamily
3RK2B 1BE3D 3H1JJ 2QJYB 3CLQA 1YJWP 3L73E 2BEZF 1W5CE 3IF4A 1SQBE 1DX7A 1MUUA 1PV3A 1LTJB 1SQPJ 3E1RA 5KKZC 1KORA 2LXBA 2ZYGA 3C8VA 2KZIA 2FXMA 4HYTB 1JOCA 2ITAA 1P84D 1DH3A 3KHUA 3Q5RA 2YMKA 4UB6E 1FZAA 1NTKG 3BCCG 1OW7A 3IN6A 2Y0EA 5CBNA 4PV1D 1FZEA 3BCCJ 5GTHE 2BCCG 2Q3EA 3CMAP 2GUVA 4WY4C 3VMYA 2AXTE 3O6QA 2WSFH 2YNYA 3A2AA 1IFMA 1Q81Q 1Z56A 1N73C 3LIEA 4PD4H 4HKZH 3CWBD 3CXHI 2O01J 1J1EB 2E74B 3FGAD 1LTGC 3HE5A 3A0HH 3AE5C 3AEAC 1RF1B 1LT1A 1JY2P 2J5UA 1EDLA 5KLVD 4EI2A 4C7NA 3PJSK 1GK4A 3H1LE 4YPCA 4EDFA 1PL5A 3H1HJ 1K05A 1KTMA 2D2CD 2ZVNB 3WMM0 2YKOA 3LW5J 2A06E 2K88A 1NU1D 2KS1A 2OYHB 3KXDA 1KILB 5APWA 3P32A 3AEDC 2HR3A 2LKMA 3TSIA 3RL0C 1N86A 3H1JE 1ZLLA 2FYNC 3TDKA 1G1JA 1FZCA 1YQ3C 1SQPE 1K73Q 1K04A 1BGYJ 5AVYB 3L71G 1GZLA 1JY2O 2W27A 1LTSC 1IFJA 2PFXA 2OARA 1N7SC 2OTKE 3N7NA 1MFTA 1X8YA 3G9RA 2WITA 3CXHD 1JO5A 1H89A 2E76C 2N1TB 5B5EH 1NOHA 1URQB 1HVVA 1VF5D 3GMAA 3L70D 1MV8A 4HH2A 2CPSA 3OAKA 5CMZA 2M5AA 1BCCG 4GODA 1HJ0A 4YXDC 3MUDA 2JKVA 2R5DA 1URQA 4L76A 1ZN5A 2H8PD 3U1CA 1L0LJ 3KDPB 4YXWH 1L4AA 1QEXA 2IPPA 1BCCJ 1SQXJ 3G4SP 3JSVC 4AQRD 3CCVP 2WSEJ 5AW4B 5AVUB 2QE7H 1OX3A 4CPGA 1L0NG 1KC8Q 1H88A 2Y9YA 3CPWO 4N78D 4UB8H 1UIXA 4ZMDA 2WSCH 1L0NJ 1RE4A 1BE3G 4H44D 2O3JA 3RK2C 2YO3A 1EZVI 2V7QH 2P67A 1PGQA 3H1HE 3CX5D 1BE3J 3B5NA 1ZV8A 2HPCB 3HUSA 1JUNA 1YJ9P 2FFDA 1EDJA 3AE1C 3H1KD 3NXSA 2GM4A 3QH9A 1EXJA 4JF7A 3JCUH 5AW2B 3SFEC 1NTZE 2WSSH 2RMZA 4M3LA 1CI6B 1SQBK 3H1IE 2SPZA 3TGUD 1JY3P 3H32A 1E79H 1HJBA 2KOGA 1EDIA 2QIWA 3I5CA 1BGYE 3AEFC 2ZXEB 4PD4I 3VMXA 3AE8C 1SQVD 3L75D 1KILE 3RBZA 3BASA 2KK7A 2KUBA 3CWBG 3SWYA 4UB6H 1N73B 1KYOE 1QX8A 2NPSC 3GHGB 1Q86Q 5AW5B 4WY4A 1ZP0C 2CPBA 5KJ7C 1K9MQ 2C9NY 1J1EC 3V2QA 3HTKB 1YIJP 3IFMA 2E74C 4H13D 2I8DA 2FYUD 1RF0C 1ZR2A 1L0LE 1Q90D 3KYQA 3HTKA 1OW8A 2Q7CA 4RJTA 1JY3O 1OXZA 5KLVG 1LT9B 1R8EA 1SQXE 1EZVD 1LWUC 1BSNA 3HD7D 1GK6A 2PRRA 2I1KA 3ZDMA 3RK3C 5KLVJ 1IK7A 3RBXA 3CL3D 4GKGA 3HE4A 3IAOA 3L72E 4BXLA 1NU1G 2LR2A 4BRYB 5BVZA 2NRGA 4R4LA 1NGMB 1G1IA 2NZ2A 3D70A 1NO4A 1RH5B 1YQ4C 2Q6QA 1KILC 1RQUA 1GL2C 3CCSP 4I1LA 1ZW0A 1NU1J 1H8AA 1U7JA 1M57D 2P1JA 4OH8B 1PP9J 1HH0A 1FBMA 2FYNB 3AE7C 2A45G 1NKZB 4PD4D 5APVA 3Q2YA 1NH4A 1YBKA 1VL2A 2KNCA 4HJGH 2POHA 3QWOC 2ZT9C 3P7KA 5CCGA 1P84I 2M8RA 1N7SB 2PAJA 4H0LD 1RE3C 1SQPK 1M8OB 3AE2C 3T97B 2XNDH 1N2DC 2YIUC 2JWAA 3L70G 1NTMJ 3P8MC 2E75D 2E76B 1FS0E 3KZIE 1QL2A 1S3JA 3L70J 4TLFA 4UB8E 4K3AA 4IFFA 2HODB 1PPJD 5TISH 1LP1A 4D6TD 3I56P 2KIKA 1EXIA 4JBZA 3MHVA 1SFCB 5H2FE 3L74J 4NPFX 2G3AA 4LC1A 3V2RA 3A0BE 1GU4A 4I6MC 2B9BA 4PJ0E 4WVZA 2WTYA 1FOSF 1AV1A 2GUSA 1UIIA 1L4AD 2B87B 4DJGA 1KQGB 2C0XA 3S4RA 1IFIA 3A7OA 4PV1C 2Y0CA 5AVVB 2O01H 3MGNA 2P2UA 2ZYDA 3H1KG 1A02F 1N8RQ 3AEBC 1M1JC 2WQYC 4W7ZA 4BWNA 3H1KJ 1IJDB 1D7MA 2IBZE 3UIAA 2E43A 2KSEA 3TGUG 3AE6C 3CCMP 1XTCC 1PP9E 1LTJA 4WB4A 2KZJA 2W83C 1PGPA 1NTKJ 3B5ND 1SQVG 3WU2H 1OMIA 2DW3A 3SFDC 3L75G 1NTZK 3N4XA 1SQQE 3LW5H 2UWJE 2A45I 1PGJA 2BCCJ 1H0TB 4IL6X 3C1LA 1EQ7A 1VQ5P 3L75J 5B66E 3JC22 2H7HA 3B4SA 3VTPC 1HGVA 3GHGC 3VP8A 3PHLA 3U1AA 2ZXXA 1NTME 2NPSB 1YYCA 1USEA 1GW3A 1NAFA 2QVAA 2XV5A 2FYUG 3R2PA 3HRNA 3F89A 2NPSA 3V4QA 4O9BA 4U3FE 2R3CA 1JB0J 1JEKA 1EZVG 1LTTC 5KJ7A 1AA0A 1LT9C 2KYVA 5CHXA 2W90A 3L74E 1NVOA 1LWUB 1KYOH 4WY4D 2JEEA 3GG2A 1L0LK 1RF1A 3RK3B 3K5BA 1U7MA 2WT7B 2JWDA 2OQQA 1R5LA 1SQXK 1LNQA 2QA4P 4IFMA 1KB9E 3C9IA 1JTHB 3MZWB 1PFIA 1EC5A 1JM0A 1GW4A 5E79H 5EFWB 1GL2B 3U59A 3PLNA 3L73D 2WT7A 5AVWB 2Y9ZA 1SQBD 3M0DC 3CC2P 1NKNA 5AW8B 4ASVA 1NTZG 5TJHA 4L73A 2OYHA 1KILA 3RL0g 1GL2A 1VF5C 4OGQB 5AVSB 1JNMA 2XKMA 2IYPA 3A5TA 3H1IG 3CX5I 2JO1A 4KT0J 2XZRA 1VQ4P 5TISE 2WPRA 1J1DB 2ZT9B 1S9KE 1M1KQ 2W6JH 1DIPA 4R4MA 3L71J 3M9BA 2KSJA 2XDJA 3W68A 3D71A 1NTKE 2K1AA 3BCCE 4LGDE 2CK3H 2YIUB 3D6YA 2G8YA 1QL1A 2E42A 1ZRTE 2BEQD 1PPJG 2QJKC 2BCCE 3RL0D 4D6TG 4TT3H 3NMDA 5CCGD 2N1TA 3M91A 3L35A 4GOEA 1KQSO 4D6TJ 1SFCC 4W7YA 5CCHD 4H44C 2M0BA 1VQ7P 3P8CE 4DOJA 5APYA 4L74A 1BDCA 1FAVA 1M7LA 2QSIA 5APQA 1DEEG 4YTPC 1RHZB 2P58A 3KZIH 1VQ8P 1S5LX 2KLVA 3H1LD 1M90Q 1DD4A 3PRJA 1HWTC 2A06D 2K9YA 2Q9IA 3WU2E 5H2FH 3GLMA 4WWIA 2BASA 4PV1B 2QRXA 2N9YB 1NJIQ 3A0BH 4PJ0H 2J58A 1PIXA 1M1JB 3H1JD 5KAFE 5AW6B 5L8RJ 2HPCA 2RH0A 2ZFCA 2KLUA 4JYBA 1SQPD 2C9LY 4MN4C 3ITKA 4EYYQ 1L2PA 5DJUB 1XTGB 1VQ6P 3RK3E 3EQ2A 1HGZA 4RO0A 1S72P 4WBAA 4U7JA 1IC2A 1X9VA 1FDOA 1WRGA 1CI6A 3A3YB 1Q7YQ 1IZNB 4RESB 3RK2D 1GD2E 1ZMEC 3SWFA 3L71E 4RKUJ 4IL6H 3HD7C 2K3RA 1SQQK 3CWBJ 5BU8B 5KLIC 2WSCJ 1R5SA 3Q5PA 1N73A 3GHGA 2D2CB 3USSA 3BRVB 3OJAB 1NAYA 5E79E 2V7QJ 3TNUB 1NTMK 2R5BA 5AVTB 1A02J 3PP5A 1YTZT 5B66H 1BCCE 4KHXA 1Y8AA 1AFOA 1QLED 4W80A 1FZBA 3I55P 1OWAA 1GDTA 3L4FA 2IFNA 3CXHH 4ZKPA 4I7ZB 3E7KA 1AQ5A 1LT9A 2KXPB 1LTIC 2RKLA 2FXPA 4N6JA 3L73G 3IR9A 1Y9BA 1L0NE 3H1HD 1SQBG 3M06A 4JQ0D 4H0LC 4BRYA 2E74D 3V2PA 1WMKA 5CJ4A 1PGOA 1SQBJ 1BE3E 5AVXB 4OGQC 2W6BA 1IFNA 2YKPA 1SS1A 3MTUE 1NTZD 3MD0A 1VF5B 5K5GB 3MIWA 4NPEA 1J1DC 2MKVA 1AVOA 1SVFA 4XE5B 3H1ID 3EFFK 3M0DA 1IFDA 2YXRB 1VQPP 1RQVA 1P84E 2JP3A 1KB9H 4EIJA 2ZJSE 3II6A 1BGYD 2N9BA 1YJNP 1FZGA 2Q1KA 1KFNA 1X79B 1T2KD 1KILD 3E1IA 1N7SA 5APUA 1KYOD 2RN0A 1VQKP 2HFED 3MP7B 4IOIH 3T97A 2QJKB 1HBWA 2AXCA 1BDDA 1NTKK 3MUDC 3M0AA 3CC4P 1VQOP 1CSBA 3GF7A 3CWBE 4H44B 1G2CB 1OIPA 2HODA 2PGDA 3AEEC 1L0LD 2O01N 3BVHA 2GA1A 3Q1MA 1SQXD 2K37A 1LJ2A 1SFCA 3SWKA 3H1LG 1VQ9P 2JJLA 4HB1A 2K9JB 2N1TD 1LTBC 1URQD 5AW1B 2J59M 2A06G 3L72D 5KTBA 3H1LJ 2R3SA 3O8ZA 1FU1A 4GOFA 1W2BO 2L91A 3RGUA 1GMJA 4OVNF 5KLVE 3B5NC 3CCEP 2V4HA 3H1JG 2B87A 1MKMA 1JMBA 1WT6A 2IFMA 4K35A 3VOPA 1NYHA 1NU1E 1FDIA 1AQTA 1SQPG 5APTA 4A7PA 4IL6E 3VMZA 5BU5A 1VQNP 2QEXP 2H89C 3EWKA 2YXQB 1DD3A 4DZOA 2MJZA 5GTIE 3G6EP 2ZVOB 3TGUJ 1USDA 2IX7C 4GDOA 2Y0DA 2IBZI 1JY3N 4H13B 5AW9B 1SQVJ 3O6QB 2FBWC 1CW5A 2ZYAA 3OW2O 5KAFH 1DEBA 1T8ZA 2XU6A 1SP4A 4KJMA 2FY8A 3V5BA 1OVVA 3CI9A 3AE4C 1VPCA 1QVGO 3CXHE 3HD7B 3AEGC 2OTJP 1H0TA 3VYIA 2R44A 4AYCA 2OYIC 5KLIB 1IO4A 3L70E 1U57A 2D2CC 3BRTB 1HTLC 3WUVA 3HD7A 3HE5B 2FYUJ 2I1JA 2KB7P 1AVYA 2QJPC 3G71P 3V2NA 4C7NB 4I7ZC 1RF0A 3FXEA 5AW0B 2FXOA 2E5YA 3H6PA 1N7LA 3AE9C 4Y99B 1QVFO 2AEJA 1JCCA 2P10A 1FE6A 3H1HG 1LWUA 2OTLP 2KS1B 3G3ZA 4GIFA 4N78E 2IYOA 4H0LB 1E5WA 5DJTB 1JTHA 2QM7A 2WSFJ 2IBZD 1IFPA 2WSEH 3NTNA 2E75B 3CX5E 4ZNCA 1L0NK 1KB9I 1FZCB 2P7JA 1KQFB 1NTZJ 4I2LC 3WUTA 1PP9D 2O1KA 3H1KE 5CCGC 2B89A 2E5TA 1BGYG 1KV4A 3H1IJ 1M56D 4C7RA 5KAIH 2W8ZA 1T6AA 5CCHC 2JDIH 3FXDA 2WZ7A 1SQQD 1LTAC 3TGUE 4B86A 3H25A 2LXCB 3WUUA 1SLQA 5AVQB 3AECC 2YMYA 2QM8A 3L36A 1RE3A 1SQVE 3W67A 2HYNA 2WPQA 1NTMD 3L75E 2M5AB 1ZXGA 1S4XA 3GW6A 2KI7B 2H43A 1OVUA 3EFGA 1S5LE 3VMAA 3M9QA 4XA4A 4Y28J 1P84H 3BATA 1L4AB 2HG5D 5CBOA 1L0LG 4DT0A 1FZFA 1KQLA 4U3FD 4XFJA 1SQXG 2Q5UA 4GT1A 2AEMA 3CCJP 1N7SD 3L74D 1K8AQ 3B8EB 2FYUE 3R4YA 3L72G 2E76D 3CMEP 1KMIZ 2Z5IA 1EZVE 3KQGA 3L72J 3GF3A 1KB9D 2R32A 1HUCA 3B5NB 3CCLP 3FX0A 3HUSB 1Q82Q 1OZHA 1SFCD 2FFDB 2B88A 3FWLA 1S2EA 5KLVK 1HF9A 2QJYC 1MFZA 5APSA 3Q3DA 1MZ9A 1S1CX 2IDBA 1LTJC 2WMMA 1NWQA 4OWFA 1M1JA 4Z1MH 1NU1K 3H32B 5KKZB 2WWWA 1S9KD 1T3UA 3ABVC 4PD4E 2ZAEB 1ZR4A 4H13C 3TK1A 1GU5A 1YI2P 1NTKD 1FJKA 3BCCD 1NHLA 2W6AA 1ZRTD 3TF5A 1KZUB 2AEFA 4QMAA 3PTZA 1OFCX 2BCCD 3A0HE 1X22A 2OYOA 3S9OA 4WY4B 1CZQA 1KFMA 3S1KA 5GTIH 2OYIB 4AUWA 3OA7A 3FWNA 2JR8A 3V4WA 1KYOI 2A45H 5CJ0A 1PPJE 3NFQA 3P8CD 2YO2A 4D6TE 3LIDA 4EOTA 2OYIA 2FYZA 2HLOA 5GTHH 2H88C 1GTWA 1X0TA 2Z4EA 3CCRP 1FJPA 2QJPB 1QGKB 1KD1Q 1FC2C 3TNUA 5AVRB 3KPEA 2O1JA 1JY2N 5AW7B 1ZOYC 1RF1C 2AXTH 2Q3IA 4Y99C 4ASWA 3CCUP 3HE4B 2WPSA 1W2EA 5AW3B 3CC7P 1EDKA 1FDMA 2NPSD 4IFDK 1PZQA 5KJ7D 5KAIE 3L37A 2WPVB 1YTZI 2XNXA 2L5GB 2Z5HA 3D6ZA 3L73J 3B71A 2IBZG 1YHQP 4LLHA 2OYHC 1T2KC 2E75C 2M3EA 3Q5SA 1FZCC 1LGHB 2VRSA 1PP9G 1OW6A 1Y47A 2OGUA 2KNCB 1OVRA 5B5EE 1YITP 3RL0B 4JYCA 3VN0A 1KN7A 5M1BA 3RK3D 1SQQG 2IZ0A 3CD6P 1TU3F 1VQLP 2PP6A 1SQQJ 1JMMA 1GL2D 1AJYA 5C39A 4DCKA 3L71D 1Q2NA 1NTMG 3CCQP 3CX5H 2WVRA 5CCHA 1JCDA 2KP8A 3SSUA 2N1TC 4C46A 4N3YB 1URQC 2QG4A 4OGQD 1LP1B 1L4AC 1FOSE 3F5HA 4U3FG 3TYYA 1SQVK 2ZT9D 3L74G 4U3FJ 1BCCD 3VP9A 4NPDA 4JPZB 1G2CA 2FKWB 2C0WA 3AE3C 1T3JA 4ZKUA 1RE4C 1S5LH 2IZ1A 5AVZB 1BSHA 2K9JA 2FYUK 3JCUE 3V6IA 1VQMP 1L0ND 1VDFA 1J2JB 3HUSC 5APXA 4L75A 2FFDC 2YKQA 3M9HA 1RY3A 2M3BA 1IK9A 3PH0A
chains in the Genus database with same CATH topology
3RK2B 1JTHA 2QM7A 1H8AA 2J58A 3CLQA 1M1JB 2WSEH 3NTNA 2P1JA 1L0NK 4OH8B 1FZCB 5AW6B 1DX7A 1MUUA 1LTJB 2P7JA 1HH0A 2HPCA 1FBMA 2ZFCA 4I2LC 2A45G 2O1KA 1NKZB 4JYBA 2C9LY 2FXMA 4HYTB 1JOCA 5CCGC 5APVA 1DH3A 1NH4A 1FZAA 1XTGB 2POHA 3P7KA 3EQ2A 1HGZA 4C7RA 5CCGA 5CCHC 4WBAA 2WZ7A 1IC2A 1X9VA 1LTAC 1WRGA 2M8RA 1CI6A 1FZEA 1N7SB 2PAJA 3A3YB 4B86A 1RE3C 1SQPK 4RESB 3RK2D 1GD2E 1SLQA 5AVQB 3SWFA 1N2DC 2GUVA 2YMYA 4WY4C 3VMYA 2QM8A 3P8MC 3L36A 1RE3A 2HYNA 2WPQA 2WSFH 3A2AA 2YNYA 1IFMA 3HD7C 1QL2A 1Z56A 1N73C 3LIEA 1SQQK 2H43A 3EFGA 5BU8B 3M9QA 4XA4A 4IFFA 2HODB 1L4AB 3BATA 2HG5D 1N73A 1FZFA 1KQLA 3GHGA 3BRVB 3OJAB 1J1EB 2Q5UA 4GT1A 1NTMK 1SFCB 3TNUB 2R5BA 1N7SD 5AVTB 1LTGC 4LC1A 3V2RA 3HE5A 1A02J 1GU4A 3PP5A 3B8EB 1YTZT 4I6MC 4KHXA 1AFOA 4W80A 1FZBA 2WTYA 1OWAA 1RF1B 1GDTA 3L4FA 1FOSF 1JY2P 2IFNA 4ZKPA 2Z5IA 1AQ5A 4C7NA 3KQGA 1LT9A 1LTIC 2GUSA 1GK4A 1L4AD 2R32A 4N6JA 1HUCA 2C0XA 3IR9A 1IFIA 3A7OA 3B5NB 3WMM0 3HUSB 2YKOA 3M06A 5AVVB 2O01H 1SFCD 2FFDB 3MGNA 2P2UA 3V2PA 1A02F 2OYHB 1KILB 5APWA 5KLVK 3P32A 5CJ4A 1MFZA 2LKMA 1M1JC 5APSA 4W7ZA 3TSIA 5AVXB 1MZ9A 2W6BA 1IFNA 2YKPA 3RL0C 1N86A 1LTJC 1IJDB 3MTUE 1ZLLA 3MD0A 1NWQA 3MIWA 1M1JA 3UIAA 1J1DC 1G1JA 2E43A 1NU1K 3H32B 1SVFA 4XE5B 1FZCA 1XTCC 2WWWA 1S9KD 1T3UA 1LTJA 3M0DA 4WB4A 1IFDA 1ZR4A 5AVYB 3TK1A 4EIJA 1GZLA 1JY2O 2W27A 3II6A 3B5ND 1LTSC 1IFJA 2N9BA 1GU5A 1FZGA 2OARA 1FJKA 1NTZK 1KFNA 1N7SC 1NHLA 1X79B 3N4XA 3LW5H 3N7NA 1X8YA 1T2KD 1KILD 2A45I 2W6AA 1KZUB 2WITA 3E1IA 1EQ7A 1N7SA 5APUA 1JO5A 1H89A 2H7HA 3VTPC 1HGVA 2N1TB 2HFED 4WY4B 1NOHA 3T97A 3GHGC 3VP8A 1URQB 1HVVA 1CZQA 1HBWA 3U1AA 1NTKK 1KFMA 3M0AA 1MV8A 2NPSB 2OYIB 4HH2A 2CPSA 4AUWA 3OAKA 3OA7A 1CSBA 5CMZA 3V4WA 1YYCA 2XV5A 1GW3A 1NAFA 2A45H 3MUDA 5CJ0A 2R5DA 1URQA 1ZN5A 2H8PD 3NFQA 1G2CB 2YO2A 3P8CD 3U1CA 3R2PA 3KDPB 2HODA 1L4AA 3HRNA 3LIDA 2NPSA 3V4QA 4EOTA 2OYIA 2FYZA 2HLOA 4O9BA 2IPPA 2R3CA 1GTWA 2Z4EA 1LTTC 3BVHA 1FJPA 5KJ7A 1LT9C 2KYVA 4AQRD 5CHXA 3TNUA 1SFCA 5AW4B 5AVRB 3KPEA 2O1JA 1JY2N 5AVUB 5AW7B 2JJLA 1RF1C 2N1TD 2Q3IA 4Y99C 1LWUB 1LTBC 4WY4D 2JEEA 3HE4B 1URQD 5AW1B 2J59M 1W2EA 2WPSA 1H88A 5AW3B 5KTBA 1FDMA 2NPSD 1L0LK 1RF1A 3RK3B 3O8ZA 4IFDK 1FU1A 4N78D 2WT7B 5KJ7D 2WSCH 3L37A 1SQXK 1RE4A 1YTZI 2XNXA 4IFMA 3B5NC 2L5GB 2Z5HA 3C9IA 3RK2C 1JTHB 2YO3A 1PFIA 1GW4A 2P67A 1GL2B 3U59A 4LLHA 1WT6A 2IFMA 2OYHC 1T2KC 2WT7A 3VOPA 5AVWB 3B5NA 1ZV8A 2HPCB 3HUSA 1LGHB 1FZCC 2VRSA 1JUNA 3M0DC 2FFDA 1NKNA 5APTA 5AW8B 3VMZA 5BU5A 2OYHA 1KILA 3NXSA 2GM4A 1GL2A 5AVSB 3RL0B 2XKMA 1JNMA 3A5TA 4JF7A 4JYCA 3VN0A 5AW2B 4DZOA 3RK3D 2MJZA 2XZRA 2WPRA 1J1DB 4M3LA 1CI6B 1SQBK 2IX7C 1S9KE 1JY3P 3H32A 1HJBA 1JY3N 2KOGA 5AW9B 3M9BA 2PP6A 3I5CA 1JMMA 1GL2D 2KSJA 2ZXEB 2XDJA 3VMXA 1CW5A 4LGDE 1DEBA 1T8ZA 2XU6A 1SP4A 5CCHA 3V5BA 1JCDA 3CI9A 1QL1A 2KP8A 2E42A 2N1TC 4C46A 1VPCA 3BASA 4N3YB 3HD7B 3SWYA 1URQC 3VYIA 1N73B 3RL0D 1L4AC 1FOSE 2NPSC 3NMDA 4AYCA 5CCGD 2OYIC 3GHGB 2N1TA 3M91A 5AW5B 1IO4A 3TYYA 4WY4A 2CPBA 5KJ7C 3BRTB 1SQVK 2C9NY 3L35A 1J1EC 3V2QA 3HTKB 1HTLC 1SFCC 3IFMA 4W7YA 3HD7A 3HE5B 5CCHD 2I1JA 2KB7P 3VP9A 3P8CE 4DOJA 1RF0C 5APYA 1FAVA 1M7LA 1G2CA 1ZR2A 5APQA 2FKWB 3KYQA 3HTKA 2Q7CA 3V2NA 1JY3O 1OXZA 2C0WA 4C7NB 1LT9B 1RF0A 1T3JA 5AW0B 4ZKUA 1LWUC 1RE4C 3H6PA 3HD7D 1GK6A 1N7LA 2KLVA 2I1KA 5AVZB 4Y99B 1JCCA 3RK3C 2FYUK 1LWUA 3CL3D 1HWTC 4GKGA 3HE4A 1VDFA 1J2JB 3HUSC 3G3ZA 5BVZA 4GIFA 5APXA 2Q9IA 4N78E 1G1IA 2FFDC 1NO4A 2BASA 2YKQA 3M9HA 1RY3A 1KILC 2M3BA 1IK9A 1GL2C 4I1LA 1E5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZB A;  1FZA A;  1N73 A;  3BVH A;  1RF1 B;  2OYI B;  1JY3 P;  2FFD A;  3H32 A;  3HUS B;  1LT9 C;  1M1J A;  1JY3 N;  1FZF A;  1JY2 P;  3GHG A;  2OYH A;  1N73 B;  2FFD B;  1RE4 A;  1RF0 C;  1RE3 A;  2A45 I;  1LWU A;  3H32 B;  2XNX A;  1JY2 N;  1M1J B;  1FZC A;  2OYI C;  1T3U A;  1RF1 C;  1LTJ A;  3GHG B;  2OYH B;  2A45 H;  3E1I A;  3HUS C;  1LWU B;  1FZC B;  1LT9 A;  1N73 C;  2Q9I A;  1LTJ B;  1JY3 O;  2FFD C;  2H43 A;  1M1J C;  2HOD A;  1W2E A;  2HPC A;  1FZE A;  1LT9 B;  1RF0 A;  1JY2 O;  2A45 G;  2OYH C;  2OYI A;  3GHG C;  1RE3 C;  2HLO A;  1LWU C;  1RE4 C;  1RF1 A;  1N86 A;  2HOD B;  2HPC B;  3HUS A;  1FZG A;  1FZC C;  1LTJ C;  2Z4E A; 
#chains in the Genus database with same CATH topology
 3RK2 B;  1BE3 D;  3H1J J;  2QJY B;  3CLQ A;  1YJW P;  3L73 E;  2BEZ F;  1W5C E;  3IF4 A;  1SQB E;  1DX7 A;  1MUU A;  1PV3 A;  1LTJ B;  1SQP J;  3E1R A;  5KKZ C;  1KOR A;  2LXB A;  2ZYG A;  3C8V A;  2KZI A;  2FXM A;  4HYT B;  1JOC A;  2ITA A;  1P84 D;  1DH3 A;  3KHU A;  3Q5R A;  2YMK A;  4UB6 E;  1FZA A;  1NTK G;  3BCC G;  1OW7 A;  3IN6 A;  2Y0E A;  5CBN A;  4PV1 D;  1FZE A;  3BCC J;  5GTH E;  2BCC G;  2Q3E A;  3CMA P;  2GUV A;  4WY4 C;  3VMY A;  2AXT E;  3O6Q A;  2WSF H;  2YNY A;  3A2A A;  1IFM A;  1Q81 Q;  1Z56 A;  1N73 C;  3LIE A;  4PD4 H;  4HKZ H;  3CWB D;  3CXH I;  2O01 J;  1J1E B;  2E74 B;  3FGA D;  1LTG C;  3HE5 A;  3A0H H;  3AE5 C;  3AEA C;  1RF1 B;  1LT1 A;  1JY2 P;  2J5U A;  1EDL A;  5KLV D;  4EI2 A;  4C7N A;  3PJS K;  1GK4 A;  3H1L E;  4YPC A;  4EDF A;  1PL5 A;  3H1H J;  1K05 A;  1KTM A;  2D2C D;  2ZVN B;  3WMM 0;  2YKO A;  3LW5 J;  2A06 E;  2K88 A;  1NU1 D;  2KS1 A;  2OYH B;  3KXD A;  1KIL B;  5APW A;  3P32 A;  3AED C;  2HR3 A;  2LKM A;  3TSI A;  3RL0 C;  1N86 A;  3H1J E;  1ZLL A;  2FYN C;  3TDK A;  1G1J A;  1FZC A;  1YQ3 C;  1SQP E;  1K73 Q;  1K04 A;  1BGY J;  5AVY B;  3L71 G;  1GZL A;  1JY2 O;  2W27 A;  1LTS C;  1IFJ A;  2PFX A;  2OAR A;  1N7S C;  2OTK E;  3N7N A;  1MFT A;  1X8Y A;  3G9R A;  2WIT A;  3CXH D;  1JO5 A;  1H89 A;  2E76 C;  2N1T B;  5B5E H;  1NOH A;  1URQ B;  1HVV A;  1VF5 D;  3GMA A;  3L70 D;  1MV8 A;  4HH2 A;  2CPS A;  3OAK A;  5CMZ A;  2M5A A;  1BCC G;  4GOD A;  1HJ0 A;  4YXD C;  3MUD A;  2JKV A;  2R5D A;  1URQ A;  4L76 A;  1ZN5 A;  2H8P D;  3U1C A;  1L0L J;  3KDP B;  4YXW H;  1L4A A;  1QEX A;  2IPP A;  1BCC J;  1SQX J;  3G4S P;  3JSV C;  4AQR D;  3CCV P;  2WSE J;  5AW4 B;  5AVU B;  2QE7 H;  1OX3 A;  4CPG A;  1L0N G;  1KC8 Q;  1H88 A;  2Y9Y A;  3CPW O;  4N78 D;  4UB8 H;  1UIX A;  4ZMD A;  2WSC H;  1L0N J;  1RE4 A;  1BE3 G;  4H44 D;  2O3J A;  3RK2 C;  2YO3 A;  1EZV I;  2V7Q H;  2P67 A;  1PGQ A;  3H1H E;  3CX5 D;  1BE3 J;  3B5N A;  1ZV8 A;  2HPC B;  3HUS A;  1JUN A;  1YJ9 P;  2FFD A;  1EDJ A;  3AE1 C;  3H1K D;  3NXS A;  2GM4 A;  3QH9 A;  1EXJ A;  4JF7 A;  3JCU H;  5AW2 B;  3SFE C;  1NTZ E;  2WSS H;  2RMZ A;  4M3L A;  1CI6 B;  1SQB K;  3H1I E;  2SPZ A;  3TGU D;  1JY3 P;  3H32 A;  1E79 H;  1HJB A;  2KOG A;  1EDI A;  2QIW A;  3I5C A;  1BGY E;  3AEF C;  2ZXE B;  4PD4 I;  3VMX A;  3AE8 C;  1SQV D;  3L75 D;  1KIL E;  3RBZ A;  3BAS A;  2KK7 A;  2KUB A;  3CWB G;  3SWY A;  4UB6 H;  1N73 B;  1KYO E;  1QX8 A;  2NPS C;  3GHG B;  1Q86 Q;  5AW5 B;  4WY4 A;  1ZP0 C;  2CPB A;  5KJ7 C;  1K9M Q;  2C9N Y;  1J1E C;  3V2Q A;  3HTK B;  1YIJ P;  3IFM A;  2E74 C;  4H13 D;  2I8D A;  2FYU D;  1RF0 C;  1ZR2 A;  1L0L E;  1Q90 D;  3KYQ A;  3HTK A;  1OW8 A;  2Q7C A;  4RJT A;  1JY3 O;  1OXZ A;  5KLV G;  1LT9 B;  1R8E A;  1SQX E;  1EZV D;  1LWU C;  1BSN A;  3HD7 D;  1GK6 A;  2PRR A;  2I1K A;  3ZDM A;  3RK3 C;  5KLV J;  1IK7 A;  3RBX A;  3CL3 D;  4GKG A;  3HE4 A;  3IAO A;  3L72 E;  4BXL A;  1NU1 G;  2LR2 A;  4BRY B;  5BVZ A;  2NRG A;  4R4L A;  1NGM B;  1G1I A;  2NZ2 A;  3D70 A;  1NO4 A;  1RH5 B;  1YQ4 C;  2Q6Q A;  1KIL C;  1RQU A;  1GL2 C;  3CCS P;  4I1L A;  1ZW0 A;  1NU1 J;  1H8A A;  1U7J A;  1M57 D;  2P1J A;  4OH8 B;  1PP9 J;  1HH0 A;  1FBM A;  2FYN B;  3AE7 C;  2A45 G;  1NKZ B;  4PD4 D;  5APV A;  3Q2Y A;  1NH4 A;  1YBK A;  1VL2 A;  2KNC A;  4HJG H;  2POH A;  3QWO C;  2ZT9 C;  3P7K A;  5CCG A;  1P84 I;  2M8R A;  1N7S B;  2PAJ A;  4H0L D;  1RE3 C;  1SQP K;  1M8O B;  3AE2 C;  3T97 B;  2XND H;  1N2D C;  2YIU C;  2JWA A;  3L70 G;  1NTM J;  3P8M C;  2E75 D;  2E76 B;  1FS0 E;  3KZI E;  1QL2 A;  1S3J A;  3L70 J;  4TLF A;  4UB8 E;  4K3A A;  4IFF A;  2HOD B;  1PPJ D;  5TIS H;  1LP1 A;  4D6T D;  3I56 P;  2KIK A;  1EXI A;  4JBZ A;  3MHV A;  1SFC B;  5H2F E;  3L74 J;  4NPF X;  2G3A A;  4LC1 A;  3V2R A;  3A0B E;  1GU4 A;  4I6M C;  2B9B A;  4PJ0 E;  4WVZ A;  2WTY A;  1FOS F;  1AV1 A;  2GUS A;  1UII A;  1L4A D;  2B87 B;  4DJG A;  1KQG B;  2C0X A;  3S4R A;  1IFI A;  3A7O A;  4PV1 C;  2Y0C A;  5AVV B;  2O01 H;  3MGN A;  2P2U A;  2ZYD A;  3H1K G;  1A02 F;  1N8R Q;  3AEB C;  1M1J C;  2WQY C;  4W7Z A;  4BWN A;  3H1K J;  1IJD B;  1D7M A;  2IBZ E;  3UIA A;  2E43 A;  2KSE A;  3TGU G;  3AE6 C;  3CCM P;  1XTC C;  1PP9 E;  1LTJ A;  4WB4 A;  2KZJ A;  2W83 C;  1PGP A;  1NTK J;  3B5N D;  1SQV G;  3WU2 H;  1OMI A;  2DW3 A;  3SFD C;  3L75 G;  1NTZ K;  3N4X A;  1SQQ E;  3LW5 H;  2UWJ E;  2A45 I;  1PGJ A;  2BCC J;  1H0T B;  4IL6 X;  3C1L A;  1EQ7 A;  1VQ5 P;  3L75 J;  5B66 E;  3JC2 2;  2H7H A;  3B4S A;  3VTP C;  1HGV A;  3GHG C;  3VP8 A;  3PHL A;  3U1A A;  2ZXX A;  1NTM E;  2NPS B;  1YYC A;  1USE A;  1GW3 A;  1NAF A;  2QVA A;  2XV5 A;  2FYU G;  3R2P A;  3HRN A;  3F89 A;  2NPS A;  3V4Q A;  4O9B A;  4U3F E;  2R3C A;  1JB0 J;  1JEK A;  1EZV G;  1LTT C;  5KJ7 A;  1AA0 A;  1LT9 C;  2KYV A;  5CHX A;  2W90 A;  3L74 E;  1NVO A;  1LWU B;  1KYO H;  4WY4 D;  2JEE A;  3GG2 A;  1L0L K;  1RF1 A;  3RK3 B;  3K5B A;  1U7M A;  2WT7 B;  2JWD A;  2OQQ A;  1R5L A;  1SQX K;  1LNQ A;  2QA4 P;  4IFM A;  1KB9 E;  3C9I A;  1JTH B;  3MZW B;  1PFI A;  1EC5 A;  1JM0 A;  1GW4 A;  5E79 H;  5EFW B;  1GL2 B;  3U59 A;  3PLN A;  3L73 D;  2WT7 A;  5AVW B;  2Y9Z A;  1SQB D;  3M0D C;  3CC2 P;  1NKN A;  5AW8 B;  4ASV A;  1NTZ G;  5TJH A;  4L73 A;  2OYH A;  1KIL A;  3RL0 g;  1GL2 A;  1VF5 C;  4OGQ B;  5AVS B;  1JNM A;  2XKM A;  2IYP A;  3A5T A;  3H1I G;  3CX5 I;  2JO1 A;  4KT0 J;  2XZR A;  1VQ4 P;  5TIS E;  2WPR A;  1J1D B;  2ZT9 B;  1S9K E;  1M1K Q;  2W6J H;  1DIP A;  4R4M A;  3L71 J;  3M9B A;  2KSJ A;  2XDJ A;  3W68 A;  3D71 A;  1NTK E;  2K1A A;  3BCC E;  4LGD E;  2CK3 H;  2YIU B;  3D6Y A;  2G8Y A;  1QL1 A;  2E42 A;  1ZRT E;  2BEQ D;  1PPJ G;  2QJK C;  2BCC E;  3RL0 D;  4D6T G;  4TT3 H;  3NMD A;  5CCG D;  2N1T A;  3M91 A;  3L35 A;  4GOE A;  1KQS O;  4D6T J;  1SFC C;  4W7Y A;  5CCH D;  4H44 C;  2M0B A;  1VQ7 P;  3P8C E;  4DOJ A;  5APY A;  4L74 A;  1BDC A;  1FAV A;  1M7L A;  2QSI A;  5APQ A;  1DEE G;  4YTP C;  1RHZ B;  2P58 A;  3KZI H;  1VQ8 P;  1S5L X;  2KLV A;  3H1L D;  1M90 Q;  1DD4 A;  3PRJ A;  1HWT C;  2A06 D;  2K9Y A;  2Q9I A;  3WU2 E;  5H2F H;  3GLM A;  4WWI A;  2BAS A;  4PV1 B;  2QRX A;  2N9Y B;  1NJI Q;  3A0B H;  4PJ0 H;  2J58 A;  1PIX A;  1M1J B;  3H1J D;  5KAF E;  5AW6 B;  5L8R J;  2HPC A;  2RH0 A;  2ZFC A;  2KLU A;  4JYB A;  1SQP D;  2C9L Y;  4MN4 C;  3ITK A;  4EYY Q;  1L2P A;  5DJU B;  1XTG B;  1VQ6 P;  3RK3 E;  3EQ2 A;  1HGZ A;  4RO0 A;  1S72 P;  4WBA A;  4U7J A;  1IC2 A;  1X9V A;  1FDO A;  1WRG A;  1CI6 A;  3A3Y B;  1Q7Y Q;  1IZN B;  4RES B;  3RK2 D;  1GD2 E;  1ZME C;  3SWF A;  3L71 E;  4RKU J;  4IL6 H;  3HD7 C;  2K3R A;  1SQQ K;  3CWB J;  5BU8 B;  5KLI C;  2WSC J;  1R5S A;  3Q5P A;  1N73 A;  3GHG A;  2D2C B;  3USS A;  3BRV B;  3OJA B;  1NAY A;  5E79 E;  2V7Q J;  3TNU B;  1NTM K;  2R5B A;  5AVT B;  1A02 J;  3PP5 A;  1YTZ T;  5B66 H;  1BCC E;  4KHX A;  1Y8A A;  1AFO A;  1QLE D;  4W80 A;  1FZB A;  3I55 P;  1OWA A;  1GDT A;  3L4F A;  2IFN A;  3CXH H;  4ZKP A;  4I7Z B;  3E7K A;  1AQ5 A;  1LT9 A;  2KXP B;  1LTI C;  2RKL A;  2FXP A;  4N6J A;  3L73 G;  3IR9 A;  1Y9B A;  1L0N E;  3H1H D;  1SQB G;  3M06 A;  4JQ0 D;  4H0L C;  4BRY A;  2E74 D;  3V2P A;  1WMK A;  5CJ4 A;  1PGO A;  1SQB J;  1BE3 E;  5AVX B;  4OGQ C;  2W6B A;  1IFN A;  2YKP A;  1SS1 A;  3MTU E;  1NTZ D;  3MD0 A;  1VF5 B;  5K5G B;  3MIW A;  4NPE A;  1J1D C;  2MKV A;  1AVO A;  1SVF A;  4XE5 B;  3H1I D;  3EFF K;  3M0D A;  1IFD A;  2YXR B;  1VQP P;  1RQV A;  1P84 E;  2JP3 A;  1KB9 H;  4EIJ A;  2ZJS E;  3II6 A;  1BGY D;  2N9B A;  1YJN P;  1FZG A;  2Q1K A;  1KFN A;  1X79 B;  1T2K D;  1KIL D;  3E1I A;  1N7S A;  5APU A;  1KYO D;  2RN0 A;  1VQK P;  2HFE D;  3MP7 B;  4IOI H;  3T97 A;  2QJK B;  1HBW A;  2AXC A;  1BDD A;  1NTK K;  3MUD C;  3M0A A;  3CC4 P;  1VQO P;  1CSB A;  3GF7 A;  3CWB E;  4H44 B;  1G2C B;  1OIP A;  2HOD A;  2PGD A;  3AEE C;  1L0L D;  2O01 N;  3BVH A;  2GA1 A;  3Q1M A;  1SQX D;  2K37 A;  1LJ2 A;  1SFC A;  3SWK A;  3H1L G;  1VQ9 P;  2JJL A;  4HB1 A;  2K9J B;  2N1T D;  1LTB C;  1URQ D;  5AW1 B;  2J59 M;  2A06 G;  3L72 D;  5KTB A;  3H1L J;  2R3S A;  3O8Z A;  1FU1 A;  4GOF A;  1W2B O;  2L91 A;  3RGU A;  1GMJ A;  4OVN F;  5KLV E;  3B5N C;  3CCE P;  2V4H A;  3H1J G;  2B87 A;  1MKM A;  1JMB A;  1WT6 A;  2IFM A;  4K35 A;  3VOP A;  1NYH A;  1NU1 E;  1FDI A;  1AQT A;  1SQP G;  5APT A;  4A7P A;  4IL6 E;  3VMZ A;  5BU5 A;  1VQN P;  2QEX P;  2H89 C;  3EWK A;  2YXQ B;  1DD3 A;  4DZO A;  2MJZ A;  5GTI E;  3G6E P;  2ZVO B;  3TGU J;  1USD A;  2IX7 C;  4GDO A;  2Y0D A;  2IBZ I;  1JY3 N;  4H13 B;  5AW9 B;  1SQV J;  3O6Q B;  2FBW C;  1CW5 A;  2ZYA A;  3OW2 O;  5KAF H;  1DEB A;  1T8Z A;  2XU6 A;  1SP4 A;  4KJM A;  2FY8 A;  3V5B A;  1OVV A;  3CI9 A;  3AE4 C;  1VPC A;  1QVG O;  3CXH E;  3HD7 B;  3AEG C;  2OTJ P;  1H0T A;  3VYI A;  2R44 A;  4AYC A;  2OYI C;  5KLI B;  1IO4 A;  3L70 E;  1U57 A;  2D2C C;  3BRT B;  1HTL C;  3WUV A;  3HD7 A;  3HE5 B;  2FYU J;  2I1J A;  2KB7 P;  1AVY A;  2QJP C;  3G71 P;  3V2N A;  4C7N B;  4I7Z C;  1RF0 A;  3FXE A;  5AW0 B;  2FXO A;  2E5Y A;  3H6P A;  1N7L A;  3AE9 C;  4Y99 B;  1QVF O;  2AEJ A;  1JCC A;  2P10 A;  1FE6 A;  3H1H G;  1LWU A;  2OTL P;  2KS1 B;  3G3Z A;  4GIF A;  4N78 E;  2IYO A;  4H0L B;  1E5W A;  5DJT B;  1JTH A;  2QM7 A;  2WSF J;  2IBZ D;  1IFP A;  2WSE H;  3NTN A;  2E75 B;  3CX5 E;  4ZNC A;  1L0N K;  1KB9 I;  1FZC B;  2P7J A;  1KQF B;  1NTZ J;  4I2L C;  3WUT A;  1PP9 D;  2O1K A;  3H1K E;  5CCG C;  2B89 A;  2E5T A;  1BGY G;  1KV4 A;  3H1I J;  1M56 D;  4C7R A;  5KAI H;  2W8Z A;  1T6A A;  5CCH C;  2JDI H;  3FXD A;  2WZ7 A;  1SQQ D;  1LTA C;  3TGU E;  4B86 A;  3H25 A;  2LXC B;  3WUU A;  1SLQ A;  5AVQ B;  3AEC C;  2YMY A;  2QM8 A;  3L36 A;  1RE3 A;  1SQV E;  3W67 A;  2HYN A;  2WPQ A;  1NTM D;  3L75 E;  2M5A B;  1ZXG A;  1S4X A;  3GW6 A;  2KI7 B;  2H43 A;  1OVU A;  3EFG A;  1S5L E;  3VMA A;  3M9Q A;  4XA4 A;  4Y28 J;  1P84 H;  3BAT A;  1L4A B;  2HG5 D;  5CBO A;  1L0L G;  4DT0 A;  1FZF A;  1KQL A;  4U3F D;  4XFJ A;  1SQX G;  2Q5U A;  4GT1 A;  2AEM A;  3CCJ P;  1N7S D;  3L74 D;  1K8A Q;  3B8E B;  2FYU E;  3R4Y A;  3L72 G;  2E76 D;  3CME P;  1KMI Z;  2Z5I A;  1EZV E;  3KQG A;  3L72 J;  3GF3 A;  1KB9 D;  2R32 A;  1HUC A;  3B5N B;  3CCL P;  3FX0 A;  3HUS B;  1Q82 Q;  1OZH A;  1SFC D;  2FFD B;  2B88 A;  3FWL A;  1S2E A;  5KLV K;  1HF9 A;  2QJY C;  1MFZ A;  5APS A;  3Q3D A;  1MZ9 A;  1S1C X;  2IDB A;  1LTJ C;  2WMM A;  1NWQ A;  4OWF A;  1M1J A;  4Z1M H;  1NU1 K;  3H32 B;  5KKZ B;  2WWW A;  1S9K D;  1T3U A;  3ABV C;  4PD4 E;  2ZAE B;  1ZR4 A;  4H13 C;  3TK1 A;  1GU5 A;  1YI2 P;  1NTK D;  1FJK A;  3BCC D;  1NHL A;  2W6A A;  1ZRT D;  3TF5 A;  1KZU B;  2AEF A;  4QMA A;  3PTZ A;  1OFC X;  2BCC D;  3A0H E;  1X22 A;  2OYO A;  3S9O A;  4WY4 B;  1CZQ A;  1KFM A;  3S1K A;  5GTI H;  2OYI B;  4AUW A;  3OA7 A;  3FWN A;  2JR8 A;  3V4W A;  1KYO I;  2A45 H;  5CJ0 A;  1PPJ E;  3NFQ A;  3P8C D;  2YO2 A;  4D6T E;  3LID A;  4EOT A;  2OYI A;  2FYZ A;  2HLO A;  5GTH H;  2H88 C;  1GTW A;  1X0T A;  2Z4E A;  3CCR P;  1FJP A;  2QJP B;  1QGK B;  1KD1 Q;  1FC2 C;  3TNU A;  5AVR B;  3KPE A;  2O1J A;  1JY2 N;  5AW7 B;  1ZOY C;  1RF1 C;  2AXT H;  2Q3I A;  4Y99 C;  4ASW A;  3CCU P;  3HE4 B;  2WPS A;  1W2E A;  5AW3 B;  3CC7 P;  1EDK A;  1FDM A;  2NPS D;  4IFD K;  1PZQ A;  5KJ7 D;  5KAI E;  3L37 A;  2WPV B;  1YTZ I;  2XNX A;  2L5G B;  2Z5H A;  3D6Z A;  3L73 J;  3B71 A;  2IBZ G;  1YHQ P;  4LLH A;  2OYH C;  1T2K C;  2E75 C;  2M3E A;  3Q5S A;  1FZC C;  1LGH B;  2VRS A;  1PP9 G;  1OW6 A;  1Y47 A;  2OGU A;  2KNC B;  1OVR A;  5B5E E;  1YIT P;  3RL0 B;  4JYC A;  3VN0 A;  1KN7 A;  5M1B A;  3RK3 D;  1SQQ G;  2IZ0 A;  3CD6 P;  1TU3 F;  1VQL P;  2PP6 A;  1SQQ J;  1JMM A;  1GL2 D;  1AJY A;  5C39 A;  4DCK A;  3L71 D;  1Q2N A;  1NTM G;  3CCQ P;  3CX5 H;  2WVR A;  5CCH A;  1JCD A;  2KP8 A;  3SSU A;  2N1T C;  4C46 A;  4N3Y B;  1URQ C;  2QG4 A;  4OGQ D;  1LP1 B;  1L4A C;  1FOS E;  3F5H A;  4U3F G;  3TYY A;  1SQV K;  2ZT9 D;  3L74 G;  4U3F J;  1BCC D;  3VP9 A;  4NPD A;  4JPZ B;  1G2C A;  2FKW B;  2C0W A;  3AE3 C;  1T3J A;  4ZKU A;  1RE4 C;  1S5L H;  2IZ1 A;  5AVZ B;  1BSH A;  2K9J A;  2FYU K;  3JCU E;  3V6I A;  1VQM P;  1L0N D;  1VDF A;  1J2J B;  3HUS C;  5APX A;  4L75 A;  2FFD C;  2YKQ A;  3M9H A;  1RY3 A;  2M3B A;  1IK9 A;  3PH0 A; 
#chains in the Genus database with same CATH homology
 3RK2 B;  1JTH A;  2QM7 A;  1H8A A;  2J58 A;  3CLQ A;  1M1J B;  2WSE H;  3NTN A;  2P1J A;  1L0N K;  4OH8 B;  1FZC B;  5AW6 B;  1DX7 A;  1MUU A;  1LTJ B;  2P7J A;  1HH0 A;  2HPC A;  1FBM A;  2ZFC A;  4I2L C;  2A45 G;  2O1K A;  1NKZ B;  4JYB A;  2C9L Y;  2FXM A;  4HYT B;  1JOC A;  5CCG C;  5APV A;  1DH3 A;  1NH4 A;  1FZA A;  1XTG B;  2POH A;  3P7K A;  3EQ2 A;  1HGZ A;  4C7R A;  5CCG A;  5CCH C;  4WBA A;  2WZ7 A;  1IC2 A;  1X9V A;  1LTA C;  1WRG A;  2M8R A;  1CI6 A;  1FZE A;  1N7S B;  2PAJ A;  3A3Y B;  4B86 A;  1RE3 C;  1SQP K;  4RES B;  3RK2 D;  1GD2 E;  1SLQ A;  5AVQ B;  3SWF A;  1N2D C;  2GUV A;  2YMY A;  4WY4 C;  3VMY A;  2QM8 A;  3P8M C;  3L36 A;  1RE3 A;  2HYN A;  2WPQ A;  2WSF H;  3A2A A;  2YNY A;  1IFM A;  3HD7 C;  1QL2 A;  1Z56 A;  1N73 C;  3LIE A;  1SQQ K;  2H43 A;  3EFG A;  5BU8 B;  3M9Q A;  4XA4 A;  4IFF A;  2HOD B;  1L4A B;  3BAT A;  2HG5 D;  1N73 A;  1FZF A;  1KQL A;  3GHG A;  3BRV B;  3OJA B;  1J1E B;  2Q5U A;  4GT1 A;  1NTM K;  1SFC B;  3TNU B;  2R5B A;  1N7S D;  5AVT B;  1LTG C;  4LC1 A;  3V2R A;  3HE5 A;  1A02 J;  1GU4 A;  3PP5 A;  3B8E B;  1YTZ T;  4I6M C;  4KHX A;  1AFO A;  4W80 A;  1FZB A;  2WTY A;  1OWA A;  1RF1 B;  1GDT A;  3L4F A;  1FOS F;  1JY2 P;  2IFN A;  4ZKP A;  2Z5I A;  1AQ5 A;  4C7N A;  3KQG A;  1LT9 A;  1LTI C;  2GUS A;  1GK4 A;  1L4A D;  2R32 A;  4N6J A;  1HUC A;  2C0X A;  3IR9 A;  1IFI A;  3A7O A;  3B5N B;  3WMM 0;  3HUS B;  2YKO A;  3M06 A;  5AVV B;  2O01 H;  1SFC D;  2FFD B;  3MGN A;  2P2U A;  3V2P A;  1A02 F;  2OYH B;  1KIL B;  5APW A;  5KLV K;  3P32 A;  5CJ4 A;  1MFZ A;  2LKM A;  1M1J C;  5APS A;  4W7Z A;  3TSI A;  5AVX B;  1MZ9 A;  2W6B A;  1IFN A;  2YKP A;  3RL0 C;  1N86 A;  1LTJ C;  1IJD B;  3MTU E;  1ZLL A;  3MD0 A;  1NWQ A;  3MIW A;  1M1J A;  3UIA A;  1J1D C;  1G1J A;  2E43 A;  1NU1 K;  3H32 B;  1SVF A;  4XE5 B;  1FZC A;  1XTC C;  2WWW A;  1S9K D;  1T3U A;  1LTJ A;  3M0D A;  4WB4 A;  1IFD A;  1ZR4 A;  5AVY B;  3TK1 A;  4EIJ A;  1GZL A;  1JY2 O;  2W27 A;  3II6 A;  3B5N D;  1LTS C;  1IFJ A;  2N9B A;  1GU5 A;  1FZG A;  2OAR A;  1FJK A;  1NTZ K;  1KFN A;  1N7S C;  1NHL A;  1X79 B;  3N4X A;  3LW5 H;  3N7N A;  1X8Y A;  1T2K D;  1KIL D;  2A45 I;  2W6A A;  1KZU B;  2WIT A;  3E1I A;  1EQ7 A;  1N7S A;  5APU A;  1JO5 A;  1H89 A;  2H7H A;  3VTP C;  1HGV A;  2N1T B;  2HFE D;  4WY4 B;  1NOH A;  3T97 A;  3GHG C;  3VP8 A;  1URQ B;  1HVV A;  1CZQ A;  1HBW A;  3U1A A;  1NTK K;  1KFM A;  3M0A A;  1MV8 A;  2NPS B;  2OYI B;  4HH2 A;  2CPS A;  4AUW A;  3OAK A;  3OA7 A;  1CSB A;  5CMZ A;  3V4W A;  1YYC A;  2XV5 A;  1GW3 A;  1NAF A;  2A45 H;  3MUD A;  5CJ0 A;  2R5D A;  1URQ A;  1ZN5 A;  2H8P D;  3NFQ A;  1G2C B;  2YO2 A;  3P8C D;  3U1C A;  3R2P A;  3KDP B;  2HOD A;  1L4A A;  3HRN A;  3LID A;  2NPS A;  3V4Q A;  4EOT A;  2OYI A;  2FYZ A;  2HLO A;  4O9B A;  2IPP A;  2R3C A;  1GTW A;  2Z4E A;  1LTT C;  3BVH A;  1FJP A;  5KJ7 A;  1LT9 C;  2KYV A;  4AQR D;  5CHX A;  3TNU A;  1SFC A;  5AW4 B;  5AVR B;  3KPE A;  2O1J A;  1JY2 N;  5AVU B;  5AW7 B;  2JJL A;  1RF1 C;  2N1T D;  2Q3I A;  4Y99 C;  1LWU B;  1LTB C;  4WY4 D;  2JEE A;  3HE4 B;  1URQ D;  5AW1 B;  2J59 M;  1W2E A;  2WPS A;  1H88 A;  5AW3 B;  5KTB A;  1FDM A;  2NPS D;  1L0L K;  1RF1 A;  3RK3 B;  3O8Z A;  4IFD K;  1FU1 A;  4N78 D;  2WT7 B;  5KJ7 D;  2WSC H;  3L37 A;  1SQX K;  1RE4 A;  1YTZ I;  2XNX A;  4IFM A;  3B5N C;  2L5G B;  2Z5H A;  3C9I A;  3RK2 C;  1JTH B;  2YO3 A;  1PFI A;  1GW4 A;  2P67 A;  1GL2 B;  3U59 A;  4LLH A;  1WT6 A;  2IFM A;  2OYH C;  1T2K C;  2WT7 A;  3VOP A;  5AVW B;  3B5N A;  1ZV8 A;  2HPC B;  3HUS A;  1LGH B;  1FZC C;  2VRS A;  1JUN A;  3M0D C;  2FFD A;  1NKN A;  5APT A;  5AW8 B;  3VMZ A;  5BU5 A;  2OYH A;  1KIL A;  3NXS A;  2GM4 A;  1GL2 A;  5AVS B;  3RL0 B;  2XKM A;  1JNM A;  3A5T A;  4JF7 A;  4JYC A;  3VN0 A;  5AW2 B;  4DZO A;  3RK3 D;  2MJZ A;  2XZR A;  2WPR A;  1J1D B;  4M3L A;  1CI6 B;  1SQB K;  2IX7 C;  1S9K E;  1JY3 P;  3H32 A;  1HJB A;  1JY3 N;  2KOG A;  5AW9 B;  3M9B A;  2PP6 A;  3I5C A;  1JMM A;  1GL2 D;  2KSJ A;  2ZXE B;  2XDJ A;  3VMX A;  1CW5 A;  4LGD E;  1DEB A;  1T8Z A;  2XU6 A;  1SP4 A;  5CCH A;  3V5B A;  1JCD A;  3CI9 A;  1QL1 A;  2KP8 A;  2E42 A;  2N1T C;  4C46 A;  1VPC A;  3BAS A;  4N3Y B;  3HD7 B;  3SWY A;  1URQ C;  3VYI A;  1N73 B;  3RL0 D;  1L4A C;  1FOS E;  2NPS C;  3NMD A;  4AYC A;  5CCG D;  2OYI C;  3GHG B;  2N1T A;  3M91 A;  5AW5 B;  1IO4 A;  3TYY A;  4WY4 A;  2CPB A;  5KJ7 C;  3BRT B;  1SQV K;  2C9N Y;  3L35 A;  1J1E C;  3V2Q A;  3HTK B;  1HTL C;  1SFC C;  3IFM A;  4W7Y A;  3HD7 A;  3HE5 B;  5CCH D;  2I1J A;  2KB7 P;  3VP9 A;  3P8C E;  4DOJ A;  1RF0 C;  5APY A;  1FAV A;  1M7L A;  1G2C A;  1ZR2 A;  5APQ A;  2FKW B;  3KYQ A;  3HTK A;  2Q7C A;  3V2N A;  1JY3 O;  1OXZ A;  2C0W A;  4C7N B;  1LT9 B;  1RF0 A;  1T3J A;  5AW0 B;  4ZKU A;  1LWU C;  1RE4 C;  3H6P A;  3HD7 D;  1GK6 A;  1N7L A;  2KLV A;  2I1K A;  5AVZ B;  4Y99 B;  1JCC A;  3RK3 C;  2FYU K;  1LWU A;  3CL3 D;  1HWT C;  4GKG A;  3HE4 A;  1VDF A;  1J2J B;  3HUS C;  3G3Z A;  5BVZ A;  4GIF A;  5APX A;  2Q9I A;  4N78 E;  1G1I A;  2FFD C;  1NO4 A;  2BAS A;  2YKQ A;  3M9H A;  1RY3 A;  1KIL C;  2M3B A;  1IK9 A;  1GL2 C;  4I1L A;  1E5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...