1FZAA

Crystal structure of fibrinogen fragment d
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
85
structure length
85
Chain Sequence
VSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood coagulation
molecule keywords FIBRINOGEN
publication title Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin.
pubmed doi rcsb
total genus 30
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzaA00
2A45I 1FZCA 1FZCC 1N73A 1LTJB 1RF1A 1FZEA 2OYIC 3HUSB 1N73B 2HLOA 1FZCB 2OYHC 3H32A 1LWUA 1FZGA 2HPCA 1RF1B 1RE3A 1LTJC 1FZBA 1RE4A 1M1JA 2XNXA 3GHGA 3H32B 1LWUB 3HUSC 1LT9A 1RF0A 2HODA 2HPCB 1JY2N 1M1JB 1N73C 1JY3O 3GHGB 1RF1C 1JY3P 1FZFA 2H43A 2FFDA 1LT9B 1N86A 2HODB 2A45H 1LWUC 1W2EA 1RE3C 2FFDB 1RE4C 1T3UA 1M1JC 3E1IA 3GHGC 2Q9IA 2OYIA 1RF0C 1LT9C 2OYHA 2Z4EA 1LTJA 1FZAA 1JY3N 2A45G 3BVHA 1JY2O 2FFDC 2OYIB 2OYHB 1JY2P 3HUSA
chains in the Genus database with same CATH superfamily
4MN4C 3VP9A 1Q2NA 3VN0A 3A5TA 2FFDA 1KB9D 2DW3A 1KILB 5AVSB 1H89A 1SQBJ 3W67A 1PL5A 4EOTA 3B8EB 2OYOA 1YIJP 1NTMG 1OZHA 4DOJA 1JY3N 1PP9D 2Q1KA 4KT0J 4NPFX 5KAIH 3K5BA 3ZDMA 4IFDK 3TNUA 2ZVNB 3D70A 1G2CB 5CCHC 1IJDB 3USSA 1AA0A 1IFIA 1NU1E 2QJYB 1R8EA 2KP8A 2O1JA 2FBWC 2KSJA 4BRYA 1M1JA 1Y8AA 5KKZC 3AE4C 4UB8H 1L4AD 1RE3C 2NPSA 3AE3C 1NTKE 3H1JE 1YQ3C 3NMDA 2GM4A 1Y47A 3KQGA 3RL0D 4N78D 3GHGA 4OGQB 1FZCC 2YO3A 2A45H 2KS1A 1IZNB 3KHUA 3H1KG 3N4XA 2WSEJ 5M1BA 1YTZT 4RKUJ 1FS0E 2KOGA 5AW7B 3FXDA 3V2RA 1L4AC 3NXSA 2Y9ZA 1GW3A 4L73A 1PPJD 1L0LD 2D2CD 1XTCC 2J5UA 4WY4B 1DD3A 3RL0C 3H1HG 3D71A 3S9OA 3IF4A 1SFCD 3AEDC 1BDDA 3HE5B 2JO1A 5H2FE 2I1KA 2P10A 2AEJA 3H1ID 4M3LA 2QEXP 1Q82Q 3C9IA 1LGHB 2QVAA 3BCCD 3FXEA 1MUUA 2FXOA 2K37A 1LNQA 3E1RA 3L72E 2D2CC 2CK3H 4ZKPA 5KLVD 2ZXXA 5B5EE 1LT9B 1QGKB 2ZT9B 5BU5A 2K9JA 1A02F 1EQ7A 1VPCA 2LXBA 2FFDC 1SFCC 2Y0CA 3L70E 1KYOI 1RH5B 1S5LH 3L74J 2ZJSE 1L0NK 2P2UA 1Q90D 3HE4A 1YITP 5AVYB 1J2JB 1R5LA 1OW7A 1VQPP 1HVVA 1LTAC 5CCGD 2Q5UA 3C8VA 4PV1B 4I7ZB 4NPEA 2JWDA 1FOSE 5K5GB 1VQKP 1IFNA 2WT7B 3HUSB 2OYHC 5AVUB 2IDBA 5KTBA 1BE3G 4BXLA 5GTIE 2KSEA 2HPCB 1OWAA 3OW2O 1KORA 3NFQA 3Q2YA 1PGPA 5APVA 4HJGH 2BCCD 1VF5B 3AE8C 5DJUB 2NPSC 1L0NG 2Q3EA 4IFMA 4N6JA 1E5WA 1LWUA 1NU1J 4ZNCA 1IO4A 1LJ2A 5CCGC 1MKMA 3M0DA 3TGUJ 1MZ9A 1AQ5A 2WSFJ 1WRGA 4AYCA 3CWBE 2OTLP 1G1JA 2BEQD 3H1JJ 1RHZB 4BRYB 1M1JB 3VMZA 3KPEA 2MJZA 3L71G 5EFWB 2AXTE 4I2LC 1LP1A 3HRNA 2W83C 4WBAA 5CBOA 3FGAD 1KFMA 4WWIA 2HLOA 2YKOA 3OJAB 3P8MC 4JPZB 3GHGB 1NWQA 3VYIA 1VQOP 4N78E 1BCCE 1R5SA 1G1IA 4I6MC 2KYVA 4ZKUA 3S4RA 3M9BA 2R3CA 1K8AQ 2K88A 2FYUK 1VQ7P 1JM0A 1KB9I 1EDKA 1Q7YQ 4JYBA 4DT0A 2YMKA 2M5AA 2XV5A 2V7QH 5E79H 1PPJE 1L0LE 3UIAA 1S72P 4H44B 3II6A 4XA4A 2H88C 1RF1B 3AE9C 2N9BA 1SQXK 2AEMA 1RF0A 5TISH 1URQD 5AVTB 3SWKA 1FDIA 4D6TG 2QM8A 1HTLC 2FYUG 2N1TA 1FJKA 1X0TA 3O6QA 4PJ0H 1YI2P 3QH9A 4H13D 3CXHH 1N7SB 2XZRA 3IFMA 1ZXGA 1X79B 1N2DC 1T6AA 1GW4A 2WPQA 4RESB 5KLVE 3B4SA 2K9JB 4IL6E 2H7HA 4L74A 2R5DA 1VQ4P 1M8OB 1SQXG 2BASA 5KAFE 1N7LA 2Q3IA 1VQ5P 2KZIA 2KK7A 3R2PA 3V5BA 1HGZA 3BRVB 3EFFK 4H0LD 3PRJA 1T2KD 4CPGA 4L76A 2WVRA 4H13C 5APSA 5CCHA 2QJKC 3AE7C 3M9QA 2ZYAA 2C0XA 2AXCA 3GF7A 3WU2H 2QA4P 1NO4A 1KYOD 1M90Q 1BGYG 2AEFA 3AEBC 3PHLA 2E5YA 1PP9J 1ZP0C 2R3SA 2XU6A 1KQFB 4EI2A 1W2BO 2QJPB 3CX5D 2E75D 1IC2A 1JCDA 4OH8B 2BCCE 1RE3A 2G8YA 4BWNA 1ZOYC 4H0LC 1T2KC 1GL2B 1HUCA 2QIWA 3RK3D 4K35A 3CCSP 5APUA 5AVVB 2OYIB 3L71D 2A45I 1FZCA 1H88A 2ZVOB 4U7JA 2ZYDA 3SWFA 4IL6X 1ZMEC 3EQ2A 1LTTC 2LKMA 3AEFC 3CCMP 2FXPA 1RQVA 3G71P 2JEEA 2O01H 1NH4A 4C46A 1FE6A 1QEXA 1PFIA 3C1LA 1SQBK 5CJ0A 3SSUA 3FWNA 1L4AA 1NTZD 1KILD 3S1KA 2Z5IA 2N9YB 1EDIA 5AW0B 2LR2A 3RK3C 3WUUA 1FZFA 1AJYA 3F5HA 4W7YA 4GOEA 3L75G 3CMAP 2JP3A 2E74B 4AQRD 1HH0A 2WSCH 1L0LJ 2ZYGA 2P1JA 2RN0A 4PD4H 1SQBG 4ZMDA 2FYZA 2M5AB 3L74E 2WTYA 2FYNB 5AW6B 1CSBA 3EWKA 2KUBA 1S5LX 1USEA 1YJWP 1QL1A 3H1IJ 5APTA 2ZAEB 1SFCA 3BCCJ 2WPRA 1RE4C 3H25A 5KLIC 3WMM0 2ZFCA 3V2PA 4OGQD 3MHVA 2H8PD 5KLVJ 3FX0A 1EZVG 4TT3H 1SQQD 1SQPD 1SVFA 4LGDE 4Z1MH 1JNMA 1Q81Q 2YXQB 2W6JH 2W6AA 4LC1A 1SQXD 2OYHA 1BDCA 4YPCA 2CPBA 3VMYA 3MGNA 4KHXA 2IFMA 3TGUE 2M0BA 4WY4D 3RL0g 2FXMA 2HODA 5AVZB 4YXDC 3H1LG 3A0HH 4O9BA 3CCLP 5AVQB 1Z56A 3VTPC 1BGYD 1YBKA 4U3FG 5GTHH 1SQVD 1HGVA 1ZV8A 2A06G 5CCGA 2KB7P 1OVRA 5APQA 1EXIA 3BATA 2QRXA 1EDLA 1KYOE 5CJ4A 2BCCJ 2KIKA 1S9KD 3KZIH 2ZT9D 3CX5E 1P84H 4HYTB 1M57D 5APWA 1DX7A 2WSSH 2Q7CA 2Z4EA 3M0AA 2PGDA 1M7LA 1JY2P 4QMAA 1VQ9P 4PV1D 5BU8B 4OVNF 3SFEC 3HD7B 1E79H 1T3UA 3B5NB 2ZT9C 3L4FA 3RBZA 1LTIC 1XTGB 4R4MA 1SLQA 3CC7P 1L4AB 3HTKA 2Q6QA 3CCQP 1NTZE 1GMJA 1NU1K 3L37A 1JTHB 2GUVA 1NYHA 1VF5D 3RL0B 1NJIQ 1UIXA 1FDOA 2IBZD 2B89A 4PV1C 4I7ZC 3P7KA 1NTKK 3HUSC 3AE5C 2WSEH 4HH2A 3CX5I 3EFGA 3CXHI 2WPVB 2KLUA 2IPPA 2D2CB 1LTJB 3F89A 3A0BE 1NU1G 1VL2A 1VF5C 1NTMD 1EZVD 3WUTA 1OMIA 2PAJA 1KQSO 3Q3DA 4WB4A 4A7PA 2FFDB 1KB9E 3PH0A 2P58A 3O8ZA 1GTWA 2O1KA 1URQA 1FU1A 4EIJA 1FOSF 1D7MA 1NTKG 1GU5A 1PP9E 3H1JG 3H32A 1OFCX 2H89C 1S4XA 1EXJA 3JCUE 1SQPE 1SQQE 1N73C 3TNUB 1NAFA 4UB6E 5AW1B 5AW2B 3GF3A 5APXA 3U1CA 3H1LD 2OYHB 3CCRP 3R4YA 1KZUB 5B66H 2W90A 3VP8A 2E5TA 2OGUA 3PJSK 4U3FD 2E76D 3KYQA 1S3JA 4JQ0D 4H44D 4NPDA 2NPSB 2POHA 3H1KD 2R32A 1SQVE 2UWJE 1OVVA 2P7JA 1J1EC 5L8RJ 1OX3A 2KS1B 1N7SD 3CMEP 2I8DA 2B9BA 2P67A 1S9KE 2E76C 2KZJA 5KAIE 4H44C 1EDJA 2HYNA 3H1HD 2HFED 1RF1C 2Y0EA 3L72G 3L71J 1K05A 2YXRB 4N3YB 2K3RA 1DD4A 3L70G 5AW8B 2XNDH 3KDPB 2WSFH 2H43A 4UB8E 2OQQA 2YIUB 3GG2A 1NTZJ 1HWTC 2B87A 2RH0A 1M1KQ 4W7ZA 3H1IE 1WT6A 1FC2C 1QVGO 1FDMA 1CZQA 3BCCE 1KILA 3V6IA 1JY3P 1M56D 3ABVC 2HR3A 1GL2D 2IBZE 1IFJA 1KQLA 5BVZA 1G2CA 4KJMA 1RE4A 2FY8A 1URQC 2J58A 3A7OA 1VDFA 3MIWA 3HE4B 1USDA 1W2EA 2OARA 1KFNA 1BE3D 5AVRB 1J1DB 3RK2B 2FYUJ 1ZLLA 2QJPC 3CI9A 3P8CD 3G9RA 2O01N 5H2FH 2W27A 3M91A 1IK7A 1NTKD 1CI6A 1L0ND 1NTME 3CWBG 3T97A 4ASVA 1GDTA 5AW4B 1GL2C 2KI7B 1SQPJ 1SQQJ 2OTJP 2E43A 5CBNA 2PFXA 3CCEP 3CXHD 2OYIC 1VQMP 1OXZA 1L0LK 1SQXJ 3TYYA 4DJGA 1KN7A 1LWUB 5B5EH 1CW5A 2Y0DA 1PV3A 3CPWO 2WSCJ 3E7KA 3Q5SA 1PGOA 1BCCG 1JY2O 1NOHA 3GMAA 1ZR4A 2YKPA 1S5LE 3LW5H 3ITKA 2YO2A 2XKMA 4ASWA 2IBZI 1BGYJ 4HKZH 4WY4A 1SQVJ 2E75C 1LP1B 5DJTB 2SPZA 1DEEG 2QG4A 4GOFA 1PPJG 5KLVK 1L0LG 3HE5A 2NRGA 1KC8Q 2RKLA 3L35A 5GTIH 1KD1Q 5C39A 3H1KE 3L73G 1GK4A 1KMIZ 3NTNA 1KB9H 1GK6A 1YJ9P 1AVOA 2KXPB 3L72D 4YTPC 2C9NY 2FKWB 4DZOA 1EZVI 3AEEC 3PTZA 2JJLA 1LTSC 3CCUP 2KNCA 1LT9A 1PZQA 3N7NA 3WUVA 2WWWA 3H1HE 1Q86Q 3L70D 1HJBA 1KILC 1KQGB 1RY3A 3OAKA 3TSIA 4D6TD 3CC2P 1IFDA 2XNXA 2FYUD 1VQ8P 2M8RA 2AXTH 1MFZA 1VQ6P 1NGMB 3P32A 4Y99B 2WT7A 2JKVA 3HUSA 1GU4A 2QJYC 2N1TB 3MTUE 2PRRA 2HPCA 3O6QB 1MV8A 4HB1A 3TF5A 4RO0A 2W8ZA 3VOPA 1T3JA 2IX7C 2ITAA 1BSHA 2I1JA 5KJ7D 1AV1A 1RQUA 1LT1A 1DEBA 2G3AA 4PD4D 3CD6P 2VRSA 1KV4A 1YHQP 5KLIB 2NZ2A 3AECC 1NHLA 2BCCG 4OGQC 5E79E 1NAYA 3M06A 3BASA 1JB0J 3CWBD 1JMBA 1OIPA 1BE3E 1NTMJ 1QLED 1N73A 3HD7D 1YYCA 2IZ0A 3AE6C 3B5ND 3U59A 3P8CE 5TISE 1CI6B 3T97B 1L0NE 5TJHA 2L91A 3A3YB 5KJ7C 2ZXEB 3CCJP 4WY4C 3Q5PA 1K04A 5KKZB 4PJ0E 4IFFA 1BCCD 3CXHE 2WMMA 3SWYA 2LXCB 3I5CA 1TU3F 1ZRTD 2L5GB 3H6PA 3H1LJ 3LIEA 4B86A 4EYYQ 1QL2A 1QVFO 3HD7C 4IL6H 2Z5HA 4U3FJ 3RK3E 3B5NC 4C7NA 1FZCB 4Y28J 3L71E 5KAFH 1VQNP 2KLVA 2GUSA 2E42A 2B88A 1H0TA 1DH3A 1LT9C 2CPSA 4JBZA 3H1KJ 3L73D 1NKNA 2IFNA 3L74G 1OW6A 1RF1A 3D6ZA 3L75D 1KILE 3WU2E 1GZLA 3AE1C 1BSNA 1JY3O 5APYA 3VMXA 5AW3B 1FZAA 1SQBD 4YXWH 3H1HJ 1P84D 3QWOC 1N7SA 2MKVA 1LTJC 3FWLA 2KNCB 2O3JA 2R44A 2WZ7A 4I1LA 1SS1A 2J59M 3M9HA 2RMZA 1DIPA 5AVXB 2YKQA 1X9VA 1FZGA 2NPSD 1W5CE 3A2AA 5AVWB 4GODA 4D6TE 3TGUG 3GW6A 1K73Q 1AFOA 2FYUE 3E1IA 3RBXA 3BRTB 1SFCB 5CMZA 4W80A 3AE2C 2C0WA 1S2EA 4TLFA 4K3AA 2BEZF 3TK1A 1OW8A 1JCCA 1U7MA 3L36A 3MUDA 3GLMA 1M1JC 1YJNP 1HF9A 1IK9A 1SQXE 1T8ZA 2GA1A 2XDJA 2V7QJ 3IAOA 4XFJA 2WITA 1K9MQ 1IFMA 2JWAA 1GL2A 1BE3J 4PD4E 2A06D 2HODB 1U7JA 3GHGC 1FAVA 1NTZK 2OYIA 2Y9YA 3LIDA 3IN6A 1GD2E 3IR9A 1BGYE 1N73B 1NTKJ 1L0NJ 1EC5A 5AW9B 2R5BA 2WPSA 1QX8A 4JF7A 3SFDC 1Y9BA 2WQYC 1PGQA 2JDIH 5CHXA 1X8YA 3VMAA 3U1AA 1LTBC 2YNYA 3JSVC 1NTZG 3KXDA 1FJPA 1ZRTE 2PP6A 2YIUC 2IZ1A 1U57A 4R4LA 3G6EP 4C7NB 3V2NA 1L2PA 1J1EB 1JY2N 3L74D 3RK2D 1N7SC 3A0HE 2HG5D 2M3BA 1X22A 2QSIA 2V4HA 2E76B 1SQQK 1SQPK 1SP4A 1H0TB 4GDOA 5GTHE 4PD4I 3JC22 3L73E 1A02J 1JOCA 3I55P 3HTKB 1FBMA 1FZBA 2QE7H 3L75E 1KYOH 3L72J 3OA7A 3KZIE 1AVYA 4WVZA 3CX5H 1J1DC 3V2QA 2M3EA 3PP5A 1SQBE 1P84E 3RK2C 3L70J 1JEKA 4GIFA 2K9YA 3AEAC 1PP9G 1MFTA 1NU1D 1SQVK 1SQPG 1SQQG 3LW5J 4RJTA 1H8AA 2C9LY 3TGUD 4D6TJ 3MUDC 2W6BA 2O01J 1PIXA 3V4WA 2K1AA 3V4QA 1YQ4C 1WMKA 3CC4P 4GT1A 1LWUC 3D6YA 3H1JD 2Q9IA 1EZVE 3G3ZA 3M0DC 1VQLP 2IYPA 1URQB 3CLQA 1AQTA 3H32B 1OVUA 1SQVG 1N86A 3W68A 3RGUA 4DCKA 2E74D 2OTKE 4H13B 3CCVP 2QJKB 3BVHA 4IOIH 1YTZI 4EDFA 3H1LE 3CL3D 2YMYA 3PLNA 5KJ7A 4U3FE 4OWFA 3CWBJ 1IFPA 1HBWA 1P84I 3AEGC 2A06E 1S1CX 3Q1MA 3A0BH 3MD0A 4L75A 3MP7B 1ZW0A 4H0LB 2QM7A 2E74C 3HD7A 4C7RA 1PGJA 2N1TD 5AW5B 3B5NA 1KTMA 3TDKA 3G4SP 1NKZB 1BCCJ 3MZWB 1JMMA 4JYCA 3I56P 1JTHA 2FYNC 3JCUH 3H1IG 1ZN5A 2JR8A 2E75B 1NVOA 2IYOA 4UB6H 1ZR2A 3BCCG 1JO5A 1HJ0A 3Q5RA 1RF0C 1UIIA 2A45G 5KLVG 1JUNA 1NTMK 3B71A 5B66E 1FZEA 4Y99C 1N8RQ 3RK3B 2IBZG 4AUWA 2N1TC 4LLHA 3L73J 4XE5B 5CCHD 4GKGA 1LTGC 1LTJA 3L75J 2B87B
chains in the Genus database with same CATH topology
2IFNA 5CCHA 1RF1A 3M9QA 2R32A 2C0XA 2P7JA 3VP9A 1NO4A 1GZLA 1JY3O 3VN0A 3A5TA 2FFDA 1KILB 5AVSB 1H89A 1J1EC 5APYA 4EOTA 1N7SD 3B8EB 3VMXA 2XU6A 5AW3B 4DOJA 1FZAA 1JY3N 2P67A 1IC2A 1S9KE 1JCDA 1N7SA 4IFDK 4OH8B 1RE3A 1LTJC 3TNUA 2HYNA 2HFED 1G2CB 5CCHC 1RF1C 1T2KC 1IJDB 1GL2B 2WZ7A 4I1LA 1HUCA 3RK3D 4N3YB 2J59M 1IFIA 5APUA 3M9HA 5AVVB 2OYIB 2A45I 5AVXB 1H88A 1FZCA 2YKQA 2KP8A 1X9VA 2O1JA 3SWFA 1FZGA 3EQ2A 1LTTC 2NPSD 2KSJA 5AW8B 2LKMA 1M1JA 3A2AA 3KDPB 2WSFH 5AVWB 2H43A 2JEEA 2O01H 1NH4A 4C46A 1L4AD 1RE3C 2NPSA 1PFIA 1AFOA 3E1IA 1SQBK 3BRTB 5CJ0A 1SFCB 1HWTC 5CMZA 4W80A 2C0WA 1L4AA 4W7ZA 3NMDA 2GM4A 1WT6A 1KILD 3KQGA 3RL0D 3TK1A 1FDMA 2Z5IA 1CZQA 4N78D 5AW0B 3GHGA 1JCCA 1FZCC 1KILA 3RK3C 3L36A 1JY3P 1FZFA 2YO3A 3MUDA 2A45H 4W7YA 1M1JC 3N4XA 1IK9A 1T8ZA 2XDJA 1GL2D 1YTZT 4AQRD 1IFJA 1HH0A 2WSCH 1KQLA 2KOGA 2P1JA 5BVZA 1G2CA 5AW7B 1RE4A 3V2RA 1L4AC 2WITA 3NXSA 1IFMA 1GW3A 1URQC 1GL2A 2J58A 3A7OA 1VDFA 3MIWA 3HE4B 2HODB 1W2EA 2FYZA 1XTCC 2OARA 1KFNA 3GHGC 1FAVA 1NTZK 4WY4B 2OYIA 3LIDA 5AVRB 3RL0C 2WTYA 1GD2E 1J1DB 3IR9A 5AW6B 3RK2B 1CSBA 1ZLLA 1N73B 3CI9A 1SFCD 3HE5B 3P8CD 1QL1A 5APTA 2W27A 3M91A 2I1KA 1CI6A 3T97A 1SFCA 5AW9B 2WPRA 1GDTA 1RE4C 2R5BA 4M3LA 5AW4B 1GL2C 3WMM0 2WPSA 2ZFCA 3C9IA 3V2PA 1LGHB 4JF7A 2E43A 2H8PD 1MUUA 2OYIC 1SVFA 4LGDE 1JNMA 1OXZA 1L0LK 3TYYA 4ZKPA 1LWUB 2W6AA 4LC1A 1X8YA 5CHXA 3U1AA 1LTBC 1CW5A 2YNYA 1LT9B 5BU5A 1FJPA 1A02F 1EQ7A 1VPCA 2PP6A 2OYHA 2CPBA 3VMYA 2FFDC 1JY2O 1NOHA 1SFCC 1ZR4A 2YKPA 3MGNA 4KHXA 2IFMA 4C7NB 4WY4D 1L0NK 3LW5H 2P2UA 3V2NA 2YO2A 3HE4A 2FXMA 1J1EB 2HODA 1JY2N 2XKMA 5AVYB 1J2JB 5AVZB 3RK2D 1N7SC 4O9BA 4WY4A 2HG5D 2M3BA 1HVVA 5AVQB 1LTAC 5CCGD 1Z56A 2Q5UA 3VTPC 1SQQK 1SQPK 1SP4A 1FOSE 1HGVA 1ZV8A 5KLVK 1IFNA 2WT7B 1A02J 1JOCA 3HE5A 5CCGA 2KB7P 3HUSB 2OYHC 5AVUB 3HTKB 5KTBA 5APQA 1FBMA 1FZBA 3L35A 3BATA 2HPCB 1OWAA 1GK4A 5CJ4A 3NFQA 3NTNA 1GK6A 3OA7A 1S9KD 5APVA 2C9NY 2FKWB 2NPSC 1J1DC 4IFMA 4N6JA 4DZOA 3V2QA 3PP5A 4HYTB 1E5WA 1LWUA 3RK2C 2JJLA 1LTSC 5APWA 1LT9A 1IO4A 4GIFA 5CCGC 3N7NA 2WWWA 3M0DA 1DX7A 1MZ9A 1SQVK 1H8AA 1AQ5A 1HJBA 1KILC 2Q7CA 2Z4EA 1RY3A 3OAKA 2C9LY 3M0AA 3TSIA 1M7LA 1JY2P 2W6BA 1WRGA 3V4WA 4AYCA 3V4QA 1IFDA 1G1JA 2XNXA 5BU8B 1M1JB 3VMZA 3KPEA 2M8RA 2MJZA 4GT1A 1MFZA 1LWUC 4I2LC 3HD7B 3HRNA 1T3UA 3P32A 2Q9IA 3B5NB 4WBAA 1KFMA 3G3ZA 3L4FA 4Y99B 2WT7A 3M0DC 1LTIC 1XTGB 3HUSA 1SLQA 1L4AB 3HTKA 1GU4A 1URQB 3CLQA 2HLOA 2N1TB 3MTUE 2HPCA 2YKOA 3OJAB 3P8MC 1NU1K 3L37A 1MV8A 3H32B 1JTHB 2GUVA 3GHGB 1NWQA 3VYIA 4N78E 1N86A 3RL0B 1G1IA 4I6MC 2KYVA 3VOPA 4ZKUA 1T3JA 2IX7C 3BVHA 3M9BA 2R3CA 1YTZI 2I1JA 2FYUK 5KJ7D 1DEBA 3P7KA 1NTKK 2VRSA 3HUSC 3CL3D 2WSEH 2YMYA 4JYBA 1NHLA 5KJ7A 4HH2A 2XV5A 1HBWA 3EFGA 3M06A 3BASA 3UIAA 2IPPA 1N73A 1LTJB 3MD0A 3HD7D 3II6A 1YYCA 4XA4A 1RF1B 2N9BA 3B5ND 2QM7A 1SQXK 1RF0A 3HD7A 4C7RA 3U59A 3P8CE 1URQD 2PAJA 1CI6B 2N1TD 4WB4A 5AW5B 2FFDB 3B5NA 5AVTB 3O8ZA 1NKZB 2QM8A 3A3YB 5KJ7C 2ZXEB 1HTLC 2O1KA 1URQA 1FU1A 1GTWA 4EIJA 1JMMA 1FOSF 2N1TA 4JYCA 4WY4C 1FJKA 1GU5A 3H32A 1JTHA 4IFFA 1N7SB 2XZRA 3SWYA 3IFMA 1ZN5A 3I5CA 1N73C 3TNUB 1X79B 2L5GB 1NAFA 1N2DC 2WPQA 1GW4A 3H6PA 1ZR2A 4RESB 1JO5A 5AW1B 1RF0C 3LIEA 5AW2B 4B86A 1QL2A 3HD7C 5APXA 3U1CA 2OYHB 2A45G 2Z5HA 1JUNA 2H7HA 1KZUB 1NTMK 3B5NC 2R5DA 1FZEA 4Y99C 4C7NA 3VP8A 1FZCB 2BASA 3RK3B 1N7LA 2Q3IA 4AUWA 2N1TC 3KYQA 2KLVA 2GUSA 3R2PA 3V5BA 4LLHA 2E42A 1HGZA 3BRVB 4XE5B 5CCHD 4GKGA 1T2KD 1DH3A 2NPSB 1LT9C 2CPSA 2POHA 1NKNA 1LTGC 1LTJA 5APSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A45 I;  1FZC A;  1FZC C;  1N73 A;  1LTJ B;  1RF1 A;  1FZE A;  2OYI C;  3HUS B;  1N73 B;  2HLO A;  1FZC B;  2OYH C;  3H32 A;  1LWU A;  1FZG A;  2HPC A;  1RF1 B;  1RE3 A;  1LTJ C;  1FZB A;  1RE4 A;  1M1J A;  2XNX A;  3GHG A;  3H32 B;  1LWU B;  3HUS C;  1LT9 A;  1RF0 A;  2HOD A;  2HPC B;  1JY2 N;  1M1J B;  1N73 C;  1JY3 O;  3GHG B;  1RF1 C;  1JY3 P;  1FZF A;  2H43 A;  2FFD A;  1LT9 B;  1N86 A;  2HOD B;  2A45 H;  1LWU C;  1W2E A;  1RE3 C;  2FFD B;  1RE4 C;  1T3U A;  1M1J C;  3E1I A;  3GHG C;  2Q9I A;  2OYI A;  1RF0 C;  1LT9 C;  2OYH A;  2Z4E A;  1LTJ A;  1FZA A;  1JY3 N;  2A45 G;  3BVH A;  1JY2 O;  2FFD C;  2OYI B;  2OYH B;  1JY2 P;  3HUS A; 
#chains in the Genus database with same CATH topology
 4MN4 C;  3VP9 A;  1Q2N A;  3VN0 A;  3A5T A;  2FFD A;  1KB9 D;  2DW3 A;  1KIL B;  5AVS B;  1H89 A;  1SQB J;  3W67 A;  1PL5 A;  4EOT A;  3B8E B;  2OYO A;  1YIJ P;  1NTM G;  1OZH A;  4DOJ A;  1JY3 N;  1PP9 D;  2Q1K A;  4KT0 J;  4NPF X;  5KAI H;  3K5B A;  3ZDM A;  4IFD K;  3TNU A;  2ZVN B;  3D70 A;  1G2C B;  5CCH C;  1IJD B;  3USS A;  1AA0 A;  1IFI A;  1NU1 E;  2QJY B;  1R8E A;  2KP8 A;  2O1J A;  2FBW C;  2KSJ A;  4BRY A;  1M1J A;  1Y8A A;  5KKZ C;  3AE4 C;  4UB8 H;  1L4A D;  1RE3 C;  2NPS A;  3AE3 C;  1NTK E;  3H1J E;  1YQ3 C;  3NMD A;  2GM4 A;  1Y47 A;  3KQG A;  3RL0 D;  4N78 D;  3GHG A;  4OGQ B;  1FZC C;  2YO3 A;  2A45 H;  2KS1 A;  1IZN B;  3KHU A;  3H1K G;  3N4X A;  2WSE J;  5M1B A;  1YTZ T;  4RKU J;  1FS0 E;  2KOG A;  5AW7 B;  3FXD A;  3V2R A;  1L4A C;  3NXS A;  2Y9Z A;  1GW3 A;  4L73 A;  1PPJ D;  1L0L D;  2D2C D;  1XTC C;  2J5U A;  4WY4 B;  1DD3 A;  3RL0 C;  3H1H G;  3D71 A;  3S9O A;  3IF4 A;  1SFC D;  3AED C;  1BDD A;  3HE5 B;  2JO1 A;  5H2F E;  2I1K A;  2P10 A;  2AEJ A;  3H1I D;  4M3L A;  2QEX P;  1Q82 Q;  3C9I A;  1LGH B;  2QVA A;  3BCC D;  3FXE A;  1MUU A;  2FXO A;  2K37 A;  1LNQ A;  3E1R A;  3L72 E;  2D2C C;  2CK3 H;  4ZKP A;  5KLV D;  2ZXX A;  5B5E E;  1LT9 B;  1QGK B;  2ZT9 B;  5BU5 A;  2K9J A;  1A02 F;  1EQ7 A;  1VPC A;  2LXB A;  2FFD C;  1SFC C;  2Y0C A;  3L70 E;  1KYO I;  1RH5 B;  1S5L H;  3L74 J;  2ZJS E;  1L0N K;  2P2U A;  1Q90 D;  3HE4 A;  1YIT P;  5AVY B;  1J2J B;  1R5L A;  1OW7 A;  1VQP P;  1HVV A;  1LTA C;  5CCG D;  2Q5U A;  3C8V A;  4PV1 B;  4I7Z B;  4NPE A;  2JWD A;  1FOS E;  5K5G B;  1VQK P;  1IFN A;  2WT7 B;  3HUS B;  2OYH C;  5AVU B;  2IDB A;  5KTB A;  1BE3 G;  4BXL A;  5GTI E;  2KSE A;  2HPC B;  1OWA A;  3OW2 O;  1KOR A;  3NFQ A;  3Q2Y A;  1PGP A;  5APV A;  4HJG H;  2BCC D;  1VF5 B;  3AE8 C;  5DJU B;  2NPS C;  1L0N G;  2Q3E A;  4IFM A;  4N6J A;  1E5W A;  1LWU A;  1NU1 J;  4ZNC A;  1IO4 A;  1LJ2 A;  5CCG C;  1MKM A;  3M0D A;  3TGU J;  1MZ9 A;  1AQ5 A;  2WSF J;  1WRG A;  4AYC A;  3CWB E;  2OTL P;  1G1J A;  2BEQ D;  3H1J J;  1RHZ B;  4BRY B;  1M1J B;  3VMZ A;  3KPE A;  2MJZ A;  3L71 G;  5EFW B;  2AXT E;  4I2L C;  1LP1 A;  3HRN A;  2W83 C;  4WBA A;  5CBO A;  3FGA D;  1KFM A;  4WWI A;  2HLO A;  2YKO A;  3OJA B;  3P8M C;  4JPZ B;  3GHG B;  1NWQ A;  3VYI A;  1VQO P;  4N78 E;  1BCC E;  1R5S A;  1G1I A;  4I6M C;  2KYV A;  4ZKU A;  3S4R A;  3M9B A;  2R3C A;  1K8A Q;  2K88 A;  2FYU K;  1VQ7 P;  1JM0 A;  1KB9 I;  1EDK A;  1Q7Y Q;  4JYB A;  4DT0 A;  2YMK A;  2M5A A;  2XV5 A;  2V7Q H;  5E79 H;  1PPJ E;  1L0L E;  3UIA A;  1S72 P;  4H44 B;  3II6 A;  4XA4 A;  2H88 C;  1RF1 B;  3AE9 C;  2N9B A;  1SQX K;  2AEM A;  1RF0 A;  5TIS H;  1URQ D;  5AVT B;  3SWK A;  1FDI A;  4D6T G;  2QM8 A;  1HTL C;  2FYU G;  2N1T A;  1FJK A;  1X0T A;  3O6Q A;  4PJ0 H;  1YI2 P;  3QH9 A;  4H13 D;  3CXH H;  1N7S B;  2XZR A;  3IFM A;  1ZXG A;  1X79 B;  1N2D C;  1T6A A;  1GW4 A;  2WPQ A;  4RES B;  5KLV E;  3B4S A;  2K9J B;  4IL6 E;  2H7H A;  4L74 A;  2R5D A;  1VQ4 P;  1M8O B;  1SQX G;  2BAS A;  5KAF E;  1N7L A;  2Q3I A;  1VQ5 P;  2KZI A;  2KK7 A;  3R2P A;  3V5B A;  1HGZ A;  3BRV B;  3EFF K;  4H0L D;  3PRJ A;  1T2K D;  4CPG A;  4L76 A;  2WVR A;  4H13 C;  5APS A;  5CCH A;  2QJK C;  3AE7 C;  3M9Q A;  2ZYA A;  2C0X A;  2AXC A;  3GF7 A;  3WU2 H;  2QA4 P;  1NO4 A;  1KYO D;  1M90 Q;  1BGY G;  2AEF A;  3AEB C;  3PHL A;  2E5Y A;  1PP9 J;  1ZP0 C;  2R3S A;  2XU6 A;  1KQF B;  4EI2 A;  1W2B O;  2QJP B;  3CX5 D;  2E75 D;  1IC2 A;  1JCD A;  4OH8 B;  2BCC E;  1RE3 A;  2G8Y A;  4BWN A;  1ZOY C;  4H0L C;  1T2K C;  1GL2 B;  1HUC A;  2QIW A;  3RK3 D;  4K35 A;  3CCS P;  5APU A;  5AVV B;  2OYI B;  3L71 D;  2A45 I;  1FZC A;  1H88 A;  2ZVO B;  4U7J A;  2ZYD A;  3SWF A;  4IL6 X;  1ZME C;  3EQ2 A;  1LTT C;  2LKM A;  3AEF C;  3CCM P;  2FXP A;  1RQV A;  3G71 P;  2JEE A;  2O01 H;  1NH4 A;  4C46 A;  1FE6 A;  1QEX A;  1PFI A;  3C1L A;  1SQB K;  5CJ0 A;  3SSU A;  3FWN A;  1L4A A;  1NTZ D;  1KIL D;  3S1K A;  2Z5I A;  2N9Y B;  1EDI A;  5AW0 B;  2LR2 A;  3RK3 C;  3WUU A;  1FZF A;  1AJY A;  3F5H A;  4W7Y A;  4GOE A;  3L75 G;  3CMA P;  2JP3 A;  2E74 B;  4AQR D;  1HH0 A;  2WSC H;  1L0L J;  2ZYG A;  2P1J A;  2RN0 A;  4PD4 H;  1SQB G;  4ZMD A;  2FYZ A;  2M5A B;  3L74 E;  2WTY A;  2FYN B;  5AW6 B;  1CSB A;  3EWK A;  2KUB A;  1S5L X;  1USE A;  1YJW P;  1QL1 A;  3H1I J;  5APT A;  2ZAE B;  1SFC A;  3BCC J;  2WPR A;  1RE4 C;  3H25 A;  5KLI C;  3WMM 0;  2ZFC A;  3V2P A;  4OGQ D;  3MHV A;  2H8P D;  5KLV J;  3FX0 A;  1EZV G;  4TT3 H;  1SQQ D;  1SQP D;  1SVF A;  4LGD E;  4Z1M H;  1JNM A;  1Q81 Q;  2YXQ B;  2W6J H;  2W6A A;  4LC1 A;  1SQX D;  2OYH A;  1BDC A;  4YPC A;  2CPB A;  3VMY A;  3MGN A;  4KHX A;  2IFM A;  3TGU E;  2M0B A;  4WY4 D;  3RL0 g;  2FXM A;  2HOD A;  5AVZ B;  4YXD C;  3H1L G;  3A0H H;  4O9B A;  3CCL P;  5AVQ B;  1Z56 A;  3VTP C;  1BGY D;  1YBK A;  4U3F G;  5GTH H;  1SQV D;  1HGV A;  1ZV8 A;  2A06 G;  5CCG A;  2KB7 P;  1OVR A;  5APQ A;  1EXI A;  3BAT A;  2QRX A;  1EDL A;  1KYO E;  5CJ4 A;  2BCC J;  2KIK A;  1S9K D;  3KZI H;  2ZT9 D;  3CX5 E;  1P84 H;  4HYT B;  1M57 D;  5APW A;  1DX7 A;  2WSS H;  2Q7C A;  2Z4E A;  3M0A A;  2PGD A;  1M7L A;  1JY2 P;  4QMA A;  1VQ9 P;  4PV1 D;  5BU8 B;  4OVN F;  3SFE C;  3HD7 B;  1E79 H;  1T3U A;  3B5N B;  2ZT9 C;  3L4F A;  3RBZ A;  1LTI C;  1XTG B;  4R4M A;  1SLQ A;  3CC7 P;  1L4A B;  3HTK A;  2Q6Q A;  3CCQ P;  1NTZ E;  1GMJ A;  1NU1 K;  3L37 A;  1JTH B;  2GUV A;  1NYH A;  1VF5 D;  3RL0 B;  1NJI Q;  1UIX A;  1FDO A;  2IBZ D;  2B89 A;  4PV1 C;  4I7Z C;  3P7K A;  1NTK K;  3HUS C;  3AE5 C;  2WSE H;  4HH2 A;  3CX5 I;  3EFG A;  3CXH I;  2WPV B;  2KLU A;  2IPP A;  2D2C B;  1LTJ B;  3F89 A;  3A0B E;  1NU1 G;  1VL2 A;  1VF5 C;  1NTM D;  1EZV D;  3WUT A;  1OMI A;  2PAJ A;  1KQS O;  3Q3D A;  4WB4 A;  4A7P A;  2FFD B;  1KB9 E;  3PH0 A;  2P58 A;  3O8Z A;  1GTW A;  2O1K A;  1URQ A;  1FU1 A;  4EIJ A;  1FOS F;  1D7M A;  1NTK G;  1GU5 A;  1PP9 E;  3H1J G;  3H32 A;  1OFC X;  2H89 C;  1S4X A;  1EXJ A;  3JCU E;  1SQP E;  1SQQ E;  1N73 C;  3TNU B;  1NAF A;  4UB6 E;  5AW1 B;  5AW2 B;  3GF3 A;  5APX A;  3U1C A;  3H1L D;  2OYH B;  3CCR P;  3R4Y A;  1KZU B;  5B66 H;  2W90 A;  3VP8 A;  2E5T A;  2OGU A;  3PJS K;  4U3F D;  2E76 D;  3KYQ A;  1S3J A;  4JQ0 D;  4H44 D;  4NPD A;  2NPS B;  2POH A;  3H1K D;  2R32 A;  1SQV E;  2UWJ E;  1OVV A;  2P7J A;  1J1E C;  5L8R J;  1OX3 A;  2KS1 B;  1N7S D;  3CME P;  2I8D A;  2B9B A;  2P67 A;  1S9K E;  2E76 C;  2KZJ A;  5KAI E;  4H44 C;  1EDJ A;  2HYN A;  3H1H D;  2HFE D;  1RF1 C;  2Y0E A;  3L72 G;  3L71 J;  1K05 A;  2YXR B;  4N3Y B;  2K3R A;  1DD4 A;  3L70 G;  5AW8 B;  2XND H;  3KDP B;  2WSF H;  2H43 A;  4UB8 E;  2OQQ A;  2YIU B;  3GG2 A;  1NTZ J;  1HWT C;  2B87 A;  2RH0 A;  1M1K Q;  4W7Z A;  3H1I E;  1WT6 A;  1FC2 C;  1QVG O;  1FDM A;  1CZQ A;  3BCC E;  1KIL A;  3V6I A;  1JY3 P;  1M56 D;  3ABV C;  2HR3 A;  1GL2 D;  2IBZ E;  1IFJ A;  1KQL A;  5BVZ A;  1G2C A;  4KJM A;  1RE4 A;  2FY8 A;  1URQ C;  2J58 A;  3A7O A;  1VDF A;  3MIW A;  3HE4 B;  1USD A;  1W2E A;  2OAR A;  1KFN A;  1BE3 D;  5AVR B;  1J1D B;  3RK2 B;  2FYU J;  1ZLL A;  2QJP C;  3CI9 A;  3P8C D;  3G9R A;  2O01 N;  5H2F H;  2W27 A;  3M91 A;  1IK7 A;  1NTK D;  1CI6 A;  1L0N D;  1NTM E;  3CWB G;  3T97 A;  4ASV A;  1GDT A;  5AW4 B;  1GL2 C;  2KI7 B;  1SQP J;  1SQQ J;  2OTJ P;  2E43 A;  5CBN A;  2PFX A;  3CCE P;  3CXH D;  2OYI C;  1VQM P;  1OXZ A;  1L0L K;  1SQX J;  3TYY A;  4DJG A;  1KN7 A;  1LWU B;  5B5E H;  1CW5 A;  2Y0D A;  1PV3 A;  3CPW O;  2WSC J;  3E7K A;  3Q5S A;  1PGO A;  1BCC G;  1JY2 O;  1NOH A;  3GMA A;  1ZR4 A;  2YKP A;  1S5L E;  3LW5 H;  3ITK A;  2YO2 A;  2XKM A;  4ASW A;  2IBZ I;  1BGY J;  4HKZ H;  4WY4 A;  1SQV J;  2E75 C;  1LP1 B;  5DJT B;  2SPZ A;  1DEE G;  2QG4 A;  4GOF A;  1PPJ G;  5KLV K;  1L0L G;  3HE5 A;  2NRG A;  1KC8 Q;  2RKL A;  3L35 A;  5GTI H;  1KD1 Q;  5C39 A;  3H1K E;  3L73 G;  1GK4 A;  1KMI Z;  3NTN A;  1KB9 H;  1GK6 A;  1YJ9 P;  1AVO A;  2KXP B;  3L72 D;  4YTP C;  2C9N Y;  2FKW B;  4DZO A;  1EZV I;  3AEE C;  3PTZ A;  2JJL A;  1LTS C;  3CCU P;  2KNC A;  1LT9 A;  1PZQ A;  3N7N A;  3WUV A;  2WWW A;  3H1H E;  1Q86 Q;  3L70 D;  1HJB A;  1KIL C;  1KQG B;  1RY3 A;  3OAK A;  3TSI A;  4D6T D;  3CC2 P;  1IFD A;  2XNX A;  2FYU D;  1VQ8 P;  2M8R A;  2AXT H;  1MFZ A;  1VQ6 P;  1NGM B;  3P32 A;  4Y99 B;  2WT7 A;  2JKV A;  3HUS A;  1GU4 A;  2QJY C;  2N1T B;  3MTU E;  2PRR A;  2HPC A;  3O6Q B;  1MV8 A;  4HB1 A;  3TF5 A;  4RO0 A;  2W8Z A;  3VOP A;  1T3J A;  2IX7 C;  2ITA A;  1BSH A;  2I1J A;  5KJ7 D;  1AV1 A;  1RQU A;  1LT1 A;  1DEB A;  2G3A A;  4PD4 D;  3CD6 P;  2VRS A;  1KV4 A;  1YHQ P;  5KLI B;  2NZ2 A;  3AEC C;  1NHL A;  2BCC G;  4OGQ C;  5E79 E;  1NAY A;  3M06 A;  3BAS A;  1JB0 J;  3CWB D;  1JMB A;  1OIP A;  1BE3 E;  1NTM J;  1QLE D;  1N73 A;  3HD7 D;  1YYC A;  2IZ0 A;  3AE6 C;  3B5N D;  3U59 A;  3P8C E;  5TIS E;  1CI6 B;  3T97 B;  1L0N E;  5TJH A;  2L91 A;  3A3Y B;  5KJ7 C;  2ZXE B;  3CCJ P;  4WY4 C;  3Q5P A;  1K04 A;  5KKZ B;  4PJ0 E;  4IFF A;  1BCC D;  3CXH E;  2WMM A;  3SWY A;  2LXC B;  3I5C A;  1TU3 F;  1ZRT D;  2L5G B;  3H6P A;  3H1L J;  3LIE A;  4B86 A;  4EYY Q;  1QL2 A;  1QVF O;  3HD7 C;  4IL6 H;  2Z5H A;  4U3F J;  3RK3 E;  3B5N C;  4C7N A;  1FZC B;  4Y28 J;  3L71 E;  5KAF H;  1VQN P;  2KLV A;  2GUS A;  2E42 A;  2B88 A;  1H0T A;  1DH3 A;  1LT9 C;  2CPS A;  4JBZ A;  3H1K J;  3L73 D;  1NKN A;  2IFN A;  3L74 G;  1OW6 A;  1RF1 A;  3D6Z A;  3L75 D;  1KIL E;  3WU2 E;  1GZL A;  3AE1 C;  1BSN A;  1JY3 O;  5APY A;  3VMX A;  5AW3 B;  1FZA A;  1SQB D;  4YXW H;  3H1H J;  1P84 D;  3QWO C;  1N7S A;  2MKV A;  1LTJ C;  3FWL A;  2KNC B;  2O3J A;  2R44 A;  2WZ7 A;  4I1L A;  1SS1 A;  2J59 M;  3M9H A;  2RMZ A;  1DIP A;  5AVX B;  2YKQ A;  1X9V A;  1FZG A;  2NPS D;  1W5C E;  3A2A A;  5AVW B;  4GOD A;  4D6T E;  3TGU G;  3GW6 A;  1K73 Q;  1AFO A;  2FYU E;  3E1I A;  3RBX A;  3BRT B;  1SFC B;  5CMZ A;  4W80 A;  3AE2 C;  2C0W A;  1S2E A;  4TLF A;  4K3A A;  2BEZ F;  3TK1 A;  1OW8 A;  1JCC A;  1U7M A;  3L36 A;  3MUD A;  3GLM A;  1M1J C;  1YJN P;  1HF9 A;  1IK9 A;  1SQX E;  1T8Z A;  2GA1 A;  2XDJ A;  2V7Q J;  3IAO A;  4XFJ A;  2WIT A;  1K9M Q;  1IFM A;  2JWA A;  1GL2 A;  1BE3 J;  4PD4 E;  2A06 D;  2HOD B;  1U7J A;  3GHG C;  1FAV A;  1NTZ K;  2OYI A;  2Y9Y A;  3LID A;  3IN6 A;  1GD2 E;  3IR9 A;  1BGY E;  1N73 B;  1NTK J;  1L0N J;  1EC5 A;  5AW9 B;  2R5B A;  2WPS A;  1QX8 A;  4JF7 A;  3SFD C;  1Y9B A;  2WQY C;  1PGQ A;  2JDI H;  5CHX A;  1X8Y A;  3VMA A;  3U1A A;  1LTB C;  2YNY A;  3JSV C;  1NTZ G;  3KXD A;  1FJP A;  1ZRT E;  2PP6 A;  2YIU C;  2IZ1 A;  1U57 A;  4R4L A;  3G6E P;  4C7N B;  3V2N A;  1L2P A;  1J1E B;  1JY2 N;  3L74 D;  3RK2 D;  1N7S C;  3A0H E;  2HG5 D;  2M3B A;  1X22 A;  2QSI A;  2V4H A;  2E76 B;  1SQQ K;  1SQP K;  1SP4 A;  1H0T B;  4GDO A;  5GTH E;  4PD4 I;  3JC2 2;  3L73 E;  1A02 J;  1JOC A;  3I55 P;  3HTK B;  1FBM A;  1FZB A;  2QE7 H;  3L75 E;  1KYO H;  3L72 J;  3OA7 A;  3KZI E;  1AVY A;  4WVZ A;  3CX5 H;  1J1D C;  3V2Q A;  2M3E A;  3PP5 A;  1SQB E;  1P84 E;  3RK2 C;  3L70 J;  1JEK A;  4GIF A;  2K9Y A;  3AEA C;  1PP9 G;  1MFT A;  1NU1 D;  1SQV K;  1SQP G;  1SQQ G;  3LW5 J;  4RJT A;  1H8A A;  2C9L Y;  3TGU D;  4D6T J;  3MUD C;  2W6B A;  2O01 J;  1PIX A;  3V4W A;  2K1A A;  3V4Q A;  1YQ4 C;  1WMK A;  3CC4 P;  4GT1 A;  1LWU C;  3D6Y A;  3H1J D;  2Q9I A;  1EZV E;  3G3Z A;  3M0D C;  1VQL P;  2IYP A;  1URQ B;  3CLQ A;  1AQT A;  3H32 B;  1OVU A;  1SQV G;  1N86 A;  3W68 A;  3RGU A;  4DCK A;  2E74 D;  2OTK E;  4H13 B;  3CCV P;  2QJK B;  3BVH A;  4IOI H;  1YTZ I;  4EDF A;  3H1L E;  3CL3 D;  2YMY A;  3PLN A;  5KJ7 A;  4U3F E;  4OWF A;  3CWB J;  1IFP A;  1HBW A;  1P84 I;  3AEG C;  2A06 E;  1S1C X;  3Q1M A;  3A0B H;  3MD0 A;  4L75 A;  3MP7 B;  1ZW0 A;  4H0L B;  2QM7 A;  2E74 C;  3HD7 A;  4C7R A;  1PGJ A;  2N1T D;  5AW5 B;  3B5N A;  1KTM A;  3TDK A;  3G4S P;  1NKZ B;  1BCC J;  3MZW B;  1JMM A;  4JYC A;  3I56 P;  1JTH A;  2FYN C;  3JCU H;  3H1I G;  1ZN5 A;  2JR8 A;  2E75 B;  1NVO A;  2IYO A;  4UB6 H;  1ZR2 A;  3BCC G;  1JO5 A;  1HJ0 A;  3Q5R A;  1RF0 C;  1UII A;  2A45 G;  5KLV G;  1JUN A;  1NTM K;  3B71 A;  5B66 E;  1FZE A;  4Y99 C;  1N8R Q;  3RK3 B;  2IBZ G;  4AUW A;  2N1T C;  4LLH A;  3L73 J;  4XE5 B;  5CCH D;  4GKG A;  1LTG C;  1LTJ A;  3L75 J;  2B87 B; 
#chains in the Genus database with same CATH homology
 2IFN A;  5CCH A;  1RF1 A;  3M9Q A;  2R32 A;  2C0X A;  2P7J A;  3VP9 A;  1NO4 A;  1GZL A;  1JY3 O;  3VN0 A;  3A5T A;  2FFD A;  1KIL B;  5AVS B;  1H89 A;  1J1E C;  5APY A;  4EOT A;  1N7S D;  3B8E B;  3VMX A;  2XU6 A;  5AW3 B;  4DOJ A;  1FZA A;  1JY3 N;  2P67 A;  1IC2 A;  1S9K E;  1JCD A;  1N7S A;  4IFD K;  4OH8 B;  1RE3 A;  1LTJ C;  3TNU A;  2HYN A;  2HFE D;  1G2C B;  5CCH C;  1RF1 C;  1T2K C;  1IJD B;  1GL2 B;  2WZ7 A;  4I1L A;  1HUC A;  3RK3 D;  4N3Y B;  2J59 M;  1IFI A;  5APU A;  3M9H A;  5AVV B;  2OYI B;  2A45 I;  5AVX B;  1H88 A;  1FZC A;  2YKQ A;  2KP8 A;  1X9V A;  2O1J A;  3SWF A;  1FZG A;  3EQ2 A;  1LTT C;  2NPS D;  2KSJ A;  5AW8 B;  2LKM A;  1M1J A;  3A2A A;  3KDP B;  2WSF H;  5AVW B;  2H43 A;  2JEE A;  2O01 H;  1NH4 A;  4C46 A;  1L4A D;  1RE3 C;  2NPS A;  1PFI A;  1AFO A;  3E1I A;  1SQB K;  3BRT B;  5CJ0 A;  1SFC B;  1HWT C;  5CMZ A;  4W80 A;  2C0W A;  1L4A A;  4W7Z A;  3NMD A;  2GM4 A;  1WT6 A;  1KIL D;  3KQG A;  3RL0 D;  3TK1 A;  1FDM A;  2Z5I A;  1CZQ A;  4N78 D;  5AW0 B;  3GHG A;  1JCC A;  1FZC C;  1KIL A;  3RK3 C;  3L36 A;  1JY3 P;  1FZF A;  2YO3 A;  3MUD A;  2A45 H;  4W7Y A;  1M1J C;  3N4X A;  1IK9 A;  1T8Z A;  2XDJ A;  1GL2 D;  1YTZ T;  4AQR D;  1IFJ A;  1HH0 A;  2WSC H;  1KQL A;  2KOG A;  2P1J A;  5BVZ A;  1G2C A;  5AW7 B;  1RE4 A;  3V2R A;  1L4A C;  2WIT A;  3NXS A;  1IFM A;  1GW3 A;  1URQ C;  1GL2 A;  2J58 A;  3A7O A;  1VDF A;  3MIW A;  3HE4 B;  2HOD B;  1W2E A;  2FYZ A;  1XTC C;  2OAR A;  1KFN A;  3GHG C;  1FAV A;  1NTZ K;  4WY4 B;  2OYI A;  3LID A;  5AVR B;  3RL0 C;  2WTY A;  1GD2 E;  1J1D B;  3IR9 A;  5AW6 B;  3RK2 B;  1CSB A;  1ZLL A;  1N73 B;  3CI9 A;  1SFC D;  3HE5 B;  3P8C D;  1QL1 A;  5APT A;  2W27 A;  3M91 A;  2I1K A;  1CI6 A;  3T97 A;  1SFC A;  5AW9 B;  2WPR A;  1GDT A;  1RE4 C;  2R5B A;  4M3L A;  5AW4 B;  1GL2 C;  3WMM 0;  2WPS A;  2ZFC A;  3C9I A;  3V2P A;  1LGH B;  4JF7 A;  2E43 A;  2H8P D;  1MUU A;  2OYI C;  1SVF A;  4LGD E;  1JNM A;  1OXZ A;  1L0L K;  3TYY A;  4ZKP A;  1LWU B;  2W6A A;  4LC1 A;  1X8Y A;  5CHX A;  3U1A A;  1LTB C;  1CW5 A;  2YNY A;  1LT9 B;  5BU5 A;  1FJP A;  1A02 F;  1EQ7 A;  1VPC A;  2PP6 A;  2OYH A;  2CPB A;  3VMY A;  2FFD C;  1JY2 O;  1NOH A;  1SFC C;  1ZR4 A;  2YKP A;  3MGN A;  4KHX A;  2IFM A;  4C7N B;  4WY4 D;  1L0N K;  3LW5 H;  2P2U A;  3V2N A;  2YO2 A;  3HE4 A;  2FXM A;  1J1E B;  2HOD A;  1JY2 N;  2XKM A;  5AVY B;  1J2J B;  5AVZ B;  3RK2 D;  1N7S C;  4O9B A;  4WY4 A;  2HG5 D;  2M3B A;  1HVV A;  5AVQ B;  1LTA C;  5CCG D;  1Z56 A;  2Q5U A;  3VTP C;  1SQQ K;  1SQP K;  1SP4 A;  1FOS E;  1HGV A;  1ZV8 A;  5KLV K;  1IFN A;  2WT7 B;  1A02 J;  1JOC A;  3HE5 A;  5CCG A;  2KB7 P;  3HUS B;  2OYH C;  5AVU B;  3HTK B;  5KTB A;  5APQ A;  1FBM A;  1FZB A;  3L35 A;  3BAT A;  2HPC B;  1OWA A;  1GK4 A;  5CJ4 A;  3NFQ A;  3NTN A;  1GK6 A;  3OA7 A;  1S9K D;  5APV A;  2C9N Y;  2FKW B;  2NPS C;  1J1D C;  4IFM A;  4N6J A;  4DZO A;  3V2Q A;  3PP5 A;  4HYT B;  1E5W A;  1LWU A;  3RK2 C;  2JJL A;  1LTS C;  5APW A;  1LT9 A;  1IO4 A;  4GIF A;  5CCG C;  3N7N A;  2WWW A;  3M0D A;  1DX7 A;  1MZ9 A;  1SQV K;  1H8A A;  1AQ5 A;  1HJB A;  1KIL C;  2Q7C A;  2Z4E A;  1RY3 A;  3OAK A;  2C9L Y;  3M0A A;  3TSI A;  1M7L A;  1JY2 P;  2W6B A;  1WRG A;  3V4W A;  4AYC A;  3V4Q A;  1IFD A;  1G1J A;  2XNX A;  5BU8 B;  1M1J B;  3VMZ A;  3KPE A;  2M8R A;  2MJZ A;  4GT1 A;  1MFZ A;  1LWU C;  4I2L C;  3HD7 B;  3HRN A;  1T3U A;  3P32 A;  2Q9I A;  3B5N B;  4WBA A;  1KFM A;  3G3Z A;  3L4F A;  4Y99 B;  2WT7 A;  3M0D C;  1LTI C;  1XTG B;  3HUS A;  1SLQ A;  1L4A B;  3HTK A;  1GU4 A;  1URQ B;  3CLQ A;  2HLO A;  2N1T B;  3MTU E;  2HPC A;  2YKO A;  3OJA B;  3P8M C;  1NU1 K;  3L37 A;  1MV8 A;  3H32 B;  1JTH B;  2GUV A;  3GHG B;  1NWQ A;  3VYI A;  4N78 E;  1N86 A;  3RL0 B;  1G1I A;  4I6M C;  2KYV A;  3VOP A;  4ZKU A;  1T3J A;  2IX7 C;  3BVH A;  3M9B A;  2R3C A;  1YTZ I;  2I1J A;  2FYU K;  5KJ7 D;  1DEB A;  3P7K A;  1NTK K;  2VRS A;  3HUS C;  3CL3 D;  2WSE H;  2YMY A;  4JYB A;  1NHL A;  5KJ7 A;  4HH2 A;  2XV5 A;  1HBW A;  3EFG A;  3M06 A;  3BAS A;  3UIA A;  2IPP A;  1N73 A;  1LTJ B;  3MD0 A;  3HD7 D;  3II6 A;  1YYC A;  4XA4 A;  1RF1 B;  2N9B A;  3B5N D;  2QM7 A;  1SQX K;  1RF0 A;  3HD7 A;  4C7R A;  3U59 A;  3P8C E;  1URQ D;  2PAJ A;  1CI6 B;  2N1T D;  4WB4 A;  5AW5 B;  2FFD B;  3B5N A;  5AVT B;  3O8Z A;  1NKZ B;  2QM8 A;  3A3Y B;  5KJ7 C;  2ZXE B;  1HTL C;  2O1K A;  1URQ A;  1FU1 A;  1GTW A;  4EIJ A;  1JMM A;  1FOS F;  2N1T A;  4JYC A;  4WY4 C;  1FJK A;  1GU5 A;  3H32 A;  1JTH A;  4IFF A;  1N7S B;  2XZR A;  3SWY A;  3IFM A;  1ZN5 A;  3I5C A;  1N73 C;  3TNU B;  1X79 B;  2L5G B;  1NAF A;  1N2D C;  2WPQ A;  1GW4 A;  3H6P A;  1ZR2 A;  4RES B;  1JO5 A;  5AW1 B;  1RF0 C;  3LIE A;  5AW2 B;  4B86 A;  1QL2 A;  3HD7 C;  5APX A;  3U1C A;  2OYH B;  2A45 G;  2Z5H A;  1JUN A;  2H7H A;  1KZU B;  1NTM K;  3B5N C;  2R5D A;  1FZE A;  4Y99 C;  4C7N A;  3VP8 A;  1FZC B;  2BAS A;  3RK3 B;  1N7L A;  2Q3I A;  4AUW A;  2N1T C;  3KYQ A;  2KLV A;  2GUS A;  3R2P A;  3V5B A;  4LLH A;  2E42 A;  1HGZ A;  3BRV B;  4XE5 B;  5CCH D;  4GKG A;  1T2K D;  1DH3 A;  2NPS B;  1LT9 C;  2CPS A;  2POH A;  1NKN A;  1LTG C;  1LTJ A;  5APS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...