1FZAA

Crystal structure of fibrinogen fragment d
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
85
structure length
85
Chain Sequence
VSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin.
pubmed doi rcsb
molecule tags Blood coagulation
molecule keywords FIBRINOGEN
total genus 30
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzaA00
2Q9IA 2A45I 1JY2N 3HUSB 1N73A 2Z4EA 1FZCA 1FZCB 2HODA 1FZCC 1RF1B 1RF0C 1RF1A 1W2EA 2HLOA 2OYIA 1N73C 1FZEA 1M1JA 2A45G 1M1JC 1N73B 1JY3O 2FFDA 1LT9B 2FFDC 1FZBA 1RE3A 1JY3P 3GHGC 1LT9A 2OYHC 1LT9C 2OYHA 1LWUB 1JY3N 2XNXA 1FZFA 1FZAA 2A45H 1RF0A 1RE4C 1LTJB 1LTJA 1JY2P 2HODB 3HUSA 1RF1C 1LTJC 2OYIC 3HUSC 2OYIB 2HPCA 1JY2O 1LWUA 1LWUC 3GHGA 3H32A 3BVHA 2OYHB 3GHGB 3H32B 1RE3C 2FFDB 1N86A 1M1JB 3E1IA 1FZGA 1RE4A 1T3UA 2H43A 2HPCB
chains in the Genus database with same CATH superfamily
1PP9G 3CX5E 1YYCA 4H13B 2RH0A 2OARA 2H8PD 1LTTC 3NMDA 3A0HE 5KTBA 1FZCC 1BE3G 1SQXD 1W2EA 1M7LA 3H1KG 2WVRA 4YXWH 2H7HA 3HD7D 1LT9B 3VOPA 2WSFJ 1RE3A 2AXTH 1CI6A 1JTHA 3W67A 1KD1Q 5KLVK 1SQVE 3H1HJ 3RK2B 3S4RA 1DD4A 2IZ1A 3KYQA 2BCCD 2K9JB 4RKUJ 2Z5HA 5AVVB 1FJPA 3V6IA 1J2JB 3L70G 3L74G 1M57D 2ZYAA 2WWWA 3RBXA 5KLVE 3A2AA 3H25A 1UIXA 1YHQP 1PFIA 3EFFK 3CWBG 2BCCE 1AFOA 2OQQA 3H1JE 2FKWB 3I5CA 1QVFO 4UB6E 5TISH 1FZGA 1BGYG 2KNCB 3JSVC 3V2PA 2Q9IA 2PAJA 1XTGB 1JMBA 1SFCC 3S9OA 1RF1A 3G4SP 1E5WA 3PP5A 4L75A 3B71A 2AEMA 1VQOP 2M3BA 1IJDB 1R5LA 5E79E 3ITKA 3RL0g 1VQMP 5AVYB 2QJKC 3RBZA 1ZRTD 1USDA 1JY3P 1SQPJ 2OYHC 1NKNA 3FGAD 4N78E 1NHLA 1VF5D 1KYOD 1RY3A 2A45H 2PGDA 1GL2B 2QJYB 2YXRB 1S72P 1USEA 3HUSA 2P1JA 1L0LK 1NOHA 1NTMJ 4H13C 4ZMDA 2KXPB 3I55P 1SQBJ 2JWAA 2FXOA 4HJGH 2QRXA 2RMZA 2IYPA 3H32A 4PJ0H 4TLFA 4BRYB 1JMMA 2B87A 3RL0D 1FBMA 1HUCA 2KIKA 3E1IA 3ZDMA 5CCGA 5AW9B 2NPSD 1FU1A 3CX5I 4L74A 4OGQC 5KLVG 3WU2E 1NH4A 1N73A 2H43A 2HR3A 2WMMA 1JO5A 1OIPA 2E5TA 1E79H 5APQA 3TNUA 3VMZA 2KS1B 1OVVA 3H1JG 3HTKA 4HH2A 1YI2P 1EZVI 4JPZB 1LT1A 1BGYE 1DEEG 4BXLA 1N7SB 2FFDC 1KQLA 1SQBD 3M9HA 1GW3A 2W6BA 4NPDA 5KAIE 1VQKP 2W83C 2XNXA 3B4SA 3GF3A 1X8YA 1FJKA 2K88A 3AE5C 4LC1A 3D6YA 1LTJC 1PPJD 1U7JA 1J1EB 2FYUG 3H1LJ 4N6JA 1SFCB 1J1DC 2O01H 1IFNA 1Y47A 1BE3D 1SQXG 3L75J 2ZJSE 4WB4A 5AW1B 1KV4A 2Y0EA 2K1AA 1ZRTE 1ZOYC 1GDTA 3B5NB 4N78D 5CHXA 1NTZE 3C8VA 3CWBJ 5CBOA 1N86A 1M1JB 2MKVA 1G2CB 3L73D 3PTZA 2O1JA 1CW5A 1J1DB 2J5UA 1H89A 5B66H 2Z4EA 2WSEH 1RQVA 2YIUC 2QIWA 3AEFC 3AE2C 4MN4C 1NTMG 5AW8B 5L8RJ 4ASWA 1NTKG 3W68A 2JDIH 1AQ5A 1ZMEC 1LTIC 3MIWA 3IF4A 1ZLLA 3B5ND 3CXHI 1NGMB 2WT7A 1ZR2A 1A02F 2IX7C 3L71G 2ZAEB 3V2RA 3TF5A 1GU5A 3O6QB 1FS0E 1AQTA 3MUDC 1IZNB 3N4XA 4XA4A 4D6TD 4C7RA 3CC2P 3MGNA 4CPGA 1RE4C 1LTJB 5C39A 3H1LE 2MJZA 2M5AB 3P8MC 2A06E 5KLVD 4DZOA 3GF7A 1BSNA 2ZYDA 1T2KD 1Y8AA 3LW5J 1GD2E 1URQB 4WY4C 1PIXA 1LTAC 3Q5PA 1FC2C 3V2QA 2OTKE 4JYCA 5CJ4A 5GTIH 5AVXB 1S9KE 3MD0A 1RE3C 1SQVD 2NPSB 3SSUA 5GTHE 1NTKD 2N1TA 2POHA 2WPRA 1OVUA 3F5HA 3CLQA 1T6AA 1T3UA 1SQXE 3EWKA 1JB0J 2V4HA 3LIDA 4KJMA 3IR9A 4LGDE 5AVZB 1N2DC 2H88C 1YQ3C 3CL3D 4I7ZB 1FZCA 3C1LA 2V7QH 1FZCB 2K37A 1DX7A 1P84H 3OW2O 2KOGA 5APTA 4PD4I 2N1TB 2IFMA 1YJNP 2FFDA 2ZYGA 3BATA 3KQGA 5DJTB 3CX5D 1T8ZA 4IFFA 3VN0A 5B5EE 1A02J 3CC4P 3H1HG 3GHGC 1IFMA 3L73E 1AVYA 2Z5IA 4GOEA 3O8ZA 1LP1A 1URQA 1JY3N 1L0LG 2N9BA 2FYNC 5APYA 1R8EA 1JNMA 1KTMA 1SQVK 3HE5B 2M5AA 2W27A 4PD4D 3CCLP 2OYIC 1LTJA 1SFCD 2KLUA 1PL5A 1FE6A 3TGUE 1FDOA 1K9MQ 2SPZA 1GU4A 4Y28J 4AQRD 2FXMA 1W5CE 1KILC 3AEEC 1BSHA 4RESB 2WT7B 1QVGO 2IDBA 1WRGA 2O1KA 1EXIA 3L72D 1NYHA 5CBNA 1KQGB 3CD6P 3IN6A 3B8EB 4DT0A 1UIIA 3NFQA 1QGKB 1L4AD 1M1JA 1LP1B 1T3JA 4KHXA 1SVFA 4HKZH 1X79B 3MP7B 3UIAA 1Q7YQ 1VQ9P 3A0BE 4OWFA 1VDFA 4BWNA 2GA1A 3C9IA 1JEKA 1SFCA 5KJ7C 3SWFA 1EDJA 2GUSA 2OYOA 3II6A 3WU2H 1EZVD 1GMJA 1NO4A 4I6MC 1Q2NA 3TSIA 3AECC 3M0AA 4GODA 5AVRB 1BGYJ 1P84I 1EDIA 5B5EH 1L0NG 1L0LE 4GOFA 1P84E 1KILD 2R3SA 3L72J 4PD4E 2Q7CA 1GZLA 1HJ0A 1KB9I 2Q1KA 5EFWB 1YJWP 1N7SA 3BVHA 3HD7C 1OWAA 5KLIB 1SQPE 4Y99C 2I1JA 4WY4B 1RE4A 2M8RA 3PH0A 3Q2YA 1N73C 1DH3A 3PJSK 3QH9A 1L0NJ 1S2EA 2QEXP 3R2PA 1KC8Q 5AW6B 3CCUP 1CSBA 1GW4A 1SQPK 1H0TA 1G1JA 3AE7C 4O9BA 2L5GB 2B87B 1NTZJ 2J59M 4IL6X 5CMZA 5BU8B 4BRYA 1IO4A 4KT0J 4WY4D 5DJUB 1H0TB 3CCMP 1GK6A 1PGOA 2ZXEB 2K3RA 3Q1MA 2B9BA 3BCCD 1YTZI 1J1EC 2YIUB 3F89A 3L74E 4QMAA 4UB6H 4AYCA 1M56D 4UB8H 4TT3H 3H1LD 3CI9A 3S1KA 2R32A 1ZN5A 2ZXXA 3B5NA 2OTJP 1VF5B 2KZIA 3H1IJ 3PLNA 4OVNF 1EXJA 2ITAA 1LTBC 1MFZA 2WPVB 1AVOA 1L0NE 2ZT9C 1YTZT 2A45I 1KB9H 1KFMA 1HVVA 1NAYA 4H0LD 1XTCC 2E76C 2WZ7A 1FOSE 3CPWO 3L70J 2KB7P 4XFJA 1DIPA 1T2KC 4OGQB 1S9KD 3HE5A 2Q3IA 3LW5H 3CCRP 2WSCH 1NJIQ 4WY4A 2E5YA 3NXSA 1LGHB 5CJ0A 3PHLA 2WSEJ 1LT9C 3L4FA 4I2LC 4LLHA 1JUNA 3GLMA 2KS1A 3HTKB 4H0LB 3TNUB 3H1ID 2N1TC 3M91A 2AXTE 3BCCE 3LIEA 1RF1C 1BE3E 4JF7A 1S4XA 3H1KE 4OGQD 1OW8A 4DCKA 2FXPA 4Z1MH 1OX3A 5KLVJ 1PGJA 1M90Q 2QG4A 1LWUC 1MV8A 2O01J 1S1CX 1YQ4C 2E74C 2FYUK 3P32A 2QJPC 1L4AC 4N3YB 4WWIA 2YMYA 3RK3E 3H32B 4D6TG 1KQSO 3L72G 1HJBA 5APUA 1BCCD 1JCCA 2P10A 3A7OA 3AEGC 3KHUA 2GUVA 4JQ0D 3SWYA 2YMKA 3HUSB 1TU3F 3L70E 1GL2A 1YJ9P 2CK3H 5AVWB 4K3AA 2OYIA 1M8OB 2R44A 5CCHA 1FZEA 2IPPA 2QVAA 2YKPA 3A3YB 1SQXK 4RO0A 2YNYA 3V4WA 1FZBA 3OAKA 3O6QA 1IK7A 1K04A 1KILE 4UB8E 3AEAC 1LTSC 2M3EA 1OMIA 5KKZB 3H1HD 1FZFA 1EC5A 2Y0CA 4ZKUA 3H1KJ 1NTKJ 5CCHC 3IFMA 3M9QA 1WMKA 3H6PA 3FX0A 2QJYC 4JBZA 3EQ2A 5BVZA 1VQLP 2I8DA 1SQBE 1PP9J 3D6ZA 1BCCJ 2W8ZA 4GIFA 2NRGA 3VMYA 1NWQA 1AV1A 3RK2C 3SFDC 1BGYD 5APXA 1IFJA 3E1RA 2IBZI 1SQVG 1S3JA 1SQBG 2JP3A 2FY8A 2PP6A 5KJ7A 2P67A 3AEBC 3CC7P 1HGVA 1AJYA 2JEEA 2CPBA 1HBWA 2XZRA 2FYUJ 1SQQD 5AW5B 3V4QA 4EDFA 1EDLA 2LXBA 3L72E 3JCUE 2IBZG 3A5TA 4I1LA 1M1JC 2KK7A 1BDDA 2Q6QA 2G3AA 4PD4H 3L35A 4C7NA 2BCCG 1CI6B 1JTHB 2JJLA 1WT6A 3CCJP 2NPSA 1LT9A 5CCGD 3H1JD 3OA7A 1N7SC 3M06A 3MZWB 1U57A 3MUDA 1FZAA 1SP4A 1JY2P 5KJ7D 1KYOE 1OZHA 2A06G 2IBZD 3KZIE 1NKZB 1DD3A 1KMIZ 2W90A 2WSCJ 1NTMD 3WUUA 4EOTA 1H88A 2BEZF 2QSIA 1L4AA 1KFNA 2YO3A 1K05A 2B89A 3G9RA 1NU1K 3H1IG 3HD7A 4R4MA 2P2UA 5CCGC 2YXQB 3GG2A 2C0XA 1URQC 3L74J 1PV3A 3BASA 2FYUE 2OTLP 1L0ND 2R3CA 2JR8A 2E42A 1QLED 1S5LE 3CCQP 3PRJA 4W7YA 2QM8A 1YIJP 1Q81Q 2OYIB 1LJ2A 2VRSA 5AW7B 3U59A 2IYOA 4GKGA 3N7NA 1G2CA 1L0LJ 1NTMK 2CPSA 5AW3B 1NTZG 2D2CB 1Q86Q 4R4LA 2JKVA 3B5NC 3RK3B 1LWUB 1CZQA 1Z56A 3IAOA 3USSA 2IBZE 5B66E 1VPCA 5TISE 1URQD 2HODB 2HFED 1RHZB 1ZW0A 2XDJA 1NTME 2E76B 3M0DC 4PJ0E 1ZR4A 3TDKA 2M0BA 2WSFH 2L91A 3L74D 3RL0C 4IOIH 1GL2D 3JCUH 2N9YB 3AE6C 1MFTA 1G1IA 2QM7A 3GMAA 5H2FH 2D2CD 2O3JA 3CWBD 3CMEP 3G71P 3GHGB 1SQQK 2WTYA 1BCCG 1L0NK 3KDPB 3P8CD 4U3FJ 3Q5RA 3AE4C 4NPFX 2LKMA 1SLQA 1SQQE 5M1BA 4RJTA 3CMAP 3RL0B 2N1TD 5AW4B 2FFDB 3SWKA 2KSEA 1NTZK 5GTIE 1SQQG 3HE4A 3U1AA 4DOJA 1N73B 1FAVA 2HG5D 1N7LA 2KUBA 3K5BA 1IK9A 3L36A 3R4YA 2D2CC 5APWA 5KAFH 3RK3C 1X0TA 1HWTC 1GTWA 1IFDA 3SFEC 2XV5A 4GT1A 1VQNP 1KN7A 3CX5H 4WVZA 1SS1A 1S5LX 3V2NA 1RF0A 2C9LY 3V5BA 4L76A 1IFPA 1KZUB 2E75C 4U3FD 1VQ6P 2HPCA 3TGUJ 3L75E 1GL2C 1HGZA 4W80A 1QEXA 1U7MA 1EZVE 4IL6E 5KLIC 4Y99B 3CXHE 1SQVJ 2FBWC 2P58A 2WSSH 3H1HE 3CCSP 2C9NY 2RKLA 1MZ9A 1NAFA 1R5SA 2KI7B 1X9VA 2OGUA 2GM4A 2IZ0A 2J58A 2E74D 2QE7H 1Y9BA 2JWDA 1HF9A 1JY2N 1PGPA 5TJHA 1OW7A 3TGUG 5GTHH 3H1LG 2W6JH 3BCCJ 2E75D 5K5GB 4C46A 1RF1B 1BCCE 2DW3A 2A45G 2ZT9B 1OW6A 2KNCA 1FDIA 4XE5B 3RK3D 1QL2A 3HRNA 5AVUB 3M9BA 1VQPP 1YITP 2E74B 3Q3DA 3VP9A 2P7JA 4HYTB 4L73A 1AA0A 2BASA 2KSJA 1VQ5P 4IFDK 2R5DA 1OFCX 3JC22 3TGUD 1FDMA 3AE8C 1X22A 3FXEA 2E75B 1OVRA 5APSA 1JM0A 3VP8A 3AE3C 2PRRA 1RQUA 2UWJE 1JY2O 2Q3EA 2ZT9D 3H1KD 3KXDA 4H0LC 3VMAA 2K9JA 1KB9D 4YTPC 4B86A 4EIJA 1LTGC 4PV1C 1KILA 2V7QJ 1EQ7A 2B88A 2LR2A 1JOCA 3L73G 4AUWA 4YXDC 1SQXJ 3L75G 1N7SD 1KORA 1VQ8P 1EZVG 1YBKA 4GDOA 1BDCA 2AEFA 1RF0C 2Y0DA 5H2FE 1FOSF 2ZFCA 4JYBA 1NTKE 1PPJG 2FYUD 2AEJA 3CXHH 1OXZA 3AEDC 1EDKA 1W2BO 1PGQA 3FWNA 1VF5C 1MUUA 1GK4A 2BCCJ 2XKMA 4H44B 1S5LH 1SQPG 2Q5UA 3FWLA 2C0WA 3L71E 4NPEA 2PFXA 1VQ4P 1NTKK 2A06D 2IFNA 2WPQA 3H1JJ 3WUVA 2WQYC 3BCCG 3T97A 4I7ZC 1HTLC 1Q90D 4K35A 4W7ZA 1RH5B 1ZXGA 1LWUA 2RN0A 3L71D 5KKZC 3KPEA 3A0HH 5E79H 3FXDA 4ZNCA 2FYZA 1ZV8A 4D6TE 2OYHB 2AXCA 3TK1A 4HB1A 2ZVNB 2NZ2A 2XU6A 1IFIA 2HPCB 2H89C 5BU5A 3L37A 4EI2A 1MKMA 5AVQB 4H13D 2Y9ZA 1K8AQ 4ZKPA 1N8RQ 2HLOA 1NU1D 1VL2A 1SQPD 3OJAB 2R5BA 2BEQD 2I1KA 2YKQA 1NTZD 3EFGA 4IL6H 3T97B 1JY3O 5AVSB 1KYOH 3KZIH 3NTNA 3WMM0 3HD7B 5CCHD 1PP9D 2YKOA 3AE9C 1L4AB 4H44C 1P84D 1KB9E 3L71J 1L0LD 4PV1B 1DEBA 1LNQA 3TYYA 3HE4B 1Q82Q 2O01N 4OH8B 3RK2D 1PPJE 1K73Q 1H8AA 3VYIA 1KYOI 4DJGA 4A7PA 1BE3J 3L75D 3RGUA 1M1KQ 5KAFE 1NU1G 3BRTB 1VQ7P 3ABVC 3P7KA 3GHGA 4D6TJ 3BRVB 1PZQA 2WITA 4PV1D 1QX8A 5APVA 3WUTA 4C7NB 3CCEP 1KILB 3M0DA 1NU1J 1JCDA 4ASVA 1SQBK 1D7MA 3G3ZA 3MTUE 3QWOC 5KAIH 2HODA 2G8YA 3Q5SA 3AE1C 1QL1A 4WBAA 2XNDH 2QA4P 2ZVOB 2HYNA 3L70D 2FYNB 3MHVA 2WPSA 1IC2A 3I56P 4IFMA 3CXHD 4H44D 2NPSC 1HH0A 2QJPB 3P8CE 2LXCB 4U7JA 2OYHA 3CWBE 5AW0B 4U3FE 3D70A 4M3LA 2JO1A 4EYYQ 1SQQJ 3CCVP 3D71A 1ZP0C 3HUSC 5AVTB 2K9YA 2KLVA 2KYVA 1KQFB 4U3FG 3VMXA 3VTPC 2Y9YA 3G6EP 2KP8A 3L73J 1PP9E 3H1IE 5AW2B 1L2PA 2KZJA 2YO2A 3E7KA 1NVOA 2QJKB 2E76D 2W6AA 3U1CA 1NU1E 2E43A 4YPCA 3GW6A 3A0BH
chains in the Genus database with same CATH topology
1YYCA 2OARA 2H8PD 1LTTC 3NMDA 5KTBA 1FZCC 1W2EA 1M7LA 2H7HA 3HD7D 1LT9B 3VOPA 1RE3A 1CI6A 1JTHA 5KLVK 3RK2B 3KYQA 2Z5HA 5AVVB 1FJPA 1J2JB 2WWWA 3A2AA 1PFIA 3I5CA 2FKWB 1FZGA 3V2PA 2Q9IA 2PAJA 1XTGB 1SFCC 1RF1A 1E5WA 3PP5A 2M3BA 1IJDB 5AVYB 1JY3P 2OYHC 1NKNA 4N78E 1NHLA 1RY3A 2A45H 1GL2B 3HUSA 2P1JA 1L0LK 1NOHA 3H32A 1JMMA 3RL0D 1FBMA 1HUCA 3E1IA 5CCGA 5AW9B 2NPSD 1FU1A 2H43A 1NH4A 1N73A 1JO5A 5APQA 3TNUA 3VMZA 3HTKA 4HH2A 2FFDC 1N7SB 1KQLA 3M9HA 1GW3A 2W6BA 2XNXA 1X8YA 1FJKA 4LC1A 1LTJC 4N6JA 1J1EB 1SFCB 1J1DC 2O01H 1IFNA 5APUA 5AW1B 4WB4A 1GDTA 3B5NB 4N78D 5CHXA 1N86A 1M1JB 1G2CB 1CW5A 2O1JA 1J1DB 1H89A 2Z4EA 2WSEH 5AW8B 4C7RA 1AQ5A 1LTIC 3MIWA 1ZLLA 3B5ND 2WT7A 1ZR2A 1A02F 2IX7C 3V2RA 1GU5A 1AFOA 3N4XA 4XA4A 3MGNA 1RE4C 1LTJB 2MJZA 3P8MC 4DZOA 2OYIB 1T2KD 1GD2E 1URQB 4WY4C 1LTAC 3V2QA 4JYCA 5CJ4A 5AVXB 1S9KE 3MD0A 1RE3C 2FFDB 2NPSB 2N1TA 2POHA 2WPRA 3LIDA 3CLQA 1T3UA 4LGDE 5AVZB 3IR9A 1N2DC 1FZCA 1FZCB 3CL3D 1DX7A 2KOGA 5APTA 2N1TB 2IFMA 2FFDA 3BATA 3KQGA 1T8ZA 4IFFA 3VN0A 1A02J 3GHGC 1IFMA 2Z5IA 3O8ZA 5APYA 1URQA 1JY3N 2N9BA 1JNMA 1SQVK 3HE5B 2W27A 2OYIC 1LTJA 1SFCD 1GU4A 4AQRD 2FXMA 1KILC 4RESB 2WT7B 2O1KA 1WRGA 3B8EB 3NFQA 1L4AD 1M1JA 1T3JA 4KHXA 1SVFA 1X79B 3UIAA 5KJ7C 1VDFA 3C9IA 1SFCA 3SWFA 2GUSA 3II6A 1NO4A 4I6MC 3TSIA 3M0AA 5AVRB 1KILD 2Q7CA 1GZLA 3BVHA 1N7SA 3HD7C 1OWAA 4Y99C 2I1JA 4WY4B 1RE4A 2M8RA 1N73C 1DH3A 3R2PA 5AW6B 1CSBA 1GW4A 1SQPK 1G1JA 4O9BA 2L5GB 2J59M 5CMZA 5BU8B 1IO4A 4WY4D 1GK6A 2ZXEB 1YTZI 1J1EC 4AYCA 3CI9A 2R32A 1ZN5A 3B5NA 1LTBC 1MFZA 1YTZT 2A45I 1KFMA 1HVVA 1FOSE 1XTCC 2WZ7A 2KB7P 1T2KC 1S9KD 3HE5A 2Q3IA 3LW5H 2WSCH 4WY4A 3NXSA 5CJ0A 1LGHB 4LLHA 1LT9C 3L4FA 4I2LC 1JUNA 3HTKB 3TNUB 2N1TC 3M91A 3LIEA 1RF1C 4JF7A 1LWUC 1MV8A 2FYUK 3P32A 1L4AC 4N3YB 2YMYA 3H32B 1HJBA 1JCCA 3A7OA 2GUVA 3SWYA 3HUSB 1GL2A 5AVWB 2OYIA 5CCHA 1FZEA 2IPPA 2YKPA 3A3YB 1SQXK 2YNYA 3V4WA 1FZBA 3OAKA 1LTSC 1FZFA 4ZKUA 5CCHC 3IFMA 3M9QA 3H6PA 5BVZA 3EQ2A 4GIFA 1NWQA 3VMYA 3RK2C 5APXA 1IFJA 2PP6A 5KJ7A 2P67A 1HGVA 2JEEA 2CPBA 1HBWA 2XZRA 5AW5B 3V4QA 3A5TA 4I1LA 1M1JC 4C7NA 3L35A 1CI6B 1JTHB 2JJLA 1WT6A 2NPSA 1LT9A 5CCGD 3OA7A 1N7SC 3M06A 3MUDA 1FZAA 1SP4A 1JY2P 5KJ7D 1NKZB 4EOTA 1H88A 1L4AA 1KFNA 2YO3A 3HD7A 1NU1K 2P2UA 5CCGC 2C0XA 1URQC 3BASA 2R3CA 4W7YA 2QM8A 2VRSA 5AW7B 3U59A 4GKGA 3N7NA 1G2CA 1NTMK 2CPSA 5AW3B 3RK3B 3B5NC 1LWUB 1CZQA 1Z56A 1VPCA 1URQD 2HODB 2HFED 2XDJA 3M0DC 2E42A 1ZR4A 2WSFH 3RL0C 1GL2D 1G1IA 2QM7A 3GHGB 1SQQK 2WTYA 3P8CD 1L0NK 3KDPB 2LKMA 1SLQA 3RL0B 2N1TD 5AW4B 1NTZK 3HE4A 3U1AA 4DOJA 1N73B 1FAVA 2HG5D 1N7LA 3L36A 1IK9A 5APWA 1HWTC 3RK3C 1GTWA 1IFDA 2XV5A 4GT1A 3V2NA 2C9LY 1RF0A 3V5BA 1KZUB 2HPCA 1GL2C 1HGZA 4W80A 4Y99B 2C9NY 1MZ9A 1NAFA 2GM4A 1X9VA 2J58A 1JY2N 1RF1B 4C46A 2A45G 4XE5B 3RK3D 1QL2A 3HRNA 5AVUB 3M9BA 3VP9A 2P7JA 4HYTB 4IFDK 2BASA 2KSJA 1FDMA 2R5DA 5APSA 3VP8A 1JY2O 4EIJA 4B86A 1LTGC 1KILA 1EQ7A 1JOCA 4AUWA 1N7SD 1FOSF 1RF0C 2ZFCA 4JYBA 1OXZA 2XKMA 1MUUA 1GK4A 2Q5UA 2C0WA 1NTKK 2IFNA 2WPQA 3T97A 1HTLC 4W7ZA 1LWUA 3KPEA 2FYZA 1ZV8A 2OYHB 3TK1A 2XU6A 1IFIA 2HPCB 5BU5A 3L37A 5AVQB 4ZKPA 2HLOA 3OJAB 2R5BA 2I1KA 2YKQA 3EFGA 1JY3O 5AVSB 5CCHD 3NTNA 3WMM0 3HD7B 2YKOA 1L4AB 3TYYA 1DEBA 3HE4B 4OH8B 1H8AA 3RK2D 3VYIA 3BRTB 3P7KA 3GHGA 3BRVB 2WITA 5APVA 4C7NB 1KILB 3M0DA 1JCDA 1SQBK 3G3ZA 3MTUE 2HODA 1QL1A 4WBAA 2HYNA 2WPSA 1IC2A 4IFMA 2NPSC 1HH0A 3P8CE 2OYHA 5AW0B 4M3LA 3HUSC 5AVTB 2KLVA 2KYVA 3VMXA 3VTPC 2KP8A 5AW2B 2YO2A 2W6AA 3U1CA 2E43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9I A;  2A45 I;  1JY2 N;  3HUS B;  1N73 A;  2Z4E A;  1FZC A;  1FZC B;  2HOD A;  1FZC C;  1RF1 B;  1RF0 C;  1RF1 A;  1W2E A;  2HLO A;  2OYI A;  1N73 C;  1FZE A;  1M1J A;  2A45 G;  1M1J C;  1N73 B;  1JY3 O;  2FFD A;  1LT9 B;  2FFD C;  1FZB A;  1RE3 A;  1JY3 P;  3GHG C;  1LT9 A;  2OYH C;  1LT9 C;  2OYH A;  1LWU B;  1JY3 N;  2XNX A;  1FZF A;  1FZA A;  2A45 H;  1RF0 A;  1RE4 C;  1LTJ B;  1LTJ A;  1JY2 P;  2HOD B;  3HUS A;  1RF1 C;  1LTJ C;  2OYI C;  3HUS C;  2OYI B;  2HPC A;  1JY2 O;  1LWU A;  1LWU C;  3GHG A;  3H32 A;  3BVH A;  2OYH B;  3GHG B;  3H32 B;  1RE3 C;  2FFD B;  1N86 A;  1M1J B;  3E1I A;  1FZG A;  1RE4 A;  1T3U A;  2H43 A;  2HPC B; 
#chains in the Genus database with same CATH topology
 1PP9 G;  3CX5 E;  1YYC A;  4H13 B;  2RH0 A;  2OAR A;  2H8P D;  1LTT C;  3NMD A;  3A0H E;  5KTB A;  1FZC C;  1BE3 G;  1SQX D;  1W2E A;  1M7L A;  3H1K G;  2WVR A;  4YXW H;  2H7H A;  3HD7 D;  1LT9 B;  3VOP A;  2WSF J;  1RE3 A;  2AXT H;  1CI6 A;  1JTH A;  3W67 A;  1KD1 Q;  5KLV K;  1SQV E;  3H1H J;  3RK2 B;  3S4R A;  1DD4 A;  2IZ1 A;  3KYQ A;  2BCC D;  2K9J B;  4RKU J;  2Z5H A;  5AVV B;  1FJP A;  3V6I A;  1J2J B;  3L70 G;  3L74 G;  1M57 D;  2ZYA A;  2WWW A;  3RBX A;  5KLV E;  3A2A A;  3H25 A;  1UIX A;  1YHQ P;  1PFI A;  3EFF K;  3CWB G;  2BCC E;  1AFO A;  2OQQ A;  3H1J E;  2FKW B;  3I5C A;  1QVF O;  4UB6 E;  5TIS H;  1FZG A;  1BGY G;  2KNC B;  3JSV C;  3V2P A;  2Q9I A;  2PAJ A;  1XTG B;  1JMB A;  1SFC C;  3S9O A;  1RF1 A;  3G4S P;  1E5W A;  3PP5 A;  4L75 A;  3B71 A;  2AEM A;  1VQO P;  2M3B A;  1IJD B;  1R5L A;  5E79 E;  3ITK A;  3RL0 g;  1VQM P;  5AVY B;  2QJK C;  3RBZ A;  1ZRT D;  1USD A;  1JY3 P;  1SQP J;  2OYH C;  1NKN A;  3FGA D;  4N78 E;  1NHL A;  1VF5 D;  1KYO D;  1RY3 A;  2A45 H;  2PGD A;  1GL2 B;  2QJY B;  2YXR B;  1S72 P;  1USE A;  3HUS A;  2P1J A;  1L0L K;  1NOH A;  1NTM J;  4H13 C;  4ZMD A;  2KXP B;  3I55 P;  1SQB J;  2JWA A;  2FXO A;  4HJG H;  2QRX A;  2RMZ A;  2IYP A;  3H32 A;  4PJ0 H;  4TLF A;  4BRY B;  1JMM A;  2B87 A;  3RL0 D;  1FBM A;  1HUC A;  2KIK A;  3E1I A;  3ZDM A;  5CCG A;  5AW9 B;  2NPS D;  1FU1 A;  3CX5 I;  4L74 A;  4OGQ C;  5KLV G;  3WU2 E;  1NH4 A;  1N73 A;  2H43 A;  2HR3 A;  2WMM A;  1JO5 A;  1OIP A;  2E5T A;  1E79 H;  5APQ A;  3TNU A;  3VMZ A;  2KS1 B;  1OVV A;  3H1J G;  3HTK A;  4HH2 A;  1YI2 P;  1EZV I;  4JPZ B;  1LT1 A;  1BGY E;  1DEE G;  4BXL A;  1N7S B;  2FFD C;  1KQL A;  1SQB D;  3M9H A;  1GW3 A;  2W6B A;  4NPD A;  5KAI E;  1VQK P;  2W83 C;  2XNX A;  3B4S A;  3GF3 A;  1X8Y A;  1FJK A;  2K88 A;  3AE5 C;  4LC1 A;  3D6Y A;  1LTJ C;  1PPJ D;  1U7J A;  1J1E B;  2FYU G;  3H1L J;  4N6J A;  1SFC B;  1J1D C;  2O01 H;  1IFN A;  1Y47 A;  1BE3 D;  1SQX G;  3L75 J;  2ZJS E;  4WB4 A;  5AW1 B;  1KV4 A;  2Y0E A;  2K1A A;  1ZRT E;  1ZOY C;  1GDT A;  3B5N B;  4N78 D;  5CHX A;  1NTZ E;  3C8V A;  3CWB J;  5CBO A;  1N86 A;  1M1J B;  2MKV A;  1G2C B;  3L73 D;  3PTZ A;  2O1J A;  1CW5 A;  1J1D B;  2J5U A;  1H89 A;  5B66 H;  2Z4E A;  2WSE H;  1RQV A;  2YIU C;  2QIW A;  3AEF C;  3AE2 C;  4MN4 C;  1NTM G;  5AW8 B;  5L8R J;  4ASW A;  1NTK G;  3W68 A;  2JDI H;  1AQ5 A;  1ZME C;  1LTI C;  3MIW A;  3IF4 A;  1ZLL A;  3B5N D;  3CXH I;  1NGM B;  2WT7 A;  1ZR2 A;  1A02 F;  2IX7 C;  3L71 G;  2ZAE B;  3V2R A;  3TF5 A;  1GU5 A;  3O6Q B;  1FS0 E;  1AQT A;  3MUD C;  1IZN B;  3N4X A;  4XA4 A;  4D6T D;  4C7R A;  3CC2 P;  3MGN A;  4CPG A;  1RE4 C;  1LTJ B;  5C39 A;  3H1L E;  2MJZ A;  2M5A B;  3P8M C;  2A06 E;  5KLV D;  4DZO A;  3GF7 A;  1BSN A;  2ZYD A;  1T2K D;  1Y8A A;  3LW5 J;  1GD2 E;  1URQ B;  4WY4 C;  1PIX A;  1LTA C;  3Q5P A;  1FC2 C;  3V2Q A;  2OTK E;  4JYC A;  5CJ4 A;  5GTI H;  5AVX B;  1S9K E;  3MD0 A;  1RE3 C;  1SQV D;  2NPS B;  3SSU A;  5GTH E;  1NTK D;  2N1T A;  2POH A;  2WPR A;  1OVU A;  3F5H A;  3CLQ A;  1T6A A;  1T3U A;  1SQX E;  3EWK A;  1JB0 J;  2V4H A;  3LID A;  4KJM A;  3IR9 A;  4LGD E;  5AVZ B;  1N2D C;  2H88 C;  1YQ3 C;  3CL3 D;  4I7Z B;  1FZC A;  3C1L A;  2V7Q H;  1FZC B;  2K37 A;  1DX7 A;  1P84 H;  3OW2 O;  2KOG A;  5APT A;  4PD4 I;  2N1T B;  2IFM A;  1YJN P;  2FFD A;  2ZYG A;  3BAT A;  3KQG A;  5DJT B;  3CX5 D;  1T8Z A;  4IFF A;  3VN0 A;  5B5E E;  1A02 J;  3CC4 P;  3H1H G;  3GHG C;  1IFM A;  3L73 E;  1AVY A;  2Z5I A;  4GOE A;  3O8Z A;  1LP1 A;  1URQ A;  1JY3 N;  1L0L G;  2N9B A;  2FYN C;  5APY A;  1R8E A;  1JNM A;  1KTM A;  1SQV K;  3HE5 B;  2M5A A;  2W27 A;  4PD4 D;  3CCL P;  2OYI C;  1LTJ A;  1SFC D;  2KLU A;  1PL5 A;  1FE6 A;  3TGU E;  1FDO A;  1K9M Q;  2SPZ A;  1GU4 A;  4Y28 J;  4AQR D;  2FXM A;  1W5C E;  1KIL C;  3AEE C;  1BSH A;  4RES B;  2WT7 B;  1QVG O;  2IDB A;  1WRG A;  2O1K A;  1EXI A;  3L72 D;  1NYH A;  5CBN A;  1KQG B;  3CD6 P;  3IN6 A;  3B8E B;  4DT0 A;  1UII A;  3NFQ A;  1QGK B;  1L4A D;  1M1J A;  1LP1 B;  1T3J A;  4KHX A;  1SVF A;  4HKZ H;  1X79 B;  3MP7 B;  3UIA A;  1Q7Y Q;  1VQ9 P;  3A0B E;  4OWF A;  1VDF A;  4BWN A;  2GA1 A;  3C9I A;  1JEK A;  1SFC A;  5KJ7 C;  3SWF A;  1EDJ A;  2GUS A;  2OYO A;  3II6 A;  3WU2 H;  1EZV D;  1GMJ A;  1NO4 A;  4I6M C;  1Q2N A;  3TSI A;  3AEC C;  3M0A A;  4GOD A;  5AVR B;  1BGY J;  1P84 I;  1EDI A;  5B5E H;  1L0N G;  1L0L E;  4GOF A;  1P84 E;  1KIL D;  2R3S A;  3L72 J;  4PD4 E;  2Q7C A;  1GZL A;  1HJ0 A;  1KB9 I;  2Q1K A;  5EFW B;  1YJW P;  1N7S A;  3BVH A;  3HD7 C;  1OWA A;  5KLI B;  1SQP E;  4Y99 C;  2I1J A;  4WY4 B;  1RE4 A;  2M8R A;  3PH0 A;  3Q2Y A;  1N73 C;  1DH3 A;  3PJS K;  3QH9 A;  1L0N J;  1S2E A;  2QEX P;  3R2P A;  1KC8 Q;  5AW6 B;  3CCU P;  1CSB A;  1GW4 A;  1SQP K;  1H0T A;  1G1J A;  3AE7 C;  4O9B A;  2L5G B;  2B87 B;  1NTZ J;  2J59 M;  4IL6 X;  5CMZ A;  5BU8 B;  4BRY A;  1IO4 A;  4KT0 J;  4WY4 D;  5DJU B;  1H0T B;  3CCM P;  1GK6 A;  1PGO A;  2ZXE B;  2K3R A;  3Q1M A;  2B9B A;  3BCC D;  1YTZ I;  1J1E C;  2YIU B;  3F89 A;  3L74 E;  4QMA A;  4UB6 H;  4AYC A;  1M56 D;  4UB8 H;  4TT3 H;  3H1L D;  3CI9 A;  3S1K A;  2R32 A;  1ZN5 A;  2ZXX A;  3B5N A;  2OTJ P;  1VF5 B;  2KZI A;  3H1I J;  3PLN A;  4OVN F;  1EXJ A;  2ITA A;  1LTB C;  1MFZ A;  2WPV B;  1AVO A;  1L0N E;  2ZT9 C;  1YTZ T;  2A45 I;  1KB9 H;  1KFM A;  1HVV A;  1NAY A;  4H0L D;  1XTC C;  2E76 C;  2WZ7 A;  1FOS E;  3CPW O;  3L70 J;  2KB7 P;  4XFJ A;  1DIP A;  1T2K C;  4OGQ B;  1S9K D;  3HE5 A;  2Q3I A;  3LW5 H;  3CCR P;  2WSC H;  1NJI Q;  4WY4 A;  2E5Y A;  3NXS A;  1LGH B;  5CJ0 A;  3PHL A;  2WSE J;  1LT9 C;  3L4F A;  4I2L C;  4LLH A;  1JUN A;  3GLM A;  2KS1 A;  3HTK B;  4H0L B;  3TNU B;  3H1I D;  2N1T C;  3M91 A;  2AXT E;  3BCC E;  3LIE A;  1RF1 C;  1BE3 E;  4JF7 A;  1S4X A;  3H1K E;  4OGQ D;  1OW8 A;  4DCK A;  2FXP A;  4Z1M H;  1OX3 A;  5KLV J;  1PGJ A;  1M90 Q;  2QG4 A;  1LWU C;  1MV8 A;  2O01 J;  1S1C X;  1YQ4 C;  2E74 C;  2FYU K;  3P32 A;  2QJP C;  1L4A C;  4N3Y B;  4WWI A;  2YMY A;  3RK3 E;  3H32 B;  4D6T G;  1KQS O;  3L72 G;  1HJB A;  5APU A;  1BCC D;  1JCC A;  2P10 A;  3A7O A;  3AEG C;  3KHU A;  2GUV A;  4JQ0 D;  3SWY A;  2YMK A;  3HUS B;  1TU3 F;  3L70 E;  1GL2 A;  1YJ9 P;  2CK3 H;  5AVW B;  4K3A A;  2OYI A;  1M8O B;  2R44 A;  5CCH A;  1FZE A;  2IPP A;  2QVA A;  2YKP A;  3A3Y B;  1SQX K;  4RO0 A;  2YNY A;  3V4W A;  1FZB A;  3OAK A;  3O6Q A;  1IK7 A;  1K04 A;  1KIL E;  4UB8 E;  3AEA C;  1LTS C;  2M3E A;  1OMI A;  5KKZ B;  3H1H D;  1FZF A;  1EC5 A;  2Y0C A;  4ZKU A;  3H1K J;  1NTK J;  5CCH C;  3IFM A;  3M9Q A;  1WMK A;  3H6P A;  3FX0 A;  2QJY C;  4JBZ A;  3EQ2 A;  5BVZ A;  1VQL P;  2I8D A;  1SQB E;  1PP9 J;  3D6Z A;  1BCC J;  2W8Z A;  4GIF A;  2NRG A;  3VMY A;  1NWQ A;  1AV1 A;  3RK2 C;  3SFD C;  1BGY D;  5APX A;  1IFJ A;  3E1R A;  2IBZ I;  1SQV G;  1S3J A;  1SQB G;  2JP3 A;  2FY8 A;  2PP6 A;  5KJ7 A;  2P67 A;  3AEB C;  3CC7 P;  1HGV A;  1AJY A;  2JEE A;  2CPB A;  1HBW A;  2XZR A;  2FYU J;  1SQQ D;  5AW5 B;  3V4Q A;  4EDF A;  1EDL A;  2LXB A;  3L72 E;  3JCU E;  2IBZ G;  3A5T A;  4I1L A;  1M1J C;  2KK7 A;  1BDD A;  2Q6Q A;  2G3A A;  4PD4 H;  3L35 A;  4C7N A;  2BCC G;  1CI6 B;  1JTH B;  2JJL A;  1WT6 A;  3CCJ P;  2NPS A;  1LT9 A;  5CCG D;  3H1J D;  3OA7 A;  1N7S C;  3M06 A;  3MZW B;  1U57 A;  3MUD A;  1FZA A;  1SP4 A;  1JY2 P;  5KJ7 D;  1KYO E;  1OZH A;  2A06 G;  2IBZ D;  3KZI E;  1NKZ B;  1DD3 A;  1KMI Z;  2W90 A;  2WSC J;  1NTM D;  3WUU A;  4EOT A;  1H88 A;  2BEZ F;  2QSI A;  1L4A A;  1KFN A;  2YO3 A;  1K05 A;  2B89 A;  3G9R A;  1NU1 K;  3H1I G;  3HD7 A;  4R4M A;  2P2U A;  5CCG C;  2YXQ B;  3GG2 A;  2C0X A;  1URQ C;  3L74 J;  1PV3 A;  3BAS A;  2FYU E;  2OTL P;  1L0N D;  2R3C A;  2JR8 A;  2E42 A;  1QLE D;  1S5L E;  3CCQ P;  3PRJ A;  4W7Y A;  2QM8 A;  1YIJ P;  1Q81 Q;  2OYI B;  1LJ2 A;  2VRS A;  5AW7 B;  3U59 A;  2IYO A;  4GKG A;  3N7N A;  1G2C A;  1L0L J;  1NTM K;  2CPS A;  5AW3 B;  1NTZ G;  2D2C B;  1Q86 Q;  4R4L A;  2JKV A;  3B5N C;  3RK3 B;  1LWU B;  1CZQ A;  1Z56 A;  3IAO A;  3USS A;  2IBZ E;  5B66 E;  1VPC A;  5TIS E;  1URQ D;  2HOD B;  2HFE D;  1RHZ B;  1ZW0 A;  2XDJ A;  1NTM E;  2E76 B;  3M0D C;  4PJ0 E;  1ZR4 A;  3TDK A;  2M0B A;  2WSF H;  2L91 A;  3L74 D;  3RL0 C;  4IOI H;  1GL2 D;  3JCU H;  2N9Y B;  3AE6 C;  1MFT A;  1G1I A;  2QM7 A;  3GMA A;  5H2F H;  2D2C D;  2O3J A;  3CWB D;  3CME P;  3G71 P;  3GHG B;  1SQQ K;  2WTY A;  1BCC G;  1L0N K;  3KDP B;  3P8C D;  4U3F J;  3Q5R A;  3AE4 C;  4NPF X;  2LKM A;  1SLQ A;  1SQQ E;  5M1B A;  4RJT A;  3CMA P;  3RL0 B;  2N1T D;  5AW4 B;  2FFD B;  3SWK A;  2KSE A;  1NTZ K;  5GTI E;  1SQQ G;  3HE4 A;  3U1A A;  4DOJ A;  1N73 B;  1FAV A;  2HG5 D;  1N7L A;  2KUB A;  3K5B A;  1IK9 A;  3L36 A;  3R4Y A;  2D2C C;  5APW A;  5KAF H;  3RK3 C;  1X0T A;  1HWT C;  1GTW A;  1IFD A;  3SFE C;  2XV5 A;  4GT1 A;  1VQN P;  1KN7 A;  3CX5 H;  4WVZ A;  1SS1 A;  1S5L X;  3V2N A;  1RF0 A;  2C9L Y;  3V5B A;  4L76 A;  1IFP A;  1KZU B;  2E75 C;  4U3F D;  1VQ6 P;  2HPC A;  3TGU J;  3L75 E;  1GL2 C;  1HGZ A;  4W80 A;  1QEX A;  1U7M A;  1EZV E;  4IL6 E;  5KLI C;  4Y99 B;  3CXH E;  1SQV J;  2FBW C;  2P58 A;  2WSS H;  3H1H E;  3CCS P;  2C9N Y;  2RKL A;  1MZ9 A;  1NAF A;  1R5S A;  2KI7 B;  1X9V A;  2OGU A;  2GM4 A;  2IZ0 A;  2J58 A;  2E74 D;  2QE7 H;  1Y9B A;  2JWD A;  1HF9 A;  1JY2 N;  1PGP A;  5TJH A;  1OW7 A;  3TGU G;  5GTH H;  3H1L G;  2W6J H;  3BCC J;  2E75 D;  5K5G B;  4C46 A;  1RF1 B;  1BCC E;  2DW3 A;  2A45 G;  2ZT9 B;  1OW6 A;  2KNC A;  1FDI A;  4XE5 B;  3RK3 D;  1QL2 A;  3HRN A;  5AVU B;  3M9B A;  1VQP P;  1YIT P;  2E74 B;  3Q3D A;  3VP9 A;  2P7J A;  4HYT B;  4L73 A;  1AA0 A;  2BAS A;  2KSJ A;  1VQ5 P;  4IFD K;  2R5D A;  1OFC X;  3JC2 2;  3TGU D;  1FDM A;  3AE8 C;  1X22 A;  3FXE A;  2E75 B;  1OVR A;  5APS A;  1JM0 A;  3VP8 A;  3AE3 C;  2PRR A;  1RQU A;  2UWJ E;  1JY2 O;  2Q3E A;  2ZT9 D;  3H1K D;  3KXD A;  4H0L C;  3VMA A;  2K9J A;  1KB9 D;  4YTP C;  4B86 A;  4EIJ A;  1LTG C;  4PV1 C;  1KIL A;  2V7Q J;  1EQ7 A;  2B88 A;  2LR2 A;  1JOC A;  3L73 G;  4AUW A;  4YXD C;  1SQX J;  3L75 G;  1N7S D;  1KOR A;  1VQ8 P;  1EZV G;  1YBK A;  4GDO A;  1BDC A;  2AEF A;  1RF0 C;  2Y0D A;  5H2F E;  1FOS F;  2ZFC A;  4JYB A;  1NTK E;  1PPJ G;  2FYU D;  2AEJ A;  3CXH H;  1OXZ A;  3AED C;  1EDK A;  1W2B O;  1PGQ A;  3FWN A;  1VF5 C;  1MUU A;  1GK4 A;  2BCC J;  2XKM A;  4H44 B;  1S5L H;  1SQP G;  2Q5U A;  3FWL A;  2C0W A;  3L71 E;  4NPE A;  2PFX A;  1VQ4 P;  1NTK K;  2A06 D;  2IFN A;  2WPQ A;  3H1J J;  3WUV A;  2WQY C;  3BCC G;  3T97 A;  4I7Z C;  1HTL C;  1Q90 D;  4K35 A;  4W7Z A;  1RH5 B;  1ZXG A;  1LWU A;  2RN0 A;  3L71 D;  5KKZ C;  3KPE A;  3A0H H;  5E79 H;  3FXD A;  4ZNC A;  2FYZ A;  1ZV8 A;  4D6T E;  2OYH B;  2AXC A;  3TK1 A;  4HB1 A;  2ZVN B;  2NZ2 A;  2XU6 A;  1IFI A;  2HPC B;  2H89 C;  5BU5 A;  3L37 A;  4EI2 A;  1MKM A;  5AVQ B;  4H13 D;  2Y9Z A;  1K8A Q;  4ZKP A;  1N8R Q;  2HLO A;  1NU1 D;  1VL2 A;  1SQP D;  3OJA B;  2R5B A;  2BEQ D;  2I1K A;  2YKQ A;  1NTZ D;  3EFG A;  4IL6 H;  3T97 B;  1JY3 O;  5AVS B;  1KYO H;  3KZI H;  3NTN A;  3WMM 0;  3HD7 B;  5CCH D;  1PP9 D;  2YKO A;  3AE9 C;  1L4A B;  4H44 C;  1P84 D;  1KB9 E;  3L71 J;  1L0L D;  4PV1 B;  1DEB A;  1LNQ A;  3TYY A;  3HE4 B;  1Q82 Q;  2O01 N;  4OH8 B;  3RK2 D;  1PPJ E;  1K73 Q;  1H8A A;  3VYI A;  1KYO I;  4DJG A;  4A7P A;  1BE3 J;  3L75 D;  3RGU A;  1M1K Q;  5KAF E;  1NU1 G;  3BRT B;  1VQ7 P;  3ABV C;  3P7K A;  3GHG A;  4D6T J;  3BRV B;  1PZQ A;  2WIT A;  4PV1 D;  1QX8 A;  5APV A;  3WUT A;  4C7N B;  3CCE P;  1KIL B;  3M0D A;  1NU1 J;  1JCD A;  4ASV A;  1SQB K;  1D7M A;  3G3Z A;  3MTU E;  3QWO C;  5KAI H;  2HOD A;  2G8Y A;  3Q5S A;  3AE1 C;  1QL1 A;  4WBA A;  2XND H;  2QA4 P;  2ZVO B;  2HYN A;  3L70 D;  2FYN B;  3MHV A;  2WPS A;  1IC2 A;  3I56 P;  4IFM A;  3CXH D;  4H44 D;  2NPS C;  1HH0 A;  2QJP B;  3P8C E;  2LXC B;  4U7J A;  2OYH A;  3CWB E;  5AW0 B;  4U3F E;  3D70 A;  4M3L A;  2JO1 A;  4EYY Q;  1SQQ J;  3CCV P;  3D71 A;  1ZP0 C;  3HUS C;  5AVT B;  2K9Y A;  2KLV A;  2KYV A;  1KQF B;  4U3F G;  3VMX A;  3VTP C;  2Y9Y A;  3G6E P;  2KP8 A;  3L73 J;  1PP9 E;  3H1I E;  5AW2 B;  1L2P A;  2KZJ A;  2YO2 A;  3E7K A;  1NVO A;  2QJK B;  2E76 D;  2W6A A;  3U1C A;  1NU1 E;  2E43 A;  4YPC A;  3GW6 A;  3A0B H; 
#chains in the Genus database with same CATH homology
 1YYC A;  2OAR A;  2H8P D;  1LTT C;  3NMD A;  5KTB A;  1FZC C;  1W2E A;  1M7L A;  2H7H A;  3HD7 D;  1LT9 B;  3VOP A;  1RE3 A;  1CI6 A;  1JTH A;  5KLV K;  3RK2 B;  3KYQ A;  2Z5H A;  5AVV B;  1FJP A;  1J2J B;  2WWW A;  3A2A A;  1PFI A;  3I5C A;  2FKW B;  1FZG A;  3V2P A;  2Q9I A;  2PAJ A;  1XTG B;  1SFC C;  1RF1 A;  1E5W A;  3PP5 A;  2M3B A;  1IJD B;  5AVY B;  1JY3 P;  2OYH C;  1NKN A;  4N78 E;  1NHL A;  1RY3 A;  2A45 H;  1GL2 B;  3HUS A;  2P1J A;  1L0L K;  1NOH A;  3H32 A;  1JMM A;  3RL0 D;  1FBM A;  1HUC A;  3E1I A;  5CCG A;  5AW9 B;  2NPS D;  1FU1 A;  2H43 A;  1NH4 A;  1N73 A;  1JO5 A;  5APQ A;  3TNU A;  3VMZ A;  3HTK A;  4HH2 A;  2FFD C;  1N7S B;  1KQL A;  3M9H A;  1GW3 A;  2W6B A;  2XNX A;  1X8Y A;  1FJK A;  4LC1 A;  1LTJ C;  4N6J A;  1J1E B;  1SFC B;  1J1D C;  2O01 H;  1IFN A;  5APU A;  5AW1 B;  4WB4 A;  1GDT A;  3B5N B;  4N78 D;  5CHX A;  1N86 A;  1M1J B;  1G2C B;  1CW5 A;  2O1J A;  1J1D B;  1H89 A;  2Z4E A;  2WSE H;  5AW8 B;  4C7R A;  1AQ5 A;  1LTI C;  3MIW A;  1ZLL A;  3B5N D;  2WT7 A;  1ZR2 A;  1A02 F;  2IX7 C;  3V2R A;  1GU5 A;  1AFO A;  3N4X A;  4XA4 A;  3MGN A;  1RE4 C;  1LTJ B;  2MJZ A;  3P8M C;  4DZO A;  2OYI B;  1T2K D;  1GD2 E;  1URQ B;  4WY4 C;  1LTA C;  3V2Q A;  4JYC A;  5CJ4 A;  5AVX B;  1S9K E;  3MD0 A;  1RE3 C;  2FFD B;  2NPS B;  2N1T A;  2POH A;  2WPR A;  3LID A;  3CLQ A;  1T3U A;  4LGD E;  5AVZ B;  3IR9 A;  1N2D C;  1FZC A;  1FZC B;  3CL3 D;  1DX7 A;  2KOG A;  5APT A;  2N1T B;  2IFM A;  2FFD A;  3BAT A;  3KQG A;  1T8Z A;  4IFF A;  3VN0 A;  1A02 J;  3GHG C;  1IFM A;  2Z5I A;  3O8Z A;  5APY A;  1URQ A;  1JY3 N;  2N9B A;  1JNM A;  1SQV K;  3HE5 B;  2W27 A;  2OYI C;  1LTJ A;  1SFC D;  1GU4 A;  4AQR D;  2FXM A;  1KIL C;  4RES B;  2WT7 B;  2O1K A;  1WRG A;  3B8E B;  3NFQ A;  1L4A D;  1M1J A;  1T3J A;  4KHX A;  1SVF A;  1X79 B;  3UIA A;  5KJ7 C;  1VDF A;  3C9I A;  1SFC A;  3SWF A;  2GUS A;  3II6 A;  1NO4 A;  4I6M C;  3TSI A;  3M0A A;  5AVR B;  1KIL D;  2Q7C A;  1GZL A;  3BVH A;  1N7S A;  3HD7 C;  1OWA A;  4Y99 C;  2I1J A;  4WY4 B;  1RE4 A;  2M8R A;  1N73 C;  1DH3 A;  3R2P A;  5AW6 B;  1CSB A;  1GW4 A;  1SQP K;  1G1J A;  4O9B A;  2L5G B;  2J59 M;  5CMZ A;  5BU8 B;  1IO4 A;  4WY4 D;  1GK6 A;  2ZXE B;  1YTZ I;  1J1E C;  4AYC A;  3CI9 A;  2R32 A;  1ZN5 A;  3B5N A;  1LTB C;  1MFZ A;  1YTZ T;  2A45 I;  1KFM A;  1HVV A;  1FOS E;  1XTC C;  2WZ7 A;  2KB7 P;  1T2K C;  1S9K D;  3HE5 A;  2Q3I A;  3LW5 H;  2WSC H;  4WY4 A;  3NXS A;  5CJ0 A;  1LGH B;  4LLH A;  1LT9 C;  3L4F A;  4I2L C;  1JUN A;  3HTK B;  3TNU B;  2N1T C;  3M91 A;  3LIE A;  1RF1 C;  4JF7 A;  1LWU C;  1MV8 A;  2FYU K;  3P32 A;  1L4A C;  4N3Y B;  2YMY A;  3H32 B;  1HJB A;  1JCC A;  3A7O A;  2GUV A;  3SWY A;  3HUS B;  1GL2 A;  5AVW B;  2OYI A;  5CCH A;  1FZE A;  2IPP A;  2YKP A;  3A3Y B;  1SQX K;  2YNY A;  3V4W A;  1FZB A;  3OAK A;  1LTS C;  1FZF A;  4ZKU A;  5CCH C;  3IFM A;  3M9Q A;  3H6P A;  5BVZ A;  3EQ2 A;  4GIF A;  1NWQ A;  3VMY A;  3RK2 C;  5APX A;  1IFJ A;  2PP6 A;  5KJ7 A;  2P67 A;  1HGV A;  2JEE A;  2CPB A;  1HBW A;  2XZR A;  5AW5 B;  3V4Q A;  3A5T A;  4I1L A;  1M1J C;  4C7N A;  3L35 A;  1CI6 B;  1JTH B;  2JJL A;  1WT6 A;  2NPS A;  1LT9 A;  5CCG D;  3OA7 A;  1N7S C;  3M06 A;  3MUD A;  1FZA A;  1SP4 A;  1JY2 P;  5KJ7 D;  1NKZ B;  4EOT A;  1H88 A;  1L4A A;  1KFN A;  2YO3 A;  3HD7 A;  1NU1 K;  2P2U A;  5CCG C;  2C0X A;  1URQ C;  3BAS A;  2R3C A;  4W7Y A;  2QM8 A;  2VRS A;  5AW7 B;  3U59 A;  4GKG A;  3N7N A;  1G2C A;  1NTM K;  2CPS A;  5AW3 B;  3RK3 B;  3B5N C;  1LWU B;  1CZQ A;  1Z56 A;  1VPC A;  1URQ D;  2HOD B;  2HFE D;  2XDJ A;  3M0D C;  2E42 A;  1ZR4 A;  2WSF H;  3RL0 C;  1GL2 D;  1G1I A;  2QM7 A;  3GHG B;  1SQQ K;  2WTY A;  3P8C D;  1L0N K;  3KDP B;  2LKM A;  1SLQ A;  3RL0 B;  2N1T D;  5AW4 B;  1NTZ K;  3HE4 A;  3U1A A;  4DOJ A;  1N73 B;  1FAV A;  2HG5 D;  1N7L A;  3L36 A;  1IK9 A;  5APW A;  1HWT C;  3RK3 C;  1GTW A;  1IFD A;  2XV5 A;  4GT1 A;  3V2N A;  2C9L Y;  1RF0 A;  3V5B A;  1KZU B;  2HPC A;  1GL2 C;  1HGZ A;  4W80 A;  4Y99 B;  2C9N Y;  1MZ9 A;  1NAF A;  2GM4 A;  1X9V A;  2J58 A;  1JY2 N;  1RF1 B;  4C46 A;  2A45 G;  4XE5 B;  3RK3 D;  1QL2 A;  3HRN A;  5AVU B;  3M9B A;  3VP9 A;  2P7J A;  4HYT B;  4IFD K;  2BAS A;  2KSJ A;  1FDM A;  2R5D A;  5APS A;  3VP8 A;  1JY2 O;  4EIJ A;  4B86 A;  1LTG C;  1KIL A;  1EQ7 A;  1JOC A;  4AUW A;  1N7S D;  1FOS F;  1RF0 C;  2ZFC A;  4JYB A;  1OXZ A;  2XKM A;  1MUU A;  1GK4 A;  2Q5U A;  2C0W A;  1NTK K;  2IFN A;  2WPQ A;  3T97 A;  1HTL C;  4W7Z A;  1LWU A;  3KPE A;  2FYZ A;  1ZV8 A;  2OYH B;  3TK1 A;  2XU6 A;  1IFI A;  2HPC B;  5BU5 A;  3L37 A;  5AVQ B;  4ZKP A;  2HLO A;  3OJA B;  2R5B A;  2I1K A;  2YKQ A;  3EFG A;  1JY3 O;  5AVS B;  5CCH D;  3NTN A;  3WMM 0;  3HD7 B;  2YKO A;  1L4A B;  3TYY A;  1DEB A;  3HE4 B;  4OH8 B;  1H8A A;  3RK2 D;  3VYI A;  3BRT B;  3P7K A;  3GHG A;  3BRV B;  2WIT A;  5APV A;  4C7N B;  1KIL B;  3M0D A;  1JCD A;  1SQB K;  3G3Z A;  3MTU E;  2HOD A;  1QL1 A;  4WBA A;  2HYN A;  2WPS A;  1IC2 A;  4IFM A;  2NPS C;  1HH0 A;  3P8C E;  2OYH A;  5AW0 B;  4M3L A;  3HUS C;  5AVT B;  2KLV A;  2KYV A;  3VMX A;  3VTP C;  2KP8 A;  5AW2 B;  2YO2 A;  2W6A A;  3U1C A;  2E43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...