3B5NC

Structure of the yeast plasma membrane snare complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
70
structure length
70
Chain Sequence
GSIKFTKQSSVASTRNTLKMAQDAERAGMNTLGMLGHQSEQLNNVEGNLDLMKVQNKVADEKVAELKKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Synaptobrevin homolog 1
publication title The Structure of the Yeast Plasma Membrane SNARE Complex Reveals Destabilizing Water-filled Cavities.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 34
structure length 70
sequence length 70
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3b5nC00
5KJ7C 2PP6A 5CCHC 1T3JA 2HFED 3RK2D 3RK3D 2NPSC 4WY4B 2M8RA 1L4AA 3RK3B 3B5NA 2N1TB 1SFCD 1HVVA 2WZ7A 1GL2D 1JTHA 3HTKB 1GL2B 1KILB 4WY4D 1L4AC 3B5NC 1SFCA 2N1TD 5CCGD 1URQD 3RL0D 3KYQA 1URQB 3PP5A 1GL2A 3RL0B 1N7SD 3TSIA 3RK2C 2YMYA 3VOPA 3HD7D 3RK3C 1N7SB 4WY4A 1KILD 2HG5D 3HD7B 3M0DC 5KJ7D 1SFCC 2N1TA 5CCGA 2XDJA 1URQA 4W7ZA 2H8PD 5CCHD 1GL2C 4OH8B 1N7SA 2NPSD 4LGDE 3HD7A 1L4AB 2NPSB 4W7YA 4WY4C 1KILA 4N78E 1XTGB 5KJ7A 2N1TC 5CCGC 1URQC 4W80A 3RL0C 5CCHA 4JF7A 3RK2B 1JTHB 1N7SC 1NHLA 2NPSA 3P8CE 2KOGA 3HD7C 1L4AD 3B5ND 1KILC 1SFCB 3B5NB
chains in the Genus database with same CATH superfamily
1M1KQ 2IYOA 2A45G 2ZYAA 5BU5A 1WMKA 1L0NK 3F5HA 1GU4A 2YO3A 4ASVA 1VQKP 1CI6A 2Q1KA 3HUSB 3GMAA 1H0TA 2WPRA 1KILB 2ZFCA 2KI7B 3V2PA 1DD4A 4OWFA 2K37A 1JY3P 1LTGC 3PJSK 3I55P 3CCVP 3RBZA 1PGPA 3TGUE 3OJAB 3L73J 3BASA 2XDJA 1EXIA 2WVRA 3KPEA 1LGHB 1SQQG 1DIPA 3HD7A 3CCQP 1FJPA 3ITKA 4XFJA 1NTKG 3HE5B 3D71A 2W27A 2JO1A 3H1KG 3I56P 3CCUP 2B87B 4BWNA 3A0BE 1GW4A 3KZIH 1BSHA 3O8ZA 1NTZK 5CJ0A 3V2RA 2HLOA 3M06A 3EFGA 1QLED 4ASWA 1XTCC 2A45H 3FXDA 3O6QA 3USSA 3VN0A 2WSFJ 3SFDC 2C0WA 4YTPC 1N8RQ 3WU2H 3FX0A 1ZR4A 3E1IA 1J1EC 1EXJA 4EIJA 3V2QA 4DZOA 2M5AA 1NU1D 3L72J 1FAVA 1SQVK 1IK9A 3PP5A 2FYUE 2A06E 3TSIA 3JCUE 2QVAA 3EWKA 2AEJA 1RE3A 5DJTB 3IAOA 1NTMK 4NPEA 3AEDC 2BCCE 2IZ1A 2Z5HA 2M3BA 3TDKA 3L73G 2NPSD 4K3AA 1J1EB 3VMAA 5H2FH 4KT0J 2Q7CA 5KJ7A 1Q7YQ 1CI6B 4AQRD 3CXHE 1JY3O 2XNDH 3H1IE 1JO5A 1H0TB 1G2CA 4LC1A 3HD7C 2IYPA 1G1IA 1W5CE 2AXCA 5KKZC 1RHZB 3LW5J 3M9HA 1U7JA 1GDTA 4H13C 1L0ND 1L0NJ 2G3AA 1IO4A 2QJKB 3TGUJ 2FYNC 1S4XA 3NTNA 5L8RJ 3NFQA 1MFTA 3MTUE 2JJLA 4PD4I 1HWTC 2C9LY 1G1JA 3V4QA 3AE2C 1KN7A 3WMM0 4GKGA 1MV8A 3L75D 3L75J 2YXQB 3AEGC 4H0LD 2SPZA 1VQLP 1VF5C 1CW5A 2ZVOB 1DH3A 5AVUB 5CHXA 5KKZB 2CK3H 5C39A 1HTLC 1E5WA 1ZV8A 1N7LA 3S9OA 1M56D 4L76A 5KAIH 4I7ZC 3RL0D 4H13B 4PJ0H 3H1HD 3G3ZA 3KZIE 3L72G 2FYNB 4BRYA 3VOPA 2LKMA 3TK1A 1OVRA 1N7SB 3D70A 2Q3IA 1KMIZ 2XZRA 4JYBA 3MIWA 2R5DA 1AQTA 3L71D 4KHXA 5M1BA 1URQA 2W90A 1VF5B 2N9BA 3IN6A 3O6QB 3QWOC 2K9YA 1PP9E 1IFNA 2OYIA 3CC2P 4I7ZB 1VQ8P 1RE3C 1PIXA 2E74D 1SP4A 1FZBA 4KJMA 1FOSF 1NO4A 1RE4A 1KYOD 1NHLA 1PV3A 2ZXEB 2M5AB 3BVHA 2HPCB 3B5ND 1SQBE 1NTZD 5AW2B 4L74A 2FKWB 4I2LC 5KJ7C 2R5BA 1N2DC 2AXTE 3U59A 2FYUJ 2A06D 2GUSA 4ZKUA 1VQ9P 4EI2A 3IR9A 3CCSP 1NOHA 3B71A 3TGUG 2BCCD 2BCCJ 4JQ0D 2NRGA 4OGQD 1M1JB 1H88A 3R4YA 3PTZA 5GTIH 2D2CD 4GOEA 1JTHA 2J59M 1KQGB 2IX7C 1T6AA 4LLHA 2ZXXA 1LWUB 2FFDA 3CXHI 1YJNP 1YTZI 3H1IJ 2OYOA 1M90Q 2O1JA 3FWNA 2CPSA 1K8AQ 3GF7A 3RK2C 1S72P 1JB0J 3NMDA 4UB6E 1OX3A 1DEEG 1CSBA 1IFIA 2E75D 3JC22 5CCHD 1JNMA 1ZN5A 1NKZB 1D7MA 2JEEA 2WMMA 2QJPB 2P67A 1URQC 4W80A 1RF0C 3RK2B 5CJ4A 3Q2YA 1IZNB 2P10A 2OTLP 2Y0DA 2LR2A 3CCMP 1PL5A 2OYIC 3PRJA 1DD3A 2ZYGA 1QL1A 1QGKB 1KB9D 2JDIH 5E79E 3T97B 1RE4C 2FXMA 1NKNA 1J2JB 4U3FD 2Q9IA 3N4XA 2FYUG 2A06G 3BATA 3LW5H 1SS1A 5KTBA 2NZ2A 1OW7A 2W6JH 3G4SP 1AV1A 2BCCG 1PP9D 1PP9J 4K35A 2OYIB 5APWA 2B89A 1KFNA 2OARA 1NAYA 3E7KA 1SQXK 1EDJA 4D6TD 3L37A 2HODB 3MZWB 3H1IG 1LTJB 1SQBD 1FZGA 1SQBJ 2FFDC 2O01J 1GW3A 1OVUA 2Q3EA 1N86A 1BGYD 1BGYJ 5KLVE 3D6YA 3A0BH 3L36A 4XE5B 2KS1B 1XTGB 5GTIE 1OVVA 5AVXB 3Q5PA 1T8ZA 1P84D 1QVFO 1JCDA 1JTHB 2FXOA 1J1DC 2NPSA 3KXDA 2FFDB 3TNUB 4Z1MH 1FOSE 3CCRP 1SQPK 1LTAC 1NU1E 2KZJA 1JOCA 1KQLA 4L75A 2QG4A 1KQFB 2KSJA 2O3JA 3CLQA 1S3JA 3RK3D 2V7QJ 1M57D 2M3EA 3L74D 1EZVD 1VQPP 3GF3A 1ZXGA 2M8RA 1YHQP 1JY2P 1HGVA 1U7MA 5BVZA 1TU3F 1X0TA 2W83C 5K5GB 3VMXA 1GK6A 1VQMP 1S5LX 3JCUH 3SWYA 1OZHA 1GL2B 4QMAA 3OA7A 1ZMEC 1HH0A 1S5LH 3U1AA 1PP9G 3KDPB 1BDDA 1FZEA 2WPQA 3IF4A 1YIJP 2W8ZA 3CXHH 1LJ2A 2K3RA 2JKVA 2IFNA 5AVTB 2WSEJ 1SQBG 2KNCB 2QJYC 1AJYA 4I6MC 3ABVC 4YXWH 1IFPA 3CX5D 2I1KA 1L0NE 1WT6A 2KB7P 4JPZB 1ZP0C 4H44C 2PGDA 3VMYA 2BEQD 2W6BA 4A7PA 3L75E 2OYHA 1GMJA 1LNQA 1FZAA 2H89C 2JWDA 2QJYB 1LT9A 5AVVB 1ZR2A 2NPSC 1S1CX 1DEBA 3H1HE 3AEFC 2RMZA 3B5NA 2DW3A 3OAKA 1SFCD 3AE8C 1KB9H 4JYCA 3L71E 5KLVD 5KLVJ 1HBWA 3K5BA 4AYCA 2KK7A 3H1LE 1GK4A 3M9QA 3UIAA 3CWBE 5KAFH 2KYVA 3Q3DA 2ZYDA 3MGNA 2R44A 1SQXD 3KYQA 1HF9A 1BDCA 1JY2O 1ZRTE 2BASA 3A0HE 5AVRB 1KYOE 2FYZA 4DOJA 1M8OB 1KQSO 1NU1J 1NTZE 4H0LC 1NAFA 1FZCA 2K88A 4H44D 2OTKE 4O9BA 1OIPA 4W7YA 4Y28J 5APQA 2O01H 1S2EA 2WPVB 2YNYA 4C7RA 3GHGA 1GTWA 5BU8B 2AXTH 2N9YB 4TLFA 3RL0C 5CCHA 1S5LE 2WT7A 3SWFA 2I1JA 1L4AD 3M0AA 1EDLA 1RF1A 1L0LK 2OGUA 1U57A 2M0BA 1SQVE 4ZKPA 1YJ9P 2QM7A 3Q5SA 2CPBA 2R32A 2OYHC 1YJWP 2E74C 2BEZF 1LT9C 1PGJA 2XNXA 1NTME 1PZQA 2YKPA 2V7QH 5AVQB 4UB6H 1Y9BA 5KLVG 3B5NC 3CC7P 1AVYA 1FE6A 1FS0E 1MFZA 4M3LA 3AE3C 3NXSA 1VQ4P 4PV1D 2IBZD 1FZFA 3H1JD 3H1JJ 2KLUA 2OYHB 2Y0EA 2MJZA 3V2NA 2WSCH 3HD7B 1JM0A 1USEA 2E74B 1BCCD 1BCCJ 1LT9B 2ZVNB 1GU5A 4OGQC 4PD4D 2D2CC 3HTKA 3CMEP 3H1HJ 1NU1G 1KB9E 3S4RA 4DJGA 2QA4P 2IZ0A 1UIXA 3AE1C 4U3FE 2WSEH 2K1AA 5KAFE 5E79H 3L71J 1VQ6P 3V5BA 3W68A 1GD2E 3N7NA 1FZCC 3CX5H 1RF0A 3H1LD 3H1LJ 2KOGA 3MHVA 3CWBD 2Q6QA 3CWBJ 3Q1MA 3GHGC 4OGQB 1LT1A 2E75C 4HKZH 5CCHC 1LP1A 3H6PA 1USDA 2O01N 2XU6A 1ZRTD 5TJHA 4JBZA 1KYOI 5APXA 1CZQA 4D6TE 3HRNA 4C7NA 4C46A 5B66E 4GT1A 1RF1C 3C1LA 3LIEA 4WB4A 3P8CD 1NTZJ 1FZCB 5AW5B 1QX8A 3KHUA 2G8YA 4WY4D 1BGYE 1SQQK 3M0DA 1NYHA 3GHGB 4BXLA 4IFDK 3AE5C 4CPGA 2C9NY 3L35A 3SWKA 2LXCB 1NTKK 3D6ZA 1L0NG 1N7SD 1MUUA 1P84E 3BCCD 3TYYA 3OW2O 1RY3A 1RF1B 3L75G 1Q90D 1H8AA 1SQVD 1SQVJ 1FDMA 1K04A 1G2CB 3PH0A 2AEFA 3RK3E 2PFXA 1EZVE 3L74E 1K05A 2YO2A 3B4SA 2K9JA 3H1HG 1NTMD 1NTMJ 3F89A 3A3YB 3VP8A 3H25A 3WUUA 3L71G 1K73Q 2Z5IA 3L70D 3BRVB 4WWIA 2PAJA 2WZ7A 5EFWB 2WITA 3H1LG 1L0LD 3AEEC 3HE4A 3CWBG 3A5TA 1T3JA 3FXEA 2YIUC 1IK7A 3RGUA 5APTA 1VQ5P 1T3UA 2E5TA 4HJGH 1ZOYC 3VYIA 1R8EA 1GZLA 1KB9I 3HTKB 2KSEA 2RH0A 4BRYB 5AW4B 1NTZG 3RL0g 1SFCA 4U3FJ 4TT3H 3CX5E 3R2PA 4HH2A 3P7KA 3CL3D 1URQB 1OW8A 2WQYC 4N3YB 1FDOA 2YIUB 2GM4A 2YMYA 2IPPA 5AW8B 3RK3C 4GOFA 3M0DC 4UB8H 1PPJD 1YQ3C 2H43A 2H8PD 4NPFX 2KP8A 1HGZA 4OH8B 2ITAA 3I5CA 4C7NB 4D6TJ 1LTSC 3CMAP 3G6EP 1SQVG 3CPWO 4NPDA 4R4MA 1NJIQ 2UWJE 4Y99C 1L2PA 1DX7A 1YYCA 1YQ4C 1JUNA 5CBNA 2Y9ZA 4XA4A 1KILE 1NTMG 1QL2A 2WTYA 1YTZT 2OQQA 1MZ9A 3A2AA 1P84I 4IFFA 3CCJP 3AE6C 1SQXE 1L4AA 2LXBA 2E42A 1AFOA 3G71P 2P7JA 2H88C 4Y99B 5APVA 1EDKA 5AW0B 1AVOA 4GIFA 1ZLLA 3MUDA 1EC5A 1JMBA 3A0HH 2XKMA 1SQQD 1EZVI 1KYOH 1SQQJ 2ZT9D 3L74J 1OWAA 2N1TD 3A7OA 3U1CA 2K9JB 2WWWA 2Z4EA 4U3FG 1J1DB 1T2KD 1KTMA 2PRRA 5AW3B 1SFCC 3HE4B 2QIWA 1HUCA 2WSCJ 1SQPE 2J5UA 4RKUJ 1BE3E 3ZDMA 1EDIA 3CCEP 5AW7B 5APYA 1VL2A 2H7HA 4D6TG 1N73A 2C0XA 1VDFA 1IJDB 2R3CA 2YKQA 3CX5I 1SFCB 1A02F 2P58A 3B8EB 2W6AA 2PP6A 1BGYG 4DCKA 1JCCA 2OTJP 2E76D 2VRSA 4UB8E 3LIDA 1FDIA 1FU1A 2IBZE 3H1JE 1KD1Q 2ZAEB 2Q5UA 5GTHE 1GL2D 5AVYB 1BCCE 3L73D 3H32A 3PLNA 3EQ2A 1L4AC 4PD4E 3CD6P 2KIKA 2L91A 5CCGD 1OMIA 5CBOA 4IL6X 4H44B 3L74G 1EZVG 3M91A 3W67A 3MUDC 2L5GB 2WSSH 4WY4A 1KILD 2HG5D 4IL6H 1WRGA 4EDFA 3CC4P 1OW6A 1X9VA 1SVFA 3AE7C 4RO0A 1SQXJ 1N7SA 1IFDA 3AECC 3AEBC 4LGDE 1L4AB 2NPSB 1RH5B 3MP7B 2KLVA 1S9KE 1AQ5A 2FYUK 4EYYQ 4JF7A 1NGMB 1NVOA 4PV1C 3P8CE 1LTIC 4ZNCA 5B66H 1HJBA 1PFIA 5B5EH 4RJTA 1N73C 1Q2NA 5AVWB 4RESB 1E79H 4N78D 2KXPB 2E43A 3L72D 2QSIA 2HPCA 1KORA 3C9IA 3BCCE 1KC8Q 1SQPD 1Q86Q 1SQPJ 1KFMA 4PV1B 1P84H 3GG2A 3TF5A 4H0LB 5CMZA 1BE3D 1BE3J 2B88A 2YMKA 3CI9A 1LTTC 1M1JA 1N73B 4OVNF 4AUWA 2QJKC 3RL0B 4N6JA 1JY2N 1LWUA 2ZJSE 3GW6A 1JEKA 4GODA 2B9BA 1PGOA 1Y47A 4YPCA 3L70E 5APUA 1VPCA 1L0LE 1EQ7A 2IBZI 1FBMA 3FWLA 4WY4C 1VQ7P 1Z56A 1SQXG 3E1RA 2GA1A 3TGUD 1N7SC 3H32B 3FGAD 1K9MQ 5TISH 4HB1A 3B5NB 2I8DA 3VMZA 1NWQA 1JY3N 4IL6E 1X22A 2IDBA 4WY4B 2KUBA 2R3SA 4YXDC 2QRXA 4IOIH 1W2BO 1QEXA 2FY8A 3T97A 1PPJE 1NH4A 1SQBK 2D2CB 1MKMA 1SQPG 1Q82Q 1YITP 1S9KD 4B86A 2XV5A 1BE3G 4U7JA 3WU2E 5B5EE 1FC2C 5APSA 1KZUB 4DT0A 1OXZA 3HD7D 2J58A 2N1TA 2MKVA 1M1JC 2RKLA 3WUVA 1QVGO 1IFMA 3EFFK 1KV4A 4H13D 2E75B 2HODA 2RN0A 4ZMDA 1R5LA 3L4FA 1LTJA 1LWUC 4IFMA 2WT7B 1YBKA 2FBWC 2KZIA 3AEAC 3BCCJ 3AE9C 1M7LA 2FYUD 1Y8AA 2IBZG 3H1JG 1VF5D 5AW9B 2QEXP 3QH9A 3II6A 2KS1A 1BCCG 3IFMA 1SQQE 5H2FE 1IC2A 2WSFH 2HFED 2O1KA 3V4WA 1NTKE 1HJ0A 3TNUA 3CXHD 1RQVA 2QJPC 3H1ID 2QM8A 1HVVA 3H1KE 3L70J 4L73A 4WBAA 1L0LJ 1IFJA 1YI2P 2JWAA 2HYNA 3C8VA 1X8YA 5TISE 1GL2A 3AE4C 3GLMA 2Y0CA 5KJ7D 4R4LA 1JMMA 5CCGA 4MN4C 1A02J 5KAIE 5AVZB 3S1KA 4PJ0E 1FJKA 3RBXA 3HUSA 2POHA 1KILA 1UIIA 2ZT9C 5KLIC 2N1TC 2KNCA 3JSVC 1OFCX 1RQUA 3BCCG 2A45I 1LP1B 1LTJC 3Q5RA 1T2KC 2Y9YA 1VQOP 3L73E 5KLVK 3SFEC 5GTHH 1X79B 3P32A 2YXRB 3RK2D 2V4HA 4PD4H 2ZT9B 5KLIB 4WVZA 3RK3B 3VP9A 2N1TB 2YKOA 1VQNP 2HR3A 2GUVA 1PGQA 3HE5A 2QE7H 3P8MC 2AEMA 3BRTB 3L70G 2B87A 1NU1K 1L0LG 2WPSA 3CCLP 1URQD 2P1JA 1AA0A 5AW6B 2E76C 2FXPA 1H89A 4HYTB 4I1LA 3WUTA 1R5SA 4EOTA 1BSNA 4W7ZA 1ZW0A 3PHLA 2JR8A 1GL2C 1Q81Q 3M9BA 1NTKD 1NTKJ 2IFMA 1SLQA 4N78E 3V6IA 3L72E 4GDOA 3G9RA 3H1KD 3H1KJ 5AVSB 5CCGC 2JP3A 2E76B 5DJUB 5AW1B 2P2UA 1W2EA 3MD0A 3HUSC 1LTBC 2E5YA 3VTPC 1KILC 3KQGA 1PPJG 3SSUA
chains in the Genus database with same CATH topology
3GHGC 1QL1A 1N73C 2A45G 5AVWB 4RESB 5CCHC 3H6PA 4N78D 5BU5A 2E43A 1RE4C 2FXMA 1L0NK 1NKNA 2XU6A 2HPCA 1J2JB 5APXA 1CZQA 1GU4A 3HRNA 2Q9IA 4C7NA 3N4XA 4C46A 3C9IA 4GT1A 2YO3A 3BATA 3LW5H 1RF1C 3LIEA 4WB4A 3P8CD 1CI6A 1KFMA 5KTBA 1FZCB 5AW5B 3HUSB 5CMZA 2WPRA 1KILB 2ZFCA 4WY4D 1SQQK 2OYIB 3V2PA 5APWA 3M0DA 3GHGB 1KFNA 3CI9A 2OARA 4IFDK 1LTTC 1M1JA 1N73B 2C9NY 3L35A 4AUWA 1SQXK 1JY3P 1NTKK 3RL0B 1LTGC 1N7SD 4N6JA 1JY2N 3L37A 1LWUA 1MUUA 2HODB 3TYYA 3OJAB 1RY3A 1LTJB 1FZGA 2FFDC 1RF1B 3BASA 1GW3A 2XDJA 1H8AA 1N86A 3KPEA 5APUA 1VPCA 1LGHB 1EQ7A 1FDMA 3HD7A 3L36A 1FBMA 1G2CB 4XE5B 4WY4C 1XTGB 1FJPA 1Z56A 2YO2A 5AVXB 1T8ZA 3HE5B 1JCDA 1JTHB 2W27A 1J1DC 3A3YB 3VP8A 1N7SC 3H32B 2NPSA 2FFDB 2Z5IA 3TNUB 1GW4A 1FOSE 3BRVB 2PAJA 3O8ZA 1NTZK 2WZ7A 3B5NB 1SQPK 5CJ0A 2WITA 3V2RA 2HLOA 1LTAC 3HE4A 3VMZA 3A5TA 1NWQA 3M06A 1JOCA 1KQLA 1JY3N 2KSJA 3EFGA 1T3JA 3CLQA 1XTCC 3RK3D 2A45H 4WY4B 3VN0A 5APTA 2M8RA 1JY2P 1T3UA 1HGVA 5BVZA 2C0WA 3VMXA 1GK6A 3VYIA 3T97A 1GZLA 3SWYA 3HTKB 1NH4A 1SQBK 1GL2B 3OA7A 1ZR4A 3E1IA 1J1EC 5AW4B 4EIJA 3V2QA 1HH0A 4DZOA 1FAVA 1SFCA 3U1AA 1S9KD 1SQVK 3R2PA 4B86A 4HH2A 1IK9A 2XV5A 3P7KA 3KDPB 3CL3D 1URQB 3PP5A 4N3YB 1FZEA 5APSA 2GM4A 1KZUB 2WPQA 2YMYA 3TSIA 1OXZA 2IPPA 3HD7D 5AW8B 3RK3C 2J58A 3M0DC 1RE3A 1NTMK 2N1TA 1M1JC 2H43A 2IFNA 5AVTB 2H8PD 2Z5HA 1IFMA 2M3BA 2HODA 2KP8A 4I6MC 1HGZA 4OH8B 2NPSD 1J1EB 3I5CA 1LTJA 3L4FA 1LWUC 4C7NB 1LTSC 4IFMA 2WT7B 2I1KA 1WT6A 2KB7P 2Q7CA 5KJ7A 1M7LA 1CI6B 4AQRD 1JY3O 1JO5A 4Y99C 5AW9B 3VMYA 1DX7A 3II6A 2W6BA 1G2CA 4LC1A 1YYCA 3HD7C 2OYHA 1JUNA 4XA4A 1G1IA 1QL2A 2WTYA 1YTZT 1FZAA 3IFMA 1MZ9A 3A2AA 3M9HA 1IC2A 1LT9A 2WSFH 5AVVB 1GDTA 2HFED 4IFFA 2O1KA 3V4WA 1ZR2A 1IO4A 2NPSC 3TNUA 3NTNA 1DEBA 1L4AA 3NFQA 3B5NA 3MTUE 2JJLA 3OAKA 1HWTC 2QM8A 2C9LY 1G1JA 3V4QA 1SFCD 2E42A 3WMM0 1AFOA 1HVVA 2P7JA 4GKGA 1MV8A 4Y99B 5APVA 5AW0B 4JYCA 1HBWA 4WBAA 1CW5A 4AYCA 1IFJA 4GIFA 1ZLLA 3MUDA 1GK4A 1DH3A 3M9QA 2XKMA 3UIAA 5AVUB 5CHXA 2KYVA 1HTLC 1E5WA 1ZV8A 1N7LA 1OWAA 2HYNA 2N1TD 3A7OA 3U1CA 3MGNA 3RL0D 1X8YA 2WWWA 2Z4EA 3KYQA 3G3ZA 1GL2A 3VOPA 2LKMA 3TK1A 1J1DB 1JY2O 1T2KD 1N7SB 2BASA 2Q3IA 2XZRA 4JYBA 5AW3B 5AVRB 3MIWA 2R5DA 4KHXA 2FYZA 5KJ7D 1SFCC 3HE4B 1JMMA 4DOJA 1HUCA 5CCGA 1URQA 1A02J 2N9BA 5AVZB 1NAFA 1FZCA 1FJKA 3HUSA 4O9BA 2POHA 4W7YA 5APQA 1KILA 2O01H 1IFNA 2OYIA 2YNYA 5AW7B 1RE3C 5APYA 4C7RA 3GHGA 1GTWA 5BU8B 2N1TC 1SP4A 2H7HA 1FZBA 1N73A 3RL0C 2C0XA 5CCHA 1VDFA 1IJDB 1FOSF 2R3CA 1NO4A 1RE4A 2A45I 2WT7A 1NHLA 1LTJC 2ZXEB 2YKQA 3SWFA 1T2KC 2I1JA 1L4AD 3M0AA 3BVHA 2HPCB 3B5ND 1SFCB 1A02F 3B8EB 1RF1A 5AW2B 2FKWB 4I2LC 5KJ7C 5KLVK 1X79B 3P32A 2R5BA 2W6AA 1L0LK 2PP6A 1JCCA 2VRSA 1N2DC 4ZKPA 3U59A 2GUSA 4ZKUA 3RK2D 2QM7A 2CPBA 2R32A 3LIDA 3IR9A 2OYHC 1NOHA 3RK3B 1FU1A 3VP9A 2N1TB 2YKOA 2GUVA 2Q5UA 1M1JB 1LT9C 3HE5A 2XNXA 1GL2D 1H88A 2YKPA 5AVYB 3P8MC 1JTHA 5AVQB 3BRTB 2J59M 2IX7C 4LLHA 3H32A 1LWUB 3EQ2A 2FFDA 1L4AC 3B5NC 1NU1K 2WPSA 5CCGD 1URQD 1YTZI 2P1JA 1MFZA 4M3LA 3NXSA 5AW6B 2O1JA 2CPSA 1FZFA 1H89A 4HYTB 3M91A 3RK2C 4I1LA 2OYHB 2L5GB 2MJZA 4EOTA 3V2NA 4WY4A 1KILD 2HG5D 3NMDA 2WSCH 3HD7B 1CSBA 1IFIA 1WRGA 1LT9B 1GU5A 4W7ZA 1X9VA 1SVFA 5CCHD 1JNMA 1ZN5A 1GL2C 1N7SA 1IFDA 1NKZB 3M9BA 4LGDE 2IFMA 1L4AB 3HTKA 1SLQA 2NPSB 4N78E 2JEEA 2KLVA 2P67A 1S9KE 1AQ5A 2WSEH 5AVSB 2FYUK 5CCGC 1URQC 4W80A 1RF0C 3V5BA 4JF7A 3RK2B 1GD2E 5AW1B 5CJ4A 3N7NA 1FZCC 2P2UA 1RF0A 1W2EA 3P8CE 1LTIC 2KOGA 3MD0A 3HUSC 1HJBA 1PFIA 1LTBC 3VTPC 1KILC 3KQGA 2OYIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJ7 C;  2PP6 A;  5CCH C;  1T3J A;  2HFE D;  3RK2 D;  3RK3 D;  2NPS C;  4WY4 B;  2M8R A;  1L4A A;  3RK3 B;  3B5N A;  2N1T B;  1SFC D;  1HVV A;  2WZ7 A;  1GL2 D;  1JTH A;  3HTK B;  1GL2 B;  1KIL B;  4WY4 D;  1L4A C;  3B5N C;  1SFC A;  2N1T D;  5CCG D;  1URQ D;  3RL0 D;  3KYQ A;  1URQ B;  3PP5 A;  1GL2 A;  3RL0 B;  1N7S D;  3TSI A;  3RK2 C;  2YMY A;  3VOP A;  3HD7 D;  3RK3 C;  1N7S B;  4WY4 A;  1KIL D;  2HG5 D;  3HD7 B;  3M0D C;  5KJ7 D;  1SFC C;  2N1T A;  5CCG A;  2XDJ A;  1URQ A;  4W7Z A;  2H8P D;  5CCH D;  1GL2 C;  4OH8 B;  1N7S A;  2NPS D;  4LGD E;  3HD7 A;  1L4A B;  2NPS B;  4W7Y A;  4WY4 C;  1KIL A;  4N78 E;  1XTG B;  5KJ7 A;  2N1T C;  5CCG C;  1URQ C;  4W80 A;  3RL0 C;  5CCH A;  4JF7 A;  3RK2 B;  1JTH B;  1N7S C;  1NHL A;  2NPS A;  3P8C E;  2KOG A;  3HD7 C;  1L4A D;  3B5N D;  1KIL C;  1SFC B;  3B5N B; 
#chains in the Genus database with same CATH topology
 1M1K Q;  2IYO A;  2A45 G;  2ZYA A;  5BU5 A;  1WMK A;  1L0N K;  3F5H A;  1GU4 A;  2YO3 A;  4ASV A;  1VQK P;  1CI6 A;  2Q1K A;  3HUS B;  3GMA A;  1H0T A;  2WPR A;  1KIL B;  2ZFC A;  2KI7 B;  3V2P A;  1DD4 A;  4OWF A;  2K37 A;  1JY3 P;  1LTG C;  3PJS K;  3I55 P;  3CCV P;  3RBZ A;  1PGP A;  3TGU E;  3OJA B;  3L73 J;  3BAS A;  2XDJ A;  1EXI A;  2WVR A;  3KPE A;  1LGH B;  1SQQ G;  1DIP A;  3HD7 A;  3CCQ P;  1FJP A;  3ITK A;  4XFJ A;  1NTK G;  3HE5 B;  3D71 A;  2W27 A;  2JO1 A;  3H1K G;  3I56 P;  3CCU P;  2B87 B;  4BWN A;  3A0B E;  1GW4 A;  3KZI H;  1BSH A;  3O8Z A;  1NTZ K;  5CJ0 A;  3V2R A;  2HLO A;  3M06 A;  3EFG A;  1QLE D;  4ASW A;  1XTC C;  2A45 H;  3FXD A;  3O6Q A;  3USS A;  3VN0 A;  2WSF J;  3SFD C;  2C0W A;  4YTP C;  1N8R Q;  3WU2 H;  3FX0 A;  1ZR4 A;  3E1I A;  1J1E C;  1EXJ A;  4EIJ A;  3V2Q A;  4DZO A;  2M5A A;  1NU1 D;  3L72 J;  1FAV A;  1SQV K;  1IK9 A;  3PP5 A;  2FYU E;  2A06 E;  3TSI A;  3JCU E;  2QVA A;  3EWK A;  2AEJ A;  1RE3 A;  5DJT B;  3IAO A;  1NTM K;  4NPE A;  3AED C;  2BCC E;  2IZ1 A;  2Z5H A;  2M3B A;  3TDK A;  3L73 G;  2NPS D;  4K3A A;  1J1E B;  3VMA A;  5H2F H;  4KT0 J;  2Q7C A;  5KJ7 A;  1Q7Y Q;  1CI6 B;  4AQR D;  3CXH E;  1JY3 O;  2XND H;  3H1I E;  1JO5 A;  1H0T B;  1G2C A;  4LC1 A;  3HD7 C;  2IYP A;  1G1I A;  1W5C E;  2AXC A;  5KKZ C;  1RHZ B;  3LW5 J;  3M9H A;  1U7J A;  1GDT A;  4H13 C;  1L0N D;  1L0N J;  2G3A A;  1IO4 A;  2QJK B;  3TGU J;  2FYN C;  1S4X A;  3NTN A;  5L8R J;  3NFQ A;  1MFT A;  3MTU E;  2JJL A;  4PD4 I;  1HWT C;  2C9L Y;  1G1J A;  3V4Q A;  3AE2 C;  1KN7 A;  3WMM 0;  4GKG A;  1MV8 A;  3L75 D;  3L75 J;  2YXQ B;  3AEG C;  4H0L D;  2SPZ A;  1VQL P;  1VF5 C;  1CW5 A;  2ZVO B;  1DH3 A;  5AVU B;  5CHX A;  5KKZ B;  2CK3 H;  5C39 A;  1HTL C;  1E5W A;  1ZV8 A;  1N7L A;  3S9O A;  1M56 D;  4L76 A;  5KAI H;  4I7Z C;  3RL0 D;  4H13 B;  4PJ0 H;  3H1H D;  3G3Z A;  3KZI E;  3L72 G;  2FYN B;  4BRY A;  3VOP A;  2LKM A;  3TK1 A;  1OVR A;  1N7S B;  3D70 A;  2Q3I A;  1KMI Z;  2XZR A;  4JYB A;  3MIW A;  2R5D A;  1AQT A;  3L71 D;  4KHX A;  5M1B A;  1URQ A;  2W90 A;  1VF5 B;  2N9B A;  3IN6 A;  3O6Q B;  3QWO C;  2K9Y A;  1PP9 E;  1IFN A;  2OYI A;  3CC2 P;  4I7Z B;  1VQ8 P;  1RE3 C;  1PIX A;  2E74 D;  1SP4 A;  1FZB A;  4KJM A;  1FOS F;  1NO4 A;  1RE4 A;  1KYO D;  1NHL A;  1PV3 A;  2ZXE B;  2M5A B;  3BVH A;  2HPC B;  3B5N D;  1SQB E;  1NTZ D;  5AW2 B;  4L74 A;  2FKW B;  4I2L C;  5KJ7 C;  2R5B A;  1N2D C;  2AXT E;  3U59 A;  2FYU J;  2A06 D;  2GUS A;  4ZKU A;  1VQ9 P;  4EI2 A;  3IR9 A;  3CCS P;  1NOH A;  3B71 A;  3TGU G;  2BCC D;  2BCC J;  4JQ0 D;  2NRG A;  4OGQ D;  1M1J B;  1H88 A;  3R4Y A;  3PTZ A;  5GTI H;  2D2C D;  4GOE A;  1JTH A;  2J59 M;  1KQG B;  2IX7 C;  1T6A A;  4LLH A;  2ZXX A;  1LWU B;  2FFD A;  3CXH I;  1YJN P;  1YTZ I;  3H1I J;  2OYO A;  1M90 Q;  2O1J A;  3FWN A;  2CPS A;  1K8A Q;  3GF7 A;  3RK2 C;  1S72 P;  1JB0 J;  3NMD A;  4UB6 E;  1OX3 A;  1DEE G;  1CSB A;  1IFI A;  2E75 D;  3JC2 2;  5CCH D;  1JNM A;  1ZN5 A;  1NKZ B;  1D7M A;  2JEE A;  2WMM A;  2QJP B;  2P67 A;  1URQ C;  4W80 A;  1RF0 C;  3RK2 B;  5CJ4 A;  3Q2Y A;  1IZN B;  2P10 A;  2OTL P;  2Y0D A;  2LR2 A;  3CCM P;  1PL5 A;  2OYI C;  3PRJ A;  1DD3 A;  2ZYG A;  1QL1 A;  1QGK B;  1KB9 D;  2JDI H;  5E79 E;  3T97 B;  1RE4 C;  2FXM A;  1NKN A;  1J2J B;  4U3F D;  2Q9I A;  3N4X A;  2FYU G;  2A06 G;  3BAT A;  3LW5 H;  1SS1 A;  5KTB A;  2NZ2 A;  1OW7 A;  2W6J H;  3G4S P;  1AV1 A;  2BCC G;  1PP9 D;  1PP9 J;  4K35 A;  2OYI B;  5APW A;  2B89 A;  1KFN A;  2OAR A;  1NAY A;  3E7K A;  1SQX K;  1EDJ A;  4D6T D;  3L37 A;  2HOD B;  3MZW B;  3H1I G;  1LTJ B;  1SQB D;  1FZG A;  1SQB J;  2FFD C;  2O01 J;  1GW3 A;  1OVU A;  2Q3E A;  1N86 A;  1BGY D;  1BGY J;  5KLV E;  3D6Y A;  3A0B H;  3L36 A;  4XE5 B;  2KS1 B;  1XTG B;  5GTI E;  1OVV A;  5AVX B;  3Q5P A;  1T8Z A;  1P84 D;  1QVF O;  1JCD A;  1JTH B;  2FXO A;  1J1D C;  2NPS A;  3KXD A;  2FFD B;  3TNU B;  4Z1M H;  1FOS E;  3CCR P;  1SQP K;  1LTA C;  1NU1 E;  2KZJ A;  1JOC A;  1KQL A;  4L75 A;  2QG4 A;  1KQF B;  2KSJ A;  2O3J A;  3CLQ A;  1S3J A;  3RK3 D;  2V7Q J;  1M57 D;  2M3E A;  3L74 D;  1EZV D;  1VQP P;  3GF3 A;  1ZXG A;  2M8R A;  1YHQ P;  1JY2 P;  1HGV A;  1U7M A;  5BVZ A;  1TU3 F;  1X0T A;  2W83 C;  5K5G B;  3VMX A;  1GK6 A;  1VQM P;  1S5L X;  3JCU H;  3SWY A;  1OZH A;  1GL2 B;  4QMA A;  3OA7 A;  1ZME C;  1HH0 A;  1S5L H;  3U1A A;  1PP9 G;  3KDP B;  1BDD A;  1FZE A;  2WPQ A;  3IF4 A;  1YIJ P;  2W8Z A;  3CXH H;  1LJ2 A;  2K3R A;  2JKV A;  2IFN A;  5AVT B;  2WSE J;  1SQB G;  2KNC B;  2QJY C;  1AJY A;  4I6M C;  3ABV C;  4YXW H;  1IFP A;  3CX5 D;  2I1K A;  1L0N E;  1WT6 A;  2KB7 P;  4JPZ B;  1ZP0 C;  4H44 C;  2PGD A;  3VMY A;  2BEQ D;  2W6B A;  4A7P A;  3L75 E;  2OYH A;  1GMJ A;  1LNQ A;  1FZA A;  2H89 C;  2JWD A;  2QJY B;  1LT9 A;  5AVV B;  1ZR2 A;  2NPS C;  1S1C X;  1DEB A;  3H1H E;  3AEF C;  2RMZ A;  3B5N A;  2DW3 A;  3OAK A;  1SFC D;  3AE8 C;  1KB9 H;  4JYC A;  3L71 E;  5KLV D;  5KLV J;  1HBW A;  3K5B A;  4AYC A;  2KK7 A;  3H1L E;  1GK4 A;  3M9Q A;  3UIA A;  3CWB E;  5KAF H;  2KYV A;  3Q3D A;  2ZYD A;  3MGN A;  2R44 A;  1SQX D;  3KYQ A;  1HF9 A;  1BDC A;  1JY2 O;  1ZRT E;  2BAS A;  3A0H E;  5AVR B;  1KYO E;  2FYZ A;  4DOJ A;  1M8O B;  1KQS O;  1NU1 J;  1NTZ E;  4H0L C;  1NAF A;  1FZC A;  2K88 A;  4H44 D;  2OTK E;  4O9B A;  1OIP A;  4W7Y A;  4Y28 J;  5APQ A;  2O01 H;  1S2E A;  2WPV B;  2YNY A;  4C7R A;  3GHG A;  1GTW A;  5BU8 B;  2AXT H;  2N9Y B;  4TLF A;  3RL0 C;  5CCH A;  1S5L E;  2WT7 A;  3SWF A;  2I1J A;  1L4A D;  3M0A A;  1EDL A;  1RF1 A;  1L0L K;  2OGU A;  1U57 A;  2M0B A;  1SQV E;  4ZKP A;  1YJ9 P;  2QM7 A;  3Q5S A;  2CPB A;  2R32 A;  2OYH C;  1YJW P;  2E74 C;  2BEZ F;  1LT9 C;  1PGJ A;  2XNX A;  1NTM E;  1PZQ A;  2YKP A;  2V7Q H;  5AVQ B;  4UB6 H;  1Y9B A;  5KLV G;  3B5N C;  3CC7 P;  1AVY A;  1FE6 A;  1FS0 E;  1MFZ A;  4M3L A;  3AE3 C;  3NXS A;  1VQ4 P;  4PV1 D;  2IBZ D;  1FZF A;  3H1J D;  3H1J J;  2KLU A;  2OYH B;  2Y0E A;  2MJZ A;  3V2N A;  2WSC H;  3HD7 B;  1JM0 A;  1USE A;  2E74 B;  1BCC D;  1BCC J;  1LT9 B;  2ZVN B;  1GU5 A;  4OGQ C;  4PD4 D;  2D2C C;  3HTK A;  3CME P;  3H1H J;  1NU1 G;  1KB9 E;  3S4R A;  4DJG A;  2QA4 P;  2IZ0 A;  1UIX A;  3AE1 C;  4U3F E;  2WSE H;  2K1A A;  5KAF E;  5E79 H;  3L71 J;  1VQ6 P;  3V5B A;  3W68 A;  1GD2 E;  3N7N A;  1FZC C;  3CX5 H;  1RF0 A;  3H1L D;  3H1L J;  2KOG A;  3MHV A;  3CWB D;  2Q6Q A;  3CWB J;  3Q1M A;  3GHG C;  4OGQ B;  1LT1 A;  2E75 C;  4HKZ H;  5CCH C;  1LP1 A;  3H6P A;  1USD A;  2O01 N;  2XU6 A;  1ZRT D;  5TJH A;  4JBZ A;  1KYO I;  5APX A;  1CZQ A;  4D6T E;  3HRN A;  4C7N A;  4C46 A;  5B66 E;  4GT1 A;  1RF1 C;  3C1L A;  3LIE A;  4WB4 A;  3P8C D;  1NTZ J;  1FZC B;  5AW5 B;  1QX8 A;  3KHU A;  2G8Y A;  4WY4 D;  1BGY E;  1SQQ K;  3M0D A;  1NYH A;  3GHG B;  4BXL A;  4IFD K;  3AE5 C;  4CPG A;  2C9N Y;  3L35 A;  3SWK A;  2LXC B;  1NTK K;  3D6Z A;  1L0N G;  1N7S D;  1MUU A;  1P84 E;  3BCC D;  3TYY A;  3OW2 O;  1RY3 A;  1RF1 B;  3L75 G;  1Q90 D;  1H8A A;  1SQV D;  1SQV J;  1FDM A;  1K04 A;  1G2C B;  3PH0 A;  2AEF A;  3RK3 E;  2PFX A;  1EZV E;  3L74 E;  1K05 A;  2YO2 A;  3B4S A;  2K9J A;  3H1H G;  1NTM D;  1NTM J;  3F89 A;  3A3Y B;  3VP8 A;  3H25 A;  3WUU A;  3L71 G;  1K73 Q;  2Z5I A;  3L70 D;  3BRV B;  4WWI A;  2PAJ A;  2WZ7 A;  5EFW B;  2WIT A;  3H1L G;  1L0L D;  3AEE C;  3HE4 A;  3CWB G;  3A5T A;  1T3J A;  3FXE A;  2YIU C;  1IK7 A;  3RGU A;  5APT A;  1VQ5 P;  1T3U A;  2E5T A;  4HJG H;  1ZOY C;  3VYI A;  1R8E A;  1GZL A;  1KB9 I;  3HTK B;  2KSE A;  2RH0 A;  4BRY B;  5AW4 B;  1NTZ G;  3RL0 g;  1SFC A;  4U3F J;  4TT3 H;  3CX5 E;  3R2P A;  4HH2 A;  3P7K A;  3CL3 D;  1URQ B;  1OW8 A;  2WQY C;  4N3Y B;  1FDO A;  2YIU B;  2GM4 A;  2YMY A;  2IPP A;  5AW8 B;  3RK3 C;  4GOF A;  3M0D C;  4UB8 H;  1PPJ D;  1YQ3 C;  2H43 A;  2H8P D;  4NPF X;  2KP8 A;  1HGZ A;  4OH8 B;  2ITA A;  3I5C A;  4C7N B;  4D6T J;  1LTS C;  3CMA P;  3G6E P;  1SQV G;  3CPW O;  4NPD A;  4R4M A;  1NJI Q;  2UWJ E;  4Y99 C;  1L2P A;  1DX7 A;  1YYC A;  1YQ4 C;  1JUN A;  5CBN A;  2Y9Z A;  4XA4 A;  1KIL E;  1NTM G;  1QL2 A;  2WTY A;  1YTZ T;  2OQQ A;  1MZ9 A;  3A2A A;  1P84 I;  4IFF A;  3CCJ P;  3AE6 C;  1SQX E;  1L4A A;  2LXB A;  2E42 A;  1AFO A;  3G71 P;  2P7J A;  2H88 C;  4Y99 B;  5APV A;  1EDK A;  5AW0 B;  1AVO A;  4GIF A;  1ZLL A;  3MUD A;  1EC5 A;  1JMB A;  3A0H H;  2XKM A;  1SQQ D;  1EZV I;  1KYO H;  1SQQ J;  2ZT9 D;  3L74 J;  1OWA A;  2N1T D;  3A7O A;  3U1C A;  2K9J B;  2WWW A;  2Z4E A;  4U3F G;  1J1D B;  1T2K D;  1KTM A;  2PRR A;  5AW3 B;  1SFC C;  3HE4 B;  2QIW A;  1HUC A;  2WSC J;  1SQP E;  2J5U A;  4RKU J;  1BE3 E;  3ZDM A;  1EDI A;  3CCE P;  5AW7 B;  5APY A;  1VL2 A;  2H7H A;  4D6T G;  1N73 A;  2C0X A;  1VDF A;  1IJD B;  2R3C A;  2YKQ A;  3CX5 I;  1SFC B;  1A02 F;  2P58 A;  3B8E B;  2W6A A;  2PP6 A;  1BGY G;  4DCK A;  1JCC A;  2OTJ P;  2E76 D;  2VRS A;  4UB8 E;  3LID A;  1FDI A;  1FU1 A;  2IBZ E;  3H1J E;  1KD1 Q;  2ZAE B;  2Q5U A;  5GTH E;  1GL2 D;  5AVY B;  1BCC E;  3L73 D;  3H32 A;  3PLN A;  3EQ2 A;  1L4A C;  4PD4 E;  3CD6 P;  2KIK A;  2L91 A;  5CCG D;  1OMI A;  5CBO A;  4IL6 X;  4H44 B;  3L74 G;  1EZV G;  3M91 A;  3W67 A;  3MUD C;  2L5G B;  2WSS H;  4WY4 A;  1KIL D;  2HG5 D;  4IL6 H;  1WRG A;  4EDF A;  3CC4 P;  1OW6 A;  1X9V A;  1SVF A;  3AE7 C;  4RO0 A;  1SQX J;  1N7S A;  1IFD A;  3AEC C;  3AEB C;  4LGD E;  1L4A B;  2NPS B;  1RH5 B;  3MP7 B;  2KLV A;  1S9K E;  1AQ5 A;  2FYU K;  4EYY Q;  4JF7 A;  1NGM B;  1NVO A;  4PV1 C;  3P8C E;  1LTI C;  4ZNC A;  5B66 H;  1HJB A;  1PFI A;  5B5E H;  4RJT A;  1N73 C;  1Q2N A;  5AVW B;  4RES B;  1E79 H;  4N78 D;  2KXP B;  2E43 A;  3L72 D;  2QSI A;  2HPC A;  1KOR A;  3C9I A;  3BCC E;  1KC8 Q;  1SQP D;  1Q86 Q;  1SQP J;  1KFM A;  4PV1 B;  1P84 H;  3GG2 A;  3TF5 A;  4H0L B;  5CMZ A;  1BE3 D;  1BE3 J;  2B88 A;  2YMK A;  3CI9 A;  1LTT C;  1M1J A;  1N73 B;  4OVN F;  4AUW A;  2QJK C;  3RL0 B;  4N6J A;  1JY2 N;  1LWU A;  2ZJS E;  3GW6 A;  1JEK A;  4GOD A;  2B9B A;  1PGO A;  1Y47 A;  4YPC A;  3L70 E;  5APU A;  1VPC A;  1L0L E;  1EQ7 A;  2IBZ I;  1FBM A;  3FWL A;  4WY4 C;  1VQ7 P;  1Z56 A;  1SQX G;  3E1R A;  2GA1 A;  3TGU D;  1N7S C;  3H32 B;  3FGA D;  1K9M Q;  5TIS H;  4HB1 A;  3B5N B;  2I8D A;  3VMZ A;  1NWQ A;  1JY3 N;  4IL6 E;  1X22 A;  2IDB A;  4WY4 B;  2KUB A;  2R3S A;  4YXD C;  2QRX A;  4IOI H;  1W2B O;  1QEX A;  2FY8 A;  3T97 A;  1PPJ E;  1NH4 A;  1SQB K;  2D2C B;  1MKM A;  1SQP G;  1Q82 Q;  1YIT P;  1S9K D;  4B86 A;  2XV5 A;  1BE3 G;  4U7J A;  3WU2 E;  5B5E E;  1FC2 C;  5APS A;  1KZU B;  4DT0 A;  1OXZ A;  3HD7 D;  2J58 A;  2N1T A;  2MKV A;  1M1J C;  2RKL A;  3WUV A;  1QVG O;  1IFM A;  3EFF K;  1KV4 A;  4H13 D;  2E75 B;  2HOD A;  2RN0 A;  4ZMD A;  1R5L A;  3L4F A;  1LTJ A;  1LWU C;  4IFM A;  2WT7 B;  1YBK A;  2FBW C;  2KZI A;  3AEA C;  3BCC J;  3AE9 C;  1M7L A;  2FYU D;  1Y8A A;  2IBZ G;  3H1J G;  1VF5 D;  5AW9 B;  2QEX P;  3QH9 A;  3II6 A;  2KS1 A;  1BCC G;  3IFM A;  1SQQ E;  5H2F E;  1IC2 A;  2WSF H;  2HFE D;  2O1K A;  3V4W A;  1NTK E;  1HJ0 A;  3TNU A;  3CXH D;  1RQV A;  2QJP C;  3H1I D;  2QM8 A;  1HVV A;  3H1K E;  3L70 J;  4L73 A;  4WBA A;  1L0L J;  1IFJ A;  1YI2 P;  2JWA A;  2HYN A;  3C8V A;  1X8Y A;  5TIS E;  1GL2 A;  3AE4 C;  3GLM A;  2Y0C A;  5KJ7 D;  4R4L A;  1JMM A;  5CCG A;  4MN4 C;  1A02 J;  5KAI E;  5AVZ B;  3S1K A;  4PJ0 E;  1FJK A;  3RBX A;  3HUS A;  2POH A;  1KIL A;  1UII A;  2ZT9 C;  5KLI C;  2N1T C;  2KNC A;  3JSV C;  1OFC X;  1RQU A;  3BCC G;  2A45 I;  1LP1 B;  1LTJ C;  3Q5R A;  1T2K C;  2Y9Y A;  1VQO P;  3L73 E;  5KLV K;  3SFE C;  5GTH H;  1X79 B;  3P32 A;  2YXR B;  3RK2 D;  2V4H A;  4PD4 H;  2ZT9 B;  5KLI B;  4WVZ A;  3RK3 B;  3VP9 A;  2N1T B;  2YKO A;  1VQN P;  2HR3 A;  2GUV A;  1PGQ A;  3HE5 A;  2QE7 H;  3P8M C;  2AEM A;  3BRT B;  3L70 G;  2B87 A;  1NU1 K;  1L0L G;  2WPS A;  3CCL P;  1URQ D;  2P1J A;  1AA0 A;  5AW6 B;  2E76 C;  2FXP A;  1H89 A;  4HYT B;  4I1L A;  3WUT A;  1R5S A;  4EOT A;  1BSN A;  4W7Z A;  1ZW0 A;  3PHL A;  2JR8 A;  1GL2 C;  1Q81 Q;  3M9B A;  1NTK D;  1NTK J;  2IFM A;  1SLQ A;  4N78 E;  3V6I A;  3L72 E;  4GDO A;  3G9R A;  3H1K D;  3H1K J;  5AVS B;  5CCG C;  2JP3 A;  2E76 B;  5DJU B;  5AW1 B;  2P2U A;  1W2E A;  3MD0 A;  3HUS C;  1LTB C;  2E5Y A;  3VTP C;  1KIL C;  3KQG A;  1PPJ G;  3SSU A; 
#chains in the Genus database with same CATH homology
 3GHG C;  1QL1 A;  1N73 C;  2A45 G;  5AVW B;  4RES B;  5CCH C;  3H6P A;  4N78 D;  5BU5 A;  2E43 A;  1RE4 C;  2FXM A;  1L0N K;  1NKN A;  2XU6 A;  2HPC A;  1J2J B;  5APX A;  1CZQ A;  1GU4 A;  3HRN A;  2Q9I A;  4C7N A;  3N4X A;  4C46 A;  3C9I A;  4GT1 A;  2YO3 A;  3BAT A;  3LW5 H;  1RF1 C;  3LIE A;  4WB4 A;  3P8C D;  1CI6 A;  1KFM A;  5KTB A;  1FZC B;  5AW5 B;  3HUS B;  5CMZ A;  2WPR A;  1KIL B;  2ZFC A;  4WY4 D;  1SQQ K;  2OYI B;  3V2P A;  5APW A;  3M0D A;  3GHG B;  1KFN A;  3CI9 A;  2OAR A;  4IFD K;  1LTT C;  1M1J A;  1N73 B;  2C9N Y;  3L35 A;  4AUW A;  1SQX K;  1JY3 P;  1NTK K;  3RL0 B;  1LTG C;  1N7S D;  4N6J A;  1JY2 N;  3L37 A;  1LWU A;  1MUU A;  2HOD B;  3TYY A;  3OJA B;  1RY3 A;  1LTJ B;  1FZG A;  2FFD C;  1RF1 B;  3BAS A;  1GW3 A;  2XDJ A;  1H8A A;  1N86 A;  3KPE A;  5APU A;  1VPC A;  1LGH B;  1EQ7 A;  1FDM A;  3HD7 A;  3L36 A;  1FBM A;  1G2C B;  4XE5 B;  4WY4 C;  1XTG B;  1FJP A;  1Z56 A;  2YO2 A;  5AVX B;  1T8Z A;  3HE5 B;  1JCD A;  1JTH B;  2W27 A;  1J1D C;  3A3Y B;  3VP8 A;  1N7S C;  3H32 B;  2NPS A;  2FFD B;  2Z5I A;  3TNU B;  1GW4 A;  1FOS E;  3BRV B;  2PAJ A;  3O8Z A;  1NTZ K;  2WZ7 A;  3B5N B;  1SQP K;  5CJ0 A;  2WIT A;  3V2R A;  2HLO A;  1LTA C;  3HE4 A;  3VMZ A;  3A5T A;  1NWQ A;  3M06 A;  1JOC A;  1KQL A;  1JY3 N;  2KSJ A;  3EFG A;  1T3J A;  3CLQ A;  1XTC C;  3RK3 D;  2A45 H;  4WY4 B;  3VN0 A;  5APT A;  2M8R A;  1JY2 P;  1T3U A;  1HGV A;  5BVZ A;  2C0W A;  3VMX A;  1GK6 A;  3VYI A;  3T97 A;  1GZL A;  3SWY A;  3HTK B;  1NH4 A;  1SQB K;  1GL2 B;  3OA7 A;  1ZR4 A;  3E1I A;  1J1E C;  5AW4 B;  4EIJ A;  3V2Q A;  1HH0 A;  4DZO A;  1FAV A;  1SFC A;  3U1A A;  1S9K D;  1SQV K;  3R2P A;  4B86 A;  4HH2 A;  1IK9 A;  2XV5 A;  3P7K A;  3KDP B;  3CL3 D;  1URQ B;  3PP5 A;  4N3Y B;  1FZE A;  5APS A;  2GM4 A;  1KZU B;  2WPQ A;  2YMY A;  3TSI A;  1OXZ A;  2IPP A;  3HD7 D;  5AW8 B;  3RK3 C;  2J58 A;  3M0D C;  1RE3 A;  1NTM K;  2N1T A;  1M1J C;  2H43 A;  2IFN A;  5AVT B;  2H8P D;  2Z5H A;  1IFM A;  2M3B A;  2HOD A;  2KP8 A;  4I6M C;  1HGZ A;  4OH8 B;  2NPS D;  1J1E B;  3I5C A;  1LTJ A;  3L4F A;  1LWU C;  4C7N B;  1LTS C;  4IFM A;  2WT7 B;  2I1K A;  1WT6 A;  2KB7 P;  2Q7C A;  5KJ7 A;  1M7L A;  1CI6 B;  4AQR D;  1JY3 O;  1JO5 A;  4Y99 C;  5AW9 B;  3VMY A;  1DX7 A;  3II6 A;  2W6B A;  1G2C A;  4LC1 A;  1YYC A;  3HD7 C;  2OYH A;  1JUN A;  4XA4 A;  1G1I A;  1QL2 A;  2WTY A;  1YTZ T;  1FZA A;  3IFM A;  1MZ9 A;  3A2A A;  3M9H A;  1IC2 A;  1LT9 A;  2WSF H;  5AVV B;  1GDT A;  2HFE D;  4IFF A;  2O1K A;  3V4W A;  1ZR2 A;  1IO4 A;  2NPS C;  3TNU A;  3NTN A;  1DEB A;  1L4A A;  3NFQ A;  3B5N A;  3MTU E;  2JJL A;  3OAK A;  1HWT C;  2QM8 A;  2C9L Y;  1G1J A;  3V4Q A;  1SFC D;  2E42 A;  3WMM 0;  1AFO A;  1HVV A;  2P7J A;  4GKG A;  1MV8 A;  4Y99 B;  5APV A;  5AW0 B;  4JYC A;  1HBW A;  4WBA A;  1CW5 A;  4AYC A;  1IFJ A;  4GIF A;  1ZLL A;  3MUD A;  1GK4 A;  1DH3 A;  3M9Q A;  2XKM A;  3UIA A;  5AVU B;  5CHX A;  2KYV A;  1HTL C;  1E5W A;  1ZV8 A;  1N7L A;  1OWA A;  2HYN A;  2N1T D;  3A7O A;  3U1C A;  3MGN A;  3RL0 D;  1X8Y A;  2WWW A;  2Z4E A;  3KYQ A;  3G3Z A;  1GL2 A;  3VOP A;  2LKM A;  3TK1 A;  1J1D B;  1JY2 O;  1T2K D;  1N7S B;  2BAS A;  2Q3I A;  2XZR A;  4JYB A;  5AW3 B;  5AVR B;  3MIW A;  2R5D A;  4KHX A;  2FYZ A;  5KJ7 D;  1SFC C;  3HE4 B;  1JMM A;  4DOJ A;  1HUC A;  5CCG A;  1URQ A;  1A02 J;  2N9B A;  5AVZ B;  1NAF A;  1FZC A;  1FJK A;  3HUS A;  4O9B A;  2POH A;  4W7Y A;  5APQ A;  1KIL A;  2O01 H;  1IFN A;  2OYI A;  2YNY A;  5AW7 B;  1RE3 C;  5APY A;  4C7R A;  3GHG A;  1GTW A;  5BU8 B;  2N1T C;  1SP4 A;  2H7H A;  1FZB A;  1N73 A;  3RL0 C;  2C0X A;  5CCH A;  1VDF A;  1IJD B;  1FOS F;  2R3C A;  1NO4 A;  1RE4 A;  2A45 I;  2WT7 A;  1NHL A;  1LTJ C;  2ZXE B;  2YKQ A;  3SWF A;  1T2K C;  2I1J A;  1L4A D;  3M0A A;  3BVH A;  2HPC B;  3B5N D;  1SFC B;  1A02 F;  3B8E B;  1RF1 A;  5AW2 B;  2FKW B;  4I2L C;  5KJ7 C;  5KLV K;  1X79 B;  3P32 A;  2R5B A;  2W6A A;  1L0L K;  2PP6 A;  1JCC A;  2VRS A;  1N2D C;  4ZKP A;  3U59 A;  2GUS A;  4ZKU A;  3RK2 D;  2QM7 A;  2CPB A;  2R32 A;  3LID A;  3IR9 A;  2OYH C;  1NOH A;  3RK3 B;  1FU1 A;  3VP9 A;  2N1T B;  2YKO A;  2GUV A;  2Q5U A;  1M1J B;  1LT9 C;  3HE5 A;  2XNX A;  1GL2 D;  1H88 A;  2YKP A;  5AVY B;  3P8M C;  1JTH A;  5AVQ B;  3BRT B;  2J59 M;  2IX7 C;  4LLH A;  3H32 A;  1LWU B;  3EQ2 A;  2FFD A;  1L4A C;  3B5N C;  1NU1 K;  2WPS A;  5CCG D;  1URQ D;  1YTZ I;  2P1J A;  1MFZ A;  4M3L A;  3NXS A;  5AW6 B;  2O1J A;  2CPS A;  1FZF A;  1H89 A;  4HYT B;  3M91 A;  3RK2 C;  4I1L A;  2OYH B;  2L5G B;  2MJZ A;  4EOT A;  3V2N A;  4WY4 A;  1KIL D;  2HG5 D;  3NMD A;  2WSC H;  3HD7 B;  1CSB A;  1IFI A;  1WRG A;  1LT9 B;  1GU5 A;  4W7Z A;  1X9V A;  1SVF A;  5CCH D;  1JNM A;  1ZN5 A;  1GL2 C;  1N7S A;  1IFD A;  1NKZ B;  3M9B A;  4LGD E;  2IFM A;  1L4A B;  3HTK A;  1SLQ A;  2NPS B;  4N78 E;  2JEE A;  2KLV A;  2P67 A;  1S9K E;  1AQ5 A;  2WSE H;  5AVS B;  2FYU K;  5CCG C;  1URQ C;  4W80 A;  1RF0 C;  3V5B A;  4JF7 A;  3RK2 B;  1GD2 E;  5AW1 B;  5CJ4 A;  3N7N A;  1FZC C;  2P2U A;  1RF0 A;  1W2E A;  3P8C E;  1LTI C;  2KOG A;  3MD0 A;  3HUS C;  1HJB A;  1PFI A;  1LTB C;  3VTP C;  1KIL C;  3KQG A;  2OYI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...