3B5NC

Structure of the yeast plasma membrane snare complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
70
structure length
70
Chain Sequence
GSIKFTKQSSVASTRNTLKMAQDAERAGMNTLGMLGHQSEQLNNVEGNLDLMKVQNKVADEKVAELKKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Yeast Plasma Membrane SNARE Complex Reveals Destabilizing Water-filled Cavities.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords Synaptobrevin homolog 1
total genus 34
structure length 70
sequence length 70
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3b5nC00
1SFCC 1HVVA 1GL2D 1L4AD 1N7SC 3B5NB 2NPSD 2N1TA 5CCHC 3RK3D 1URQA 5CCGC 3B5NC 1GL2B 3HD7A 1SFCB 2WZ7A 1JTHB 5CCHD 3RL0B 1SFCD 5CCGA 2YMYA 5KJ7C 5CCHA 2HFED 1KILA 2H8PD 3P8CE 4WY4C 4W80A 1T3JA 4W7ZA 3RL0C 3RL0D 1XTGB 1SFCA 2PP6A 2NPSB 3RK2C 1URQD 3VOPA 4WY4A 3HD7C 4OH8B 2M8RA 4W7YA 3RK2D 1KILB 2HG5D 3HTKB 5KJ7A 3TSIA 1N7SB 1L4AB 4WY4D 3RK3C 3KYQA 3HD7D 3RK3B 1L4AC 1N7SD 1GL2C 1URQC 2N1TB 3PP5A 1KILC 1L4AA 3B5ND 3HD7B 2XDJA 5CCGD 4LGDE 1JTHA 2N1TD 3M0DC 1NHLA 3RK2B 2NPSC 4JF7A 3B5NA 5KJ7D 4WY4B 1URQB 2N1TC 4N78E 2NPSA 1N7SA 1GL2A 1KILD 2KOGA
chains in the Genus database with same CATH superfamily
1AJYA 1SQPK 1Y8AA 1HVVA 1GK6A 1Q86Q 2FFDB 3D6YA 2OQQA 1SQXD 1FC2C 3GLMA 1GK4A 3AECC 1RE4C 4PD4I 3L71E 5BVZA 2LKMA 3H32A 3HUSC 4QMAA 1R5LA 1ZR4A 3P8MC 4PV1D 3U1CA 2ZXEB 1RF1A 4GKGA 3CWBE 5K5GB 2OTKE 1N86A 2E5TA 1W2EA 3F5HA 3B5NC 1KQFB 2A06E 4H0LB 2KK7A 2O1KA 2OGUA 4I1LA 1NTMD 3H1HE 1S4XA 2KYVA 2K37A 5AVQB 5AW2B 5TJHA 3S9OA 3T97B 3TGUG 3E1RA 1S2EA 2NZ2A 5CCHD 2Q1KA 5KAFH 1GD2E 3O8ZA 1VQLP 2DW3A 2AEJA 1AV1A 4DJGA 3OAKA 2IDBA 3IFMA 2ZT9C 3SFDC 1J1DC 2ITAA 4A7PA 3H1LE 4BWNA 2KSJA 3WUTA 2HODB 1SLQA 3D6ZA 1CW5A 3IN6A 2K9JA 1IJDB 2XV5A 3G3ZA 4MN4C 4R4LA 5AVVB 3CCLP 1NTZG 2XNDH 1RF0C 1FS0E 3Q5SA 3L71D 1P84I 1LTJB 3V6IA 2B88A 1NVOA 2FYNB 1X79B 4W80A 3SWYA 3P8CD 1SQBG 1T3JA 3MIWA 3RL0C 1H8AA 3F89A 1EZVG 3M0AA 1Q7YQ 5APVA 4EDFA 3RL0D 2QVAA 2YIUB 4GODA 2PP6A 3W68A 1GTWA 4M3LA 2IBZE 5KAIH 4DOJA 1FZFA 2Q7CA 2RMZA 1URQD 5AVXB 2LXBA 1VQ6P 1KYOI 2YXRB 1ZOYC 2FYUJ 1BGYJ 1S5LE 3AEGC 3M9HA 3L70D 1L0NJ 1T6AA 3JCUE 3HD7C 1Y47A 2IFNA 2YKQA 4OH8B 4WY4A 3CD6P 1AQ5A 1NU1D 2HLOA 3TNUB 4GIFA 3RK2D 3AE2C 3TGUJ 3CI9A 1U57A 2HG5D 3HTKB 4JYBA 1PP9E 3R4YA 5CHXA 1N7SB 1R5SA 1FJPA 1M1JC 1L4AB 1SQXJ 3Q1MA 1EXJA 5KLVE 1A02F 4ASVA 4EOTA 2A06G 3L75E 4IL6X 2E75B 4HB1A 4JQ0D 4EI2A 1Q81Q 2W6JH 4PV1C 3V5BA 3L71G 3TGUD 3HD7D 2KNCB 1AA0A 4KT0J 4IFMA 4ZNCA 3IAOA 1DX7A 1SQQE 4L75A 3CX5D 1EDKA 1SQBJ 2BCCD 2N1TB 1WRGA 1BCCE 1MFZA 3I56P 2Q3EA 1IO4A 3CC7P 1FDMA 2AEFA 5AW5B 3H1JJ 1PZQA 5AVYB 1BE3E 1M8OB 1KILC 2HYNA 5TISE 1HH0A 1LWUB 2QIWA 1AVOA 1FZEA 1NH4A 3L37A 4H44C 4R4MA 5C39A 3G4SP 3CPWO 1A02J 2XDJA 5AW0B 1LTAC 2ZAEB 2WPSA 3L70G 2Y0CA 3IF4A 5CCGD 2FYUD 2ZYGA 2A45H 4LGDE 5KKZB 1YHQP 1M56D 1L0LD 3II6A 3MHVA 3PRJA 4OGQB 3W67A 2YKPA 3BATA 4ZMDA 4LLHA 4RESB 1NHLA 2WT7B 3H1LG 1JEKA 4BXLA 1W5CE 1KB9I 2D2CB 2L91A 2JEEA 2QRXA 1NOHA 5APSA 3VN0A 4H44B 2K9YA 1NTZJ 1FOSE 1LWUC 4UB8E 1SQPE 2Y9YA 4L74A 2V7QH 3V4QA 1KTMA 2E5YA 2GA1A 3E7KA 4WY4B 5B5EE 2WSCJ 2IBZG 1FZCA 3L71J 2K3RA 3MUDA 1HGVA 5AW7B 1HTLC 3V4WA 1KD1Q 2MKVA 1VQ9P 1BCCJ 1ZP0C 2AEMA 2NPSA 1LTBC 2O3JA 3MD0A 1OW6A 3CCEP 1SQQG 2H7HA 1UIXA 5KAIE 1WT6A 4PV1B 2R5DA 4TT3H 1SFCC 2BEQD 3CL3D 3BASA 1M7LA 4I6MC 1DD4A 1OW7A 3GMAA 5CCGA 1PPJG 2FXMA 1M1JB 3Q5PA 2C0XA 2BEZF 2WTYA 5AVZB 2NPSD 2E76D 1T8ZA 1QGKB 3O6QB 4NPDA 2W27A 2QE7H 3A0BH 3BCCE 3MUDC 1S9KE 1NTKD 4HJGH 1FZCC 1KFMA 1FZBA 1LT9A 2PRRA 2HR3A 2M3EA 3CXHE 4Y28J 4AUWA 3OA7A 2P67A 3V2QA 1KQSO 2WSSH 1YQ3C 2KZIA 3H1HD 1Q82Q 3BCCJ 1MZ9A 2WWWA 1PGJA 2P1JA 1DIPA 1JTHB 2G8YA 1JY2O 2GM4A 4XE5B 2WPVB 1OVUA 3L70E 3FXEA 3H1LD 1AVYA 1L0ND 2FYNC 2GUVA 2KSEA 1USDA 2VRSA 2YMYA 3ABVC 5KJ7C 3CC4P 5CCHA 1BE3G 3VTPC 1DH3A 2OTJP 2QG4A 1YJWP 1KILA 3RK3E 3SWFA 1RE3A 4JPZB 5H2FH 4DCKA 2E74C 3KQGA 2IZ1A 3L75G 1USEA 3OJAB 4RKUJ 1QVFO 1PPJD 1XTCC 2C0WA 3JC22 1SQPG 1VF5C 1OVVA 1XTGB 4GOFA 3VP8A 1LTIC 1T2KD 2QJPB 3A0HE 3D70A 2JO1A 1FU1A 1YTZI 3FWLA 3RK2C 3TGUE 1GDTA 4OGQC 3D71A 1SQPJ 4U3FD 1IK9A 4Y99C 3WUUA 3LIEA 1RH5B 4D6TJ 2KZJA 1KYOD 3CX5E 1SQVG 3H1KD 3R2PA 4UB8H 1L2PA 2WPRA 5APWA 4GOEA 3C1LA 2O01H 4W7YA 2ZT9D 5AW4B 5H2FE 1M1JA 4WWIA 5B66E 2O1JA 1H0TA 1D7MA 5AVSB 2A45G 2OYOA 5KJ7A 1GW4A 1ZMEC 3A5TA 3O6QA 4YXWH 5L8RJ 2Z4EA 4IOIH 3L74D 5AVUB 1OIPA 2R32A 4XA4A 1SQBE 4H13B 4WB4A 5KLVD 3M9QA 1HBWA 1IFJA 1T3UA 1N73A 2CPBA 2JJLA 3GF7A 3KYQA 4GT1A 5BU8B 2V4HA 1NWQA 2QA4P 2W83C 1X9VA 1L4AC 1N7SD 2ZXXA 3L75J 2K1AA 4HH2A 3CX5I 3FGAD 1EDJA 1KB9E 3HTKA 1NU1K 2CPSA 3CCRP 3CCSP 3L73E 4HYTB 1JB0J 1QL1A 4O9BA 3CCUP 1OVRA 1ZLLA 1BE3D 2FYUK 3VYIA 1L4AA 2YO3A 1FOSF 1RF0A 3HE5A 3V2PA 1L0LK 1M1KQ 1OX3A 1SQVE 1VL2A 3KPEA 1J1EB 1N73C 3V2RA 2LR2A 4K35A 5AVRB 1SQBK 2E74D 2NPSC 1IFMA 1JUNA 3QH9A 2WSEH 4ZKUA 3H6PA 1DEEG 1IFPA 5E79E 3RBXA 5AW6B 1BE3J 5KTBA 3B5NA 1OWAA 2JWDA 5KJ7D 2Q6QA 3H1KG 3VMZA 1PGQA 1S1CX 2AXTH 4B86A 3H25A 3SFEC 2IFMA 4WVZA 1RF1C 1FE6A 1LGHB 1LWUA 5EFWB 4N78D 3CXHD 1URQB 1G2CB 2FY8A 1YI2P 1EZVE 1SQQJ 2WITA 5TISH 3CCMP 2L5GB 1RE4A 2B89A 1LP1B 1PV3A 4YPCA 3ZDMA 4I2LC 2QEXP 3CXHH 2Q5UA 1JY2N 1K8AQ 3I5CA 1YBKA 3AE1C 3H1JD 2KXPB 2V7QJ 1MUUA 1NGMB 5KLVJ 4H0LD 1NAFA 3GHGB 1S5LH 2QM7A 3EFGA 1E79H 1X22A 1GL2D 1QEXA 4H0LC 1RHZB 1L0NG 1ZV8A 1QL2A 1IFDA 1YYCA 1RE3C 1KN7A 5B66H 1PP9G 1ZW0A 1J2JB 1P84H 2B87B 2P58A 3M9BA 3RGUA 1SQXK 3RK3D 1S5LX 2FXOA 2YKOA 5CCGC 1HGZA 1NTKE 1PGPA 2A06D 3L73G 2FBWC 5APYA 1VQ4P 1FDOA 1BGYE 5GTHH 3CWBD 2KLVA 3RBZA 2KP8A 2N9YB 2O01J 2R3CA 3B8EB 3NXSA 2ZYDA 5M1BA 1JOCA 1VQOP 1CSBA 2I1JA 1IFNA 1BCCG 3HD7A 2O01N 3L72J 2RN0A 2OARA 2QJPC 1K9MQ 3P32A 1VDFA 2BASA 2W8ZA 1JNMA 2H43A 2WSCH 1OZHA 4C7RA 3CLQA 2XZRA 4N3YB 2Q3IA 3WU2E 1SFCD 2B9BA 4PJ0E 2M3BA 4H13D 5BU5A 1T2KC 3SSUA 2E42A 1LT9C 1EDIA 3AEFC 3U1AA 4XFJA 4PD4H 3G6EP 1QX8A 2JKVA 2WMMA 2ZYAA 4RJTA 1VQKP 1YIJP 1H0TB 2YMKA 3L35A 3NFQA 4DT0A 2H8PD 3P8CE 4WY4C 2QM8A 3CCJP 3CCVP 1DD3A 2GUSA 4NPFX 1BDDA 3C8VA 4W7ZA 5AW8B 3EWKA 1FDIA 2IBZI 2I1KA 4D6TE 3OW2O 1KQGB 2KS1B 3CC2P 1PPJE 1SFCA 1YJ9P 1HWTC 1S72P 4N6JA 5APTA 4EIJA 1TU3F 3H1HG 2IZ0A 1J1EC 1GMJA 3VOPA 1N73B 1JMBA 1SVFA 4U3FE 1OW8A 3AE5C 3AEEC 1KMIZ 1LTTC 1OFCX 2UWJE 2WPQA 3LIDA 3PH0A 1KYOE 1VF5B 3H1KE 5E79H 1K73Q 1PIXA 2FFDA 1FZCB 2P7JA 2E43A 3JCUH 2E74B 4IFFA 2XKMA 1LT1A 3ITKA 1KILB 2WQYC 4PD4E 5APXA 3TDKA 3TF5A 5CCHC 2M5AA 4KHXA 1VPCA 1P84D 1PFIA 3H32B 1PP9D 2QJYC 5CBOA 1QVGO 3CMEP 1CI6B 2Q9IA 2P2UA 3L75D 1EQ7A 3WMM0 1HF9A 2K88A 3C9IA 3KDPB 1G1IA 2IYPA 3TYYA 1NTKJ 2JWAA 1IFIA 1PL5A 3RK3C 4Z1MH 3HE4B 2OYIB 1ZRTD 5DJUB 1KYOH 3RK3B 2C9LY 3PJSK 1BCCD 1KB9H 2E75D 2ZJSE 4NPEA 1GL2C 4OGQD 3CMAP 1U7JA 1GZLA 1SQQD 2QSIA 1NKNA 3HRNA 1PGOA 1PP9J 3HUSA 3PP5A 1VQNP 4PD4D 1KB9D 3FX0A 3Q2YA 1JMMA 2C9NY 2WSFH 4I7ZC 1WMKA 1GW3A 5APQA 4TLFA 3B5ND 1G2CA 1NTZD 2D2CC 2FXPA 3AE3C 1VQMP 3S1KA 1LP1A 3B71A 2Z5HA 1NU1G 1JTHA 3H1JE 2N1TD 1G1JA 1X0TA 3AE7C 4U7JA 1VQPP 4K3AA 1BSNA 1RQUA 2JR8A 1JY3O 4PJ0H 4AYCA 2OYHC 1KV4A 1U7MA 1YTZT 4BRYB 2J58A 3PLNA 3AE4C 2MJZA 5CJ4A 3K5BA 1AFOA 1HJ0A 1SQPD 4U3FJ 3WUVA 2IYOA 2LXCB 3L72D 1EZVI 1L0LJ 3V2NA 2B87A 4YTPC 4EYYQ 2N1TC 2PGDA 1MFTA 1UIIA 1SQVJ 4N78E 4LC1A 1JCCA 1NTZE 2ZFCA 3H1LJ 2KI7B 2JDIH 3L4FA 1N7SA 4IL6H 4C46A 1RQVA 2BCCG 2R44A 1J1DB 2XNXA 3A0HH 2KUBA 3M0DA 1KILD 3T97A 3NMDA 1YITP 2PAJA 2WVRA 3KZIH 2ZVOB 2OTLP 1S3JA 3G71P 4ASWA 5CBNA 2KLUA 1NKZB 2XU6A 2J59M 3CWBJ 3M06A 2QJYB 5DJTB 5AW1B 3VMXA 2Y0EA 3LW5J 1L4AD 1N7SC 3B5NB 3B4SA 3BRTB 1S9KD 2SPZA 3TK1A 3MP7B 1YQ4C 3L74G 1YJNP 2M0BA 2N1TA 1Q90D 5APUA 3P7KA 1HUCA 2KIKA 1URQA 3L72E 4I7ZB 1LTJA 1AQTA 3BCCD 1N2DC 3SWKA 2R3SA 1NTMK 5GTHE 2J5UA 1DEBA 1LNQA 1LTSC 1VQ8P 4WBAA 3KZIE 3L70J 3L36A 3N4XA 3VP9A 1NAYA 1BGYD 1GL2B 1KFNA 1FZAA 2WSEJ 3CXHI 2Y9ZA 1OXZA 3GHGC 1SFCB 3BRVB 5AW9B 1KILE 3A7OA 4RO0A 1MV8A 2FYUG 1EXIA 3H1JG 2WZ7A 2W6AA 2W90A 3GG2A 1FAVA 1L0LG 5KAFE 3MGNA 2E75C 3RL0B 2WT7A 1RY3A 1GU4A 1JO5A 1SQXE 1KQLA 1MKMA 1N7LA 3FWNA 3NTNA 1JY2P 1L0NE 2HFED 3AEDC 3TNUA 1KORA 5B5EH 3HE5B 1Z56A 2KB7P 1RF1B 1P84E 2I8DA 2M5AB 1VF5D 4H44D 3GW6A 4C7NB 1IC2A 2ZT9B 3A2AA 2JP3A 2OYHB 2FKWB 3CWBG 1NTME 4D6TD 2IBZD 4UB6H 5AW3B 1JY3P 2NPSB 3EFFK 4OWFA 1ZRTE 1HJBA 3VMAA 1EC5A 3HE4A 5KLVK 4L73A 2QJKB 2KNCA 2Z5IA 2CK3H 2H89C 2NRGA 3AE6C 3IR9A 2YIUC 3KXDA 1NU1E 2IX7C 5CMZA 3WU2H 2M8RA 1ZXGA 2W6BA 1NO4A 1VQ5P 1KC8Q 3H1IG 1BGYG 3CX5H 3FXDA 3AEAC 3PHLA 2AXTE 4JBZA 1EDLA 3HUSB 4YXDC 1R8EA 3QWOC 3S4RA 1SQQK 3AE8C 3A0BE 2OYIA 2HPCB 3TSIA 2D2CD 3L74E 1LTJC 5KKZC 1KZUB 1L0NK 3G9RA 3H1IJ 2RKLA 1NTMJ 1SQVK 3N7NA 1NYHA 3MZWB 4UB6E 4DZOA 1NTKG 2YNYA 1SQBD 1M57D 1X8YA 2BCCJ 1K05A 2KS1A 2P10A 3AEBC 4WY4D 3CCQP 2A45I 4KJMA 2WSFJ 2Y0DA 3GF3A 3BCCG 1SQXG 1SS1A 3GHGA 2E76B 4JYCA 4L76A 2PFXA 2OYIC 1FZGA 5GTIE 3L73J 3H1HJ 3Q5RA 3EQ2A 5AVTB 4H13C 5CJ0A 2BCCE 3UIAA 3USSA 3RL0g 1URQC 2N9BA 3E1IA 1Q2NA 1N8RQ 1GU5A 4BRYA 2POHA 3L74J 1JY3N 1SP4A 3L73D 3L72G 4ZKPA 2FYZA 5AVWB 1ZR2A 1K04A 1CI6A 1JM0A 1NU1J 3HD7B 3H1KJ 1SQVD 3I55P 2R5BA 3JSVC 3U59A 5GTIH 1NJIQ 3Q3DA 2H88C 2QJKC 1CZQA 3H1ID 3AE9C 4Y99B 3M0DC 3BVHA 2OYHA 1NTZK 4IL6E 4CPGA 2HODA 3RK2B 3VMYA 2G3AA 2K9JB 1ZN5A 2RH0A 4D6TG 1H89A 1NTMG 4U3FG 1JCDA 3M91A 4JF7A 4AQRD 1LTGC 2FFDC 5KLIB 1Y9BA 2IPPA 4GDOA 3PTZA 1NTKK 5KLVG 2AXCA 1OMIA 2ZVNB 1EZVD 1IK7A 1E5WA 3LW5H 4OVNF 1LT9B 4HKZH 1M90Q 2HPCA 2YO2A 5KLIC 1IZNB 1W2BO 3MTUE 2FYUE 1H88A 1FJKA 1GL2A 1VQ7P 2YXQB 1BDCA 3H1IE 2E76C 3KHUA 1L0LE 1LJ2A 1QLED 4C7NA 2KOGA 3A3YB 1BSHA 1FBMA 4IFDK
chains in the Genus database with same CATH topology
1SQPK 1HVVA 1GK6A 2FFDB 1GK4A 1RE4C 5BVZA 2LKMA 3H32A 3HUSC 1ZR4A 3P8MC 3U1CA 2ZXEB 1RF1A 4GKGA 1N86A 1W2EA 3B5NC 4I1LA 2O1KA 4C7NA 5AVQB 2FFDC 2KYVA 5AW2B 1GD2E 3O8ZA 3OAKA 3IFMA 1J1DC 1CW5A 2KSJA 2HODB 1SLQA 1IJDB 2XV5A 3G3ZA 5AVVB 1RF0C 1LTJB 1X79B 4W80A 3SWYA 3P8CD 1T3JA 3MIWA 3RL0C 3M0AA 5APVA 3RL0D 2PP6A 1GTWA 4M3LA 4DOJA 1FZFA 2Q7CA 1URQD 5AVXB 3M9HA 4WY4A 3HD7C 4OH8B 2IFNA 2YKQA 2HLOA 3TNUB 4GIFA 3RK2D 3CI9A 2HG5D 3HTKB 4JYBA 5CHXA 1N7SB 1FJPA 1M1JC 1L4AB 1A02F 4EOTA 3V5BA 3HD7D 4IFMA 1DX7A 2N1TB 1WRGA 1MFZA 1IO4A 1FDMA 5AW5B 5AVYB 2HYNA 1KILC 1HH0A 1LWUB 1FZEA 1NH4A 3L37A 1A02J 2XDJA 5AW0B 1LTAC 2WPSA 5CCGD 4LGDE 2A45H 3II6A 2YKPA 3BATA 4LLHA 4RESB 1NHLA 2WT7B 2JEEA 5APSA 1NOHA 3VN0A 1FOSE 1LWUC 3V4QA 4WY4B 1FZCA 5AW7B 3MUDA 1HGVA 3V4WA 1HTLC 2NPSA 3MD0A 1LTBC 2H7HA 1WT6A 2R5DA 1SFCC 3CL3D 3BASA 1M7LA 4I6MC 2FXMA 1M1JB 2C0XA 2WTYA 5AVZB 2NPSD 1T8ZA 2W27A 1S9KE 1FZCC 1KFMA 1FZBA 1LT9A 4AUWA 3OA7A 2P67A 3V2QA 1MZ9A 2WWWA 2P1JA 1JTHB 1JY2O 2GM4A 4XE5B 5CCGA 2YMYA 2GUVA 5KJ7C 2VRSA 5CCHA 3VTPC 1DH3A 1KILA 3SWFA 1RE3A 3OJAB 3KQGA 1XTCC 2C0WA 1XTGB 3VP8A 1LTIC 1T2KD 1FU1A 1YTZI 3RK2C 1GDTA 1IK9A 4Y99C 3LIEA 3R2PA 5APWA 2WPRA 5AW4B 4W7YA 1AQ5A 2O01H 1M1JA 2O1JA 5AVSB 2A45G 5KJ7A 1GW4A 3A5TA 2Z4EA 5AVUB 2R32A 4XA4A 4WB4A 3M9QA 1HBWA 1IFJA 1T3UA 1N73A 2CPBA 2JJLA 4GT1A 3KYQA 5BU8B 1NWQA 1X9VA 1L4AC 1N7SD 4HH2A 3HTKA 1NU1K 2CPSA 4HYTB 1QL1A 4O9BA 1ZLLA 3VYIA 2FYUK 1FOSF 1L4AA 2YO3A 1RF0A 3HE5A 3V2PA 1L0LK 3KPEA 1J1EB 1N73C 3V2RA 5AVRB 1SQBK 2NPSC 1IFMA 1JUNA 2WSEH 4ZKUA 3H6PA 5KTBA 5AW6B 3B5NA 1OWAA 3VMZA 5KJ7D 4B86A 1RF1C 2IFMA 1LGHB 1LWUA 4N78D 1URQB 1G2CB 2WITA 2L5GB 1RE4A 2KOGA 4I2LC 2Q5UA 1JY2N 3I5CA 1MUUA 1NAFA 3GHGB 2QM7A 3EFGA 1GL2D 1ZV8A 1QL2A 1IFDA 1YYCA 1RE3C 1J2JB 5CCHC 3M9BA 3RK3D 1SQXK 2YKOA 5CCGC 1HGZA 5APYA 1T2KC 2KLVA 2KP8A 3B8EB 3NXSA 2R3CA 1GU5A 3BVHA 1H8AA 1JOCA 1CSBA 2I1JA 1IFNA 3HD7A 2OARA 3P32A 1VDFA 2BASA 1JNMA 2H43A 2WSCH 4C7RA 3CLQA 2XZRA 4N3YB 2Q3IA 5BU5A 1SFCD 5CCHD 2E42A 2M3BA 1LT9C 3U1AA 3L35A 3NFQA 2H8PD 3P8CE 4WY4C 2QM8A 2GUSA 5AW8B 4W7ZA 2I1KA 1SFCA 1HWTC 4N6JA 5APTA 4EIJA 1J1EC 1N73B 3VOPA 1SVFA 1LTTC 2WPQA 3LIDA 2FFDA 1FZCB 2P7JA 2E43A 4IFFA 2XKMA 1KILB 5APXA 4KHXA 1VPCA 1PFIA 3H32B 1CI6B 2Q9IA 2P2UA 1EQ7A 3WMM0 3C9IA 3KDPB 1G1IA 3TYYA 3RK3C 1IFIA 3HE4B 2OYIB 3RK3B 2C9LY 1GL2C 1GZLA 3HRNA 1NKNA 3HUSA 3PP5A 1JMMA 2C9NY 2WSFH 1GW3A 5APQA 3B5ND 1G2CA 2Z5HA 1JTHA 2N1TD 1G1JA 4AYCA 1JY3O 2OYHC 1YTZT 2J58A 5CJ4A 2MJZA 1AFOA 3V2NA 2N1TC 4N78E 4LC1A 1JCCA 2ZFCA 3L4FA 4C46A 1N7SA 1J1DB 2XNXA 3M0DA 3T97A 1KILD 3NMDA 2PAJA 2XU6A 1NKZB 3VMXA 2J59M 3M06A 2OYIA 1JO5A 5AW1B 1L4AD 1N7SC 3B5NB 3BRTB 1S9KD 3TK1A 2N1TA 5APUA 3P7KA 1HUCA 1URQA 1LTJA 1N2DC 1NTMK 1DEBA 1LTSC 4WBAA 3VP9A 3N4XA 3L36A 1GL2B 1KFNA 1FZAA 1OXZA 3GHGC 1SFCB 3BRVB 5AW9B 3A7OA 1MV8A 2WZ7A 2W6AA 1FAVA 3MGNA 3RL0B 2WT7A 1RY3A 1GU4A 1KQLA 1N7LA 3NTNA 1JY2P 2HFED 3TNUA 3HE5B 1Z56A 2KB7P 1RF1B 4C7NB 1IC2A 2OYHB 3A2AA 2FKWB 5AW3B 1JY3P 2NPSB 1HJBA 3HE4A 5KLVK 2Z5IA 3IR9A 2IX7C 5CMZA 2M8RA 2W6BA 1H89A 1NO4A 3HUSB 1SQQK 2HPCB 3TSIA 1LTJC 1KZUB 1L0NK 3N7NA 1SQVK 4DZOA 2YNYA 1X8YA 4WY4D 2A45I 3GHGA 4JYCA 2OYIC 1FZGA 3EQ2A 5AVTB 5CJ0A 3UIAA 1URQC 2N9BA 3E1IA 2POHA 1JY3N 1SP4A 4ZKPA 2FYZA 5AVWB 1ZR2A 1CI6A 3HD7B 2R5BA 3U59A 1CZQA 4Y99B 2OYHA 3M0DC 1NTZK 2HODA 3RK2B 3VMYA 1ZN5A 4AQRD 1JCDA 3M91A 4JF7A 1LTGC 2IPPA 1NTKK 1E5WA 3LW5H 1LT9B 2HPCA 3MTUE 1H88A 1FJKA 1GL2A 2YO2A 3A3YB 1FBMA 4IFDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFC C;  1HVV A;  1GL2 D;  1L4A D;  1N7S C;  3B5N B;  2NPS D;  2N1T A;  5CCH C;  3RK3 D;  1URQ A;  5CCG C;  3B5N C;  1GL2 B;  3HD7 A;  1SFC B;  2WZ7 A;  1JTH B;  5CCH D;  3RL0 B;  1SFC D;  5CCG A;  2YMY A;  5KJ7 C;  5CCH A;  2HFE D;  1KIL A;  2H8P D;  3P8C E;  4WY4 C;  4W80 A;  1T3J A;  4W7Z A;  3RL0 C;  3RL0 D;  1XTG B;  1SFC A;  2PP6 A;  2NPS B;  3RK2 C;  1URQ D;  3VOP A;  4WY4 A;  3HD7 C;  4OH8 B;  2M8R A;  4W7Y A;  3RK2 D;  1KIL B;  2HG5 D;  3HTK B;  5KJ7 A;  3TSI A;  1N7S B;  1L4A B;  4WY4 D;  3RK3 C;  3KYQ A;  3HD7 D;  3RK3 B;  1L4A C;  1N7S D;  1GL2 C;  1URQ C;  2N1T B;  3PP5 A;  1KIL C;  1L4A A;  3B5N D;  3HD7 B;  2XDJ A;  5CCG D;  4LGD E;  1JTH A;  2N1T D;  3M0D C;  1NHL A;  3RK2 B;  2NPS C;  4JF7 A;  3B5N A;  5KJ7 D;  4WY4 B;  1URQ B;  2N1T C;  4N78 E;  2NPS A;  1N7S A;  1GL2 A;  1KIL D;  2KOG A; 
#chains in the Genus database with same CATH topology
 1AJY A;  1SQP K;  1Y8A A;  1HVV A;  1GK6 A;  1Q86 Q;  2FFD B;  3D6Y A;  2OQQ A;  1SQX D;  1FC2 C;  3GLM A;  1GK4 A;  3AEC C;  1RE4 C;  4PD4 I;  3L71 E;  5BVZ A;  2LKM A;  3H32 A;  3HUS C;  4QMA A;  1R5L A;  1ZR4 A;  3P8M C;  4PV1 D;  3U1C A;  2ZXE B;  1RF1 A;  4GKG A;  3CWB E;  5K5G B;  2OTK E;  1N86 A;  2E5T A;  1W2E A;  3F5H A;  3B5N C;  1KQF B;  2A06 E;  4H0L B;  2KK7 A;  2O1K A;  2OGU A;  4I1L A;  1NTM D;  3H1H E;  1S4X A;  2KYV A;  2K37 A;  5AVQ B;  5AW2 B;  5TJH A;  3S9O A;  3T97 B;  3TGU G;  3E1R A;  1S2E A;  2NZ2 A;  5CCH D;  2Q1K A;  5KAF H;  1GD2 E;  3O8Z A;  1VQL P;  2DW3 A;  2AEJ A;  1AV1 A;  4DJG A;  3OAK A;  2IDB A;  3IFM A;  2ZT9 C;  3SFD C;  1J1D C;  2ITA A;  4A7P A;  3H1L E;  4BWN A;  2KSJ A;  3WUT A;  2HOD B;  1SLQ A;  3D6Z A;  1CW5 A;  3IN6 A;  2K9J A;  1IJD B;  2XV5 A;  3G3Z A;  4MN4 C;  4R4L A;  5AVV B;  3CCL P;  1NTZ G;  2XND H;  1RF0 C;  1FS0 E;  3Q5S A;  3L71 D;  1P84 I;  1LTJ B;  3V6I A;  2B88 A;  1NVO A;  2FYN B;  1X79 B;  4W80 A;  3SWY A;  3P8C D;  1SQB G;  1T3J A;  3MIW A;  3RL0 C;  1H8A A;  3F89 A;  1EZV G;  3M0A A;  1Q7Y Q;  5APV A;  4EDF A;  3RL0 D;  2QVA A;  2YIU B;  4GOD A;  2PP6 A;  3W68 A;  1GTW A;  4M3L A;  2IBZ E;  5KAI H;  4DOJ A;  1FZF A;  2Q7C A;  2RMZ A;  1URQ D;  5AVX B;  2LXB A;  1VQ6 P;  1KYO I;  2YXR B;  1ZOY C;  2FYU J;  1BGY J;  1S5L E;  3AEG C;  3M9H A;  3L70 D;  1L0N J;  1T6A A;  3JCU E;  3HD7 C;  1Y47 A;  2IFN A;  2YKQ A;  4OH8 B;  4WY4 A;  3CD6 P;  1AQ5 A;  1NU1 D;  2HLO A;  3TNU B;  4GIF A;  3RK2 D;  3AE2 C;  3TGU J;  3CI9 A;  1U57 A;  2HG5 D;  3HTK B;  4JYB A;  1PP9 E;  3R4Y A;  5CHX A;  1N7S B;  1R5S A;  1FJP A;  1M1J C;  1L4A B;  1SQX J;  3Q1M A;  1EXJ A;  5KLV E;  1A02 F;  4ASV A;  4EOT A;  2A06 G;  3L75 E;  4IL6 X;  2E75 B;  4HB1 A;  4JQ0 D;  4EI2 A;  1Q81 Q;  2W6J H;  4PV1 C;  3V5B A;  3L71 G;  3TGU D;  3HD7 D;  2KNC B;  1AA0 A;  4KT0 J;  4IFM A;  4ZNC A;  3IAO A;  1DX7 A;  1SQQ E;  4L75 A;  3CX5 D;  1EDK A;  1SQB J;  2BCC D;  2N1T B;  1WRG A;  1BCC E;  1MFZ A;  3I56 P;  2Q3E A;  1IO4 A;  3CC7 P;  1FDM A;  2AEF A;  5AW5 B;  3H1J J;  1PZQ A;  5AVY B;  1BE3 E;  1M8O B;  1KIL C;  2HYN A;  5TIS E;  1HH0 A;  1LWU B;  2QIW A;  1AVO A;  1FZE A;  1NH4 A;  3L37 A;  4H44 C;  4R4M A;  5C39 A;  3G4S P;  3CPW O;  1A02 J;  2XDJ A;  5AW0 B;  1LTA C;  2ZAE B;  2WPS A;  3L70 G;  2Y0C A;  3IF4 A;  5CCG D;  2FYU D;  2ZYG A;  2A45 H;  4LGD E;  5KKZ B;  1YHQ P;  1M56 D;  1L0L D;  3II6 A;  3MHV A;  3PRJ A;  4OGQ B;  3W67 A;  2YKP A;  3BAT A;  4ZMD A;  4LLH A;  4RES B;  1NHL A;  2WT7 B;  3H1L G;  1JEK A;  4BXL A;  1W5C E;  1KB9 I;  2D2C B;  2L91 A;  2JEE A;  2QRX A;  1NOH A;  5APS A;  3VN0 A;  4H44 B;  2K9Y A;  1NTZ J;  1FOS E;  1LWU C;  4UB8 E;  1SQP E;  2Y9Y A;  4L74 A;  2V7Q H;  3V4Q A;  1KTM A;  2E5Y A;  2GA1 A;  3E7K A;  4WY4 B;  5B5E E;  2WSC J;  2IBZ G;  1FZC A;  3L71 J;  2K3R A;  3MUD A;  1HGV A;  5AW7 B;  1HTL C;  3V4W A;  1KD1 Q;  2MKV A;  1VQ9 P;  1BCC J;  1ZP0 C;  2AEM A;  2NPS A;  1LTB C;  2O3J A;  3MD0 A;  1OW6 A;  3CCE P;  1SQQ G;  2H7H A;  1UIX A;  5KAI E;  1WT6 A;  4PV1 B;  2R5D A;  4TT3 H;  1SFC C;  2BEQ D;  3CL3 D;  3BAS A;  1M7L A;  4I6M C;  1DD4 A;  1OW7 A;  3GMA A;  5CCG A;  1PPJ G;  2FXM A;  1M1J B;  3Q5P A;  2C0X A;  2BEZ F;  2WTY A;  5AVZ B;  2NPS D;  2E76 D;  1T8Z A;  1QGK B;  3O6Q B;  4NPD A;  2W27 A;  2QE7 H;  3A0B H;  3BCC E;  3MUD C;  1S9K E;  1NTK D;  4HJG H;  1FZC C;  1KFM A;  1FZB A;  1LT9 A;  2PRR A;  2HR3 A;  2M3E A;  3CXH E;  4Y28 J;  4AUW A;  3OA7 A;  2P67 A;  3V2Q A;  1KQS O;  2WSS H;  1YQ3 C;  2KZI A;  3H1H D;  1Q82 Q;  3BCC J;  1MZ9 A;  2WWW A;  1PGJ A;  2P1J A;  1DIP A;  1JTH B;  2G8Y A;  1JY2 O;  2GM4 A;  4XE5 B;  2WPV B;  1OVU A;  3L70 E;  3FXE A;  3H1L D;  1AVY A;  1L0N D;  2FYN C;  2GUV A;  2KSE A;  1USD A;  2VRS A;  2YMY A;  3ABV C;  5KJ7 C;  3CC4 P;  5CCH A;  1BE3 G;  3VTP C;  1DH3 A;  2OTJ P;  2QG4 A;  1YJW P;  1KIL A;  3RK3 E;  3SWF A;  1RE3 A;  4JPZ B;  5H2F H;  4DCK A;  2E74 C;  3KQG A;  2IZ1 A;  3L75 G;  1USE A;  3OJA B;  4RKU J;  1QVF O;  1PPJ D;  1XTC C;  2C0W A;  3JC2 2;  1SQP G;  1VF5 C;  1OVV A;  1XTG B;  4GOF A;  3VP8 A;  1LTI C;  1T2K D;  2QJP B;  3A0H E;  3D70 A;  2JO1 A;  1FU1 A;  1YTZ I;  3FWL A;  3RK2 C;  3TGU E;  1GDT A;  4OGQ C;  3D71 A;  1SQP J;  4U3F D;  1IK9 A;  4Y99 C;  3WUU A;  3LIE A;  1RH5 B;  4D6T J;  2KZJ A;  1KYO D;  3CX5 E;  1SQV G;  3H1K D;  3R2P A;  4UB8 H;  1L2P A;  2WPR A;  5APW A;  4GOE A;  3C1L A;  2O01 H;  4W7Y A;  2ZT9 D;  5AW4 B;  5H2F E;  1M1J A;  4WWI A;  5B66 E;  2O1J A;  1H0T A;  1D7M A;  5AVS B;  2A45 G;  2OYO A;  5KJ7 A;  1GW4 A;  1ZME C;  3A5T A;  3O6Q A;  4YXW H;  5L8R J;  2Z4E A;  4IOI H;  3L74 D;  5AVU B;  1OIP A;  2R32 A;  4XA4 A;  1SQB E;  4H13 B;  4WB4 A;  5KLV D;  3M9Q A;  1HBW A;  1IFJ A;  1T3U A;  1N73 A;  2CPB A;  2JJL A;  3GF7 A;  3KYQ A;  4GT1 A;  5BU8 B;  2V4H A;  1NWQ A;  2QA4 P;  2W83 C;  1X9V A;  1L4A C;  1N7S D;  2ZXX A;  3L75 J;  2K1A A;  4HH2 A;  3CX5 I;  3FGA D;  1EDJ A;  1KB9 E;  3HTK A;  1NU1 K;  2CPS A;  3CCR P;  3CCS P;  3L73 E;  4HYT B;  1JB0 J;  1QL1 A;  4O9B A;  3CCU P;  1OVR A;  1ZLL A;  1BE3 D;  2FYU K;  3VYI A;  1L4A A;  2YO3 A;  1FOS F;  1RF0 A;  3HE5 A;  3V2P A;  1L0L K;  1M1K Q;  1OX3 A;  1SQV E;  1VL2 A;  3KPE A;  1J1E B;  1N73 C;  3V2R A;  2LR2 A;  4K35 A;  5AVR B;  1SQB K;  2E74 D;  2NPS C;  1IFM A;  1JUN A;  3QH9 A;  2WSE H;  4ZKU A;  3H6P A;  1DEE G;  1IFP A;  5E79 E;  3RBX A;  5AW6 B;  1BE3 J;  5KTB A;  3B5N A;  1OWA A;  2JWD A;  5KJ7 D;  2Q6Q A;  3H1K G;  3VMZ A;  1PGQ A;  1S1C X;  2AXT H;  4B86 A;  3H25 A;  3SFE C;  2IFM A;  4WVZ A;  1RF1 C;  1FE6 A;  1LGH B;  1LWU A;  5EFW B;  4N78 D;  3CXH D;  1URQ B;  1G2C B;  2FY8 A;  1YI2 P;  1EZV E;  1SQQ J;  2WIT A;  5TIS H;  3CCM P;  2L5G B;  1RE4 A;  2B89 A;  1LP1 B;  1PV3 A;  4YPC A;  3ZDM A;  4I2L C;  2QEX P;  3CXH H;  2Q5U A;  1JY2 N;  1K8A Q;  3I5C A;  1YBK A;  3AE1 C;  3H1J D;  2KXP B;  2V7Q J;  1MUU A;  1NGM B;  5KLV J;  4H0L D;  1NAF A;  3GHG B;  1S5L H;  2QM7 A;  3EFG A;  1E79 H;  1X22 A;  1GL2 D;  1QEX A;  4H0L C;  1RHZ B;  1L0N G;  1ZV8 A;  1QL2 A;  1IFD A;  1YYC A;  1RE3 C;  1KN7 A;  5B66 H;  1PP9 G;  1ZW0 A;  1J2J B;  1P84 H;  2B87 B;  2P58 A;  3M9B A;  3RGU A;  1SQX K;  3RK3 D;  1S5L X;  2FXO A;  2YKO A;  5CCG C;  1HGZ A;  1NTK E;  1PGP A;  2A06 D;  3L73 G;  2FBW C;  5APY A;  1VQ4 P;  1FDO A;  1BGY E;  5GTH H;  3CWB D;  2KLV A;  3RBZ A;  2KP8 A;  2N9Y B;  2O01 J;  2R3C A;  3B8E B;  3NXS A;  2ZYD A;  5M1B A;  1JOC A;  1VQO P;  1CSB A;  2I1J A;  1IFN A;  1BCC G;  3HD7 A;  2O01 N;  3L72 J;  2RN0 A;  2OAR A;  2QJP C;  1K9M Q;  3P32 A;  1VDF A;  2BAS A;  2W8Z A;  1JNM A;  2H43 A;  2WSC H;  1OZH A;  4C7R A;  3CLQ A;  2XZR A;  4N3Y B;  2Q3I A;  3WU2 E;  1SFC D;  2B9B A;  4PJ0 E;  2M3B A;  4H13 D;  5BU5 A;  1T2K C;  3SSU A;  2E42 A;  1LT9 C;  1EDI A;  3AEF C;  3U1A A;  4XFJ A;  4PD4 H;  3G6E P;  1QX8 A;  2JKV A;  2WMM A;  2ZYA A;  4RJT A;  1VQK P;  1YIJ P;  1H0T B;  2YMK A;  3L35 A;  3NFQ A;  4DT0 A;  2H8P D;  3P8C E;  4WY4 C;  2QM8 A;  3CCJ P;  3CCV P;  1DD3 A;  2GUS A;  4NPF X;  1BDD A;  3C8V A;  4W7Z A;  5AW8 B;  3EWK A;  1FDI A;  2IBZ I;  2I1K A;  4D6T E;  3OW2 O;  1KQG B;  2KS1 B;  3CC2 P;  1PPJ E;  1SFC A;  1YJ9 P;  1HWT C;  1S72 P;  4N6J A;  5APT A;  4EIJ A;  1TU3 F;  3H1H G;  2IZ0 A;  1J1E C;  1GMJ A;  3VOP A;  1N73 B;  1JMB A;  1SVF A;  4U3F E;  1OW8 A;  3AE5 C;  3AEE C;  1KMI Z;  1LTT C;  1OFC X;  2UWJ E;  2WPQ A;  3LID A;  3PH0 A;  1KYO E;  1VF5 B;  3H1K E;  5E79 H;  1K73 Q;  1PIX A;  2FFD A;  1FZC B;  2P7J A;  2E43 A;  3JCU H;  2E74 B;  4IFF A;  2XKM A;  1LT1 A;  3ITK A;  1KIL B;  2WQY C;  4PD4 E;  5APX A;  3TDK A;  3TF5 A;  5CCH C;  2M5A A;  4KHX A;  1VPC A;  1P84 D;  1PFI A;  3H32 B;  1PP9 D;  2QJY C;  5CBO A;  1QVG O;  3CME P;  1CI6 B;  2Q9I A;  2P2U A;  3L75 D;  1EQ7 A;  3WMM 0;  1HF9 A;  2K88 A;  3C9I A;  3KDP B;  1G1I A;  2IYP A;  3TYY A;  1NTK J;  2JWA A;  1IFI A;  1PL5 A;  3RK3 C;  4Z1M H;  3HE4 B;  2OYI B;  1ZRT D;  5DJU B;  1KYO H;  3RK3 B;  2C9L Y;  3PJS K;  1BCC D;  1KB9 H;  2E75 D;  2ZJS E;  4NPE A;  1GL2 C;  4OGQ D;  3CMA P;  1U7J A;  1GZL A;  1SQQ D;  2QSI A;  1NKN A;  3HRN A;  1PGO A;  1PP9 J;  3HUS A;  3PP5 A;  1VQN P;  4PD4 D;  1KB9 D;  3FX0 A;  3Q2Y A;  1JMM A;  2C9N Y;  2WSF H;  4I7Z C;  1WMK A;  1GW3 A;  5APQ A;  4TLF A;  3B5N D;  1G2C A;  1NTZ D;  2D2C C;  2FXP A;  3AE3 C;  1VQM P;  3S1K A;  1LP1 A;  3B71 A;  2Z5H A;  1NU1 G;  1JTH A;  3H1J E;  2N1T D;  1G1J A;  1X0T A;  3AE7 C;  4U7J A;  1VQP P;  4K3A A;  1BSN A;  1RQU A;  2JR8 A;  1JY3 O;  4PJ0 H;  4AYC A;  2OYH C;  1KV4 A;  1U7M A;  1YTZ T;  4BRY B;  2J58 A;  3PLN A;  3AE4 C;  2MJZ A;  5CJ4 A;  3K5B A;  1AFO A;  1HJ0 A;  1SQP D;  4U3F J;  3WUV A;  2IYO A;  2LXC B;  3L72 D;  1EZV I;  1L0L J;  3V2N A;  2B87 A;  4YTP C;  4EYY Q;  2N1T C;  2PGD A;  1MFT A;  1UII A;  1SQV J;  4N78 E;  4LC1 A;  1JCC A;  1NTZ E;  2ZFC A;  3H1L J;  2KI7 B;  2JDI H;  3L4F A;  1N7S A;  4IL6 H;  4C46 A;  1RQV A;  2BCC G;  2R44 A;  1J1D B;  2XNX A;  3A0H H;  2KUB A;  3M0D A;  1KIL D;  3T97 A;  3NMD A;  1YIT P;  2PAJ A;  2WVR A;  3KZI H;  2ZVO B;  2OTL P;  1S3J A;  3G71 P;  4ASW A;  5CBN A;  2KLU A;  1NKZ B;  2XU6 A;  2J59 M;  3CWB J;  3M06 A;  2QJY B;  5DJT B;  5AW1 B;  3VMX A;  2Y0E A;  3LW5 J;  1L4A D;  1N7S C;  3B5N B;  3B4S A;  3BRT B;  1S9K D;  2SPZ A;  3TK1 A;  3MP7 B;  1YQ4 C;  3L74 G;  1YJN P;  2M0B A;  2N1T A;  1Q90 D;  5APU A;  3P7K A;  1HUC A;  2KIK A;  1URQ A;  3L72 E;  4I7Z B;  1LTJ A;  1AQT A;  3BCC D;  1N2D C;  3SWK A;  2R3S A;  1NTM K;  5GTH E;  2J5U A;  1DEB A;  1LNQ A;  1LTS C;  1VQ8 P;  4WBA A;  3KZI E;  3L70 J;  3L36 A;  3N4X A;  3VP9 A;  1NAY A;  1BGY D;  1GL2 B;  1KFN A;  1FZA A;  2WSE J;  3CXH I;  2Y9Z A;  1OXZ A;  3GHG C;  1SFC B;  3BRV B;  5AW9 B;  1KIL E;  3A7O A;  4RO0 A;  1MV8 A;  2FYU G;  1EXI A;  3H1J G;  2WZ7 A;  2W6A A;  2W90 A;  3GG2 A;  1FAV A;  1L0L G;  5KAF E;  3MGN A;  2E75 C;  3RL0 B;  2WT7 A;  1RY3 A;  1GU4 A;  1JO5 A;  1SQX E;  1KQL A;  1MKM A;  1N7L A;  3FWN A;  3NTN A;  1JY2 P;  1L0N E;  2HFE D;  3AED C;  3TNU A;  1KOR A;  5B5E H;  3HE5 B;  1Z56 A;  2KB7 P;  1RF1 B;  1P84 E;  2I8D A;  2M5A B;  1VF5 D;  4H44 D;  3GW6 A;  4C7N B;  1IC2 A;  2ZT9 B;  3A2A A;  2JP3 A;  2OYH B;  2FKW B;  3CWB G;  1NTM E;  4D6T D;  2IBZ D;  4UB6 H;  5AW3 B;  1JY3 P;  2NPS B;  3EFF K;  4OWF A;  1ZRT E;  1HJB A;  3VMA A;  1EC5 A;  3HE4 A;  5KLV K;  4L73 A;  2QJK B;  2KNC A;  2Z5I A;  2CK3 H;  2H89 C;  2NRG A;  3AE6 C;  3IR9 A;  2YIU C;  3KXD A;  1NU1 E;  2IX7 C;  5CMZ A;  3WU2 H;  2M8R A;  1ZXG A;  2W6B A;  1NO4 A;  1VQ5 P;  1KC8 Q;  3H1I G;  1BGY G;  3CX5 H;  3FXD A;  3AEA C;  3PHL A;  2AXT E;  4JBZ A;  1EDL A;  3HUS B;  4YXD C;  1R8E A;  3QWO C;  3S4R A;  1SQQ K;  3AE8 C;  3A0B E;  2OYI A;  2HPC B;  3TSI A;  2D2C D;  3L74 E;  1LTJ C;  5KKZ C;  1KZU B;  1L0N K;  3G9R A;  3H1I J;  2RKL A;  1NTM J;  1SQV K;  3N7N A;  1NYH A;  3MZW B;  4UB6 E;  4DZO A;  1NTK G;  2YNY A;  1SQB D;  1M57 D;  1X8Y A;  2BCC J;  1K05 A;  2KS1 A;  2P10 A;  3AEB C;  4WY4 D;  3CCQ P;  2A45 I;  4KJM A;  2WSF J;  2Y0D A;  3GF3 A;  3BCC G;  1SQX G;  1SS1 A;  3GHG A;  2E76 B;  4JYC A;  4L76 A;  2PFX A;  2OYI C;  1FZG A;  5GTI E;  3L73 J;  3H1H J;  3Q5R A;  3EQ2 A;  5AVT B;  4H13 C;  5CJ0 A;  2BCC E;  3UIA A;  3USS A;  3RL0 g;  1URQ C;  2N9B A;  3E1I A;  1Q2N A;  1N8R Q;  1GU5 A;  4BRY A;  2POH A;  3L74 J;  1JY3 N;  1SP4 A;  3L73 D;  3L72 G;  4ZKP A;  2FYZ A;  5AVW B;  1ZR2 A;  1K04 A;  1CI6 A;  1JM0 A;  1NU1 J;  3HD7 B;  3H1K J;  1SQV D;  3I55 P;  2R5B A;  3JSV C;  3U59 A;  5GTI H;  1NJI Q;  3Q3D A;  2H88 C;  2QJK C;  1CZQ A;  3H1I D;  3AE9 C;  4Y99 B;  3M0D C;  3BVH A;  2OYH A;  1NTZ K;  4IL6 E;  4CPG A;  2HOD A;  3RK2 B;  3VMY A;  2G3A A;  2K9J B;  1ZN5 A;  2RH0 A;  4D6T G;  1H89 A;  1NTM G;  4U3F G;  1JCD A;  3M91 A;  4JF7 A;  4AQR D;  1LTG C;  2FFD C;  5KLI B;  1Y9B A;  2IPP A;  4GDO A;  3PTZ A;  1NTK K;  5KLV G;  2AXC A;  1OMI A;  2ZVN B;  1EZV D;  1IK7 A;  1E5W A;  3LW5 H;  4OVN F;  1LT9 B;  4HKZ H;  1M90 Q;  2HPC A;  2YO2 A;  5KLI C;  1IZN B;  1W2B O;  3MTU E;  2FYU E;  1H88 A;  1FJK A;  1GL2 A;  1VQ7 P;  2YXQ B;  1BDC A;  3H1I E;  2E76 C;  3KHU A;  1L0L E;  1LJ2 A;  1QLE D;  4C7N A;  2KOG A;  3A3Y B;  1BSH A;  1FBM A;  4IFD K; 
#chains in the Genus database with same CATH homology
 1SQP K;  1HVV A;  1GK6 A;  2FFD B;  1GK4 A;  1RE4 C;  5BVZ A;  2LKM A;  3H32 A;  3HUS C;  1ZR4 A;  3P8M C;  3U1C A;  2ZXE B;  1RF1 A;  4GKG A;  1N86 A;  1W2E A;  3B5N C;  4I1L A;  2O1K A;  4C7N A;  5AVQ B;  2FFD C;  2KYV A;  5AW2 B;  1GD2 E;  3O8Z A;  3OAK A;  3IFM A;  1J1D C;  1CW5 A;  2KSJ A;  2HOD B;  1SLQ A;  1IJD B;  2XV5 A;  3G3Z A;  5AVV B;  1RF0 C;  1LTJ B;  1X79 B;  4W80 A;  3SWY A;  3P8C D;  1T3J A;  3MIW A;  3RL0 C;  3M0A A;  5APV A;  3RL0 D;  2PP6 A;  1GTW A;  4M3L A;  4DOJ A;  1FZF A;  2Q7C A;  1URQ D;  5AVX B;  3M9H A;  4WY4 A;  3HD7 C;  4OH8 B;  2IFN A;  2YKQ A;  2HLO A;  3TNU B;  4GIF A;  3RK2 D;  3CI9 A;  2HG5 D;  3HTK B;  4JYB A;  5CHX A;  1N7S B;  1FJP A;  1M1J C;  1L4A B;  1A02 F;  4EOT A;  3V5B A;  3HD7 D;  4IFM A;  1DX7 A;  2N1T B;  1WRG A;  1MFZ A;  1IO4 A;  1FDM A;  5AW5 B;  5AVY B;  2HYN A;  1KIL C;  1HH0 A;  1LWU B;  1FZE A;  1NH4 A;  3L37 A;  1A02 J;  2XDJ A;  5AW0 B;  1LTA C;  2WPS A;  5CCG D;  4LGD E;  2A45 H;  3II6 A;  2YKP A;  3BAT A;  4LLH A;  4RES B;  1NHL A;  2WT7 B;  2JEE A;  5APS A;  1NOH A;  3VN0 A;  1FOS E;  1LWU C;  3V4Q A;  4WY4 B;  1FZC A;  5AW7 B;  3MUD A;  1HGV A;  3V4W A;  1HTL C;  2NPS A;  3MD0 A;  1LTB C;  2H7H A;  1WT6 A;  2R5D A;  1SFC C;  3CL3 D;  3BAS A;  1M7L A;  4I6M C;  2FXM A;  1M1J B;  2C0X A;  2WTY A;  5AVZ B;  2NPS D;  1T8Z A;  2W27 A;  1S9K E;  1FZC C;  1KFM A;  1FZB A;  1LT9 A;  4AUW A;  3OA7 A;  2P67 A;  3V2Q A;  1MZ9 A;  2WWW A;  2P1J A;  1JTH B;  1JY2 O;  2GM4 A;  4XE5 B;  5CCG A;  2YMY A;  2GUV A;  5KJ7 C;  2VRS A;  5CCH A;  3VTP C;  1DH3 A;  1KIL A;  3SWF A;  1RE3 A;  3OJA B;  3KQG A;  1XTC C;  2C0W A;  1XTG B;  3VP8 A;  1LTI C;  1T2K D;  1FU1 A;  1YTZ I;  3RK2 C;  1GDT A;  1IK9 A;  4Y99 C;  3LIE A;  3R2P A;  5APW A;  2WPR A;  5AW4 B;  4W7Y A;  1AQ5 A;  2O01 H;  1M1J A;  2O1J A;  5AVS B;  2A45 G;  5KJ7 A;  1GW4 A;  3A5T A;  2Z4E A;  5AVU B;  2R32 A;  4XA4 A;  4WB4 A;  3M9Q A;  1HBW A;  1IFJ A;  1T3U A;  1N73 A;  2CPB A;  2JJL A;  4GT1 A;  3KYQ A;  5BU8 B;  1NWQ A;  1X9V A;  1L4A C;  1N7S D;  4HH2 A;  3HTK A;  1NU1 K;  2CPS A;  4HYT B;  1QL1 A;  4O9B A;  1ZLL A;  3VYI A;  2FYU K;  1FOS F;  1L4A A;  2YO3 A;  1RF0 A;  3HE5 A;  3V2P A;  1L0L K;  3KPE A;  1J1E B;  1N73 C;  3V2R A;  5AVR B;  1SQB K;  2NPS C;  1IFM A;  1JUN A;  2WSE H;  4ZKU A;  3H6P A;  5KTB A;  5AW6 B;  3B5N A;  1OWA A;  3VMZ A;  5KJ7 D;  4B86 A;  1RF1 C;  2IFM A;  1LGH B;  1LWU A;  4N78 D;  1URQ B;  1G2C B;  2WIT A;  2L5G B;  1RE4 A;  2KOG A;  4I2L C;  2Q5U A;  1JY2 N;  3I5C A;  1MUU A;  1NAF A;  3GHG B;  2QM7 A;  3EFG A;  1GL2 D;  1ZV8 A;  1QL2 A;  1IFD A;  1YYC A;  1RE3 C;  1J2J B;  5CCH C;  3M9B A;  3RK3 D;  1SQX K;  2YKO A;  5CCG C;  1HGZ A;  5APY A;  1T2K C;  2KLV A;  2KP8 A;  3B8E B;  3NXS A;  2R3C A;  1GU5 A;  3BVH A;  1H8A A;  1JOC A;  1CSB A;  2I1J A;  1IFN A;  3HD7 A;  2OAR A;  3P32 A;  1VDF A;  2BAS A;  1JNM A;  2H43 A;  2WSC H;  4C7R A;  3CLQ A;  2XZR A;  4N3Y B;  2Q3I A;  5BU5 A;  1SFC D;  5CCH D;  2E42 A;  2M3B A;  1LT9 C;  3U1A A;  3L35 A;  3NFQ A;  2H8P D;  3P8C E;  4WY4 C;  2QM8 A;  2GUS A;  5AW8 B;  4W7Z A;  2I1K A;  1SFC A;  1HWT C;  4N6J A;  5APT A;  4EIJ A;  1J1E C;  1N73 B;  3VOP A;  1SVF A;  1LTT C;  2WPQ A;  3LID A;  2FFD A;  1FZC B;  2P7J A;  2E43 A;  4IFF A;  2XKM A;  1KIL B;  5APX A;  4KHX A;  1VPC A;  1PFI A;  3H32 B;  1CI6 B;  2Q9I A;  2P2U A;  1EQ7 A;  3WMM 0;  3C9I A;  3KDP B;  1G1I A;  3TYY A;  3RK3 C;  1IFI A;  3HE4 B;  2OYI B;  3RK3 B;  2C9L Y;  1GL2 C;  1GZL A;  3HRN A;  1NKN A;  3HUS A;  3PP5 A;  1JMM A;  2C9N Y;  2WSF H;  1GW3 A;  5APQ A;  3B5N D;  1G2C A;  2Z5H A;  1JTH A;  2N1T D;  1G1J A;  4AYC A;  1JY3 O;  2OYH C;  1YTZ T;  2J58 A;  5CJ4 A;  2MJZ A;  1AFO A;  3V2N A;  2N1T C;  4N78 E;  4LC1 A;  1JCC A;  2ZFC A;  3L4F A;  4C46 A;  1N7S A;  1J1D B;  2XNX A;  3M0D A;  3T97 A;  1KIL D;  3NMD A;  2PAJ A;  2XU6 A;  1NKZ B;  3VMX A;  2J59 M;  3M06 A;  2OYI A;  1JO5 A;  5AW1 B;  1L4A D;  1N7S C;  3B5N B;  3BRT B;  1S9K D;  3TK1 A;  2N1T A;  5APU A;  3P7K A;  1HUC A;  1URQ A;  1LTJ A;  1N2D C;  1NTM K;  1DEB A;  1LTS C;  4WBA A;  3VP9 A;  3N4X A;  3L36 A;  1GL2 B;  1KFN A;  1FZA A;  1OXZ A;  3GHG C;  1SFC B;  3BRV B;  5AW9 B;  3A7O A;  1MV8 A;  2WZ7 A;  2W6A A;  1FAV A;  3MGN A;  3RL0 B;  2WT7 A;  1RY3 A;  1GU4 A;  1KQL A;  1N7L A;  3NTN A;  1JY2 P;  2HFE D;  3TNU A;  3HE5 B;  1Z56 A;  2KB7 P;  1RF1 B;  4C7N B;  1IC2 A;  2OYH B;  3A2A A;  2FKW B;  5AW3 B;  1JY3 P;  2NPS B;  1HJB A;  3HE4 A;  5KLV K;  2Z5I A;  3IR9 A;  2IX7 C;  5CMZ A;  2M8R A;  2W6B A;  1H89 A;  1NO4 A;  3HUS B;  1SQQ K;  2HPC B;  3TSI A;  1LTJ C;  1KZU B;  1L0N K;  3N7N A;  1SQV K;  4DZO A;  2YNY A;  1X8Y A;  4WY4 D;  2A45 I;  3GHG A;  4JYC A;  2OYI C;  1FZG A;  3EQ2 A;  5AVT B;  5CJ0 A;  3UIA A;  1URQ C;  2N9B A;  3E1I A;  2POH A;  1JY3 N;  1SP4 A;  4ZKP A;  2FYZ A;  5AVW B;  1ZR2 A;  1CI6 A;  3HD7 B;  2R5B A;  3U59 A;  1CZQ A;  4Y99 B;  2OYH A;  3M0D C;  1NTZ K;  2HOD A;  3RK2 B;  3VMY A;  1ZN5 A;  4AQR D;  1JCD A;  3M91 A;  4JF7 A;  1LTG C;  2IPP A;  1NTK K;  1E5W A;  3LW5 H;  1LT9 B;  2HPC A;  3MTU E;  1H88 A;  1FJK A;  1GL2 A;  2YO2 A;  3A3Y B;  1FBM A;  4IFD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...