3B5NC

Structure of the yeast plasma membrane snare complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
70
structure length
70
Chain Sequence
b'GSIKFTKQSSVASTRNTLKMAQDAERAGMNTLGMLGHQSEQLNNVEGNLDLMKVQNKVADEKVAELKKLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synaptobrevin homolog 1
publication title The Structure of the Yeast Plasma Membrane SNARE Complex Reveals Destabilizing Water-filled Cavities.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 34
structure length 70
sequence length 70
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3b5nC00
1N7SB 2NPSD 3RK2B 1KILB 3HD7B 1L4AA 3TSIA 1L4AD 1N7SD 3HD7D 2HG5D 2HFED 5CCGA 4WY4A 3RK2C 5CCGD 5KJ7D 1URQC 3B5NC 4W7YA 3PP5A 1JTHA 1URQB 3B5NB 1N7SA 1KILA 3HD7A 3RK2D 5CCHC 1URQA 1KILD 3B5NA 1URQD 3B5ND 2XDJA 5KJ7A 3KYQA 4N78E 2KOGA 1GL2C 1SFCC 5CCHD 2M8RA 3HTKB 3RL0B 2H8PD 1NHLA 1GL2B 1SFCB 2N1TB 4OH8B 3RL0C 1GL2D 1SFCD 4W80A 2NPSB 4WY4C 1HVVA 1T3JA 5CCHA 3M0DC 3RK3C 2N1TC 4W7ZA 2WZ7A 2NPSC 3RL0D 4WY4B 1XTGB 4LGDE 1L4AC 1N7SC 4WY4D 1KILC 3HD7C 3RK3B 2PP6A 3P8CE 3VOPA 1GL2A 4JF7A 1SFCA 2N1TA 3RK3D 2N1TD 5CCGC 5KJ7C 1JTHB 2YMYA 2NPSA 1L4AB
chains in the Genus database with same CATH superfamily
2WTYA 4BXLA 3HD7D 3LIDA 3CX5D 3IFMA 4WY4A 2JWAA 1WRGA 3R2PA 1YHQP 5DJTB 1H0TB 3B4SA 5APXA 3H1JD 1Q7YQ 1SQVE 2OYHC 1MFZA 2QVAA 1YYCA 1LTAC 2FXMA 4JPZB 1EZVG 1GZLA 2R3CA 5KJ7A 4ASVA 1Q86Q 4U3FD 2NRGA 2FFDA 2WVRA 1DH3A 1U57A 2Q5UA 4RKUJ 1NU1J 4ZKPA 3N4XA 5GTIE 2OYIA 1SFCD 1BDDA 5TISE 1NTKG 1CI6B 2VRSA 3A0BH 3CWBJ 3F5HA 3L75J 1L4AC 1SQXK 4BWNA 3P7KA 3EFGA 4L73A 2M5AA 2N1TA 3GF3A 3CCSP 1USDA 4H44B 1KILB 3CPWO 2HPCB 3MP7B 1BSNA 2Q7CA 3VMZA 1SQPG 1SQQD 1VF5C 1Y8AA 4OGQB 3L74D 2BEZF 2W27A 3PP5A 3II6A 1BE3G 2WSCH 2XNDH 3RK2D 1N73B 1URQD 2AXTH 1NOHA 3BCCG 1PGPA 4IL6H 1LJ2A 2KNCB 1NTZJ 4HB1A 1NKZB 1FZFA 1JY3P 5AW8B 1GL2C 1P84H 1P84I 2J59M 3VP8A 2ITAA 3HTKA 1OX3A 1USEA 4PV1B 1ZRTE 2RMZA 2E75C 2KUBA 3AE7C 1NTMG 2C0XA 1HJBA 1LTSC 4GKGA 1M1JC 1SQVK 2QJPC 2FYUJ 3HD7C 2A06G 1KORA 2KS1A 3M9BA 3V2PA 3C8VA 3L70J 3AEFC 4I7ZC 1JNMA 1LT1A 2AEJA 2Z5HA 1IJDB 1RE3A 2J5UA 1PP9D 2N9BA 3H1IG 3O6QA 2WPSA 5DJUB 3Q1MA 4L75A 1GK6A 4PD4E 1EZVE 3H1LG 3AECC 3C1LA 5KLVJ 2I1KA 1FOSE 4LLHA 4GIFA 4HJGH 3VMYA 4BRYB 1KQLA 1PV3A 1XTCC 2O1JA 2G3AA 2OGUA 1SFCC 2E75B 3HTKB 4YTPC 1NTKE 2M3BA 1FZCC 4IL6X 3KZIE 3AE8C 1IK9A 2XZRA 3SSUA 2QJPB 1WMKA 3PTZA 3EFFK 1SQXG 1VQ6P 3RL0D 4NPEA 3L71J 1OVRA 1FC2C 3CCLP 4R4MA 1SQBD 2Q6QA 3V4QA 1MFTA 2XV5A 1KYOD 5AVYB 1SQPE 1EZVD 1BGYJ 3AEBC 4D6TG 5BU5A 4I1LA 2JP3A 3AE6C 1KD1Q 1BE3E 3RK2C 3MZWB 2QIWA 3G71P 1Y9BA 1JY3O 2XKMA 1URQC 1L0LG 3BCCE 4PJ0H 2HLOA 1RHZB 1N8RQ 2NZ2A 2YO3A 4WWIA 4B86A 2QE7H 5CMZA 3AE4C 3B5ND 3JCUE 2QSIA 1RQVA 2AEFA 3H32A 3CWBG 1K73Q 1IO4A 3L75G 2E5YA 1LT9B 3GG2A 2BCCJ 1FZCB 2C9LY 1OZHA 1NTME 3CCMP 1H8AA 1OVVA 1RF1A 2UWJE 2KLUA 1NH4A 1KTMA 2AEMA 1IFIA 3SFDC 2A06E 3V4WA 1OFCX 2H88C 5CCHA 1LTGC 3M0DC 1RF0C 2W90A 3CLQA 3VTPC 2OTJP 4LGDE 2O01N 4WY4D 1ZW0A 2BASA 3H1IE 1NTZG 1OW7A 3MIWA 5E79H 3RK2B 1QL1A 3H1LE 1RY3A 1NTKK 1S4XA 1J1EB 3H1KD 3GMAA 5KJ7D 2QM8A 3RK3E 2HR3A 3MUDA 3PLNA 4JYCA 3A0BE 3RBXA 2WSSH 3V2RA 1NTMD 4RJTA 1AJYA 2Y0EA 1BCCD 3ABVC 2XDJA 2ZVNB 4MN4C 3HUSC 2QJYC 2IFNA 3L35A 1LTJB 4R4LA 3TGUG 1EXJA 2KOGA 3WUUA 1YJNP 2W83C 1SQPK 2IFMA 1KZUB 1VQPP 2E76B 3U1CA 4KHXA 1Q90D 1H0TA 1AQTA 4NPDA 4RESB 4WVZA 3V5BA 3RL0C 3L37A 3IF4A 1M90Q 1IC2A 3GHGC 2P58A 1LTIC 2AXTE 1VQLP 1S5LH 4IL6E 3H1LD 3HRNA 5KLVG 4C7NB 4D6TE 3L73J 1FZGA 2P1JA 2E74B 4JF7A 1P84E 1MV8A 3RK3D 2B9BA 2K9JB 2ZXXA 5CJ4A 1L0LE 1N7SB 2NPSD 1CZQA 3Q5SA 3TSIA 1SLQA 1CI6A 1NTMK 2QJKB 1YJWP 3L72G 4N3YB 5AW7B 1EDJA 1KB9H 1KB9I 1Q2NA 3B5NC 3PRJA 3G9RA 2R44A 3CWBE 3AEDC 2WSEJ 1KFNA 1PL5A 3L75E 1VQ5P 5AVWB 1HTLC 5APWA 1KILA 2WPRA 3HE5B 1SS1A 2HPCA 2KZIA 5AVXB 3FXEA 4DT0A 1SQXD 1OW6A 3L71G 3AE9C 2FBWC 2AXCA 2ZXEB 1JY2O 4O9BA 2YKOA 4HYTB 1N7LA 3RL0B 2H7HA 4YXDC 1W2EA 4GDOA 1G1IA 4D6TD 1RQUA 3BRVB 3FX0A 2FYNC 1N73A 4H0LD 2JWDA 2HYNA 2KNCA 1JCDA 3AEGC 4WY4C 3LW5H 1S1CX 2Y0CA 1L0LD 2OYOA 3TYYA 1OXZA 1NTZE 2E42A 3MGNA 4H13D 1J1DB 1EC5A 3H1JJ 1KN7A 1ZP0C 3H1HD 2YMKA 5KJ7C 2IDBA 1L4AA 4U3FJ 1S5LX 1X0TA 5APUA 3R4YA 3WUVA 3BATA 3Q5PA 2FFDC 2WT7B 2IZ1A 2IBZG 3AEEC 2WSEH 5AW2B 1DD3A 1OMIA 3P32A 3TGUE 1IFDA 5CBNA 3JSVC 3I55P 2LKMA 4DOJA 3MHVA 1EDIA 1SQVD 3L4FA 3LIEA 4EDFA 2JO1A 2K1AA 1M8OB 4N78E 2MKVA 3F89A 3W68A 4K35A 2OYHB 2R3SA 1L0LK 1YITP 3TK1A 1FU1A 4PJ0E 3CCRP 2WWWA 5KLVE 1KFMA 1TU3F 2FYZA 3NTNA 2JEEA 3CX5H 3CCJP 3CX5I 4BRYA 1EQ7A 1SQQJ 3CCVP 3KPEA 3RK3C 5GTHH 3L74J 2NPSC 3TNUB 1MKMA 3KDPB 1L0NG 4YPCA 3V2NA 2W6AA 3L72E 5TJHA 1IFPA 3NMDA 4L74A 2CPSA 3TGUD 1L4AB 4HKZH 1VQOP 4ZKUA 3H25A 1M1KQ 1NVOA 1KV4A 2OQQA 3VMXA 3PH0A 4Y99C 2YNYA 3A2AA 4EIJA 1FAVA 4N78D 2W8ZA 4GT1A 2HODB 4AUWA 2GUSA 3L71E 2IZ0A 1VF5B 5KAIH 1NTZK 1E79H 3K5BA 1JO5A 1PPJG 1GMJA 3WU2H 5AVQB 1VDFA 3JC22 5E79E 2A45I 3L73G 1Y47A 4H0LC 2KXPB 1K05A 3E1RA 5CCHD 2M8RA 2KB7P 1G1JA 2Y9YA 1QX8A 1ZRTD 1RE3C 1GL2B 1G2CB 4H13C 1PP9J 3SWFA 2YKPA 3L72D 1OIPA 2NPSB 4GOFA 1JY3N 1LT9A 1LTBC 1FZCA 1M56D 1NJIQ 3S9OA 4XA4A 5KLIC 3S4RA 5KKZC 1NAYA 2BCCE 2OTKE 1DIPA 3M9HA 4U7JA 4WBAA 3WMM0 1M1JB 2M3EA 4XFJA 2GM4A 2IBZE 5AW3B 3U1AA 3HD7B 1VPCA 1OW8A 3G3ZA 3D6ZA 4OWFA 2RN0A 2O01J 3C9IA 1W2BO 4I7ZB 1PFIA 4LC1A 5CCGD 5KLVK 1KQGB 4PD4D 1ZOYC 1S5LE 4Z1MH 4ZMDA 2R32A 3N7NA 2QEXP 1KILE 1URQA 3ITKA 2P7JA 3IR9A 2YIUC 2C9NY 5BU8B 3FWNA 4EI2A 1NU1G 1SQBJ 3H1JG 3CL3D 2CK3H 1KB9E 1NTKD 3AE5C 1VQMP 1SFCB 1LWUC 2I8DA 4W80A 1L0NE 3D6YA 1LTJA 1HVVA 5KLIB 1QVFO 2IBZD 4K3AA 2Q3EA 5KKZB 2P10A 3IN6A 1KQSO 1GK4A 4DZOA 4KT0J 1VQNP 3O8ZA 5K5GB 1FZAA 3WUTA 3USSA 3TF5A 2FXPA 4UB6H 1SQPD 2FXOA 1RF0A 1S72P 1AV1A 2JKVA 1UIIA 1DEEG 1JY2P 4H44D 4TT3H 1FJKA 1JMMA 2V7QJ 5BVZA 3SFEC 2Q3IA 4C7NA 1BE3D 1RF1C 1X22A 1PPJE 3BCCD 4OGQD 3L73E 1FDOA 2K9JA 2YIUB 2QG4A 1URQB 1SQQG 1N7SA 5CCHC 2KZJA 3ZDMA 3L74G 3MD0A 2Y0DA 1MUUA 1HGVA 2ZFCA 3GLMA 1R5SA 3E1IA 1L0ND 3VMAA 2Y9ZA 2LR2A 5KTBA 1KMIZ 1KYOI 1IFNA 1EZVI 5APVA 1RE4C 2PFXA 2P67A 3HE5A 4AYCA 4PV1D 1VQ4P 5APYA 3MTUE 4IFMA 5AVVB 3H1KJ 1VQ8P 2FYUG 5AW0B 3H6PA 2A06D 4JYBA 3L70G 3MUDC 2W6BA 1YTZI 4RO0A 1NTMJ 4UB8H 2KSEA 3P8CE 5AW5B 3VYIA 1RH5B 1BCCJ 3H1ID 2N1TD 5CCGC 1CW5A 4DJGA 3PJSK 1LP1B 3CXHH 3HE4B 3CXHI 3GF7A 2V7QH 2Z4EA 1JY2N 2G8YA 1IFJA 1LTTC 2L91A 4C7RA 3CX5E 5H2FH 2SPZA 5B66H 5AVZB 5GTHE 1L0NK 3A0HH 1FJPA 3QH9A 2XNXA 4KJMA 1NU1E 3H1JE 3L36A 1U7MA 5AVSB 2B89A 3B5NA 2YXQB 1M7LA 2QM7A 3H1LJ 2KIKA 2WT7A 3SWYA 3I5CA 2KP8A 1FE6A 1NYHA 3HUSB 2OTLP 2QJYB 1MZ9A 1JMBA 1YI2P 1PGJA 4HH2A 3EWKA 4QMAA 3VN0A 3KXDA 2ZT9D 4OH8B 3P8CD 5M1BA 2WMMA 3BRTB 5KAIE 2PAJA 1NGMB 4EYYQ 3CC4P 1KC8Q 2OYHA 3WU2E 5APQA 2WZ7A 4M3LA 1ZN5A 2ZAEB 2MJZA 1BGYG 1JUNA 1XTGB 3GHGB 2E43A 5KAFH 4H44C 1KILC 1H88A 1GW3A 1P84D 1SQXJ 1JTHB 3NXSA 2QRXA 3T97B 4OGQC 1SQBG 1NU1D 1Q81Q 2JJLA 3E7KA 3IAOA 2WSCJ 1EDKA 3RBZA 4Y28J 3A3YB 1SQQE 1ZXGA 3TNUA 2WPQA 3A7OA 5CBOA 3RL0g 4D6TJ 3L74E 3Q2YA 1YIJP 3CC2P 1JM0A 1N73C 2FY8A 3PHLA 3AEAC 3CWBD 4JBZA 1M57D 3BVHA 3L75D 1FDMA 5CJ0A 3B5NB 2BCCG 1L0LJ 5AVUB 2KLVA 2R5DA 2B87B 3M91A 3FXDA 1W5CE 2Z5IA 3FGAD 1VQKP 1JB0J 4PV1C 2ZYAA 3EQ2A 2OYIC 2HODA 1DX7A 3H1HJ 2FYUE 3OAKA 4N6JA 4WB4A 1ZMEC 3L70E 1DEBA 1AVOA 4L76A 3CC7P 1ZLLA 2DW3A 4I2LC 1J2JB 5AW4B 2C0WA 2ZYGA 1R5LA 2N1TC 2FYNB 1YBKA 1NU1K 1NTZD 1N2DC 4WY4B 1GL2A 1G2CA 5AVRB 1SQVJ 1GW4A 3CCQP 1DD4A 4AQRD 2KK7A 3V2QA 1AA0A 2NPSA 2BEQD 3D71A 4EOTA 1PP9E 1L2PA 2HFED 1FBMA 1JOCA 3M06A 2WSFJ 4C46A 1HJ0A 2H89C 2D2CD 5B5EH 5AVTB 2FFDB 2KSJA 1M1JA 3H1KG 2FYUD 3OA7A 1LGHB 3HD7A 3UIAA 5CHXA 1S3JA 3L70D 2OYIB 4UB6E 1NAFA 2ZT9C 2PRRA 1FS0E 2ZVOB 3QWOC 2IX7C 1BCCG 1QVGO 4IOIH 1GTWA 2E76D 3TGUJ 2ZJSE 1NHLA 2LXCB 2M5AB 1SQQK 3TDKA 2N1TB 3CD6P 3KHUA 1AVYA 1BGYE 2A45H 5KLVD 1ZR2A 3M0AA 2O1KA 1T6AA 3I56P 1SQBE 3RGUA 1GD2E 3P8MC 3RK3B 1KYOE 1SFCA 4JQ0D 4ZNCA 2E74D 1ZV8A 5AW6B 2K3RA 1PGQA 4IFFA 2K37A 2IYOA 2PGDA 5AW1B 4YXWH 1FOSF 2FYUK 1N7SD 3G6EP 2WSFH 1LNQA 1R8EA 3KQGA 4W7YA 2JDIH 4OVNF 5GTIH 2OARA 2K9YA 3L72J 4Y99B 3L71D 5TISH 1IFMA 1LT9C 3CCUP 1HBWA 4UB8E 2ZT9B 1A02F 2YKQA 4DCKA 1QL2A 1VL2A 1BGYD 1HH0A 3CXHE 5APSA 5APTA 1D7MA 2H43A 1HGZA 2YO2A 2V4HA 5H2FE 3VP9A 2GA1A 5B66E 1YTZT 4H0LB 2H8PD 2KS1B 3GW6A 1T2KD 1QGKB 1FZEA 3A0HE 1NKNA 3Q5RA 1SVFA 1T3JA 1S9KE 1N86A 3CCEP 2K88A 3BASA 4H13B 4W7ZA 1Z56A 2J58A 2E5TA 3O6QB 1LWUA 3AE2C 2KYVA 1ZR4A 2JR8A 2O3JA 4U3FG 2BCCD 1X8YA 1T3UA 1FZBA 1EXIA 1J1EC 2POHA 2D2CC 1GU5A 3AE1C 1X79B 2KI7B 1KQFB 2HG5D 3H1KE 3H1HG 2N9YB 3V6IA 1OVUA 1Q82Q 2WITA 1NTKJ 2LXBA 4GOEA 3SWKA 3M0DA 3CXHD 1A02J 1YJ9P 2QA4P 3B71A 1LTJC 2A45G 1WT6A 5KAFE 1LP1A 2O01H 3HE4A 1BCCE 1KILD 1SQBK 1T8ZA 2E76C 1HWTC 5L8RJ 3B8EB 4CPGA 3KYQA 2XU6A 4GODA 2RKLA 3S1KA 2WPVB 3CMAP 1UIXA 1S9KD 1VQ9P 3M9QA 1SQVG 2ZYDA 1K04A 3G4SP 1SQPJ 1KB9D 5AW9B 2FKWB 2P2UA 2M0BA 1QEXA 2GUVA 1BE3J 3FWLA 1RE4A 4PD4H 4PD4I 1KYOH 1LWUB 3BCCJ 2E74C 3HUSA 1CSBA 1H89A 2D2CB 4TLFA 4XE5B 2IPPA 1N7SC 1K9MQ 2PP6A 5EFWB 1NWQA 3VOPA 2QJKC 2Q9IA 3U59A 2YMYA 1PZQA 4NPFX 1L0NJ 3Q3DA 1L4AD 1E5WA 1IK7A 3H32B 5CCGA 3GHGA 2Q1KA 1PPJD 3AE3C 3KZIH 3CMEP 1BDCA 2CPBA 3OW2O 3A5TA 2YXRB 3L73D 1PGOA 1JEKA 2IBZI 1JTHA 1RF1B 1HF9A 3T97A 1VF5D 1YQ4C 2WQYC 1GDTA 4A7PA 1HUCA 1SQXE 3D70A 1QLED 3CI9A 1T2KC 2R5BA 1IZNB 3W67A 3LW5J 1PP9G 3H1IJ 1K8AQ 1EDLA 2RH0A 1U7JA 2B88A 5B5EE 5C39A 1GL2D 4I6MC 2B87A 2IYPA 3NFQA 4U3FE 2W6JH 1VQ7P 1J1DC 1AFOA 1GU4A 1PIXA 1JCCA 1YQ3C 1FDIA 4ASWA 2E75D 1AQ5A 1SP4A 1S2EA 1NO4A 4IFDK 1OWAA 3H1HE 3JCUH 1BSHA 2I1JA 1X9VA 2L5GB 3OJAB
chains in the Genus database with same CATH topology
3RK2B 3HD7B 1QL1A 2WTYA 1VPCA 4EOTA 3G3ZA 1RY3A 1NTKK 3HD7D 1J1EB 2HFED 3C9IA 1FBMA 1JOCA 3M06A 3LIDA 4C46A 3IFMA 1PFIA 4LC1A 4WY4A 5CCGD 5KJ7D 2QM8A 5KLVK 1WRGA 3R2PA 5AVTB 3MUDA 2FFDB 2KSJA 1M1JA 4JYCA 2R32A 3N7NA 5APXA 3V2RA 3OA7A 1LGHB 3HD7A 3UIAA 1URQA 5CHXA 2OYHC 1MFZA 2XDJA 1YYCA 1LTAC 2FXMA 2P7JA 3HUSC 2OYIB 1NAFA 3IR9A 1GZLA 2IFNA 2R3CA 3L35A 5KJ7A 2C9NY 1LTJB 5BU8B 2KOGA 1SQPK 2IFMA 1KZUB 2IX7C 3CL3D 3U1CA 2FFDA 4KHXA 1DH3A 1GTWA 4RESB 2Q5UA 1NHLA 3V5BA 4ZKPA 3N4XA 1SQQK 1SFCB 2N1TB 1LWUC 3RL0C 2A45H 2OYIA 1SFCD 4W80A 3L37A 1ZR2A 1LTJA 1HVVA 1IC2A 3GHGC 3M0AA 1CI6B 1GK4A 1LTIC 2O1KA 4DZOA 2VRSA 3HRNA 4C7NB 3O8ZA 1GD2E 1FZGA 1L4AC 2P1JA 1SQXK 1FZAA 3P8MC 3RK3B 3P7KA 3EFGA 4JF7A 1SFCA 2N1TA 1MV8A 3RK3D 1ZV8A 1RF0A 5AW6B 5CJ4A 4IFFA 1N7SB 2NPSD 1CZQA 1KILB 5AW1B 2HPCB 1FOSF 3TSIA 2FYUK 1SLQA 1CI6A 1NTMK 1JY2P 1N7SD 1FJKA 1JMMA 2WSFH 4N3YB 2Q7CA 5BVZA 3VMZA 3KQGA 2Q3IA 5AW7B 4C7NA 1RF1C 3B5NC 4W7YA 2W27A 2OARA 4Y99B 1KFNA 3PP5A 5AVWB 3II6A 1IFMA 1URQB 1LT9C 1HTLC 1N7SA 2WSCH 5APWA 1HBWA 1KILA 2WPRA 3HE5B 3RK2D 5CCHC 1A02F 2YKQA 2HPCA 1N73B 1URQD 1NOHA 3MD0A 5AVXB 1QL2A 1MUUA 1HH0A 1HGVA 1NKZB 2ZFCA 3E1IA 2ZXEB 1FZFA 5APSA 5APTA 1JY3P 1JY2O 4O9BA 5AW8B 5KTBA 1GL2C 2YKOA 4HYTB 2H43A 2J59M 3VP8A 1IFNA 1N7LA 3RL0B 2H7HA 1W2EA 1HGZA 2YO2A 3HTKA 3VP9A 5APVA 1RE4C 1G1IA 1YTZT 2H8PD 2P67A 1T2KD 3BRVB 3HE5A 1N73A 4AYCA 1FZEA 2HYNA 1NKNA 5APYA 3MTUE 4IFMA 5AVVB 1JCDA 4WY4C 3LW5H 1SVFA 5AW0B 3H6PA 1T3JA 2C0XA 1S9KE 1N86A 4JYBA 3BASA 1HJBA 3TYYA 4W7ZA 1OXZA 1LTSC 1Z56A 2J58A 2E42A 3MGNA 4GKGA 1M1JC 1LWUA 2KYVA 1SQVK 1ZR4A 2W6BA 1YTZI 1J1DB 3HD7C 3M9BA 3P8CE 1X8YA 1T3UA 5AW5B 3V2PA 1FZBA 3VYIA 2N1TD 5CCGC 1J1EC 5KJ7C 1CW5A 2POHA 1GU5A 1JNMA 3HE4B 1X79B 1L4AA 2Z5HA 2Z4EA 1IJDB 1JY2N 1RE3A 5APUA 1IFJA 2HG5D 2N9BA 1LTTC 3BATA 2FFDC 4C7RA 2WT7B 2WPSA 2WITA 1GK6A 5AVZB 3M0DA 1L0NK 1A02J 2WSEH 5AW2B 1FJPA 3P32A 2XNXA 1IFDA 1LTJC 2A45G 2I1KA 1WT6A 3L36A 2LKMA 5AVSB 1FOSE 2O01H 3HE4A 3V2QA 4DOJA 3B5NA 1KILD 4LLHA 4GIFA 3L4FA 3LIEA 1SQBK 1M7LA 1T8ZA 1HWTC 2QM7A 3VMYA 3B8EB 3KYQA 2XU6A 4N78E 2WT7A 1KQLA 1XTCC 2O1JA 3SWYA 3I5CA 2OYHB 1S9KD 3M9QA 2KP8A 1SFCC 3HUSB 1L0LK 3HTKB 1MZ9A 4HH2A 2M3BA 3VN0A 5AW9B 3TK1A 1FU1A 1FZCC 2FKWB 4OH8B 2P2UA 3P8CD 2WWWA 1KFMA 1IK9A 2FYZA 3NTNA 2JEEA 2XZRA 3BRTB 2PAJA 2GUVA 1EQ7A 1RE4A 3KPEA 3RK3C 2OYHA 1LWUB 5APQA 2WZ7A 4M3LA 1ZN5A 3HUSA 1CSBA 2MJZA 2NPSC 1H89A 3RL0D 1JUNA 3TNUB 1XTGB 3GHGB 3KDPB 4XE5B 2E43A 2IPPA 1N7SC 1KILC 3V2NA 1H88A 2W6AA 2PP6A 1NWQA 3VOPA 3V4QA 2XV5A 1GW3A 5AVYB 3NMDA 2Q9IA 2CPSA 1JTHB 2YMYA 3NXSA 3U59A 1L4AB 5BU5A 4ZKUA 4I1LA 1L4AD 1E5WA 2JJLA 3VMXA 3H32B 4Y99C 3A3YB 5CCGA 2YNYA 3RK2C 3TNUA 3A2AA 2WPQA 4EIJA 1FAVA 1JY3O 2XKMA 1URQC 3A7OA 3GHGA 4N78D 4GT1A 1N73C 2HODB 4AUWA 2GUSA 2HLOA 2CPBA 3A5TA 3BVHA 2YO3A 1FDMA 1RF1B 1JTHA 3B5NB 5CJ0A 1NTZK 4B86A 3T97A 5CMZA 1JO5A 3B5ND 5AVQB 5AVUB 1GDTA 2KLVA 1VDFA 2R5DA 1HUCA 3M91A 3H32A 2A45I 3CI9A 1T2KC 2R5BA 2Z5IA 1IO4A 1LT9B 3EQ2A 1FZCB 2C9LY 2OYIC 2HODA 5CCHD 2M8RA 1DX7A 2KB7P 1G1JA 3OAKA 4N6JA 1H8AA 1RF1A 4WB4A 1RE3C 1GL2B 1G2CB 1DEBA 1ZLLA 3SWFA 2YKPA 1J2JB 4I2LC 1GL2D 1NH4A 4I6MC 3NFQA 5AW4B 2NPSB 2C0WA 1IFIA 1J1DC 3V4WA 1JY3N 1LT9A 1AFOA 1GU4A 5CCHA 1LTBC 1JCCA 1LTGC 2N1TC 3M0DC 1NU1K 1FZCA 1RF0C 1N2DC 1AQ5A 4WY4B 1SP4A 4XA4A 3CLQA 3VTPC 1NO4A 4LGDE 4IFDK 4WY4D 3M9HA 1OWAA 2BASA 1GL2A 1G2CA 5AVRB 4WBAA 3WMM0 1GW4A 1M1JB 2GM4A 3MIWA 2I1JA 1X9VA 5AW3B 4AQRD 2L5GB 3U1AA 2NPSA 3OJAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7S B;  2NPS D;  3RK2 B;  1KIL B;  3HD7 B;  1L4A A;  3TSI A;  1L4A D;  1N7S D;  3HD7 D;  2HG5 D;  2HFE D;  5CCG A;  4WY4 A;  3RK2 C;  5CCG D;  5KJ7 D;  1URQ C;  3B5N C;  4W7Y A;  3PP5 A;  1JTH A;  1URQ B;  3B5N B;  1N7S A;  1KIL A;  3HD7 A;  3RK2 D;  5CCH C;  1URQ A;  1KIL D;  3B5N A;  1URQ D;  3B5N D;  2XDJ A;  5KJ7 A;  3KYQ A;  4N78 E;  2KOG A;  1GL2 C;  1SFC C;  5CCH D;  2M8R A;  3HTK B;  3RL0 B;  2H8P D;  1NHL A;  1GL2 B;  1SFC B;  2N1T B;  4OH8 B;  3RL0 C;  1GL2 D;  1SFC D;  4W80 A;  2NPS B;  4WY4 C;  1HVV A;  1T3J A;  5CCH A;  3M0D C;  3RK3 C;  2N1T C;  4W7Z A;  2WZ7 A;  2NPS C;  3RL0 D;  4WY4 B;  1XTG B;  4LGD E;  1L4A C;  1N7S C;  4WY4 D;  1KIL C;  3HD7 C;  3RK3 B;  2PP6 A;  3P8C E;  3VOP A;  1GL2 A;  4JF7 A;  1SFC A;  2N1T A;  3RK3 D;  2N1T D;  5CCG C;  5KJ7 C;  1JTH B;  2YMY A;  2NPS A;  1L4A B; 
#chains in the Genus database with same CATH topology
 2WTY A;  4BXL A;  3HD7 D;  3LID A;  3CX5 D;  3IFM A;  4WY4 A;  2JWA A;  1WRG A;  3R2P A;  1YHQ P;  5DJT B;  1H0T B;  3B4S A;  5APX A;  3H1J D;  1Q7Y Q;  1SQV E;  2OYH C;  1MFZ A;  2QVA A;  1YYC A;  1LTA C;  2FXM A;  4JPZ B;  1EZV G;  1GZL A;  2R3C A;  5KJ7 A;  4ASV A;  1Q86 Q;  4U3F D;  2NRG A;  2FFD A;  2WVR A;  1DH3 A;  1U57 A;  2Q5U A;  4RKU J;  1NU1 J;  4ZKP A;  3N4X A;  5GTI E;  2OYI A;  1SFC D;  1BDD A;  5TIS E;  1NTK G;  1CI6 B;  2VRS A;  3A0B H;  3CWB J;  3F5H A;  3L75 J;  1L4A C;  1SQX K;  4BWN A;  3P7K A;  3EFG A;  4L73 A;  2M5A A;  2N1T A;  3GF3 A;  3CCS P;  1USD A;  4H44 B;  1KIL B;  3CPW O;  2HPC B;  3MP7 B;  1BSN A;  2Q7C A;  3VMZ A;  1SQP G;  1SQQ D;  1VF5 C;  1Y8A A;  4OGQ B;  3L74 D;  2BEZ F;  2W27 A;  3PP5 A;  3II6 A;  1BE3 G;  2WSC H;  2XND H;  3RK2 D;  1N73 B;  1URQ D;  2AXT H;  1NOH A;  3BCC G;  1PGP A;  4IL6 H;  1LJ2 A;  2KNC B;  1NTZ J;  4HB1 A;  1NKZ B;  1FZF A;  1JY3 P;  5AW8 B;  1GL2 C;  1P84 H;  1P84 I;  2J59 M;  3VP8 A;  2ITA A;  3HTK A;  1OX3 A;  1USE A;  4PV1 B;  1ZRT E;  2RMZ A;  2E75 C;  2KUB A;  3AE7 C;  1NTM G;  2C0X A;  1HJB A;  1LTS C;  4GKG A;  1M1J C;  1SQV K;  2QJP C;  2FYU J;  3HD7 C;  2A06 G;  1KOR A;  2KS1 A;  3M9B A;  3V2P A;  3C8V A;  3L70 J;  3AEF C;  4I7Z C;  1JNM A;  1LT1 A;  2AEJ A;  2Z5H A;  1IJD B;  1RE3 A;  2J5U A;  1PP9 D;  2N9B A;  3H1I G;  3O6Q A;  2WPS A;  5DJU B;  3Q1M A;  4L75 A;  1GK6 A;  4PD4 E;  1EZV E;  3H1L G;  3AEC C;  3C1L A;  5KLV J;  2I1K A;  1FOS E;  4LLH A;  4GIF A;  4HJG H;  3VMY A;  4BRY B;  1KQL A;  1PV3 A;  1XTC C;  2O1J A;  2G3A A;  2OGU A;  1SFC C;  2E75 B;  3HTK B;  4YTP C;  1NTK E;  2M3B A;  1FZC C;  4IL6 X;  3KZI E;  3AE8 C;  1IK9 A;  2XZR A;  3SSU A;  2QJP B;  1WMK A;  3PTZ A;  3EFF K;  1SQX G;  1VQ6 P;  3RL0 D;  4NPE A;  3L71 J;  1OVR A;  1FC2 C;  3CCL P;  4R4M A;  1SQB D;  2Q6Q A;  3V4Q A;  1MFT A;  2XV5 A;  1KYO D;  5AVY B;  1SQP E;  1EZV D;  1BGY J;  3AEB C;  4D6T G;  5BU5 A;  4I1L A;  2JP3 A;  3AE6 C;  1KD1 Q;  1BE3 E;  3RK2 C;  3MZW B;  2QIW A;  3G71 P;  1Y9B A;  1JY3 O;  2XKM A;  1URQ C;  1L0L G;  3BCC E;  4PJ0 H;  2HLO A;  1RHZ B;  1N8R Q;  2NZ2 A;  2YO3 A;  4WWI A;  4B86 A;  2QE7 H;  5CMZ A;  3AE4 C;  3B5N D;  3JCU E;  2QSI A;  1RQV A;  2AEF A;  3H32 A;  3CWB G;  1K73 Q;  1IO4 A;  3L75 G;  2E5Y A;  1LT9 B;  3GG2 A;  2BCC J;  1FZC B;  2C9L Y;  1OZH A;  1NTM E;  3CCM P;  1H8A A;  1OVV A;  1RF1 A;  2UWJ E;  2KLU A;  1NH4 A;  1KTM A;  2AEM A;  1IFI A;  3SFD C;  2A06 E;  3V4W A;  1OFC X;  2H88 C;  5CCH A;  1LTG C;  3M0D C;  1RF0 C;  2W90 A;  3CLQ A;  3VTP C;  2OTJ P;  4LGD E;  2O01 N;  4WY4 D;  1ZW0 A;  2BAS A;  3H1I E;  1NTZ G;  1OW7 A;  3MIW A;  5E79 H;  3RK2 B;  1QL1 A;  3H1L E;  1RY3 A;  1NTK K;  1S4X A;  1J1E B;  3H1K D;  3GMA A;  5KJ7 D;  2QM8 A;  3RK3 E;  2HR3 A;  3MUD A;  3PLN A;  4JYC A;  3A0B E;  3RBX A;  2WSS H;  3V2R A;  1NTM D;  4RJT A;  1AJY A;  2Y0E A;  1BCC D;  3ABV C;  2XDJ A;  2ZVN B;  4MN4 C;  3HUS C;  2QJY C;  2IFN A;  3L35 A;  1LTJ B;  4R4L A;  3TGU G;  1EXJ A;  2KOG A;  3WUU A;  1YJN P;  2W83 C;  1SQP K;  2IFM A;  1KZU B;  1VQP P;  2E76 B;  3U1C A;  4KHX A;  1Q90 D;  1H0T A;  1AQT A;  4NPD A;  4RES B;  4WVZ A;  3V5B A;  3RL0 C;  3L37 A;  3IF4 A;  1M90 Q;  1IC2 A;  3GHG C;  2P58 A;  1LTI C;  2AXT E;  1VQL P;  1S5L H;  4IL6 E;  3H1L D;  3HRN A;  5KLV G;  4C7N B;  4D6T E;  3L73 J;  1FZG A;  2P1J A;  2E74 B;  4JF7 A;  1P84 E;  1MV8 A;  3RK3 D;  2B9B A;  2K9J B;  2ZXX A;  5CJ4 A;  1L0L E;  1N7S B;  2NPS D;  1CZQ A;  3Q5S A;  3TSI A;  1SLQ A;  1CI6 A;  1NTM K;  2QJK B;  1YJW P;  3L72 G;  4N3Y B;  5AW7 B;  1EDJ A;  1KB9 H;  1KB9 I;  1Q2N A;  3B5N C;  3PRJ A;  3G9R A;  2R44 A;  3CWB E;  3AED C;  2WSE J;  1KFN A;  1PL5 A;  3L75 E;  1VQ5 P;  5AVW B;  1HTL C;  5APW A;  1KIL A;  2WPR A;  3HE5 B;  1SS1 A;  2HPC A;  2KZI A;  5AVX B;  3FXE A;  4DT0 A;  1SQX D;  1OW6 A;  3L71 G;  3AE9 C;  2FBW C;  2AXC A;  2ZXE B;  1JY2 O;  4O9B A;  2YKO A;  4HYT B;  1N7L A;  3RL0 B;  2H7H A;  4YXD C;  1W2E A;  4GDO A;  1G1I A;  4D6T D;  1RQU A;  3BRV B;  3FX0 A;  2FYN C;  1N73 A;  4H0L D;  2JWD A;  2HYN A;  2KNC A;  1JCD A;  3AEG C;  4WY4 C;  3LW5 H;  1S1C X;  2Y0C A;  1L0L D;  2OYO A;  3TYY A;  1OXZ A;  1NTZ E;  2E42 A;  3MGN A;  4H13 D;  1J1D B;  1EC5 A;  3H1J J;  1KN7 A;  1ZP0 C;  3H1H D;  2YMK A;  5KJ7 C;  2IDB A;  1L4A A;  4U3F J;  1S5L X;  1X0T A;  5APU A;  3R4Y A;  3WUV A;  3BAT A;  3Q5P A;  2FFD C;  2WT7 B;  2IZ1 A;  2IBZ G;  3AEE C;  2WSE H;  5AW2 B;  1DD3 A;  1OMI A;  3P32 A;  3TGU E;  1IFD A;  5CBN A;  3JSV C;  3I55 P;  2LKM A;  4DOJ A;  3MHV A;  1EDI A;  1SQV D;  3L4F A;  3LIE A;  4EDF A;  2JO1 A;  2K1A A;  1M8O B;  4N78 E;  2MKV A;  3F89 A;  3W68 A;  4K35 A;  2OYH B;  2R3S A;  1L0L K;  1YIT P;  3TK1 A;  1FU1 A;  4PJ0 E;  3CCR P;  2WWW A;  5KLV E;  1KFM A;  1TU3 F;  2FYZ A;  3NTN A;  2JEE A;  3CX5 H;  3CCJ P;  3CX5 I;  4BRY A;  1EQ7 A;  1SQQ J;  3CCV P;  3KPE A;  3RK3 C;  5GTH H;  3L74 J;  2NPS C;  3TNU B;  1MKM A;  3KDP B;  1L0N G;  4YPC A;  3V2N A;  2W6A A;  3L72 E;  5TJH A;  1IFP A;  3NMD A;  4L74 A;  2CPS A;  3TGU D;  1L4A B;  4HKZ H;  1VQO P;  4ZKU A;  3H25 A;  1M1K Q;  1NVO A;  1KV4 A;  2OQQ A;  3VMX A;  3PH0 A;  4Y99 C;  2YNY A;  3A2A A;  4EIJ A;  1FAV A;  4N78 D;  2W8Z A;  4GT1 A;  2HOD B;  4AUW A;  2GUS A;  3L71 E;  2IZ0 A;  1VF5 B;  5KAI H;  1NTZ K;  1E79 H;  3K5B A;  1JO5 A;  1PPJ G;  1GMJ A;  3WU2 H;  5AVQ B;  1VDF A;  3JC2 2;  5E79 E;  2A45 I;  3L73 G;  1Y47 A;  4H0L C;  2KXP B;  1K05 A;  3E1R A;  5CCH D;  2M8R A;  2KB7 P;  1G1J A;  2Y9Y A;  1QX8 A;  1ZRT D;  1RE3 C;  1GL2 B;  1G2C B;  4H13 C;  1PP9 J;  3SWF A;  2YKP A;  3L72 D;  1OIP A;  2NPS B;  4GOF A;  1JY3 N;  1LT9 A;  1LTB C;  1FZC A;  1M56 D;  1NJI Q;  3S9O A;  4XA4 A;  5KLI C;  3S4R A;  5KKZ C;  1NAY A;  2BCC E;  2OTK E;  1DIP A;  3M9H A;  4U7J A;  4WBA A;  3WMM 0;  1M1J B;  2M3E A;  4XFJ A;  2GM4 A;  2IBZ E;  5AW3 B;  3U1A A;  3HD7 B;  1VPC A;  1OW8 A;  3G3Z A;  3D6Z A;  4OWF A;  2RN0 A;  2O01 J;  3C9I A;  1W2B O;  4I7Z B;  1PFI A;  4LC1 A;  5CCG D;  5KLV K;  1KQG B;  4PD4 D;  1ZOY C;  1S5L E;  4Z1M H;  4ZMD A;  2R32 A;  3N7N A;  2QEX P;  1KIL E;  1URQ A;  3ITK A;  2P7J A;  3IR9 A;  2YIU C;  2C9N Y;  5BU8 B;  3FWN A;  4EI2 A;  1NU1 G;  1SQB J;  3H1J G;  3CL3 D;  2CK3 H;  1KB9 E;  1NTK D;  3AE5 C;  1VQM P;  1SFC B;  1LWU C;  2I8D A;  4W80 A;  1L0N E;  3D6Y A;  1LTJ A;  1HVV A;  5KLI B;  1QVF O;  2IBZ D;  4K3A A;  2Q3E A;  5KKZ B;  2P10 A;  3IN6 A;  1KQS O;  1GK4 A;  4DZO A;  4KT0 J;  1VQN P;  3O8Z A;  5K5G B;  1FZA A;  3WUT A;  3USS A;  3TF5 A;  2FXP A;  4UB6 H;  1SQP D;  2FXO A;  1RF0 A;  1S72 P;  1AV1 A;  2JKV A;  1UII A;  1DEE G;  1JY2 P;  4H44 D;  4TT3 H;  1FJK A;  1JMM A;  2V7Q J;  5BVZ A;  3SFE C;  2Q3I A;  4C7N A;  1BE3 D;  1RF1 C;  1X22 A;  1PPJ E;  3BCC D;  4OGQ D;  3L73 E;  1FDO A;  2K9J A;  2YIU B;  2QG4 A;  1URQ B;  1SQQ G;  1N7S A;  5CCH C;  2KZJ A;  3ZDM A;  3L74 G;  3MD0 A;  2Y0D A;  1MUU A;  1HGV A;  2ZFC A;  3GLM A;  1R5S A;  3E1I A;  1L0N D;  3VMA A;  2Y9Z A;  2LR2 A;  5KTB A;  1KMI Z;  1KYO I;  1IFN A;  1EZV I;  5APV A;  1RE4 C;  2PFX A;  2P67 A;  3HE5 A;  4AYC A;  4PV1 D;  1VQ4 P;  5APY A;  3MTU E;  4IFM A;  5AVV B;  3H1K J;  1VQ8 P;  2FYU G;  5AW0 B;  3H6P A;  2A06 D;  4JYB A;  3L70 G;  3MUD C;  2W6B A;  1YTZ I;  4RO0 A;  1NTM J;  4UB8 H;  2KSE A;  3P8C E;  5AW5 B;  3VYI A;  1RH5 B;  1BCC J;  3H1I D;  2N1T D;  5CCG C;  1CW5 A;  4DJG A;  3PJS K;  1LP1 B;  3CXH H;  3HE4 B;  3CXH I;  3GF7 A;  2V7Q H;  2Z4E A;  1JY2 N;  2G8Y A;  1IFJ A;  1LTT C;  2L91 A;  4C7R A;  3CX5 E;  5H2F H;  2SPZ A;  5B66 H;  5AVZ B;  5GTH E;  1L0N K;  3A0H H;  1FJP A;  3QH9 A;  2XNX A;  4KJM A;  1NU1 E;  3H1J E;  3L36 A;  1U7M A;  5AVS B;  2B89 A;  3B5N A;  2YXQ B;  1M7L A;  2QM7 A;  3H1L J;  2KIK A;  2WT7 A;  3SWY A;  3I5C A;  2KP8 A;  1FE6 A;  1NYH A;  3HUS B;  2OTL P;  2QJY B;  1MZ9 A;  1JMB A;  1YI2 P;  1PGJ A;  4HH2 A;  3EWK A;  4QMA A;  3VN0 A;  3KXD A;  2ZT9 D;  4OH8 B;  3P8C D;  5M1B A;  2WMM A;  3BRT B;  5KAI E;  2PAJ A;  1NGM B;  4EYY Q;  3CC4 P;  1KC8 Q;  2OYH A;  3WU2 E;  5APQ A;  2WZ7 A;  4M3L A;  1ZN5 A;  2ZAE B;  2MJZ A;  1BGY G;  1JUN A;  1XTG B;  3GHG B;  2E43 A;  5KAF H;  4H44 C;  1KIL C;  1H88 A;  1GW3 A;  1P84 D;  1SQX J;  1JTH B;  3NXS A;  2QRX A;  3T97 B;  4OGQ C;  1SQB G;  1NU1 D;  1Q81 Q;  2JJL A;  3E7K A;  3IAO A;  2WSC J;  1EDK A;  3RBZ A;  4Y28 J;  3A3Y B;  1SQQ E;  1ZXG A;  3TNU A;  2WPQ A;  3A7O A;  5CBO A;  3RL0 g;  4D6T J;  3L74 E;  3Q2Y A;  1YIJ P;  3CC2 P;  1JM0 A;  1N73 C;  2FY8 A;  3PHL A;  3AEA C;  3CWB D;  4JBZ A;  1M57 D;  3BVH A;  3L75 D;  1FDM A;  5CJ0 A;  3B5N B;  2BCC G;  1L0L J;  5AVU B;  2KLV A;  2R5D A;  2B87 B;  3M91 A;  3FXD A;  1W5C E;  2Z5I A;  3FGA D;  1VQK P;  1JB0 J;  4PV1 C;  2ZYA A;  3EQ2 A;  2OYI C;  2HOD A;  1DX7 A;  3H1H J;  2FYU E;  3OAK A;  4N6J A;  4WB4 A;  1ZME C;  3L70 E;  1DEB A;  1AVO A;  4L76 A;  3CC7 P;  1ZLL A;  2DW3 A;  4I2L C;  1J2J B;  5AW4 B;  2C0W A;  2ZYG A;  1R5L A;  2N1T C;  2FYN B;  1YBK A;  1NU1 K;  1NTZ D;  1N2D C;  4WY4 B;  1GL2 A;  1G2C A;  5AVR B;  1SQV J;  1GW4 A;  3CCQ P;  1DD4 A;  4AQR D;  2KK7 A;  3V2Q A;  1AA0 A;  2NPS A;  2BEQ D;  3D71 A;  4EOT A;  1PP9 E;  1L2P A;  2HFE D;  1FBM A;  1JOC A;  3M06 A;  2WSF J;  4C46 A;  1HJ0 A;  2H89 C;  2D2C D;  5B5E H;  5AVT B;  2FFD B;  2KSJ A;  1M1J A;  3H1K G;  2FYU D;  3OA7 A;  1LGH B;  3HD7 A;  3UIA A;  5CHX A;  1S3J A;  3L70 D;  2OYI B;  4UB6 E;  1NAF A;  2ZT9 C;  2PRR A;  1FS0 E;  2ZVO B;  3QWO C;  2IX7 C;  1BCC G;  1QVG O;  4IOI H;  1GTW A;  2E76 D;  3TGU J;  2ZJS E;  1NHL A;  2LXC B;  2M5A B;  1SQQ K;  3TDK A;  2N1T B;  3CD6 P;  3KHU A;  1AVY A;  1BGY E;  2A45 H;  5KLV D;  1ZR2 A;  3M0A A;  2O1K A;  1T6A A;  3I56 P;  1SQB E;  3RGU A;  1GD2 E;  3P8M C;  3RK3 B;  1KYO E;  1SFC A;  4JQ0 D;  4ZNC A;  2E74 D;  1ZV8 A;  5AW6 B;  2K3R A;  1PGQ A;  4IFF A;  2K37 A;  2IYO A;  2PGD A;  5AW1 B;  4YXW H;  1FOS F;  2FYU K;  1N7S D;  3G6E P;  2WSF H;  1LNQ A;  1R8E A;  3KQG A;  4W7Y A;  2JDI H;  4OVN F;  5GTI H;  2OAR A;  2K9Y A;  3L72 J;  4Y99 B;  3L71 D;  5TIS H;  1IFM A;  1LT9 C;  3CCU P;  1HBW A;  4UB8 E;  2ZT9 B;  1A02 F;  2YKQ A;  4DCK A;  1QL2 A;  1VL2 A;  1BGY D;  1HH0 A;  3CXH E;  5APS A;  5APT A;  1D7M A;  2H43 A;  1HGZ A;  2YO2 A;  2V4H A;  5H2F E;  3VP9 A;  2GA1 A;  5B66 E;  1YTZ T;  4H0L B;  2H8P D;  2KS1 B;  3GW6 A;  1T2K D;  1QGK B;  1FZE A;  3A0H E;  1NKN A;  3Q5R A;  1SVF A;  1T3J A;  1S9K E;  1N86 A;  3CCE P;  2K88 A;  3BAS A;  4H13 B;  4W7Z A;  1Z56 A;  2J58 A;  2E5T A;  3O6Q B;  1LWU A;  3AE2 C;  2KYV A;  1ZR4 A;  2JR8 A;  2O3J A;  4U3F G;  2BCC D;  1X8Y A;  1T3U A;  1FZB A;  1EXI A;  1J1E C;  2POH A;  2D2C C;  1GU5 A;  3AE1 C;  1X79 B;  2KI7 B;  1KQF B;  2HG5 D;  3H1K E;  3H1H G;  2N9Y B;  3V6I A;  1OVU A;  1Q82 Q;  2WIT A;  1NTK J;  2LXB A;  4GOE A;  3SWK A;  3M0D A;  3CXH D;  1A02 J;  1YJ9 P;  2QA4 P;  3B71 A;  1LTJ C;  2A45 G;  1WT6 A;  5KAF E;  1LP1 A;  2O01 H;  3HE4 A;  1BCC E;  1KIL D;  1SQB K;  1T8Z A;  2E76 C;  1HWT C;  5L8R J;  3B8E B;  4CPG A;  3KYQ A;  2XU6 A;  4GOD A;  2RKL A;  3S1K A;  2WPV B;  3CMA P;  1UIX A;  1S9K D;  1VQ9 P;  3M9Q A;  1SQV G;  2ZYD A;  1K04 A;  3G4S P;  1SQP J;  1KB9 D;  5AW9 B;  2FKW B;  2P2U A;  2M0B A;  1QEX A;  2GUV A;  1BE3 J;  3FWL A;  1RE4 A;  4PD4 H;  4PD4 I;  1KYO H;  1LWU B;  3BCC J;  2E74 C;  3HUS A;  1CSB A;  1H89 A;  2D2C B;  4TLF A;  4XE5 B;  2IPP A;  1N7S C;  1K9M Q;  2PP6 A;  5EFW B;  1NWQ A;  3VOP A;  2QJK C;  2Q9I A;  3U59 A;  2YMY A;  1PZQ A;  4NPF X;  1L0N J;  3Q3D A;  1L4A D;  1E5W A;  1IK7 A;  3H32 B;  5CCG A;  3GHG A;  2Q1K A;  1PPJ D;  3AE3 C;  3KZI H;  3CME P;  1BDC A;  2CPB A;  3OW2 O;  3A5T A;  2YXR B;  3L73 D;  1PGO A;  1JEK A;  2IBZ I;  1JTH A;  1RF1 B;  1HF9 A;  3T97 A;  1VF5 D;  1YQ4 C;  2WQY C;  1GDT A;  4A7P A;  1HUC A;  1SQX E;  3D70 A;  1QLE D;  3CI9 A;  1T2K C;  2R5B A;  1IZN B;  3W67 A;  3LW5 J;  1PP9 G;  3H1I J;  1K8A Q;  1EDL A;  2RH0 A;  1U7J A;  2B88 A;  5B5E E;  5C39 A;  1GL2 D;  4I6M C;  2B87 A;  2IYP A;  3NFQ A;  4U3F E;  2W6J H;  1VQ7 P;  1J1D C;  1AFO A;  1GU4 A;  1PIX A;  1JCC A;  1YQ3 C;  1FDI A;  4ASW A;  2E75 D;  1AQ5 A;  1SP4 A;  1S2E A;  1NO4 A;  4IFD K;  1OWA A;  3H1H E;  3JCU H;  1BSH A;  2I1J A;  1X9V A;  2L5G B;  3OJA B; 
#chains in the Genus database with same CATH homology
 3RK2 B;  3HD7 B;  1QL1 A;  2WTY A;  1VPC A;  4EOT A;  3G3Z A;  1RY3 A;  1NTK K;  3HD7 D;  1J1E B;  2HFE D;  3C9I A;  1FBM A;  1JOC A;  3M06 A;  3LID A;  4C46 A;  3IFM A;  1PFI A;  4LC1 A;  4WY4 A;  5CCG D;  5KJ7 D;  2QM8 A;  5KLV K;  1WRG A;  3R2P A;  5AVT B;  3MUD A;  2FFD B;  2KSJ A;  1M1J A;  4JYC A;  2R32 A;  3N7N A;  5APX A;  3V2R A;  3OA7 A;  1LGH B;  3HD7 A;  3UIA A;  1URQ A;  5CHX A;  2OYH C;  1MFZ A;  2XDJ A;  1YYC A;  1LTA C;  2FXM A;  2P7J A;  3HUS C;  2OYI B;  1NAF A;  3IR9 A;  1GZL A;  2IFN A;  2R3C A;  3L35 A;  5KJ7 A;  2C9N Y;  1LTJ B;  5BU8 B;  2KOG A;  1SQP K;  2IFM A;  1KZU B;  2IX7 C;  3CL3 D;  3U1C A;  2FFD A;  4KHX A;  1DH3 A;  1GTW A;  4RES B;  2Q5U A;  1NHL A;  3V5B A;  4ZKP A;  3N4X A;  1SQQ K;  1SFC B;  2N1T B;  1LWU C;  3RL0 C;  2A45 H;  2OYI A;  1SFC D;  4W80 A;  3L37 A;  1ZR2 A;  1LTJ A;  1HVV A;  1IC2 A;  3GHG C;  3M0A A;  1CI6 B;  1GK4 A;  1LTI C;  2O1K A;  4DZO A;  2VRS A;  3HRN A;  4C7N B;  3O8Z A;  1GD2 E;  1FZG A;  1L4A C;  2P1J A;  1SQX K;  1FZA A;  3P8M C;  3RK3 B;  3P7K A;  3EFG A;  4JF7 A;  1SFC A;  2N1T A;  1MV8 A;  3RK3 D;  1ZV8 A;  1RF0 A;  5AW6 B;  5CJ4 A;  4IFF A;  1N7S B;  2NPS D;  1CZQ A;  1KIL B;  5AW1 B;  2HPC B;  1FOS F;  3TSI A;  2FYU K;  1SLQ A;  1CI6 A;  1NTM K;  1JY2 P;  1N7S D;  1FJK A;  1JMM A;  2WSF H;  4N3Y B;  2Q7C A;  5BVZ A;  3VMZ A;  3KQG A;  2Q3I A;  5AW7 B;  4C7N A;  1RF1 C;  3B5N C;  4W7Y A;  2W27 A;  2OAR A;  4Y99 B;  1KFN A;  3PP5 A;  5AVW B;  3II6 A;  1IFM A;  1URQ B;  1LT9 C;  1HTL C;  1N7S A;  2WSC H;  5APW A;  1HBW A;  1KIL A;  2WPR A;  3HE5 B;  3RK2 D;  5CCH C;  1A02 F;  2YKQ A;  2HPC A;  1N73 B;  1URQ D;  1NOH A;  3MD0 A;  5AVX B;  1QL2 A;  1MUU A;  1HH0 A;  1HGV A;  1NKZ B;  2ZFC A;  3E1I A;  2ZXE B;  1FZF A;  5APS A;  5APT A;  1JY3 P;  1JY2 O;  4O9B A;  5AW8 B;  5KTB A;  1GL2 C;  2YKO A;  4HYT B;  2H43 A;  2J59 M;  3VP8 A;  1IFN A;  1N7L A;  3RL0 B;  2H7H A;  1W2E A;  1HGZ A;  2YO2 A;  3HTK A;  3VP9 A;  5APV A;  1RE4 C;  1G1I A;  1YTZ T;  2H8P D;  2P67 A;  1T2K D;  3BRV B;  3HE5 A;  1N73 A;  4AYC A;  1FZE A;  2HYN A;  1NKN A;  5APY A;  3MTU E;  4IFM A;  5AVV B;  1JCD A;  4WY4 C;  3LW5 H;  1SVF A;  5AW0 B;  3H6P A;  1T3J A;  2C0X A;  1S9K E;  1N86 A;  4JYB A;  3BAS A;  1HJB A;  3TYY A;  4W7Z A;  1OXZ A;  1LTS C;  1Z56 A;  2J58 A;  2E42 A;  3MGN A;  4GKG A;  1M1J C;  1LWU A;  2KYV A;  1SQV K;  1ZR4 A;  2W6B A;  1YTZ I;  1J1D B;  3HD7 C;  3M9B A;  3P8C E;  1X8Y A;  1T3U A;  5AW5 B;  3V2P A;  1FZB A;  3VYI A;  2N1T D;  5CCG C;  1J1E C;  5KJ7 C;  1CW5 A;  2POH A;  1GU5 A;  1JNM A;  3HE4 B;  1X79 B;  1L4A A;  2Z5H A;  2Z4E A;  1IJD B;  1JY2 N;  1RE3 A;  5APU A;  1IFJ A;  2HG5 D;  2N9B A;  1LTT C;  3BAT A;  2FFD C;  4C7R A;  2WT7 B;  2WPS A;  2WIT A;  1GK6 A;  5AVZ B;  3M0D A;  1L0N K;  1A02 J;  2WSE H;  5AW2 B;  1FJP A;  3P32 A;  2XNX A;  1IFD A;  1LTJ C;  2A45 G;  2I1K A;  1WT6 A;  3L36 A;  2LKM A;  5AVS B;  1FOS E;  2O01 H;  3HE4 A;  3V2Q A;  4DOJ A;  3B5N A;  1KIL D;  4LLH A;  4GIF A;  3L4F A;  3LIE A;  1SQB K;  1M7L A;  1T8Z A;  1HWT C;  2QM7 A;  3VMY A;  3B8E B;  3KYQ A;  2XU6 A;  4N78 E;  2WT7 A;  1KQL A;  1XTC C;  2O1J A;  3SWY A;  3I5C A;  2OYH B;  1S9K D;  3M9Q A;  2KP8 A;  1SFC C;  3HUS B;  1L0L K;  3HTK B;  1MZ9 A;  4HH2 A;  2M3B A;  3VN0 A;  5AW9 B;  3TK1 A;  1FU1 A;  1FZC C;  2FKW B;  4OH8 B;  2P2U A;  3P8C D;  2WWW A;  1KFM A;  1IK9 A;  2FYZ A;  3NTN A;  2JEE A;  2XZR A;  3BRT B;  2PAJ A;  2GUV A;  1EQ7 A;  1RE4 A;  3KPE A;  3RK3 C;  2OYH A;  1LWU B;  5APQ A;  2WZ7 A;  4M3L A;  1ZN5 A;  3HUS A;  1CSB A;  2MJZ A;  2NPS C;  1H89 A;  3RL0 D;  1JUN A;  3TNU B;  1XTG B;  3GHG B;  3KDP B;  4XE5 B;  2E43 A;  2IPP A;  1N7S C;  1KIL C;  3V2N A;  1H88 A;  2W6A A;  2PP6 A;  1NWQ A;  3VOP A;  3V4Q A;  2XV5 A;  1GW3 A;  5AVY B;  3NMD A;  2Q9I A;  2CPS A;  1JTH B;  2YMY A;  3NXS A;  3U59 A;  1L4A B;  5BU5 A;  4ZKU A;  4I1L A;  1L4A D;  1E5W A;  2JJL A;  3VMX A;  3H32 B;  4Y99 C;  3A3Y B;  5CCG A;  2YNY A;  3RK2 C;  3TNU A;  3A2A A;  2WPQ A;  4EIJ A;  1FAV A;  1JY3 O;  2XKM A;  1URQ C;  3A7O A;  3GHG A;  4N78 D;  4GT1 A;  1N73 C;  2HOD B;  4AUW A;  2GUS A;  2HLO A;  2CPB A;  3A5T A;  3BVH A;  2YO3 A;  1FDM A;  1RF1 B;  1JTH A;  3B5N B;  5CJ0 A;  1NTZ K;  4B86 A;  3T97 A;  5CMZ A;  1JO5 A;  3B5N D;  5AVQ B;  5AVU B;  1GDT A;  2KLV A;  1VDF A;  2R5D A;  1HUC A;  3M91 A;  3H32 A;  2A45 I;  3CI9 A;  1T2K C;  2R5B A;  2Z5I A;  1IO4 A;  1LT9 B;  3EQ2 A;  1FZC B;  2C9L Y;  2OYI C;  2HOD A;  5CCH D;  2M8R A;  1DX7 A;  2KB7 P;  1G1J A;  3OAK A;  4N6J A;  1H8A A;  1RF1 A;  4WB4 A;  1RE3 C;  1GL2 B;  1G2C B;  1DEB A;  1ZLL A;  3SWF A;  2YKP A;  1J2J B;  4I2L C;  1GL2 D;  1NH4 A;  4I6M C;  3NFQ A;  5AW4 B;  2NPS B;  2C0W A;  1IFI A;  1J1D C;  3V4W A;  1JY3 N;  1LT9 A;  1AFO A;  1GU4 A;  5CCH A;  1LTB C;  1JCC A;  1LTG C;  2N1T C;  3M0D C;  1NU1 K;  1FZC A;  1RF0 C;  1N2D C;  1AQ5 A;  4WY4 B;  1SP4 A;  4XA4 A;  3CLQ A;  3VTP C;  1NO4 A;  4LGD E;  4IFD K;  4WY4 D;  3M9H A;  1OWA A;  2BAS A;  1GL2 A;  1G2C A;  5AVR B;  4WBA A;  3WMM 0;  1GW4 A;  1M1J B;  2GM4 A;  3MIW A;  2I1J A;  1X9V A;  5AW3 B;  4AQR D;  2L5G B;  3U1A A;  2NPS A;  3OJA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...