3SWFA

Cnga1 621-690 containing clz domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
b'GLEEKVTRMESSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFLKPLIDTEFSAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cGMP-gated cation channel alpha-1
publication title Molecular mechanism for 3:1 subunit stoichiometry of rod cyclic nucleotide-gated ion channels.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transport protein
total genus 23
structure length 56
sequence length 56
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3swfA00
4HYTB 4AQRD 3KDPB 3A7OA 3L35A 4EOTA 1HJBA 1GK6A 1HUCA 4LC1A 4C7NA 3L36A 3VMZA 2R5BA 5APVA 3V4QA 2P2UA 5AW1B 1GU5A 3UIAA 2E42A 1HBWA 1CI6B 3HE5B 5AVRB 2KP8A 3TNUB 1S9KE 2BASA 3A3YB 4AYCA 2WPRA 3M0DA 2W6AA 5APUA 1H89A 3HE4B 3LIDA 2Q5UA 4I6MC 3VN0A 1CZQA 1SP4A 3T97A 3TYYA 4KHXA 3A5TA 4JYBA 3HTKA 1HWTC 1J2JB 5APTA 5AW2B 2E43A 1A02J 1NAFA 2XZRA 3NTNA 4M3LA 3NXSA 3V5BA 1KQLA 2XV5A 1YYCA 1H8AA 5AW9B 2JJLA 1FOSF 2P7JA 1GK4A 1G2CB 3P7KA 5AVZB 5AW6B 1GU4A 3L37A 1DH3A 1NWQA 1MUUA 2R3CA 2QM8A 2WWWA 5AVVB 5AW3B 3B8EB 3MGNA 4JYCA 5AVUB 2WT7A 5APWA 3A2AA 4C7NB 1MV8A 5AW4B 3LIEA 5AW7B 3IR9A 2Z5HA 2VRSA 3M91A 5AVQB 3VMYA 3M9HA 1X8YA 3P32A 1GTWA 1FOSE 3VTPC 5AVYB 3MD0A 5AW0B 3P8MC 2YNYA 4AUWA 2IPPA 2W27A 4XE5B 5APXA 2WPQA 5CMZA 4DZOA 1S9KD 2N9BA 3NMDA 2R5DA 3M0AA 5AVXB 2H7HA 1GZLA 2R32A 2XU6A 2Q3IA 3NFQA 3VMXA 2Q7CA 2P67A 2YO3A 1OXZA 3V4WA 5AW8B 1CSBA 4B86A 5AW5B 5AVTB 3HE5A 1CI6A 4C46A 1JNMA 3TNUA 3VYIA 2QM7A 2C9NY 3KQGA 2C9LY 2WPSA 2ZFCA 3M9BA 1MFZA 4RESB 3O8ZA 4GT1A 5AVSB 3SWFA 1H88A 3HE4A 5APQA 3TK1A 2WT7B 1GD2E 1SLQA 5AVWB 4GKGA 4I2LC 1JUNA 3M06A 5APSA 2YO2A 1FAVA 1A02F 2WTYA 1T2KD 2Z5IA 3OAKA 1IO4A 5APYA 2ZXEB 1T2KC 3I5CA 1OWAA
chains in the Genus database with same CATH superfamily
3M9QA 4AQRD 4D6TE 5B66E 2K37A 1GK6A 1VQMP 1S2EA 3CC4P 3VMZA 3H1HJ 1FU1A 2V7QJ 5AVRB 1L0LJ 3F89A 4IFMA 3M0DC 3VP8A 2KSEA 1M56D 4EI2A 2AXCA 1KILE 1L4AC 3NTNA 1RQVA 2A45I 2ZT9D 3WU2H 2XKMA 1E79H 1FOSF 1GK4A 1FZFA 1G1JA 1OIPA 4N78E 3MGNA 3CCJP 2QA4P 3L74D 3LIEA 1NTMD 1PGQA 5AVQB 1GW4A 1SFCA 2KZJA 1URQA 3AE4C 3U1CA 1M1JB 3GF7A 5KJ7D 3L70J 3HTKB 1Y9BA 3H25A 1K9MQ 3HE5A 1P84H 3VYIA 3KQGA 1SQPK 3HD7A 1IK7A 3L71J 1H0TA 3WUTA 3P8CD 1EXIA 2GUSA 1JUNA 2WTYA 3L72J 1IO4A 3L73E 1LGHB 3N4XA 2FXOA 1RE4A 2QEXP 3H6PA 1UIIA 3CXHH 1FZCA 1HUCA 1SQVJ 2PGDA 3BRTB 4Y28J 1L0NE 2FY8A 4ZKUA 3SFDC 2CPBA 3K5BA 2E75D 1JOCA 3AE7C 2WPVB 3VN0A 3QWOC 3AEAC 2Y0CA 1URQD 1Z56A 5AW2B 3RK3C 2BEQD 1NAFA 1RHZB 3RL0C 1J1DC 1D7MA 4EDFA 2P7JA 2SPZA 1G2CB 5AVZB 5AW6B 2RMZA 2FYZA 3H1HG 5APWA 2HODB 3USSA 1BE3D 3CCLP 1L0LG 1N7LA 3BCCE 1T3JA 1VQPP 4GOFA 5AVYB 5L8RJ 3L75D 3HD7D 4OVNF 4IFFA 2R32A 1W2BO 3NFQA 1RF0C 1KB9D 1NHLA 4ASVA 4L76A 1JNMA 3PP5A 2IBZD 1LWUA 2C9NY 2N1TC 3L4FA 5CBOA 1N73C 1NAYA 1VQ7P 1NTZJ 3RK3B 2P58A 3RL0B 1J1DB 1N7SA 4HH2A 2IZ1A 3PHLA 5DJTB 2KYVA 1VDFA 1EDJA 3L70G 4DT0A 5TISH 1KYOD 2CK3H 3OJAB 1EZVE 1NJIQ 4N6JA 2B9BA 1VQ6P 3WUVA 1KN7A 3L71G 4PJ0E 2QVAA 1RY3A 1H89A 3V2NA 1NKZB 4U3FD 3L72G 1OW6A 1LT9C 2DW3A 4RO0A 1NTKJ 2YKPA 2G8YA 4XA4A 3EQ2A 2A06G 1SQVG 2N1TB 2QM8A 1VQ8P 1JEKA 2KXPB 3H1LD 1ZXGA 1GTWA 1AA0A 1YITP 3RK2C 1KD1Q 3L75J 2N9BA 3M0AA 1N7SD 1KB9I 3CX5I 4WY4D 2IBZI 3H1KD 2CPSA 2D2CD 1L0ND 2NZ2A 3G6EP 3GG2A 1FJPA 5CCHA 3CCEP 2KNCB 1VPCA 2Y9ZA 1YTZT 3KZIH 1Q2NA 1LT9B 3SFEC 2H8PD 2PAJA 5KTBA 2B87B 2K3RA 3L35A 3CCUP 4IFDK 1NTKK 2ZYGA 5AW1B 4PD4D 1PP9J 3RK2B 1M57D 1NU1J 1NTZG 1AV1A 4H0LC 2QJKC 1IFMA 1J2JB 4UB6H 1SQXE 1EDIA 1YJWP 1OVUA 3KYQA 3B8EB 1IFIA 1IFPA 3TDKA 3CCMP 3S4RA 1VF5C 1NYHA 1YBKA 1SQVE 4AUWA 2W27A 5CCHD 1BCCJ 1W2EA 1NTKG 5KLVJ 5B66H 3JCUE 2K9JA 1J1EC 1BDDA 1USEA 5AVSB 4RKUJ 3CCSP 3HE4A 3U1AA 2E76C 4H0LB 1T2KD 2QJKB 1USDA 5APYA 3Q5PA 4BRYB 1KYOH 4W80A 4EIJA 4HYTB 1PIXA 3L74E 1NTME 3MUDA 3IFMA 4LC1A 5CJ4A 4JF7A 1VF5B 1BGYJ 2WSCH 1N2DC 2I1JA 2FYUK 4PD4I 1G1IA 1EC5A 5APUA 3TF5A 4EYYQ 2NPSC 1KQFB 1LTAC 1HWTC 2OYOA 3H1HD 1S5LX 1VQLP 1LTGC 3HUSC 2UWJE 1J1EB 1L0LD 3P7KA 5E79H 3P8CE 1LP1A 1NTZE 3GHGC 1RE3C 1Y8AA 3AE5C 3GLMA 4HB1A 1MV8A 2PFXA 3V2PA 2E76B 3M91A 2VRSA 1DEEG 1PP9G 2O01H 2OQQA 1NU1G 1JY3P 4DJGA 2Q3EA 4PV1D 1QLED 4B86A 5AVTB 3I55P 1JY3O 5CCGC 3V6IA 4C7RA 3O8ZA 1M7LA 2NPSB 1HGZA 2E5YA 3L70D 2Z5IA 1WT6A 1Q90D 4BXLA 4IOIH 2KS1A 3HUSB 1BCCG 2K1AA 1BE3E 2GUVA 3GHGB 3L71D 5KAFE 4DCKA 5KLVG 4R4MA 5APVA 3L75E 4NPFX 3G71P 2P2UA 4XFJA 3AEDC 3L72D 1ZR2A 3TNUB 1OVVA 5K5GB 3M0DA 1KFMA 2FFDA 2OARA 1KB9E 3AE8C 4I6MC 3CX5E 1YJ9P 2A06D 3TYYA 1SQVD 1X22A 2IBZE 3E7KA 1SQPJ 3V5BA 1KQLA 4H44C 1GL2C 3Q2YA 2O01N 1BGYG 2WT7A 3A2AA 4C7NB 1KTMA 2OYIC 1PGPA 1JTHA 2Y0DA 1KYOE 2HLOA 1LTSC 1KC8Q 1SQQK 3CWBG 1HVVA 2V4HA 5KJ7C 2J58A 2WZ7A 1LTBC 2YO3A 1G2CA 5BVZA 1KZUB 1MKMA 4U3FE 3AE3C 2OTJP 3S9OA 5APQA 4KJMA 4OGQC 4TLFA 4PJ0H 4I2LC 1HGVA 1OW8A 1FZGA 2W90A 2G3AA 5BU8B 4H44B 5E79E 1GL2B 3Q5RA 4YXDC 3H1LE 5CHXA 3D71A 2Q1KA 1K8AQ 2FXMA 1ZOYC 1DD3A 2OYIB 3UIAA 1NTZD 2YMKA 2E42A 5KLIC 1S3JA 1SQBK 1JCCA 2KSJA 3A3YB 1L4AB 3PTZA 5KLVE 1X9VA 1NVOA 1YHQP 2QIWA 1JY2N 3N7NA 3LW5H 3A5TA 2YKOA 3PLNA 1SFCC 3H1KE 5AW9B 2K9YA 2W8ZA 1PPJG 3W68A 3CC2P 1NWQA 2BCCJ 2L5GB 4OGQB 2YKQA 2Z5HA 3RBXA 2MKVA 2A45H 1NTKD 2IFNA 1JMMA 2WSFJ 3HD7C 3PRJA 1S9KD 1BDCA 4GOEA 3KPEA 1RF0A 2XU6A 1SQPG 1IFNA 2YXRB 3VMXA 4PD4E 2JDIH 1JMBA 2N1TA 1JO5A 1SQBG 1RE4C 5KLIB 1QX8A 1FZEA 4RESB 4GT1A 1VQ4P 1HJ0A 1KQGB 1FZCC 2YIUC 4GDOA 1M8OB 4OH8B 2MJZA 4BWNA 1WMKA 2W83C 1SFCB 3WUUA 3CX5D 3RK3D 4CPGA 3RL0D 3KDPB 1KILC 2HPCA 1SQXK 1MFTA 3H1IG 3ITKA 3W67A 1JY2P 2L91A 3HE5B 3BATA 3SWKA 1ZMEC 1HH0A 2IFMA 3HD7B 1IK9A 1H0TB 2KNCA 3IAOA 1JM0A 2FKWB 2JEEA 4WY4A 3VOPA 2M8RA 3JSVC 4WB4A 3C9IA 1RF1A 1PP9D 3JCUH 2ZYAA 5AVVB 4JYCA 1FZCB 1NU1D 2JKVA 2WVRA 2N1TD 2YIUB 1DD4A 5AW7B 2HFED 1Y47A 1DEBA 1LWUC 2ZJSE 1FE6A 1GW3A 1EDLA 1KILB 1FZBA 3R2PA 1E5WA 1N7SC 1OX3A 1N73B 1NTMK 2WPSA 2BCCG 1M1KQ 3SWFA 1H88A 5CJ0A 1BCCD 3H1HE 3TGUJ 2RKLA 1FC2C 1A02F 1L0LE 5KLVD 4NPDA 1PV3A 4HJGH 3BVHA 1TU3F 2FYNC 2N9YB 2GM4A 2LXCB 3S1KA 2J5UA 1LWUB 2E74D 3ABVC 4L73A 1AVOA 1SVFA 3VMAA 3V2QA 3T97A 1N8RQ 4KHXA 4H13C 3RK2D 3B5NC 1BGYD 1N7SB 1OMIA 2WITA 1QVFO 2JJLA 4WWIA 1EQ7A 1NKNA 5B5EE 1KMIZ 3EWKA 3L37A 1ZRTE 1GMJA 3L70E 2QRXA 2B89A 4OWFA 1RQUA 3CWBD 2LXBA 4I7ZC 3FGAD 2FYNB 3L71E 1Q86Q 4DZOA 3NMDA 2FYUJ 3L72E 4UB8H 5KAFH 1FDOA 1CI6A 2Z4EA 3H1JJ 5KKZC 1AFOA 1T8ZA 2KI7B 1S1CX 2I8DA 4JQ0D 2A06E 1Q81Q 2QJPC 2H89C 3CPWO 3ZDMA 4GKGA 1Q82Q 4H13B 1NH4A 4KT0J 2XNXA 1KB9H 3CX5H 3B5NB 4U7JA 3IF4A 1T2KC 2WSSH 1DX7A 2QJYC 1LTJA 1AJYA 3C8VA 3H32A 3L36A 3SWYA 2KIKA 2YXQB 3MHVA 2KP8A 3AE9C 2KB7P 3BRVB 1VF5D 4I7ZB 4AYCA 4MN4C 4LGDE 1OZHA 3TGUG 2WSEH 4DOJA 2O1JA 1Q7YQ 1PPJD 1IFJA 4JYBA 2IDBA 1A02J 4M3LA 2ZVNB 1JCDA 1H8AA 5KKZB 2JR8A 1FS0E 5AW3B 3KHUA 3V2RA 3A0HE 1IFDA 1PGJA 1R5SA 2QJPB 2QG4A 1JB0J 1NGMB 1FOSE 1P84D 4IL6E 1SQPD 3MD0A 5AW0B 1PZQA 3CWBJ 2AEMA 1LJ2A 2QJYB 5CMZA 4D6TG 1SQBD 1DIPA 5KAIH 3F5HA 2HG5D 2Q3IA 4W7ZA 4PV1C 5AW8B 1QGKB 2QE7H 3BCCJ 3GF3A 2ITAA 1MFZA 3MUDC 2NPSD 2C0XA 2OGUA 3H1ID 2KZIA 1PL5A 3CL3D 2FYUG 3MZWB 1FBMA 5GTIH 1BSHA 2Y9YA 3OA7A 4K35A 3H1JG 1NTKE 1M90Q 1L0NK 2ZXXA 3GMAA 3II6A 1FZAA 1SQQJ 1ZRTD 2JO1A 2M3EA 1S9KE 4I1LA 2BASA 3O6QB 1M1JA 3HE4B 3AEEC 1SP4A 4UB8E 3HTKA 2E43A 2BEZF 4PV1B 4JPZB 1R8EA 4N3YB 4PD4H 2R44A 1ZP0C 1K04A 1MUUA 2ZYDA 2OYHC 1IJDB 1L2PA 1LTIC 5CCGD 5AW4B 2WQYC 1X8YA 1P84I 1L4AA 5H2FE 3RK3E 3L73G 3VTPC 2O1KA 2FXPA 4K3AA 1N86A 2ZT9C 2BCCD 1OVRA 1SQBJ 3AEBC 1FJKA 1L0NG 2LR2A 2OTKE 2ZFCA 2Y0EA 1LP1B 3CXHI 1U57A 3LW5J 2IYOA 1QVGO 3G3ZA 1SS1A 3CCVP 3FXDA 1PP9E 3Q3DA 2FFDC 1NU1E 3H1IJ 1KQSO 2OYHB 4H44D 1HJBA 1GL2D 2HODA 4NPEA 2H43A 3BCCG 3FX0A 1VQKP 2FYUE 1YQ4C 2WPRA 2W6AA 1XTCC 5KAIE 1CW5A 1IC2A 3H1JE 2AXTE 1L4AD 2ZT9B 4GODA 3D6ZA 3G9RA 2PP6A 2KK7A 4Z1MH 2KS1B 1GU4A 1BCCE 5AVUB 2E5TA 4ZNCA 1SQQG 3D70A 2E75C 2M5AB 3WMM0 4OGQD 2V7QH 3CMEP 1SQXJ 2XNDH 4YXWH 4L75A 5GTIE 1URQC 5C39A 2HR3A 2FFDB 1IZNB 1L0LK 2R5DA 4JBZA 5AVXB 3BASA 1YTZI 1K73Q 3B4SA 2P67A 3Q5SA 1CSBA 1EZVG 5AW5B 4YTPC 4WVZA 1S5LE 3CD6P 2GA1A 3TK1A 2WT7B 1GD2E 1BGYE 3JC22 1AVYA 3HRNA 2JWAA 5APSA 2JP3A 4LLHA 3VP9A 5DJUB 1JTHB 1YIJP 3CMAP 1SFCD 1KILA 5B5EH 3CWBE 2R5BA 3TGUD 1N73A 1GU5A 2E75B 4GIFA 1UIXA 3C1LA 1ZV8A 1AQ5A 2KOGA 3AECC 5GTHE 3G4SP 1URQB 3EFGA 1XTGB 3AE2C 3L74J 1NTMJ 2P1JA 2NRGA 5APTA 1VQOP 1LT1A 1KFNA 2XV5A 2O3JA 1DH3A 2M3BA 2WWWA 1VL2A 3FWLA 2A45G 4D6TD 3IR9A 3MP7B 2FBWC 1LT9A 1SQVK 3P8MC 1JY2O 2AEJA 2Q9IA 3A0BH 5APXA 2B87A 3I56P 3IN6A 1SQQE 3CLQA 3KXDA 3WU2E 2KLUA 3AE1C 1K05A 1W5CE 1KILD 1KORA 2WSFH 4IL6X 1FDIA 1PPJE 4HKZH 3TSIA 5AVWB 4ASWA 4N78D 2FYUD 2IYPA 1U7JA 1SQXG 3OAKA 1QL1A 3H1JD 4WY4C 1KV4A 1P84E 1RH5B 1FDMA 1SQPE 1X0TA 3A0HH 3OW2O 2D2CC 1RF1C 1SQBE 1EXJA 2E74C 4IL6H 2PRRA 1CZQA 1BE3J 3B5NA 3CI9A 3FXEA 3GW6A 2XZRA 3FWNA 3NXSA 3CXHE 1YYCA 1NTZK 3L73D 1YQ3C 1QEXA 2RH0A 2HPCB 1WRGA 4ZMDA 3H1IE 3M9HA 4D6TJ 1ZN5A 3Q1MA 2IPPA 1MZ9A 2B88A 4BRYA 4YPCA 4QMAA 3L74G 1NTMG 2ZVOB 4WY4B 5EFWB 2Q7CA 1LTTC 2W6BA 1KYOI 3U59A 2D2CB 2QM7A 1RF1B 4RJTA 1VQ9P 2WSEJ 3M9BA 2E74B 2KUBA 3AE6C 1SLQA 2XDJA 2Q6QA 2H88C 5CCHC 2WSCJ 2ZXEB 1OFCX 3BCCD 4H13D 4ZKPA 3B5ND 2WMMA 4A7PA 4U3FJ 4EOTA 4O9BA 5TJHA 2ZAEB 1PFIA 2M0BA 3A0BE 2BCCE 5H2FH 4H0LD 3LIDA 4Y99C 1S4XA 3B71A 3H1LJ 1YI2P 1HF9A 2QSIA 3E1RA 5TISE 1SQQD 3CCQP 2O01J 3PH0A 1JY3N 2NPSA 3L73J 1ZLLA 1YJNP 1LNQA 4W7YA 2OTLP 3O6QA 1AQTA 5M1BA 2YNYA 3H1KJ 1EZVD 3HUSA 1VQNP 3AEGC 4XE5B 1BE3G 3E1IA 2RN0A 1L0NJ 2H7HA 3GHGA 3T97B 1RE3A 3L75G 2I1KA 1NU1K 1R5LA 3R4YA 3TNUA 1S72P 2P10A 1LTJC 3RL0g 3AEFC 3MIWA 2E76D 4Y99B 3QH9A 2JWDA 3D6YA 3M06A 2IBZG 1FAVA 2HYNA 2AXTH 2YMYA 3MTUE 1OWAA 5CCGA 3A7OA 1U7MA 4C7NA 3CXHD 2KLVA 3V4QA 1HBWA 1OW7A 1CI6B 3RBZA 5KLVK 1NO4A 1PGOA 4TT3H 3KZIE 2Q5UA 2K88A 2C0WA 5CBNA 3CC7P 1NOHA 1QL2A 2AEFA 3SSUA 2OYHA 4L74A 4U3FG 1VQ5P 1X79B 2K9JB 2R3CA 1LTJB 3EFFK 3H32B 1BSNA 2IX7C 1S5LH 1T3UA 3VMYA 3P32A 1EZVI 5BU5A 1GL2A 3H1LG 2POHA 2WPQA 3TGUE 1EDKA 2IZ0A 4UB6E 3RGUA 1GZLA 3PJSK 1ZR4A 1OXZA 3V4WA 1ZW0A 2OYIA 4R4LA 4C46A 2C9LY 2LKMA 1SQXD 1GDTA 2W6JH 2M5AA 2R3SA 1HTLC 3CCRP 1T6AA 5KJ7A 5GTHH 2YO2A 2J59M 3H1KG 4WBAA 3I5CA 1M1JC
chains in the Genus database with same CATH topology
3M9QA 4HYTB 4AQRD 1SFCD 1KILA 3MUDA 1GK6A 3IFMA 4LC1A 3VMZA 2R5BA 1N73A 5CJ4A 4JF7A 1FU1A 2WSCH 1N2DC 1GU5A 4GIFA 2I1JA 2FYUK 5AVRB 1ZV8A 1AQ5A 1G1IA 1LWUB 2KOGA 5APUA 2NPSC 4IFMA 1URQB 3M0DC 3EFGA 1SVFA 1XTGB 3VP8A 3V2QA 3T97A 1LTAC 4KHXA 3RK2D 1HWTC 2P1JA 5APTA 1L4AC 3B5NC 3NTNA 2A45I 1KFNA 2XV5A 1N7SB 1LTGC 2WITA 2XKMA 3HUSC 2JJLA 1J1EB 1FOSF 1EQ7A 1GK4A 1NKNA 3P7KA 1FZFA 3L37A 3P8CE 1DH3A 1G1JA 2M3BA 4N78E 2WWWA 3GHGC 3MGNA 1RE3C 2A45G 1MV8A 3V2PA 3LIEA 3IR9A 3M91A 2VRSA 5AVQB 1LT9A 1SQVK 1GW4A 1SFCA 1JY2O 2O01H 3P8MC 1URQA 3U1CA 1JY3P 1M1JB 2Q9IA 5APXA 4DZOA 5KJ7D 3CLQA 3NMDA 3HTKB 4B86A 5AVTB 1CI6A 1JY3O 3HE5A 1KILD 2Z4EA 1AFOA 1T8ZA 3VYIA 2WSFH 3KQGA 5CCGC 4C7RA 3O8ZA 1SQPK 1M7LA 3HD7A 2NPSB 3TSIA 1HGZA 3P8CD 5AVWB 2GUSA 4GKGA 4N78D 1JUNA 1NH4A 2WTYA 2XNXA 2Z5IA 1WT6A 3B5NB 3OAKA 1IO4A 1QL1A 1T2KC 1LGHB 3N4XA 1DX7A 3HUSB 1RE4A 3H6PA 1LTJA 2GUVA 3GHGB 4WY4C 1FZCA 1HUCA 3H32A 3L36A 1FDMA 3BRTB 5APVA 3SWYA 2P2UA 1ZR2A 2KP8A 3TNUB 1RF1C 2KB7P 4ZKUA 3BRVB 2CPBA 4AYCA 4LGDE 3M0DA 1KFMA 1JOCA 2FFDA 2OARA 2WSEH 4DOJA 4I6MC 2O1JA 3VN0A 1CZQA 1IFJA 3TYYA 3B5NA 4JYBA 3CI9A 1URQD 1Z56A 5AW2B 3RK3C 1A02J 1NAFA 2XZRA 3RL0C 1J1DC 4M3LA 3NXSA 3V5BA 1KQLA 1JCDA 1YYCA 1H8AA 1GL2C 2P7JA 1G2CB 5AVZB 5AW6B 1NTZK 5AW3B 3V2RA 2FYZA 1IFDA 2WT7A 2HPCB 5APWA 3A2AA 4C7NB 2HODB 1WRGA 1N7LA 2OYIC 3M9HA 1T3JA 1FOSE 1JTHA 5AVYB 3MD0A 5AW0B 3HD7D 1ZN5A 2HLOA 2IPPA 1MZ9A 1LTSC 1SQQK 5CMZA 4IFFA 2HG5D 2R32A 1HVVA 4WY4B 5KJ7C 2Q3IA 3NFQA 2J58A 2Q7CA 2WZ7A 1LTBC 1RF0C 2YO3A 4W7ZA 1LTTC 5AW8B 1NHLA 2W6BA 1G2CA 5BVZA 1KZUB 1JNMA 3PP5A 3U59A 1LWUA 2QM7A 1RF1B 2C9NY 3M9BA 1MFZA 2N1TC 3L4FA 5APQA 1SLQA 2XDJA 1N73C 4I2LC 1HGVA 2NPSD 2C0XA 3RK3B 5CCHC 1FZGA 3RL0B 1J1DB 1N7SA 2ZXEB 4HH2A 5BU8B 1GL2B 3CL3D 2KYVA 1VDFA 4ZKPA 3B5ND 1FBMA 5CHXA 4EOTA 4O9BA 3OA7A 3OJAB 2FXMA 1L0NK 2OYIB 3II6A 1FZAA 3UIAA 2E42A 4N6JA 1SQBK 1JCCA 1S9KE 4I1LA 2KSJA 2BASA 3A3YB 1PFIA 1L4AB 1RY3A 1H89A 1M1JA 3V2NA 1X9VA 3HE4B 1NKZB 4Y99C 3LIDA 1JY2N 3N7NA 1SP4A 3LW5H 3A5TA 3HTKA 2E43A 2YKOA 1LT9C 1SFCC 5AW9B 2YKPA 4N3YB 4XA4A 3EQ2A 1NWQA 1MUUA 2OYHC 2N1TB 2QM8A 1IJDB 1JY3N 2NPSA 2L5GB 1ZLLA 1LTIC 5CCGD 5AW4B 2YKQA 4W7YA 2Z5HA 1X8YA 1GTWA 1L4AA 3VTPC 2A45H 2YNYA 2IFNA 2O1KA 1JMMA 3HUSA 4XE5B 3RK2C 3HD7C 1S9KD 2N9BA 3E1IA 3M0AA 3KPEA 1N86A 2H7HA 3GHGA 1RF0A 2XU6A 1RE3A 3VMXA 1IFNA 1N7SD 2I1KA 1FJKA 1NU1K 4WY4D 1JO5A 2N1TA 1RE4C 3TNUA 1FZEA 4RESB 2ZFCA 1LTJC 2CPSA 4GT1A 3MIWA 1FZCC 4Y99B 3G3ZA 1FJPA 5CCHA 3M06A 1VPCA 4OH8B 1FAVA 2HYNA 1YTZT 2MJZA 1LT9B 2YMYA 1SFCB 2H8PD 3MTUE 2PAJA 2FFDC 1OWAA 3RK3D 5CCGA 5KTBA 3RL0D 2OYHB 3KDPB 3A7OA 3L35A 1HJBA 1GL2D 1KILC 1SQXK 4C7NA 2HPCA 2HODA 2KLVA 4IFDK 2H43A 1NTKK 3V4QA 5AW1B 1HBWA 1JY2P 1CI6B 3HE5B 3BATA 2WPRA 5KLVK 2W6AA 1NO4A 3RK2B 1XTCC 1HH0A 2IFMA 3HD7B 1IK9A 1CW5A 2GM4A 1IC2A 2Q5UA 2C0WA 2FKWB 1L4AD 2JEEA 4WY4A 2M8RA 4WB4A 1NOHA 3VOPA 1IFMA 1J2JB 1QL2A 3C9IA 2PP6A 2OYHA 1RF1A 1GU4A 1X79B 3KYQA 2R3CA 1LTJB 5AVVB 3B8EB 4JYCA 5AVUB 1IFIA 1FZCB 3H32B 2N1TD 2IX7C 5AW7B 2HFED 3VMYA 1T3UA 3WMM0 3P32A 1DEBA 1LWUC 4AUWA 2W27A 5BU5A 1GL2A 1URQC 2POHA 2WPQA 2FFDB 1GW3A 5CCHD 1L0LK 2R5DA 5AVXB 3BASA 1GZLA 1YTZI 1W2EA 1KILB 2P67A 1ZR4A 1OXZA 1FZBA 3V4WA 1CSBA 3R2PA 5AW5B 1E5WA 1N7SC 2OYIA 1N73B 1J1EC 4C46A 1NTMK 2C9LY 2WPSA 2LKMA 5AVSB 3SWFA 1GDTA 1H88A 3HE4A 5CJ0A 3TK1A 2WT7B 1GD2E 3U1AA 1HTLC 3HRNA 5KJ7A 5APSA 4LLHA 2YO2A 1A02F 2J59M 1T2KD 3VP9A 1JTHB 4WBAA 5APYA 3BVHA 3I5CA 1M1JC 4W80A 4EIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYT B;  4AQR D;  3KDP B;  3A7O A;  3L35 A;  4EOT A;  1HJB A;  1GK6 A;  1HUC A;  4LC1 A;  4C7N A;  3L36 A;  3VMZ A;  2R5B A;  5APV A;  3V4Q A;  2P2U A;  5AW1 B;  1GU5 A;  3UIA A;  2E42 A;  1HBW A;  1CI6 B;  3HE5 B;  5AVR B;  2KP8 A;  3TNU B;  1S9K E;  2BAS A;  3A3Y B;  4AYC A;  2WPR A;  3M0D A;  2W6A A;  5APU A;  1H89 A;  3HE4 B;  3LID A;  2Q5U A;  4I6M C;  3VN0 A;  1CZQ A;  1SP4 A;  3T97 A;  3TYY A;  4KHX A;  3A5T A;  4JYB A;  3HTK A;  1HWT C;  1J2J B;  5APT A;  5AW2 B;  2E43 A;  1A02 J;  1NAF A;  2XZR A;  3NTN A;  4M3L A;  3NXS A;  3V5B A;  1KQL A;  2XV5 A;  1YYC A;  1H8A A;  5AW9 B;  2JJL A;  1FOS F;  2P7J A;  1GK4 A;  1G2C B;  3P7K A;  5AVZ B;  5AW6 B;  1GU4 A;  3L37 A;  1DH3 A;  1NWQ A;  1MUU A;  2R3C A;  2QM8 A;  2WWW A;  5AVV B;  5AW3 B;  3B8E B;  3MGN A;  4JYC A;  5AVU B;  2WT7 A;  5APW A;  3A2A A;  4C7N B;  1MV8 A;  5AW4 B;  3LIE A;  5AW7 B;  3IR9 A;  2Z5H A;  2VRS A;  3M91 A;  5AVQ B;  3VMY A;  3M9H A;  1X8Y A;  3P32 A;  1GTW A;  1FOS E;  3VTP C;  5AVY B;  3MD0 A;  5AW0 B;  3P8M C;  2YNY A;  4AUW A;  2IPP A;  2W27 A;  4XE5 B;  5APX A;  2WPQ A;  5CMZ A;  4DZO A;  1S9K D;  2N9B A;  3NMD A;  2R5D A;  3M0A A;  5AVX B;  2H7H A;  1GZL A;  2R32 A;  2XU6 A;  2Q3I A;  3NFQ A;  3VMX A;  2Q7C A;  2P67 A;  2YO3 A;  1OXZ A;  3V4W A;  5AW8 B;  1CSB A;  4B86 A;  5AW5 B;  5AVT B;  3HE5 A;  1CI6 A;  4C46 A;  1JNM A;  3TNU A;  3VYI A;  2QM7 A;  2C9N Y;  3KQG A;  2C9L Y;  2WPS A;  2ZFC A;  3M9B A;  1MFZ A;  4RES B;  3O8Z A;  4GT1 A;  5AVS B;  3SWF A;  1H88 A;  3HE4 A;  5APQ A;  3TK1 A;  2WT7 B;  1GD2 E;  1SLQ A;  5AVW B;  4GKG A;  4I2L C;  1JUN A;  3M06 A;  5APS A;  2YO2 A;  1FAV A;  1A02 F;  2WTY A;  1T2K D;  2Z5I A;  3OAK A;  1IO4 A;  5APY A;  2ZXE B;  1T2K C;  3I5C A;  1OWA A; 
#chains in the Genus database with same CATH topology
 3M9Q A;  4AQR D;  4D6T E;  5B66 E;  2K37 A;  1GK6 A;  1VQM P;  1S2E A;  3CC4 P;  3VMZ A;  3H1H J;  1FU1 A;  2V7Q J;  5AVR B;  1L0L J;  3F89 A;  4IFM A;  3M0D C;  3VP8 A;  2KSE A;  1M56 D;  4EI2 A;  2AXC A;  1KIL E;  1L4A C;  3NTN A;  1RQV A;  2A45 I;  2ZT9 D;  3WU2 H;  2XKM A;  1E79 H;  1FOS F;  1GK4 A;  1FZF A;  1G1J A;  1OIP A;  4N78 E;  3MGN A;  3CCJ P;  2QA4 P;  3L74 D;  3LIE A;  1NTM D;  1PGQ A;  5AVQ B;  1GW4 A;  1SFC A;  2KZJ A;  1URQ A;  3AE4 C;  3U1C A;  1M1J B;  3GF7 A;  5KJ7 D;  3L70 J;  3HTK B;  1Y9B A;  3H25 A;  1K9M Q;  3HE5 A;  1P84 H;  3VYI A;  3KQG A;  1SQP K;  3HD7 A;  1IK7 A;  3L71 J;  1H0T A;  3WUT A;  3P8C D;  1EXI A;  2GUS A;  1JUN A;  2WTY A;  3L72 J;  1IO4 A;  3L73 E;  1LGH B;  3N4X A;  2FXO A;  1RE4 A;  2QEX P;  3H6P A;  1UII A;  3CXH H;  1FZC A;  1HUC A;  1SQV J;  2PGD A;  3BRT B;  4Y28 J;  1L0N E;  2FY8 A;  4ZKU A;  3SFD C;  2CPB A;  3K5B A;  2E75 D;  1JOC A;  3AE7 C;  2WPV B;  3VN0 A;  3QWO C;  3AEA C;  2Y0C A;  1URQ D;  1Z56 A;  5AW2 B;  3RK3 C;  2BEQ D;  1NAF A;  1RHZ B;  3RL0 C;  1J1D C;  1D7M A;  4EDF A;  2P7J A;  2SPZ A;  1G2C B;  5AVZ B;  5AW6 B;  2RMZ A;  2FYZ A;  3H1H G;  5APW A;  2HOD B;  3USS A;  1BE3 D;  3CCL P;  1L0L G;  1N7L A;  3BCC E;  1T3J A;  1VQP P;  4GOF A;  5AVY B;  5L8R J;  3L75 D;  3HD7 D;  4OVN F;  4IFF A;  2R32 A;  1W2B O;  3NFQ A;  1RF0 C;  1KB9 D;  1NHL A;  4ASV A;  4L76 A;  1JNM A;  3PP5 A;  2IBZ D;  1LWU A;  2C9N Y;  2N1T C;  3L4F A;  5CBO A;  1N73 C;  1NAY A;  1VQ7 P;  1NTZ J;  3RK3 B;  2P58 A;  3RL0 B;  1J1D B;  1N7S A;  4HH2 A;  2IZ1 A;  3PHL A;  5DJT B;  2KYV A;  1VDF A;  1EDJ A;  3L70 G;  4DT0 A;  5TIS H;  1KYO D;  2CK3 H;  3OJA B;  1EZV E;  1NJI Q;  4N6J A;  2B9B A;  1VQ6 P;  3WUV A;  1KN7 A;  3L71 G;  4PJ0 E;  2QVA A;  1RY3 A;  1H89 A;  3V2N A;  1NKZ B;  4U3F D;  3L72 G;  1OW6 A;  1LT9 C;  2DW3 A;  4RO0 A;  1NTK J;  2YKP A;  2G8Y A;  4XA4 A;  3EQ2 A;  2A06 G;  1SQV G;  2N1T B;  2QM8 A;  1VQ8 P;  1JEK A;  2KXP B;  3H1L D;  1ZXG A;  1GTW A;  1AA0 A;  1YIT P;  3RK2 C;  1KD1 Q;  3L75 J;  2N9B A;  3M0A A;  1N7S D;  1KB9 I;  3CX5 I;  4WY4 D;  2IBZ I;  3H1K D;  2CPS A;  2D2C D;  1L0N D;  2NZ2 A;  3G6E P;  3GG2 A;  1FJP A;  5CCH A;  3CCE P;  2KNC B;  1VPC A;  2Y9Z A;  1YTZ T;  3KZI H;  1Q2N A;  1LT9 B;  3SFE C;  2H8P D;  2PAJ A;  5KTB A;  2B87 B;  2K3R A;  3L35 A;  3CCU P;  4IFD K;  1NTK K;  2ZYG A;  5AW1 B;  4PD4 D;  1PP9 J;  3RK2 B;  1M57 D;  1NU1 J;  1NTZ G;  1AV1 A;  4H0L C;  2QJK C;  1IFM A;  1J2J B;  4UB6 H;  1SQX E;  1EDI A;  1YJW P;  1OVU A;  3KYQ A;  3B8E B;  1IFI A;  1IFP A;  3TDK A;  3CCM P;  3S4R A;  1VF5 C;  1NYH A;  1YBK A;  1SQV E;  4AUW A;  2W27 A;  5CCH D;  1BCC J;  1W2E A;  1NTK G;  5KLV J;  5B66 H;  3JCU E;  2K9J A;  1J1E C;  1BDD A;  1USE A;  5AVS B;  4RKU J;  3CCS P;  3HE4 A;  3U1A A;  2E76 C;  4H0L B;  1T2K D;  2QJK B;  1USD A;  5APY A;  3Q5P A;  4BRY B;  1KYO H;  4W80 A;  4EIJ A;  4HYT B;  1PIX A;  3L74 E;  1NTM E;  3MUD A;  3IFM A;  4LC1 A;  5CJ4 A;  4JF7 A;  1VF5 B;  1BGY J;  2WSC H;  1N2D C;  2I1J A;  2FYU K;  4PD4 I;  1G1I A;  1EC5 A;  5APU A;  3TF5 A;  4EYY Q;  2NPS C;  1KQF B;  1LTA C;  1HWT C;  2OYO A;  3H1H D;  1S5L X;  1VQL P;  1LTG C;  3HUS C;  2UWJ E;  1J1E B;  1L0L D;  3P7K A;  5E79 H;  3P8C E;  1LP1 A;  1NTZ E;  3GHG C;  1RE3 C;  1Y8A A;  3AE5 C;  3GLM A;  4HB1 A;  1MV8 A;  2PFX A;  3V2P A;  2E76 B;  3M91 A;  2VRS A;  1DEE G;  1PP9 G;  2O01 H;  2OQQ A;  1NU1 G;  1JY3 P;  4DJG A;  2Q3E A;  4PV1 D;  1QLE D;  4B86 A;  5AVT B;  3I55 P;  1JY3 O;  5CCG C;  3V6I A;  4C7R A;  3O8Z A;  1M7L A;  2NPS B;  1HGZ A;  2E5Y A;  3L70 D;  2Z5I A;  1WT6 A;  1Q90 D;  4BXL A;  4IOI H;  2KS1 A;  3HUS B;  1BCC G;  2K1A A;  1BE3 E;  2GUV A;  3GHG B;  3L71 D;  5KAF E;  4DCK A;  5KLV G;  4R4M A;  5APV A;  3L75 E;  4NPF X;  3G71 P;  2P2U A;  4XFJ A;  3AED C;  3L72 D;  1ZR2 A;  3TNU B;  1OVV A;  5K5G B;  3M0D A;  1KFM A;  2FFD A;  2OAR A;  1KB9 E;  3AE8 C;  4I6M C;  3CX5 E;  1YJ9 P;  2A06 D;  3TYY A;  1SQV D;  1X22 A;  2IBZ E;  3E7K A;  1SQP J;  3V5B A;  1KQL A;  4H44 C;  1GL2 C;  3Q2Y A;  2O01 N;  1BGY G;  2WT7 A;  3A2A A;  4C7N B;  1KTM A;  2OYI C;  1PGP A;  1JTH A;  2Y0D A;  1KYO E;  2HLO A;  1LTS C;  1KC8 Q;  1SQQ K;  3CWB G;  1HVV A;  2V4H A;  5KJ7 C;  2J58 A;  2WZ7 A;  1LTB C;  2YO3 A;  1G2C A;  5BVZ A;  1KZU B;  1MKM A;  4U3F E;  3AE3 C;  2OTJ P;  3S9O A;  5APQ A;  4KJM A;  4OGQ C;  4TLF A;  4PJ0 H;  4I2L C;  1HGV A;  1OW8 A;  1FZG A;  2W90 A;  2G3A A;  5BU8 B;  4H44 B;  5E79 E;  1GL2 B;  3Q5R A;  4YXD C;  3H1L E;  5CHX A;  3D71 A;  2Q1K A;  1K8A Q;  2FXM A;  1ZOY C;  1DD3 A;  2OYI B;  3UIA A;  1NTZ D;  2YMK A;  2E42 A;  5KLI C;  1S3J A;  1SQB K;  1JCC A;  2KSJ A;  3A3Y B;  1L4A B;  3PTZ A;  5KLV E;  1X9V A;  1NVO A;  1YHQ P;  2QIW A;  1JY2 N;  3N7N A;  3LW5 H;  3A5T A;  2YKO A;  3PLN A;  1SFC C;  3H1K E;  5AW9 B;  2K9Y A;  2W8Z A;  1PPJ G;  3W68 A;  3CC2 P;  1NWQ A;  2BCC J;  2L5G B;  4OGQ B;  2YKQ A;  2Z5H A;  3RBX A;  2MKV A;  2A45 H;  1NTK D;  2IFN A;  1JMM A;  2WSF J;  3HD7 C;  3PRJ A;  1S9K D;  1BDC A;  4GOE A;  3KPE A;  1RF0 A;  2XU6 A;  1SQP G;  1IFN A;  2YXR B;  3VMX A;  4PD4 E;  2JDI H;  1JMB A;  2N1T A;  1JO5 A;  1SQB G;  1RE4 C;  5KLI B;  1QX8 A;  1FZE A;  4RES B;  4GT1 A;  1VQ4 P;  1HJ0 A;  1KQG B;  1FZC C;  2YIU C;  4GDO A;  1M8O B;  4OH8 B;  2MJZ A;  4BWN A;  1WMK A;  2W83 C;  1SFC B;  3WUU A;  3CX5 D;  3RK3 D;  4CPG A;  3RL0 D;  3KDP B;  1KIL C;  2HPC A;  1SQX K;  1MFT A;  3H1I G;  3ITK A;  3W67 A;  1JY2 P;  2L91 A;  3HE5 B;  3BAT A;  3SWK A;  1ZME C;  1HH0 A;  2IFM A;  3HD7 B;  1IK9 A;  1H0T B;  2KNC A;  3IAO A;  1JM0 A;  2FKW B;  2JEE A;  4WY4 A;  3VOP A;  2M8R A;  3JSV C;  4WB4 A;  3C9I A;  1RF1 A;  1PP9 D;  3JCU H;  2ZYA A;  5AVV B;  4JYC A;  1FZC B;  1NU1 D;  2JKV A;  2WVR A;  2N1T D;  2YIU B;  1DD4 A;  5AW7 B;  2HFE D;  1Y47 A;  1DEB A;  1LWU C;  2ZJS E;  1FE6 A;  1GW3 A;  1EDL A;  1KIL B;  1FZB A;  3R2P A;  1E5W A;  1N7S C;  1OX3 A;  1N73 B;  1NTM K;  2WPS A;  2BCC G;  1M1K Q;  3SWF A;  1H88 A;  5CJ0 A;  1BCC D;  3H1H E;  3TGU J;  2RKL A;  1FC2 C;  1A02 F;  1L0L E;  5KLV D;  4NPD A;  1PV3 A;  4HJG H;  3BVH A;  1TU3 F;  2FYN C;  2N9Y B;  2GM4 A;  2LXC B;  3S1K A;  2J5U A;  1LWU B;  2E74 D;  3ABV C;  4L73 A;  1AVO A;  1SVF A;  3VMA A;  3V2Q A;  3T97 A;  1N8R Q;  4KHX A;  4H13 C;  3RK2 D;  3B5N C;  1BGY D;  1N7S B;  1OMI A;  2WIT A;  1QVF O;  2JJL A;  4WWI A;  1EQ7 A;  1NKN A;  5B5E E;  1KMI Z;  3EWK A;  3L37 A;  1ZRT E;  1GMJ A;  3L70 E;  2QRX A;  2B89 A;  4OWF A;  1RQU A;  3CWB D;  2LXB A;  4I7Z C;  3FGA D;  2FYN B;  3L71 E;  1Q86 Q;  4DZO A;  3NMD A;  2FYU J;  3L72 E;  4UB8 H;  5KAF H;  1FDO A;  1CI6 A;  2Z4E A;  3H1J J;  5KKZ C;  1AFO A;  1T8Z A;  2KI7 B;  1S1C X;  2I8D A;  4JQ0 D;  2A06 E;  1Q81 Q;  2QJP C;  2H89 C;  3CPW O;  3ZDM A;  4GKG A;  1Q82 Q;  4H13 B;  1NH4 A;  4KT0 J;  2XNX A;  1KB9 H;  3CX5 H;  3B5N B;  4U7J A;  3IF4 A;  1T2K C;  2WSS H;  1DX7 A;  2QJY C;  1LTJ A;  1AJY A;  3C8V A;  3H32 A;  3L36 A;  3SWY A;  2KIK A;  2YXQ B;  3MHV A;  2KP8 A;  3AE9 C;  2KB7 P;  3BRV B;  1VF5 D;  4I7Z B;  4AYC A;  4MN4 C;  4LGD E;  1OZH A;  3TGU G;  2WSE H;  4DOJ A;  2O1J A;  1Q7Y Q;  1PPJ D;  1IFJ A;  4JYB A;  2IDB A;  1A02 J;  4M3L A;  2ZVN B;  1JCD A;  1H8A A;  5KKZ B;  2JR8 A;  1FS0 E;  5AW3 B;  3KHU A;  3V2R A;  3A0H E;  1IFD A;  1PGJ A;  1R5S A;  2QJP B;  2QG4 A;  1JB0 J;  1NGM B;  1FOS E;  1P84 D;  4IL6 E;  1SQP D;  3MD0 A;  5AW0 B;  1PZQ A;  3CWB J;  2AEM A;  1LJ2 A;  2QJY B;  5CMZ A;  4D6T G;  1SQB D;  1DIP A;  5KAI H;  3F5H A;  2HG5 D;  2Q3I A;  4W7Z A;  4PV1 C;  5AW8 B;  1QGK B;  2QE7 H;  3BCC J;  3GF3 A;  2ITA A;  1MFZ A;  3MUD C;  2NPS D;  2C0X A;  2OGU A;  3H1I D;  2KZI A;  1PL5 A;  3CL3 D;  2FYU G;  3MZW B;  1FBM A;  5GTI H;  1BSH A;  2Y9Y A;  3OA7 A;  4K35 A;  3H1J G;  1NTK E;  1M90 Q;  1L0N K;  2ZXX A;  3GMA A;  3II6 A;  1FZA A;  1SQQ J;  1ZRT D;  2JO1 A;  2M3E A;  1S9K E;  4I1L A;  2BAS A;  3O6Q B;  1M1J A;  3HE4 B;  3AEE C;  1SP4 A;  4UB8 E;  3HTK A;  2E43 A;  2BEZ F;  4PV1 B;  4JPZ B;  1R8E A;  4N3Y B;  4PD4 H;  2R44 A;  1ZP0 C;  1K04 A;  1MUU A;  2ZYD A;  2OYH C;  1IJD B;  1L2P A;  1LTI C;  5CCG D;  5AW4 B;  2WQY C;  1X8Y A;  1P84 I;  1L4A A;  5H2F E;  3RK3 E;  3L73 G;  3VTP C;  2O1K A;  2FXP A;  4K3A A;  1N86 A;  2ZT9 C;  2BCC D;  1OVR A;  1SQB J;  3AEB C;  1FJK A;  1L0N G;  2LR2 A;  2OTK E;  2ZFC A;  2Y0E A;  1LP1 B;  3CXH I;  1U57 A;  3LW5 J;  2IYO A;  1QVG O;  3G3Z A;  1SS1 A;  3CCV P;  3FXD A;  1PP9 E;  3Q3D A;  2FFD C;  1NU1 E;  3H1I J;  1KQS O;  2OYH B;  4H44 D;  1HJB A;  1GL2 D;  2HOD A;  4NPE A;  2H43 A;  3BCC G;  3FX0 A;  1VQK P;  2FYU E;  1YQ4 C;  2WPR A;  2W6A A;  1XTC C;  5KAI E;  1CW5 A;  1IC2 A;  3H1J E;  2AXT E;  1L4A D;  2ZT9 B;  4GOD A;  3D6Z A;  3G9R A;  2PP6 A;  2KK7 A;  4Z1M H;  2KS1 B;  1GU4 A;  1BCC E;  5AVU B;  2E5T A;  4ZNC A;  1SQQ G;  3D70 A;  2E75 C;  2M5A B;  3WMM 0;  4OGQ D;  2V7Q H;  3CME P;  1SQX J;  2XND H;  4YXW H;  4L75 A;  5GTI E;  1URQ C;  5C39 A;  2HR3 A;  2FFD B;  1IZN B;  1L0L K;  2R5D A;  4JBZ A;  5AVX B;  3BAS A;  1YTZ I;  1K73 Q;  3B4S A;  2P67 A;  3Q5S A;  1CSB A;  1EZV G;  5AW5 B;  4YTP C;  4WVZ A;  1S5L E;  3CD6 P;  2GA1 A;  3TK1 A;  2WT7 B;  1GD2 E;  1BGY E;  3JC2 2;  1AVY A;  3HRN A;  2JWA A;  5APS A;  2JP3 A;  4LLH A;  3VP9 A;  5DJU B;  1JTH B;  1YIJ P;  3CMA P;  1SFC D;  1KIL A;  5B5E H;  3CWB E;  2R5B A;  3TGU D;  1N73 A;  1GU5 A;  2E75 B;  4GIF A;  1UIX A;  3C1L A;  1ZV8 A;  1AQ5 A;  2KOG A;  3AEC C;  5GTH E;  3G4S P;  1URQ B;  3EFG A;  1XTG B;  3AE2 C;  3L74 J;  1NTM J;  2P1J A;  2NRG A;  5APT A;  1VQO P;  1LT1 A;  1KFN A;  2XV5 A;  2O3J A;  1DH3 A;  2M3B A;  2WWW A;  1VL2 A;  3FWL A;  2A45 G;  4D6T D;  3IR9 A;  3MP7 B;  2FBW C;  1LT9 A;  1SQV K;  3P8M C;  1JY2 O;  2AEJ A;  2Q9I A;  3A0B H;  5APX A;  2B87 A;  3I56 P;  3IN6 A;  1SQQ E;  3CLQ A;  3KXD A;  3WU2 E;  2KLU A;  3AE1 C;  1K05 A;  1W5C E;  1KIL D;  1KOR A;  2WSF H;  4IL6 X;  1FDI A;  1PPJ E;  4HKZ H;  3TSI A;  5AVW B;  4ASW A;  4N78 D;  2FYU D;  2IYP A;  1U7J A;  1SQX G;  3OAK A;  1QL1 A;  3H1J D;  4WY4 C;  1KV4 A;  1P84 E;  1RH5 B;  1FDM A;  1SQP E;  1X0T A;  3A0H H;  3OW2 O;  2D2C C;  1RF1 C;  1SQB E;  1EXJ A;  2E74 C;  4IL6 H;  2PRR A;  1CZQ A;  1BE3 J;  3B5N A;  3CI9 A;  3FXE A;  3GW6 A;  2XZR A;  3FWN A;  3NXS A;  3CXH E;  1YYC A;  1NTZ K;  3L73 D;  1YQ3 C;  1QEX A;  2RH0 A;  2HPC B;  1WRG A;  4ZMD A;  3H1I E;  3M9H A;  4D6T J;  1ZN5 A;  3Q1M A;  2IPP A;  1MZ9 A;  2B88 A;  4BRY A;  4YPC A;  4QMA A;  3L74 G;  1NTM G;  2ZVO B;  4WY4 B;  5EFW B;  2Q7C A;  1LTT C;  2W6B A;  1KYO I;  3U59 A;  2D2C B;  2QM7 A;  1RF1 B;  4RJT A;  1VQ9 P;  2WSE J;  3M9B A;  2E74 B;  2KUB A;  3AE6 C;  1SLQ A;  2XDJ A;  2Q6Q A;  2H88 C;  5CCH C;  2WSC J;  2ZXE B;  1OFC X;  3BCC D;  4H13 D;  4ZKP A;  3B5N D;  2WMM A;  4A7P A;  4U3F J;  4EOT A;  4O9B A;  5TJH A;  2ZAE B;  1PFI A;  2M0B A;  3A0B E;  2BCC E;  5H2F H;  4H0L D;  3LID A;  4Y99 C;  1S4X A;  3B71 A;  3H1L J;  1YI2 P;  1HF9 A;  2QSI A;  3E1R A;  5TIS E;  1SQQ D;  3CCQ P;  2O01 J;  3PH0 A;  1JY3 N;  2NPS A;  3L73 J;  1ZLL A;  1YJN P;  1LNQ A;  4W7Y A;  2OTL P;  3O6Q A;  1AQT A;  5M1B A;  2YNY A;  3H1K J;  1EZV D;  3HUS A;  1VQN P;  3AEG C;  4XE5 B;  1BE3 G;  3E1I A;  2RN0 A;  1L0N J;  2H7H A;  3GHG A;  3T97 B;  1RE3 A;  3L75 G;  2I1K A;  1NU1 K;  1R5L A;  3R4Y A;  3TNU A;  1S72 P;  2P10 A;  1LTJ C;  3RL0 g;  3AEF C;  3MIW A;  2E76 D;  4Y99 B;  3QH9 A;  2JWD A;  3D6Y A;  3M06 A;  2IBZ G;  1FAV A;  2HYN A;  2AXT H;  2YMY A;  3MTU E;  1OWA A;  5CCG A;  3A7O A;  1U7M A;  4C7N A;  3CXH D;  2KLV A;  3V4Q A;  1HBW A;  1OW7 A;  1CI6 B;  3RBZ A;  5KLV K;  1NO4 A;  1PGO A;  4TT3 H;  3KZI E;  2Q5U A;  2K88 A;  2C0W A;  5CBN A;  3CC7 P;  1NOH A;  1QL2 A;  2AEF A;  3SSU A;  2OYH A;  4L74 A;  4U3F G;  1VQ5 P;  1X79 B;  2K9J B;  2R3C A;  1LTJ B;  3EFF K;  3H32 B;  1BSN A;  2IX7 C;  1S5L H;  1T3U A;  3VMY A;  3P32 A;  1EZV I;  5BU5 A;  1GL2 A;  3H1L G;  2POH A;  2WPQ A;  3TGU E;  1EDK A;  2IZ0 A;  4UB6 E;  3RGU A;  1GZL A;  3PJS K;  1ZR4 A;  1OXZ A;  3V4W A;  1ZW0 A;  2OYI A;  4R4L A;  4C46 A;  2C9L Y;  2LKM A;  1SQX D;  1GDT A;  2W6J H;  2M5A A;  2R3S A;  1HTL C;  3CCR P;  1T6A A;  5KJ7 A;  5GTH H;  2YO2 A;  2J59 M;  3H1K G;  4WBA A;  3I5C A;  1M1J C; 
#chains in the Genus database with same CATH homology
 3M9Q A;  4HYT B;  4AQR D;  1SFC D;  1KIL A;  3MUD A;  1GK6 A;  3IFM A;  4LC1 A;  3VMZ A;  2R5B A;  1N73 A;  5CJ4 A;  4JF7 A;  1FU1 A;  2WSC H;  1N2D C;  1GU5 A;  4GIF A;  2I1J A;  2FYU K;  5AVR B;  1ZV8 A;  1AQ5 A;  1G1I A;  1LWU B;  2KOG A;  5APU A;  2NPS C;  4IFM A;  1URQ B;  3M0D C;  3EFG A;  1SVF A;  1XTG B;  3VP8 A;  3V2Q A;  3T97 A;  1LTA C;  4KHX A;  3RK2 D;  1HWT C;  2P1J A;  5APT A;  1L4A C;  3B5N C;  3NTN A;  2A45 I;  1KFN A;  2XV5 A;  1N7S B;  1LTG C;  2WIT A;  2XKM A;  3HUS C;  2JJL A;  1J1E B;  1FOS F;  1EQ7 A;  1GK4 A;  1NKN A;  3P7K A;  1FZF A;  3L37 A;  3P8C E;  1DH3 A;  1G1J A;  2M3B A;  4N78 E;  2WWW A;  3GHG C;  3MGN A;  1RE3 C;  2A45 G;  1MV8 A;  3V2P A;  3LIE A;  3IR9 A;  3M91 A;  2VRS A;  5AVQ B;  1LT9 A;  1SQV K;  1GW4 A;  1SFC A;  1JY2 O;  2O01 H;  3P8M C;  1URQ A;  3U1C A;  1JY3 P;  1M1J B;  2Q9I A;  5APX A;  4DZO A;  5KJ7 D;  3CLQ A;  3NMD A;  3HTK B;  4B86 A;  5AVT B;  1CI6 A;  1JY3 O;  3HE5 A;  1KIL D;  2Z4E A;  1AFO A;  1T8Z A;  3VYI A;  2WSF H;  3KQG A;  5CCG C;  4C7R A;  3O8Z A;  1SQP K;  1M7L A;  3HD7 A;  2NPS B;  3TSI A;  1HGZ A;  3P8C D;  5AVW B;  2GUS A;  4GKG A;  4N78 D;  1JUN A;  1NH4 A;  2WTY A;  2XNX A;  2Z5I A;  1WT6 A;  3B5N B;  3OAK A;  1IO4 A;  1QL1 A;  1T2K C;  1LGH B;  3N4X A;  1DX7 A;  3HUS B;  1RE4 A;  3H6P A;  1LTJ A;  2GUV A;  3GHG B;  4WY4 C;  1FZC A;  1HUC A;  3H32 A;  3L36 A;  1FDM A;  3BRT B;  5APV A;  3SWY A;  2P2U A;  1ZR2 A;  2KP8 A;  3TNU B;  1RF1 C;  2KB7 P;  4ZKU A;  3BRV B;  2CPB A;  4AYC A;  4LGD E;  3M0D A;  1KFM A;  1JOC A;  2FFD A;  2OAR A;  2WSE H;  4DOJ A;  4I6M C;  2O1J A;  3VN0 A;  1CZQ A;  1IFJ A;  3TYY A;  3B5N A;  4JYB A;  3CI9 A;  1URQ D;  1Z56 A;  5AW2 B;  3RK3 C;  1A02 J;  1NAF A;  2XZR A;  3RL0 C;  1J1D C;  4M3L A;  3NXS A;  3V5B A;  1KQL A;  1JCD A;  1YYC A;  1H8A A;  1GL2 C;  2P7J A;  1G2C B;  5AVZ B;  5AW6 B;  1NTZ K;  5AW3 B;  3V2R A;  2FYZ A;  1IFD A;  2WT7 A;  2HPC B;  5APW A;  3A2A A;  4C7N B;  2HOD B;  1WRG A;  1N7L A;  2OYI C;  3M9H A;  1T3J A;  1FOS E;  1JTH A;  5AVY B;  3MD0 A;  5AW0 B;  3HD7 D;  1ZN5 A;  2HLO A;  2IPP A;  1MZ9 A;  1LTS C;  1SQQ K;  5CMZ A;  4IFF A;  2HG5 D;  2R32 A;  1HVV A;  4WY4 B;  5KJ7 C;  2Q3I A;  3NFQ A;  2J58 A;  2Q7C A;  2WZ7 A;  1LTB C;  1RF0 C;  2YO3 A;  4W7Z A;  1LTT C;  5AW8 B;  1NHL A;  2W6B A;  1G2C A;  5BVZ A;  1KZU B;  1JNM A;  3PP5 A;  3U59 A;  1LWU A;  2QM7 A;  1RF1 B;  2C9N Y;  3M9B A;  1MFZ A;  2N1T C;  3L4F A;  5APQ A;  1SLQ A;  2XDJ A;  1N73 C;  4I2L C;  1HGV A;  2NPS D;  2C0X A;  3RK3 B;  5CCH C;  1FZG A;  3RL0 B;  1J1D B;  1N7S A;  2ZXE B;  4HH2 A;  5BU8 B;  1GL2 B;  3CL3 D;  2KYV A;  1VDF A;  4ZKP A;  3B5N D;  1FBM A;  5CHX A;  4EOT A;  4O9B A;  3OA7 A;  3OJA B;  2FXM A;  1L0N K;  2OYI B;  3II6 A;  1FZA A;  3UIA A;  2E42 A;  4N6J A;  1SQB K;  1JCC A;  1S9K E;  4I1L A;  2KSJ A;  2BAS A;  3A3Y B;  1PFI A;  1L4A B;  1RY3 A;  1H89 A;  1M1J A;  3V2N A;  1X9V A;  3HE4 B;  1NKZ B;  4Y99 C;  3LID A;  1JY2 N;  3N7N A;  1SP4 A;  3LW5 H;  3A5T A;  3HTK A;  2E43 A;  2YKO A;  1LT9 C;  1SFC C;  5AW9 B;  2YKP A;  4N3Y B;  4XA4 A;  3EQ2 A;  1NWQ A;  1MUU A;  2OYH C;  2N1T B;  2QM8 A;  1IJD B;  1JY3 N;  2NPS A;  2L5G B;  1ZLL A;  1LTI C;  5CCG D;  5AW4 B;  2YKQ A;  4W7Y A;  2Z5H A;  1X8Y A;  1GTW A;  1L4A A;  3VTP C;  2A45 H;  2YNY A;  2IFN A;  2O1K A;  1JMM A;  3HUS A;  4XE5 B;  3RK2 C;  3HD7 C;  1S9K D;  2N9B A;  3E1I A;  3M0A A;  3KPE A;  1N86 A;  2H7H A;  3GHG A;  1RF0 A;  2XU6 A;  1RE3 A;  3VMX A;  1IFN A;  1N7S D;  2I1K A;  1FJK A;  1NU1 K;  4WY4 D;  1JO5 A;  2N1T A;  1RE4 C;  3TNU A;  1FZE A;  4RES B;  2ZFC A;  1LTJ C;  2CPS A;  4GT1 A;  3MIW A;  1FZC C;  4Y99 B;  3G3Z A;  1FJP A;  5CCH A;  3M06 A;  1VPC A;  4OH8 B;  1FAV A;  2HYN A;  1YTZ T;  2MJZ A;  1LT9 B;  2YMY A;  1SFC B;  2H8P D;  3MTU E;  2PAJ A;  2FFD C;  1OWA A;  3RK3 D;  5CCG A;  5KTB A;  3RL0 D;  2OYH B;  3KDP B;  3A7O A;  3L35 A;  1HJB A;  1GL2 D;  1KIL C;  1SQX K;  4C7N A;  2HPC A;  2HOD A;  2KLV A;  4IFD K;  2H43 A;  1NTK K;  3V4Q A;  5AW1 B;  1HBW A;  1JY2 P;  1CI6 B;  3HE5 B;  3BAT A;  2WPR A;  5KLV K;  2W6A A;  1NO4 A;  3RK2 B;  1XTC C;  1HH0 A;  2IFM A;  3HD7 B;  1IK9 A;  1CW5 A;  2GM4 A;  1IC2 A;  2Q5U A;  2C0W A;  2FKW B;  1L4A D;  2JEE A;  4WY4 A;  2M8R A;  4WB4 A;  1NOH A;  3VOP A;  1IFM A;  1J2J B;  1QL2 A;  3C9I A;  2PP6 A;  2OYH A;  1RF1 A;  1GU4 A;  1X79 B;  3KYQ A;  2R3C A;  1LTJ B;  5AVV B;  3B8E B;  4JYC A;  5AVU B;  1IFI A;  1FZC B;  3H32 B;  2N1T D;  2IX7 C;  5AW7 B;  2HFE D;  3VMY A;  1T3U A;  3WMM 0;  3P32 A;  1DEB A;  1LWU C;  4AUW A;  2W27 A;  5BU5 A;  1GL2 A;  1URQ C;  2POH A;  2WPQ A;  2FFD B;  1GW3 A;  5CCH D;  1L0L K;  2R5D A;  5AVX B;  3BAS A;  1GZL A;  1YTZ I;  1W2E A;  1KIL B;  2P67 A;  1ZR4 A;  1OXZ A;  1FZB A;  3V4W A;  1CSB A;  3R2P A;  5AW5 B;  1E5W A;  1N7S C;  2OYI A;  1N73 B;  1J1E C;  4C46 A;  1NTM K;  2C9L Y;  2WPS A;  2LKM A;  5AVS B;  3SWF A;  1GDT A;  1H88 A;  3HE4 A;  5CJ0 A;  3TK1 A;  2WT7 B;  1GD2 E;  3U1A A;  1HTL C;  3HRN A;  5KJ7 A;  5APS A;  4LLH A;  2YO2 A;  1A02 F;  2J59 M;  1T2K D;  3VP9 A;  1JTH B;  4WBA A;  5APY A;  3BVH A;  3I5C A;  1M1J C;  4W80 A;  4EIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...