3SWFA

Cnga1 621-690 containing clz domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
GLEEKVTRMESSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFLKPLIDTEFSAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism for 3:1 subunit stoichiometry of rod cyclic nucleotide-gated ion channels.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transport protein
molecule keywords cGMP-gated cation channel alpha-1
total genus 23
structure length 56
sequence length 56
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3swfA00
3LIDA 2VRSA 1MV8A 5AVTB 5AW7B 3NXSA 3HE4B 3M0AA 3HE4A 3VN0A 1CZQA 5AVWB 2WTYA 4I2LC 5APWA 3NMDA 2C9NY 3V5BA 2R5BA 3P32A 3M9HA 2C9LY 1HUCA 2E42A 3VMXA 2ZXEB 2XV5A 5AW2B 3TNUA 2WPQA 3HTKA 3A5TA 5AW8B 2XZRA 2QM7A 4RESB 1JUNA 1SP4A 5AW9B 4I6MC 2KP8A 1FOSE 3B8EB 5AVSB 2P7JA 3KDPB 2WPRA 3V4WA 5APXA 3A2AA 4DZOA 3VTPC 2WWWA 2N9BA 3LIEA 3OAKA 2QM8A 3V4QA 1S9KD 1H89A 5AVVB 3P7KA 5CMZA 2Q7CA 1GTWA 3NTNA 4KHXA 2R3CA 1CSBA 2Q5UA 4HYTB 4EOTA 1HJBA 3A3YB 3IR9A 3P8MC 5AVZB 1CI6B 3SWFA 5AVUB 3VYIA 5AW4B 1DH3A 4LC1A 2ZFCA 3HE5A 2BASA 1OXZA 2E43A 5AVQB 4GT1A 3VMYA 2Z5IA 2YO3A 2XU6A 1HWTC 1MUUA 1NAFA 4AQRD 4C7NB 5AW3B 1MFZA 3T97A 2WT7A 3O8ZA 3NFQA 3M06A 5AVRB 5AW5B 3MGNA 4JYCA 4AYCA 5APTA 2WT7B 1GZLA 4C7NA 5APYA 1H8AA 1A02J 2JJLA 3TYYA 2YNYA 5AVXB 1GU4A 1GK6A 1H88A 3M91A 3L35A 1S9KE 3L36A 1IO4A 3HE5B 2W6AA 4XE5B 4AUWA 2P2UA 3KQGA 1HBWA 5APUA 5APSA 3MD0A 3TK1A 1J2JB 1CI6A 1GU5A 2W27A 1A02F 1FAVA 5AVYB 5APQA 4M3LA 5AW1B 2R5DA 1FOSF 2Z5HA 4GKGA 1T2KC 1JNMA 1GD2E 1KQLA 1SLQA 4JYBA 1GK4A 1T2KD 3L37A 4B86A 4C46A 3UIAA 3VMZA 1OWAA 2YO2A 3M0DA 2H7HA 1X8YA 2IPPA 2P67A 5AW6B 1NWQA 3A7OA 3I5CA 2WPSA 3TNUB 3M9BA 2R32A 5AW0B 2Q3IA 5APVA 1YYCA 1G2CB
chains in the Genus database with same CATH superfamily
1DIPA 5GTHH 3H1LD 1OW8A 2VRSA 1USDA 1SQQE 3RL0g 2ZVOB 5CCHC 5AW7B 3L75D 5CBNA 1K73Q 2KNCA 2FY8A 4U3FD 3OA7A 3VN0A 1PGQA 2LKMA 3B5NC 3FXEA 4OGQD 3H1JD 3P8CD 1NTZJ 3NMDA 1NTKJ 3W67A 3CCVP 1G2CA 1NKNA 1NO4A 2PP6A 1EZVD 2FYUD 3GF3A 4TLFA 1XTCC 1BCCJ 1X9VA 4PD4D 1VQNP 4W80A 3TNUA 3FWNA 4XFJA 1JCDA 3O6QA 5E79E 3RK2D 1YITP 2AXTH 5AW8B 2XZRA 4UB6H 2QM7A 1T3JA 4RESB 1KILD 5B66E 1J1DB 1SQPD 1SQPJ 3S4RA 2C0WA 2E75C 1JY2O 2QVAA 1KV4A 2B89A 2SPZA 1J1DC 2WITA 3B8EB 1LTIC 2I1KA 1FJPA 4EYYQ 3HD7B 1UIIA 1P84I 1SFCD 2WPRA 3CC2P 1NTKD 1S5LX 1GL2C 1RE3A 2K9YA 5APXA 3V4WA 4WVZA 3H1JJ 3L73G 2PFXA 2N9BA 3BATA 3LIEA 1E79H 4I7ZC 1JY3N 5B66H 1VQ5P 1H89A 2A06D 2Q7CA 3CPWO 3SWKA 1SQXG 4W7YA 1LT9B 1KB9D 3N7NA 2WVRA 2BCCG 4IFDK 1KC8Q 3KYQA 2OYIB 1AVOA 3SWFA 1PIXA 3H1LJ 1NTMK 3MUDC 2FYNC 3FX0A 3G71P 1NKZB 1IFDA 3C9IA 2LXCB 3H1ID 2ZT9B 3W68A 2XKMA 2RMZA 1CW5A 3PTZA 2IBZD 1LT1A 2ZFCA 2W6JH 1JO5A 1Q90D 1QL1A 2BASA 3GHGB 2PGDA 4ZKPA 2Q3EA 2YKQA 5KLIB 4GT1A 4HH2A 1IK7A 1YQ4C 1SQXK 2V7QJ 1GW3A 2HFED 5H2FH 5CHXA 2XNDH 1JMMA 3LW5H 3HRNA 3RL0D 1BE3D 2WT7A 1BSNA 1JY2P 1YI2P 1BDDA 1L0ND 3NFQA 3H1HE 3H1IJ 2BCCD 3L70J 5AW5B 3RK3D 3T97B 1GZLA 4C7NA 3D70A 2P1JA 3HUSC 1BGYJ 1VPCA 2ZAEB 3TYYA 4DJGA 1N73B 5AVXB 1H88A 3U59A 1S9KE 2J59M 3B71A 3FGAD 2QJPB 2ZT9C 1VQKP 2KOGA 3M0DC 3AE8C 1EC5A 1KQSO 2FXMA 2E75D 5APUA 4DOJA 2KS1A 3EQ2A 5APSA 4XA4A 1N73A 2KYVA 3EWKA 1KYOE 1J2JB 2B88A 3AEAC 1QX8A 3Q1MA 3G4SP 1FAVA 2L91A 5AVYB 1KYOD 2AEFA 1IZNB 4ZKUA 4H44C 5BU5A 1S4XA 1LWUC 1FOSF 3CCRP 1LTTC 1K05A 1RF0C 5EFWB 5CCHA 1T2KC 1VF5D 1X0TA 1NGMB 3HUSA 4OGQB 1DD3A 2IX7C 3HD7A 1IC2A 4N78E 4WB4A 3V2NA 1GK4A 3E1RA 2HPCA 1RQVA 1N2DC 4B86A 5CBOA 1L0LE 3L72J 4PD4I 2M0BA 3Q3DA 1LTJC 1YTZI 2ZJSE 3F5HA 1SQBJ 3D6YA 1M57D 1OFCX 1NU1G 2BCCE 3H1HD 2R3SA 2HODA 5AW6B 4QMAA 3RL0B 2JEEA 2QG4A 3CCQP 2QJYC 2W8ZA 1RF0A 3L75J 2WPSA 2J5UA 4PJ0E 3TNUB 5BU8B 1RH5B 2ZYGA 3BCCG 3V2QA 4L73A 3BCCD 3BRTB 4H13D 4KT0J 2GM4A 1RY3A 1ZLLA 2ZYAA 2ZYDA 1PGJA 3LIDA 4OVNF 4UB8E 3CCLP 1MV8A 2IBZE 1M1KQ 1NTMD 2KI7B 3NXSA 1VQ6P 2IFMA 5AVWB 5KLVD 5KAIH 1NTKG 1M8OB 2ITAA 2V4HA 1VQOP 1FZGA 1RF1C 1ZW0A 2IDBA 4HJGH 3V5BA 2RH0A 2UWJE 2YKOA 2OARA 1DEEG 2E42A 2ZVNB 3VMXA 1GL2A 1RE3C 1JTHB 1NTZE 2IYOA 2N9YB 2WMMA 5KTBA 1OIPA 3ITKA 2NPSA 2E5TA 2WPQA 3WUTA 1Y8AA 1DEBA 2A45H 3MUDA 1BCCE 2D2CC 5TISH 2OYHB 2O01N 2OTJP 2M5AB 3ZDMA 2KSJA 1FZCB 2KIKA 3A0BE 4N3YB 5AW9B 2P10A 4I6MC 3KHUA 1KQFB 2KP8A 1U57A 3L4FA 1FOSE 3FXDA 3KZIE 2M8RA 2AXCA 3B5NB 1EXJA 1SQPE 2Q9IA 3KDPB 2M3EA 3TDKA 5KLVG 3H1JG 2KK7A 3A2AA 4CPGA 4DCKA 2B87A 5TISE 4H0LC 3VTPC 1IFIA 1KILA 3RK2B 3V4QA 2QJKC 2WSSH 2XDJA 5AVVB 3P7KA 1BDCA 1WT6A 3CXHE 1GTWA 2WSEJ 1X22A 1Q86Q 1D7MA 2BCCJ 2NRGA 5B5EH 1Q81Q 1J1EC 2FYUE 1ZRTE 3V2RA 2R3CA 1HJBA 1PGOA 1YHQP 1N7SC 2JO1A 3A3YB 3A0HE 3H1KJ 1LWUA 5AVZB 2FFDB 1CI6B 4H13B 1ZMEC 1FS0E 5AVUB 4IFMA 2GA1A 4U3FE 1PFIA 2E74C 3AEGC 3GHGC 3GW6A 5KLVK 3AEEC 3MIWA 1DH3A 1JY3O 1SFCA 1N7LA 1SQVG 3H1LE 2POHA 1HTLC 1SQVD 1OXZA 3PP5A 2C9NY 4Y28J 1Z56A 2KB7P 4H44B 1R5SA 3AE4C 4WBAA 1R8EA 4AQRD 1H0TA 4C7NB 1KZUB 1LTGC 4PV1D 1SQQK 1MFZA 3SWYA 1L0NG 3C1LA 1J1EB 1S2EA 1AQTA 3O8ZA 1SQXE 1BE3G 4NPEA 4AYCA 2WT7B 3PRJA 2B9BA 4IL6X 4JYCA 5APTA 3VOPA 4D6TG 1H0TB 1M56D 4GODA 1KYOH 3CX5I 1EDIA 1JY2N 1HJ0A 4H0LB 2QA4P 1NJIQ 3CCEP 1RE4A 3H1HJ 3L70E 3GLMA 1Q82Q 4BRYB 1P84D 2K3RA 1W5CE 1OMIA 3AE7C 3L36A 3GHGA 4Z1MH 1M90Q 1BGYE 1NTZK 1PPJE 1W2EA 2W6AA 3HE5B 5CJ0A 3OW2O 5M1BA 1QVGO 1PP9E 1HBWA 2BEZF 4YXDC 1SQQG 1L0NK 3MD0A 4JBZA 1OVVA 3TK1A 3VP9A 3CC7P 3BASA 2D2CB 1LWUB 2WZ7A 3KXDA 1E5WA 2R44A 1YIJP 2LXBA 5B5EE 3B5ND 4H0LD 3L71E 2NPSC 4M3LA 1LNQA 1RE4C 2R5DA 3HD7D 4GKGA 2FKWB 2KLVA 2FYUJ 2HLOA 3L74G 1BSHA 1NH4A 1JNMA 1NTZG 2CPBA 2I8DA 1NU1E 3L74D 4IOIH 1N7SD 3H1KE 4WY4C 3WUVA 4EDFA 1JM0A 1SLQA 3RK2C 4BWNA 1P84H 3CI9A 3L37A 4U3FJ 3Q5PA 3UIAA 1FU1A 2E74D 4N6JA 4D6TE 1PGPA 1URQC 1OWAA 1R5LA 2K9JB 2YO2A 2QIWA 4IL6H 5L8RJ 2M5AA 4UB8H 1HVVA 3CCMP 1L0LK 1IFNA 2W83C 3L72E 3HTKB 4IFFA 1LT9A 1M1JC 1SQBE 2OYOA 3AEDC 4GOEA 2I1JA 3U1CA 5AW0B 1JTHA 1GL2B 1SQBD 3D6ZA 1QVFO 3L72D 2B87B 4K3AA 5APVA 5KKZC 1YYCA 3S9OA 1MFTA 1N86A 5AVTB 1IFJA 5KLIC 2K88A 1NTMG 2RN0A 1CZQA 2KNCB 2V7QH 1DD4A 3HE4A 3MHVA 4GDOA 1T8ZA 4EI2A 1L0LG 4I2LC 5APWA 3Q2YA 2Y9ZA 3L73D 3QH9A 2FYNB 1YJWP 3H1KD 1VQPP 1URQA 3L74E 1ZR2A 1FZBA 1EQ7A 1NU1D 3MP7B 1PP9J 3P32A 1HUCA 1A02J 2CPSA 4WWIA 1U7JA 2C9LY 1M1JB 2YXRB 1KFNA 2ZXEB 1QL2A 1KB9I 4OH8B 5AW2B 1GD2E 2K1AA 1QLED 2JR8A 3L71D 3HTKA 4YTPC 4ZNCA 3TGUD 5E79H 1JEKA 3AE3C 4MN4C 3A5TA 2C0XA 1FZFA 1RQUA 1URQB 3CWBD 1FDOA 1VF5B 5GTIE 1UIXA 1X79B 3L71J 3F89A 3RL0C 1AA0A 1SP4A 2K9JA 1SFCC 3EFGA 1LP1B 2W6BA 3CWBJ 3HD7C 4DT0A 3WMM0 3RK3C 5AVSB 5CCGA 2FYUK 1NU1J 5CJ4A 1VQ8P 5C39A 2J58A 1PPJD 2P7JA 2WPVB 1LJ2A 2YXQB 3U1AA 3HUSB 3Q5RA 2WWWA 3OAKA 2Q1KA 1T6AA 3R4YA 3A0BH 2KSEA 4OWFA 2Z4EA 5CMZA 4C7RA 2M3BA 3NTNA 1FDMA 2G8YA 3R2PA 4GOFA 3SSUA 5CCHD 2E5YA 4KHXA 4RO0A 4EOTA 1SQXD 1JY3P 2HODB 1L2PA 2WQYC 3IR9A 3P8MC 3TGUG 3VP8A 3CCSP 3IFMA 3CXHI 1KN7A 1RHZB 3VYIA 4LGDE 5AW4B 2HPCB 2IBZG 4JPZB 3CCJP 5KAFH 4BRYA 2KUBA 1NYHA 2O3JA 3GG2A 3H32B 1OZHA 5AVQB 4LLHA 2E43A 2OTLP 3KPEA 2WSEH 2XU6A 1HWTC 1MUUA 1KILC 2KLUA 1QGKB 1JOCA 1IJDB 3MTUE 5H2FE 1N73C 1NHLA 3JSVC 4JQ0D 1KB9H 1MZ9A 1HH0A 3M06A 1ZRTD 2KXPB 1KORA 2YIUB 3MGNA 3OJAB 5AVRB 1H8AA 1AJYA 2H89C 1HGZA 1L4AC 3CXHD 3AE1C 4I7ZB 2Y0CA 1TU3F 3I56P 1N7SA 1GU4A 3CMEP 1SQXJ 3M91A 1S5LE 1SQBK 4TT3H 3ABVC 2H88C 5CCGC 4WY4D 2E76B 3II6A 3RBZA 1IO4A 1FZEA 1VQLP 2OTKE 2WSFJ 4A7PA 2P2UA 1VQMP 3CX5E 1U7MA 3KQGA 4H13C 1K9MQ 4AUWA 1EXIA 5K5GB 3CD6P 1URQD 1LTAC 3RK3B 1JMBA 1CI6A 4O9BA 4H44D 1LTJA 1MKMA 1S3JA 1SS1A 2PAJA 5KJ7A 1A02F 1BCCD 2A45G 1VF5C 2YIUC 5APQA 1BCCG 5AW1B 1FJKA 1SQBG 3C8VA 1ZXGA 2AXTE 2JKVA 2E76D 1NTZD 4ZMDA 2IYPA 3CL3D 3CX5D 5DJUB 3TSIA 1KILB 3AECC 1YJNP 3CXHH 1KMIZ 3L70G 3CMAP 1LTBC 2FYZA 2AEJA 1GW4A 4JYBA 1Q7YQ 3B5NA 4U3FG 2XNXA 1T2KD 1K8AQ 2D2CD 3EFFK 5KLVE 3G6EP 4ASVA 1IK9A 1LP1A 3VMZA 3AEBC 1PZQA 2QSIA 1NTME 3M0DA 4Y99B 3H6PA 3USSA 2OYHC 2MKVA 1X8YA 5GTHE 1KD1Q 2GUSA 3WU2E 1N8RQ 1RF1A 1VQ9P 3A7OA 3I5CA 1M7LA 3BCCE 4HB1A 4PJ0H 3L73J 4D6TJ 4EIJA 2H43A 3O6QB 1ZV8A 5KKZB 2NPSB 1AV1A 4R4LA 1KQGB 3D71A 3M9BA 3N4XA 2HR3A 2R32A 3E1IA 3FWLA 1IFMA 3L72G 2Q3IA 3LW5J 1G1IA 4IL6E 1LGHB 1FBMA 1G2CB 3AE6C 4PV1B 1YTZT 3G9RA 2W90A 3H1LG 1AQ5A 2YMKA 2BEQD 3HE4B 3M0AA 2IBZI 1L0LD 3L75G 1NVOA 1SQPK 4L75A 1K04A 2WTYA 4N78D 1ZOYC 2N1TD 4U7JA 2G3AA 1AVYA 2GUVA 5KAIE 2JP3A 2R5BA 1FZCA 1S5LH 1SQVK 3V6IA 1EDLA 1IFPA 2OYHA 3M9HA 3H1KG 4KJMA 3S1KA 4WY4B 2QJYB 1EZVG 1OW7A 2A45I 5KJ7D 1FZAA 2XV5A 1OVRA 1ZP0C 2HYNA 2OQQA 1LT9C 1M1JA 2FXOA 3L74J 2K37A 3B4SA 3WUUA 3SFDC 2HG5D 5GTIH 2QRXA 2QEXP 3L71G 3CX5H 3PJSK 1JUNA 4RJTA 1L4AA 2WSFH 3H1IG 3CWBG 2O01J 2KZJA 4YXWH 1SQPG 1T3UA 3G3ZA 3IF4A 1FZCC 1NU1K 2Y9YA 3IN6A 1OX3A 5DJTB 3VMAA 3CWBE 3CCUP 2E75B 1EZVI 2O01H 2Y0DA 2MJZA 3JCUE 4PD4H 4DZOA 3TGUE 3I55P 1S9KD 4YPCA 2QM8A 1HF9A 3CC4P 1WRGA 2FFDC 3IAOA 4HKZH 3RK3E 1S1CX 1L0NE 1CSBA 2Q5UA 4HYTB 2QJKB 3GMAA 1VQ4P 1RF1B 3L73E 1BE3E 1W2BO 4R4MA 3Q5SA 1EDKA 3WU2H 2WSCJ 1NTKK 1L4AD 1USEA 2KS1B 2OGUA 3MZWB 1YJ9P 4L74A 4LC1A 2NPSD 2QJPC 1Y9BA 3HE5A 1GL2D 5CCGD 2JWDA 2L5GB 1PPJG 4PV1C 5TJHA 3VMYA 4W7ZA 2Z5IA 2YO3A 4RKUJ 3H1IE 1YQ3C 1NAFA 2JDIH 2A06G 5AW3B 3T97A 1KTMA 3GF7A 3PH0A 1G1JA 1SQVJ 2IZ1A 2DW3A 1LTJB 1KB9E 3JC22 1FE6A 1OW6A 1SQQJ 5APYA 5KJ7C 2RKLA 2JJLA 4D6TD 2A06E 2N1TB 2YNYA 1YBKA 4Y99C 1BGYG 1GK6A 2E76C 4OGQC 3L35A 2YMYA 2QE7H 2E74B 1KYOI 2O1JA 1NTKE 1VL2A 1FDIA 1VDFA 1SFCB 3K5BA 4XE5B 3AE2C 2Y0EA 3M9QA 1N7SB 4I1LA 1WMKA 2N1TA 1VQ7P 2Q6QA 4UB6E 1DX7A 1KFMA 3BVHA 2OYIA 1PL5A 1NOHA 3RGUA 1GU5A 1KILE 2FFDA 2W27A 1ZR4A 2O1KA 2AEMA 3BRVB 3TGUJ 4ASWA 1GMJA 4GIFA 3H25A 3JCUH 3SFEC 1NAYA 1JCCA 2Z5HA 1PP9D 4NPDA 4PD4E 1L0NJ 3H32A 1EZVE 1L0LJ 1XTGB 2KZIA 1BGYD 2ZT9D 3PLNA 4NPFX 1BE3J 1KQLA 3RBXA 1P84E 1PV3A 1Y47A 3V2PA 3L70D 3H1JE 2JWAA 3P8CE 3KZIH 3AEFC 5KAFE 3A0HH 2H8PD 3AE9C 4C46A 1ZN5A 2FBWC 2CK3H 3E7KA 1SVFA 3H1HG 2NZ2A 2PRRA 2IZ0A 2ZXXA 1SQQD 3L75E 1L4AB 3PHLA 2H7HA 2FYUG 2N1TC 2IPPA 5KLVJ 2P67A 1NWQA 1S72P 2P58A 4JF7A 2IFNA 1FC2C 1NTMJ 2OYIC 5BVZA 3TF5A 1QEXA 1AFOA 2WSCH 1HGVA 2FXPA 3CLQA 1EDJA 1LTSC 1OVUA 3QWOC 4L76A 4WY4A 1Q2NA 3AE5C 4BXLA 1GDTA 3BCCJ 4K35A 2YKPA 1JB0J 1SQVE 2LR2A 1PP9G
chains in the Genus database with same CATH topology
2VRSA 5CCHC 5AW7B 3OA7A 3VN0A 2LKMA 3B5NC 3P8CD 3NMDA 1G2CA 1NKNA 1NO4A 2PP6A 1XTCC 1X9VA 4W80A 3TNUA 1JCDA 3RK2D 5AW8B 2XZRA 2QM7A 1T3JA 4RESB 1KILD 1J1DB 2C0WA 1JY2O 1J1DC 2WITA 3B8EB 1LTIC 2I1KA 1FJPA 3HD7B 1SFCD 2WPRA 3V4WA 5APXA 1GL2C 1RE3A 2N9BA 3BATA 3LIEA 1JY3N 1H89A 2Q7CA 4W7YA 1LT9B 3N7NA 4IFDK 3KYQA 2OYIB 3SWFA 1NTMK 1NKZB 1IFDA 3C9IA 2XKMA 1CW5A 2ZFCA 1JO5A 1QL1A 2BASA 3GHGB 4ZKPA 2YKQA 4GT1A 4HH2A 1SQXK 1GW3A 2HFED 5CHXA 1JMMA 3LW5H 3HRNA 3RL0D 2WT7A 1JY2P 3NFQA 5AW5B 3RK3D 1GZLA 4C7NA 2P1JA 3HUSC 1VPCA 3TYYA 1N73B 5AVXB 1H88A 3U59A 1S9KE 2J59M 2KOGA 3M0DC 2FXMA 5APUA 4DOJA 3EQ2A 5APSA 4XA4A 1N73A 2KYVA 1J2JB 1FAVA 5AVYB 4ZKUA 5BU5A 1LWUC 1FOSF 1LTTC 1RF0C 5CCHA 1T2KC 3HUSA 2IX7C 3HD7A 1IC2A 4N78E 4WB4A 3V2NA 1GK4A 2HPCA 1N2DC 4B86A 1LTJC 1YTZI 2HODA 5AW6B 3RL0B 2JEEA 1RF0A 2WPSA 3TNUB 5BU8B 3V2QA 3BRTB 2GM4A 1RY3A 1ZLLA 3LIDA 1MV8A 3NXSA 2IFMA 5AVWB 1RF1C 1FZGA 3V5BA 2YKOA 2OARA 2E42A 3VMXA 1GL2A 1RE3C 1JTHB 5KTBA 2NPSA 2WPQA 1DEBA 2A45H 3MUDA 2OYHB 2KSJA 1FZCB 4N3YB 5AW9B 4I6MC 2KP8A 3L4FA 1FOSE 2M8RA 3B5NB 2Q9IA 3KDPB 3A2AA 3VTPC 1IFIA 1KILA 3RK2B 3V4QA 2XDJA 5AVVB 3P7KA 1WT6A 1GTWA 1J1EC 3V2RA 2R3CA 1HJBA 2FFDB 1N7SC 3A3YB 1LWUA 5AVZB 1CI6B 5AVUB 4IFMA 1PFIA 3GHGC 5KLVK 1DH3A 3MIWA 1JY3O 1SFCA 1N7LA 2POHA 1HTLC 1OXZA 3PP5A 1Z56A 2KB7P 4WBAA 4AQRD 4C7NB 1KZUB 1LTGC 3SWYA 1SQQK 1MFZA 1J1EB 3O8ZA 4AYCA 2WT7B 3VOPA 4JYCA 5APTA 1JY2N 1RE4A 3L36A 3GHGA 3HE5B 1NTZK 1W2EA 2W6AA 5CJ0A 1HBWA 1L0NK 3MD0A 3VP9A 3TK1A 3BASA 2WZ7A 1LWUB 1E5WA 3B5ND 2NPSC 4M3LA 1RE4C 2R5DA 3HD7D 4GKGA 2FKWB 2KLVA 2HLOA 1NH4A 1JNMA 2CPBA 4WY4C 1N7SD 3RK2C 1SLQA 3L37A 3CI9A 3UIAA 1FU1A 4N6JA 1URQC 1OWAA 2YO2A 1HVVA 1L0LK 1IFNA 3HTKB 4IFFA 1LT9A 1M1JC 2I1JA 3U1CA 5AW0B 1JTHA 1GL2B 5APVA 1YYCA 1N86A 5AVTB 1IFJA 3HE4A 1CZQA 1T8ZA 4I2LC 5APWA 2C9NY 1ZR2A 1URQA 1FZBA 1EQ7A 3P32A 2C9LY 1HUCA 2CPSA 1M1JB 2ZXEB 1KFNA 1QL2A 4OH8B 5AW2B 3HTKA 3A5TA 1FZFA 2C0XA 1URQB 1X79B 3RL0C 1SP4A 1SFCC 3EFGA 2W6BA 3HD7C 3WMM0 3RK3C 5AVSB 5CCGA 2FYUK 5CJ4A 2J58A 2P7JA 3U1AA 3HUSB 2WWWA 3OAKA 2Z4EA 5CMZA 4C7RA 2M3BA 3NTNA 1FDMA 3R2PA 5CCHD 4KHXA 4EOTA 1JY3P 2HODB 3IR9A 3P8MC 3VP8A 3IFMA 3VYIA 4LGDE 5AW4B 2HPCB 2E43A 5AVQB 3H32B 4LLHA 3KPEA 2WSEH 2XU6A 1HWTC 1MUUA 1KILC 1JOCA 1IJDB 3MTUE 1N73C 1NHLA 1MZ9A 1HH0A 3M06A 5AVRB 3MGNA 3OJAB 1H8AA 1HGZA 1L4AC 1A02J 1N7SA 1GU4A 3M91A 1SQBK 5CCGC 4WY4D 3II6A 1IO4A 1FZEA 4AUWA 2P2UA 3KQGA 1URQD 1LTAC 3RK3B 4O9BA 1CI6A 1LTJA 2PAJA 5KJ7A 1A02F 2A45G 5APQA 5AW1B 1FJKA 3CL3D 3TSIA 1KILB 1LTBC 2FYZA 1GW4A 4JYBA 3B5NA 2XNXA 1T2KD 1IK9A 3VMZA 3M0DA 4Y99B 2OYHC 3H6PA 1X8YA 2GUSA 1RF1A 3A7OA 3I5CA 1M7LA 4EIJA 2H43A 1ZV8A 2NPSB 3M9BA 3N4XA 2R32A 3E1IA 1IFMA 2Q3IA 1G1IA 1LGHB 1FBMA 1G2CB 1YTZT 1AQ5A 3HE4B 3M0AA 1SQPK 2WTYA 4N78D 2N1TD 1FZCA 2GUVA 2R5BA 1SQVK 2OYHA 3M9HA 4WY4B 5KJ7D 2A45I 1FZAA 2XV5A 2HYNA 1LT9C 1M1JA 2HG5D 1JUNA 1L4AA 2WSFH 1T3UA 3G3ZA 1FZCC 1NU1K 4DZOA 2O01H 2MJZA 1S9KD 2QM8A 1WRGA 2FFDC 1CSBA 2Q5UA 4HYTB 1RF1B 1NTKK 1L4AD 4LC1A 2NPSD 3HE5A 1GL2D 5CCGD 2L5GB 3VMYA 4W7ZA 2Z5IA 2YO3A 1NAFA 5AW3B 3T97A 1G1JA 1LTJB 5APYA 5KJ7C 2JJLA 2N1TB 2YNYA 4Y99C 1GK6A 3L35A 2YMYA 2O1JA 1VDFA 1SFCB 4XE5B 3M9QA 1N7SB 4I1LA 2N1TA 1DX7A 1KFMA 3BVHA 2OYIA 1NOHA 1GU5A 2FFDA 2W27A 1ZR4A 2O1KA 3BRVB 4GIFA 1JCCA 2Z5HA 3H32A 1GD2E 1XTGB 1KQLA 3V2PA 3P8CE 4C46A 2H8PD 1ZN5A 1SVFA 2H7HA 1L4AB 2N1TC 2IPPA 2P67A 1NWQA 4JF7A 2IFNA 2OYIC 5BVZA 1AFOA 2WSCH 1HGVA 3CLQA 1LTSC 4WY4A 1GDTA 2YKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LID A;  2VRS A;  1MV8 A;  5AVT B;  5AW7 B;  3NXS A;  3HE4 B;  3M0A A;  3HE4 A;  3VN0 A;  1CZQ A;  5AVW B;  2WTY A;  4I2L C;  5APW A;  3NMD A;  2C9N Y;  3V5B A;  2R5B A;  3P32 A;  3M9H A;  2C9L Y;  1HUC A;  2E42 A;  3VMX A;  2ZXE B;  2XV5 A;  5AW2 B;  3TNU A;  2WPQ A;  3HTK A;  3A5T A;  5AW8 B;  2XZR A;  2QM7 A;  4RES B;  1JUN A;  1SP4 A;  5AW9 B;  4I6M C;  2KP8 A;  1FOS E;  3B8E B;  5AVS B;  2P7J A;  3KDP B;  2WPR A;  3V4W A;  5APX A;  3A2A A;  4DZO A;  3VTP C;  2WWW A;  2N9B A;  3LIE A;  3OAK A;  2QM8 A;  3V4Q A;  1S9K D;  1H89 A;  5AVV B;  3P7K A;  5CMZ A;  2Q7C A;  1GTW A;  3NTN A;  4KHX A;  2R3C A;  1CSB A;  2Q5U A;  4HYT B;  4EOT A;  1HJB A;  3A3Y B;  3IR9 A;  3P8M C;  5AVZ B;  1CI6 B;  3SWF A;  5AVU B;  3VYI A;  5AW4 B;  1DH3 A;  4LC1 A;  2ZFC A;  3HE5 A;  2BAS A;  1OXZ A;  2E43 A;  5AVQ B;  4GT1 A;  3VMY A;  2Z5I A;  2YO3 A;  2XU6 A;  1HWT C;  1MUU A;  1NAF A;  4AQR D;  4C7N B;  5AW3 B;  1MFZ A;  3T97 A;  2WT7 A;  3O8Z A;  3NFQ A;  3M06 A;  5AVR B;  5AW5 B;  3MGN A;  4JYC A;  4AYC A;  5APT A;  2WT7 B;  1GZL A;  4C7N A;  5APY A;  1H8A A;  1A02 J;  2JJL A;  3TYY A;  2YNY A;  5AVX B;  1GU4 A;  1GK6 A;  1H88 A;  3M91 A;  3L35 A;  1S9K E;  3L36 A;  1IO4 A;  3HE5 B;  2W6A A;  4XE5 B;  4AUW A;  2P2U A;  3KQG A;  1HBW A;  5APU A;  5APS A;  3MD0 A;  3TK1 A;  1J2J B;  1CI6 A;  1GU5 A;  2W27 A;  1A02 F;  1FAV A;  5AVY B;  5APQ A;  4M3L A;  5AW1 B;  2R5D A;  1FOS F;  2Z5H A;  4GKG A;  1T2K C;  1JNM A;  1GD2 E;  1KQL A;  1SLQ A;  4JYB A;  1GK4 A;  1T2K D;  3L37 A;  4B86 A;  4C46 A;  3UIA A;  3VMZ A;  1OWA A;  2YO2 A;  3M0D A;  2H7H A;  1X8Y A;  2IPP A;  2P67 A;  5AW6 B;  1NWQ A;  3A7O A;  3I5C A;  2WPS A;  3TNU B;  3M9B A;  2R32 A;  5AW0 B;  2Q3I A;  5APV A;  1YYC A;  1G2C B; 
#chains in the Genus database with same CATH topology
 1DIP A;  5GTH H;  3H1L D;  1OW8 A;  2VRS A;  1USD A;  1SQQ E;  3RL0 g;  2ZVO B;  5CCH C;  5AW7 B;  3L75 D;  5CBN A;  1K73 Q;  2KNC A;  2FY8 A;  4U3F D;  3OA7 A;  3VN0 A;  1PGQ A;  2LKM A;  3B5N C;  3FXE A;  4OGQ D;  3H1J D;  3P8C D;  1NTZ J;  3NMD A;  1NTK J;  3W67 A;  3CCV P;  1G2C A;  1NKN A;  1NO4 A;  2PP6 A;  1EZV D;  2FYU D;  3GF3 A;  4TLF A;  1XTC C;  1BCC J;  1X9V A;  4PD4 D;  1VQN P;  4W80 A;  3TNU A;  3FWN A;  4XFJ A;  1JCD A;  3O6Q A;  5E79 E;  3RK2 D;  1YIT P;  2AXT H;  5AW8 B;  2XZR A;  4UB6 H;  2QM7 A;  1T3J A;  4RES B;  1KIL D;  5B66 E;  1J1D B;  1SQP D;  1SQP J;  3S4R A;  2C0W A;  2E75 C;  1JY2 O;  2QVA A;  1KV4 A;  2B89 A;  2SPZ A;  1J1D C;  2WIT A;  3B8E B;  1LTI C;  2I1K A;  1FJP A;  4EYY Q;  3HD7 B;  1UII A;  1P84 I;  1SFC D;  2WPR A;  3CC2 P;  1NTK D;  1S5L X;  1GL2 C;  1RE3 A;  2K9Y A;  5APX A;  3V4W A;  4WVZ A;  3H1J J;  3L73 G;  2PFX A;  2N9B A;  3BAT A;  3LIE A;  1E79 H;  4I7Z C;  1JY3 N;  5B66 H;  1VQ5 P;  1H89 A;  2A06 D;  2Q7C A;  3CPW O;  3SWK A;  1SQX G;  4W7Y A;  1LT9 B;  1KB9 D;  3N7N A;  2WVR A;  2BCC G;  4IFD K;  1KC8 Q;  3KYQ A;  2OYI B;  1AVO A;  3SWF A;  1PIX A;  3H1L J;  1NTM K;  3MUD C;  2FYN C;  3FX0 A;  3G71 P;  1NKZ B;  1IFD A;  3C9I A;  2LXC B;  3H1I D;  2ZT9 B;  3W68 A;  2XKM A;  2RMZ A;  1CW5 A;  3PTZ A;  2IBZ D;  1LT1 A;  2ZFC A;  2W6J H;  1JO5 A;  1Q90 D;  1QL1 A;  2BAS A;  3GHG B;  2PGD A;  4ZKP A;  2Q3E A;  2YKQ A;  5KLI B;  4GT1 A;  4HH2 A;  1IK7 A;  1YQ4 C;  1SQX K;  2V7Q J;  1GW3 A;  2HFE D;  5H2F H;  5CHX A;  2XND H;  1JMM A;  3LW5 H;  3HRN A;  3RL0 D;  1BE3 D;  2WT7 A;  1BSN A;  1JY2 P;  1YI2 P;  1BDD A;  1L0N D;  3NFQ A;  3H1H E;  3H1I J;  2BCC D;  3L70 J;  5AW5 B;  3RK3 D;  3T97 B;  1GZL A;  4C7N A;  3D70 A;  2P1J A;  3HUS C;  1BGY J;  1VPC A;  2ZAE B;  3TYY A;  4DJG A;  1N73 B;  5AVX B;  1H88 A;  3U59 A;  1S9K E;  2J59 M;  3B71 A;  3FGA D;  2QJP B;  2ZT9 C;  1VQK P;  2KOG A;  3M0D C;  3AE8 C;  1EC5 A;  1KQS O;  2FXM A;  2E75 D;  5APU A;  4DOJ A;  2KS1 A;  3EQ2 A;  5APS A;  4XA4 A;  1N73 A;  2KYV A;  3EWK A;  1KYO E;  1J2J B;  2B88 A;  3AEA C;  1QX8 A;  3Q1M A;  3G4S P;  1FAV A;  2L91 A;  5AVY B;  1KYO D;  2AEF A;  1IZN B;  4ZKU A;  4H44 C;  5BU5 A;  1S4X A;  1LWU C;  1FOS F;  3CCR P;  1LTT C;  1K05 A;  1RF0 C;  5EFW B;  5CCH A;  1T2K C;  1VF5 D;  1X0T A;  1NGM B;  3HUS A;  4OGQ B;  1DD3 A;  2IX7 C;  3HD7 A;  1IC2 A;  4N78 E;  4WB4 A;  3V2N A;  1GK4 A;  3E1R A;  2HPC A;  1RQV A;  1N2D C;  4B86 A;  5CBO A;  1L0L E;  3L72 J;  4PD4 I;  2M0B A;  3Q3D A;  1LTJ C;  1YTZ I;  2ZJS E;  3F5H A;  1SQB J;  3D6Y A;  1M57 D;  1OFC X;  1NU1 G;  2BCC E;  3H1H D;  2R3S A;  2HOD A;  5AW6 B;  4QMA A;  3RL0 B;  2JEE A;  2QG4 A;  3CCQ P;  2QJY C;  2W8Z A;  1RF0 A;  3L75 J;  2WPS A;  2J5U A;  4PJ0 E;  3TNU B;  5BU8 B;  1RH5 B;  2ZYG A;  3BCC G;  3V2Q A;  4L73 A;  3BCC D;  3BRT B;  4H13 D;  4KT0 J;  2GM4 A;  1RY3 A;  1ZLL A;  2ZYA A;  2ZYD A;  1PGJ A;  3LID A;  4OVN F;  4UB8 E;  3CCL P;  1MV8 A;  2IBZ E;  1M1K Q;  1NTM D;  2KI7 B;  3NXS A;  1VQ6 P;  2IFM A;  5AVW B;  5KLV D;  5KAI H;  1NTK G;  1M8O B;  2ITA A;  2V4H A;  1VQO P;  1FZG A;  1RF1 C;  1ZW0 A;  2IDB A;  4HJG H;  3V5B A;  2RH0 A;  2UWJ E;  2YKO A;  2OAR A;  1DEE G;  2E42 A;  2ZVN B;  3VMX A;  1GL2 A;  1RE3 C;  1JTH B;  1NTZ E;  2IYO A;  2N9Y B;  2WMM A;  5KTB A;  1OIP A;  3ITK A;  2NPS A;  2E5T A;  2WPQ A;  3WUT A;  1Y8A A;  1DEB A;  2A45 H;  3MUD A;  1BCC E;  2D2C C;  5TIS H;  2OYH B;  2O01 N;  2OTJ P;  2M5A B;  3ZDM A;  2KSJ A;  1FZC B;  2KIK A;  3A0B E;  4N3Y B;  5AW9 B;  2P10 A;  4I6M C;  3KHU A;  1KQF B;  2KP8 A;  1U57 A;  3L4F A;  1FOS E;  3FXD A;  3KZI E;  2M8R A;  2AXC A;  3B5N B;  1EXJ A;  1SQP E;  2Q9I A;  3KDP B;  2M3E A;  3TDK A;  5KLV G;  3H1J G;  2KK7 A;  3A2A A;  4CPG A;  4DCK A;  2B87 A;  5TIS E;  4H0L C;  3VTP C;  1IFI A;  1KIL A;  3RK2 B;  3V4Q A;  2QJK C;  2WSS H;  2XDJ A;  5AVV B;  3P7K A;  1BDC A;  1WT6 A;  3CXH E;  1GTW A;  2WSE J;  1X22 A;  1Q86 Q;  1D7M A;  2BCC J;  2NRG A;  5B5E H;  1Q81 Q;  1J1E C;  2FYU E;  1ZRT E;  3V2R A;  2R3C A;  1HJB A;  1PGO A;  1YHQ P;  1N7S C;  2JO1 A;  3A3Y B;  3A0H E;  3H1K J;  1LWU A;  5AVZ B;  2FFD B;  1CI6 B;  4H13 B;  1ZME C;  1FS0 E;  5AVU B;  4IFM A;  2GA1 A;  4U3F E;  1PFI A;  2E74 C;  3AEG C;  3GHG C;  3GW6 A;  5KLV K;  3AEE C;  3MIW A;  1DH3 A;  1JY3 O;  1SFC A;  1N7L A;  1SQV G;  3H1L E;  2POH A;  1HTL C;  1SQV D;  1OXZ A;  3PP5 A;  2C9N Y;  4Y28 J;  1Z56 A;  2KB7 P;  4H44 B;  1R5S A;  3AE4 C;  4WBA A;  1R8E A;  4AQR D;  1H0T A;  4C7N B;  1KZU B;  1LTG C;  4PV1 D;  1SQQ K;  1MFZ A;  3SWY A;  1L0N G;  3C1L A;  1J1E B;  1S2E A;  1AQT A;  3O8Z A;  1SQX E;  1BE3 G;  4NPE A;  4AYC A;  2WT7 B;  3PRJ A;  2B9B A;  4IL6 X;  4JYC A;  5APT A;  3VOP A;  4D6T G;  1H0T B;  1M56 D;  4GOD A;  1KYO H;  3CX5 I;  1EDI A;  1JY2 N;  1HJ0 A;  4H0L B;  2QA4 P;  1NJI Q;  3CCE P;  1RE4 A;  3H1H J;  3L70 E;  3GLM A;  1Q82 Q;  4BRY B;  1P84 D;  2K3R A;  1W5C E;  1OMI A;  3AE7 C;  3L36 A;  3GHG A;  4Z1M H;  1M90 Q;  1BGY E;  1NTZ K;  1PPJ E;  1W2E A;  2W6A A;  3HE5 B;  5CJ0 A;  3OW2 O;  5M1B A;  1QVG O;  1PP9 E;  1HBW A;  2BEZ F;  4YXD C;  1SQQ G;  1L0N K;  3MD0 A;  4JBZ A;  1OVV A;  3TK1 A;  3VP9 A;  3CC7 P;  3BAS A;  2D2C B;  1LWU B;  2WZ7 A;  3KXD A;  1E5W A;  2R44 A;  1YIJ P;  2LXB A;  5B5E E;  3B5N D;  4H0L D;  3L71 E;  2NPS C;  4M3L A;  1LNQ A;  1RE4 C;  2R5D A;  3HD7 D;  4GKG A;  2FKW B;  2KLV A;  2FYU J;  2HLO A;  3L74 G;  1BSH A;  1NH4 A;  1JNM A;  1NTZ G;  2CPB A;  2I8D A;  1NU1 E;  3L74 D;  4IOI H;  1N7S D;  3H1K E;  4WY4 C;  3WUV A;  4EDF A;  1JM0 A;  1SLQ A;  3RK2 C;  4BWN A;  1P84 H;  3CI9 A;  3L37 A;  4U3F J;  3Q5P A;  3UIA A;  1FU1 A;  2E74 D;  4N6J A;  4D6T E;  1PGP A;  1URQ C;  1OWA A;  1R5L A;  2K9J B;  2YO2 A;  2QIW A;  4IL6 H;  5L8R J;  2M5A A;  4UB8 H;  1HVV A;  3CCM P;  1L0L K;  1IFN A;  2W83 C;  3L72 E;  3HTK B;  4IFF A;  1LT9 A;  1M1J C;  1SQB E;  2OYO A;  3AED C;  4GOE A;  2I1J A;  3U1C A;  5AW0 B;  1JTH A;  1GL2 B;  1SQB D;  3D6Z A;  1QVF O;  3L72 D;  2B87 B;  4K3A A;  5APV A;  5KKZ C;  1YYC A;  3S9O A;  1MFT A;  1N86 A;  5AVT B;  1IFJ A;  5KLI C;  2K88 A;  1NTM G;  2RN0 A;  1CZQ A;  2KNC B;  2V7Q H;  1DD4 A;  3HE4 A;  3MHV A;  4GDO A;  1T8Z A;  4EI2 A;  1L0L G;  4I2L C;  5APW A;  3Q2Y A;  2Y9Z A;  3L73 D;  3QH9 A;  2FYN B;  1YJW P;  3H1K D;  1VQP P;  1URQ A;  3L74 E;  1ZR2 A;  1FZB A;  1EQ7 A;  1NU1 D;  3MP7 B;  1PP9 J;  3P32 A;  1HUC A;  1A02 J;  2CPS A;  4WWI A;  1U7J A;  2C9L Y;  1M1J B;  2YXR B;  1KFN A;  2ZXE B;  1QL2 A;  1KB9 I;  4OH8 B;  5AW2 B;  1GD2 E;  2K1A A;  1QLE D;  2JR8 A;  3L71 D;  3HTK A;  4YTP C;  4ZNC A;  3TGU D;  5E79 H;  1JEK A;  3AE3 C;  4MN4 C;  3A5T A;  2C0X A;  1FZF A;  1RQU A;  1URQ B;  3CWB D;  1FDO A;  1VF5 B;  5GTI E;  1UIX A;  1X79 B;  3L71 J;  3F89 A;  3RL0 C;  1AA0 A;  1SP4 A;  2K9J A;  1SFC C;  3EFG A;  1LP1 B;  2W6B A;  3CWB J;  3HD7 C;  4DT0 A;  3WMM 0;  3RK3 C;  5AVS B;  5CCG A;  2FYU K;  1NU1 J;  5CJ4 A;  1VQ8 P;  5C39 A;  2J58 A;  1PPJ D;  2P7J A;  2WPV B;  1LJ2 A;  2YXQ B;  3U1A A;  3HUS B;  3Q5R A;  2WWW A;  3OAK A;  2Q1K A;  1T6A A;  3R4Y A;  3A0B H;  2KSE A;  4OWF A;  2Z4E A;  5CMZ A;  4C7R A;  2M3B A;  3NTN A;  1FDM A;  2G8Y A;  3R2P A;  4GOF A;  3SSU A;  5CCH D;  2E5Y A;  4KHX A;  4RO0 A;  4EOT A;  1SQX D;  1JY3 P;  2HOD B;  1L2P A;  2WQY C;  3IR9 A;  3P8M C;  3TGU G;  3VP8 A;  3CCS P;  3IFM A;  3CXH I;  1KN7 A;  1RHZ B;  3VYI A;  4LGD E;  5AW4 B;  2HPC B;  2IBZ G;  4JPZ B;  3CCJ P;  5KAF H;  4BRY A;  2KUB A;  1NYH A;  2O3J A;  3GG2 A;  3H32 B;  1OZH A;  5AVQ B;  4LLH A;  2E43 A;  2OTL P;  3KPE A;  2WSE H;  2XU6 A;  1HWT C;  1MUU A;  1KIL C;  2KLU A;  1QGK B;  1JOC A;  1IJD B;  3MTU E;  5H2F E;  1N73 C;  1NHL A;  3JSV C;  4JQ0 D;  1KB9 H;  1MZ9 A;  1HH0 A;  3M06 A;  1ZRT D;  2KXP B;  1KOR A;  2YIU B;  3MGN A;  3OJA B;  5AVR B;  1H8A A;  1AJY A;  2H89 C;  1HGZ A;  1L4A C;  3CXH D;  3AE1 C;  4I7Z B;  2Y0C A;  1TU3 F;  3I56 P;  1N7S A;  1GU4 A;  3CME P;  1SQX J;  3M91 A;  1S5L E;  1SQB K;  4TT3 H;  3ABV C;  2H88 C;  5CCG C;  4WY4 D;  2E76 B;  3II6 A;  3RBZ A;  1IO4 A;  1FZE A;  1VQL P;  2OTK E;  2WSF J;  4A7P A;  2P2U A;  1VQM P;  3CX5 E;  1U7M A;  3KQG A;  4H13 C;  1K9M Q;  4AUW A;  1EXI A;  5K5G B;  3CD6 P;  1URQ D;  1LTA C;  3RK3 B;  1JMB A;  1CI6 A;  4O9B A;  4H44 D;  1LTJ A;  1MKM A;  1S3J A;  1SS1 A;  2PAJ A;  5KJ7 A;  1A02 F;  1BCC D;  2A45 G;  1VF5 C;  2YIU C;  5APQ A;  1BCC G;  5AW1 B;  1FJK A;  1SQB G;  3C8V A;  1ZXG A;  2AXT E;  2JKV A;  2E76 D;  1NTZ D;  4ZMD A;  2IYP A;  3CL3 D;  3CX5 D;  5DJU B;  3TSI A;  1KIL B;  3AEC C;  1YJN P;  3CXH H;  1KMI Z;  3L70 G;  3CMA P;  1LTB C;  2FYZ A;  2AEJ A;  1GW4 A;  4JYB A;  1Q7Y Q;  3B5N A;  4U3F G;  2XNX A;  1T2K D;  1K8A Q;  2D2C D;  3EFF K;  5KLV E;  3G6E P;  4ASV A;  1IK9 A;  1LP1 A;  3VMZ A;  3AEB C;  1PZQ A;  2QSI A;  1NTM E;  3M0D A;  4Y99 B;  3H6P A;  3USS A;  2OYH C;  2MKV A;  1X8Y A;  5GTH E;  1KD1 Q;  2GUS A;  3WU2 E;  1N8R Q;  1RF1 A;  1VQ9 P;  3A7O A;  3I5C A;  1M7L A;  3BCC E;  4HB1 A;  4PJ0 H;  3L73 J;  4D6T J;  4EIJ A;  2H43 A;  3O6Q B;  1ZV8 A;  5KKZ B;  2NPS B;  1AV1 A;  4R4L A;  1KQG B;  3D71 A;  3M9B A;  3N4X A;  2HR3 A;  2R32 A;  3E1I A;  3FWL A;  1IFM A;  3L72 G;  2Q3I A;  3LW5 J;  1G1I A;  4IL6 E;  1LGH B;  1FBM A;  1G2C B;  3AE6 C;  4PV1 B;  1YTZ T;  3G9R A;  2W90 A;  3H1L G;  1AQ5 A;  2YMK A;  2BEQ D;  3HE4 B;  3M0A A;  2IBZ I;  1L0L D;  3L75 G;  1NVO A;  1SQP K;  4L75 A;  1K04 A;  2WTY A;  4N78 D;  1ZOY C;  2N1T D;  4U7J A;  2G3A A;  1AVY A;  2GUV A;  5KAI E;  2JP3 A;  2R5B A;  1FZC A;  1S5L H;  1SQV K;  3V6I A;  1EDL A;  1IFP A;  2OYH A;  3M9H A;  3H1K G;  4KJM A;  3S1K A;  4WY4 B;  2QJY B;  1EZV G;  1OW7 A;  2A45 I;  5KJ7 D;  1FZA A;  2XV5 A;  1OVR A;  1ZP0 C;  2HYN A;  2OQQ A;  1LT9 C;  1M1J A;  2FXO A;  3L74 J;  2K37 A;  3B4S A;  3WUU A;  3SFD C;  2HG5 D;  5GTI H;  2QRX A;  2QEX P;  3L71 G;  3CX5 H;  3PJS K;  1JUN A;  4RJT A;  1L4A A;  2WSF H;  3H1I G;  3CWB G;  2O01 J;  2KZJ A;  4YXW H;  1SQP G;  1T3U A;  3G3Z A;  3IF4 A;  1FZC C;  1NU1 K;  2Y9Y A;  3IN6 A;  1OX3 A;  5DJT B;  3VMA A;  3CWB E;  3CCU P;  2E75 B;  1EZV I;  2O01 H;  2Y0D A;  2MJZ A;  3JCU E;  4PD4 H;  4DZO A;  3TGU E;  3I55 P;  1S9K D;  4YPC A;  2QM8 A;  1HF9 A;  3CC4 P;  1WRG A;  2FFD C;  3IAO A;  4HKZ H;  3RK3 E;  1S1C X;  1L0N E;  1CSB A;  2Q5U A;  4HYT B;  2QJK B;  3GMA A;  1VQ4 P;  1RF1 B;  3L73 E;  1BE3 E;  1W2B O;  4R4M A;  3Q5S A;  1EDK A;  3WU2 H;  2WSC J;  1NTK K;  1L4A D;  1USE A;  2KS1 B;  2OGU A;  3MZW B;  1YJ9 P;  4L74 A;  4LC1 A;  2NPS D;  2QJP C;  1Y9B A;  3HE5 A;  1GL2 D;  5CCG D;  2JWD A;  2L5G B;  1PPJ G;  4PV1 C;  5TJH A;  3VMY A;  4W7Z A;  2Z5I A;  2YO3 A;  4RKU J;  3H1I E;  1YQ3 C;  1NAF A;  2JDI H;  2A06 G;  5AW3 B;  3T97 A;  1KTM A;  3GF7 A;  3PH0 A;  1G1J A;  1SQV J;  2IZ1 A;  2DW3 A;  1LTJ B;  1KB9 E;  3JC2 2;  1FE6 A;  1OW6 A;  1SQQ J;  5APY A;  5KJ7 C;  2RKL A;  2JJL A;  4D6T D;  2A06 E;  2N1T B;  2YNY A;  1YBK A;  4Y99 C;  1BGY G;  1GK6 A;  2E76 C;  4OGQ C;  3L35 A;  2YMY A;  2QE7 H;  2E74 B;  1KYO I;  2O1J A;  1NTK E;  1VL2 A;  1FDI A;  1VDF A;  1SFC B;  3K5B A;  4XE5 B;  3AE2 C;  2Y0E A;  3M9Q A;  1N7S B;  4I1L A;  1WMK A;  2N1T A;  1VQ7 P;  2Q6Q A;  4UB6 E;  1DX7 A;  1KFM A;  3BVH A;  2OYI A;  1PL5 A;  1NOH A;  3RGU A;  1GU5 A;  1KIL E;  2FFD A;  2W27 A;  1ZR4 A;  2O1K A;  2AEM A;  3BRV B;  3TGU J;  4ASW A;  1GMJ A;  4GIF A;  3H25 A;  3JCU H;  3SFE C;  1NAY A;  1JCC A;  2Z5H A;  1PP9 D;  4NPD A;  4PD4 E;  1L0N J;  3H32 A;  1EZV E;  1L0L J;  1XTG B;  2KZI A;  1BGY D;  2ZT9 D;  3PLN A;  4NPF X;  1BE3 J;  1KQL A;  3RBX A;  1P84 E;  1PV3 A;  1Y47 A;  3V2P A;  3L70 D;  3H1J E;  2JWA A;  3P8C E;  3KZI H;  3AEF C;  5KAF E;  3A0H H;  2H8P D;  3AE9 C;  4C46 A;  1ZN5 A;  2FBW C;  2CK3 H;  3E7K A;  1SVF A;  3H1H G;  2NZ2 A;  2PRR A;  2IZ0 A;  2ZXX A;  1SQQ D;  3L75 E;  1L4A B;  3PHL A;  2H7H A;  2FYU G;  2N1T C;  2IPP A;  5KLV J;  2P67 A;  1NWQ A;  1S72 P;  2P58 A;  4JF7 A;  2IFN A;  1FC2 C;  1NTM J;  2OYI C;  5BVZ A;  3TF5 A;  1QEX A;  1AFO A;  2WSC H;  1HGV A;  2FXP A;  3CLQ A;  1EDJ A;  1LTS C;  1OVU A;  3QWO C;  4L76 A;  4WY4 A;  1Q2N A;  3AE5 C;  4BXL A;  1GDT A;  3BCC J;  4K35 A;  2YKP A;  1JB0 J;  1SQV E;  2LR2 A;  1PP9 G; 
#chains in the Genus database with same CATH homology
 2VRS A;  5CCH C;  5AW7 B;  3OA7 A;  3VN0 A;  2LKM A;  3B5N C;  3P8C D;  3NMD A;  1G2C A;  1NKN A;  1NO4 A;  2PP6 A;  1XTC C;  1X9V A;  4W80 A;  3TNU A;  1JCD A;  3RK2 D;  5AW8 B;  2XZR A;  2QM7 A;  1T3J A;  4RES B;  1KIL D;  1J1D B;  2C0W A;  1JY2 O;  1J1D C;  2WIT A;  3B8E B;  1LTI C;  2I1K A;  1FJP A;  3HD7 B;  1SFC D;  2WPR A;  3V4W A;  5APX A;  1GL2 C;  1RE3 A;  2N9B A;  3BAT A;  3LIE A;  1JY3 N;  1H89 A;  2Q7C A;  4W7Y A;  1LT9 B;  3N7N A;  4IFD K;  3KYQ A;  2OYI B;  3SWF A;  1NTM K;  1NKZ B;  1IFD A;  3C9I A;  2XKM A;  1CW5 A;  2ZFC A;  1JO5 A;  1QL1 A;  2BAS A;  3GHG B;  4ZKP A;  2YKQ A;  4GT1 A;  4HH2 A;  1SQX K;  1GW3 A;  2HFE D;  5CHX A;  1JMM A;  3LW5 H;  3HRN A;  3RL0 D;  2WT7 A;  1JY2 P;  3NFQ A;  5AW5 B;  3RK3 D;  1GZL A;  4C7N A;  2P1J A;  3HUS C;  1VPC A;  3TYY A;  1N73 B;  5AVX B;  1H88 A;  3U59 A;  1S9K E;  2J59 M;  2KOG A;  3M0D C;  2FXM A;  5APU A;  4DOJ A;  3EQ2 A;  5APS A;  4XA4 A;  1N73 A;  2KYV A;  1J2J B;  1FAV A;  5AVY B;  4ZKU A;  5BU5 A;  1LWU C;  1FOS F;  1LTT C;  1RF0 C;  5CCH A;  1T2K C;  3HUS A;  2IX7 C;  3HD7 A;  1IC2 A;  4N78 E;  4WB4 A;  3V2N A;  1GK4 A;  2HPC A;  1N2D C;  4B86 A;  1LTJ C;  1YTZ I;  2HOD A;  5AW6 B;  3RL0 B;  2JEE A;  1RF0 A;  2WPS A;  3TNU B;  5BU8 B;  3V2Q A;  3BRT B;  2GM4 A;  1RY3 A;  1ZLL A;  3LID A;  1MV8 A;  3NXS A;  2IFM A;  5AVW B;  1RF1 C;  1FZG A;  3V5B A;  2YKO A;  2OAR A;  2E42 A;  3VMX A;  1GL2 A;  1RE3 C;  1JTH B;  5KTB A;  2NPS A;  2WPQ A;  1DEB A;  2A45 H;  3MUD A;  2OYH B;  2KSJ A;  1FZC B;  4N3Y B;  5AW9 B;  4I6M C;  2KP8 A;  3L4F A;  1FOS E;  2M8R A;  3B5N B;  2Q9I A;  3KDP B;  3A2A A;  3VTP C;  1IFI A;  1KIL A;  3RK2 B;  3V4Q A;  2XDJ A;  5AVV B;  3P7K A;  1WT6 A;  1GTW A;  1J1E C;  3V2R A;  2R3C A;  1HJB A;  2FFD B;  1N7S C;  3A3Y B;  1LWU A;  5AVZ B;  1CI6 B;  5AVU B;  4IFM A;  1PFI A;  3GHG C;  5KLV K;  1DH3 A;  3MIW A;  1JY3 O;  1SFC A;  1N7L A;  2POH A;  1HTL C;  1OXZ A;  3PP5 A;  1Z56 A;  2KB7 P;  4WBA A;  4AQR D;  4C7N B;  1KZU B;  1LTG C;  3SWY A;  1SQQ K;  1MFZ A;  1J1E B;  3O8Z A;  4AYC A;  2WT7 B;  3VOP A;  4JYC A;  5APT A;  1JY2 N;  1RE4 A;  3L36 A;  3GHG A;  3HE5 B;  1NTZ K;  1W2E A;  2W6A A;  5CJ0 A;  1HBW A;  1L0N K;  3MD0 A;  3VP9 A;  3TK1 A;  3BAS A;  2WZ7 A;  1LWU B;  1E5W A;  3B5N D;  2NPS C;  4M3L A;  1RE4 C;  2R5D A;  3HD7 D;  4GKG A;  2FKW B;  2KLV A;  2HLO A;  1NH4 A;  1JNM A;  2CPB A;  4WY4 C;  1N7S D;  3RK2 C;  1SLQ A;  3L37 A;  3CI9 A;  3UIA A;  1FU1 A;  4N6J A;  1URQ C;  1OWA A;  2YO2 A;  1HVV A;  1L0L K;  1IFN A;  3HTK B;  4IFF A;  1LT9 A;  1M1J C;  2I1J A;  3U1C A;  5AW0 B;  1JTH A;  1GL2 B;  5APV A;  1YYC A;  1N86 A;  5AVT B;  1IFJ A;  3HE4 A;  1CZQ A;  1T8Z A;  4I2L C;  5APW A;  2C9N Y;  1ZR2 A;  1URQ A;  1FZB A;  1EQ7 A;  3P32 A;  2C9L Y;  1HUC A;  2CPS A;  1M1J B;  2ZXE B;  1KFN A;  1QL2 A;  4OH8 B;  5AW2 B;  3HTK A;  3A5T A;  1FZF A;  2C0X A;  1URQ B;  1X79 B;  3RL0 C;  1SP4 A;  1SFC C;  3EFG A;  2W6B A;  3HD7 C;  3WMM 0;  3RK3 C;  5AVS B;  5CCG A;  2FYU K;  5CJ4 A;  2J58 A;  2P7J A;  3U1A A;  3HUS B;  2WWW A;  3OAK A;  2Z4E A;  5CMZ A;  4C7R A;  2M3B A;  3NTN A;  1FDM A;  3R2P A;  5CCH D;  4KHX A;  4EOT A;  1JY3 P;  2HOD B;  3IR9 A;  3P8M C;  3VP8 A;  3IFM A;  3VYI A;  4LGD E;  5AW4 B;  2HPC B;  2E43 A;  5AVQ B;  3H32 B;  4LLH A;  3KPE A;  2WSE H;  2XU6 A;  1HWT C;  1MUU A;  1KIL C;  1JOC A;  1IJD B;  3MTU E;  1N73 C;  1NHL A;  1MZ9 A;  1HH0 A;  3M06 A;  5AVR B;  3MGN A;  3OJA B;  1H8A A;  1HGZ A;  1L4A C;  1A02 J;  1N7S A;  1GU4 A;  3M91 A;  1SQB K;  5CCG C;  4WY4 D;  3II6 A;  1IO4 A;  1FZE A;  4AUW A;  2P2U A;  3KQG A;  1URQ D;  1LTA C;  3RK3 B;  4O9B A;  1CI6 A;  1LTJ A;  2PAJ A;  5KJ7 A;  1A02 F;  2A45 G;  5APQ A;  5AW1 B;  1FJK A;  3CL3 D;  3TSI A;  1KIL B;  1LTB C;  2FYZ A;  1GW4 A;  4JYB A;  3B5N A;  2XNX A;  1T2K D;  1IK9 A;  3VMZ A;  3M0D A;  4Y99 B;  2OYH C;  3H6P A;  1X8Y A;  2GUS A;  1RF1 A;  3A7O A;  3I5C A;  1M7L A;  4EIJ A;  2H43 A;  1ZV8 A;  2NPS B;  3M9B A;  3N4X A;  2R32 A;  3E1I A;  1IFM A;  2Q3I A;  1G1I A;  1LGH B;  1FBM A;  1G2C B;  1YTZ T;  1AQ5 A;  3HE4 B;  3M0A A;  1SQP K;  2WTY A;  4N78 D;  2N1T D;  1FZC A;  2GUV A;  2R5B A;  1SQV K;  2OYH A;  3M9H A;  4WY4 B;  5KJ7 D;  2A45 I;  1FZA A;  2XV5 A;  2HYN A;  1LT9 C;  1M1J A;  2HG5 D;  1JUN A;  1L4A A;  2WSF H;  1T3U A;  3G3Z A;  1FZC C;  1NU1 K;  4DZO A;  2O01 H;  2MJZ A;  1S9K D;  2QM8 A;  1WRG A;  2FFD C;  1CSB A;  2Q5U A;  4HYT B;  1RF1 B;  1NTK K;  1L4A D;  4LC1 A;  2NPS D;  3HE5 A;  1GL2 D;  5CCG D;  2L5G B;  3VMY A;  4W7Z A;  2Z5I A;  2YO3 A;  1NAF A;  5AW3 B;  3T97 A;  1G1J A;  1LTJ B;  5APY A;  5KJ7 C;  2JJL A;  2N1T B;  2YNY A;  4Y99 C;  1GK6 A;  3L35 A;  2YMY A;  2O1J A;  1VDF A;  1SFC B;  4XE5 B;  3M9Q A;  1N7S B;  4I1L A;  2N1T A;  1DX7 A;  1KFM A;  3BVH A;  2OYI A;  1NOH A;  1GU5 A;  2FFD A;  2W27 A;  1ZR4 A;  2O1K A;  3BRV B;  4GIF A;  1JCC A;  2Z5H A;  3H32 A;  1GD2 E;  1XTG B;  1KQL A;  3V2P A;  3P8C E;  4C46 A;  2H8P D;  1ZN5 A;  1SVF A;  2H7H A;  1L4A B;  2N1T C;  2IPP A;  2P67 A;  1NWQ A;  4JF7 A;  2IFN A;  2OYI C;  5BVZ A;  1AFO A;  2WSC H;  1HGV A;  3CLQ A;  1LTS C;  4WY4 A;  1GDT A;  2YKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...