3SWFA

Cnga1 621-690 containing clz domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
GLEEKVTRMESSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFLKPLIDTEFSAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords cGMP-gated cation channel alpha-1
publication title Molecular mechanism for 3:1 subunit stoichiometry of rod cyclic nucleotide-gated ion channels.
pubmed doi rcsb
source organism Bos taurus
total genus 23
structure length 56
sequence length 56
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3swfA00
2XV5A 2ZFCA 4AQRD 3VMZA 1GK4A 1A02J 5AW7B 2C9LY 3OAKA 3TYYA 2R5DA 4AUWA 4GT1A 2ZXEB 4XE5B 4HYTB 1YYCA 1GTWA 2WPSA 3A5TA 3P7KA 3LIEA 1OXZA 3A7OA 1MV8A 2XZRA 3O8ZA 4JYBA 4I2LC 3M06A 3VN0A 2QM7A 1JUNA 2H7HA 2P67A 1SP4A 2JJLA 3V4WA 2WTYA 2P7JA 1IO4A 3NFQA 5AW3B 1FOSE 1A02F 1KQLA 2WPRA 5AVRB 1NWQA 4AYCA 3I5CA 1S9KD 1HJBA 3A2AA 5APTA 2Q5UA 1GU4A 2IPPA 1HBWA 1GZLA 3L35A 5APSA 4RESB 1H89A 4EOTA 3P8MC 1GK6A 2P2UA 5AW8B 2KP8A 5APYA 2Z5IA 5CMZA 1FAVA 2VRSA 3M0AA 3HE5B 3HTKA 1H8AA 3VMYA 3IR9A 3NTNA 3T97A 1SLQA 1CZQA 4DZOA 5AVQB 1T2KC 5AW0B 1GD2E 1HWTC 3M91A 2R5BA 3KQGA 4I6MC 3LIDA 2Q7CA 1DH3A 4LC1A 3B8EB 1CI6B 2YNYA 3TNUA 3MD0A 2YO2A 4C7NA 5APXA 4M3LA 1J2JB 2WWWA 3HE5A 2Q3IA 3VYIA 1HUCA 5AVXB 3HE4B 4GKGA 5AVVB 5AVYB 5AVZB 5APUA 2BASA 1GU5A 1G2CB 3V4QA 5APQA 3TNUB 3NMDA 1OWAA 4C7NB 3L37A 2WT7B 2R32A 3UIAA 3M0DA 1CI6A 1X8YA 5AVWB 2XU6A 5AVUB 5AW1B 1MFZA 2N9BA 3V5BA 5AVTB 5APVA 2QM8A 5AW9B 3KDPB 5AW2B 3TK1A 3HE4A 2Z5HA 3M9BA 3VTPC 4C46A 5AW5B 4KHXA 3M9HA 5AW4B 2WT7A 1CSBA 3P32A 2R3CA 1T2KD 3NXSA 1H88A 3SWFA 1FOSF 4JYCA 2E43A 1JNMA 3A3YB 2W27A 2W6AA 2YO3A 5APWA 5AVSB 2WPQA 1S9KE 5AW6B 2C9NY 4B86A 3L36A 2E42A 1MUUA 1NAFA 3MGNA 3VMXA
chains in the Genus database with same CATH superfamily
3GHGC 2WZ7A 3BRVB 2QJYC 2K37A 4PV1C 2GUSA 3V2PA 1U7JA 4D6TG 3M06A 1WMKA 1KYOI 3H1KE 2E5TA 4YXDC 1LTJB 3Q5SA 1JCDA 1SQPD 3I5CA 1YHQP 4RESB 1AVOA 2KLUA 1PP9D 1ZRTE 2QIWA 2FYUD 4UB6H 3KQGA 2PFXA 1LWUC 3AE6C 2FYZA 2QJKC 1FZAA 2YO2A 1BCCD 1BSNA 3EWKA 5K5GB 2FY8A 3KZIH 3L75D 3CX5I 3L70G 1E79H 1J1EC 2R32A 5AVTB 4IL6H 3H32A 1M7LA 1KB9I 1PPJE 1CSBA 1EDJA 1H88A 3SWFA 1FOSF 5KAIE 1IK7A 2LKMA 2K88A 3L4FA 2W6AA 3FWNA 3G6EP 1NAFA 1VQPP 2JWAA 2BCCG 2OQQA 2WSCH 1NU1G 3S1KA 3CWBE 2P10A 2OYHA 4HYTB 1YYCA 3A5TA 2Q9IA 3LIEA 1LNQA 1L0NK 4JBZA 4JQ0D 2OYIB 3V4WA 5AW3B 3TF5A 4GOEA 3AE9C 3HD7C 3EFGA 3SWYA 1NHLA 4YXWH 2A06D 3SFDC 3WUVA 3BVHA 2B88A 3L73D 4EOTA 3CXHE 1QVGO 2QJYB 4PV1B 2Y0DA 1EZVI 4PV1D 3L70E 2AEMA 3KYQA 1GMJA 2B89A 3HUSA 2HR3A 3CCLP 1BGYD 2WSEJ 3U1CA 1Q82Q 1JMMA 4N78E 1OVVA 4HH2A 3KPEA 1IFNA 5AVZB 3RL0g 5H2FH 5C39A 1S4XA 5AVWB 3V5BA 2IZ0A 1L0LJ 1YJ9P 2A45I 2HLOA 1AVYA 3L71G 1LWUB 5GTHH 4U3FJ 2QJKB 1VQMP 1MUUA 1DEBA 5AW7B 2CPBA 2WSSH 3A0BE 2KIKA 5B66H 1EC5A 1J1EB 2GA1A 2H8PD 1KILC 1JOCA 1AV1A 3H1LJ 2V7QH 3P8CD 2W6JH 1KV4A 2IBZD 3A2AA 4TT3H 4WVZA 3A0HE 2B87A 1SQPG 4KT0J 2Y0EA 5APYA 1Y47A 5EFWB 1H8AA 4H0LC 2I1KA 1Q81Q 1PP9G 2OYHC 3H1KD 4ZKUA 1CI6B 3SFEC 1KORA 2KSEA 2FYUG 1J2JB 3TGUJ 1JY3O 2XNXA 5AVYB 3HD7B 5APUA 1X0TA 1G2CB 1GU5A 3HD7D 3MIWA 5KLVJ 2HYNA 1T8ZA 1BCCG 2IZ1A 2K9JA 1ZRTD 1N73A 1URQA 3L75G 1KD1Q 1QEXA 2Y9ZA 4EYYQ 1RY3A 2RKLA 1VQ5P 1SQVK 1S5LH 3HUSC 3USSA 3H25A 1EXJA 2C0XA 2XV5A 1GK4A 2RN0A 3AE4C 1RE4A 4RO0A 2KZJA 1DX7A 3W67A 1L0LK 2IYOA 1JUNA 1JB0J 1L4AA 2HODA 1PPJD 1IFJA 1BDCA 1QL2A 1M1JA 3ABVC 3NFQA 1JMBA 2YKPA 2WSFH 1KQLA 3CC7P 1FJPA 2ZXXA 3BASA 5APSA 2FYUE 1GK6A 3CWBD 1LT9A 1DD3A 1P84E 1BSHA 5KKZC 1N7SB 1S1CX 2A06G 1RF1A 1N7SD 2WSCJ 5KLIC 3L73G 5KAFH 4I6MC 4U3FE 3VP9A 3BRTB 2M8RA 2AEFA 3RGUA 3H32B 3WUTA 1FS0E 2E76C 1U57A 1BGYG 1JO5A 2YXQB 5BU8B 3CXHD 4UB8E 3H1LE 1M56D 3L70D 3S9OA 3VTPC 3N4XA 2WVRA 2GM4A 2IFMA 2LR2A 3RBXA 3N7NA 3P32A 1KYOH 4PD4I 2H88C 4H0LD 2FXMA 2OYHB 2PP6A 4N78D 1KQFB 1NKZB 2ZFCA 2RMZA 4AUWA 3VOPA 2RH0A 5GTIH 1OW6A 2WPSA 3CCJP 3P7KA 2YKQA 2XZRA 4JYBA 3E1RA 4IL6X 4I7ZB 3IF4A 3TGUE 1N73C 1URQC 2P1JA 2O01N 4H13C 5KLVE 1K04A 1J1DC 3OW2O 3CX5H 3AE1C 1VPCA 2IBZG 4BRYB 1ZXGA 3R2PA 4H44C 1KC8Q 1NJIQ 5AVQB 4HB1A 1RE4C 1LP1A 2WQYC 1KB9H 1KFMA 3LIDA 4UB6E 4M3LA 2WWWA 3VYIA 1CW5A 1L4AC 3AEBC 3M9QA 1QGKB 1GW4A 2QSIA 3H1KG 2V7QJ 2AEJA 2E74B 3KZIE 4NPDA 2OYOA 2N9BA 5DJTB 3Q2YA 3EQ2A 4R4LA 3KHUA 4BWNA 4HJGH 1HVVA 1NKNA 1JCCA 4IL6E 1LT9C 5KLIB 3B5NA 3GF7A 2H43A 1RF1C 3AEAC 2YIUC 5AW6B 1NTMJ 1PGPA 3D70A 2E76D 1PFIA 4L74A 3WU2H 1OXZA 2FXOA 1EDKA 1JY3N 3BCCJ 2B87B 1MKMA 3H1IJ 3Q5RA 1PPJG 1YJWP 1FC2C 3RK3C 1HGVA 2I8DA 1FZGA 3VMYA 1CZQA 1GW3A 3R4YA 2A45H 2WITA 4DJGA 2R5BA 3CCVP 3CWBG 2QE7H 3SWKA 1FDIA 3TNUA 2SPZA 4C7NA 1NTKK 3GLMA 2Q3IA 3HE5A 2K9JB 1N73B 2LXCB 1URQB 2JEEA 4IFMA 1URQD 4IFFA 3V4QA 4H13D 3L37A 3FX0A 3L72J 1J1DB 3FGAD 3JCUE 5H2FE 1P84D 3BATA 1EXIA 3KDPB 4NPFX 2NPSA 3HE4A 2Z5HA 1PGJA 4C46A 4H44B 4H44D 3L74G 4WWIA 2E5YA 1L0NG 4U3FD 1PGQA 3Q5PA 1QX8A 1KILA 5L8RJ 2G3AA 3L36A 2I1JA 5GTHE 4IFDK 1L4AB 4HKZH 2HODB 2K1AA 1L4AD 2Q6QA 1M1JB 5B5EH 3QWOC 4ZMDA 1LTBC 3GMAA 3H1LD 4I2LC 2MJZA 2ITAA 5E79E 1HJ0A 1LT9B 3H6PA 1A02F 3W68A 5AVRB 1HJBA 1S5LX 1G1IA 5CHXA 4C7RA 1NTMK 1GZLA 3B5NC 2P2UA 4L73A 1Q86Q 5AW8B 4RJTA 4GOFA 1KILE 4WY4A 2IX7C 1GD2E 1JEKA 3M91A 4L75A 1W2BO 2G8YA 1NTME 3TGUD 4N3YB 3MD0A 4U7JA 2NRGA 5KLVD 3GHGB 4GKGA 3L74E 1RF0A 1L0NE 5DJUB 1SQXJ 4DOJA 4LLHA 1SQBJ 4GIFA 3F5HA 1NH4A 1W5CE 3BCCE 2WPVB 1JM0A 3RK3D 4TLFA 5AW2B 2OTJP 1SQVJ 4KHXA 3H1IE 3AEEC 2PAJA 4PJ0H 1RQVA 3CCSP 3A3YB 5AVSB 2YO3A 1EQ7A 1Q90D 1S5LE 1OX3A 1NU1K 1OW7A 1ZLLA 3AE5C 2HG5D 1OMIA 5TJHA 4EI2A 2KNCA 3VN0A 4W80A 3CCUP 2P67A 3FWLA 1ZP0C 2P7JA 1NTZJ 5TISH 1FOSE 2NPSC 1NWQA 2ZT9C 2J59M 1SFCC 3L72E 1LP1B 3Q1MA 5CBNA 1LGHB 2Z5IA 1GDTA 1GL2A 1BDDA 4DT0A 1K8AQ 1M1KQ 4EIJA 4LC1A 1JTHA 5KAFE 4PD4H 5KAIH 1UIXA 5APXA 2O1JA 5CJ4A 1YBKA 1FZCA 2YKOA 1T3UA 3B5NB 3WUUA 3B5ND 1FZFA 1QVFO 5AW5B 3AEGC 5CCGA 2KZIA 4WY4C 1AQ5A 2GUVA 1DIPA 1KYOE 1IZNB 4EDFA 3EFFK 4MN4C 4U3FG 1SQXK 3V2QA 1SQBK 3CD6P 3O6QA 1K9MQ 1RF0C 1LTJA 5GTIE 1X79B 1PIXA 2H7HA 1HH0A 2IBZI 3JSVC 1VQOP 2JKVA 3H1LG 1SQXE 5APTA 2Q5UA 1GU4A 1SQBE 3MUDA 1Y9BA 4JPZB 3MP7B 3GW6A 1SQPK 1VQKP 1RE3A 2ZAEB 1NGMB 3CX5E 1SQVE 2J5UA 3HE5B 1VQ6P 1SLQA 1HWTC 3RK2C 1DEEG 2M0BA 2KK7A 1SQQJ 1EDLA 3V2RA 1KB9E 1NTZK 2W90A 1VF5C 2NPSB 1ZN5A 3HE4B 2NPSD 1L0LE 1TU3F 3CC2P 2ZT9D 1N8RQ 1OWAA 3TGUG 3AE2C 2NZ2A 1KILB 5KLVG 1KILD 2FKWB 1N2DC 1UIIA 1GL2C 2Y9YA 1JNMA 1IFMA 1NTMD 2JDIH 5APWA 3GG2A 2W8ZA 3L74D 3A0HH 4WB4A 1L0ND 3OAKA 2R5DA 2JR8A 1LTGC 1M90Q 4Y99C 1FZCC 3BCCD 4H0LB 3WU2E 3O8ZA 2XDJA 1AQTA 1EZVE 3H1ID 1RH5B 4WBAA 2O01H 1QL1A 1OFCX 1WT6A 4WY4B 5CCGC 4WY4D 2IPPA 1H89A 3C9IA 1VQNP 3SSUA 5BVZA 2W6BA 1DD4A 1H0TA 2YMKA 3WMM0 3M0AA 1RQUA 2KS1A 3H1HJ 4Z1MH 5AW0B 1NTKJ 5CCHA 2WMMA 4OH8B 1VL2A 3S4RA 3AE7C 1LTJC 3HUSB 3TDKA 2N1TA 2ZVNB 5AVXB 3CXHI 1Z56A 2BASA 3H1JJ 3L72D 1BE3J 3RK3E 1X8YA 3B71A 2XU6A 3RL0C 3MUDC 1XTGB 2FYNC 5KTBA 1ZV8A 3K5BA 1N86A 2KI7B 2WT7A 1RE3C 1NAYA 2R3CA 3RK2B 1JY2O 3FXEA 3RK2D 3VMAA 1SQQK 3AE8C 1OZHA 2WPQA 2E75C 1AJYA 1VF5D 2H89C 4D6TJ 3LW5H 3TYYA 4GT1A 5KKZB 1WRGA 1GTWA 2AXTH 3PJSK 2IFNA 5B5EE 2JWDA 5KJ7A 1NVOA 1SQQE 3E7KA 2JJLA 2WTYA 1U7MA 2K9YA 1FU1A 2WPRA 4W7YA 1GL2B 1KYOD 2E76B 1GL2D 2P58A 3PP5A 1JTHB 3U59A 2Y0CA 4Y99B 1K73Q 2K3RA 3C1LA 1KTMA 2OYIC 3L70J 3I56P 3QH9A 1SQXD 3PTZA 3V6IA 1YQ4C 1SQBD 2Q3EA 1R5SA 1KN7A 1NOHA 5CCGD 4R4MA 4ZNCA 5AVUB 1LT1A 3CX5D 2QM8A 1SQVD 2BEQD 3M9BA 3G71P 1L2PA 2D2CC 4IOIH 3VP8A 4ZKPA 2E43A 1T3JA 2BCCJ 1S72P 1KB9D 1NU1J 3O6QB 4H13B 4PJ0E 1S9KE 5CCHC 2WSFJ 3MHVA 2O1KA 1A02J 1L0LD 2OTLP 2ZJSE 1NTMG 2QJPC 2N1TC 1IFDA 3H1HE 1M8OB 1NTKE 1SFCA 3RL0B 3RL0D 3KXDA 1NTZD 2KUBA 2R44A 2FYNB 3BCCG 3H1JE 1IK9A 1BE3E 5TISE 4I1LA 1HBWA 1N7SA 2E75B 2OGUA 3H1IG 2E75D 1W2EA 3V2NA 5B66E 4DCKA 2VRSA 3HTKA 3IR9A 2PRRA 3NTNA 3T97A 1T2KC 1OVRA 1VQ8P 3OA7A 1EZVD 2FFDA 1FZEA 1HF9A 1RF1B 1X22A 2YIUB 2HPCA 3B4SA 5KJ7C 4PD4E 1HUCA 4D6TE 1KMIZ 1YTZT 1P84I 2O01J 3NMDA 1MFZA 2M3EA 5APVA 3RBZA 3JC22 3L71J 3L72G 1SS1A 2JO1A 3IN6A 1USDA 2OTKE 2M3BA 2E42A 3VMXA 3RK3B 2IYPA 3PH0A 3PLNA 4GDOA 2BEZF 3II6A 1YQ3C 1HGZA 4Y28J 1SP4A 2D2CB 2D2CD 1ZW0A 1H0TB 4N6JA 4CPGA 3CCRP 1SQPJ 2KS1B 3L35A 3ZDMA 4BRYA 1VQ7P 4OWFA 5CCHD 1JY3P 1JY2N 3JCUH 2YMYA 1PP9J 2QJPB 3D6YA 2N1TB 3AECC 3LW5J 2N1TD 2FYUJ 2ZVOB 2M5AA 2BCCE 1SQQD 2XKMA 1NU1E 3B8EB 1VDFA 1KQGB 1X9VA 3HRNA 2KYVA 1Q2NA 3CMAP 1R8EA 1SVFA 3CLQA 4BXLA 1BCCJ 1S2EA 2POHA 5APQA 3L75J 2WT7B 3M0DA 4KJMA 1ZR2A 1LJ2A 3CC4P 5AW9B 1SQXG 3TK1A 1N7SC 1Q7YQ 1SQBG 1FZBA 5E79H 1T2KD 3CMEP 1FDMA 1SQVG 1YIJP 2C9NY 4B86A 2XNDH 3AEDC 4OGQC 2FFDC 1ZR4A 5KJ7D 4XA4A 4XE5B 2KLVA 4L76A 1RHZB 1OVUA 1MV8A 2CPSA 3C8VA 1L0LG 2QM7A 2C0WA 2CK3H 1S9KD 1ZMEC 1XTCC 1NTZG 3AEFC 1K05A 2LXBA 3CXHH 2UWJE 3CCEP 2KOGA 1NO4A 3L73J 2KP8A 3L71E 2L91A 3CL3D 1PV3A 3H1HD 1VQ4P 2KSJA 1NTKD 1VQ9P 3D6ZA 3MZWB 3Q3DA 2QVAA 3IAOA 4I7ZC 2YNYA 1BGYJ 1ZOYC 3G3ZA 3U1AA 1R5LA 3H1JD 1Y8AA 1BE3D 2J58A 5AVVB 2N9YB 2L5GB 2OARA 1EZVG 3TNUB 4C7NB 1M57D 1G1JA 3PRJA 3AE3C 2QEXP 2V4HA 4A7PA 5AW4B 2FYUK 1SQPE 1VQLP 3E1IA 1OIPA 1PGOA 2ZT9B 1PZQA 2W27A 1SFCB 3TSIA 4PD4D 1USEA 4D6TD 1SFCD 3A0BH 3VMZA 4YPCA 1FBMA 2C9LY 3OJAB 1PP9E 2KB7P 2E74C 2A45G 2ZXEB 3GF3A 1N7LA 5BU5A 1NTZE 4JF7A 1LTIC 1LTAC 1HTLC 3A7OA 1AA0A 4ASWA 1OW8A 2AXTE 1IFPA 3IFMA 3M0DC 1IO4A 5CJ0A 1BCCE 4AYCA 2DW3A 1AFOA 3CCMP 3HTKB 3L75E 3T97B 2ZYDA 1FJKA 4ASVA 2OYIA 3CCQP 4LGDE 4OGQB 2FFDB 1E5WA 1JY2P 2FXPA 4OGQD 4NPEA 2HPCB 1KFNA 3PHLA 1FE6A 1EDIA 2AXCA 4DZOA 4K35A 2JP3A 3GHGA 2Q7CA 3H1KJ 5M1BA 1KQSO 1SQQG 1LTSC 5AW1B 1T6AA 5KLVK 1YITP 4RKUJ 2PGDA 4W7ZA 2BCCD 1NU1D 3NXSA 2KXPB 4OVNF 1S3JA 4K3AA 5CBOA 2QRXA 2A06E 3ITKA 1D7MA 1YI2P 4AQRD 3L73E 1FDOA 4YTPC 2FBWC 1LWUA 2WSEH 3FXDA 2YXRB 2Q1KA 2MKVA 1YJNP 1BGYE 1KZUB 1IJDB 4O9BA 2HFED 2KNCB 1VF5B 2O3JA 2R3SA 1LTTC 1MZ9A 2ZYGA 2Z4EA 2IDBA 4QMAA 3I55P 2M5AB 1P84H 3P8MC 3F89A 2W83C 3CPWO 3G4SP 1M1JC 5CMZA 1FAVA 3CWBJ 2E74D 1IFIA 1PL5A 1NYHA 2QG4A 3G9RA 1QLED 1DH3A 1IC2A 3H1HG 1NTKG 1MFTA 2QA4P 3CI9A 3MTUE 4GODA 3D71A 4UB8H 3UIAA 1CI6A 1FZCB 3L71D 3H1JG 3L74J 2ZYAA 1BE3G 1L0NJ 1YTZI 3HD7A 1G2CA 3M9HA 4XFJA 2B9BA 3P8CE 2IBZE 4JYCA 3MGNA
chains in the Genus database with same CATH topology
3GHGC 2ZFCA 2WZ7A 3BRVB 3RK3B 1SQXK 4AUWA 2GUSA 3V2QA 3VOPA 1SQBK 3V2PA 2WPSA 3II6A 3P7KA 1RF0C 1LTJA 2YKQA 2XZRA 4JYBA 3M06A 1X79B 1HGZA 2H7HA 1HH0A 1SP4A 1LTJB 1JCDA 1N73C 4N6JA 1URQC 2P1JA 3I5CA 5APTA 2Q5UA 1GU4A 3MUDA 3L35A 4RESB 1J1DC 5CCHD 1JY3P 1SQPK 1RE3A 1JY2N 1VPCA 2YMYA 3HE5B 2N1TB 3R2PA 1SLQA 5AVQB 2N1TD 1RE4C 1HWTC 3RK2C 3KQGA 1KFMA 2XKMA 1LWUC 3LIDA 3B8EB 1VDFA 2FYZA 1FZAA 1X9VA 3V2RA 1NTZK 2YO2A 3HRNA 4M3LA 2KYVA 2WWWA 3VYIA 1CW5A 1L4AC 1SVFA 3CLQA 2NPSB 1ZN5A 3HE4B 3M9QA 2NPSD 1GW4A 2POHA 5APQA 1J1EC 1OWAA 2WT7B 2R32A 3M0DA 2N9BA 1ZR2A 5AVTB 1KILB 5AW9B 3EQ2A 3H32A 1KILD 3TK1A 1N7SC 1HVVA 1M7LA 1NKNA 1JCCA 1FZBA 1LT9C 1CSBA 3B5NA 1T2KD 2FKWB 1H88A 3SWFA 1N2DC 1FOSF 1GL2C 1JNMA 1IFMA 2LKMA 2H43A 1RF1C 1FDMA 3L4FA 2W6AA 5APWA 5AW6B 2C9NY 4B86A 1NAFA 2FFDC 4WB4A 1ZR4A 2WSCH 3OAKA 5KJ7D 2R5DA 4XA4A 1LTGC 1PFIA 2OYHA 4XE5B 2KLVA 4HYTB 1YYCA 4Y99C 1FZCC 3A5TA 2Q9IA 3LIEA 1OXZA 1MV8A 2CPSA 1JY3N 3O8ZA 1L0NK 2XDJA 2QM7A 2OYIB 2C0WA 3V4WA 4WBAA 2O01H 1QL1A 5AW3B 1WT6A 3HD7C 3EFGA 3SWYA 1S9KD 1NHLA 4WY4B 1XTCC 4WY4D 5CCGC 2IPPA 1H89A 3BVHA 3C9IA 4EOTA 5BVZA 3RK3C 2W6BA 1HGVA 2KOGA 1NO4A 1FZGA 2KP8A 3CL3D 3WMM0 2KSJA 3M0AA 3VMYA 3KYQA 3HUSA 1CZQA 1GW3A 5AW0B 5CCHA 2A45H 2WITA 2R5BA 4OH8B 3U1CA 2YNYA 1JMMA 1LTJC 3HUSB 3TNUA 4N78E 4C7NA 3G3ZA 3U1AA 1NTKK 2Q3IA 3HE5A 4HH2A 2N1TA 1N73B 3KPEA 1IFNA 1URQB 2J58A 5AVXB 5AVVB 5AVZB 2JEEA 4IFMA 1URQD 1Z56A 2BASA 2L5GB 2OARA 4IFFA 3V4QA 3TNUB 4C7NB 3L37A 1X8YA 5AVWB 1J1DB 2XU6A 3RL0C 3V5BA 1G1JA 3BATA 3KDPB 1XTGB 2NPSA 3HE4A 2Z5HA 5KTBA 2A45I 1ZV8A 4C46A 2HLOA 1N86A 5AW4B 2FYUK 2WT7A 1RE3C 2R3CA 3RK2B 1JY2O 3E1IA 3RK2D 1LWUB 1KILA 1SQQK 2W27A 2WPQA 1SFCB 3L36A 3TSIA 1MUUA 2I1JA 1SFCD 1DEBA 4IFDK 3VMZA 5AW7B 1L4AB 1FBMA 2CPBA 2C9LY 3OJAB 3LW5H 2HODB 1L4AD 2KB7P 3TYYA 1M1JB 2A45G 4GT1A 2ZXEB 1J1EB 1N7LA 1WRGA 5BU5A 1GTWA 4JF7A 1LTIC 1LTAC 1HTLC 2H8PD 1LTBC 3A7OA 1KILC 2IFNA 1JOCA 4I2LC 2MJZA 5KJ7A 3IFMA 3M0DC 2JJLA 2WTYA 1IO4A 5CJ0A 1LT9B 3P8CD 3H6PA 1FU1A 1A02F 2WPRA 4W7YA 5AVRB 1GL2B 4AYCA 1HJBA 1AFOA 3A2AA 3HTKB 1G1IA 1GL2D 5CHXA 4C7RA 1NTMK 1GZLA 3B5NC 1FJKA 2OYIA 4LGDE 2FFDB 2P2UA 1E5WA 1JY2P 3PP5A 1JTHB 5AW8B 3U59A 5APYA 2HPCB 1KFNA 4WY4A 1H8AA 4Y99B 4DZOA 2IX7C 2I1KA 1GD2E 3M91A 2OYHC 3GHGA 2Q7CA 2OYIC 4ZKUA 1CI6B 4N3YB 3MD0A 1J2JB 1JY3O 3GHGB 2XNXA 4GKGA 5AVYB 1RF0A 3HD7B 5APUA 1GU5A 1G2CB 3HD7D 3MIWA 2HYNA 4DOJA 4LLHA 1LTSC 1T8ZA 4GIFA 1NOHA 5CCGD 5AVUB 5AW1B 1NH4A 3RK3D 2QM8A 1N73A 5KLVK 5AW2B 1URQA 3M9BA 3VP8A 4KHXA 4W7ZA 2PAJA 3NXSA 4ZKPA 1RY3A 2E43A 1T3JA 3A3YB 1SQVK 3HUSC 2YO3A 5AVSB 1S9KE 1EQ7A 5CCHC 2C0XA 2XV5A 4AQRD 1GK4A 2O1KA 1A02J 1NU1K 1RE4A 1LWUA 1ZLLA 2N1TC 2HG5D 1IFDA 2WSEH 1SFCA 1DX7A 3RL0B 3RL0D 3VN0A 1L0LK 1JUNA 1L4AA 4W80A 2HODA 2P67A 1IFJA 1QL2A 1KZUB 1IJDB 2P7JA 1M1JA 4O9BA 2HFED 3NFQA 1FOSE 2YKPA 2NPSC 2WSFH 1LTTC 1KQLA 1MZ9A 1NWQA 2Z4EA 1IK9A 2J59M 1FJPA 1SFCC 4I1LA 3BASA 1HBWA 5APSA 1N7SA 1LGHB 3P8MC 1GK6A 1W2EA 3V2NA 1LT9A 1M1JC 2Z5IA 5CMZA 1GDTA 1GL2A 1FAVA 2VRSA 1N7SB 3HTKA 1IFIA 1RF1A 1N7SD 3IR9A 3NTNA 3T97A 1T2KC 3OA7A 4I6MC 2FFDA 1FZEA 4EIJA 1DH3A 3VP9A 4LC1A 1JTHA 3BRTB 1RF1B 1IC2A 2M8RA 2HPCA 5APXA 2O1JA 5KJ7C 1HUCA 3H32B 5CJ4A 1FZCA 1YTZT 3CI9A 3MTUE 1JO5A 3NMDA 2YKOA 1T3UA 3UIAA 3B5NB 1CI6A 5BU8B 1FZCB 1MFZA 3B5ND 5APVA 1YTZI 1FZFA 3VTPC 3HD7A 3N4XA 2GM4A 1G2CA 5AW5B 2IFMA 3M9HA 3N7NA 5CCGA 3P32A 2FXMA 3P8CE 4WY4C 1AQ5A 2OYHB 2PP6A 2GUVA 4N78D 2M3BA 1NKZB 2E42A 4JYCA 3MGNA 3VMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XV5 A;  2ZFC A;  4AQR D;  3VMZ A;  1GK4 A;  1A02 J;  5AW7 B;  2C9L Y;  3OAK A;  3TYY A;  2R5D A;  4AUW A;  4GT1 A;  2ZXE B;  4XE5 B;  4HYT B;  1YYC A;  1GTW A;  2WPS A;  3A5T A;  3P7K A;  3LIE A;  1OXZ A;  3A7O A;  1MV8 A;  2XZR A;  3O8Z A;  4JYB A;  4I2L C;  3M06 A;  3VN0 A;  2QM7 A;  1JUN A;  2H7H A;  2P67 A;  1SP4 A;  2JJL A;  3V4W A;  2WTY A;  2P7J A;  1IO4 A;  3NFQ A;  5AW3 B;  1FOS E;  1A02 F;  1KQL A;  2WPR A;  5AVR B;  1NWQ A;  4AYC A;  3I5C A;  1S9K D;  1HJB A;  3A2A A;  5APT A;  2Q5U A;  1GU4 A;  2IPP A;  1HBW A;  1GZL A;  3L35 A;  5APS A;  4RES B;  1H89 A;  4EOT A;  3P8M C;  1GK6 A;  2P2U A;  5AW8 B;  2KP8 A;  5APY A;  2Z5I A;  5CMZ A;  1FAV A;  2VRS A;  3M0A A;  3HE5 B;  3HTK A;  1H8A A;  3VMY A;  3IR9 A;  3NTN A;  3T97 A;  1SLQ A;  1CZQ A;  4DZO A;  5AVQ B;  1T2K C;  5AW0 B;  1GD2 E;  1HWT C;  3M91 A;  2R5B A;  3KQG A;  4I6M C;  3LID A;  2Q7C A;  1DH3 A;  4LC1 A;  3B8E B;  1CI6 B;  2YNY A;  3TNU A;  3MD0 A;  2YO2 A;  4C7N A;  5APX A;  4M3L A;  1J2J B;  2WWW A;  3HE5 A;  2Q3I A;  3VYI A;  1HUC A;  5AVX B;  3HE4 B;  4GKG A;  5AVV B;  5AVY B;  5AVZ B;  5APU A;  2BAS A;  1GU5 A;  1G2C B;  3V4Q A;  5APQ A;  3TNU B;  3NMD A;  1OWA A;  4C7N B;  3L37 A;  2WT7 B;  2R32 A;  3UIA A;  3M0D A;  1CI6 A;  1X8Y A;  5AVW B;  2XU6 A;  5AVU B;  5AW1 B;  1MFZ A;  2N9B A;  3V5B A;  5AVT B;  5APV A;  2QM8 A;  5AW9 B;  3KDP B;  5AW2 B;  3TK1 A;  3HE4 A;  2Z5H A;  3M9B A;  3VTP C;  4C46 A;  5AW5 B;  4KHX A;  3M9H A;  5AW4 B;  2WT7 A;  1CSB A;  3P32 A;  2R3C A;  1T2K D;  3NXS A;  1H88 A;  3SWF A;  1FOS F;  4JYC A;  2E43 A;  1JNM A;  3A3Y B;  2W27 A;  2W6A A;  2YO3 A;  5APW A;  5AVS B;  2WPQ A;  1S9K E;  5AW6 B;  2C9N Y;  4B86 A;  3L36 A;  2E42 A;  1MUU A;  1NAF A;  3MGN A;  3VMX A; 
#chains in the Genus database with same CATH topology
 3GHG C;  2WZ7 A;  3BRV B;  2QJY C;  2K37 A;  4PV1 C;  2GUS A;  3V2P A;  1U7J A;  4D6T G;  3M06 A;  1WMK A;  1KYO I;  3H1K E;  2E5T A;  4YXD C;  1LTJ B;  3Q5S A;  1JCD A;  1SQP D;  3I5C A;  1YHQ P;  4RES B;  1AVO A;  2KLU A;  1PP9 D;  1ZRT E;  2QIW A;  2FYU D;  4UB6 H;  3KQG A;  2PFX A;  1LWU C;  3AE6 C;  2FYZ A;  2QJK C;  1FZA A;  2YO2 A;  1BCC D;  1BSN A;  3EWK A;  5K5G B;  2FY8 A;  3KZI H;  3L75 D;  3CX5 I;  3L70 G;  1E79 H;  1J1E C;  2R32 A;  5AVT B;  4IL6 H;  3H32 A;  1M7L A;  1KB9 I;  1PPJ E;  1CSB A;  1EDJ A;  1H88 A;  3SWF A;  1FOS F;  5KAI E;  1IK7 A;  2LKM A;  2K88 A;  3L4F A;  2W6A A;  3FWN A;  3G6E P;  1NAF A;  1VQP P;  2JWA A;  2BCC G;  2OQQ A;  2WSC H;  1NU1 G;  3S1K A;  3CWB E;  2P10 A;  2OYH A;  4HYT B;  1YYC A;  3A5T A;  2Q9I A;  3LIE A;  1LNQ A;  1L0N K;  4JBZ A;  4JQ0 D;  2OYI B;  3V4W A;  5AW3 B;  3TF5 A;  4GOE A;  3AE9 C;  3HD7 C;  3EFG A;  3SWY A;  1NHL A;  4YXW H;  2A06 D;  3SFD C;  3WUV A;  3BVH A;  2B88 A;  3L73 D;  4EOT A;  3CXH E;  1QVG O;  2QJY B;  4PV1 B;  2Y0D A;  1EZV I;  4PV1 D;  3L70 E;  2AEM A;  3KYQ A;  1GMJ A;  2B89 A;  3HUS A;  2HR3 A;  3CCL P;  1BGY D;  2WSE J;  3U1C A;  1Q82 Q;  1JMM A;  4N78 E;  1OVV A;  4HH2 A;  3KPE A;  1IFN A;  5AVZ B;  3RL0 g;  5H2F H;  5C39 A;  1S4X A;  5AVW B;  3V5B A;  2IZ0 A;  1L0L J;  1YJ9 P;  2A45 I;  2HLO A;  1AVY A;  3L71 G;  1LWU B;  5GTH H;  4U3F J;  2QJK B;  1VQM P;  1MUU A;  1DEB A;  5AW7 B;  2CPB A;  2WSS H;  3A0B E;  2KIK A;  5B66 H;  1EC5 A;  1J1E B;  2GA1 A;  2H8P D;  1KIL C;  1JOC A;  1AV1 A;  3H1L J;  2V7Q H;  3P8C D;  2W6J H;  1KV4 A;  2IBZ D;  3A2A A;  4TT3 H;  4WVZ A;  3A0H E;  2B87 A;  1SQP G;  4KT0 J;  2Y0E A;  5APY A;  1Y47 A;  5EFW B;  1H8A A;  4H0L C;  2I1K A;  1Q81 Q;  1PP9 G;  2OYH C;  3H1K D;  4ZKU A;  1CI6 B;  3SFE C;  1KOR A;  2KSE A;  2FYU G;  1J2J B;  3TGU J;  1JY3 O;  2XNX A;  5AVY B;  3HD7 B;  5APU A;  1X0T A;  1G2C B;  1GU5 A;  3HD7 D;  3MIW A;  5KLV J;  2HYN A;  1T8Z A;  1BCC G;  2IZ1 A;  2K9J A;  1ZRT D;  1N73 A;  1URQ A;  3L75 G;  1KD1 Q;  1QEX A;  2Y9Z A;  4EYY Q;  1RY3 A;  2RKL A;  1VQ5 P;  1SQV K;  1S5L H;  3HUS C;  3USS A;  3H25 A;  1EXJ A;  2C0X A;  2XV5 A;  1GK4 A;  2RN0 A;  3AE4 C;  1RE4 A;  4RO0 A;  2KZJ A;  1DX7 A;  3W67 A;  1L0L K;  2IYO A;  1JUN A;  1JB0 J;  1L4A A;  2HOD A;  1PPJ D;  1IFJ A;  1BDC A;  1QL2 A;  1M1J A;  3ABV C;  3NFQ A;  1JMB A;  2YKP A;  2WSF H;  1KQL A;  3CC7 P;  1FJP A;  2ZXX A;  3BAS A;  5APS A;  2FYU E;  1GK6 A;  3CWB D;  1LT9 A;  1DD3 A;  1P84 E;  1BSH A;  5KKZ C;  1N7S B;  1S1C X;  2A06 G;  1RF1 A;  1N7S D;  2WSC J;  5KLI C;  3L73 G;  5KAF H;  4I6M C;  4U3F E;  3VP9 A;  3BRT B;  2M8R A;  2AEF A;  3RGU A;  3H32 B;  3WUT A;  1FS0 E;  2E76 C;  1U57 A;  1BGY G;  1JO5 A;  2YXQ B;  5BU8 B;  3CXH D;  4UB8 E;  3H1L E;  1M56 D;  3L70 D;  3S9O A;  3VTP C;  3N4X A;  2WVR A;  2GM4 A;  2IFM A;  2LR2 A;  3RBX A;  3N7N A;  3P32 A;  1KYO H;  4PD4 I;  2H88 C;  4H0L D;  2FXM A;  2OYH B;  2PP6 A;  4N78 D;  1KQF B;  1NKZ B;  2ZFC A;  2RMZ A;  4AUW A;  3VOP A;  2RH0 A;  5GTI H;  1OW6 A;  2WPS A;  3CCJ P;  3P7K A;  2YKQ A;  2XZR A;  4JYB A;  3E1R A;  4IL6 X;  4I7Z B;  3IF4 A;  3TGU E;  1N73 C;  1URQ C;  2P1J A;  2O01 N;  4H13 C;  5KLV E;  1K04 A;  1J1D C;  3OW2 O;  3CX5 H;  3AE1 C;  1VPC A;  2IBZ G;  4BRY B;  1ZXG A;  3R2P A;  4H44 C;  1KC8 Q;  1NJI Q;  5AVQ B;  4HB1 A;  1RE4 C;  1LP1 A;  2WQY C;  1KB9 H;  1KFM A;  3LID A;  4UB6 E;  4M3L A;  2WWW A;  3VYI A;  1CW5 A;  1L4A C;  3AEB C;  3M9Q A;  1QGK B;  1GW4 A;  2QSI A;  3H1K G;  2V7Q J;  2AEJ A;  2E74 B;  3KZI E;  4NPD A;  2OYO A;  2N9B A;  5DJT B;  3Q2Y A;  3EQ2 A;  4R4L A;  3KHU A;  4BWN A;  4HJG H;  1HVV A;  1NKN A;  1JCC A;  4IL6 E;  1LT9 C;  5KLI B;  3B5N A;  3GF7 A;  2H43 A;  1RF1 C;  3AEA C;  2YIU C;  5AW6 B;  1NTM J;  1PGP A;  3D70 A;  2E76 D;  1PFI A;  4L74 A;  3WU2 H;  1OXZ A;  2FXO A;  1EDK A;  1JY3 N;  3BCC J;  2B87 B;  1MKM A;  3H1I J;  3Q5R A;  1PPJ G;  1YJW P;  1FC2 C;  3RK3 C;  1HGV A;  2I8D A;  1FZG A;  3VMY A;  1CZQ A;  1GW3 A;  3R4Y A;  2A45 H;  2WIT A;  4DJG A;  2R5B A;  3CCV P;  3CWB G;  2QE7 H;  3SWK A;  1FDI A;  3TNU A;  2SPZ A;  4C7N A;  1NTK K;  3GLM A;  2Q3I A;  3HE5 A;  2K9J B;  1N73 B;  2LXC B;  1URQ B;  2JEE A;  4IFM A;  1URQ D;  4IFF A;  3V4Q A;  4H13 D;  3L37 A;  3FX0 A;  3L72 J;  1J1D B;  3FGA D;  3JCU E;  5H2F E;  1P84 D;  3BAT A;  1EXI A;  3KDP B;  4NPF X;  2NPS A;  3HE4 A;  2Z5H A;  1PGJ A;  4C46 A;  4H44 B;  4H44 D;  3L74 G;  4WWI A;  2E5Y A;  1L0N G;  4U3F D;  1PGQ A;  3Q5P A;  1QX8 A;  1KIL A;  5L8R J;  2G3A A;  3L36 A;  2I1J A;  5GTH E;  4IFD K;  1L4A B;  4HKZ H;  2HOD B;  2K1A A;  1L4A D;  2Q6Q A;  1M1J B;  5B5E H;  3QWO C;  4ZMD A;  1LTB C;  3GMA A;  3H1L D;  4I2L C;  2MJZ A;  2ITA A;  5E79 E;  1HJ0 A;  1LT9 B;  3H6P A;  1A02 F;  3W68 A;  5AVR B;  1HJB A;  1S5L X;  1G1I A;  5CHX A;  4C7R A;  1NTM K;  1GZL A;  3B5N C;  2P2U A;  4L73 A;  1Q86 Q;  5AW8 B;  4RJT A;  4GOF A;  1KIL E;  4WY4 A;  2IX7 C;  1GD2 E;  1JEK A;  3M91 A;  4L75 A;  1W2B O;  2G8Y A;  1NTM E;  3TGU D;  4N3Y B;  3MD0 A;  4U7J A;  2NRG A;  5KLV D;  3GHG B;  4GKG A;  3L74 E;  1RF0 A;  1L0N E;  5DJU B;  1SQX J;  4DOJ A;  4LLH A;  1SQB J;  4GIF A;  3F5H A;  1NH4 A;  1W5C E;  3BCC E;  2WPV B;  1JM0 A;  3RK3 D;  4TLF A;  5AW2 B;  2OTJ P;  1SQV J;  4KHX A;  3H1I E;  3AEE C;  2PAJ A;  4PJ0 H;  1RQV A;  3CCS P;  3A3Y B;  5AVS B;  2YO3 A;  1EQ7 A;  1Q90 D;  1S5L E;  1OX3 A;  1NU1 K;  1OW7 A;  1ZLL A;  3AE5 C;  2HG5 D;  1OMI A;  5TJH A;  4EI2 A;  2KNC A;  3VN0 A;  4W80 A;  3CCU P;  2P67 A;  3FWL A;  1ZP0 C;  2P7J A;  1NTZ J;  5TIS H;  1FOS E;  2NPS C;  1NWQ A;  2ZT9 C;  2J59 M;  1SFC C;  3L72 E;  1LP1 B;  3Q1M A;  5CBN A;  1LGH B;  2Z5I A;  1GDT A;  1GL2 A;  1BDD A;  4DT0 A;  1K8A Q;  1M1K Q;  4EIJ A;  4LC1 A;  1JTH A;  5KAF E;  4PD4 H;  5KAI H;  1UIX A;  5APX A;  2O1J A;  5CJ4 A;  1YBK A;  1FZC A;  2YKO A;  1T3U A;  3B5N B;  3WUU A;  3B5N D;  1FZF A;  1QVF O;  5AW5 B;  3AEG C;  5CCG A;  2KZI A;  4WY4 C;  1AQ5 A;  2GUV A;  1DIP A;  1KYO E;  1IZN B;  4EDF A;  3EFF K;  4MN4 C;  4U3F G;  1SQX K;  3V2Q A;  1SQB K;  3CD6 P;  3O6Q A;  1K9M Q;  1RF0 C;  1LTJ A;  5GTI E;  1X79 B;  1PIX A;  2H7H A;  1HH0 A;  2IBZ I;  3JSV C;  1VQO P;  2JKV A;  3H1L G;  1SQX E;  5APT A;  2Q5U A;  1GU4 A;  1SQB E;  3MUD A;  1Y9B A;  4JPZ B;  3MP7 B;  3GW6 A;  1SQP K;  1VQK P;  1RE3 A;  2ZAE B;  1NGM B;  3CX5 E;  1SQV E;  2J5U A;  3HE5 B;  1VQ6 P;  1SLQ A;  1HWT C;  3RK2 C;  1DEE G;  2M0B A;  2KK7 A;  1SQQ J;  1EDL A;  3V2R A;  1KB9 E;  1NTZ K;  2W90 A;  1VF5 C;  2NPS B;  1ZN5 A;  3HE4 B;  2NPS D;  1L0L E;  1TU3 F;  3CC2 P;  2ZT9 D;  1N8R Q;  1OWA A;  3TGU G;  3AE2 C;  2NZ2 A;  1KIL B;  5KLV G;  1KIL D;  2FKW B;  1N2D C;  1UII A;  1GL2 C;  2Y9Y A;  1JNM A;  1IFM A;  1NTM D;  2JDI H;  5APW A;  3GG2 A;  2W8Z A;  3L74 D;  3A0H H;  4WB4 A;  1L0N D;  3OAK A;  2R5D A;  2JR8 A;  1LTG C;  1M90 Q;  4Y99 C;  1FZC C;  3BCC D;  4H0L B;  3WU2 E;  3O8Z A;  2XDJ A;  1AQT A;  1EZV E;  3H1I D;  1RH5 B;  4WBA A;  2O01 H;  1QL1 A;  1OFC X;  1WT6 A;  4WY4 B;  5CCG C;  4WY4 D;  2IPP A;  1H89 A;  3C9I A;  1VQN P;  3SSU A;  5BVZ A;  2W6B A;  1DD4 A;  1H0T A;  2YMK A;  3WMM 0;  3M0A A;  1RQU A;  2KS1 A;  3H1H J;  4Z1M H;  5AW0 B;  1NTK J;  5CCH A;  2WMM A;  4OH8 B;  1VL2 A;  3S4R A;  3AE7 C;  1LTJ C;  3HUS B;  3TDK A;  2N1T A;  2ZVN B;  5AVX B;  3CXH I;  1Z56 A;  2BAS A;  3H1J J;  3L72 D;  1BE3 J;  3RK3 E;  1X8Y A;  3B71 A;  2XU6 A;  3RL0 C;  3MUD C;  1XTG B;  2FYN C;  5KTB A;  1ZV8 A;  3K5B A;  1N86 A;  2KI7 B;  2WT7 A;  1RE3 C;  1NAY A;  2R3C A;  3RK2 B;  1JY2 O;  3FXE A;  3RK2 D;  3VMA A;  1SQQ K;  3AE8 C;  1OZH A;  2WPQ A;  2E75 C;  1AJY A;  1VF5 D;  2H89 C;  4D6T J;  3LW5 H;  3TYY A;  4GT1 A;  5KKZ B;  1WRG A;  1GTW A;  2AXT H;  3PJS K;  2IFN A;  5B5E E;  2JWD A;  5KJ7 A;  1NVO A;  1SQQ E;  3E7K A;  2JJL A;  2WTY A;  1U7M A;  2K9Y A;  1FU1 A;  2WPR A;  4W7Y A;  1GL2 B;  1KYO D;  2E76 B;  1GL2 D;  2P58 A;  3PP5 A;  1JTH B;  3U59 A;  2Y0C A;  4Y99 B;  1K73 Q;  2K3R A;  3C1L A;  1KTM A;  2OYI C;  3L70 J;  3I56 P;  3QH9 A;  1SQX D;  3PTZ A;  3V6I A;  1YQ4 C;  1SQB D;  2Q3E A;  1R5S A;  1KN7 A;  1NOH A;  5CCG D;  4R4M A;  4ZNC A;  5AVU B;  1LT1 A;  3CX5 D;  2QM8 A;  1SQV D;  2BEQ D;  3M9B A;  3G71 P;  1L2P A;  2D2C C;  4IOI H;  3VP8 A;  4ZKP A;  2E43 A;  1T3J A;  2BCC J;  1S72 P;  1KB9 D;  1NU1 J;  3O6Q B;  4H13 B;  4PJ0 E;  1S9K E;  5CCH C;  2WSF J;  3MHV A;  2O1K A;  1A02 J;  1L0L D;  2OTL P;  2ZJS E;  1NTM G;  2QJP C;  2N1T C;  1IFD A;  3H1H E;  1M8O B;  1NTK E;  1SFC A;  3RL0 B;  3RL0 D;  3KXD A;  1NTZ D;  2KUB A;  2R44 A;  2FYN B;  3BCC G;  3H1J E;  1IK9 A;  1BE3 E;  5TIS E;  4I1L A;  1HBW A;  1N7S A;  2E75 B;  2OGU A;  3H1I G;  2E75 D;  1W2E A;  3V2N A;  5B66 E;  4DCK A;  2VRS A;  3HTK A;  3IR9 A;  2PRR A;  3NTN A;  3T97 A;  1T2K C;  1OVR A;  1VQ8 P;  3OA7 A;  1EZV D;  2FFD A;  1FZE A;  1HF9 A;  1RF1 B;  1X22 A;  2YIU B;  2HPC A;  3B4S A;  5KJ7 C;  4PD4 E;  1HUC A;  4D6T E;  1KMI Z;  1YTZ T;  1P84 I;  2O01 J;  3NMD A;  1MFZ A;  2M3E A;  5APV A;  3RBZ A;  3JC2 2;  3L71 J;  3L72 G;  1SS1 A;  2JO1 A;  3IN6 A;  1USD A;  2OTK E;  2M3B A;  2E42 A;  3VMX A;  3RK3 B;  2IYP A;  3PH0 A;  3PLN A;  4GDO A;  2BEZ F;  3II6 A;  1YQ3 C;  1HGZ A;  4Y28 J;  1SP4 A;  2D2C B;  2D2C D;  1ZW0 A;  1H0T B;  4N6J A;  4CPG A;  3CCR P;  1SQP J;  2KS1 B;  3L35 A;  3ZDM A;  4BRY A;  1VQ7 P;  4OWF A;  5CCH D;  1JY3 P;  1JY2 N;  3JCU H;  2YMY A;  1PP9 J;  2QJP B;  3D6Y A;  2N1T B;  3AEC C;  3LW5 J;  2N1T D;  2FYU J;  2ZVO B;  2M5A A;  2BCC E;  1SQQ D;  2XKM A;  1NU1 E;  3B8E B;  1VDF A;  1KQG B;  1X9V A;  3HRN A;  2KYV A;  1Q2N A;  3CMA P;  1R8E A;  1SVF A;  3CLQ A;  4BXL A;  1BCC J;  1S2E A;  2POH A;  5APQ A;  3L75 J;  2WT7 B;  3M0D A;  4KJM A;  1ZR2 A;  1LJ2 A;  3CC4 P;  5AW9 B;  1SQX G;  3TK1 A;  1N7S C;  1Q7Y Q;  1SQB G;  1FZB A;  5E79 H;  1T2K D;  3CME P;  1FDM A;  1SQV G;  1YIJ P;  2C9N Y;  4B86 A;  2XND H;  3AED C;  4OGQ C;  2FFD C;  1ZR4 A;  5KJ7 D;  4XA4 A;  4XE5 B;  2KLV A;  4L76 A;  1RHZ B;  1OVU A;  1MV8 A;  2CPS A;  3C8V A;  1L0L G;  2QM7 A;  2C0W A;  2CK3 H;  1S9K D;  1ZME C;  1XTC C;  1NTZ G;  3AEF C;  1K05 A;  2LXB A;  3CXH H;  2UWJ E;  3CCE P;  2KOG A;  1NO4 A;  3L73 J;  2KP8 A;  3L71 E;  2L91 A;  3CL3 D;  1PV3 A;  3H1H D;  1VQ4 P;  2KSJ A;  1NTK D;  1VQ9 P;  3D6Z A;  3MZW B;  3Q3D A;  2QVA A;  3IAO A;  4I7Z C;  2YNY A;  1BGY J;  1ZOY C;  3G3Z A;  3U1A A;  1R5L A;  3H1J D;  1Y8A A;  1BE3 D;  2J58 A;  5AVV B;  2N9Y B;  2L5G B;  2OAR A;  1EZV G;  3TNU B;  4C7N B;  1M57 D;  1G1J A;  3PRJ A;  3AE3 C;  2QEX P;  2V4H A;  4A7P A;  5AW4 B;  2FYU K;  1SQP E;  1VQL P;  3E1I A;  1OIP A;  1PGO A;  2ZT9 B;  1PZQ A;  2W27 A;  1SFC B;  3TSI A;  4PD4 D;  1USE A;  4D6T D;  1SFC D;  3A0B H;  3VMZ A;  4YPC A;  1FBM A;  2C9L Y;  3OJA B;  1PP9 E;  2KB7 P;  2E74 C;  2A45 G;  2ZXE B;  3GF3 A;  1N7L A;  5BU5 A;  1NTZ E;  4JF7 A;  1LTI C;  1LTA C;  1HTL C;  3A7O A;  1AA0 A;  4ASW A;  1OW8 A;  2AXT E;  1IFP A;  3IFM A;  3M0D C;  1IO4 A;  5CJ0 A;  1BCC E;  4AYC A;  2DW3 A;  1AFO A;  3CCM P;  3HTK B;  3L75 E;  3T97 B;  2ZYD A;  1FJK A;  4ASV A;  2OYI A;  3CCQ P;  4LGD E;  4OGQ B;  2FFD B;  1E5W A;  1JY2 P;  2FXP A;  4OGQ D;  4NPE A;  2HPC B;  1KFN A;  3PHL A;  1FE6 A;  1EDI A;  2AXC A;  4DZO A;  4K35 A;  2JP3 A;  3GHG A;  2Q7C A;  3H1K J;  5M1B A;  1KQS O;  1SQQ G;  1LTS C;  5AW1 B;  1T6A A;  5KLV K;  1YIT P;  4RKU J;  2PGD A;  4W7Z A;  2BCC D;  1NU1 D;  3NXS A;  2KXP B;  4OVN F;  1S3J A;  4K3A A;  5CBO A;  2QRX A;  2A06 E;  3ITK A;  1D7M A;  1YI2 P;  4AQR D;  3L73 E;  1FDO A;  4YTP C;  2FBW C;  1LWU A;  2WSE H;  3FXD A;  2YXR B;  2Q1K A;  2MKV A;  1YJN P;  1BGY E;  1KZU B;  1IJD B;  4O9B A;  2HFE D;  2KNC B;  1VF5 B;  2O3J A;  2R3S A;  1LTT C;  1MZ9 A;  2ZYG A;  2Z4E A;  2IDB A;  4QMA A;  3I55 P;  2M5A B;  1P84 H;  3P8M C;  3F89 A;  2W83 C;  3CPW O;  3G4S P;  1M1J C;  5CMZ A;  1FAV A;  3CWB J;  2E74 D;  1IFI A;  1PL5 A;  1NYH A;  2QG4 A;  3G9R A;  1QLE D;  1DH3 A;  1IC2 A;  3H1H G;  1NTK G;  1MFT A;  2QA4 P;  3CI9 A;  3MTU E;  4GOD A;  3D71 A;  4UB8 H;  3UIA A;  1CI6 A;  1FZC B;  3L71 D;  3H1J G;  3L74 J;  2ZYA A;  1BE3 G;  1L0N J;  1YTZ I;  3HD7 A;  1G2C A;  3M9H A;  4XFJ A;  2B9B A;  3P8C E;  2IBZ E;  4JYC A;  3MGN A; 
#chains in the Genus database with same CATH homology
 3GHG C;  2ZFC A;  2WZ7 A;  3BRV B;  3RK3 B;  1SQX K;  4AUW A;  2GUS A;  3V2Q A;  3VOP A;  1SQB K;  3V2P A;  2WPS A;  3II6 A;  3P7K A;  1RF0 C;  1LTJ A;  2YKQ A;  2XZR A;  4JYB A;  3M06 A;  1X79 B;  1HGZ A;  2H7H A;  1HH0 A;  1SP4 A;  1LTJ B;  1JCD A;  1N73 C;  4N6J A;  1URQ C;  2P1J A;  3I5C A;  5APT A;  2Q5U A;  1GU4 A;  3MUD A;  3L35 A;  4RES B;  1J1D C;  5CCH D;  1JY3 P;  1SQP K;  1RE3 A;  1JY2 N;  1VPC A;  2YMY A;  3HE5 B;  2N1T B;  3R2P A;  1SLQ A;  5AVQ B;  2N1T D;  1RE4 C;  1HWT C;  3RK2 C;  3KQG A;  1KFM A;  2XKM A;  1LWU C;  3LID A;  3B8E B;  1VDF A;  2FYZ A;  1FZA A;  1X9V A;  3V2R A;  1NTZ K;  2YO2 A;  3HRN A;  4M3L A;  2KYV A;  2WWW A;  3VYI A;  1CW5 A;  1L4A C;  1SVF A;  3CLQ A;  2NPS B;  1ZN5 A;  3HE4 B;  3M9Q A;  2NPS D;  1GW4 A;  2POH A;  5APQ A;  1J1E C;  1OWA A;  2WT7 B;  2R32 A;  3M0D A;  2N9B A;  1ZR2 A;  5AVT B;  1KIL B;  5AW9 B;  3EQ2 A;  3H32 A;  1KIL D;  3TK1 A;  1N7S C;  1HVV A;  1M7L A;  1NKN A;  1JCC A;  1FZB A;  1LT9 C;  1CSB A;  3B5N A;  1T2K D;  2FKW B;  1H88 A;  3SWF A;  1N2D C;  1FOS F;  1GL2 C;  1JNM A;  1IFM A;  2LKM A;  2H43 A;  1RF1 C;  1FDM A;  3L4F A;  2W6A A;  5APW A;  5AW6 B;  2C9N Y;  4B86 A;  1NAF A;  2FFD C;  4WB4 A;  1ZR4 A;  2WSC H;  3OAK A;  5KJ7 D;  2R5D A;  4XA4 A;  1LTG C;  1PFI A;  2OYH A;  4XE5 B;  2KLV A;  4HYT B;  1YYC A;  4Y99 C;  1FZC C;  3A5T A;  2Q9I A;  3LIE A;  1OXZ A;  1MV8 A;  2CPS A;  1JY3 N;  3O8Z A;  1L0N K;  2XDJ A;  2QM7 A;  2OYI B;  2C0W A;  3V4W A;  4WBA A;  2O01 H;  1QL1 A;  5AW3 B;  1WT6 A;  3HD7 C;  3EFG A;  3SWY A;  1S9K D;  1NHL A;  4WY4 B;  1XTC C;  4WY4 D;  5CCG C;  2IPP A;  1H89 A;  3BVH A;  3C9I A;  4EOT A;  5BVZ A;  3RK3 C;  2W6B A;  1HGV A;  2KOG A;  1NO4 A;  1FZG A;  2KP8 A;  3CL3 D;  3WMM 0;  2KSJ A;  3M0A A;  3VMY A;  3KYQ A;  3HUS A;  1CZQ A;  1GW3 A;  5AW0 B;  5CCH A;  2A45 H;  2WIT A;  2R5B A;  4OH8 B;  3U1C A;  2YNY A;  1JMM A;  1LTJ C;  3HUS B;  3TNU A;  4N78 E;  4C7N A;  3G3Z A;  3U1A A;  1NTK K;  2Q3I A;  3HE5 A;  4HH2 A;  2N1T A;  1N73 B;  3KPE A;  1IFN A;  1URQ B;  2J58 A;  5AVX B;  5AVV B;  5AVZ B;  2JEE A;  4IFM A;  1URQ D;  1Z56 A;  2BAS A;  2L5G B;  2OAR A;  4IFF A;  3V4Q A;  3TNU B;  4C7N B;  3L37 A;  1X8Y A;  5AVW B;  1J1D B;  2XU6 A;  3RL0 C;  3V5B A;  1G1J A;  3BAT A;  3KDP B;  1XTG B;  2NPS A;  3HE4 A;  2Z5H A;  5KTB A;  2A45 I;  1ZV8 A;  4C46 A;  2HLO A;  1N86 A;  5AW4 B;  2FYU K;  2WT7 A;  1RE3 C;  2R3C A;  3RK2 B;  1JY2 O;  3E1I A;  3RK2 D;  1LWU B;  1KIL A;  1SQQ K;  2W27 A;  2WPQ A;  1SFC B;  3L36 A;  3TSI A;  1MUU A;  2I1J A;  1SFC D;  1DEB A;  4IFD K;  3VMZ A;  5AW7 B;  1L4A B;  1FBM A;  2CPB A;  2C9L Y;  3OJA B;  3LW5 H;  2HOD B;  1L4A D;  2KB7 P;  3TYY A;  1M1J B;  2A45 G;  4GT1 A;  2ZXE B;  1J1E B;  1N7L A;  1WRG A;  5BU5 A;  1GTW A;  4JF7 A;  1LTI C;  1LTA C;  1HTL C;  2H8P D;  1LTB C;  3A7O A;  1KIL C;  2IFN A;  1JOC A;  4I2L C;  2MJZ A;  5KJ7 A;  3IFM A;  3M0D C;  2JJL A;  2WTY A;  1IO4 A;  5CJ0 A;  1LT9 B;  3P8C D;  3H6P A;  1FU1 A;  1A02 F;  2WPR A;  4W7Y A;  5AVR B;  1GL2 B;  4AYC A;  1HJB A;  1AFO A;  3A2A A;  3HTK B;  1G1I A;  1GL2 D;  5CHX A;  4C7R A;  1NTM K;  1GZL A;  3B5N C;  1FJK A;  2OYI A;  4LGD E;  2FFD B;  2P2U A;  1E5W A;  1JY2 P;  3PP5 A;  1JTH B;  5AW8 B;  3U59 A;  5APY A;  2HPC B;  1KFN A;  4WY4 A;  1H8A A;  4Y99 B;  4DZO A;  2IX7 C;  2I1K A;  1GD2 E;  3M91 A;  2OYH C;  3GHG A;  2Q7C A;  2OYI C;  4ZKU A;  1CI6 B;  4N3Y B;  3MD0 A;  1J2J B;  1JY3 O;  3GHG B;  2XNX A;  4GKG A;  5AVY B;  1RF0 A;  3HD7 B;  5APU A;  1GU5 A;  1G2C B;  3HD7 D;  3MIW A;  2HYN A;  4DOJ A;  4LLH A;  1LTS C;  1T8Z A;  4GIF A;  1NOH A;  5CCG D;  5AVU B;  5AW1 B;  1NH4 A;  3RK3 D;  2QM8 A;  1N73 A;  5KLV K;  5AW2 B;  1URQ A;  3M9B A;  3VP8 A;  4KHX A;  4W7Z A;  2PAJ A;  3NXS A;  4ZKP A;  1RY3 A;  2E43 A;  1T3J A;  3A3Y B;  1SQV K;  3HUS C;  2YO3 A;  5AVS B;  1S9K E;  1EQ7 A;  5CCH C;  2C0X A;  2XV5 A;  4AQR D;  1GK4 A;  2O1K A;  1A02 J;  1NU1 K;  1RE4 A;  1LWU A;  1ZLL A;  2N1T C;  2HG5 D;  1IFD A;  2WSE H;  1SFC A;  1DX7 A;  3RL0 B;  3RL0 D;  3VN0 A;  1L0L K;  1JUN A;  1L4A A;  4W80 A;  2HOD A;  2P67 A;  1IFJ A;  1QL2 A;  1KZU B;  1IJD B;  2P7J A;  1M1J A;  4O9B A;  2HFE D;  3NFQ A;  1FOS E;  2YKP A;  2NPS C;  2WSF H;  1LTT C;  1KQL A;  1MZ9 A;  1NWQ A;  2Z4E A;  1IK9 A;  2J59 M;  1FJP A;  1SFC C;  4I1L A;  3BAS A;  1HBW A;  5APS A;  1N7S A;  1LGH B;  3P8M C;  1GK6 A;  1W2E A;  3V2N A;  1LT9 A;  1M1J C;  2Z5I A;  5CMZ A;  1GDT A;  1GL2 A;  1FAV A;  2VRS A;  1N7S B;  3HTK A;  1IFI A;  1RF1 A;  1N7S D;  3IR9 A;  3NTN A;  3T97 A;  1T2K C;  3OA7 A;  4I6M C;  2FFD A;  1FZE A;  4EIJ A;  1DH3 A;  3VP9 A;  4LC1 A;  1JTH A;  3BRT B;  1RF1 B;  1IC2 A;  2M8R A;  2HPC A;  5APX A;  2O1J A;  5KJ7 C;  1HUC A;  3H32 B;  5CJ4 A;  1FZC A;  1YTZ T;  3CI9 A;  3MTU E;  1JO5 A;  3NMD A;  2YKO A;  1T3U A;  3UIA A;  3B5N B;  1CI6 A;  5BU8 B;  1FZC B;  1MFZ A;  3B5N D;  5APV A;  1YTZ I;  1FZF A;  3VTP C;  3HD7 A;  3N4X A;  2GM4 A;  1G2C A;  5AW5 B;  2IFM A;  3M9H A;  3N7N A;  5CCG A;  3P32 A;  2FXM A;  3P8C E;  4WY4 C;  1AQ5 A;  2OYH B;  2PP6 A;  2GUV A;  4N78 D;  2M3B A;  1NKZ B;  2E42 A;  4JYC A;  3MGN A;  3VMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...