3SWFA

Cnga1 621-690 containing clz domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
GLEEKVTRMESSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFLKPLIDTEFSAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cGMP-gated cation channel alpha-1
publication title Molecular mechanism for 3:1 subunit stoichiometry of rod cyclic nucleotide-gated ion channels.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transport protein
total genus 23
structure length 56
sequence length 56
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3swfA00
4KHXA 5AW0B 3T97A 1KQLA 1DH3A 3TYYA 1MUUA 1MFZA 1MV8A 3TNUA 2WWWA 3MGNA 5APTA 5AW8B 1HJBA 3P7KA 1A02F 3HE4A 1S9KD 2Q7CA 1JUNA 1CI6A 4XE5B 3HTKA 2YNYA 3V4WA 1A02J 2YO3A 5AVYB 1HWTC 3A3YB 2R3CA 4C7NB 5AW9B 1H88A 2Q3IA 3MD0A 2ZFCA 5AW2B 4LC1A 1S9KE 3KDPB 2E42A 2ZXEB 4JYCA 5APVA 4HYTB 3L36A 3M9HA 2IPPA 2BASA 1IO4A 1CI6B 5APWA 5AW4B 2WTYA 2P67A 5AW1B 3LIDA 5AVQB 3VMZA 4C46A 5APYA 5AVWB 1JNMA 1FOSF 2WT7A 4EOTA 5AVSB 1HBWA 2YO2A 3M0AA 1T2KD 1X8YA 4RESB 2QM7A 3IR9A 3UIAA 1GU4A 2QM8A 5APUA 1OWAA 1SP4A 1FAVA 3VYIA 2WPSA 3V5BA 5AVUB 2C9LY 2JJLA 3M9BA 5APSA 4JYBA 1HUCA 4AYCA 4DZOA 2R5DA 1GK4A 2XZRA 3VMYA 1CZQA 2XU6A 3NTNA 1GD2E 3TK1A 5AW6B 3TNUB 1GU5A 2Z5IA 3V4QA 2C9NY 2WT7B 4M3LA 3VMXA 3HE4B 1J2JB 2E43A 3A2AA 3A7OA 2VRSA 2Z5HA 2WPQA 1GTWA 5AW5B 3M91A 2W6AA 5AVTB 4AQRD 1YYCA 3NXSA 1H89A 1H8AA 3L35A 2N9BA 2Q5UA 3SWFA 1T2KC 4AUWA 3OAKA 5AVRB 2R5BA 3B8EB 3L37A 1GK6A 4I2LC 3VN0A 4GKGA 1SLQA 5APXA 3HE5A 3P8MC 2WPRA 3LIEA 4I6MC 5AVZB 2H7HA 5APQA 2R32A 3VTPC 1GZLA 3KQGA 4B86A 2P2UA 1FOSE 5AVVB 2P7JA 2XV5A 1NAFA 1OXZA 5AW3B 1NWQA 5CMZA 2KP8A 3M06A 3NFQA 1G2CB 5AVXB 3O8ZA 3P32A 4C7NA 1CSBA 3I5CA 4GT1A 3HE5B 3M0DA 5AW7B 3NMDA 3A5TA 2W27A
chains in the Genus database with same CATH superfamily
5AW0B 3AEFC 2QJKB 5AW8B 4LGDE 3L70J 2A45I 2KK7A 1PGQA 3FX0A 1NTMJ 1SQPD 1FJPA 1T3JA 3L70D 3RK3C 2WSEJ 1JMBA 4EIJA 1NTMD 2WQYC 1IFPA 3AE7C 1JY2N 4L75A 2BASA 1AFOA 2ZJSE 2O1KA 3MP7B 1L0NE 2QJKC 4A7PA 1QLED 3L73J 3CLQA 2SPZA 2XU6A 4DOJA 1OVUA 3VMXA 1J2JB 3L73D 1VQ4P 1PPJE 3B4SA 2I8DA 5DJUB 4YTPC 2OTJP 1L0LK 2NZ2A 4H0LD 3AE6C 4KJMA 5DJTB 1LGHB 2Y0DA 1G2CA 1DD4A 1GK6A 2PRRA 1JB0J 1SLQA 2MJZA 5GTHE 1GZLA 2O1JA 5B5EH 2P2UA 4NPEA 3PLNA 4Y28J 3SWKA 2M3EA 2YKOA 5CMZA 3O8ZA 2WSSH 5KJ7D 3QWOC 3VOPA 3FWNA 5BU8B 5H2FH 2Q1KA 2D2CB 3TNUA 3MGNA 4ASWA 1A02F 1WMKA 1S9KD 2QSIA 3LW5H 2FFDA 3A3YB 1JY3N 3CXHH 4C7NB 2Q3IA 4IL6E 4LC1A 3VP9A 2E76B 3B5ND 1LP1A 4HYTB 3V2RA 5APYA 1K9MQ 4PJ0H 4ZKUA 4GIFA 2IBZD 4N3YB 2AEMA 5AVUB 1PPJG 2HPCA 1FJKA 4DZOA 1SQBK 5TJHA 4Y99B 1LTSC 4NPFX 2Z5IA 4WBAA 3V4QA 2E76C 2WT7B 3IAOA 3SWYA 1LTIC 2AEJA 2WPQA 1VF5D 4IOIH 2ZXXA 2N9BA 1KILD 3SWFA 1T2KC 3RK2D 4WVZA 1EDLA 1HGZA 2KB7P 1LTGC 4I2LC 2NPSB 4NPDA 3CXHI 1JCDA 3HD7A 1GMJA 4KT0J 4DCKA 5KLVK 1NU1E 1NYHA 3C9IA 2A45G 3D70A 2QRXA 2O01J 3AEDC 3L75J 1KN7A 1SQVK 1SQPG 2AXTE 2B88A 2JP3A 3L70G 1ZXGA 3L75D 1S9KE 1NTMG 2HG5D 1SFCD 3EFGA 1RH5B 3U1AA 1SQQJ 1VQ7P 3TF5A 1IO4A 1G1JA 4C46A 3R2PA 4RESB 4EYYQ 3VYIA 2OARA 2K88A 2PGDA 2CK3H 4L73A 1L0NK 1NO4A 1FBMA 3VMYA 3L73G 3PP5A 1FZCB 5AW6B 4D6TE 4OVNF 1VQ6P 1FZGA 3JCUH 3JC22 3SSUA 3IN6A 1YJWP 3SFDC 1J1EB 2IYOA 2JO1A 2V7QJ 3H1JJ 4H0LB 1QEXA 2R5BA 3B8EB 4H44D 3WU2E 3MUDC 1AA0A 1QL1A 2Y0EA 3EWKA 3OW2O 1KILE 3P8MC 3CCUP 1U7JA 3KPEA 4GDOA 3RL0D 4WY4D 1FZCC 2IZ0A 3CL3D 1NAYA 3M06A 2R44A 1N86A 2E5YA 2QVAA 1QVFO 3GHGB 4H0LC 1RHZB 2W27A 2WWWA 4HH2A 1HJBA 2HR3A 1ZR4A 1VPCA 1FC2C 3MD0A 3FXEA 1QVGO 3V2QA 3CC7P 3KDPB 2E42A 3L72J 3B5NB 3RBXA 1TU3F 4LLHA 1NTZJ 5KJ7C 2J5UA 2IBZG 1NKZB 3CCRP 3L72D 1JNMA 1HVVA 3KZIE 1RE3C 1IK7A 2FYUE 5CBOA 4OGQD 1PV3A 2QM8A 1NTZD 3L71E 2N1TD 3CWBJ 3GF3A 4YPCA 1FZBA 3BRTB 4C7RA 1M56D 1IFJA 2IFNA 1SQQE 3CWBD 1SQXJ 4ASVA 3B5NC 3H32A 1EDIA 1LT9B 3S4RA 2ZYDA 2KNCA 1OW6A 5AVTB 1ZP0C 1KILB 1MZ9A 1SQXD 3L35A 2AXCA 3RK2B 3G3ZA 3QH9A 1KC8Q 1N7SD 3OA7A 1L4AD 2YMKA 1U7MA 3AECC 3VTPC 3E1IA 1T6AA 4U7JA 3H1JE 2B87B 2LR2A 1K8AQ 1PFIA 1K04A 3MUDA 1VF5C 1LT9C 2WITA 2KZJA 1CSBA 4GT1A 2LXCB 1FZFA 1QL2A 1SS1A 1N7LA 1KILC 2W6BA 3RK2C 1VQMP 1FZCA 3A0BE 1OW8A 2QG4A 3HUSB 3L75G 4GODA 1NU1K 2HYNA 5AW9B 1P84D 2H88C 1IK9A 1PIXA 1SFCB 3RK3E 1VQLP 2PFXA 4IL6X 3EQ2A 3HTKB 3VMZA 4YXWH 1HTLC 2D2CD 5GTHH 1FOSF 2HLOA 5AVSB 1VQNP 1OFCX 3F5HA 2E74B 2GA1A 3L72E 3O6QB 3HUSC 2M5AA 4AYCA 3T97B 1Q81Q 1RE3A 5KKZB 3A0HE 2E43A 1SFCC 1N8RQ 4UB8E 1VQKP 1FU1A 1IJDB 4IL6H 2A45H 2W8ZA 2NRGA 3AE2C 1YJ9P 3B5NA 2BEZF 4UB6E 3CX5D 4PV1D 4L74A 5APQA 3RL0B 4WY4B 2KI7B 4PD4D 4BRYB 2XV5A 3GF7A 1NAFA 1NTKJ 1JOCA 2A06D 2WSEH 4TT3H 2JKVA 2Y9YA 2UWJE 3M0DA 3ZDMA 1GDTA 2Q6QA 1NTKD 2NPSD 4H44C 4QMAA 2W6JH 4JPZB 1DEEG 3II6A 1LNQA 1RF1A 1M90Q 2K3RA 1LT1A 1LT9A 4ZNCA 3FGAD 1H88A 3RL0C 4WY4C 1ZRTE 1KILA 4EI2A 3H6PA 4JYCA 1AVYA 3SFEC 3L72G 3CI9A 1SQPJ 2P67A 5AVQB 1NTZG 5AVWB 4EOTA 4OGQB 5CBNA 2N1TB 4U3FJ 2B87A 5TISE 4JYBA 3U59A 1ZR2A 3CWBG 2FYUK 1FDIA 1FDOA 4I7ZB 2WZ7A 4U3FD 3GLMA 2VRSA 1SQXG 2AXTH 4W7YA 3HUSA 1SQQK 3CD6P 3PJSK 1T3UA 1URQD 4OGQC 1N7SB 2N1TC 1L4AB 3H25A 3G9RA 1L2PA 2KLUA 5C39A 3ABVC 1MKMA 1AVOA 1LTJB 2N9YB 1OXZA 1FZEA 3BVHA 3O6QA 3HRNA 5AW7B 5E79E 3USSA 2ZAEB 3T97A 3PHLA 1USEA 3H1HJ 1N7SC 1L4AC 3H1LD 1H0TA 1S72P 3V4WA 1JO5A 2YO3A 3H1HD 4XA4A 1HF9A 2ZXEB 1BDCA 1RF0A 1LTJC 2YIUB 1RY3A 3WU2H 1OW7A 4JBZA 3LIDA 1Q90D 3CCJP 4WY4A 1BE3J 1GU4A 1PZQA 5APUA 1YQ4C 2IX7C 1BE3D 1R8EA 1OVRA 1SQPE 2OTKE 1KQGB 5GTIE 3L70E 2YIUC 2Z5HA 3TSIA 3W68A 1IFIA 1NTME 2FY8A 1NGMB 2IBZI 2D2CC 5CCGD 1NOHA 3CC2P 3HE5A 4PV1B 2O01H 1IFNA 1R5LA 1Q82Q 2A06G 1FOSE 1BCCD 3KZIH 3I55P 3MZWB 2KS1B 2PP6A 2WSFJ 2N1TA 3L73E 2Q9IA 2RKLA 1NTKG 3N7NA 2ZVOB 3S1KA 5KAIE 1K73Q 2GUSA 2JR8A 3P7KA 4Y99C 2P1JA 4W80A 2YNYA 3KXDA 4PV1C 5AVYB 1KB9D 1KB9I 2HFED 2KSEA 2M8RA 1Q7YQ 1KFNA 2P10A 3L36A 1L4AA 1CI6B 2H43A 2WTYA 1JY3O 1RE4C 2NPSC 2IDBA 2V7QH 2WMMA 1FAVA 2V4HA 2WPSA 3M9BA 2OGUA 4DT0A 4U3FG 1Q86Q 4Z1MH 2XZRA 3L74J 3TDKA 1LJ2A 2AEFA 3TK1A 3ITKA 1J1DB 3MIWA 1BSNA 3A0BH 3L74D 3NXSA 1JY2P 3E1RA 3W67A 1URQB 2E74D 1DX7A 2IBZE 1M7LA 3CCMP 5APXA 5AVZB 2QJPB 2IZ1A 1U57A 1J1DC 5CJ0A 3GMAA 2K9JB 1JMMA 4C7NA 2RMZA 1KORA 3NMDA 3H1KJ 1L0LJ 3H1LG 1URQC 2Y0CA 4N6JA 3A0HH 3CMAP 1FZAA 3H1HG 3L4FA 3H1KD 1L0LD 5CCHD 1WRGA 4UB8H 2KIKA 1AJYA 1LTTC 1J1EC 1W2EA 2YMYA 1R5SA 2B89A 4IFMA 1KB9E 3BCCG 1AQ5A 4UB6H 2WT7A 1GW4A 3M0AA 3UIAA 1OWAA 1BE3G 3AE4C 1M1JB 3NTNA 1JY3P 1JEKA 3L75E 1YTZI 4M3LA 1K05A 2OYOA 3HE4B 2Q3EA 2NPSA 1RQVA 1EXIA 3GHGC 2FBWC 3AEAC 4ZMDA 3M91A 4EDFA 3CCEP 1LWUB 2ZYGA 1SQPK 3L74E 3G71P 1YI2P 1NTMK 4GKGA 2M3BA 1P84H 1BCCG 2HODB 1M1JC 1S1CX 1NJIQ 1SQBJ 1OZHA 2W90A 1VDFA 4TLFA 2KP8A 3P32A 5L8RJ 3Q1MA 5TISH 1LWUC 1SQBD 3CCQP 5CCGC 1MFZA 2J59M 3HD7D 1JTHB 2OYHB 1M1KQ 2J58A 3H1KE 5APVA 1GL2D 2FYNB 4HB1A 5KLVJ 2H8PD 2R3SA 2KLVA 4JF7A 1P84I 1GK4A 5KLVD 2OYHC 3L74G 5E79H 3C1LA 1SQVD 4ZKPA 3A7OA 3CCLP 2FYNC 2WSCJ 2WPVB 2M0BA 1PGPA 2O01N 3Q5SA 5KJ7A 1NTZE 5KAFE 3H1IJ 3GHGA 1AQTA 3AE8C 1HJ0A 4I6MC 3PRJA 2YXRB 1N2DC 1KTMA 1JCCA 2K37A 4R4LA 3WUUA 1VL2A 3CWBE 3H1ID 3FWLA 1G2CB 1X79B 2O3JA 1S5LE 4GOFA 4XFJA 2ZVNB 3MTUE 1SQXE 2E74C 2G3AA 1HH0A 1NH4A 2B9BA 3H1KG 1L0LG 3CX5I 5GTIH 5BVZA 3HE4A 2Q7CA 3RL0g 4PD4I 1EXJA 3AE5C 1ZW0A 1Z56A 3BRVB 5KKZC 5AW2B 4HKZH 5CCGA 1YITP 1ZN5A 5CJ4A 3D6ZA 1HGVA 1EQ7A 3AEEC 2E5TA 2QE7H 2FFDB 1XTGB 1HBWA 1EZVD 4JQ0D 1EZVI 2CPBA 3F89A 5APSA 3TGUJ 1LP1B 1DIPA 5CCHC 1VQOP 1ZMEC 2KOGA 3WUTA 1P84E 1GU5A 2C9NY 1EDKA 3TGUD 3V6IA 5KAIH 4CPGA 5KLVE 1VQ8P 2E75D 5AW5B 3VMAA 1KYOD 3KYQA 1PP9G 2Q5UA 1Y8AA 2FFDC 4AUWA 1KZUB 1OX3A 2LXBA 1IFDA 3LIEA 1MFTA 1IC2A 1VQ9P 3CPWO 1SQBG 1X22A 1S2EA 1OVVA 3H1IE 2LKMA 1SFCA 1ZV8A 3HD7B 4XE5B 3HTKA 4I7ZC 2WVRA 3CX5E 2ZFCA 4RKUJ 3RBZA 4PD4E 1PGOA 1GL2B 3H1LJ 5CHXA 2A06E 2C0XA 2OYIB 5AW4B 5APWA 2OQQA 3PTZA 1NTKE 5KLVG 1SP4A 2BCCJ 2JJLA 3HD7C 2L91A 1KFMA 1BDDA 3PH0A 2K1AA 3AE1C 1EZVE 1CZQA 1SQVG 3EFFK 3BCCJ 1NU1J 2BCCD 1GL2C 3Q5RA 3BCCD 1NU1D 3RGUA 2OYIC 3TGUE 4DJGA 1BSHA 4OH8B 2WSFH 4BRYA 5CCHA 1JY2O 2KSJA 1KYOE 1IFMA 2W83C 3P8CD 1XTCC 4BXLA 2XNDH 1KB9H 3H1IG 3V2NA 4U3FE 1NTZK 1L0NG 4RO0A 1NWQA 4W7ZA 3KHUA 1EDJA 4HJGH 4BWNA 2C0WA 1YIJP 1W2BO 3A5TA 1BCCJ 5AVVB 1DH3A 4D6TJ 5BU5A 2QEXP 1FS0E 5APTA 2FKWB 2R3CA 1BGYJ 1SQXK 4D6TD 2CPSA 1BGYD 3M9HA 5B66E 2Z4EA 3CCVP 5AW1B 1EZVG 2ZT9D 1LTBC 2QM7A 3IR9A 2KZIA 3LW5J 4GOEA 1M8OB 3BASA 2KYVA 2C9LY 1YQ3C 3H1LE 1NKNA 3TGUG 1SVFA 1N7SA 3CXHD 3WMM0 3H1HE 2RN0A 1YJNP 2E75B 2YKPA 3G4SP 4L76A 1AV1A 2BCCE 3R4YA 1LTJA 3GG2A 3BCCE 4K35A 3H32B 1GL2A 1USDA 3AE3C 2H7HA 2R32A 2KNCB 1PGJA 2OYIA 2KUBA 1FE6A 4B86A 3P8CE 1BE3E 2XKMA 2P7JA 1PL5A 2FYUJ 2L5GB 1ZLLA 2E75C 1X0TA 3L71J 3NFQA 2YXQB 5M1BA 3MHVA 3Q2YA 2FYZA 2YKQA 3D6YA 2FYUD 2P58A 2I1JA 1E5WA 4KHXA 1KQLA 3L71D 1MV8A 1IZNB 1S5LX 2GUVA 4OWFA 1JUNA 1A02J 1SQQD 4K3AA 1BCCE 4H13D 2POHA 5KAFH 1T8ZA 5B5EE 5KLIB 2IFMA 1VQ5P 1BGYE 2QJPC 1UIXA 2BCCG 5H2FE 1S5LH 1W5CE 3H1JD 1NTKK 1NU1G 3A2AA 4IFFA 3CXHE 1QX8A 2M5AB 3GW6A 1CW5A 5KLIC 2OTLP 2KS1A 1N73B 3FXDA 1RQUA 4N78D 3L37A 2WPRA 1RE4A 1OMIA 4PJ0E 1VQPP 3BATA 2QJYB 1KQFB 1S4XA 3RK3D 1PP9J 5AW3B 2XDJA 3Q5PA 1LTAC 1QGKB 1Y47A 2JWAA 1PP9D 3I56P 3B71A 1N73C 4D6TG 1CI6A 1X9VA 4RJTA 1HWTC 3D71A 2QJYC 3JSVC 1BGYG 2FXMA 1FDMA 1M57D 3IF4A 1KD1Q 2K9YA 2ZT9B 1RF1B 2QIWA 1VF5B 2WSCH 2YO2A 1X8YA 2GM4A 3Q3DA 4WB4A 1HUCA 2QA4P 2JWDA 1URQA 1L0LE 4MN4C 1ZOYC 3M0DC 2BEQD 2PAJA 1EC5A 2ITAA 2JEEA 1GW3A 2W6AA 2JDIH 4AQRD 1YYCA 1H89A 2ZT9C 1RF1C 3CX5H 1JM0A 2K9JA 1SQVJ 5AVRB 4PD4H 1DD3A 2FXPA 5EFWB 4R4MA 4N78E 1KV4A 1ZRTD 3KQGA 1NHLA 1OIPA 3C8VA 1YTZT 3G6EP 2XNXA 2RH0A 1YBKA 2FYUG 2ZYAA 3AE9C 3L71G 3I5CA 3M9QA 2IYPA 1G1IA 2H89C 3IFMA 3V2PA 3JCUE 3E7KA 3TYYA 1MUUA 3OJAB 1SQQG 1PP9E 1L0NJ 3S9OA 3CCSP 1YHQP 1NVOA 4YXDC 3AEGC 1DEBA 2E76D 2MKVA 1L0ND 1KYOH 4H13B 1N73A 3CMEP 1M1JA 2G8YA 2IPPA 2FXOA 3AEBC 1H0TB 1SQBE 1E79H 1T2KD 4WWIA 1UIIA 4I1LA 4IFDK 2I1KA 1D7MA 3V5BA 1LWUA 3H1JG 4H44B 3WUVA 2R5DA 1Y9BA 3CC4P 1GD2E 1PPJD 3TNUB 1WT6A 4O9BA 3K5BA 3N4XA 5KTBA 2KXPB 2HODA 4H13C 1GTWA 1KQSO 1H8AA 1Q2NA 2DW3A 3OAKA 2Y9ZA 3VN0A 3VP8A 1RF0C 5K5GB 5B66H 3U1CA 1KMIZ 3RK3B 2HPCB 1KYOI 1JTHA 5AVXB 1SQVE 2OYHA 3HE5B 1S3JA
chains in the Genus database with same CATH topology
5AW0B 1DH3A 3RK2C 4N6JA 1FZCA 5BU5A 5APTA 5AW8B 4LGDE 1FZAA 3HUSB 2A45I 3L4FA 1NU1K 2HYNA 2FKWB 5CCHD 2R3CA 1WRGA 1SQXK 5AW9B 1IK9A 1FJPA 1T3JA 3RK3C 2CPSA 1SFCB 1LTTC 1J1EC 1W2EA 2YMYA 4IFMA 4EIJA 3EQ2A 3M9HA 2Z4EA 1JY2N 2BASA 1AFOA 1AQ5A 3HTKB 5AW1B 3VMZA 1HTLC 2O1KA 1FOSF 2WT7A 2HLOA 5AVSB 1GW4A 3M0AA 1LTBC 2QM7A 3IR9A 3UIAA 1OWAA 3BASA 2KYVA 2C9LY 3HUSC 4AYCA 3CLQA 1M1JB 1NKNA 2XU6A 3NTNA 1SVFA 1JY3P 1N7SA 3WMM0 4DOJA 1RE3A 1YTZI 4M3LA 3VMXA 3HE4B 1J2JB 2E43A 2NPSA 1SFCC 2YKPA 3GHGC 3M91A 1LWUB 1L0LK 1SQPK 1FU1A 1LTJA 1IJDB 2A45H 1LGHB 1G2CA 1GK6A 3B5NA 1NTMK 4GKGA 3H32B 1GL2A 1SLQA 2M3BA 2MJZA 2HODB 2H7HA 1M1JC 2R32A 5APQA 3RL0B 4WY4B 1GZLA 2O1JA 2OYIA 4B86A 3P8CE 2P2UA 2XKMA 1VDFA 2P7JA 2XV5A 2L5GB 1ZLLA 1NAFA 2YKOA 5CMZA 1JOCA 2KP8A 3NFQA 3O8ZA 3P32A 2WSEH 5KJ7D 1LWUC 3M0DA 2FYZA 3VOPA 2YKQA 1GDTA 5BU8B 2I1JA 1E5WA 4KHXA 5CCGC 1KQLA 2NPSD 3TNUA 1MFZA 1MV8A 3MGNA 1A02F 2GUVA 3II6A 1S9KD 1JUNA 2J59M 3HD7D 1JTHB 1RF1A 1A02J 3LW5H 1LT9A 2OYHB 2FFDA 3A3YB 1JY3N 4C7NB 1H88A 2Q3IA 3RL0C 4WY4C 4LC1A 3VP9A 2J58A 1KILA 3H6PA 4JYCA 3B5ND 5APVA 1GL2D 4HYTB 3V2RA 2POHA 1T8ZA 3CI9A 2P67A 5AVQB 5APYA 2IFMA 5AVWB 4EOTA 4ZKUA 2H8PD 4GIFA 2N1TB 2KLVA 4N3YB 4JF7A 5AVUB 4JYBA 2HPCA 3U59A 1ZR2A 1FJKA 4DZOA 1SQBK 1GK4A 4Y99B 2OYHC 2FYUK 1LTSC 2WZ7A 1NTKK 2Z5IA 4WBAA 3V4QA 2WT7B 3A2AA 3SWYA 4ZKPA 3A7OA 2VRSA 1LTIC 2WPQA 4IFFA 4W7YA 3HUSA 1SQQK 1CW5A 2N9BA 1T3UA 1KILD 1URQD 3SWFA 1T2KC 3RK2D 1N73B 4N78D 1N7SB 3L37A 1HGZA 2N1TC 2KB7P 1LTGC 1L4AB 5KJ7A 4I2LC 2NPSB 3GHGA 2WPRA 1RE4A 4I6MC 1N2DC 1JCCA 3BATA 1JCDA 3RK3D 1LTJB 3HD7A 1OXZA 5AW3B 1FZEA 1G2CB 1X79B 3BVHA 2XDJA 1LTAC 5KLVK 3HRNA 5AW7B 3C9IA 2A45G 3MTUE 3T97A 1HH0A 1NH4A 1N73C 1SQVK 1N7SC 5BVZA 3HE4A 2Q7CA 1L4AC 1CI6A 1X9VA 3V4WA 1JO5A 1Z56A 2YO3A 1HWTC 3BRVB 5AW2B 1S9KE 4XA4A 2HG5D 2ZXEB 2FXMA 5CCGA 1RF0A 1FDMA 1ZN5A 1SFCD 1LTJC 1RY3A 3EFGA 5CJ4A 1HGVA 3U1AA 1IO4A 1EQ7A 1G1JA 3LIDA 1RF1B 4C46A 2FFDB 1XTGB 1HBWA 2WSCH 2YO2A 3R2PA 4WY4A 1X8YA 4RESB 1GU4A 5APUA 2GM4A 2CPBA 3VYIA 4WB4A 2OARA 5APSA 2IX7C 1HUCA 1L0NK 1URQA 1NO4A 5CCHC 1FBMA 3VMYA 2KOGA 3PP5A 1FZCB 5AW6B 3M0DC 1GU5A 2C9NY 1FZGA 2PAJA 2Z5HA 3TSIA 2JEEA 5AW5B 1GW3A 1J1EB 2W6AA 1IFIA 4AQRD 1YYCA 1H89A 1RF1C 3KYQA 2Q5UA 2FFDC 5CCGD 4AUWA 1NOHA 1KZUB 2R5BA 5AVRB 3B8EB 1QL1A 1IFDA 3HE5A 3P8MC 2O01H 1IFNA 3LIEA 1IC2A 3KPEA 4N78E 3RL0D 4WY4D 3KQGA 1NHLA 1FZCC 1FOSE 1YTZT 3CL3D 2XNXA 2PP6A 3M06A 2N1TA 2Q9IA 1N86A 3N7NA 3I5CA 3M9QA 1G1IA 3GHGB 2LKMA 3IFMA 3V2PA 2W27A 1SFCA 3TYYA 1MUUA 3OJAB 2WWWA 1ZV8A 2GUSA 4HH2A 3P7KA 1HJBA 3HD7B 4Y99C 2P1JA 1ZR4A 1VPCA 3HTKA 4XE5B 4W80A 2YNYA 5AVYB 3MD0A 2ZFCA 2HFED 1DEBA 2M8RA 3V2QA 3KDPB 1KFNA 2E42A 3B5NB 1GL2B 1N73A 5CHXA 3L36A 1M1JA 4LLHA 2C0XA 2IPPA 1L4AA 2OYIB 5KJ7C 1CI6B 5APWA 5AW4B 1NKZB 2WTYA 2H43A 1JY3O 1JNMA 1RE4C 1HVVA 1RE3C 1T2KD 4I1LA 2NPSC 4IFDK 2I1KA 2QM8A 2N1TD 1SP4A 1FAVA 2WPSA 3V5BA 1LWUA 2JJLA 1FZBA 3M9BA 3BRTB 3HD7C 1KFMA 4C7RA 2R5DA 2XZRA 1IFJA 1CZQA 2IFNA 1GD2E 3TK1A 1J1DB 3TNUB 1WT6A 4O9BA 3MIWA 3N4XA 5KTBA 3B5NC 3H32A 1GL2C 2HODA 1LT9B 1GTWA 5AVTB 2OYIC 3NXSA 1JY2P 4OH8B 1H8AA 2WSFH 1KILB 1MZ9A 3L35A 5CCHA 1URQB 3RK2B 3G3ZA 3OAKA 1JY2O 2KSJA 1DX7A 1N7SD 3OA7A 1IFMA 1M7LA 3P8CD 1XTCC 1L4AD 3VN0A 3VP8A 1RF0C 5APXA 5AVZB 3VTPC 3U1CA 3E1IA 3V2NA 1J1DC 3RK3B 5CJ0A 1NTZK 2HPCB 1JTHA 1NWQA 1PFIA 1JMMA 5AVXB 4W7ZA 3MUDA 2OYHA 1LT9C 2WITA 4C7NA 1CSBA 4GT1A 3HE5B 1FZFA 1QL2A 2C0WA 3NMDA 3A5TA 1N7LA 1KILC 2W6BA 5AVVB 1URQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHX A;  5AW0 B;  3T97 A;  1KQL A;  1DH3 A;  3TYY A;  1MUU A;  1MFZ A;  1MV8 A;  3TNU A;  2WWW A;  3MGN A;  5APT A;  5AW8 B;  1HJB A;  3P7K A;  1A02 F;  3HE4 A;  1S9K D;  2Q7C A;  1JUN A;  1CI6 A;  4XE5 B;  3HTK A;  2YNY A;  3V4W A;  1A02 J;  2YO3 A;  5AVY B;  1HWT C;  3A3Y B;  2R3C A;  4C7N B;  5AW9 B;  1H88 A;  2Q3I A;  3MD0 A;  2ZFC A;  5AW2 B;  4LC1 A;  1S9K E;  3KDP B;  2E42 A;  2ZXE B;  4JYC A;  5APV A;  4HYT B;  3L36 A;  3M9H A;  2IPP A;  2BAS A;  1IO4 A;  1CI6 B;  5APW A;  5AW4 B;  2WTY A;  2P67 A;  5AW1 B;  3LID A;  5AVQ B;  3VMZ A;  4C46 A;  5APY A;  5AVW B;  1JNM A;  1FOS F;  2WT7 A;  4EOT A;  5AVS B;  1HBW A;  2YO2 A;  3M0A A;  1T2K D;  1X8Y A;  4RES B;  2QM7 A;  3IR9 A;  3UIA A;  1GU4 A;  2QM8 A;  5APU A;  1OWA A;  1SP4 A;  1FAV A;  3VYI A;  2WPS A;  3V5B A;  5AVU B;  2C9L Y;  2JJL A;  3M9B A;  5APS A;  4JYB A;  1HUC A;  4AYC A;  4DZO A;  2R5D A;  1GK4 A;  2XZR A;  3VMY A;  1CZQ A;  2XU6 A;  3NTN A;  1GD2 E;  3TK1 A;  5AW6 B;  3TNU B;  1GU5 A;  2Z5I A;  3V4Q A;  2C9N Y;  2WT7 B;  4M3L A;  3VMX A;  3HE4 B;  1J2J B;  2E43 A;  3A2A A;  3A7O A;  2VRS A;  2Z5H A;  2WPQ A;  1GTW A;  5AW5 B;  3M91 A;  2W6A A;  5AVT B;  4AQR D;  1YYC A;  3NXS A;  1H89 A;  1H8A A;  3L35 A;  2N9B A;  2Q5U A;  3SWF A;  1T2K C;  4AUW A;  3OAK A;  5AVR B;  2R5B A;  3B8E B;  3L37 A;  1GK6 A;  4I2L C;  3VN0 A;  4GKG A;  1SLQ A;  5APX A;  3HE5 A;  3P8M C;  2WPR A;  3LIE A;  4I6M C;  5AVZ B;  2H7H A;  5APQ A;  2R32 A;  3VTP C;  1GZL A;  3KQG A;  4B86 A;  2P2U A;  1FOS E;  5AVV B;  2P7J A;  2XV5 A;  1NAF A;  1OXZ A;  5AW3 B;  1NWQ A;  5CMZ A;  2KP8 A;  3M06 A;  3NFQ A;  1G2C B;  5AVX B;  3O8Z A;  3P32 A;  4C7N A;  1CSB A;  3I5C A;  4GT1 A;  3HE5 B;  3M0D A;  5AW7 B;  3NMD A;  3A5T A;  2W27 A; 
#chains in the Genus database with same CATH topology
 5AW0 B;  3AEF C;  2QJK B;  5AW8 B;  4LGD E;  3L70 J;  2A45 I;  2KK7 A;  1PGQ A;  3FX0 A;  1NTM J;  1SQP D;  1FJP A;  1T3J A;  3L70 D;  3RK3 C;  2WSE J;  1JMB A;  4EIJ A;  1NTM D;  2WQY C;  1IFP A;  3AE7 C;  1JY2 N;  4L75 A;  2BAS A;  1AFO A;  2ZJS E;  2O1K A;  3MP7 B;  1L0N E;  2QJK C;  4A7P A;  1QLE D;  3L73 J;  3CLQ A;  2SPZ A;  2XU6 A;  4DOJ A;  1OVU A;  3VMX A;  1J2J B;  3L73 D;  1VQ4 P;  1PPJ E;  3B4S A;  2I8D A;  5DJU B;  4YTP C;  2OTJ P;  1L0L K;  2NZ2 A;  4H0L D;  3AE6 C;  4KJM A;  5DJT B;  1LGH B;  2Y0D A;  1G2C A;  1DD4 A;  1GK6 A;  2PRR A;  1JB0 J;  1SLQ A;  2MJZ A;  5GTH E;  1GZL A;  2O1J A;  5B5E H;  2P2U A;  4NPE A;  3PLN A;  4Y28 J;  3SWK A;  2M3E A;  2YKO A;  5CMZ A;  3O8Z A;  2WSS H;  5KJ7 D;  3QWO C;  3VOP A;  3FWN A;  5BU8 B;  5H2F H;  2Q1K A;  2D2C B;  3TNU A;  3MGN A;  4ASW A;  1A02 F;  1WMK A;  1S9K D;  2QSI A;  3LW5 H;  2FFD A;  3A3Y B;  1JY3 N;  3CXH H;  4C7N B;  2Q3I A;  4IL6 E;  4LC1 A;  3VP9 A;  2E76 B;  3B5N D;  1LP1 A;  4HYT B;  3V2R A;  5APY A;  1K9M Q;  4PJ0 H;  4ZKU A;  4GIF A;  2IBZ D;  4N3Y B;  2AEM A;  5AVU B;  1PPJ G;  2HPC A;  1FJK A;  4DZO A;  1SQB K;  5TJH A;  4Y99 B;  1LTS C;  4NPF X;  2Z5I A;  4WBA A;  3V4Q A;  2E76 C;  2WT7 B;  3IAO A;  3SWY A;  1LTI C;  2AEJ A;  2WPQ A;  1VF5 D;  4IOI H;  2ZXX A;  2N9B A;  1KIL D;  3SWF A;  1T2K C;  3RK2 D;  4WVZ A;  1EDL A;  1HGZ A;  2KB7 P;  1LTG C;  4I2L C;  2NPS B;  4NPD A;  3CXH I;  1JCD A;  3HD7 A;  1GMJ A;  4KT0 J;  4DCK A;  5KLV K;  1NU1 E;  1NYH A;  3C9I A;  2A45 G;  3D70 A;  2QRX A;  2O01 J;  3AED C;  3L75 J;  1KN7 A;  1SQV K;  1SQP G;  2AXT E;  2B88 A;  2JP3 A;  3L70 G;  1ZXG A;  3L75 D;  1S9K E;  1NTM G;  2HG5 D;  1SFC D;  3EFG A;  1RH5 B;  3U1A A;  1SQQ J;  1VQ7 P;  3TF5 A;  1IO4 A;  1G1J A;  4C46 A;  3R2P A;  4RES B;  4EYY Q;  3VYI A;  2OAR A;  2K88 A;  2PGD A;  2CK3 H;  4L73 A;  1L0N K;  1NO4 A;  1FBM A;  3VMY A;  3L73 G;  3PP5 A;  1FZC B;  5AW6 B;  4D6T E;  4OVN F;  1VQ6 P;  1FZG A;  3JCU H;  3JC2 2;  3SSU A;  3IN6 A;  1YJW P;  3SFD C;  1J1E B;  2IYO A;  2JO1 A;  2V7Q J;  3H1J J;  4H0L B;  1QEX A;  2R5B A;  3B8E B;  4H44 D;  3WU2 E;  3MUD C;  1AA0 A;  1QL1 A;  2Y0E A;  3EWK A;  3OW2 O;  1KIL E;  3P8M C;  3CCU P;  1U7J A;  3KPE A;  4GDO A;  3RL0 D;  4WY4 D;  1FZC C;  2IZ0 A;  3CL3 D;  1NAY A;  3M06 A;  2R44 A;  1N86 A;  2E5Y A;  2QVA A;  1QVF O;  3GHG B;  4H0L C;  1RHZ B;  2W27 A;  2WWW A;  4HH2 A;  1HJB A;  2HR3 A;  1ZR4 A;  1VPC A;  1FC2 C;  3MD0 A;  3FXE A;  1QVG O;  3V2Q A;  3CC7 P;  3KDP B;  2E42 A;  3L72 J;  3B5N B;  3RBX A;  1TU3 F;  4LLH A;  1NTZ J;  5KJ7 C;  2J5U A;  2IBZ G;  1NKZ B;  3CCR P;  3L72 D;  1JNM A;  1HVV A;  3KZI E;  1RE3 C;  1IK7 A;  2FYU E;  5CBO A;  4OGQ D;  1PV3 A;  2QM8 A;  1NTZ D;  3L71 E;  2N1T D;  3CWB J;  3GF3 A;  4YPC A;  1FZB A;  3BRT B;  4C7R A;  1M56 D;  1IFJ A;  2IFN A;  1SQQ E;  3CWB D;  1SQX J;  4ASV A;  3B5N C;  3H32 A;  1EDI A;  1LT9 B;  3S4R A;  2ZYD A;  2KNC A;  1OW6 A;  5AVT B;  1ZP0 C;  1KIL B;  1MZ9 A;  1SQX D;  3L35 A;  2AXC A;  3RK2 B;  3G3Z A;  3QH9 A;  1KC8 Q;  1N7S D;  3OA7 A;  1L4A D;  2YMK A;  1U7M A;  3AEC C;  3VTP C;  3E1I A;  1T6A A;  4U7J A;  3H1J E;  2B87 B;  2LR2 A;  1K8A Q;  1PFI A;  1K04 A;  3MUD A;  1VF5 C;  1LT9 C;  2WIT A;  2KZJ A;  1CSB A;  4GT1 A;  2LXC B;  1FZF A;  1QL2 A;  1SS1 A;  1N7L A;  1KIL C;  2W6B A;  3RK2 C;  1VQM P;  1FZC A;  3A0B E;  1OW8 A;  2QG4 A;  3HUS B;  3L75 G;  4GOD A;  1NU1 K;  2HYN A;  5AW9 B;  1P84 D;  2H88 C;  1IK9 A;  1PIX A;  1SFC B;  3RK3 E;  1VQL P;  2PFX A;  4IL6 X;  3EQ2 A;  3HTK B;  3VMZ A;  4YXW H;  1HTL C;  2D2C D;  5GTH H;  1FOS F;  2HLO A;  5AVS B;  1VQN P;  1OFC X;  3F5H A;  2E74 B;  2GA1 A;  3L72 E;  3O6Q B;  3HUS C;  2M5A A;  4AYC A;  3T97 B;  1Q81 Q;  1RE3 A;  5KKZ B;  3A0H E;  2E43 A;  1SFC C;  1N8R Q;  4UB8 E;  1VQK P;  1FU1 A;  1IJD B;  4IL6 H;  2A45 H;  2W8Z A;  2NRG A;  3AE2 C;  1YJ9 P;  3B5N A;  2BEZ F;  4UB6 E;  3CX5 D;  4PV1 D;  4L74 A;  5APQ A;  3RL0 B;  4WY4 B;  2KI7 B;  4PD4 D;  4BRY B;  2XV5 A;  3GF7 A;  1NAF A;  1NTK J;  1JOC A;  2A06 D;  2WSE H;  4TT3 H;  2JKV A;  2Y9Y A;  2UWJ E;  3M0D A;  3ZDM A;  1GDT A;  2Q6Q A;  1NTK D;  2NPS D;  4H44 C;  4QMA A;  2W6J H;  4JPZ B;  1DEE G;  3II6 A;  1LNQ A;  1RF1 A;  1M90 Q;  2K3R A;  1LT1 A;  1LT9 A;  4ZNC A;  3FGA D;  1H88 A;  3RL0 C;  4WY4 C;  1ZRT E;  1KIL A;  4EI2 A;  3H6P A;  4JYC A;  1AVY A;  3SFE C;  3L72 G;  3CI9 A;  1SQP J;  2P67 A;  5AVQ B;  1NTZ G;  5AVW B;  4EOT A;  4OGQ B;  5CBN A;  2N1T B;  4U3F J;  2B87 A;  5TIS E;  4JYB A;  3U59 A;  1ZR2 A;  3CWB G;  2FYU K;  1FDI A;  1FDO A;  4I7Z B;  2WZ7 A;  4U3F D;  3GLM A;  2VRS A;  1SQX G;  2AXT H;  4W7Y A;  3HUS A;  1SQQ K;  3CD6 P;  3PJS K;  1T3U A;  1URQ D;  4OGQ C;  1N7S B;  2N1T C;  1L4A B;  3H25 A;  3G9R A;  1L2P A;  2KLU A;  5C39 A;  3ABV C;  1MKM A;  1AVO A;  1LTJ B;  2N9Y B;  1OXZ A;  1FZE A;  3BVH A;  3O6Q A;  3HRN A;  5AW7 B;  5E79 E;  3USS A;  2ZAE B;  3T97 A;  3PHL A;  1USE A;  3H1H J;  1N7S C;  1L4A C;  3H1L D;  1H0T A;  1S72 P;  3V4W A;  1JO5 A;  2YO3 A;  3H1H D;  4XA4 A;  1HF9 A;  2ZXE B;  1BDC A;  1RF0 A;  1LTJ C;  2YIU B;  1RY3 A;  3WU2 H;  1OW7 A;  4JBZ A;  3LID A;  1Q90 D;  3CCJ P;  4WY4 A;  1BE3 J;  1GU4 A;  1PZQ A;  5APU A;  1YQ4 C;  2IX7 C;  1BE3 D;  1R8E A;  1OVR A;  1SQP E;  2OTK E;  1KQG B;  5GTI E;  3L70 E;  2YIU C;  2Z5H A;  3TSI A;  3W68 A;  1IFI A;  1NTM E;  2FY8 A;  1NGM B;  2IBZ I;  2D2C C;  5CCG D;  1NOH A;  3CC2 P;  3HE5 A;  4PV1 B;  2O01 H;  1IFN A;  1R5L A;  1Q82 Q;  2A06 G;  1FOS E;  1BCC D;  3KZI H;  3I55 P;  3MZW B;  2KS1 B;  2PP6 A;  2WSF J;  2N1T A;  3L73 E;  2Q9I A;  2RKL A;  1NTK G;  3N7N A;  2ZVO B;  3S1K A;  5KAI E;  1K73 Q;  2GUS A;  2JR8 A;  3P7K A;  4Y99 C;  2P1J A;  4W80 A;  2YNY A;  3KXD A;  4PV1 C;  5AVY B;  1KB9 D;  1KB9 I;  2HFE D;  2KSE A;  2M8R A;  1Q7Y Q;  1KFN A;  2P10 A;  3L36 A;  1L4A A;  1CI6 B;  2H43 A;  2WTY A;  1JY3 O;  1RE4 C;  2NPS C;  2IDB A;  2V7Q H;  2WMM A;  1FAV A;  2V4H A;  2WPS A;  3M9B A;  2OGU A;  4DT0 A;  4U3F G;  1Q86 Q;  4Z1M H;  2XZR A;  3L74 J;  3TDK A;  1LJ2 A;  2AEF A;  3TK1 A;  3ITK A;  1J1D B;  3MIW A;  1BSN A;  3A0B H;  3L74 D;  3NXS A;  1JY2 P;  3E1R A;  3W67 A;  1URQ B;  2E74 D;  1DX7 A;  2IBZ E;  1M7L A;  3CCM P;  5APX A;  5AVZ B;  2QJP B;  2IZ1 A;  1U57 A;  1J1D C;  5CJ0 A;  3GMA A;  2K9J B;  1JMM A;  4C7N A;  2RMZ A;  1KOR A;  3NMD A;  3H1K J;  1L0L J;  3H1L G;  1URQ C;  2Y0C A;  4N6J A;  3A0H H;  3CMA P;  1FZA A;  3H1H G;  3L4F A;  3H1K D;  1L0L D;  5CCH D;  1WRG A;  4UB8 H;  2KIK A;  1AJY A;  1LTT C;  1J1E C;  1W2E A;  2YMY A;  1R5S A;  2B89 A;  4IFM A;  1KB9 E;  3BCC G;  1AQ5 A;  4UB6 H;  2WT7 A;  1GW4 A;  3M0A A;  3UIA A;  1OWA A;  1BE3 G;  3AE4 C;  1M1J B;  3NTN A;  1JY3 P;  1JEK A;  3L75 E;  1YTZ I;  4M3L A;  1K05 A;  2OYO A;  3HE4 B;  2Q3E A;  2NPS A;  1RQV A;  1EXI A;  3GHG C;  2FBW C;  3AEA C;  4ZMD A;  3M91 A;  4EDF A;  3CCE P;  1LWU B;  2ZYG A;  1SQP K;  3L74 E;  3G71 P;  1YI2 P;  1NTM K;  4GKG A;  2M3B A;  1P84 H;  1BCC G;  2HOD B;  1M1J C;  1S1C X;  1NJI Q;  1SQB J;  1OZH A;  2W90 A;  1VDF A;  4TLF A;  2KP8 A;  3P32 A;  5L8R J;  3Q1M A;  5TIS H;  1LWU C;  1SQB D;  3CCQ P;  5CCG C;  1MFZ A;  2J59 M;  3HD7 D;  1JTH B;  2OYH B;  1M1K Q;  2J58 A;  3H1K E;  5APV A;  1GL2 D;  2FYN B;  4HB1 A;  5KLV J;  2H8P D;  2R3S A;  2KLV A;  4JF7 A;  1P84 I;  1GK4 A;  5KLV D;  2OYH C;  3L74 G;  5E79 H;  3C1L A;  1SQV D;  4ZKP A;  3A7O A;  3CCL P;  2FYN C;  2WSC J;  2WPV B;  2M0B A;  1PGP A;  2O01 N;  3Q5S A;  5KJ7 A;  1NTZ E;  5KAF E;  3H1I J;  3GHG A;  1AQT A;  3AE8 C;  1HJ0 A;  4I6M C;  3PRJ A;  2YXR B;  1N2D C;  1KTM A;  1JCC A;  2K37 A;  4R4L A;  3WUU A;  1VL2 A;  3CWB E;  3H1I D;  3FWL A;  1G2C B;  1X79 B;  2O3J A;  1S5L E;  4GOF A;  4XFJ A;  2ZVN B;  3MTU E;  1SQX E;  2E74 C;  2G3A A;  1HH0 A;  1NH4 A;  2B9B A;  3H1K G;  1L0L G;  3CX5 I;  5GTI H;  5BVZ A;  3HE4 A;  2Q7C A;  3RL0 g;  4PD4 I;  1EXJ A;  3AE5 C;  1ZW0 A;  1Z56 A;  3BRV B;  5KKZ C;  5AW2 B;  4HKZ H;  5CCG A;  1YIT P;  1ZN5 A;  5CJ4 A;  3D6Z A;  1HGV A;  1EQ7 A;  3AEE C;  2E5T A;  2QE7 H;  2FFD B;  1XTG B;  1HBW A;  1EZV D;  4JQ0 D;  1EZV I;  2CPB A;  3F89 A;  5APS A;  3TGU J;  1LP1 B;  1DIP A;  5CCH C;  1VQO P;  1ZME C;  2KOG A;  3WUT A;  1P84 E;  1GU5 A;  2C9N Y;  1EDK A;  3TGU D;  3V6I A;  5KAI H;  4CPG A;  5KLV E;  1VQ8 P;  2E75 D;  5AW5 B;  3VMA A;  1KYO D;  3KYQ A;  1PP9 G;  2Q5U A;  1Y8A A;  2FFD C;  4AUW A;  1KZU B;  1OX3 A;  2LXB A;  1IFD A;  3LIE A;  1MFT A;  1IC2 A;  1VQ9 P;  3CPW O;  1SQB G;  1X22 A;  1S2E A;  1OVV A;  3H1I E;  2LKM A;  1SFC A;  1ZV8 A;  3HD7 B;  4XE5 B;  3HTK A;  4I7Z C;  2WVR A;  3CX5 E;  2ZFC A;  4RKU J;  3RBZ A;  4PD4 E;  1PGO A;  1GL2 B;  3H1L J;  5CHX A;  2A06 E;  2C0X A;  2OYI B;  5AW4 B;  5APW A;  2OQQ A;  3PTZ A;  1NTK E;  5KLV G;  1SP4 A;  2BCC J;  2JJL A;  3HD7 C;  2L91 A;  1KFM A;  1BDD A;  3PH0 A;  2K1A A;  3AE1 C;  1EZV E;  1CZQ A;  1SQV G;  3EFF K;  3BCC J;  1NU1 J;  2BCC D;  1GL2 C;  3Q5R A;  3BCC D;  1NU1 D;  3RGU A;  2OYI C;  3TGU E;  4DJG A;  1BSH A;  4OH8 B;  2WSF H;  4BRY A;  5CCH A;  1JY2 O;  2KSJ A;  1KYO E;  1IFM A;  2W83 C;  3P8C D;  1XTC C;  4BXL A;  2XND H;  1KB9 H;  3H1I G;  3V2N A;  4U3F E;  1NTZ K;  1L0N G;  4RO0 A;  1NWQ A;  4W7Z A;  3KHU A;  1EDJ A;  4HJG H;  4BWN A;  2C0W A;  1YIJ P;  1W2B O;  3A5T A;  1BCC J;  5AVV B;  1DH3 A;  4D6T J;  5BU5 A;  2QEX P;  1FS0 E;  5APT A;  2FKW B;  2R3C A;  1BGY J;  1SQX K;  4D6T D;  2CPS A;  1BGY D;  3M9H A;  5B66 E;  2Z4E A;  3CCV P;  5AW1 B;  1EZV G;  2ZT9 D;  1LTB C;  2QM7 A;  3IR9 A;  2KZI A;  3LW5 J;  4GOE A;  1M8O B;  3BAS A;  2KYV A;  2C9L Y;  1YQ3 C;  3H1L E;  1NKN A;  3TGU G;  1SVF A;  1N7S A;  3CXH D;  3WMM 0;  3H1H E;  2RN0 A;  1YJN P;  2E75 B;  2YKP A;  3G4S P;  4L76 A;  1AV1 A;  2BCC E;  3R4Y A;  1LTJ A;  3GG2 A;  3BCC E;  4K35 A;  3H32 B;  1GL2 A;  1USD A;  3AE3 C;  2H7H A;  2R32 A;  2KNC B;  1PGJ A;  2OYI A;  2KUB A;  1FE6 A;  4B86 A;  3P8C E;  1BE3 E;  2XKM A;  2P7J A;  1PL5 A;  2FYU J;  2L5G B;  1ZLL A;  2E75 C;  1X0T A;  3L71 J;  3NFQ A;  2YXQ B;  5M1B A;  3MHV A;  3Q2Y A;  2FYZ A;  2YKQ A;  3D6Y A;  2FYU D;  2P58 A;  2I1J A;  1E5W A;  4KHX A;  1KQL A;  3L71 D;  1MV8 A;  1IZN B;  1S5L X;  2GUV A;  4OWF A;  1JUN A;  1A02 J;  1SQQ D;  4K3A A;  1BCC E;  4H13 D;  2POH A;  5KAF H;  1T8Z A;  5B5E E;  5KLI B;  2IFM A;  1VQ5 P;  1BGY E;  2QJP C;  1UIX A;  2BCC G;  5H2F E;  1S5L H;  1W5C E;  3H1J D;  1NTK K;  1NU1 G;  3A2A A;  4IFF A;  3CXH E;  1QX8 A;  2M5A B;  3GW6 A;  1CW5 A;  5KLI C;  2OTL P;  2KS1 A;  1N73 B;  3FXD A;  1RQU A;  4N78 D;  3L37 A;  2WPR A;  1RE4 A;  1OMI A;  4PJ0 E;  1VQP P;  3BAT A;  2QJY B;  1KQF B;  1S4X A;  3RK3 D;  1PP9 J;  5AW3 B;  2XDJ A;  3Q5P A;  1LTA C;  1QGK B;  1Y47 A;  2JWA A;  1PP9 D;  3I56 P;  3B71 A;  1N73 C;  4D6T G;  1CI6 A;  1X9V A;  4RJT A;  1HWT C;  3D71 A;  2QJY C;  3JSV C;  1BGY G;  2FXM A;  1FDM A;  1M57 D;  3IF4 A;  1KD1 Q;  2K9Y A;  2ZT9 B;  1RF1 B;  2QIW A;  1VF5 B;  2WSC H;  2YO2 A;  1X8Y A;  2GM4 A;  3Q3D A;  4WB4 A;  1HUC A;  2QA4 P;  2JWD A;  1URQ A;  1L0L E;  4MN4 C;  1ZOY C;  3M0D C;  2BEQ D;  2PAJ A;  1EC5 A;  2ITA A;  2JEE A;  1GW3 A;  2W6A A;  2JDI H;  4AQR D;  1YYC A;  1H89 A;  2ZT9 C;  1RF1 C;  3CX5 H;  1JM0 A;  2K9J A;  1SQV J;  5AVR B;  4PD4 H;  1DD3 A;  2FXP A;  5EFW B;  4R4M A;  4N78 E;  1KV4 A;  1ZRT D;  3KQG A;  1NHL A;  1OIP A;  3C8V A;  1YTZ T;  3G6E P;  2XNX A;  2RH0 A;  1YBK A;  2FYU G;  2ZYA A;  3AE9 C;  3L71 G;  3I5C A;  3M9Q A;  2IYP A;  1G1I A;  2H89 C;  3IFM A;  3V2P A;  3JCU E;  3E7K A;  3TYY A;  1MUU A;  3OJA B;  1SQQ G;  1PP9 E;  1L0N J;  3S9O A;  3CCS P;  1YHQ P;  1NVO A;  4YXD C;  3AEG C;  1DEB A;  2E76 D;  2MKV A;  1L0N D;  1KYO H;  4H13 B;  1N73 A;  3CME P;  1M1J A;  2G8Y A;  2IPP A;  2FXO A;  3AEB C;  1H0T B;  1SQB E;  1E79 H;  1T2K D;  4WWI A;  1UII A;  4I1L A;  4IFD K;  2I1K A;  1D7M A;  3V5B A;  1LWU A;  3H1J G;  4H44 B;  3WUV A;  2R5D A;  1Y9B A;  3CC4 P;  1GD2 E;  1PPJ D;  3TNU B;  1WT6 A;  4O9B A;  3K5B A;  3N4X A;  5KTB A;  2KXP B;  2HOD A;  4H13 C;  1GTW A;  1KQS O;  1H8A A;  1Q2N A;  2DW3 A;  3OAK A;  2Y9Z A;  3VN0 A;  3VP8 A;  1RF0 C;  5K5G B;  5B66 H;  3U1C A;  1KMI Z;  3RK3 B;  2HPC B;  1KYO I;  1JTH A;  5AVX B;  1SQV E;  2OYH A;  3HE5 B;  1S3J A; 
#chains in the Genus database with same CATH homology
 5AW0 B;  1DH3 A;  3RK2 C;  4N6J A;  1FZC A;  5BU5 A;  5APT A;  5AW8 B;  4LGD E;  1FZA A;  3HUS B;  2A45 I;  3L4F A;  1NU1 K;  2HYN A;  2FKW B;  5CCH D;  2R3C A;  1WRG A;  1SQX K;  5AW9 B;  1IK9 A;  1FJP A;  1T3J A;  3RK3 C;  2CPS A;  1SFC B;  1LTT C;  1J1E C;  1W2E A;  2YMY A;  4IFM A;  4EIJ A;  3EQ2 A;  3M9H A;  2Z4E A;  1JY2 N;  2BAS A;  1AFO A;  1AQ5 A;  3HTK B;  5AW1 B;  3VMZ A;  1HTL C;  2O1K A;  1FOS F;  2WT7 A;  2HLO A;  5AVS B;  1GW4 A;  3M0A A;  1LTB C;  2QM7 A;  3IR9 A;  3UIA A;  1OWA A;  3BAS A;  2KYV A;  2C9L Y;  3HUS C;  4AYC A;  3CLQ A;  1M1J B;  1NKN A;  2XU6 A;  3NTN A;  1SVF A;  1JY3 P;  1N7S A;  3WMM 0;  4DOJ A;  1RE3 A;  1YTZ I;  4M3L A;  3VMX A;  3HE4 B;  1J2J B;  2E43 A;  2NPS A;  1SFC C;  2YKP A;  3GHG C;  3M91 A;  1LWU B;  1L0L K;  1SQP K;  1FU1 A;  1LTJ A;  1IJD B;  2A45 H;  1LGH B;  1G2C A;  1GK6 A;  3B5N A;  1NTM K;  4GKG A;  3H32 B;  1GL2 A;  1SLQ A;  2M3B A;  2MJZ A;  2HOD B;  2H7H A;  1M1J C;  2R32 A;  5APQ A;  3RL0 B;  4WY4 B;  1GZL A;  2O1J A;  2OYI A;  4B86 A;  3P8C E;  2P2U A;  2XKM A;  1VDF A;  2P7J A;  2XV5 A;  2L5G B;  1ZLL A;  1NAF A;  2YKO A;  5CMZ A;  1JOC A;  2KP8 A;  3NFQ A;  3O8Z A;  3P32 A;  2WSE H;  5KJ7 D;  1LWU C;  3M0D A;  2FYZ A;  3VOP A;  2YKQ A;  1GDT A;  5BU8 B;  2I1J A;  1E5W A;  4KHX A;  5CCG C;  1KQL A;  2NPS D;  3TNU A;  1MFZ A;  1MV8 A;  3MGN A;  1A02 F;  2GUV A;  3II6 A;  1S9K D;  1JUN A;  2J59 M;  3HD7 D;  1JTH B;  1RF1 A;  1A02 J;  3LW5 H;  1LT9 A;  2OYH B;  2FFD A;  3A3Y B;  1JY3 N;  4C7N B;  1H88 A;  2Q3I A;  3RL0 C;  4WY4 C;  4LC1 A;  3VP9 A;  2J58 A;  1KIL A;  3H6P A;  4JYC A;  3B5N D;  5APV A;  1GL2 D;  4HYT B;  3V2R A;  2POH A;  1T8Z A;  3CI9 A;  2P67 A;  5AVQ B;  5APY A;  2IFM A;  5AVW B;  4EOT A;  4ZKU A;  2H8P D;  4GIF A;  2N1T B;  2KLV A;  4N3Y B;  4JF7 A;  5AVU B;  4JYB A;  2HPC A;  3U59 A;  1ZR2 A;  1FJK A;  4DZO A;  1SQB K;  1GK4 A;  4Y99 B;  2OYH C;  2FYU K;  1LTS C;  2WZ7 A;  1NTK K;  2Z5I A;  4WBA A;  3V4Q A;  2WT7 B;  3A2A A;  3SWY A;  4ZKP A;  3A7O A;  2VRS A;  1LTI C;  2WPQ A;  4IFF A;  4W7Y A;  3HUS A;  1SQQ K;  1CW5 A;  2N9B A;  1T3U A;  1KIL D;  1URQ D;  3SWF A;  1T2K C;  3RK2 D;  1N73 B;  4N78 D;  1N7S B;  3L37 A;  1HGZ A;  2N1T C;  2KB7 P;  1LTG C;  1L4A B;  5KJ7 A;  4I2L C;  2NPS B;  3GHG A;  2WPR A;  1RE4 A;  4I6M C;  1N2D C;  1JCC A;  3BAT A;  1JCD A;  3RK3 D;  1LTJ B;  3HD7 A;  1OXZ A;  5AW3 B;  1FZE A;  1G2C B;  1X79 B;  3BVH A;  2XDJ A;  1LTA C;  5KLV K;  3HRN A;  5AW7 B;  3C9I A;  2A45 G;  3MTU E;  3T97 A;  1HH0 A;  1NH4 A;  1N73 C;  1SQV K;  1N7S C;  5BVZ A;  3HE4 A;  2Q7C A;  1L4A C;  1CI6 A;  1X9V A;  3V4W A;  1JO5 A;  1Z56 A;  2YO3 A;  1HWT C;  3BRV B;  5AW2 B;  1S9K E;  4XA4 A;  2HG5 D;  2ZXE B;  2FXM A;  5CCG A;  1RF0 A;  1FDM A;  1ZN5 A;  1SFC D;  1LTJ C;  1RY3 A;  3EFG A;  5CJ4 A;  1HGV A;  3U1A A;  1IO4 A;  1EQ7 A;  1G1J A;  3LID A;  1RF1 B;  4C46 A;  2FFD B;  1XTG B;  1HBW A;  2WSC H;  2YO2 A;  3R2P A;  4WY4 A;  1X8Y A;  4RES B;  1GU4 A;  5APU A;  2GM4 A;  2CPB A;  3VYI A;  4WB4 A;  2OAR A;  5APS A;  2IX7 C;  1HUC A;  1L0N K;  1URQ A;  1NO4 A;  5CCH C;  1FBM A;  3VMY A;  2KOG A;  3PP5 A;  1FZC B;  5AW6 B;  3M0D C;  1GU5 A;  2C9N Y;  1FZG A;  2PAJ A;  2Z5H A;  3TSI A;  2JEE A;  5AW5 B;  1GW3 A;  1J1E B;  2W6A A;  1IFI A;  4AQR D;  1YYC A;  1H89 A;  1RF1 C;  3KYQ A;  2Q5U A;  2FFD C;  5CCG D;  4AUW A;  1NOH A;  1KZU B;  2R5B A;  5AVR B;  3B8E B;  1QL1 A;  1IFD A;  3HE5 A;  3P8M C;  2O01 H;  1IFN A;  3LIE A;  1IC2 A;  3KPE A;  4N78 E;  3RL0 D;  4WY4 D;  3KQG A;  1NHL A;  1FZC C;  1FOS E;  1YTZ T;  3CL3 D;  2XNX A;  2PP6 A;  3M06 A;  2N1T A;  2Q9I A;  1N86 A;  3N7N A;  3I5C A;  3M9Q A;  1G1I A;  3GHG B;  2LKM A;  3IFM A;  3V2P A;  2W27 A;  1SFC A;  3TYY A;  1MUU A;  3OJA B;  2WWW A;  1ZV8 A;  2GUS A;  4HH2 A;  3P7K A;  1HJB A;  3HD7 B;  4Y99 C;  2P1J A;  1ZR4 A;  1VPC A;  3HTK A;  4XE5 B;  4W80 A;  2YNY A;  5AVY B;  3MD0 A;  2ZFC A;  2HFE D;  1DEB A;  2M8R A;  3V2Q A;  3KDP B;  1KFN A;  2E42 A;  3B5N B;  1GL2 B;  1N73 A;  5CHX A;  3L36 A;  1M1J A;  4LLH A;  2C0X A;  2IPP A;  1L4A A;  2OYI B;  5KJ7 C;  1CI6 B;  5APW A;  5AW4 B;  1NKZ B;  2WTY A;  2H43 A;  1JY3 O;  1JNM A;  1RE4 C;  1HVV A;  1RE3 C;  1T2K D;  4I1L A;  2NPS C;  4IFD K;  2I1K A;  2QM8 A;  2N1T D;  1SP4 A;  1FAV A;  2WPS A;  3V5B A;  1LWU A;  2JJL A;  1FZB A;  3M9B A;  3BRT B;  3HD7 C;  1KFM A;  4C7R A;  2R5D A;  2XZR A;  1IFJ A;  1CZQ A;  2IFN A;  1GD2 E;  3TK1 A;  1J1D B;  3TNU B;  1WT6 A;  4O9B A;  3MIW A;  3N4X A;  5KTB A;  3B5N C;  3H32 A;  1GL2 C;  2HOD A;  1LT9 B;  1GTW A;  5AVT B;  2OYI C;  3NXS A;  1JY2 P;  4OH8 B;  1H8A A;  2WSF H;  1KIL B;  1MZ9 A;  3L35 A;  5CCH A;  1URQ B;  3RK2 B;  3G3Z A;  3OAK A;  1JY2 O;  2KSJ A;  1DX7 A;  1N7S D;  3OA7 A;  1IFM A;  1M7L A;  3P8C D;  1XTC C;  1L4A D;  3VN0 A;  3VP8 A;  1RF0 C;  5APX A;  5AVZ B;  3VTP C;  3U1C A;  3E1I A;  3V2N A;  1J1D C;  3RK3 B;  5CJ0 A;  1NTZ K;  2HPC B;  1JTH A;  1NWQ A;  1PFI A;  1JMM A;  5AVX B;  4W7Z A;  3MUD A;  2OYH A;  1LT9 C;  2WIT A;  4C7N A;  1CSB A;  4GT1 A;  3HE5 B;  1FZF A;  1QL2 A;  2C0W A;  3NMD A;  3A5T A;  1N7L A;  1KIL C;  2W6B A;  5AVV B;  1URQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...