2OYHA

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
64
structure length
64
Chain Sequence
IEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 64
sequence length 64
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyhA00
1JY3O 1RE3C 1JY2O 1LT9A 1T3UA 1FZBA 1RE4C 3HUSC 1RF1B 2HODB 2OYIC 1FZFA 1FZCC 1LT9B 2OYHA 3GHGA 3E1IA 2HODA 1LWUA 1M1JA 1FZGA 2A45H 2Z4EA 2FFDC 3H32A 2XNXA 2HPCA 1JY3P 1FZAA 3GHGB 1N73C 2OYHB 1RF0A 1LTJC 1JY2P 1LWUB 1M1JB 1W2EA 2Q9IA 1RE3A 1FZEA 3H32B 2A45G 2HPCB 3HUSA 1RE4A 1RF1C 2OYIA 1FZCA 3BVHA 1LT9C 3HUSB 2OYIB 1N86A 1FZCB 2FFDA 2H43A 1JY3N 2HLOA 1N73A 2OYHC 3GHGC 1JY2N 1LTJA 1LWUC 1M1JC 2FFDB 1N73B 2A45I 1RF1A 1LTJB 1RF0C
chains in the Genus database with same CATH superfamily
2FY8A 3EQ2A 3N4XA 1SQBK 2R3CA 3L70J 1CSBA 3L74G 2C9LY 1KB9H 1RF0A 1M1JB 3CMEP 2E43A 5AW0B 1YBKA 1HF9A 3B5NB 1SQBD 1YYCA 5CCGC 1RF1A 3M0DC 2C9NY 2AEJA 2Z4EA 2NRGA 2E75D 1DX7A 5B66E 2P1JA 4Y99B 1AJYA 5BU5A 3H1HJ 1SQQE 3CWBD 1QLED 3AEFC 4D6TG 2QRXA 1TU3F 5GTIH 4H13D 2FYUG 2MJZA 4JBZA 2XKMA 5APYA 1SP4A 3A5TA 1JY2P 1WMKA 4YTPC 1ZMEC 1RE4A 1YIJP 1PPJD 2W6AA 1CI6A 4GIFA 2H88C 3SFDC 4I2LC 3V4WA 2W6BA 1H0TB 3S4RA 2K9JA 1WRGA 2IFNA 3L73E 3TNUA 3L74J 5KAIE 2YXRB 2PAJA 1S4XA 3H1JG 2YKQA 3H1KG 2V7QH 3AE7C 1RY3A 2KSJA 3M9BA 3ZDMA 3V2QA 2W8ZA 4W7YA 1EZVI 1FZGA 1NYHA 5APUA 4HB1A 1LTSC 1KILE 5KJ7D 1OZHA 2QG4A 1VQ5P 1Q86Q 1GW3A 2KXPB 3HTKB 1NKZB 3W68A 2QJYC 3CPWO 2XNDH 2CPBA 2FYUJ 1XTGB 2OYHA 1LJ2A 2K37A 1M57D 1AQTA 1NO4A 3Q5PA 3PH0A 1GL2A 4NPFX 2HFED 4QMAA 3KQGA 1X22A 1VQPP 4H44D 3CXHE 2KS1A 2SPZA 2E76D 1JB0J 3P7KA 1S1CX 5APQA 3PHLA 4OGQC 4WY4A 1GU4A 4IFMA 3SFEC 3H1JJ 5EFWB 3MP7B 3GLMA 2ZT9D 3C9IA 1L0LG 3H1KJ 3L70D 1H88A 4N3YB 5M1BA 2J58A 4UB6H 2BEQD 2BCCG 1HVVA 2W83C 2R32A 4EDFA 1JOCA 4U3FG 4XFJA 2WITA 1IJDB 4BRYA 3Q3DA 2KYVA 3V2NA 2QJYB 4AQRD 3AEAC 4H0LD 3L71G 4C7RA 3RK3E 1E5WA 3V6IA 3H1HD 3D6YA 3G9RA 2JWDA 1SLQA 1JNMA 3Q5SA 2E5YA 1AFOA 2E74D 1S9KE 1L4AC 5APSA 5APXA 3IFMA 3U59A 4OGQB 2Y0DA 1LP1A 1X8YA 1JEKA 2QJKC 1L0LJ 3T97B 3VYIA 4U7JA 3L74D 3A3YB 3I5CA 3AE3C 2OTKE 4XE5B 2HODA 5AVVB 2BCCJ 2CK3H 1FZFA 2A06E 3AEGC 4R4LA 5AW3B 2O01H 1ZW0A 4HJGH 4DJGA 1VF5C 2WT7B 3L71J 2FYUK 1N7SD 2N9YB 3AE4C 1N2DC 2O01N 1L4AB 1BGYG 3E1IA 3GMAA 4LLHA 1YITP 4D6TD 2NPSA 3O6QB 4NPEA 2FYUD 2JDIH 3B4SA 2KSEA 3PJSK 3CCLP 1ZRTE 1E79H 1SFCD 1LT9A 2QJKB 3RK2D 4L76A 2J5UA 1R8EA 3I56P 1SQPG 2JEEA 4PD4H 1IK9A 2I1KA 1OW8A 3H1JD 1AVYA 3H1KD 1KYOD 1QGKB 3BCCE 3GF7A 1HJ0A 2ITAA 2YIUC 1VF5B 3D70A 3PLNA 2Q5UA 4IL6E 1EZVE 3MUDC 4OWFA 3AEEC 1LTAC 2WSFJ 1W5CE 1N73A 1RHZB 5AVTB 1FZBA 3CX5H 3KPEA 4GT1A 2C0WA 1IFIA 2A45H 1P84D 1DD4A 2ZYDA 4BXLA 3EWKA 1NVOA 2RMZA 1M8OB 2RKLA 3HRNA 2YO3A 5CCGD 4BWNA 2OYOA 3N7NA 1GMJA 4W7ZA 4WVZA 3JCUE 1ZOYC 3NXSA 4PV1C 2IBZG 5AVRB 1GDTA 1L0LK 2HPCB 1SQPJ 2O1KA 1S72P 3AE9C 1VQ4P 3CLQA 3CI9A 1GU5A 1VQKP 2YIUB 3OW2O 5APWA 1L0LD 2QM7A 1KQLA 2P10A 3H1IG 1MUUA 1KB9E 4AYCA 2PP6A 2XNXA 1KILC 2BCCD 1EC5A 1Y47A 4DOJA 1U57A 4U3FD 1EDLA 1T3JA 4RO0A 3MHVA 2KNCA 2OTLP 3W67A 2KP8A 4N78E 2I8DA 3VOPA 3L71D 1PL5A 1YTZT 3M91A 1EXJA 3FWLA 3VMZA 4PV1B 1VQNP 1RQUA 1QVFO 5GTIE 2YNYA 2Q1KA 1SQBE 1OWAA 1SVFA 1SQQG 1ZR2A 4ZMDA 3MTUE 5B5EH 2IFMA 2ZYAA 3LIEA 1EDKA 1VQ9P 3A0HH 3L75E 2YXQB 4DCKA 1G1IA 5AW9B 3H25A 3HD7D 3E7KA 3MZWB 2FXMA 1KILB 1RF0C 1NTME 1OVVA 2WPQA 3KZIH 3WUVA 2RN0A 3H1IJ 3II6A 4EIJA 3HUSA 1RF1C 4JPZB 1IFDA 1NTKE 2AEFA 1PPJE 3RK3C 1VL2A 3C8VA 1L2PA 2O1JA 1NTZE 2P58A 3CCSP 2POHA 1GD2E 2ZJSE 3ITKA 1BGYD 4JYBA 3CX5I 1HJBA 2BEZF 1UIIA 2A45I 3TGUE 4OVNF 1RE4C 1A02F 1SQQJ 2JWAA 5L8RJ 1NHLA 1SQPK 3CCMP 3P8CE 3G4SP 1N7SA 3M0AA 4KT0J 1HUCA 1ZN5A 1LTGC 1URQD 3PP5A 5CBNA 1SQPD 3PTZA 2Y9YA 2WTYA 1RF1B 1YQ4C 5APVA 4DT0A 3G3ZA 1P84I 3V4QA 3RK3B 1KN7A 1GK6A 1L4AD 1IK7A 3L73J 1SFCA 4UB6E 2PGDA 2D2CC 1YJNP 4UB8H 2IZ1A 2GUSA 4WB4A 1SQXE 1NJIQ 1OFCX 1RE3A 1OXZA 2WZ7A 2WSCH 2WSEH 2WQYC 4GODA 2OYHC 2KLUA 1CI6B 2XV5A 4RESB 1SS1A 2WPRA 2FYZA 3LIDA 1JY3O 1GL2C 2LKMA 2K9JB 3H32A 3TNUB 3JC22 4GKGA 2OYIA 3I55P 1IO4A 4I7ZC 1OMIA 2IBZD 1VQ8P 1VF5D 4WBAA 1IFMA 4WY4C 5KTBA 3MIWA 1BCCE 2D2CB 1NOHA 5H2FH 3WUTA 2QEXP 3MD0A 1AA0A 3H1ID 1YHQP 5C39A 2XDJA 1KORA 5TISH 1BE3E 3QH9A 4C7NB 1Q7YQ 4EYYQ 1R5LA 2ZAEB 1NU1E 2HG5D 2Z5IA 2B9BA 3AE1C 2OYHB 2A06G 3IF4A 1K8AQ 2N1TA 1FAVA 1GL2B 1OW6A 2WPVB 2AXCA 2I1JA 4EOTA 3D6ZA 1HGZA 1SQQK 2WVRA 4I7ZB 4ASWA 2KS1B 4IFDK 2H8PD 4WY4B 1UIXA 1ZLLA 1SQQD 1WT6A 5BU8B 1CW5A 3NMDA 3OJAB 2ZYGA 2QSIA 1HTLC 2K1AA 3L72E 1JY2O 3VMAA 3VP9A 3LW5H 4PD4E 4BRYB 2FYNC 2IZ0A 2BASA 4I1LA 1KQSO 4PV1D 3VMYA 2Z5HA 1IFPA 2B88A 3HD7A 3BCCG 1OVRA 2FFDA 1KZUB 1EZVG 5CCHA 1LTJA 1K9MQ 3CX5E 2NPSC 1T3UA 3KHUA 3U1CA 1LP1B 1FOSF 4AUWA 2J59M 1KILD 4L74A 1LT9C 3G6EP 3A2AA 3F5HA 2HODB 2QM8A 4H13C 1LNQA 2M5AA 2FYNB 1JTHA 1PGOA 3WU2H 3TYYA 5KLIC 3V5BA 3CXHD 2CPSA 4JF7A 2OTJP 3P8MC 1NH4A 1FDOA 1S5LH 1URQA 1PP9E 3TSIA 1N73C 1K73Q 2DW3A 5AW4B 2WMMA 3NTNA 3BCCJ 3MGNA 2NPSB 3UIAA 2IBZI 3H1LE 3HE5A 1QVGO 2KIKA 1NAYA 3B5ND 1LT9B 3V2PA 2M3EA 3H6PA 5E79H 1JMMA 1A02J 2M8RA 4I6MC 3RK3D 4H13B 2IX7C 2V4HA 1Q81Q 5GTHH 4U3FE 1KFMA 5TJHA 2WWWA 1VQOP 5KLIB 4OH8B 3M06A 5AVZB 1PV3A 3RBXA 3TK1A 1U7JA 5B5EE 1S9KD 2IDBA 3FX0A 1S5LX 1SQBG 3B71A 1D7MA 2M0BA 3A0HE 2KI7B 3EFGA 4RJTA 2JO1A 3L75G 1N73B 3KZIE 2K9YA 1NTMG 2OARA 1KFNA 1Z56A 2XU6A 1KYOH 2KZIA 1QEXA 2B89A 2A06D 1LT1A 3R4YA 3RGUA 1NTKG 1PPJG 1KQGB 5KJ7A 3FGAD 3GHGA 4HKZH 2L91A 1BDDA 1W2EA 2K88A 1NTZG 1RH5B 3HE4A 1KV4A 3EFFK 3CC7P 1BSHA 3CCVP 3L37A 1P84H 4L73A 2NZ2A 3AE5C 1ZV8A 4MN4C 3BASA 5AVSB 2OQQA 2KK7A 2Q6QA 3TGUG 2JP3A 1IZNB 1SQBJ 2KUBA 1L0NE 4GOEA 2YMKA 2IYOA 1ZRTD 2MKVA 3M9QA 3L75J 1XTCC 2AXTH 1GL2D 3OA7A 1SQVE 1G2CA 2KNCB 3HUSC 3IN6A 2YKOA 2B87A 5AVQB 1EQ7A 4PJ0H 5KLVE 1LWUA 1NTMJ 1QX8A 3USSA 3A0BH 1IFJA 3C1LA 1M7LA 2R5BA 3TF5A 2V7QJ 1FDMA 1R5SA 4UB8E 1NTKJ 3BCCD 2R44A 1HWTC 2OGUA 1EZVD 1Q90D 4WWIA 1PZQA 4YXWH 1NTZJ 1SQXG 3VP8A 1JCCA 5AW2B 3CCEP 1CZQA 5AVUB 1N7SC 2R5DA 1DIPA 3E1RA 5DJTB 3TGUJ 3CWBE 1NAFA 3VMXA 1JM0A 3OAKA 2Q9IA 1DH3A 2E42A 1U7MA 5K5GB 3L73G 3HUSB 2VRSA 1SFCC 2QE7H 4OGQD 3RK2C 2L5GB 1VQ7P 1BCCG 1FC2C 2ZXEB 3M9HA 4N6JA 4RKUJ 5TISE 3GW6A 1LTTC 3CL3D 1ZXGA 2QVAA 1MFTA 1LTBC 1KB9D 1RE3C 5KAFH 4L75A 1USEA 1BE3G 1KYOI 1YJWP 3L35A 1GTWA 3U1AA 1IC2A 1SQXJ 2ZVNB 2WSFH 2XZRA 1H8AA 1NU1G 1FZCA 1BSNA 1N7SB 3BVHA 3RL0C 4N78D 4JYCA 3CD6P 2OYIC 2FBWC 1M1JA 1MZ9A 1OIPA 1OW7A 3B5NA 3BRVB 3FWNA 5AVXB 1SFCB 4IFFA 2M3BA 3RK2B 3NFQA 2NPSD 1JCDA 1NTMK 1NKNA 1T6AA 3B8EB 3L75D 3L72G 1BDCA 1FBMA 1BCCJ 1FOSE 4YXDC 1T2KC 3ABVC 1JMBA 1NTMD 1PGJA 1NTKK 1MFZA 2P67A 3L70E 1BE3J 1YTZI 2N1TC 3RL0B 2G3AA 1VQ6P 2FXPA 1NTKD 1NTZK 3H32B 3KDPB 1NU1J 3S9OA 2FKWB 2OYIB 2O01J 2Y9ZA 3RL0g 2QJPC 1H0TA 1NTZD 3TDKA 5CJ0A 5AVWB 4ZNCA 4DZOA 3KXDA 1T8ZA 3BATA 5AW1B 5CCGA 3M0DA 2A45G 3G71P 3H1HE 2LXBA 3GG2A 1LTIC 3TGUD 1LGHB 3D71A 1NWQA 3A7OA 3F89A 2RH0A 3P8CD 4TT3H 1HBWA 2JJLA 3L72J 3WU2E 5AVYB 3FXDA 1EDJA 4O9BA 3HTKA 2N1TB 3RBZA 4C7NA 4C46A 3HD7C 1IFNA 2Y0EA 4D6TJ 1KD1Q 3L74E 1S5LE 1KC8Q 3O8ZA 4NPDA 1FJKA 1Q2NA 2FFDC 1FJPA 1SQXK 5CCHC 1LTJC 2QJPB 1PP9G 4ASVA 1Y9BA 2Y0CA 4CPGA 3IR9A 5AW6B 3CCRP 4M3LA 4ZKUA 5AW8B 1SQXD 1FE6A 3H1LG 2YO2A 3CC2P 1MV8A 5E79E 1N7LA 3L36A 4A7PA 2JKVA 1DEBA 5B66H 1PGQA 4D6TE 5GTHE 2FYUE 1S3JA 3K5BA 4GOFA 1KB9I 3L73D 1KTMA 1EDIA 3AE6C 5CHXA 3HD7B 5AW7B 1X79B 2YKPA 5APTA 1JY3N 5DJUB 2HLOA 1BCCD 1URQC 2QA4P 2FFDB 1LTJB 4W80A 3H1JE 1ZR4A 2PRRA 1FZAA 3H1KE 1NU1K 1KYOE 2W6JH 3PRJA 5KAIH 1PP9J 1BE3D 2E75C 2Q3EA 1J1DC 4LGDE 2N9BA 1FU1A 1NU1D 4IOIH 3H1LJ 4KJMA 5CBOA 1QL2A 3IAOA 2M5AB 3VTPC 1G1JA 1JTHB 3T97A 1J1EC 2KLVA 1P84E 1NGMB 2H89C 1GW4A 4Y28J 3GF3A 1KMIZ 2KB7P 4U3FJ 1URQB 1PIXA 4EI2A 2FXOA 3L72D 2GA1A 2WT7A 1L0NG 3AECC 2AXTE 2QIWA 2O3JA 2IYPA 3HE5B 3CXHH 1L4AA 4PJ0E 2E75B 1VQLP 3SWFA 1J1DB 1FDIA 4PD4D 3S1KA 3SWYA 2P2UA 1L0LE 1SQVG 3O6QA 2KOGA 3Q2YA 3A0BE 1M56D 5KLVG 5BVZA 1QL1A 5KJ7C 2BCCE 2E5TA 3GHGC 1JY2N 2JR8A 2R3SA 5CMZA 1J1EB 1DD3A 4HH2A 1YJ9P 2W90A 3P32A 4B86A 4JQ0D 1Q82Q 3L71E 3CX5D 2WSSH 1ZP0C 1MKMA 4H44C 1JO5A 3SSUA 1RQVA 1H89A 1VPCA 1X9VA 2E76C 1KQFB 3SWKA 3RL0D 4HYTB 3CWBG 3CCUP 2ZT9C 2ZXXA 3L4FA 2H43A 1L0NJ 1GK4A 2IPPA 1LWUC 2LXCB 4K3AA 3Q5RA 2H7HA 3QWOC 5CJ4A 1BGYJ 4YPCA 1AQ5A 1SQVJ 3JSVC 1FS0E 3GHGB 4XA4A 5KLVJ 1HGVA 2G8YA 2D2CD 1N86A 3HE4B 3KYQA 2W27A 1PP9D 4K35A 5KAFE 3CCJP 4H0LC 3CCQP 4GDOA 4Z1MH 3BRTB 2HPCA 3AE8C 2C0XA 3H1LD 1OVUA 1T2KD 2ZFCA 4H44B 5AW5B 2E74C 4LC1A 1X0TA 2WSCJ 2WSEJ 2E76B 1BGYE 3MUDA 2KZJA 3WMM0 4ZKPA 2N1TD 1G2CB 1DEEG 2ZT9B 2B87B 1LWUB 1VDFA 3CWBJ 2YMYA 2K3RA 1GZLA 4WY4D 3FXEA 1OX3A 5KKZC 3AEDC 3CMAP 1YI2P 1SQPE 1HH0A 2Q3IA 2PFXA 4H0LB 3CXHI 1AVOA 1JUNA 2P7JA 1M90Q 3AE2C 2GM4A 2Q7CA 1FZCC 1J2JB 2E74B 3L70G 1PFIA 2HR3A 4IL6H 4R4MA 1K04A 1KILA 1M1JC 1Y8AA 3B5NC 1YQ3C 4PD4I 1N8RQ 2WPSA 5CCHD 2AEMA 1JY3P 5H2FE 3CC4P 1M1KQ 3R2PA 2ZVOB 5KKZB 3VN0A 1L0NK 2UWJE 1K05A 1PGPA 3H1HG 1VQMP 1AV1A 1S2EA 3Q1MA 2IBZE 4TLFA 4Y99C 1EXIA 3JCUH 1SQVK 1L0ND 3WUUA 2LR2A 5KLVK 3V2RA 1FZEA 2HYNA 4KHXA 3LW5J 1W2BO 2GUVA 1SQVD 1FZCB 3AEBC 4IL6X 5KLVD 1USDA 3H1IE
chains in the Genus database with same CATH topology
5APWA 3EQ2A 3N4XA 2QM7A 1KQLA 3O8ZA 1SQBK 1URQA 2R3CA 1FJKA 1MUUA 1CSBA 4AYCA 2PP6A 2FFDC 1FJPA 2C9LY 2XNXA 3TSIA 1SQXK 1N73C 5CCHC 1RF0A 1LTJC 1KILC 1M1JB 5AW4B 2E43A 3NTNA 3MGNA 4DOJA 2NPSB 5AW0B 3UIAA 3IR9A 5AW6B 3B5NB 1T3JA 1YYCA 3HE5A 4M3LA 4ZKUA 5AW8B 5CCGC 1RF1A 3M0DC 2KP8A 3B5ND 4N78E 3VOPA 1LT9B 2YO2A 3V2PA 2C9NY 1MV8A 2Z4EA 1N7LA 3H6PA 1DX7A 1YTZT 3M91A 1JMMA 3L36A 2P1JA 1A02J 1DEBA 2M8RA 4Y99B 3VMZA 4I6MC 3RK3D 2IX7C 5BU5A 1KFMA 2YNYA 2WWWA 1OWAA 4OH8B 2MJZA 1SVFA 3M06A 5AVZB 1ZR2A 3TK1A 2XKMA 5CHXA 1S9KD 5APYA 1SP4A 3MTUE 1JY2P 3A5TA 2IFMA 3LIEA 3HD7B 5AW7B 1RE4A 3EFGA 1X79B 2W6AA 1CI6A 2YKPA 5APTA 1JY3N 1G1IA 5AW9B 2HLOA 1URQC 4GIFA 3HD7D 2FFDB 4I2LC 3V4WA 1N73B 2FXMA 1LTJB 1KILB 1RF0C 2W6BA 2WPQA 4W80A 1WRGA 2IFNA 1ZR4A 3II6A 3TNUA 2OARA 1FZAA 1KFNA 1NU1K 2PAJA 1Z56A 4EIJA 2XU6A 3HUSA 1RF1C 2YKQA 1J1DC 1IFDA 4LGDE 1RY3A 2N9BA 1FU1A 3RK3C 2KSJA 3M9BA 3V2QA 5KJ7A 3GHGA 2O1JA 4W7YA 1FZGA 5APUA 1QL2A 3VTPC 1G1JA 1JTHB 1W2EA 2POHA 1GD2E 3T97A 1J1EC 1LTSC 3HE4A 5KJ7D 2KLVA 4JYBA 1HJBA 1GW3A 3L37A 1GW4A 3HTKB 1NKZB 1ZV8A 2A45I 1RE4C 3BASA 2CPBA 5AVSB 1XTGB 1A02F 2KB7P 2OYHA 1NHLA 1URQB 1SQPK 3P8CE 1N7SA 1NO4A 1GL2A 3M0AA 1HUCA 1ZN5A 2HFED 1LTGC 3M9QA 1URQD 3KQGA 2WT7A 3PP5A 1XTCC 3HE5B 1GL2D 3OA7A 1G2CA 2WTYA 1L4AA 3HUSC 1RF1B 2YKOA 3P7KA 3SWFA 1J1DB 5APVA 1EQ7A 5AVQB 3SWYA 2P2UA 1LWUA 5APQA 2KOGA 4WY4A 3G3ZA 1GU4A 4IFMA 3V4QA 3RK3B 1GK6A 1L4AD 1SFCA 3C9IA 1IFJA 5BVZA 1QL1A 1M7LA 1H88A 2R5BA 5KJ7C 4N3YB 2J58A 3GHGC 1JY2N 1FDMA 5CMZA 1HVVA 1J1EB 2GUSA 2R32A 4HH2A 1HWTC 4WB4A 1JOCA 2WITA 3P32A 4B86A 1RE3A 1OXZA 2WZ7A 1IJDB 2KYVA 2WSCH 3V2NA 3VP8A 2WSEH 1JCCA 5AW2B 4AQRD 1CZQA 2OYHC 1CI6B 2XV5A 4RESB 2WPRA 2FYZA 3LIDA 1JY3O 5AVUB 4C7RA 1N7SC 1JO5A 1E5WA 1GL2C 2R5DA 1H89A 1VPCA 1X9VA 1SLQA 2LKMA 1NAFA 3VMXA 1JNMA 3H32A 3OAKA 2Q9IA 1AFOA 3TNUB 1DH3A 4GKGA 3RL0D 2E42A 4HYTB 2OYIA 1IO4A 1S9KE 1L4AC 3HUSB 4WBAA 5APSA 3L4FA 5APXA 2H43A 1GK4A 3IFMA 2IPPA 1LWUC 2VRSA 3U59A 1IFMA 4WY4C 5KTBA 3MIWA 2H7HA 1SFCC 5CJ4A 1AQ5A 3RK2C 1X8YA 3GHGB 2L5GB 1NOHA 4XA4A 2ZXEB 3M9HA 3MD0A 4N6JA 1HGVA 3VYIA 1N86A 1LTTC 3HE4B 2XDJA 3A3YB 3CL3D 3I5CA 3KYQA 2W27A 4XE5B 1LTBC 4C7NB 2HODA 5AVVB 1RE3C 1FZFA 3BRTB 2HG5D 2Z5IA 2HPCA 2OYHB 3L35A 1GTWA 3U1AA 1IC2A 2C0XA 1T2KD 2WSFH 2XZRA 2ZFCA 2O01H 5AW3B 1H8AA 1FZCA 2N1TA 1N7SB 3BVHA 1FAVA 3RL0C 5AW5B 1GL2B 4LC1A 4N78D 2I1JA 4EOTA 2WT7B 1HGZA 3MUDA 2FYUK 1N7SD 4JYCA 1SQQK 3WMM0 4ZKPA 2N1TD 2OYIC 1N2DC 1G2CB 1L4AB 4IFDK 2H8PD 3E1IA 4LLHA 1M1JA 1MZ9A 1LWUB 2NPSA 4WY4B 1VDFA 1ZLLA 3B5NA 3BRVB 1WT6A 5AVXB 2YMYA 1SFCB 5BU8B 1CW5A 3NMDA 3OJAB 4IFFA 2M3BA 1GZLA 3RK2B 3NFQA 4WY4D 1HTLC 2NPSD 1SFCD 1JY2O 1LT9A 1JCDA 1NTMK 3VP9A 1NKNA 3RK2D 3B8EB 1HH0A 2Q3IA 1FBMA 3LW5H 1FOSE 2JEEA 1T2KC 1JUNA 2P7JA 1NTKK 1IK9A 2BASA 2I1KA 1MFZA 4I1LA 2P67A 3VMYA 2GM4A 1YTZI 2Z5HA 2Q7CA 1FZCC 2N1TC 3RL0B 1J2JB 3HD7A 1PFIA 1NTZK 2Q5UA 3H32B 3KDPB 2FKWB 1LTAC 2OYIB 2FFDA 1KZUB 1N73A 5CCHA 1LTJA 1KILA 1M1JC 5CJ0A 5AVTB 2NPSC 1T3UA 1FZBA 3KPEA 3U1CA 3B5NC 5AVWB 1FOSF 4AUWA 4GT1A 2C0WA 1IFIA 2WPSA 5CCHD 2J59M 1KILD 4DZOA 2A45H 1T8ZA 3BATA 5AW1B 1JY3P 5CCGA 3M0DA 3R2PA 2A45G 3VN0A 1L0NK 1LTIC 1LT9C 1LGHB 3HRNA 2YO3A 1NWQA 5CCGD 3A7OA 3A2AA 3N7NA 4W7ZA 4Y99C 2HODB 2QM8A 3P8CD 3NXSA 1SQVK 1HBWA 2JJLA 1JTHA 5AVRB 5AVYB 3V2RA 5KLVK 1GDTA 1L0LK 1FZEA 2HYNA 2HPCB 4KHXA 2O1KA 3TYYA 3V5BA 4O9BA 2CPSA 4JF7A 2GUVA 3CLQA 3CI9A 3HTKA 1GU5A 1FZCB 2N1TB 3P8MC 4C7NA 4C46A 1NH4A 3HD7C 1IFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY3 O;  1RE3 C;  1JY2 O;  1LT9 A;  1T3U A;  1FZB A;  1RE4 C;  3HUS C;  1RF1 B;  2HOD B;  2OYI C;  1FZF A;  1FZC C;  1LT9 B;  2OYH A;  3GHG A;  3E1I A;  2HOD A;  1LWU A;  1M1J A;  1FZG A;  2A45 H;  2Z4E A;  2FFD C;  3H32 A;  2XNX A;  2HPC A;  1JY3 P;  1FZA A;  3GHG B;  1N73 C;  2OYH B;  1RF0 A;  1LTJ C;  1JY2 P;  1LWU B;  1M1J B;  1W2E A;  2Q9I A;  1RE3 A;  1FZE A;  3H32 B;  2A45 G;  2HPC B;  3HUS A;  1RE4 A;  1RF1 C;  2OYI A;  1FZC A;  3BVH A;  1LT9 C;  3HUS B;  2OYI B;  1N86 A;  1FZC B;  2FFD A;  2H43 A;  1JY3 N;  2HLO A;  1N73 A;  2OYH C;  3GHG C;  1JY2 N;  1LTJ A;  1LWU C;  1M1J C;  2FFD B;  1N73 B;  2A45 I;  1RF1 A;  1LTJ B;  1RF0 C; 
#chains in the Genus database with same CATH topology
 2FY8 A;  3EQ2 A;  3N4X A;  1SQB K;  2R3C A;  3L70 J;  1CSB A;  3L74 G;  2C9L Y;  1KB9 H;  1RF0 A;  1M1J B;  3CME P;  2E43 A;  5AW0 B;  1YBK A;  1HF9 A;  3B5N B;  1SQB D;  1YYC A;  5CCG C;  1RF1 A;  3M0D C;  2C9N Y;  2AEJ A;  2Z4E A;  2NRG A;  2E75 D;  1DX7 A;  5B66 E;  2P1J A;  4Y99 B;  1AJY A;  5BU5 A;  3H1H J;  1SQQ E;  3CWB D;  1QLE D;  3AEF C;  4D6T G;  2QRX A;  1TU3 F;  5GTI H;  4H13 D;  2FYU G;  2MJZ A;  4JBZ A;  2XKM A;  5APY A;  1SP4 A;  3A5T A;  1JY2 P;  1WMK A;  4YTP C;  1ZME C;  1RE4 A;  1YIJ P;  1PPJ D;  2W6A A;  1CI6 A;  4GIF A;  2H88 C;  3SFD C;  4I2L C;  3V4W A;  2W6B A;  1H0T B;  3S4R A;  2K9J A;  1WRG A;  2IFN A;  3L73 E;  3TNU A;  3L74 J;  5KAI E;  2YXR B;  2PAJ A;  1S4X A;  3H1J G;  2YKQ A;  3H1K G;  2V7Q H;  3AE7 C;  1RY3 A;  2KSJ A;  3M9B A;  3ZDM A;  3V2Q A;  2W8Z A;  4W7Y A;  1EZV I;  1FZG A;  1NYH A;  5APU A;  4HB1 A;  1LTS C;  1KIL E;  5KJ7 D;  1OZH A;  2QG4 A;  1VQ5 P;  1Q86 Q;  1GW3 A;  2KXP B;  3HTK B;  1NKZ B;  3W68 A;  2QJY C;  3CPW O;  2XND H;  2CPB A;  2FYU J;  1XTG B;  2OYH A;  1LJ2 A;  2K37 A;  1M57 D;  1AQT A;  1NO4 A;  3Q5P A;  3PH0 A;  1GL2 A;  4NPF X;  2HFE D;  4QMA A;  3KQG A;  1X22 A;  1VQP P;  4H44 D;  3CXH E;  2KS1 A;  2SPZ A;  2E76 D;  1JB0 J;  3P7K A;  1S1C X;  5APQ A;  3PHL A;  4OGQ C;  4WY4 A;  1GU4 A;  4IFM A;  3SFE C;  3H1J J;  5EFW B;  3MP7 B;  3GLM A;  2ZT9 D;  3C9I A;  1L0L G;  3H1K J;  3L70 D;  1H88 A;  4N3Y B;  5M1B A;  2J58 A;  4UB6 H;  2BEQ D;  2BCC G;  1HVV A;  2W83 C;  2R32 A;  4EDF A;  1JOC A;  4U3F G;  4XFJ A;  2WIT A;  1IJD B;  4BRY A;  3Q3D A;  2KYV A;  3V2N A;  2QJY B;  4AQR D;  3AEA C;  4H0L D;  3L71 G;  4C7R A;  3RK3 E;  1E5W A;  3V6I A;  3H1H D;  3D6Y A;  3G9R A;  2JWD A;  1SLQ A;  1JNM A;  3Q5S A;  2E5Y A;  1AFO A;  2E74 D;  1S9K E;  1L4A C;  5APS A;  5APX A;  3IFM A;  3U59 A;  4OGQ B;  2Y0D A;  1LP1 A;  1X8Y A;  1JEK A;  2QJK C;  1L0L J;  3T97 B;  3VYI A;  4U7J A;  3L74 D;  3A3Y B;  3I5C A;  3AE3 C;  2OTK E;  4XE5 B;  2HOD A;  5AVV B;  2BCC J;  2CK3 H;  1FZF A;  2A06 E;  3AEG C;  4R4L A;  5AW3 B;  2O01 H;  1ZW0 A;  4HJG H;  4DJG A;  1VF5 C;  2WT7 B;  3L71 J;  2FYU K;  1N7S D;  2N9Y B;  3AE4 C;  1N2D C;  2O01 N;  1L4A B;  1BGY G;  3E1I A;  3GMA A;  4LLH A;  1YIT P;  4D6T D;  2NPS A;  3O6Q B;  4NPE A;  2FYU D;  2JDI H;  3B4S A;  2KSE A;  3PJS K;  3CCL P;  1ZRT E;  1E79 H;  1SFC D;  1LT9 A;  2QJK B;  3RK2 D;  4L76 A;  2J5U A;  1R8E A;  3I56 P;  1SQP G;  2JEE A;  4PD4 H;  1IK9 A;  2I1K A;  1OW8 A;  3H1J D;  1AVY A;  3H1K D;  1KYO D;  1QGK B;  3BCC E;  3GF7 A;  1HJ0 A;  2ITA A;  2YIU C;  1VF5 B;  3D70 A;  3PLN A;  2Q5U A;  4IL6 E;  1EZV E;  3MUD C;  4OWF A;  3AEE C;  1LTA C;  2WSF J;  1W5C E;  1N73 A;  1RHZ B;  5AVT B;  1FZB A;  3CX5 H;  3KPE A;  4GT1 A;  2C0W A;  1IFI A;  2A45 H;  1P84 D;  1DD4 A;  2ZYD A;  4BXL A;  3EWK A;  1NVO A;  2RMZ A;  1M8O B;  2RKL A;  3HRN A;  2YO3 A;  5CCG D;  4BWN A;  2OYO A;  3N7N A;  1GMJ A;  4W7Z A;  4WVZ A;  3JCU E;  1ZOY C;  3NXS A;  4PV1 C;  2IBZ G;  5AVR B;  1GDT A;  1L0L K;  2HPC B;  1SQP J;  2O1K A;  1S72 P;  3AE9 C;  1VQ4 P;  3CLQ A;  3CI9 A;  1GU5 A;  1VQK P;  2YIU B;  3OW2 O;  5APW A;  1L0L D;  2QM7 A;  1KQL A;  2P10 A;  3H1I G;  1MUU A;  1KB9 E;  4AYC A;  2PP6 A;  2XNX A;  1KIL C;  2BCC D;  1EC5 A;  1Y47 A;  4DOJ A;  1U57 A;  4U3F D;  1EDL A;  1T3J A;  4RO0 A;  3MHV A;  2KNC A;  2OTL P;  3W67 A;  2KP8 A;  4N78 E;  2I8D A;  3VOP A;  3L71 D;  1PL5 A;  1YTZ T;  3M91 A;  1EXJ A;  3FWL A;  3VMZ A;  4PV1 B;  1VQN P;  1RQU A;  1QVF O;  5GTI E;  2YNY A;  2Q1K A;  1SQB E;  1OWA A;  1SVF A;  1SQQ G;  1ZR2 A;  4ZMD A;  3MTU E;  5B5E H;  2IFM A;  2ZYA A;  3LIE A;  1EDK A;  1VQ9 P;  3A0H H;  3L75 E;  2YXQ B;  4DCK A;  1G1I A;  5AW9 B;  3H25 A;  3HD7 D;  3E7K A;  3MZW B;  2FXM A;  1KIL B;  1RF0 C;  1NTM E;  1OVV A;  2WPQ A;  3KZI H;  3WUV A;  2RN0 A;  3H1I J;  3II6 A;  4EIJ A;  3HUS A;  1RF1 C;  4JPZ B;  1IFD A;  1NTK E;  2AEF A;  1PPJ E;  3RK3 C;  1VL2 A;  3C8V A;  1L2P A;  2O1J A;  1NTZ E;  2P58 A;  3CCS P;  2POH A;  1GD2 E;  2ZJS E;  3ITK A;  1BGY D;  4JYB A;  3CX5 I;  1HJB A;  2BEZ F;  1UII A;  2A45 I;  3TGU E;  4OVN F;  1RE4 C;  1A02 F;  1SQQ J;  2JWA A;  5L8R J;  1NHL A;  1SQP K;  3CCM P;  3P8C E;  3G4S P;  1N7S A;  3M0A A;  4KT0 J;  1HUC A;  1ZN5 A;  1LTG C;  1URQ D;  3PP5 A;  5CBN A;  1SQP D;  3PTZ A;  2Y9Y A;  2WTY A;  1RF1 B;  1YQ4 C;  5APV A;  4DT0 A;  3G3Z A;  1P84 I;  3V4Q A;  3RK3 B;  1KN7 A;  1GK6 A;  1L4A D;  1IK7 A;  3L73 J;  1SFC A;  4UB6 E;  2PGD A;  2D2C C;  1YJN P;  4UB8 H;  2IZ1 A;  2GUS A;  4WB4 A;  1SQX E;  1NJI Q;  1OFC X;  1RE3 A;  1OXZ A;  2WZ7 A;  2WSC H;  2WSE H;  2WQY C;  4GOD A;  2OYH C;  2KLU A;  1CI6 B;  2XV5 A;  4RES B;  1SS1 A;  2WPR A;  2FYZ A;  3LID A;  1JY3 O;  1GL2 C;  2LKM A;  2K9J B;  3H32 A;  3TNU B;  3JC2 2;  4GKG A;  2OYI A;  3I55 P;  1IO4 A;  4I7Z C;  1OMI A;  2IBZ D;  1VQ8 P;  1VF5 D;  4WBA A;  1IFM A;  4WY4 C;  5KTB A;  3MIW A;  1BCC E;  2D2C B;  1NOH A;  5H2F H;  3WUT A;  2QEX P;  3MD0 A;  1AA0 A;  3H1I D;  1YHQ P;  5C39 A;  2XDJ A;  1KOR A;  5TIS H;  1BE3 E;  3QH9 A;  4C7N B;  1Q7Y Q;  4EYY Q;  1R5L A;  2ZAE B;  1NU1 E;  2HG5 D;  2Z5I A;  2B9B A;  3AE1 C;  2OYH B;  2A06 G;  3IF4 A;  1K8A Q;  2N1T A;  1FAV A;  1GL2 B;  1OW6 A;  2WPV B;  2AXC A;  2I1J A;  4EOT A;  3D6Z A;  1HGZ A;  1SQQ K;  2WVR A;  4I7Z B;  4ASW A;  2KS1 B;  4IFD K;  2H8P D;  4WY4 B;  1UIX A;  1ZLL A;  1SQQ D;  1WT6 A;  5BU8 B;  1CW5 A;  3NMD A;  3OJA B;  2ZYG A;  2QSI A;  1HTL C;  2K1A A;  3L72 E;  1JY2 O;  3VMA A;  3VP9 A;  3LW5 H;  4PD4 E;  4BRY B;  2FYN C;  2IZ0 A;  2BAS A;  4I1L A;  1KQS O;  4PV1 D;  3VMY A;  2Z5H A;  1IFP A;  2B88 A;  3HD7 A;  3BCC G;  1OVR A;  2FFD A;  1KZU B;  1EZV G;  5CCH A;  1LTJ A;  1K9M Q;  3CX5 E;  2NPS C;  1T3U A;  3KHU A;  3U1C A;  1LP1 B;  1FOS F;  4AUW A;  2J59 M;  1KIL D;  4L74 A;  1LT9 C;  3G6E P;  3A2A A;  3F5H A;  2HOD B;  2QM8 A;  4H13 C;  1LNQ A;  2M5A A;  2FYN B;  1JTH A;  1PGO A;  3WU2 H;  3TYY A;  5KLI C;  3V5B A;  3CXH D;  2CPS A;  4JF7 A;  2OTJ P;  3P8M C;  1NH4 A;  1FDO A;  1S5L H;  1URQ A;  1PP9 E;  3TSI A;  1N73 C;  1K73 Q;  2DW3 A;  5AW4 B;  2WMM A;  3NTN A;  3BCC J;  3MGN A;  2NPS B;  3UIA A;  2IBZ I;  3H1L E;  3HE5 A;  1QVG O;  2KIK A;  1NAY A;  3B5N D;  1LT9 B;  3V2P A;  2M3E A;  3H6P A;  5E79 H;  1JMM A;  1A02 J;  2M8R A;  4I6M C;  3RK3 D;  4H13 B;  2IX7 C;  2V4H A;  1Q81 Q;  5GTH H;  4U3F E;  1KFM A;  5TJH A;  2WWW A;  1VQO P;  5KLI B;  4OH8 B;  3M06 A;  5AVZ B;  1PV3 A;  3RBX A;  3TK1 A;  1U7J A;  5B5E E;  1S9K D;  2IDB A;  3FX0 A;  1S5L X;  1SQB G;  3B71 A;  1D7M A;  2M0B A;  3A0H E;  2KI7 B;  3EFG A;  4RJT A;  2JO1 A;  3L75 G;  1N73 B;  3KZI E;  2K9Y A;  1NTM G;  2OAR A;  1KFN A;  1Z56 A;  2XU6 A;  1KYO H;  2KZI A;  1QEX A;  2B89 A;  2A06 D;  1LT1 A;  3R4Y A;  3RGU A;  1NTK G;  1PPJ G;  1KQG B;  5KJ7 A;  3FGA D;  3GHG A;  4HKZ H;  2L91 A;  1BDD A;  1W2E A;  2K88 A;  1NTZ G;  1RH5 B;  3HE4 A;  1KV4 A;  3EFF K;  3CC7 P;  1BSH A;  3CCV P;  3L37 A;  1P84 H;  4L73 A;  2NZ2 A;  3AE5 C;  1ZV8 A;  4MN4 C;  3BAS A;  5AVS B;  2OQQ A;  2KK7 A;  2Q6Q A;  3TGU G;  2JP3 A;  1IZN B;  1SQB J;  2KUB A;  1L0N E;  4GOE A;  2YMK A;  2IYO A;  1ZRT D;  2MKV A;  3M9Q A;  3L75 J;  1XTC C;  2AXT H;  1GL2 D;  3OA7 A;  1SQV E;  1G2C A;  2KNC B;  3HUS C;  3IN6 A;  2YKO A;  2B87 A;  5AVQ B;  1EQ7 A;  4PJ0 H;  5KLV E;  1LWU A;  1NTM J;  1QX8 A;  3USS A;  3A0B H;  1IFJ A;  3C1L A;  1M7L A;  2R5B A;  3TF5 A;  2V7Q J;  1FDM A;  1R5S A;  4UB8 E;  1NTK J;  3BCC D;  2R44 A;  1HWT C;  2OGU A;  1EZV D;  1Q90 D;  4WWI A;  1PZQ A;  4YXW H;  1NTZ J;  1SQX G;  3VP8 A;  1JCC A;  5AW2 B;  3CCE P;  1CZQ A;  5AVU B;  1N7S C;  2R5D A;  1DIP A;  3E1R A;  5DJT B;  3TGU J;  3CWB E;  1NAF A;  3VMX A;  1JM0 A;  3OAK A;  2Q9I A;  1DH3 A;  2E42 A;  1U7M A;  5K5G B;  3L73 G;  3HUS B;  2VRS A;  1SFC C;  2QE7 H;  4OGQ D;  3RK2 C;  2L5G B;  1VQ7 P;  1BCC G;  1FC2 C;  2ZXE B;  3M9H A;  4N6J A;  4RKU J;  5TIS E;  3GW6 A;  1LTT C;  3CL3 D;  1ZXG A;  2QVA A;  1MFT A;  1LTB C;  1KB9 D;  1RE3 C;  5KAF H;  4L75 A;  1USE A;  1BE3 G;  1KYO I;  1YJW P;  3L35 A;  1GTW A;  3U1A A;  1IC2 A;  1SQX J;  2ZVN B;  2WSF H;  2XZR A;  1H8A A;  1NU1 G;  1FZC A;  1BSN A;  1N7S B;  3BVH A;  3RL0 C;  4N78 D;  4JYC A;  3CD6 P;  2OYI C;  2FBW C;  1M1J A;  1MZ9 A;  1OIP A;  1OW7 A;  3B5N A;  3BRV B;  3FWN A;  5AVX B;  1SFC B;  4IFF A;  2M3B A;  3RK2 B;  3NFQ A;  2NPS D;  1JCD A;  1NTM K;  1NKN A;  1T6A A;  3B8E B;  3L75 D;  3L72 G;  1BDC A;  1FBM A;  1BCC J;  1FOS E;  4YXD C;  1T2K C;  3ABV C;  1JMB A;  1NTM D;  1PGJ A;  1NTK K;  1MFZ A;  2P67 A;  3L70 E;  1BE3 J;  1YTZ I;  2N1T C;  3RL0 B;  2G3A A;  1VQ6 P;  2FXP A;  1NTK D;  1NTZ K;  3H32 B;  3KDP B;  1NU1 J;  3S9O A;  2FKW B;  2OYI B;  2O01 J;  2Y9Z A;  3RL0 g;  2QJP C;  1H0T A;  1NTZ D;  3TDK A;  5CJ0 A;  5AVW B;  4ZNC A;  4DZO A;  3KXD A;  1T8Z A;  3BAT A;  5AW1 B;  5CCG A;  3M0D A;  2A45 G;  3G71 P;  3H1H E;  2LXB A;  3GG2 A;  1LTI C;  3TGU D;  1LGH B;  3D71 A;  1NWQ A;  3A7O A;  3F89 A;  2RH0 A;  3P8C D;  4TT3 H;  1HBW A;  2JJL A;  3L72 J;  3WU2 E;  5AVY B;  3FXD A;  1EDJ A;  4O9B A;  3HTK A;  2N1T B;  3RBZ A;  4C7N A;  4C46 A;  3HD7 C;  1IFN A;  2Y0E A;  4D6T J;  1KD1 Q;  3L74 E;  1S5L E;  1KC8 Q;  3O8Z A;  4NPD A;  1FJK A;  1Q2N A;  2FFD C;  1FJP A;  1SQX K;  5CCH C;  1LTJ C;  2QJP B;  1PP9 G;  4ASV A;  1Y9B A;  2Y0C A;  4CPG A;  3IR9 A;  5AW6 B;  3CCR P;  4M3L A;  4ZKU A;  5AW8 B;  1SQX D;  1FE6 A;  3H1L G;  2YO2 A;  3CC2 P;  1MV8 A;  5E79 E;  1N7L A;  3L36 A;  4A7P A;  2JKV A;  1DEB A;  5B66 H;  1PGQ A;  4D6T E;  5GTH E;  2FYU E;  1S3J A;  3K5B A;  4GOF A;  1KB9 I;  3L73 D;  1KTM A;  1EDI A;  3AE6 C;  5CHX A;  3HD7 B;  5AW7 B;  1X79 B;  2YKP A;  5APT A;  1JY3 N;  5DJU B;  2HLO A;  1BCC D;  1URQ C;  2QA4 P;  2FFD B;  1LTJ B;  4W80 A;  3H1J E;  1ZR4 A;  2PRR A;  1FZA A;  3H1K E;  1NU1 K;  1KYO E;  2W6J H;  3PRJ A;  5KAI H;  1PP9 J;  1BE3 D;  2E75 C;  2Q3E A;  1J1D C;  4LGD E;  2N9B A;  1FU1 A;  1NU1 D;  4IOI H;  3H1L J;  4KJM A;  5CBO A;  1QL2 A;  3IAO A;  2M5A B;  3VTP C;  1G1J A;  1JTH B;  3T97 A;  1J1E C;  2KLV A;  1P84 E;  1NGM B;  2H89 C;  1GW4 A;  4Y28 J;  3GF3 A;  1KMI Z;  2KB7 P;  4U3F J;  1URQ B;  1PIX A;  4EI2 A;  2FXO A;  3L72 D;  2GA1 A;  2WT7 A;  1L0N G;  3AEC C;  2AXT E;  2QIW A;  2O3J A;  2IYP A;  3HE5 B;  3CXH H;  1L4A A;  4PJ0 E;  2E75 B;  1VQL P;  3SWF A;  1J1D B;  1FDI A;  4PD4 D;  3S1K A;  3SWY A;  2P2U A;  1L0L E;  1SQV G;  3O6Q A;  2KOG A;  3Q2Y A;  3A0B E;  1M56 D;  5KLV G;  5BVZ A;  1QL1 A;  5KJ7 C;  2BCC E;  2E5T A;  3GHG C;  1JY2 N;  2JR8 A;  2R3S A;  5CMZ A;  1J1E B;  1DD3 A;  4HH2 A;  1YJ9 P;  2W90 A;  3P32 A;  4B86 A;  4JQ0 D;  1Q82 Q;  3L71 E;  3CX5 D;  2WSS H;  1ZP0 C;  1MKM A;  4H44 C;  1JO5 A;  3SSU A;  1RQV A;  1H89 A;  1VPC A;  1X9V A;  2E76 C;  1KQF B;  3SWK A;  3RL0 D;  4HYT B;  3CWB G;  3CCU P;  2ZT9 C;  2ZXX A;  3L4F A;  2H43 A;  1L0N J;  1GK4 A;  2IPP A;  1LWU C;  2LXC B;  4K3A A;  3Q5R A;  2H7H A;  3QWO C;  5CJ4 A;  1BGY J;  4YPC A;  1AQ5 A;  1SQV J;  3JSV C;  1FS0 E;  3GHG B;  4XA4 A;  5KLV J;  1HGV A;  2G8Y A;  2D2C D;  1N86 A;  3HE4 B;  3KYQ A;  2W27 A;  1PP9 D;  4K35 A;  5KAF E;  3CCJ P;  4H0L C;  3CCQ P;  4GDO A;  4Z1M H;  3BRT B;  2HPC A;  3AE8 C;  2C0X A;  3H1L D;  1OVU A;  1T2K D;  2ZFC A;  4H44 B;  5AW5 B;  2E74 C;  4LC1 A;  1X0T A;  2WSC J;  2WSE J;  2E76 B;  1BGY E;  3MUD A;  2KZJ A;  3WMM 0;  4ZKP A;  2N1T D;  1G2C B;  1DEE G;  2ZT9 B;  2B87 B;  1LWU B;  1VDF A;  3CWB J;  2YMY A;  2K3R A;  1GZL A;  4WY4 D;  3FXE A;  1OX3 A;  5KKZ C;  3AED C;  3CMA P;  1YI2 P;  1SQP E;  1HH0 A;  2Q3I A;  2PFX A;  4H0L B;  3CXH I;  1AVO A;  1JUN A;  2P7J A;  1M90 Q;  3AE2 C;  2GM4 A;  2Q7C A;  1FZC C;  1J2J B;  2E74 B;  3L70 G;  1PFI A;  2HR3 A;  4IL6 H;  4R4M A;  1K04 A;  1KIL A;  1M1J C;  1Y8A A;  3B5N C;  1YQ3 C;  4PD4 I;  1N8R Q;  2WPS A;  5CCH D;  2AEM A;  1JY3 P;  5H2F E;  3CC4 P;  1M1K Q;  3R2P A;  2ZVO B;  5KKZ B;  3VN0 A;  1L0N K;  2UWJ E;  1K05 A;  1PGP A;  3H1H G;  1VQM P;  1AV1 A;  1S2E A;  3Q1M A;  2IBZ E;  4TLF A;  4Y99 C;  1EXI A;  3JCU H;  1SQV K;  1L0N D;  3WUU A;  2LR2 A;  5KLV K;  3V2R A;  1FZE A;  2HYN A;  4KHX A;  3LW5 J;  1W2B O;  2GUV A;  1SQV D;  1FZC B;  3AEB C;  4IL6 X;  5KLV D;  1USD A;  3H1I E; 
#chains in the Genus database with same CATH homology
 5APW A;  3EQ2 A;  3N4X A;  2QM7 A;  1KQL A;  3O8Z A;  1SQB K;  1URQ A;  2R3C A;  1FJK A;  1MUU A;  1CSB A;  4AYC A;  2PP6 A;  2FFD C;  1FJP A;  2C9L Y;  2XNX A;  3TSI A;  1SQX K;  1N73 C;  5CCH C;  1RF0 A;  1LTJ C;  1KIL C;  1M1J B;  5AW4 B;  2E43 A;  3NTN A;  3MGN A;  4DOJ A;  2NPS B;  5AW0 B;  3UIA A;  3IR9 A;  5AW6 B;  3B5N B;  1T3J A;  1YYC A;  3HE5 A;  4M3L A;  4ZKU A;  5AW8 B;  5CCG C;  1RF1 A;  3M0D C;  2KP8 A;  3B5N D;  4N78 E;  3VOP A;  1LT9 B;  2YO2 A;  3V2P A;  2C9N Y;  1MV8 A;  2Z4E A;  1N7L A;  3H6P A;  1DX7 A;  1YTZ T;  3M91 A;  1JMM A;  3L36 A;  2P1J A;  1A02 J;  1DEB A;  2M8R A;  4Y99 B;  3VMZ A;  4I6M C;  3RK3 D;  2IX7 C;  5BU5 A;  1KFM A;  2YNY A;  2WWW A;  1OWA A;  4OH8 B;  2MJZ A;  1SVF A;  3M06 A;  5AVZ B;  1ZR2 A;  3TK1 A;  2XKM A;  5CHX A;  1S9K D;  5APY A;  1SP4 A;  3MTU E;  1JY2 P;  3A5T A;  2IFM A;  3LIE A;  3HD7 B;  5AW7 B;  1RE4 A;  3EFG A;  1X79 B;  2W6A A;  1CI6 A;  2YKP A;  5APT A;  1JY3 N;  1G1I A;  5AW9 B;  2HLO A;  1URQ C;  4GIF A;  3HD7 D;  2FFD B;  4I2L C;  3V4W A;  1N73 B;  2FXM A;  1LTJ B;  1KIL B;  1RF0 C;  2W6B A;  2WPQ A;  4W80 A;  1WRG A;  2IFN A;  1ZR4 A;  3II6 A;  3TNU A;  2OAR A;  1FZA A;  1KFN A;  1NU1 K;  2PAJ A;  1Z56 A;  4EIJ A;  2XU6 A;  3HUS A;  1RF1 C;  2YKQ A;  1J1D C;  1IFD A;  4LGD E;  1RY3 A;  2N9B A;  1FU1 A;  3RK3 C;  2KSJ A;  3M9B A;  3V2Q A;  5KJ7 A;  3GHG A;  2O1J A;  4W7Y A;  1FZG A;  5APU A;  1QL2 A;  3VTP C;  1G1J A;  1JTH B;  1W2E A;  2POH A;  1GD2 E;  3T97 A;  1J1E C;  1LTS C;  3HE4 A;  5KJ7 D;  2KLV A;  4JYB A;  1HJB A;  1GW3 A;  3L37 A;  1GW4 A;  3HTK B;  1NKZ B;  1ZV8 A;  2A45 I;  1RE4 C;  3BAS A;  2CPB A;  5AVS B;  1XTG B;  1A02 F;  2KB7 P;  2OYH A;  1NHL A;  1URQ B;  1SQP K;  3P8C E;  1N7S A;  1NO4 A;  1GL2 A;  3M0A A;  1HUC A;  1ZN5 A;  2HFE D;  1LTG C;  3M9Q A;  1URQ D;  3KQG A;  2WT7 A;  3PP5 A;  1XTC C;  3HE5 B;  1GL2 D;  3OA7 A;  1G2C A;  2WTY A;  1L4A A;  3HUS C;  1RF1 B;  2YKO A;  3P7K A;  3SWF A;  1J1D B;  5APV A;  1EQ7 A;  5AVQ B;  3SWY A;  2P2U A;  1LWU A;  5APQ A;  2KOG A;  4WY4 A;  3G3Z A;  1GU4 A;  4IFM A;  3V4Q A;  3RK3 B;  1GK6 A;  1L4A D;  1SFC A;  3C9I A;  1IFJ A;  5BVZ A;  1QL1 A;  1M7L A;  1H88 A;  2R5B A;  5KJ7 C;  4N3Y B;  2J58 A;  3GHG C;  1JY2 N;  1FDM A;  5CMZ A;  1HVV A;  1J1E B;  2GUS A;  2R32 A;  4HH2 A;  1HWT C;  4WB4 A;  1JOC A;  2WIT A;  3P32 A;  4B86 A;  1RE3 A;  1OXZ A;  2WZ7 A;  1IJD B;  2KYV A;  2WSC H;  3V2N A;  3VP8 A;  2WSE H;  1JCC A;  5AW2 B;  4AQR D;  1CZQ A;  2OYH C;  1CI6 B;  2XV5 A;  4RES B;  2WPR A;  2FYZ A;  3LID A;  1JY3 O;  5AVU B;  4C7R A;  1N7S C;  1JO5 A;  1E5W A;  1GL2 C;  2R5D A;  1H89 A;  1VPC A;  1X9V A;  1SLQ A;  2LKM A;  1NAF A;  3VMX A;  1JNM A;  3H32 A;  3OAK A;  2Q9I A;  1AFO A;  3TNU B;  1DH3 A;  4GKG A;  3RL0 D;  2E42 A;  4HYT B;  2OYI A;  1IO4 A;  1S9K E;  1L4A C;  3HUS B;  4WBA A;  5APS A;  3L4F A;  5APX A;  2H43 A;  1GK4 A;  3IFM A;  2IPP A;  1LWU C;  2VRS A;  3U59 A;  1IFM A;  4WY4 C;  5KTB A;  3MIW A;  2H7H A;  1SFC C;  5CJ4 A;  1AQ5 A;  3RK2 C;  1X8Y A;  3GHG B;  2L5G B;  1NOH A;  4XA4 A;  2ZXE B;  3M9H A;  3MD0 A;  4N6J A;  1HGV A;  3VYI A;  1N86 A;  1LTT C;  3HE4 B;  2XDJ A;  3A3Y B;  3CL3 D;  3I5C A;  3KYQ A;  2W27 A;  4XE5 B;  1LTB C;  4C7N B;  2HOD A;  5AVV B;  1RE3 C;  1FZF A;  3BRT B;  2HG5 D;  2Z5I A;  2HPC A;  2OYH B;  3L35 A;  1GTW A;  3U1A A;  1IC2 A;  2C0X A;  1T2K D;  2WSF H;  2XZR A;  2ZFC A;  2O01 H;  5AW3 B;  1H8A A;  1FZC A;  2N1T A;  1N7S B;  3BVH A;  1FAV A;  3RL0 C;  5AW5 B;  1GL2 B;  4LC1 A;  4N78 D;  2I1J A;  4EOT A;  2WT7 B;  1HGZ A;  3MUD A;  2FYU K;  1N7S D;  4JYC A;  1SQQ K;  3WMM 0;  4ZKP A;  2N1T D;  2OYI C;  1N2D C;  1G2C B;  1L4A B;  4IFD K;  2H8P D;  3E1I A;  4LLH A;  1M1J A;  1MZ9 A;  1LWU B;  2NPS A;  4WY4 B;  1VDF A;  1ZLL A;  3B5N A;  3BRV B;  1WT6 A;  5AVX B;  2YMY A;  1SFC B;  5BU8 B;  1CW5 A;  3NMD A;  3OJA B;  4IFF A;  2M3B A;  1GZL A;  3RK2 B;  3NFQ A;  4WY4 D;  1HTL C;  2NPS D;  1SFC D;  1JY2 O;  1LT9 A;  1JCD A;  1NTM K;  3VP9 A;  1NKN A;  3RK2 D;  3B8E B;  1HH0 A;  2Q3I A;  1FBM A;  3LW5 H;  1FOS E;  2JEE A;  1T2K C;  1JUN A;  2P7J A;  1NTK K;  1IK9 A;  2BAS A;  2I1K A;  1MFZ A;  4I1L A;  2P67 A;  3VMY A;  2GM4 A;  1YTZ I;  2Z5H A;  2Q7C A;  1FZC C;  2N1T C;  3RL0 B;  1J2J B;  3HD7 A;  1PFI A;  1NTZ K;  2Q5U A;  3H32 B;  3KDP B;  2FKW B;  1LTA C;  2OYI B;  2FFD A;  1KZU B;  1N73 A;  5CCH A;  1LTJ A;  1KIL A;  1M1J C;  5CJ0 A;  5AVT B;  2NPS C;  1T3U A;  1FZB A;  3KPE A;  3U1C A;  3B5N C;  5AVW B;  1FOS F;  4AUW A;  4GT1 A;  2C0W A;  1IFI A;  2WPS A;  5CCH D;  2J59 M;  1KIL D;  4DZO A;  2A45 H;  1T8Z A;  3BAT A;  5AW1 B;  1JY3 P;  5CCG A;  3M0D A;  3R2P A;  2A45 G;  3VN0 A;  1L0N K;  1LTI C;  1LT9 C;  1LGH B;  3HRN A;  2YO3 A;  1NWQ A;  5CCG D;  3A7O A;  3A2A A;  3N7N A;  4W7Z A;  4Y99 C;  2HOD B;  2QM8 A;  3P8C D;  3NXS A;  1SQV K;  1HBW A;  2JJL A;  1JTH A;  5AVR B;  5AVY B;  3V2R A;  5KLV K;  1GDT A;  1L0L K;  1FZE A;  2HYN A;  2HPC B;  4KHX A;  2O1K A;  3TYY A;  3V5B A;  4O9B A;  2CPS A;  4JF7 A;  2GUV A;  3CLQ A;  3CI9 A;  3HTK A;  1GU5 A;  1FZC B;  2N1T B;  3P8M C;  4C7N A;  4C46 A;  1NH4 A;  3HD7 C;  1IFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...