3H1JG

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 18
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1jG00
3L70G 1KYOH 3L71G 4PD4H 1SQQG 3H1JG 1NU1G 1SQVG 3CWBG 4D6TG 3L75G 2A06G 5KLVG 3CX5H 2IBZG 3TGUG 1BGYG 1SQPG 1BCCG 3L73G 1KB9H 1L0NG 1NTKG 1P84H 1PPJG 1SQBG 1BE3G 3L72G 3CXHH 3L74G 2BCCG 3H1HG 1NTZG 3H1IG 4U3FG 1SQXG 3BCCG 1EZVG 3H1KG 1NTMG 2FYUG 1PP9G 1L0LG 3H1LG
chains in the Genus database with same CATH superfamily
3L4FA 2OTKE 3A0BE 2ZXXA 1IFPA 1YBKA 1YQ4C 3NFQA 2QJKB 1FZGA 2SPZA 1M56D 3MP7B 4O9BA 1Y8AA 1KILB 1KYOI 1LNQA 2D2CB 1RH5B 1X22A 3NTNA 2P7JA 4HKZH 5KKZB 1OW6A 1SFCC 2K37A 2WPRA 2WSEJ 3BATA 3W67A 5B66E 1M90Q 4K3AA 3RK2C 1GD2E 1VQ8P 1CW5A 3RBXA 2JDIH 4L75A 3S1KA 1NTMK 1KQLA 1PP9D 1SFCD 1GK4A 3HD7D 1KILE 4ZMDA 3H32A 2WVRA 2M8RA 3TGUJ 1WMKA 3C1LA 3VMZA 4Y99B 5TISH 3H1LD 2B89A 5AVZB 5GTHE 1URQA 2E74B 1AVOA 2ZVOB 1G2CA 3ABVC 2RN0A 1QGKB 1EXIA 4N78D 5CCHD 1SQPD 1MUUA 1PV3A 3B4SA 3QWOC 4Y99C 1E79H 3VMAA 3JCUE 3CLQA 5B5EH 5BU8B 1N8RQ 2D2CD 3T97A 3H1LG 3U1CA 2G8YA 2QE7H 2XKMA 2PRRA 2M0BA 1EZVI 1JEKA 2R44A 1JCDA 1SQVG 2K9YA 3CMAP 1VQLP 3GHGA 2WMMA 3KPEA 1NTKE 3PLNA 4H13B 1T6AA 3HE5B 1QX8A 1NKZB 5TISE 4YXWH 2AEJA 4PD4I 2PFXA 3H6PA 2C9LY 3MUDC 4L76A 1CSBA 1XTCC 2W6JH 1NO4A 3CX5E 4LLHA 2MJZA 5APTA 2FFDA 3F89A 3CX5D 4GIFA 3L74G 3B8EB 4DJGA 3CI9A 3U1AA 2IDBA 2JP3A 4IL6X 2E76C 4HJGH 2B88A 1FZCC 2A45H 2L91A 1QLED 2P67A 2W90A 1JNMA 1N7SC 1RY3A 4UB6H 2VRSA 5KJ7D 2H89C 5APXA 2W6AA 1M1JC 2QM7A 3AE7C 3AE2C 3U59A 3WUVA 2DW3A 1MKMA 1EDKA 3TGUE 1X79B 2W27A 3AE4C 4NPDA 2Q7CA 3H1JE 4MN4C 3T97B 5KLVG 2XNXA 1T8ZA 3CX5H 5B66H 3D71A 2HG5D 3RK2B 1LTGC 4D6TJ 3C8VA 3I55P 1RF1C 3PRJA 3TGUG 4IFFA 2A45G 2FBWC 3L73G 3LIDA 3L71D 1BCCD 4Z1MH 1PPJE 3A7OA 4GODA 2KS1A 1RF1A 1L0NK 3G9RA 1VF5C 2FY8A 5AW9B 2KOGA 3AEBC 3CXHI 4AYCA 1FJKA 2NPSC 5CCGC 3LIEA 1YITP 3AECC 3Q5PA 3A0HH 4WWIA 3P8CD 3SWFA 3CCMP 3CMEP 1DH3A 3FXEA 3H25A 2KIKA 5AVUB 1YJNP 1KORA 1NU1K 2P1JA 3FWLA 3H1JJ 1GL2A 1TU3F 1IFNA 1JCCA 2QJYC 2XZRA 2MKVA 3CWBE 4YTPC 1KQSO 2WQYC 4D6TG 2HODA 1LTIC 5H2FH 3B5NB 1OX3A 3KQGA 3BASA 4Y28J 1Q90D 1BDDA 1LGHB 1VF5D 4HB1A 2NPSB 3L72D 4OVNF 1OVVA 5AVVB 1R8EA 1KQGB 1BCCJ 2E43A 3SWKA 1PPJG 4H13D 1SQQJ 1OVUA 2Q6QA 4UB8H 3OW2O 3HD7B 2I8DA 3WUUA 1KB9I 1K04A 3HTKA 5DJTB 2ZYAA 2D2CC 4PJ0E 1LP1B 1SQXK 2Q3EA 3PHLA 4EI2A 3AEFC 2YKPA 3AE6C 1SQVE 1K8AQ 2PAJA 1JUNA 1EZVG 3H1KG 1HJBA 1L4AC 1T2KC 3NXSA 1PP9E 1OW8A 3OJAB 2I1JA 1H89A 2RMZA 5CJ0A 2KS1B 2R5DA 1GW4A 2KSJA 3IN6A 2WSEH 3P8CE 1Q82Q 1CI6B 1AV1A 3LW5H 4R4MA 1BE3J 3CCSP 3G3ZA 5C39A 4ZNCA 2O01J 4EOTA 5AW7B 4M3LA 1JY2N 2RKLA 4EDFA 1A02J 3K5BA 1OVRA 2O01H 1BCCE 1SLQA 1L2PA 1NOHA 2P2UA 2QJYB 1OMIA 1QEXA 1LWUC 2M5AA 3L74E 4NPFX 1NYHA 1PGQA 4WVZA 4C7RA 2G3AA 3KZIE 4I7ZB 5AW0B 2HPCA 1JY2P 5AVXB 1LWUA 1BCCG 1BGYE 1M8OB 3H1HJ 4UB8E 2FFDC 2E5YA 5AW4B 1ZXGA 5AW5B 1KD1Q 3M9QA 3VP9A 3V2RA 3N7NA 3CXHH 1HTLC 1SQBK 2O1JA 2E42A 1L4AA 2ITAA 2Q5UA 3M0DA 3TYYA 2KNCA 2W83C 4HYTB 3L72E 3TNUA 1H0TA 5AVQB 1KZUB 3NMDA 3JCUH 1BE3D 1D7MA 1Z56A 3A3YB 3L70G 2N1TB 4KJMA 4U3FD 3VMYA 4C7NA 2K9JB 1LTTC 3RGUA 3FX0A 3HD7A 2IZ1A 1DX7A 3AEGC 3L74J 1L4AD 4H0LC 1S9KE 2OYHC 2OYOA 2KSEA 1SQQK 1NTZJ 2ZT9B 3VP8A 1JTHA 2M3EA 1S2EA 1CZQA 2OYIB 2KI7B 5KJ7A 2E75C 3CWBJ 3HRNA 1URQB 4GDOA 1ZR2A 3G71P 4JYCA 1AA0A 4JF7A 4DCKA 1PPJD 5AVSB 5APWA 2FXMA 4N3YB 1SQVJ 3Q5SA 2Y0DA 2POHA 3L72J 2AXTE 3RK3E 2WWWA 3R2PA 4WY4C 1FZCA 1URQC 3L73J 3TK1A 3O6QB 1GU5A 1DIPA 1BGYD 1NAYA 2B87B 2YO3A 1MFZA 3CL3D 1K05A 1SQXD 1J1EB 3FWNA 1YIJP 2HR3A 2KZJA 2K88A 1ZN5A 4UB6E 3V6IA 1FDMA 1S5LX 1SFCB 4PD4H 5CCGA 2HYNA 3WU2E 3FGAD 4EIJA 2R32A 1NTKK 4W80A 1NU1G 1KILA 4K35A 1SQXJ 2XNDH 1KYOD 1VQ9P 1QVGO 4KHXA 3CCVP 4C7NB 4BXLA 2R5BA 1N86A 3MZWB 3KYQA 4LC1A 1X8YA 3GF3A 1KMIZ 1N7LA 3USSA 5KLIB 1VQOP 4WY4A 3CC2P 2A45I 1ZRTE 1SQVD 3P32A 1MZ9A 2YXQB 1G1IA 3I5CA 3P7KA 4DOJA 1J1EC 2LKMA 1PZQA 4H44B 1T2KD 4XFJA 1N73A 1N7SD 3CCEP 3M91A 1OXZA 5KAIE 4D6TD 3D6ZA 5EFWB 3AEAC 1VQ5P 3CXHE 1M1JB 1YTZI 4JQ0D 1KV4A 1J1DB 1OIPA 2QVAA 3VN0A 2IBZG 1NTKD 1M1JA 1QVFO 3Q2YA 1L0LG 3M0AA 2K3RA 1GL2C 2HFED 1RF0C 2IFMA 1LT9B 2ZT9C 2KB7P 3SFEC 1L0NE 1SVFA 1VPCA 1GL2D 1P84I 4GT1A 5CMZA 3Q3DA 1ZMEC 2GUVA 3OA7A 1IC2A 1MFTA 4H44C 3GHGB 4BRYA 2LXBA 3G4SP 5GTIE 2E75D 2J58A 3HUSB 1Y9BA 4HH2A 2W6BA 3R4YA 1PGJA 1VF5B 4OGQB 5APQA 3RK3D 4BRYB 2YIUC 3BRTB 3HE4B 5AW3B 1L0LJ 1J2JB 2UWJE 1SQPE 2KZIA 1UIXA 3CXHD 3O8ZA 4L73A 5APUA 4DT0A 2YMYA 5KAIH 3JC22 4XA4A 1A02F 1SQBE 2O3JA 1ZRTD 1LTJB 5CBOA 5AVRB 3CX5I 1WRGA 5CCHC 4TT3H 1SQXG 2JEEA 1FAVA 2M5AB 2LXCB 5APVA 1KYOE 3GLMA 1QL2A 2KYVA 3UIAA 3L70J 2YO2A 1M7LA 1W2BO 3VOPA 1SQQG 3LW5J 5E79H 3VMXA 4DZOA 1GTWA 1FZFA 3SWYA 2H7HA 1JY3O 3GF7A 5AVYB 4I1LA 1PIXA 4PD4E 1KFNA 1NTKJ 1PL5A 4QMAA 2E5TA 2PGDA 1DD4A 2IX7C 3V2PA 1HWTC 1NH4A 1VQNP 1SQPJ 4PV1D 3D70A 3S9OA 4JPZB 5AW2B 2IFNA 1P84E 2KXPB 3BCCE 5M1BA 1SQPG 2QJPB 5KKZC 3IFMA 1NJIQ 1USEA 4NPEA 5KJ7C 1QL1A 3VTPC 2XU6A 1SQBG 3EFGA 4H13C 2BASA 2WSFJ 1OW7A 3GW6A 2FYZA 3H1HG 3MTUE 3MUDA 3PJSK 4I2LC 5AVWB 2WSFH 1PP9J 1VQMP 2WTYA 4U3FG 3RK2D 3GG2A 2Y9YA 1Q81Q 2JJLA 3H32B 4YPCA 1LJ2A 4PD4D 1FDOA 5E79E 1VQ7P 2A06D 3RK3B 3E1RA 1S5LH 2QM8A 2N1TD 1LTJA 1AQ5A 3TSIA 1FC2C 2BEQD 2XDJA 3V2NA 1HF9A 2YNYA 1HBWA 1NTZE 3W68A 3A5TA 3Q1MA 1BE3E 3B5NC 2FFDB 3I56P 3G6EP 2BCCD 1FDIA 1GW3A 1IFIA 1FZBA 2KUBA 1BGYJ 3L75G 5AW6B 5KLVK 2WPSA 2QSIA 4WY4D 4IOIH 5L8RJ 5CCGD 3L73D 4WBAA 2FXOA 2WSCH 1AJYA 2IZ0A 1NTME 3CCLP 1KB9E 3L75E 4B86A 3L71J 3PP5A 2H8PD 2GM4A 1JY3N 1NU1D 2P10A 1GK6A 1FE6A 1OWAA 3L37A 3RK3C 2E75B 4OGQD 3TNUB 1H8AA 4AUWA 2AXTH 2WSSH 5CJ4A 1BDCA 2C0XA 2KNCB 3CWBD 2WZ7A 3A2AA 3HTKB 1JY3P 1LTJC 4H44D 4ASWA 2OYHB 1BSHA 1Q2NA 2OARA 5K5GB 2O1KA 4A7PA 1NTZD 2OYHA 5AW1B 2RH0A 4RJTA 1FOSE 3L74D 2FYUD 1ZV8A 5KAFH 4C46A 1AQTA 3MD0A 2XV5A 3L35A 4I6MC 3H1JG 1AFOA 4OWFA 1NGMB 4N78E 4U3FJ 3WU2H 2P58A 3CWBG 4RESB 1U7MA 1USDA 2O01N 2YMKA 5CHXA 1JTHB 1NTMJ 3BRVB 3EQ2A 3CCUP 1IK7A 2Z4EA 1ZOYC 1E5WA 4YXDC 3IAOA 1PGOA 2QA4P 1LT9C 1FOSF 1VQ6P 4GKGA 3SFDC 3CCRP 3JSVC 4W7YA 1J1DC 1SQBD 2HPCB 3H1KJ 2H88C 1T3JA 1L0NG 1N7SB 1P84H 1X0TA 2J5UA 3H1HD 1XTGB 1NVOA 4EYYQ 2NRGA 1N7SA 4RKUJ 1JOCA 1NU1E 2V4HA 3L73E 3O6QA 2JWAA 1URQD 3AE1C 2Q9IA 2WPQA 2HLOA 2ZAEB 5KTBA 3L71G 1YHQP 3D6YA 2ZJSE 3EWKA 1DEBA 3HE5A 1L0ND 1Y47A 1S72P 1VQ4P 1H88A 3KXDA 2NPSA 3RL0C 3AE5C 1JB0J 1L0NJ 3M9BA 2N1TC 1S5LE 2AXCA 4ASVA 2CPSA 2C0WA 3AE9C 1IFJA 2J59M 2YKOA 2N1TA 2KLVA 2IYPA 4R4LA 3CPWO 2AEMA 2QJPC 2NPSD 2QJKC 2QRXA 4OH8B 5BU5A 1N73B 3FXDA 1N2DC 3B5ND 4D6TE 1SQQD 3KDPB 2C9NY 1ZP0C 4PV1B 1WT6A 1YI2P 4U7JA 2AEFA 3H1KD 3M0DC 1NHLA 1Q86Q 1GU4A 2ZT9D 1W5CE 2ZFCA 1LTSC 1ZLLA 2HODB 5KLVJ 1FS0E 2KP8A 1FJPA 1IO4A 1KTMA 4I7ZC 2WT7A 1RF0A 1X9VA 4PV1C 3BCCG 2GA1A 2KLUA 3E7KA 4XE5B 3L36A 5B5EE 3TF5A 2FYUG 3A0BH 3C9IA 1S9KD 1KYOH 1JY2O 4LGDE 1FZCB 2PP6A 3H1JD 2FYUK 3IF4A 1S4XA 1VDFA 3TDKA 1EZVE 2FYUJ 2B87A 1ZR4A 1IZNB 5KAFE 4RO0A 5CBNA 1EZVD 2R3SA 3EFFK 1KQFB 1L4AB 1L0LE 3CCJP 1S1CX 3CD6P 1FBMA 1U57A 3H1LE 1MV8A 3HUSA 1IK9A 3BCCJ 1GDTA 1M57D 3GHGC 2ZVNB 4OGQC 3HUSC 5AVTB 1JMBA 5GTHH 3VYIA 2B9BA 1K73Q 2Y0CA 3V4QA 1HH0A 1IFDA 2ZYGA 1BE3G 1RF1B 2M3BA 3L72G 1SQQE 1RHZB 3ITKA 1LTBC 2BCCG 2YKQA 3MIWA 4IL6E 4CPGA 1SP4A 3MHVA 3WMM0 3L70E 1YTZT 2BEZF 1GL2B 5APYA 1KFMA 2BCCJ 2FYUE 1YJWP 1NTMG 1YJ9P 1BSNA 1PP9G 1RQUA 2N9BA 1R5LA 2QIWA 2V7QJ 5DJUB 4BWNA 3CC4P 2CK3H 2JKVA 3F5HA 3H1ID 2V7QH 1UIIA 4IFMA 5KLVE 1EXJA 1G2CB 1GZLA 1W2EA 2LR2A 4GOEA 2E76B 1SQXE 2FYNB 2WT7B 2E76D 5KLIC 2ZYDA 3BVHA 5KLVD 1FU1A 2WSCJ 1HGZA 2Q1KA 3KZIH 1JM0A 3OAKA 5APSA 4H0LB 3AEEC 1YQ3C 1BGYG 3L75J 3PH0A 3GMAA 3HE4A 3AEDC 2OQQA 1L0LK 1KB9H 4H0LD 4AQRD 2YIUB 3P8MC 2BCCE 2QEXP 2QG4A 1VL2A 1DEEG 1KILD 1NTZG 4KT0J 5TJHA 1KN7A 3ZDMA 3HD7C 2ZXEB 2IPPA 2NZ2A 2H43A 3RL0B 4IFDK 2WITA 2WPVB 4WY4B 1T3UA 2IBZI 2A06E 3V2QA 4U3FE 4WB4A 3L70D 1YYCA 1R5SA 1RQVA 1EQ7A 3SSUA 3IR9A 1LWUB 3QH9A 2E74D 2N9YB 1VQKP 1RE3A 4JYBA 2A06G 3L71E 3AE8C 3B5NA 5GTIH 1SS1A 1PGPA 1NKNA 3II6A 3M9HA 2E74C 3MGNA 1LT1A 1KC8Q 2OYIC 1GMJA 1OFCX 1JMMA 2GUSA 1NTKG 3H1LJ 1EDLA 1SQBJ 1L0LD 1KB9D 1AVYA 1LT9A 2R3CA 3L75D 1FZAA 2Y0EA 5CCHA 3TGUD 1NWQA 1ZW0A 3Q5RA 1HUCA 2FXPA 2Z5HA 2YXRB 1M1KQ 2I1KA 4IL6H 1IJDB 1NTMD 2Q3IA 2CPBA 3KHUA 4W7ZA 1DD3A 1LTAC 3A0HE 4ZKUA 2FKWB 2JWDA 1HGVA 1KILC 2K9JA 1LP1A 3H1IG 3CCQP 3RL0g 1VQPP 2JO1A 3AE3C 3RBZA 1U7JA 4ZKPA 1EDJA 4L74A 2IBZE 3H1IJ 1CI6A 1NTZK 2Y9ZA 1RE4A 2JR8A 2OGUA 2OYIA 2IBZD 3PTZA 1S3JA 5BVZA 5H2FE 1HJ0A 3H1KE 2FYNC 4TLFA 1K9MQ 5AW8B 1RE3C 3V4WA 3WUTA 4GOFA 1EDIA 1G1JA 2OTJP 3RL0D 4N6JA 1NU1J 3E1IA 3M06A 1SQVK 2L5GB 2K1AA 2OTLP 1JO5A 3CC7P 2IYOA 1HVVA 1Q7YQ 2KK7A 1FZEA 3N4XA 1NAFA 1OZHA 1P84D 3BCCD 4JBZA 2W8ZA 3H1HE 4PJ0H 3S4RA 1N73C 1PFIA 1EC5A 2Z5IA 3V5BA 1H0TB 1SQPK 1IFMA 3H1IE 1RE4C 3B71A 1SFCA
chains in the Genus database with same CATH topology
3L70G 1KYOH 3L71G 4PD4H 1SQQG 3H1JG 1NU1G 1SQVG 3CWBG 4D6TG 3L75G 2A06G 5KLVG 3CX5H 2IBZG 3TGUG 1BGYG 1SQPG 1BCCG 3L73G 1KB9H 1L0NG 1NTKG 1P84H 1PPJG 1SQBG 1BE3G 3L72G 3CXHH 3L74G 2BCCG 3H1HG 1NTZG 3H1IG 4U3FG 1SQXG 3BCCG 1EZVG 3H1KG 1NTMG 2FYUG 1PP9G 1L0LG 3H1LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 G;  1KYO H;  3L71 G;  4PD4 H;  1SQQ G;  3H1J G;  1NU1 G;  1SQV G;  3CWB G;  4D6T G;  3L75 G;  2A06 G;  5KLV G;  3CX5 H;  2IBZ G;  3TGU G;  1BGY G;  1SQP G;  1BCC G;  3L73 G;  1KB9 H;  1L0N G;  1NTK G;  1P84 H;  1PPJ G;  1SQB G;  1BE3 G;  3L72 G;  3CXH H;  3L74 G;  2BCC G;  3H1H G;  1NTZ G;  3H1I G;  4U3F G;  1SQX G;  3BCC G;  1EZV G;  3H1K G;  1NTM G;  2FYU G;  1PP9 G;  1L0L G;  3H1L G; 
#chains in the Genus database with same CATH topology
 3L4F A;  2OTK E;  3A0B E;  2ZXX A;  1IFP A;  1YBK A;  1YQ4 C;  3NFQ A;  2QJK B;  1FZG A;  2SPZ A;  1M56 D;  3MP7 B;  4O9B A;  1Y8A A;  1KIL B;  1KYO I;  1LNQ A;  2D2C B;  1RH5 B;  1X22 A;  3NTN A;  2P7J A;  4HKZ H;  5KKZ B;  1OW6 A;  1SFC C;  2K37 A;  2WPR A;  2WSE J;  3BAT A;  3W67 A;  5B66 E;  1M90 Q;  4K3A A;  3RK2 C;  1GD2 E;  1VQ8 P;  1CW5 A;  3RBX A;  2JDI H;  4L75 A;  3S1K A;  1NTM K;  1KQL A;  1PP9 D;  1SFC D;  1GK4 A;  3HD7 D;  1KIL E;  4ZMD A;  3H32 A;  2WVR A;  2M8R A;  3TGU J;  1WMK A;  3C1L A;  3VMZ A;  4Y99 B;  5TIS H;  3H1L D;  2B89 A;  5AVZ B;  5GTH E;  1URQ A;  2E74 B;  1AVO A;  2ZVO B;  1G2C A;  3ABV C;  2RN0 A;  1QGK B;  1EXI A;  4N78 D;  5CCH D;  1SQP D;  1MUU A;  1PV3 A;  3B4S A;  3QWO C;  4Y99 C;  1E79 H;  3VMA A;  3JCU E;  3CLQ A;  5B5E H;  5BU8 B;  1N8R Q;  2D2C D;  3T97 A;  3H1L G;  3U1C A;  2G8Y A;  2QE7 H;  2XKM A;  2PRR A;  2M0B A;  1EZV I;  1JEK A;  2R44 A;  1JCD A;  1SQV G;  2K9Y A;  3CMA P;  1VQL P;  3GHG A;  2WMM A;  3KPE A;  1NTK E;  3PLN A;  4H13 B;  1T6A A;  3HE5 B;  1QX8 A;  1NKZ B;  5TIS E;  4YXW H;  2AEJ A;  4PD4 I;  2PFX A;  3H6P A;  2C9L Y;  3MUD C;  4L76 A;  1CSB A;  1XTC C;  2W6J H;  1NO4 A;  3CX5 E;  4LLH A;  2MJZ A;  5APT A;  2FFD A;  3F89 A;  3CX5 D;  4GIF A;  3L74 G;  3B8E B;  4DJG A;  3CI9 A;  3U1A A;  2IDB A;  2JP3 A;  4IL6 X;  2E76 C;  4HJG H;  2B88 A;  1FZC C;  2A45 H;  2L91 A;  1QLE D;  2P67 A;  2W90 A;  1JNM A;  1N7S C;  1RY3 A;  4UB6 H;  2VRS A;  5KJ7 D;  2H89 C;  5APX A;  2W6A A;  1M1J C;  2QM7 A;  3AE7 C;  3AE2 C;  3U59 A;  3WUV A;  2DW3 A;  1MKM A;  1EDK A;  3TGU E;  1X79 B;  2W27 A;  3AE4 C;  4NPD A;  2Q7C A;  3H1J E;  4MN4 C;  3T97 B;  5KLV G;  2XNX A;  1T8Z A;  3CX5 H;  5B66 H;  3D71 A;  2HG5 D;  3RK2 B;  1LTG C;  4D6T J;  3C8V A;  3I55 P;  1RF1 C;  3PRJ A;  3TGU G;  4IFF A;  2A45 G;  2FBW C;  3L73 G;  3LID A;  3L71 D;  1BCC D;  4Z1M H;  1PPJ E;  3A7O A;  4GOD A;  2KS1 A;  1RF1 A;  1L0N K;  3G9R A;  1VF5 C;  2FY8 A;  5AW9 B;  2KOG A;  3AEB C;  3CXH I;  4AYC A;  1FJK A;  2NPS C;  5CCG C;  3LIE A;  1YIT P;  3AEC C;  3Q5P A;  3A0H H;  4WWI A;  3P8C D;  3SWF A;  3CCM P;  3CME P;  1DH3 A;  3FXE A;  3H25 A;  2KIK A;  5AVU B;  1YJN P;  1KOR A;  1NU1 K;  2P1J A;  3FWL A;  3H1J J;  1GL2 A;  1TU3 F;  1IFN A;  1JCC A;  2QJY C;  2XZR A;  2MKV A;  3CWB E;  4YTP C;  1KQS O;  2WQY C;  4D6T G;  2HOD A;  1LTI C;  5H2F H;  3B5N B;  1OX3 A;  3KQG A;  3BAS A;  4Y28 J;  1Q90 D;  1BDD A;  1LGH B;  1VF5 D;  4HB1 A;  2NPS B;  3L72 D;  4OVN F;  1OVV A;  5AVV B;  1R8E A;  1KQG B;  1BCC J;  2E43 A;  3SWK A;  1PPJ G;  4H13 D;  1SQQ J;  1OVU A;  2Q6Q A;  4UB8 H;  3OW2 O;  3HD7 B;  2I8D A;  3WUU A;  1KB9 I;  1K04 A;  3HTK A;  5DJT B;  2ZYA A;  2D2C C;  4PJ0 E;  1LP1 B;  1SQX K;  2Q3E A;  3PHL A;  4EI2 A;  3AEF C;  2YKP A;  3AE6 C;  1SQV E;  1K8A Q;  2PAJ A;  1JUN A;  1EZV G;  3H1K G;  1HJB A;  1L4A C;  1T2K C;  3NXS A;  1PP9 E;  1OW8 A;  3OJA B;  2I1J A;  1H89 A;  2RMZ A;  5CJ0 A;  2KS1 B;  2R5D A;  1GW4 A;  2KSJ A;  3IN6 A;  2WSE H;  3P8C E;  1Q82 Q;  1CI6 B;  1AV1 A;  3LW5 H;  4R4M A;  1BE3 J;  3CCS P;  3G3Z A;  5C39 A;  4ZNC A;  2O01 J;  4EOT A;  5AW7 B;  4M3L A;  1JY2 N;  2RKL A;  4EDF A;  1A02 J;  3K5B A;  1OVR A;  2O01 H;  1BCC E;  1SLQ A;  1L2P A;  1NOH A;  2P2U A;  2QJY B;  1OMI A;  1QEX A;  1LWU C;  2M5A A;  3L74 E;  4NPF X;  1NYH A;  1PGQ A;  4WVZ A;  4C7R A;  2G3A A;  3KZI E;  4I7Z B;  5AW0 B;  2HPC A;  1JY2 P;  5AVX B;  1LWU A;  1BCC G;  1BGY E;  1M8O B;  3H1H J;  4UB8 E;  2FFD C;  2E5Y A;  5AW4 B;  1ZXG A;  5AW5 B;  1KD1 Q;  3M9Q A;  3VP9 A;  3V2R A;  3N7N A;  3CXH H;  1HTL C;  1SQB K;  2O1J A;  2E42 A;  1L4A A;  2ITA A;  2Q5U A;  3M0D A;  3TYY A;  2KNC A;  2W83 C;  4HYT B;  3L72 E;  3TNU A;  1H0T A;  5AVQ B;  1KZU B;  3NMD A;  3JCU H;  1BE3 D;  1D7M A;  1Z56 A;  3A3Y B;  3L70 G;  2N1T B;  4KJM A;  4U3F D;  3VMY A;  4C7N A;  2K9J B;  1LTT C;  3RGU A;  3FX0 A;  3HD7 A;  2IZ1 A;  1DX7 A;  3AEG C;  3L74 J;  1L4A D;  4H0L C;  1S9K E;  2OYH C;  2OYO A;  2KSE A;  1SQQ K;  1NTZ J;  2ZT9 B;  3VP8 A;  1JTH A;  2M3E A;  1S2E A;  1CZQ A;  2OYI B;  2KI7 B;  5KJ7 A;  2E75 C;  3CWB J;  3HRN A;  1URQ B;  4GDO A;  1ZR2 A;  3G71 P;  4JYC A;  1AA0 A;  4JF7 A;  4DCK A;  1PPJ D;  5AVS B;  5APW A;  2FXM A;  4N3Y B;  1SQV J;  3Q5S A;  2Y0D A;  2POH A;  3L72 J;  2AXT E;  3RK3 E;  2WWW A;  3R2P A;  4WY4 C;  1FZC A;  1URQ C;  3L73 J;  3TK1 A;  3O6Q B;  1GU5 A;  1DIP A;  1BGY D;  1NAY A;  2B87 B;  2YO3 A;  1MFZ A;  3CL3 D;  1K05 A;  1SQX D;  1J1E B;  3FWN A;  1YIJ P;  2HR3 A;  2KZJ A;  2K88 A;  1ZN5 A;  4UB6 E;  3V6I A;  1FDM A;  1S5L X;  1SFC B;  4PD4 H;  5CCG A;  2HYN A;  3WU2 E;  3FGA D;  4EIJ A;  2R32 A;  1NTK K;  4W80 A;  1NU1 G;  1KIL A;  4K35 A;  1SQX J;  2XND H;  1KYO D;  1VQ9 P;  1QVG O;  4KHX A;  3CCV P;  4C7N B;  4BXL A;  2R5B A;  1N86 A;  3MZW B;  3KYQ A;  4LC1 A;  1X8Y A;  3GF3 A;  1KMI Z;  1N7L A;  3USS A;  5KLI B;  1VQO P;  4WY4 A;  3CC2 P;  2A45 I;  1ZRT E;  1SQV D;  3P32 A;  1MZ9 A;  2YXQ B;  1G1I A;  3I5C A;  3P7K A;  4DOJ A;  1J1E C;  2LKM A;  1PZQ A;  4H44 B;  1T2K D;  4XFJ A;  1N73 A;  1N7S D;  3CCE P;  3M91 A;  1OXZ A;  5KAI E;  4D6T D;  3D6Z A;  5EFW B;  3AEA C;  1VQ5 P;  3CXH E;  1M1J B;  1YTZ I;  4JQ0 D;  1KV4 A;  1J1D B;  1OIP A;  2QVA A;  3VN0 A;  2IBZ G;  1NTK D;  1M1J A;  1QVF O;  3Q2Y A;  1L0L G;  3M0A A;  2K3R A;  1GL2 C;  2HFE D;  1RF0 C;  2IFM A;  1LT9 B;  2ZT9 C;  2KB7 P;  3SFE C;  1L0N E;  1SVF A;  1VPC A;  1GL2 D;  1P84 I;  4GT1 A;  5CMZ A;  3Q3D A;  1ZME C;  2GUV A;  3OA7 A;  1IC2 A;  1MFT A;  4H44 C;  3GHG B;  4BRY A;  2LXB A;  3G4S P;  5GTI E;  2E75 D;  2J58 A;  3HUS B;  1Y9B A;  4HH2 A;  2W6B A;  3R4Y A;  1PGJ A;  1VF5 B;  4OGQ B;  5APQ A;  3RK3 D;  4BRY B;  2YIU C;  3BRT B;  3HE4 B;  5AW3 B;  1L0L J;  1J2J B;  2UWJ E;  1SQP E;  2KZI A;  1UIX A;  3CXH D;  3O8Z A;  4L73 A;  5APU A;  4DT0 A;  2YMY A;  5KAI H;  3JC2 2;  4XA4 A;  1A02 F;  1SQB E;  2O3J A;  1ZRT D;  1LTJ B;  5CBO A;  5AVR B;  3CX5 I;  1WRG A;  5CCH C;  4TT3 H;  1SQX G;  2JEE A;  1FAV A;  2M5A B;  2LXC B;  5APV A;  1KYO E;  3GLM A;  1QL2 A;  2KYV A;  3UIA A;  3L70 J;  2YO2 A;  1M7L A;  1W2B O;  3VOP A;  1SQQ G;  3LW5 J;  5E79 H;  3VMX A;  4DZO A;  1GTW A;  1FZF A;  3SWY A;  2H7H A;  1JY3 O;  3GF7 A;  5AVY B;  4I1L A;  1PIX A;  4PD4 E;  1KFN A;  1NTK J;  1PL5 A;  4QMA A;  2E5T A;  2PGD A;  1DD4 A;  2IX7 C;  3V2P A;  1HWT C;  1NH4 A;  1VQN P;  1SQP J;  4PV1 D;  3D70 A;  3S9O A;  4JPZ B;  5AW2 B;  2IFN A;  1P84 E;  2KXP B;  3BCC E;  5M1B A;  1SQP G;  2QJP B;  5KKZ C;  3IFM A;  1NJI Q;  1USE A;  4NPE A;  5KJ7 C;  1QL1 A;  3VTP C;  2XU6 A;  1SQB G;  3EFG A;  4H13 C;  2BAS A;  2WSF J;  1OW7 A;  3GW6 A;  2FYZ A;  3H1H G;  3MTU E;  3MUD A;  3PJS K;  4I2L C;  5AVW B;  2WSF H;  1PP9 J;  1VQM P;  2WTY A;  4U3F G;  3RK2 D;  3GG2 A;  2Y9Y A;  1Q81 Q;  2JJL A;  3H32 B;  4YPC A;  1LJ2 A;  4PD4 D;  1FDO A;  5E79 E;  1VQ7 P;  2A06 D;  3RK3 B;  3E1R A;  1S5L H;  2QM8 A;  2N1T D;  1LTJ A;  1AQ5 A;  3TSI A;  1FC2 C;  2BEQ D;  2XDJ A;  3V2N A;  1HF9 A;  2YNY A;  1HBW A;  1NTZ E;  3W68 A;  3A5T A;  3Q1M A;  1BE3 E;  3B5N C;  2FFD B;  3I56 P;  3G6E P;  2BCC D;  1FDI A;  1GW3 A;  1IFI A;  1FZB A;  2KUB A;  1BGY J;  3L75 G;  5AW6 B;  5KLV K;  2WPS A;  2QSI A;  4WY4 D;  4IOI H;  5L8R J;  5CCG D;  3L73 D;  4WBA A;  2FXO A;  2WSC H;  1AJY A;  2IZ0 A;  1NTM E;  3CCL P;  1KB9 E;  3L75 E;  4B86 A;  3L71 J;  3PP5 A;  2H8P D;  2GM4 A;  1JY3 N;  1NU1 D;  2P10 A;  1GK6 A;  1FE6 A;  1OWA A;  3L37 A;  3RK3 C;  2E75 B;  4OGQ D;  3TNU B;  1H8A A;  4AUW A;  2AXT H;  2WSS H;  5CJ4 A;  1BDC A;  2C0X A;  2KNC B;  3CWB D;  2WZ7 A;  3A2A A;  3HTK B;  1JY3 P;  1LTJ C;  4H44 D;  4ASW A;  2OYH B;  1BSH A;  1Q2N A;  2OAR A;  5K5G B;  2O1K A;  4A7P A;  1NTZ D;  2OYH A;  5AW1 B;  2RH0 A;  4RJT A;  1FOS E;  3L74 D;  2FYU D;  1ZV8 A;  5KAF H;  4C46 A;  1AQT A;  3MD0 A;  2XV5 A;  3L35 A;  4I6M C;  3H1J G;  1AFO A;  4OWF A;  1NGM B;  4N78 E;  4U3F J;  3WU2 H;  2P58 A;  3CWB G;  4RES B;  1U7M A;  1USD A;  2O01 N;  2YMK A;  5CHX A;  1JTH B;  1NTM J;  3BRV B;  3EQ2 A;  3CCU P;  1IK7 A;  2Z4E A;  1ZOY C;  1E5W A;  4YXD C;  3IAO A;  1PGO A;  2QA4 P;  1LT9 C;  1FOS F;  1VQ6 P;  4GKG A;  3SFD C;  3CCR P;  3JSV C;  4W7Y A;  1J1D C;  1SQB D;  2HPC B;  3H1K J;  2H88 C;  1T3J A;  1L0N G;  1N7S B;  1P84 H;  1X0T A;  2J5U A;  3H1H D;  1XTG B;  1NVO A;  4EYY Q;  2NRG A;  1N7S A;  4RKU J;  1JOC A;  1NU1 E;  2V4H A;  3L73 E;  3O6Q A;  2JWA A;  1URQ D;  3AE1 C;  2Q9I A;  2WPQ A;  2HLO A;  2ZAE B;  5KTB A;  3L71 G;  1YHQ P;  3D6Y A;  2ZJS E;  3EWK A;  1DEB A;  3HE5 A;  1L0N D;  1Y47 A;  1S72 P;  1VQ4 P;  1H88 A;  3KXD A;  2NPS A;  3RL0 C;  3AE5 C;  1JB0 J;  1L0N J;  3M9B A;  2N1T C;  1S5L E;  2AXC A;  4ASV A;  2CPS A;  2C0W A;  3AE9 C;  1IFJ A;  2J59 M;  2YKO A;  2N1T A;  2KLV A;  2IYP A;  4R4L A;  3CPW O;  2AEM A;  2QJP C;  2NPS D;  2QJK C;  2QRX A;  4OH8 B;  5BU5 A;  1N73 B;  3FXD A;  1N2D C;  3B5N D;  4D6T E;  1SQQ D;  3KDP B;  2C9N Y;  1ZP0 C;  4PV1 B;  1WT6 A;  1YI2 P;  4U7J A;  2AEF A;  3H1K D;  3M0D C;  1NHL A;  1Q86 Q;  1GU4 A;  2ZT9 D;  1W5C E;  2ZFC A;  1LTS C;  1ZLL A;  2HOD B;  5KLV J;  1FS0 E;  2KP8 A;  1FJP A;  1IO4 A;  1KTM A;  4I7Z C;  2WT7 A;  1RF0 A;  1X9V A;  4PV1 C;  3BCC G;  2GA1 A;  2KLU A;  3E7K A;  4XE5 B;  3L36 A;  5B5E E;  3TF5 A;  2FYU G;  3A0B H;  3C9I A;  1S9K D;  1KYO H;  1JY2 O;  4LGD E;  1FZC B;  2PP6 A;  3H1J D;  2FYU K;  3IF4 A;  1S4X A;  1VDF A;  3TDK A;  1EZV E;  2FYU J;  2B87 A;  1ZR4 A;  1IZN B;  5KAF E;  4RO0 A;  5CBN A;  1EZV D;  2R3S A;  3EFF K;  1KQF B;  1L4A B;  1L0L E;  3CCJ P;  1S1C X;  3CD6 P;  1FBM A;  1U57 A;  3H1L E;  1MV8 A;  3HUS A;  1IK9 A;  3BCC J;  1GDT A;  1M57 D;  3GHG C;  2ZVN B;  4OGQ C;  3HUS C;  5AVT B;  1JMB A;  5GTH H;  3VYI A;  2B9B A;  1K73 Q;  2Y0C A;  3V4Q A;  1HH0 A;  1IFD A;  2ZYG A;  1BE3 G;  1RF1 B;  2M3B A;  3L72 G;  1SQQ E;  1RHZ B;  3ITK A;  1LTB C;  2BCC G;  2YKQ A;  3MIW A;  4IL6 E;  4CPG A;  1SP4 A;  3MHV A;  3WMM 0;  3L70 E;  1YTZ T;  2BEZ F;  1GL2 B;  5APY A;  1KFM A;  2BCC J;  2FYU E;  1YJW P;  1NTM G;  1YJ9 P;  1BSN A;  1PP9 G;  1RQU A;  2N9B A;  1R5L A;  2QIW A;  2V7Q J;  5DJU B;  4BWN A;  3CC4 P;  2CK3 H;  2JKV A;  3F5H A;  3H1I D;  2V7Q H;  1UII A;  4IFM A;  5KLV E;  1EXJ A;  1G2C B;  1GZL A;  1W2E A;  2LR2 A;  4GOE A;  2E76 B;  1SQX E;  2FYN B;  2WT7 B;  2E76 D;  5KLI C;  2ZYD A;  3BVH A;  5KLV D;  1FU1 A;  2WSC J;  1HGZ A;  2Q1K A;  3KZI H;  1JM0 A;  3OAK A;  5APS A;  4H0L B;  3AEE C;  1YQ3 C;  1BGY G;  3L75 J;  3PH0 A;  3GMA A;  3HE4 A;  3AED C;  2OQQ A;  1L0L K;  1KB9 H;  4H0L D;  4AQR D;  2YIU B;  3P8M C;  2BCC E;  2QEX P;  2QG4 A;  1VL2 A;  1DEE G;  1KIL D;  1NTZ G;  4KT0 J;  5TJH A;  1KN7 A;  3ZDM A;  3HD7 C;  2ZXE B;  2IPP A;  2NZ2 A;  2H43 A;  3RL0 B;  4IFD K;  2WIT A;  2WPV B;  4WY4 B;  1T3U A;  2IBZ I;  2A06 E;  3V2Q A;  4U3F E;  4WB4 A;  3L70 D;  1YYC A;  1R5S A;  1RQV A;  1EQ7 A;  3SSU A;  3IR9 A;  1LWU B;  3QH9 A;  2E74 D;  2N9Y B;  1VQK P;  1RE3 A;  4JYB A;  2A06 G;  3L71 E;  3AE8 C;  3B5N A;  5GTI H;  1SS1 A;  1PGP A;  1NKN A;  3II6 A;  3M9H A;  2E74 C;  3MGN A;  1LT1 A;  1KC8 Q;  2OYI C;  1GMJ A;  1OFC X;  1JMM A;  2GUS A;  1NTK G;  3H1L J;  1EDL A;  1SQB J;  1L0L D;  1KB9 D;  1AVY A;  1LT9 A;  2R3C A;  3L75 D;  1FZA A;  2Y0E A;  5CCH A;  3TGU D;  1NWQ A;  1ZW0 A;  3Q5R A;  1HUC A;  2FXP A;  2Z5H A;  2YXR B;  1M1K Q;  2I1K A;  4IL6 H;  1IJD B;  1NTM D;  2Q3I A;  2CPB A;  3KHU A;  4W7Z A;  1DD3 A;  1LTA C;  3A0H E;  4ZKU A;  2FKW B;  2JWD A;  1HGV A;  1KIL C;  2K9J A;  1LP1 A;  3H1I G;  3CCQ P;  3RL0 g;  1VQP P;  2JO1 A;  3AE3 C;  3RBZ A;  1U7J A;  4ZKP A;  1EDJ A;  4L74 A;  2IBZ E;  3H1I J;  1CI6 A;  1NTZ K;  2Y9Z A;  1RE4 A;  2JR8 A;  2OGU A;  2OYI A;  2IBZ D;  3PTZ A;  1S3J A;  5BVZ A;  5H2F E;  1HJ0 A;  3H1K E;  2FYN C;  4TLF A;  1K9M Q;  5AW8 B;  1RE3 C;  3V4W A;  3WUT A;  4GOF A;  1EDI A;  1G1J A;  2OTJ P;  3RL0 D;  4N6J A;  1NU1 J;  3E1I A;  3M06 A;  1SQV K;  2L5G B;  2K1A A;  2OTL P;  1JO5 A;  3CC7 P;  2IYO A;  1HVV A;  1Q7Y Q;  2KK7 A;  1FZE A;  3N4X A;  1NAF A;  1OZH A;  1P84 D;  3BCC D;  4JBZ A;  2W8Z A;  3H1H E;  4PJ0 H;  3S4R A;  1N73 C;  1PFI A;  1EC5 A;  2Z5I A;  3V5B A;  1H0T B;  1SQP K;  1IFM A;  3H1I E;  1RE4 C;  3B71 A;  1SFC A; 
#chains in the Genus database with same CATH homology
 3L70 G;  1KYO H;  3L71 G;  4PD4 H;  1SQQ G;  3H1J G;  1NU1 G;  1SQV G;  3CWB G;  4D6T G;  3L75 G;  2A06 G;  5KLV G;  3CX5 H;  2IBZ G;  3TGU G;  1BGY G;  1SQP G;  1BCC G;  3L73 G;  1KB9 H;  1L0N G;  1NTK G;  1P84 H;  1PPJ G;  1SQB G;  1BE3 G;  3L72 G;  3CXH H;  3L74 G;  2BCC G;  3H1H G;  1NTZ G;  3H1I G;  4U3F G;  1SQX G;  3BCC G;  1EZV G;  3H1K G;  1NTM G;  2FYU G;  1PP9 G;  1L0L G;  3H1L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...