3H1JG

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 18
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1jG00
1BGYG 1L0NG 3L75G 3L72G 3BCCG 3H1HG 3L70G 3L74G 1SQVG 1L0LG 5KLVG 3H1LG 1BE3G 1NTZG 1SQXG 3CXHH 3H1IG 4U3FG 4PD4H 3TGUG 3CX5H 1SQBG 1KB9H 2A06G 1PPJG 3L73G 4D6TG 1P84H 3L71G 1SQPG 1EZVG 1NU1G 2IBZG 3CWBG 1PP9G 1NTKG 2FYUG 3H1KG 2BCCG 3H1JG 1SQQG 1KYOH 1NTMG 1BCCG
chains in the Genus database with same CATH superfamily
3C9IA 1IK7A 1SQBK 2K3RA 1BDDA 3HD7D 2YKQA 1RHZB 1SQBJ 2OYHA 1SQXE 1HWTC 2ZT9C 1RF0C 3QWOC 1HVVA 2KK7A 4L74A 3K5BA 4PV1B 5KJ7A 1JNMA 1VQ8P 3MP7B 5E79E 3EQ2A 1A02F 5AVVB 3L75D 4GOFA 2RN0A 2MKVA 4N78D 4PJ0E 2N9BA 4PD4H 4CPGA 5BU5A 2LR2A 2YMYA 4KT0J 4OGQC 3AE5C 3H1KD 1LGHB 1KYOI 1FZCB 1X79B 2R3SA 3H1IE 2KS1A 1Q7YQ 1RF1B 2AXTE 2IBZD 3PJSK 5AW9B 3TF5A 2R44A 1JTHA 3CCUP 1N7LA 3ITKA 2Z5IA 1RY3A 2KNCB 1ZW0A 1HH0A 3GW6A 1DD3A 1CI6B 1D7MA 1JTHB 2I1JA 1VF5C 1LTGC 2N1TB 2WZ7A 2Y9YA 4U3FE 1JY2N 5CJ4A 4LLHA 3CCEP 1IK9A 1FJKA 1R5LA 1K05A 3A0HE 2ZXXA 3H1JD 3H1ID 1ZMEC 2W8ZA 2N1TA 4EIJA 1IFIA 3L36A 3L74G 3V2NA 3CMAP 3OA7A 3D6YA 2GUSA 2QA4P 1JCCA 1JY3O 2HODA 2IZ0A 1NTZK 1QL1A 3H1LG 4UB6E 1H8AA 2V4HA 1VQLP 2OTLP 3ZDMA 1PGOA 1IC2A 2HODB 1URQA 2W90A 1KMIZ 1FAVA 3FXEA 2Y0DA 4OH8B 4UB8E 5APWA 2XDJA 5AW7B 2W6JH 4C7RA 2KLUA 5EFWB 1NHLA 5K5GB 1GL2C 1UIXA 2QM8A 3H1KE 5CHXA 2BASA 3HTKB 1K9MQ 2E75B 2WSCH 1SQQE 3M9HA 1WRGA 1QL2A 2P58A 1QVGO 1KQLA 4W80A 3L71J 3RBZA 2XV5A 4HH2A 1KYOH 1SQQD 3C1LA 1SQXD 1OFCX 2BCCD 3B71A 2FFDC 1A02J 2KOGA 2LXBA 3N4XA 1KN7A 3L70G 3WMM0 2N9YB 4D6TJ 1RE4A 1EZVD 3B5NB 2V7QH 2ZYAA 3G3ZA 5KJ7D 2Q3IA 3MHVA 3SSUA 3CCVP 1PP9E 1L4AA 2M0BA 4RJTA 2XZRA 2LXCB 1HGVA 3GMAA 5KLVJ 4Y28J 1G2CB 4I7ZB 4HYTB 2H8PD 3W68A 1GMJA 3VMXA 1LTJC 2OYIC 1N2DC 5KLVK 1L0LK 2OYHB 2IFMA 2L91A 2R5BA 1BCCE 5AVZB 1M7LA 1EC5A 1W2EA 2E76C 2WSEH 3JSVC 1M1JB 1L0NK 1P84H 3L73G 3L71G 1RE3C 1RE3A 2O1KA 1KZUB 3IN6A 4YTPC 1YYCA 1E79H 1ZXGA 2ZVOB 3RK2D 2WITA 3NFQA 1KYOD 3JC22 1EDJA 4NPDA 1S9KE 4U7JA 1JCDA 1QGKB 1KFNA 1BGYG 1LTJA 2OYIA 3II6A 3JCUH 2RH0A 3H1HG 5B66E 2WPVB 3EFGA 4QMAA 3HD7A 1MUUA 1BDCA 2ZT9D 3FGAD 4D6TD 3H1LJ 1FC2C 4N78E 2B87B 5AW8B 3UIAA 1S1CX 2E5YA 3AE1C 3MTUE 1EXJA 2FYNC 2G3AA 3PTZA 4U3FG 4KJMA 2NPSB 2Q6QA 1BE3E 2AEFA 4NPFX 3L4FA 5KAFH 3H25A 2IX7C 2KZIA 5AVWB 2GUVA 3V2QA 1NTZE 2BEZF 2IPPA 3CL3D 1PGPA 1ZOYC 1OWAA 3Q1MA 2C9LY 1SQPD 2RMZA 2WPSA 4GT1A 1Q81Q 3B4SA 3OJAB 4PV1C 1BGYJ 2QRXA 1M1KQ 2D2CB 4PD4I 2I8DA 4BRYA 1KTMA 1SP4A 5KKZB 3A0BH 1EDKA 2C0XA 3T97A 1QEXA 1PP9J 1L0NG 1SQVE 1URQC 1ZLLA 2K9JA 2YXQB 5CBNA 1VQ7P 1JY3P 2D2CD 4D6TE 3H1IJ 5KAFE 4BWNA 2WSFH 1N73A 3Q3DA 1X9VA 3HE5B 3RL0B 2SPZA 5DJTB 3GHGC 3Q5PA 1J1EC 1OW8A 3H32B 3BASA 2N1TC 5AVTB 5H2FH 2M5AB 3I5CA 2QG4A 1X0TA 1NTMD 2A45I 1JY3N 1SQVK 2QJYC 5GTHH 3MIWA 1PV3A 1LTIC 4H0LC 3TGUG 3CX5H 3M91A 3TNUA 1EZVE 4UB6H 5E79H 1NTKD 1FZBA 5AVSB 5TISH 2KLVA 1GTWA 1NU1D 1Q82Q 1FDIA 3RK2C 4H13C 1SQPG 4L76A 1KILB 1PP9G 1ZP0C 3WU2E 4A7PA 3HUSA 3MZWB 5AW0B 1NKNA 1OVRA 1S2EA 3CC4P 1YQ3C 1FOSE 1U7JA 4OVNF 3CXHI 1OW7A 1YBKA 2M3EA 2FBWC 2A45H 2W6AA 2C0WA 1PP9D 3AEBC 5GTIH 1NGMB 1CSBA 2M8RA 5KJ7C 4Y99B 1IFPA 1LTSC 2OYHC 2C9NY 3BCCE 1X22A 1OZHA 3LIEA 3NXSA 1DEBA 1LNQA 2AEMA 2KS1B 2PFXA 5KLIC 4ZKUA 1QVFO 2IZ1A 1DIPA 2ITAA 3CX5D 3WUUA 3B5ND 5APUA 2KNCA 2WMMA 2JEEA 4JYBA 1MKMA 2B87A 1NTMJ 1CZQA 4N6JA 2OGUA 3CCQP 1EXIA 3CC7P 1OVVA 1M57D 3PHLA 3L74J 3O6QB 3CI9A 3P8CE 5CCHC 2FXOA 2KZJA 4UB8H 3L71D 1KC8Q 1GZLA 1KQFB 4I7ZC 1RH5B 1SLQA 2JKVA 3RK3C 5C39A 1LTAC 2AXCA 1ZN5A 4L75A 2FY8A 1JMMA 1L0LE 3AECC 4R4LA 2HLOA 1BCCJ 1NVOA 4Y99C 1SFCB 2WWWA 4JYCA 1Q2NA 1VL2A 2QJYB 1M90Q 2QM7A 3KZIE 2GM4A 2IYOA 1FE6A 4C46A 2O01N 1LTBC 1FS0E 4K3AA 3H1JE 3SWFA 1LWUA 4YPCA 2H43A 1SQXG 1FU1A 2E5TA 3HTKA 1KILC 1KQGB 2O3JA 3AEEC 5CCGC 3I55P 1L0NE 1E5WA 3AEDC 1FZFA 1FBMA 2FXPA 3E1IA 3CXHE 2YIUC 2M5AA 2QJPB 3L70J 2OYOA 1URQB 4D6TG 1KORA 1SQQK 3D6ZA 1QLED 1NU1G 3RK3B 1NTKG 2JO1A 1SQQJ 4L73A 1SQXJ 3CCMP 5GTIE 2ZYDA 3TGUD 1GL2B 1NTMG 3RL0g 1URQD 3RL0C 4W7ZA 1SFCC 3ABVC 1BSNA 4H44C 3V6IA 4AUWA 1NTZJ 3AE7C 2WSFJ 4ASVA 3CCLP 1AJYA 1HF9A 4HB1A 1DEEG 1DD4A 1SQPE 3P7KA 3CXHD 4OGQD 1M56D 2KP8A 4O9BA 2KSJA 4OWFA 3TK1A 3Q2YA 1L0ND 3B5NA 2E74B 1NAYA 3H1LE 1N7SD 1YJWP 4H0LD 4EOTA 3OAKA 1T6AA 3CLQA 5APXA 1Q90D 4PD4D 3V2RA 3CC2P 1T3JA 3RGUA 2FYZA 3CCRP 2CPSA 1FZCC 3A0HH 1LTJB 1UIIA 1VDFA 4HKZH 1IJDB 5M1BA 2OYIB 1KV4A 3IFMA 2H89C 1YITP 3A5TA 1RF1A 2E42A 1DX7A 1NTKK 3M0DA 2J59M 3H1KG 2XNXA 2BCCG 1AV1A 1NU1K 1JB0J 1SQQG 2OTKE 3KZIH 3SFEC 2IDBA 2XU6A 2Q5UA 4IL6X 2R32A 3L75G 1N7SA 4U3FD 5CBOA 3TGUJ 4PV1D 3G9RA 1S9KD 1L4AB 5CJ0A 1T2KC 4TT3H 2K9YA 5AW2B 1OW6A 1PGJA 1SVFA 2R3CA 4IFDK 1LTTC 2IFNA 2HG5D 2KIKA 1SQXK 3D71A 3AE4C 2HR3A 2KUBA 3FWLA 4NPEA 1KFMA 1L4AD 1USEA 1GK6A 2D2CC 4WY4C 3V4WA 4XFJA 2QVAA 5APTA 4EYYQ 2QEXP 1P84E 4ZMDA 3MUDC 3B5NC 3P8MC 3CWBJ 1HTLC 1PGQA 2I1KA 5AVUB 1L0NJ 1LJ2A 1EZVI 2PGDA 4DJGA 3NMDA 1NH4A 5CCHD 3G71P 2NPSC 1BE3J 1MV8A 2QIWA 3S1KA 4LGDE 5KLIB 1GU5A 1ZR4A 4IL6H 2CPBA 3JCUE 3KXDA 1YJNP 2Y0CA 3L71E 3RL0D 5B66H 1FZEA 3AEGC 1SFCA 1J1DB 3H1JG 3MUDA 4GODA 3BATA 5AW5B 2ZYGA 3BCCJ 1DH3A 1CW5A 1ZRTE 4JF7A 1GK4A 1GW4A 2P7JA 4WVZA 3VOPA 4ZKPA 2FFDB 3CMEP 1G1JA 1XTCC 4I6MC 2KI7B 2YO2A 3R4YA 4WY4B 3V5BA 4EI2A 2POHA 1NU1E 2O1JA 3CCJP 1FJPA 1LT9C 3I56P 1N8RQ 1N7SC 1KILD 2JR8A 3HE4A 2E75D 3VP8A 3Q5SA 2E43A 3L72E 3M9QA 4GOEA 2FKWB 5AW4B 2HPCA 2JDIH 3GLMA 3M0DC 1KB9H 2JWAA 1S4XA 3LW5J 3GF3A 4WB4A 3A7OA 1NAFA 3IF4A 3VMZA 1K8AQ 3IR9A 3VMAA 2FYNB 3VTPC 4ASWA 1P84D 3L35A 1YTZT 1VF5B 3H1HD 1SQPJ 3AE2C 1H89A 1L2PA 1M1JA 2KYVA 4N3YB 1K04A 2FFDA 1IO4A 2YKOA 4AYCA 1BGYD 1SQPK 4Z1MH 3U59A 1MFZA 3P32A 1S5LE 1VQ9P 3HE5A 1P84I 1VF5D 1G2CA 4I2LC 4JQ0D 5CMZA 3H1LD 3HUSB 1SQVG 2OARA 3C8VA 2JWDA 3L73D 2M3BA 1KILE 3KQGA 2LKMA 4LC1A 3AE3C 5AVYB 4TLFA 4W7YA 1VQNP 1JOCA 1IFMA 3H1IG 2BCCE 1S72P 1N86A 1KB9D 5B5EE 3BVHA 2H7HA 4H44B 1LT9A 2KXPB 1NYHA 1NJIQ 2YXRB 1LP1B 2W83C 1MZ9A 3KPEA 3M06A 1AVYA 1FZGA 3CD6P 3TGUE 2XKMA 2WSCJ 1EZVG 2IBZG 3V4QA 4C7NA 1VQ5P 3L70D 3BCCD 2YMKA 4RKUJ 5CCGA 1ZV8A 2WSSH 3L74E 3KHUA 4HJGH 1IFNA 2YO3A 5KAIH 2ZT9B 1LT1A 3SFDC 4DT0A 3A3YB 3HUSC 2WTYA 2WT7B 1L0LJ 5DJUB 4PJ0H 3V2PA 4XE5B 5GTHE 2NPSA 5AVXB 4WBAA 3L72J 2WVRA 4JPZB 4JBZA 3RK3E 4EDFA 4ZNCA 1MFTA 1X8YA 1SQBD 1KB9E 2E75C 1S5LX 3EFFK 1J1EB 3OW2O 3LIDA 2PRRA 4I1LA 1EDIA 3HD7B 1XTGB 2ZXEB 4GDOA 4WY4A 1VQPP 3AE8C 1M1JC 2ZVNB 1CI6A 2A06G 2NRGA 5APQA 3GHGA 2DW3A 3F89A 3H1HJ 3Q5RA 1H88A 1R5SA 3F5HA 2NPSD 2O01J 3GF7A 2PAJA 5TJHA 5CCHA 3MD0A 3KDPB 3R2PA 1JUNA 3L74D 2Y0EA 3FWNA 3VMYA 5APSA 4YXWH 5KTBA 3PRJA 2RKLA 4U3FJ 1AQTA 3E1RA 3TYYA 3P8CD 3CX5I 3L70E 2YIUB 1GU4A 5L8RJ 5BU8B 3A2AA 2Q1KA 1EQ7A 1SQBE 1FOSF 2B89A 3AE6C 3L72G 1T3UA 1IFDA 1PPJE 2K1AA 4BXLA 1RF1C 3G6EP 3L73J 4IL6E 4IOIH 1L0LG 3TSIA 2V7QJ 3T97B 1OIPA 1L0LD 2ZJSE 1JM0A 2WQYC 3CWBE 5B5EH 3TNUB 5KLVG 2FYUE 2WPQA 1IZNB 3L72D 3D70A 2AXTH 4KHXA 5APYA 4RO0A 3B8EB 2VRSA 3VN0A 3L73E 4YXDC 1ZR2A 1PFIA 5AW3B 2R5DA 3KYQA 1W5CE 3WU2H 1BE3D 1KYOE 1HJ0A 3CWBD 4WY4D 3S4RA 4BRYB 1VQKP 5AW1B 2B9BA 3WUVA 1K73Q 1GD2E 3U1CA 3W67A 1PPJD 3CX5E 1BGYE 4IFFA 5KKZC 3LW5H 1LT9B 2A06D 5TISE 3VYIA 1U7MA 1QX8A 2P2UA 2H88C 3BRTB 3VP9A 1OXZA 1FZAA 3H1HE 4DZOA 1BCCD 4H13D 1KB9I 1PL5A 1RQUA 1YTZI 2QJKB 2YKPA 1NTKE 2P1JA 2QJPC 2W6BA 4B86A 1SS1A 2BEQD 1W2BO 1NOHA 4MN4C 1SQVJ 1VQOP 1NTME 2P67A 2KSEA 4H13B 1AVOA 3U1AA 1N73C 1VQ4P 1H0TB 1OMIA 3SWKA 1BE3G 1VQ6P 1S3JA 2W27A 1PIXA 2IBZE 1JY2P 5CCGD 2WT7A 4GKGA 1AFOA 5AVRB 3AEFC 3L37A 1NTZG 3O6QA 2A45G 1H0TA 2JP3A 1GDTA 2WPRA 3PH0A 2N1TD 1LWUC 1TU3F 4GIFA 3FX0A 5H2FE 1NTKJ 2GA1A 1VQMP 1FZCA 1RE4C 1NU1J 2QSIA 2E74C 3PP5A 5AW6B 1R8EA 2OQQA 1SFCD 1USDA 2AEJA 3O8ZA 3CCSP 2UWJE 2G8YA 2HFED 3H1JJ 4H44D 4R4MA 3CPWO 3GHGB 2Q7CA 2ZFCA 1Y8AA 1NTZD 2FYUD 1WMKA 2E76B 3TDKA 1Y47A 2XNDH 1RQVA 2A06E 2BCCJ 2IBZI 3L75E 2PP6A 3HD7C 3MGNA 1SQVD 1G1IA 2P10A 2Q9IA 4WWIA 1ZRTD 2E76D 3NTNA 5APVA 1FDMA 4DOJA 3CXHH 1AQ5A 1HBWA 1Z56A 1M8OB 3M9BA 2CK3H 3AE9C 3BRVB 1NO4A 3L75J 1Q86Q 2YNYA 1SQBG 5AVQB 2K37A 1YQ4C 1KD1Q 4M3LA 2QJKC 2MJZA 3H6PA 1PPJG 3EWKA 3WUTA 1GL2D 1JY2O 1OX3A 2O01H 3HE4B 2K9JB 1PZQA 1WT6A 3FXDA 3HRNA 3E7KA 3CWBG 5KLVE 2FYUG 1N73B 1J2JB 2HYNA 1Y9BA 1YI2P 1T2KD 1JO5A 1GW3A 1KILA 1OVUA 2FXMA 1HUCA 1JEKA 2IYPA 3H32A 3BCCG 3RK3D 4DCKA 2Z4EA 1IFJA 2K88A 1YJ9P 3PLNA 5KAIE 1L4AC 1KQSO 1HGZA 1LWUB 5KLVD 4H0LB 3G4SP 1J1DC 2Q3EA 1AA0A 1FDOA 1S5LH 1YIJP 1LP1A 2JJLA 1NKZB 2Y9ZA 1HJBA 2HPCB 5BVZA 3RK2B 1VPCA 2WSEJ 3H1KJ 2OTJP 1JMBA 4C7NB 3N7NA 3M0AA 3SWYA 1BSHA 1NWQA 4AQRD 1YHQP 2L5GB 3S9OA 3AEAC 4OGQB 3RBXA 2J5UA 1RF0A 3A0BE 4IFMA 3USSA 1U57A 1NTMK 2E74D 2QE7H 4XA4A 1N7SB 2Z5HA 1GL2A 2NZ2A 2ZAEB 3QH9A 2J58A 4PD4E 4RESB 2FYUK 1EDLA 2B88A 2KB7P 3IAOA 1T8ZA 4K35A 3GG2A 2FYUJ 1BCCG
chains in the Genus database with same CATH topology
1BGYG 1L0NG 3L75G 3L72G 3BCCG 3H1HG 3L70G 3L74G 1SQVG 1L0LG 5KLVG 3H1LG 1BE3G 1NTZG 1SQXG 3CXHH 3H1IG 4U3FG 4PD4H 3TGUG 3CX5H 1SQBG 1KB9H 2A06G 1PPJG 3L73G 4D6TG 1P84H 3L71G 1SQPG 1EZVG 1NU1G 2IBZG 3CWBG 1PP9G 1NTKG 2FYUG 3H1KG 2BCCG 3H1JG 1SQQG 1KYOH 1NTMG 1BCCG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY G;  1L0N G;  3L75 G;  3L72 G;  3BCC G;  3H1H G;  3L70 G;  3L74 G;  1SQV G;  1L0L G;  5KLV G;  3H1L G;  1BE3 G;  1NTZ G;  1SQX G;  3CXH H;  3H1I G;  4U3F G;  4PD4 H;  3TGU G;  3CX5 H;  1SQB G;  1KB9 H;  2A06 G;  1PPJ G;  3L73 G;  4D6T G;  1P84 H;  3L71 G;  1SQP G;  1EZV G;  1NU1 G;  2IBZ G;  3CWB G;  1PP9 G;  1NTK G;  2FYU G;  3H1K G;  2BCC G;  3H1J G;  1SQQ G;  1KYO H;  1NTM G;  1BCC G; 
#chains in the Genus database with same CATH topology
 3C9I A;  1IK7 A;  1SQB K;  2K3R A;  1BDD A;  3HD7 D;  2YKQ A;  1RHZ B;  1SQB J;  2OYH A;  1SQX E;  1HWT C;  2ZT9 C;  1RF0 C;  3QWO C;  1HVV A;  2KK7 A;  4L74 A;  3K5B A;  4PV1 B;  5KJ7 A;  1JNM A;  1VQ8 P;  3MP7 B;  5E79 E;  3EQ2 A;  1A02 F;  5AVV B;  3L75 D;  4GOF A;  2RN0 A;  2MKV A;  4N78 D;  4PJ0 E;  2N9B A;  4PD4 H;  4CPG A;  5BU5 A;  2LR2 A;  2YMY A;  4KT0 J;  4OGQ C;  3AE5 C;  3H1K D;  1LGH B;  1KYO I;  1FZC B;  1X79 B;  2R3S A;  3H1I E;  2KS1 A;  1Q7Y Q;  1RF1 B;  2AXT E;  2IBZ D;  3PJS K;  5AW9 B;  3TF5 A;  2R44 A;  1JTH A;  3CCU P;  1N7L A;  3ITK A;  2Z5I A;  1RY3 A;  2KNC B;  1ZW0 A;  1HH0 A;  3GW6 A;  1DD3 A;  1CI6 B;  1D7M A;  1JTH B;  2I1J A;  1VF5 C;  1LTG C;  2N1T B;  2WZ7 A;  2Y9Y A;  4U3F E;  1JY2 N;  5CJ4 A;  4LLH A;  3CCE P;  1IK9 A;  1FJK A;  1R5L A;  1K05 A;  3A0H E;  2ZXX A;  3H1J D;  3H1I D;  1ZME C;  2W8Z A;  2N1T A;  4EIJ A;  1IFI A;  3L36 A;  3L74 G;  3V2N A;  3CMA P;  3OA7 A;  3D6Y A;  2GUS A;  2QA4 P;  1JCC A;  1JY3 O;  2HOD A;  2IZ0 A;  1NTZ K;  1QL1 A;  3H1L G;  4UB6 E;  1H8A A;  2V4H A;  1VQL P;  2OTL P;  3ZDM A;  1PGO A;  1IC2 A;  2HOD B;  1URQ A;  2W90 A;  1KMI Z;  1FAV A;  3FXE A;  2Y0D A;  4OH8 B;  4UB8 E;  5APW A;  2XDJ A;  5AW7 B;  2W6J H;  4C7R A;  2KLU A;  5EFW B;  1NHL A;  5K5G B;  1GL2 C;  1UIX A;  2QM8 A;  3H1K E;  5CHX A;  2BAS A;  3HTK B;  1K9M Q;  2E75 B;  2WSC H;  1SQQ E;  3M9H A;  1WRG A;  1QL2 A;  2P58 A;  1QVG O;  1KQL A;  4W80 A;  3L71 J;  3RBZ A;  2XV5 A;  4HH2 A;  1KYO H;  1SQQ D;  3C1L A;  1SQX D;  1OFC X;  2BCC D;  3B71 A;  2FFD C;  1A02 J;  2KOG A;  2LXB A;  3N4X A;  1KN7 A;  3L70 G;  3WMM 0;  2N9Y B;  4D6T J;  1RE4 A;  1EZV D;  3B5N B;  2V7Q H;  2ZYA A;  3G3Z A;  5KJ7 D;  2Q3I A;  3MHV A;  3SSU A;  3CCV P;  1PP9 E;  1L4A A;  2M0B A;  4RJT A;  2XZR A;  2LXC B;  1HGV A;  3GMA A;  5KLV J;  4Y28 J;  1G2C B;  4I7Z B;  4HYT B;  2H8P D;  3W68 A;  1GMJ A;  3VMX A;  1LTJ C;  2OYI C;  1N2D C;  5KLV K;  1L0L K;  2OYH B;  2IFM A;  2L91 A;  2R5B A;  1BCC E;  5AVZ B;  1M7L A;  1EC5 A;  1W2E A;  2E76 C;  2WSE H;  3JSV C;  1M1J B;  1L0N K;  1P84 H;  3L73 G;  3L71 G;  1RE3 C;  1RE3 A;  2O1K A;  1KZU B;  3IN6 A;  4YTP C;  1YYC A;  1E79 H;  1ZXG A;  2ZVO B;  3RK2 D;  2WIT A;  3NFQ A;  1KYO D;  3JC2 2;  1EDJ A;  4NPD A;  1S9K E;  4U7J A;  1JCD A;  1QGK B;  1KFN A;  1BGY G;  1LTJ A;  2OYI A;  3II6 A;  3JCU H;  2RH0 A;  3H1H G;  5B66 E;  2WPV B;  3EFG A;  4QMA A;  3HD7 A;  1MUU A;  1BDC A;  2ZT9 D;  3FGA D;  4D6T D;  3H1L J;  1FC2 C;  4N78 E;  2B87 B;  5AW8 B;  3UIA A;  1S1C X;  2E5Y A;  3AE1 C;  3MTU E;  1EXJ A;  2FYN C;  2G3A A;  3PTZ A;  4U3F G;  4KJM A;  2NPS B;  2Q6Q A;  1BE3 E;  2AEF A;  4NPF X;  3L4F A;  5KAF H;  3H25 A;  2IX7 C;  2KZI A;  5AVW B;  2GUV A;  3V2Q A;  1NTZ E;  2BEZ F;  2IPP A;  3CL3 D;  1PGP A;  1ZOY C;  1OWA A;  3Q1M A;  2C9L Y;  1SQP D;  2RMZ A;  2WPS A;  4GT1 A;  1Q81 Q;  3B4S A;  3OJA B;  4PV1 C;  1BGY J;  2QRX A;  1M1K Q;  2D2C B;  4PD4 I;  2I8D A;  4BRY A;  1KTM A;  1SP4 A;  5KKZ B;  3A0B H;  1EDK A;  2C0X A;  3T97 A;  1QEX A;  1PP9 J;  1L0N G;  1SQV E;  1URQ C;  1ZLL A;  2K9J A;  2YXQ B;  5CBN A;  1VQ7 P;  1JY3 P;  2D2C D;  4D6T E;  3H1I J;  5KAF E;  4BWN A;  2WSF H;  1N73 A;  3Q3D A;  1X9V A;  3HE5 B;  3RL0 B;  2SPZ A;  5DJT B;  3GHG C;  3Q5P A;  1J1E C;  1OW8 A;  3H32 B;  3BAS A;  2N1T C;  5AVT B;  5H2F H;  2M5A B;  3I5C A;  2QG4 A;  1X0T A;  1NTM D;  2A45 I;  1JY3 N;  1SQV K;  2QJY C;  5GTH H;  3MIW A;  1PV3 A;  1LTI C;  4H0L C;  3TGU G;  3CX5 H;  3M91 A;  3TNU A;  1EZV E;  4UB6 H;  5E79 H;  1NTK D;  1FZB A;  5AVS B;  5TIS H;  2KLV A;  1GTW A;  1NU1 D;  1Q82 Q;  1FDI A;  3RK2 C;  4H13 C;  1SQP G;  4L76 A;  1KIL B;  1PP9 G;  1ZP0 C;  3WU2 E;  4A7P A;  3HUS A;  3MZW B;  5AW0 B;  1NKN A;  1OVR A;  1S2E A;  3CC4 P;  1YQ3 C;  1FOS E;  1U7J A;  4OVN F;  3CXH I;  1OW7 A;  1YBK A;  2M3E A;  2FBW C;  2A45 H;  2W6A A;  2C0W A;  1PP9 D;  3AEB C;  5GTI H;  1NGM B;  1CSB A;  2M8R A;  5KJ7 C;  4Y99 B;  1IFP A;  1LTS C;  2OYH C;  2C9N Y;  3BCC E;  1X22 A;  1OZH A;  3LIE A;  3NXS A;  1DEB A;  1LNQ A;  2AEM A;  2KS1 B;  2PFX A;  5KLI C;  4ZKU A;  1QVF O;  2IZ1 A;  1DIP A;  2ITA A;  3CX5 D;  3WUU A;  3B5N D;  5APU A;  2KNC A;  2WMM A;  2JEE A;  4JYB A;  1MKM A;  2B87 A;  1NTM J;  1CZQ A;  4N6J A;  2OGU A;  3CCQ P;  1EXI A;  3CC7 P;  1OVV A;  1M57 D;  3PHL A;  3L74 J;  3O6Q B;  3CI9 A;  3P8C E;  5CCH C;  2FXO A;  2KZJ A;  4UB8 H;  3L71 D;  1KC8 Q;  1GZL A;  1KQF B;  4I7Z C;  1RH5 B;  1SLQ A;  2JKV A;  3RK3 C;  5C39 A;  1LTA C;  2AXC A;  1ZN5 A;  4L75 A;  2FY8 A;  1JMM A;  1L0L E;  3AEC C;  4R4L A;  2HLO A;  1BCC J;  1NVO A;  4Y99 C;  1SFC B;  2WWW A;  4JYC A;  1Q2N A;  1VL2 A;  2QJY B;  1M90 Q;  2QM7 A;  3KZI E;  2GM4 A;  2IYO A;  1FE6 A;  4C46 A;  2O01 N;  1LTB C;  1FS0 E;  4K3A A;  3H1J E;  3SWF A;  1LWU A;  4YPC A;  2H43 A;  1SQX G;  1FU1 A;  2E5T A;  3HTK A;  1KIL C;  1KQG B;  2O3J A;  3AEE C;  5CCG C;  3I55 P;  1L0N E;  1E5W A;  3AED C;  1FZF A;  1FBM A;  2FXP A;  3E1I A;  3CXH E;  2YIU C;  2M5A A;  2QJP B;  3L70 J;  2OYO A;  1URQ B;  4D6T G;  1KOR A;  1SQQ K;  3D6Z A;  1QLE D;  1NU1 G;  3RK3 B;  1NTK G;  2JO1 A;  1SQQ J;  4L73 A;  1SQX J;  3CCM P;  5GTI E;  2ZYD A;  3TGU D;  1GL2 B;  1NTM G;  3RL0 g;  1URQ D;  3RL0 C;  4W7Z A;  1SFC C;  3ABV C;  1BSN A;  4H44 C;  3V6I A;  4AUW A;  1NTZ J;  3AE7 C;  2WSF J;  4ASV A;  3CCL P;  1AJY A;  1HF9 A;  4HB1 A;  1DEE G;  1DD4 A;  1SQP E;  3P7K A;  3CXH D;  4OGQ D;  1M56 D;  2KP8 A;  4O9B A;  2KSJ A;  4OWF A;  3TK1 A;  3Q2Y A;  1L0N D;  3B5N A;  2E74 B;  1NAY A;  3H1L E;  1N7S D;  1YJW P;  4H0L D;  4EOT A;  3OAK A;  1T6A A;  3CLQ A;  5APX A;  1Q90 D;  4PD4 D;  3V2R A;  3CC2 P;  1T3J A;  3RGU A;  2FYZ A;  3CCR P;  2CPS A;  1FZC C;  3A0H H;  1LTJ B;  1UII A;  1VDF A;  4HKZ H;  1IJD B;  5M1B A;  2OYI B;  1KV4 A;  3IFM A;  2H89 C;  1YIT P;  3A5T A;  1RF1 A;  2E42 A;  1DX7 A;  1NTK K;  3M0D A;  2J59 M;  3H1K G;  2XNX A;  2BCC G;  1AV1 A;  1NU1 K;  1JB0 J;  1SQQ G;  2OTK E;  3KZI H;  3SFE C;  2IDB A;  2XU6 A;  2Q5U A;  4IL6 X;  2R32 A;  3L75 G;  1N7S A;  4U3F D;  5CBO A;  3TGU J;  4PV1 D;  3G9R A;  1S9K D;  1L4A B;  5CJ0 A;  1T2K C;  4TT3 H;  2K9Y A;  5AW2 B;  1OW6 A;  1PGJ A;  1SVF A;  2R3C A;  4IFD K;  1LTT C;  2IFN A;  2HG5 D;  2KIK A;  1SQX K;  3D71 A;  3AE4 C;  2HR3 A;  2KUB A;  3FWL A;  4NPE A;  1KFM A;  1L4A D;  1USE A;  1GK6 A;  2D2C C;  4WY4 C;  3V4W A;  4XFJ A;  2QVA A;  5APT A;  4EYY Q;  2QEX P;  1P84 E;  4ZMD A;  3MUD C;  3B5N C;  3P8M C;  3CWB J;  1HTL C;  1PGQ A;  2I1K A;  5AVU B;  1L0N J;  1LJ2 A;  1EZV I;  2PGD A;  4DJG A;  3NMD A;  1NH4 A;  5CCH D;  3G71 P;  2NPS C;  1BE3 J;  1MV8 A;  2QIW A;  3S1K A;  4LGD E;  5KLI B;  1GU5 A;  1ZR4 A;  4IL6 H;  2CPB A;  3JCU E;  3KXD A;  1YJN P;  2Y0C A;  3L71 E;  3RL0 D;  5B66 H;  1FZE A;  3AEG C;  1SFC A;  1J1D B;  3H1J G;  3MUD A;  4GOD A;  3BAT A;  5AW5 B;  2ZYG A;  3BCC J;  1DH3 A;  1CW5 A;  1ZRT E;  4JF7 A;  1GK4 A;  1GW4 A;  2P7J A;  4WVZ A;  3VOP A;  4ZKP A;  2FFD B;  3CME P;  1G1J A;  1XTC C;  4I6M C;  2KI7 B;  2YO2 A;  3R4Y A;  4WY4 B;  3V5B A;  4EI2 A;  2POH A;  1NU1 E;  2O1J A;  3CCJ P;  1FJP A;  1LT9 C;  3I56 P;  1N8R Q;  1N7S C;  1KIL D;  2JR8 A;  3HE4 A;  2E75 D;  3VP8 A;  3Q5S A;  2E43 A;  3L72 E;  3M9Q A;  4GOE A;  2FKW B;  5AW4 B;  2HPC A;  2JDI H;  3GLM A;  3M0D C;  1KB9 H;  2JWA A;  1S4X A;  3LW5 J;  3GF3 A;  4WB4 A;  3A7O A;  1NAF A;  3IF4 A;  3VMZ A;  1K8A Q;  3IR9 A;  3VMA A;  2FYN B;  3VTP C;  4ASW A;  1P84 D;  3L35 A;  1YTZ T;  1VF5 B;  3H1H D;  1SQP J;  3AE2 C;  1H89 A;  1L2P A;  1M1J A;  2KYV A;  4N3Y B;  1K04 A;  2FFD A;  1IO4 A;  2YKO A;  4AYC A;  1BGY D;  1SQP K;  4Z1M H;  3U59 A;  1MFZ A;  3P32 A;  1S5L E;  1VQ9 P;  3HE5 A;  1P84 I;  1VF5 D;  1G2C A;  4I2L C;  4JQ0 D;  5CMZ A;  3H1L D;  3HUS B;  1SQV G;  2OAR A;  3C8V A;  2JWD A;  3L73 D;  2M3B A;  1KIL E;  3KQG A;  2LKM A;  4LC1 A;  3AE3 C;  5AVY B;  4TLF A;  4W7Y A;  1VQN P;  1JOC A;  1IFM A;  3H1I G;  2BCC E;  1S72 P;  1N86 A;  1KB9 D;  5B5E E;  3BVH A;  2H7H A;  4H44 B;  1LT9 A;  2KXP B;  1NYH A;  1NJI Q;  2YXR B;  1LP1 B;  2W83 C;  1MZ9 A;  3KPE A;  3M06 A;  1AVY A;  1FZG A;  3CD6 P;  3TGU E;  2XKM A;  2WSC J;  1EZV G;  2IBZ G;  3V4Q A;  4C7N A;  1VQ5 P;  3L70 D;  3BCC D;  2YMK A;  4RKU J;  5CCG A;  1ZV8 A;  2WSS H;  3L74 E;  3KHU A;  4HJG H;  1IFN A;  2YO3 A;  5KAI H;  2ZT9 B;  1LT1 A;  3SFD C;  4DT0 A;  3A3Y B;  3HUS C;  2WTY A;  2WT7 B;  1L0L J;  5DJU B;  4PJ0 H;  3V2P A;  4XE5 B;  5GTH E;  2NPS A;  5AVX B;  4WBA A;  3L72 J;  2WVR A;  4JPZ B;  4JBZ A;  3RK3 E;  4EDF A;  4ZNC A;  1MFT A;  1X8Y A;  1SQB D;  1KB9 E;  2E75 C;  1S5L X;  3EFF K;  1J1E B;  3OW2 O;  3LID A;  2PRR A;  4I1L A;  1EDI A;  3HD7 B;  1XTG B;  2ZXE B;  4GDO A;  4WY4 A;  1VQP P;  3AE8 C;  1M1J C;  2ZVN B;  1CI6 A;  2A06 G;  2NRG A;  5APQ A;  3GHG A;  2DW3 A;  3F89 A;  3H1H J;  3Q5R A;  1H88 A;  1R5S A;  3F5H A;  2NPS D;  2O01 J;  3GF7 A;  2PAJ A;  5TJH A;  5CCH A;  3MD0 A;  3KDP B;  3R2P A;  1JUN A;  3L74 D;  2Y0E A;  3FWN A;  3VMY A;  5APS A;  4YXW H;  5KTB A;  3PRJ A;  2RKL A;  4U3F J;  1AQT A;  3E1R A;  3TYY A;  3P8C D;  3CX5 I;  3L70 E;  2YIU B;  1GU4 A;  5L8R J;  5BU8 B;  3A2A A;  2Q1K A;  1EQ7 A;  1SQB E;  1FOS F;  2B89 A;  3AE6 C;  3L72 G;  1T3U A;  1IFD A;  1PPJ E;  2K1A A;  4BXL A;  1RF1 C;  3G6E P;  3L73 J;  4IL6 E;  4IOI H;  1L0L G;  3TSI A;  2V7Q J;  3T97 B;  1OIP A;  1L0L D;  2ZJS E;  1JM0 A;  2WQY C;  3CWB E;  5B5E H;  3TNU B;  5KLV G;  2FYU E;  2WPQ A;  1IZN B;  3L72 D;  3D70 A;  2AXT H;  4KHX A;  5APY A;  4RO0 A;  3B8E B;  2VRS A;  3VN0 A;  3L73 E;  4YXD C;  1ZR2 A;  1PFI A;  5AW3 B;  2R5D A;  3KYQ A;  1W5C E;  3WU2 H;  1BE3 D;  1KYO E;  1HJ0 A;  3CWB D;  4WY4 D;  3S4R A;  4BRY B;  1VQK P;  5AW1 B;  2B9B A;  3WUV A;  1K73 Q;  1GD2 E;  3U1C A;  3W67 A;  1PPJ D;  3CX5 E;  1BGY E;  4IFF A;  5KKZ C;  3LW5 H;  1LT9 B;  2A06 D;  5TIS E;  3VYI A;  1U7M A;  1QX8 A;  2P2U A;  2H88 C;  3BRT B;  3VP9 A;  1OXZ A;  1FZA A;  3H1H E;  4DZO A;  1BCC D;  4H13 D;  1KB9 I;  1PL5 A;  1RQU A;  1YTZ I;  2QJK B;  2YKP A;  1NTK E;  2P1J A;  2QJP C;  2W6B A;  4B86 A;  1SS1 A;  2BEQ D;  1W2B O;  1NOH A;  4MN4 C;  1SQV J;  1VQO P;  1NTM E;  2P67 A;  2KSE A;  4H13 B;  1AVO A;  3U1A A;  1N73 C;  1VQ4 P;  1H0T B;  1OMI A;  3SWK A;  1BE3 G;  1VQ6 P;  1S3J A;  2W27 A;  1PIX A;  2IBZ E;  1JY2 P;  5CCG D;  2WT7 A;  4GKG A;  1AFO A;  5AVR B;  3AEF C;  3L37 A;  1NTZ G;  3O6Q A;  2A45 G;  1H0T A;  2JP3 A;  1GDT A;  2WPR A;  3PH0 A;  2N1T D;  1LWU C;  1TU3 F;  4GIF A;  3FX0 A;  5H2F E;  1NTK J;  2GA1 A;  1VQM P;  1FZC A;  1RE4 C;  1NU1 J;  2QSI A;  2E74 C;  3PP5 A;  5AW6 B;  1R8E A;  2OQQ A;  1SFC D;  1USD A;  2AEJ A;  3O8Z A;  3CCS P;  2UWJ E;  2G8Y A;  2HFE D;  3H1J J;  4H44 D;  4R4M A;  3CPW O;  3GHG B;  2Q7C A;  2ZFC A;  1Y8A A;  1NTZ D;  2FYU D;  1WMK A;  2E76 B;  3TDK A;  1Y47 A;  2XND H;  1RQV A;  2A06 E;  2BCC J;  2IBZ I;  3L75 E;  2PP6 A;  3HD7 C;  3MGN A;  1SQV D;  1G1I A;  2P10 A;  2Q9I A;  4WWI A;  1ZRT D;  2E76 D;  3NTN A;  5APV A;  1FDM A;  4DOJ A;  3CXH H;  1AQ5 A;  1HBW A;  1Z56 A;  1M8O B;  3M9B A;  2CK3 H;  3AE9 C;  3BRV B;  1NO4 A;  3L75 J;  1Q86 Q;  2YNY A;  1SQB G;  5AVQ B;  2K37 A;  1YQ4 C;  1KD1 Q;  4M3L A;  2QJK C;  2MJZ A;  3H6P A;  1PPJ G;  3EWK A;  3WUT A;  1GL2 D;  1JY2 O;  1OX3 A;  2O01 H;  3HE4 B;  2K9J B;  1PZQ A;  1WT6 A;  3FXD A;  3HRN A;  3E7K A;  3CWB G;  5KLV E;  2FYU G;  1N73 B;  1J2J B;  2HYN A;  1Y9B A;  1YI2 P;  1T2K D;  1JO5 A;  1GW3 A;  1KIL A;  1OVU A;  2FXM A;  1HUC A;  1JEK A;  2IYP A;  3H32 A;  3BCC G;  3RK3 D;  4DCK A;  2Z4E A;  1IFJ A;  2K88 A;  1YJ9 P;  3PLN A;  5KAI E;  1L4A C;  1KQS O;  1HGZ A;  1LWU B;  5KLV D;  4H0L B;  3G4S P;  1J1D C;  2Q3E A;  1AA0 A;  1FDO A;  1S5L H;  1YIJ P;  1LP1 A;  2JJL A;  1NKZ B;  2Y9Z A;  1HJB A;  2HPC B;  5BVZ A;  3RK2 B;  1VPC A;  2WSE J;  3H1K J;  2OTJ P;  1JMB A;  4C7N B;  3N7N A;  3M0A A;  3SWY A;  1BSH A;  1NWQ A;  4AQR D;  1YHQ P;  2L5G B;  3S9O A;  3AEA C;  4OGQ B;  3RBX A;  2J5U A;  1RF0 A;  3A0B E;  4IFM A;  3USS A;  1U57 A;  1NTM K;  2E74 D;  2QE7 H;  4XA4 A;  1N7S B;  2Z5H A;  1GL2 A;  2NZ2 A;  2ZAE B;  3QH9 A;  2J58 A;  4PD4 E;  4RES B;  2FYU K;  1EDL A;  2B88 A;  2KB7 P;  3IAO A;  1T8Z A;  4K35 A;  3GG2 A;  2FYU J;  1BCC G; 
#chains in the Genus database with same CATH homology
 1BGY G;  1L0N G;  3L75 G;  3L72 G;  3BCC G;  3H1H G;  3L70 G;  3L74 G;  1SQV G;  1L0L G;  5KLV G;  3H1L G;  1BE3 G;  1NTZ G;  1SQX G;  3CXH H;  3H1I G;  4U3F G;  4PD4 H;  3TGU G;  3CX5 H;  1SQB G;  1KB9 H;  2A06 G;  1PPJ G;  3L73 G;  4D6T G;  1P84 H;  3L71 G;  1SQP G;  1EZV G;  1NU1 G;  2IBZ G;  3CWB G;  1PP9 G;  1NTK G;  2FYU G;  3H1K G;  2BCC G;  3H1J G;  1SQQ G;  1KYO H;  1NTM G;  1BCC G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...