3H1JG

Stigmatellin-bound cytochrome bc1 complex from chicken
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
total genus 18
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3h1jG00
1NTKG 1P84H 1SQPG 1SQQG 1NTZG 1KYOH 4U3FG 1NU1G 1L0NG 1SQXG 1KB9H 4D6TG 3CXHH 3TGUG 3H1JG 4PD4H 1BGYG 3H1LG 3L71G 2A06G 3H1HG 1L0LG 1SQBG 2IBZG 3H1KG 3L70G 1EZVG 1BCCG 3CX5H 3L72G 1NTMG 3L74G 5KLVG 3L73G 2FYUG 1BE3G 2BCCG 3BCCG 3L75G 3CWBG 1PPJG 1SQVG 1PP9G 3H1IG
chains in the Genus database with same CATH superfamily
1LTSC 2Q7CA 4YTPC 1LTJC 3TDKA 2A06G 2HFED 2YXQB 1RH5B 2KS1B 2WITA 1AJYA 4EIJA 4KT0J 2YMKA 3AE2C 2FYNB 1LP1B 1BGYD 1A02F 1EDKA 1Q81Q 2OYHC 2KZIA 3L70J 3LIEA 5KKZC 4EOTA 1NO4A 1VQ6P 1S1CX 1W5CE 3HD7A 1GU5A 2WPVB 1JMMA 4PJ0H 5AVSB 2KIKA 2K9JB 1HGZA 2XZRA 2IZ1A 1GD2E 1ZR4A 1S72P 5B5EH 2NPSA 4ASVA 4LGDE 2OYHB 1BSHA 3L70G 1ZV8A 3MIWA 1QX8A 4TLFA 2QG4A 2YO3A 5KAIH 2GA1A 3M06A 2Y0DA 1K8AQ 3L70E 1ZR2A 2ZYGA 1KB9H 3HE5B 1AVYA 1KFMA 3VP9A 1GU4A 2KNCA 5AW4B 3MTUE 2W6BA 2XDJA 3AE6C 3TNUB 2E42A 2OTJP 3AEEC 1LTTC 1OFCX 1IJDB 2R44A 1KTMA 1BCCJ 4UB8E 3PTZA 5TISE 3T97A 1OW7A 1M1JA 3D6ZA 1IFDA 2JP3A 2V7QJ 1FZCA 4NPDA 2N9YB 4JBZA 2N1TC 3R2PA 2GM4A 3M9BA 5KTBA 3B5NC 3O8ZA 3WU2E 1L0LD 2GUVA 1LTGC 3CCRP 3B4SA 5CCHC 1BCCG 3L75D 3CWBD 4GOFA 2QM7A 4N78D 1EDLA 3VYIA 3TF5A 3H32A 1AV1A 3GW6A 3GF3A 1VF5B 2PGDA 4IL6X 1BCCE 2QRXA 5KJ7A 1XTCC 4W7ZA 2KSEA 2N1TB 2Q3EA 2RKLA 1VF5D 2FYUK 3B5NB 3FWLA 1J1DB 2OGUA 1L0ND 1ZP0C 2N1TD 4TT3H 1MFZA 1WRGA 2ZJSE 1KQFB 2I1JA 4GDOA 1VQLP 3HE4B 1GDTA 3GF7A 3B5ND 2WT7B 1RF1A 5CCHD 4DJGA 4C46A 4JYBA 3MUDC 1L4AC 1E79H 1KYOH 2DW3A 4GIFA 3M9HA 1NAYA 2JJLA 3KZIE 1G1IA 1EQ7A 1ZOYC 3BRVB 4BWNA 5AVUB 4GT1A 3AECC 4OGQB 1S9KD 1S5LX 3L37A 1DD4A 1OW8A 2OYIC 1PGPA 3H1LD 3I56P 4HB1A 4YPCA 3CLQA 1NTZJ 1QVFO 1SVFA 1L4AB 1SP4A 3V2PA 1N73A 4OGQD 3EFGA 3A0HE 2OARA 4JF7A 1PP9G 3RGUA 1NGMB 1L4AD 4XA4A 3AEFC 2N9BA 2YNYA 1LT9A 2IBZI 3PHLA 4RKUJ 4IFDK 2NRGA 3OJAB 1RQVA 1BGYJ 3L74G 2FYUG 1JEKA 2OYIB 2WQYC 5KAFH 5CMZA 1AQ5A 3TYYA 4GOEA 4PD4E 2HG5D 2IYOA 2W8ZA 3NXSA 2FYUE 5AW5B 5CCGD 2WSSH 1KQLA 4XE5B 4H0LB 1RF0A 5BVZA 3AEDC 1BDDA 2BCCD 2R5BA 3CCEP 3M0DC 4HH2A 1EXIA 1CI6B 3P32A 1EZVI 4NPFX 2SPZA 4H0LD 1SQVK 2WSEH 3CI9A 5E79E 1ZRTD 5GTHH 1LJ2A 2JR8A 3CXHH 3H1HD 5AVZB 1JY2O 1UIXA 5AW3B 5B66E 4A7PA 2J5UA 2AEJA 1GL2A 4DCKA 4ZKUA 3CX5E 5AVWB 1S2EA 1BGYE 4L76A 3HUSA 1CSBA 1AQTA 2P67A 1NHLA 1Q82Q 3BATA 1DIPA 3OAKA 3ABVC 1QL2A 1OW6A 5KLVK 1PZQA 1SFCC 3M9QA 2GUSA 2P7JA 1KORA 2E74C 1RHZB 1M90Q 1LT1A 1LTBC 1SQVJ 3IAOA 3JSVC 1OWAA 3TGUG 3IR9A 3AE8C 3C8VA 3L72D 2AEMA 1H0TB 3TSIA 1KD1Q 1KILB 4ASWA 1OVUA 3P8MC 1Q7YQ 1Y47A 1UIIA 4ZKPA 1PGJA 3LW5H 1L0NK 3G3ZA 1R8EA 1KILD 1EZVD 1NTMD 1X9VA 2M3EA 1FOSF 2E74B 4AQRD 2FBWC 2L91A 1SQVG 1IFPA 3LIDA 1SQXD 3C1LA 3CWBJ 4D6TD 2G3AA 1T3JA 1G2CB 4RESB 2E74D 4IL6E 3H1JG 5GTIE 3CCSP 1EDJA 4W7YA 1SQVE 2OTKE 1AFOA 1BE3D 2Y9ZA 3BCCG 4OH8B 3H1JE 4EDFA 1HTLC 3F5HA 5APTA 2ZAEB 3VMXA 2C9NY 1FBMA 1HJ0A 2G8YA 2B88A 1K73Q 2ZVOB 3BCCE 1L0NJ 5AW2B 1RE4A 1IZNB 5KLVG 2NPSC 3O6QB 2QJPC 2QJKC 2RMZA 1R5LA 2UWJE 2XNXA 4AYCA 3P7KA 5BU5A 1KB9D 2OTLP 2IYPA 2O1JA 3CWBE 1VQ5P 2YIUC 3RL0C 4N78E 1IK9A 5AW1B 3GMAA 1VPCA 1NTKD 3RK3E 2M3BA 1FDMA 3P8CE 4UB8H 5TISH 2YKOA 5CJ0A 2RN0A 1S5LE 2QJPB 2QJKB 3RK2C 1G1JA 2W27A 3GHGA 4OVNF 3VOPA 1M1JC 3H1LJ 1L0NE 5AVVB 3CD6P 4C7NB 4EI2A 3RL0B 1FZCC 2HPCB 1OVVA 3Q2YA 2D2CB 2R5DA 2HODA 3WU2H 1KN7A 2AEFA 1URQC 2Q9IA 1PV3A 3RL0D 1FAVA 3Q5SA 1N7SA 1X79B 2D2CD 1VDFA 3H1IG 4JQ0D 4K3AA 1J2JB 1IK7A 3RK2B 1JY2N 3RBXA 1GMJA 3AE4C 3H1KD 3H1LG 3USSA 2Y0EA 2H89C 3H1IE 2FXMA 4H13C 2M8RA 5DJTB 3RK2D 4JPZB 3W67A 5KJ7C 1S9KE 1SQPD 2H88C 4HKZH 3H1LE 3V4WA 1LTJB 3KQGA 2V7QH 2QA4P 1URQB 4UB6E 1SQBD 5CHXA 1NYHA 4HYTB 1NJIQ 2WSCJ 3BASA 2LR2A 2O01J 3C9IA 3H1HJ 1URQD 1YTZI 4WB4A 3FXEA 1EDIA 2B87A 1KYOD 4H13B 4YXDC 1JTHB 4WY4C 1MUUA 2YXRB 4WVZA 2M0BA 2KP8A 5KKZB 1YJ9P 3AE7C 4H13D 3IFMA 2B9BA 1L2PA 3CXHI 2JWAA 3A0BE 1RY3A 3GG2A 2R3CA 1A02J 1QL1A 1NH4A 5H2FE 3NFQA 1Y8AA 3D6YA 1JB0J 3L72J 3A0HH 2O1KA 1NU1D 4WY4B 3H1HE 3CL3D 3V4QA 1N73C 3AEGC 2E75C 2E5TA 2Z5HA 1S3JA 3MHVA 2M5AB 4WY4D 1VQ7P 2KS1A 2QJYC 1LT9C 1YIJP 4PV1C 3RK3C 1M8OB 1NTMJ 2IBZG 5L8RJ 3II6A 3L73J 3A5TA 2Q5UA 3BVHA 4WBAA 3FX0A 3NMDA 1M56D 4PD4H 2Y0CA 2QM8A 1SQXJ 2A45I 1FZFA 2IBZE 4D6TJ 2WPRA 1Q90D 2J59M 2YKQA 1ZXGA 2O3JA 1FZAA 3VN0A 3U59A 1RF0C 2XKMA 4U3FD 4K35A 2E75B 2LXCB 3CC4P 4M3LA 2QJYB 3CXHD 5E79H 1YTZT 4PV1B 1H88A 1VL2A 2WSFH 3A2AA 1PFIA 2WPSA 1PPJD 3L73G 2K9JA 3V2RA 1FDOA 5B66H 3CX5H 1SQQD 3I5CA 3SWYA 2XNDH 4PV1D 1FZEA 1EZVE 1VQMP 1NTME 4D6TG 1NTZK 3WUTA 3L73E 1HWTC 2OYHA 1NWQA 1T2KC 3JCUH 4L75A 3CMEP 4AUWA 3A3YB 1LWUC 4D6TE 5C39A 1J1EC 1OX3A 2ZYDA 1HF9A 3S9OA 3HE5A 2AXTE 1KV4A 2YMYA 3KPEA 3L71D 3TNUA 2WPQA 3RBZA 2KI7B 3AEAC 5AW6B 4Y99C 2KZJA 5BU8B 4O9BA 3QH9A 5B5EE 2BASA 1P84H 3G9RA 2A06D 1LWUB 2WVRA 1FZGA 5EFWB 3MP7B 1CW5A 4BRYB 1OZHA 3HRNA 2R3SA 2W6AA 3OA7A 1QVGO 1WMKA 2FFDC 1DEBA 3UIAA 4U7JA 5GTIH 2WTYA 3CPWO 2LXBA 5AW7B 1U7MA 2IX7C 3SWKA 1Z56A 2JO1A 1NTZG 4ZNCA 4GKGA 4B86A 5APSA 1FDIA 1OMIA 2PP6A 2N1TA 3D71A 1SQPJ 2AXCA 3N4XA 3CCMP 1GW4A 3N7NA 1MKMA 1NTZE 3B5NA 1WT6A 1K9MQ 2FFDB 1NKNA 1JO5A 1FZBA 2J58A 3U1CA 5CCHA 3HE4A 1IFNA 3H6PA 4JYCA 1BGYG 1Y9BA 3L70D 2WT7A 4IFFA 1JY3P 1OIPA 3WUUA 2V4HA 2KSJA 2VRSA 5TJHA 1BSNA 1X22A 1JNMA 4N3YB 3M91A 5AW9B 1IFIA 3HTKB 4IOIH 1L0LK 1YYCA 2YO2A 3V6IA 2MJZA 1YBKA 2KB7P 2K88A 1L4AA 1NU1J 4I2LC 2B89A 5CJ4A 1KB9I 2LKMA 1MFTA 1K05A 5KLIC 1N7SC 4Y28J 1BCCD 3V2QA 5CCGA 1SFCB 2PAJA 1DX7A 1Q86Q 2OYIA 4YXWH 1LTIC 1L0LJ 1SLQA 5CBOA 3SWFA 3L75J 2C0WA 1SFCD 1FE6A 1T6AA 2JWDA 1MV8A 4Z1MH 4U3FJ 4UB6H 1KZUB 2IFMA 2WSEJ 4ZMDA 1NKZB 4BXLA 5APXA 3S1KA 5K5GB 1NU1E 1CI6A 2NZ2A 1N2DC 4L74A 2IPPA 2OQQA 3HD7C 3SFEC 3SFDC 1SQQJ 3VP8A 1HH0A 3Q1MA 2CPSA 1L0LG 4DZOA 3IN6A 2FXPA 3CCUP 3L75G 3CWBG 3MGNA 1Q2NA 2KLUA 1L0LE 3M0DA 3WUVA 3A0BH 3L75E 1NVOA 4QMAA 1X0TA 3B71A 5APVA 1KFNA 4LLHA 4U3FE 3HD7B 1RQUA 3L71J 5H2FH 1HJBA 1T8ZA 1H89A 2QSIA 3CXHE 1R5SA 2WSCH 2O01H 1EC5A 1L0NG 3HD7D 4WWIA 2NPSB 1H0TA 4I1LA 1TU3F 4MN4C 1KILA 3VMZA 1VQ8P 3LW5J 1KMIZ 4H44C 1PP9D 1KYOI 3PJSK 2C0XA 2KYVA 2NPSD 2YIUB 1OXZA 2BEQD 2Y9YA 2W6JH 4PD4D 3L71G 3L74D 2FYUD 2I8DA 2KNCB 3EWKA 1ZW0A 3E7KA 3KYQA 1HVVA 1E5WA 1ZN5A 2IFNA 1JCDA 4KHXA 2Q3IA 1FOSE 1G2CA 2A45G 3L71E 1YITP 1PGQA 3T97B 3E1IA 2XV5A 1M1JB 4H44B 3OW2O 1GTWA 4LC1A 1DEEG 2E76C 1FZCB 3CX5D 3MD0A 4H44D 3G71P 2QIWA 2A06E 2BCCJ 2FKWB 1QLED 1T3UA 3L4FA 1U57A 3CMAP 1GK6A 2Z4EA 3O6QA 3NTNA 1FC2C 2W83C 5APWA 2HLOA 1YHQP 1GZLA 3B8EB 3H32B 1RF1C 2E76B 1JMBA 2AXTH 2JKVA 3FWNA 2XU6A 4I7ZC 3CC7P 1YJWP 3KZIH 2BCCG 1NTMK 1ZMEC 2E76D 2KXPB 3A7OA 5KJ7D 3QWOC 1P84D 3TGUD 1SQXK 3VTPC 2BCCE 2FXOA 3M0AA 3MZWB 3H1HG 1W2EA 1X8YA 4C7NA 1RF1B 1ZRTE 1JM0A 1U7JA 2HPCA 1OVRA 2ZFCA 1USEA 4I7ZB 2Z5IA 1YJNP 2ZYAA 1M7LA 2H8PD 1MZ9A 1FS0E 2E43A 1SQVD 2HYNA 1LP1A 1RE3A 3H1JD 3PRJA 4RJTA 4EYYQ 1VF5C 1S4XA 3BCCD 3L72G 2H43A 2C9LY 1YQ3C 1N73B 1K04A 1LTJA 5AVXB 2W90A 1BE3J 1URQA 3TK1A 2OYOA 1NTKK 1J1DC 2QE7H 3BRTB 3L72E 1LGHB 5AW0B 1LT9B 3D70A 5KLVD 3FXDA 2JEEA 3RK3B 1EZVG 1GK4A 1NTMG 2E75D 5APQA 1PL5A 4OWFA 1D7MA 3PP5A 2ZT9C 1KILE 3RK3D 3L36A 5APYA 1SQXG 1JY3O 1GL2C 1JTHA 1VQ9P 3CCLP 3P8CD 3H25A 3HUSC 1KQGB 1DH3A 3F89A 1N86A 1BE3G 3AE1C 1SQXE 2R32A 2K9YA 3ZDMA 1ZLLA 5DJUB 2KK7A 4R4LA 4DT0A 3AE9C 1VQOP 2BEZF 1W2BO 2CPBA 2H7HA 1QGKB 1BE3E 2P58A 1NTKJ 1FJPA 1JUNA 4HJGH 4OGQC 3G4SP 1EXJA 1XTGB 4PJ0E 2ZT9B 4N6JA 1GL2B 4WY4A 2L5GB 2ZVNB 2POHA 2K1AA 1HUCA 3HUSB 1VQPP 1PP9J 3JC22 2ZT9D 1SQPK 2K37A 2KUBA 1IC2A 2M5AA 1GL2D 1J1EB 2P1JA 1SQBK 5KAIE 3E1RA 1T2KD 3H1ID 3AEBC 3ITKA 1VQKP 3KDPB 3L74J 2FYUJ 1KB9E 5CCGC 1NTKG 2WWWA 4Y99B 1PGOA 3G6EP 4IL6H 2K3RA 3SSUA 1DD3A 2P2UA 1NTKE 2FY8A 4H0LC 4NPEA 2MKVA 3H1KJ 3PH0A 4R4MA 2WSFJ 1AA0A 1NOHA 5CBNA 2JDIH 1PP9E 2ZXXA 2KLVA 3RL0g 1JCCA 2I1KA 1SQBJ 1M1KQ 1RE4C 3L74E 1NU1K 2WZ7A 1H8AA 2PRRA 3H1KG 4C7RA 3FGAD 1IFJA 3U1AA 1GW3A 1IFMA 3EFFK 3CCQP 1SQPG 3H1KE 3CC2P 3Q3DA 1S5LH 1SQBG 3V2NA 3TGUJ 3R4YA 5AVQB 5APUA 1JOCA 1SQPE 1QEXA 3PLNA 1KILC 3KHUA 3S4RA 3GHGC 1SQBE 2Q1KA 3JCUE 1LWUA 1CZQA 5AW8B 3MUDA 4RO0A 1IO4A 5AVRB 2IDBA 4BRYA 2IBZD 1N8RQ 4CPGA 1KYOE 2RH0A 4GODA 2WMMA 2IZ0A 1SQQK 1FJKA 3AE3C 1YI2P 1VQNP 1FU1A 3H1JJ 3KXDA 5M1BA 3GHGB 1P84E 3TGUE 2A45H 1JY3N 2O01N 3BCCJ 2FYZA 3EQ2A 4KJMA 1NU1G 1PIXA 1AVOA 4W80A 3L73D 4L73A 2HODB 3WMM0 2FFDA 3Q5RA 5KLIB 5KLVJ 4PD4I 1N7SB 3V5BA 1N7LA 1N7SD 2Q6QA 5AVTB 2QEXP 4DOJA 5KAFE 3I55P 3K5BA 1HGVA 1KC8Q 1HBWA 4U3FG 3HTKA 3CCVP 3CX5I 1YQ4C 1KQSO 2YKPA 4I6MC 1JY2P 1PPJG 1M57D 2ITAA 5GTHE 1SS1A 1USDA 3IF4A 2P10A 1SQQG 5AVYB 3VMAA 2KOGA 5KLVE 3CCJP 2B87B 3AE5C 4XFJA 1PPJE 3Q5PA 3L35A 2D2CC 1SQQE 2CK3H 2ZXEB 1LNQA 3H1IJ 1LTAC 1BDCA 4IFMA 2FYNC 1SFCA 1RE3C 3VMYA 1VQ4P 3W68A 1P84I 2HR3A 1NAFA 2PFXA 2E5YA 3GLMA 2QVAA 1NTZD
chains in the Genus database with same CATH topology
1NTKG 1P84H 1SQPG 1SQQG 1NTZG 1KYOH 4U3FG 1NU1G 1L0NG 1SQXG 1KB9H 4D6TG 3CXHH 3TGUG 3H1JG 4PD4H 1BGYG 3H1LG 3L71G 2A06G 3H1HG 1L0LG 1SQBG 2IBZG 3H1KG 3L70G 1EZVG 1BCCG 3CX5H 3L72G 1NTMG 3L74G 5KLVG 3L73G 2FYUG 1BE3G 2BCCG 3BCCG 3L75G 3CWBG 1PPJG 1SQVG 1PP9G 3H1IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTK G;  1P84 H;  1SQP G;  1SQQ G;  1NTZ G;  1KYO H;  4U3F G;  1NU1 G;  1L0N G;  1SQX G;  1KB9 H;  4D6T G;  3CXH H;  3TGU G;  3H1J G;  4PD4 H;  1BGY G;  3H1L G;  3L71 G;  2A06 G;  3H1H G;  1L0L G;  1SQB G;  2IBZ G;  3H1K G;  3L70 G;  1EZV G;  1BCC G;  3CX5 H;  3L72 G;  1NTM G;  3L74 G;  5KLV G;  3L73 G;  2FYU G;  1BE3 G;  2BCC G;  3BCC G;  3L75 G;  3CWB G;  1PPJ G;  1SQV G;  1PP9 G;  3H1I G; 
#chains in the Genus database with same CATH topology
 1LTS C;  2Q7C A;  4YTP C;  1LTJ C;  3TDK A;  2A06 G;  2HFE D;  2YXQ B;  1RH5 B;  2KS1 B;  2WIT A;  1AJY A;  4EIJ A;  4KT0 J;  2YMK A;  3AE2 C;  2FYN B;  1LP1 B;  1BGY D;  1A02 F;  1EDK A;  1Q81 Q;  2OYH C;  2KZI A;  3L70 J;  3LIE A;  5KKZ C;  4EOT A;  1NO4 A;  1VQ6 P;  1S1C X;  1W5C E;  3HD7 A;  1GU5 A;  2WPV B;  1JMM A;  4PJ0 H;  5AVS B;  2KIK A;  2K9J B;  1HGZ A;  2XZR A;  2IZ1 A;  1GD2 E;  1ZR4 A;  1S72 P;  5B5E H;  2NPS A;  4ASV A;  4LGD E;  2OYH B;  1BSH A;  3L70 G;  1ZV8 A;  3MIW A;  1QX8 A;  4TLF A;  2QG4 A;  2YO3 A;  5KAI H;  2GA1 A;  3M06 A;  2Y0D A;  1K8A Q;  3L70 E;  1ZR2 A;  2ZYG A;  1KB9 H;  3HE5 B;  1AVY A;  1KFM A;  3VP9 A;  1GU4 A;  2KNC A;  5AW4 B;  3MTU E;  2W6B A;  2XDJ A;  3AE6 C;  3TNU B;  2E42 A;  2OTJ P;  3AEE C;  1LTT C;  1OFC X;  1IJD B;  2R44 A;  1KTM A;  1BCC J;  4UB8 E;  3PTZ A;  5TIS E;  3T97 A;  1OW7 A;  1M1J A;  3D6Z A;  1IFD A;  2JP3 A;  2V7Q J;  1FZC A;  4NPD A;  2N9Y B;  4JBZ A;  2N1T C;  3R2P A;  2GM4 A;  3M9B A;  5KTB A;  3B5N C;  3O8Z A;  3WU2 E;  1L0L D;  2GUV A;  1LTG C;  3CCR P;  3B4S A;  5CCH C;  1BCC G;  3L75 D;  3CWB D;  4GOF A;  2QM7 A;  4N78 D;  1EDL A;  3VYI A;  3TF5 A;  3H32 A;  1AV1 A;  3GW6 A;  3GF3 A;  1VF5 B;  2PGD A;  4IL6 X;  1BCC E;  2QRX A;  5KJ7 A;  1XTC C;  4W7Z A;  2KSE A;  2N1T B;  2Q3E A;  2RKL A;  1VF5 D;  2FYU K;  3B5N B;  3FWL A;  1J1D B;  2OGU A;  1L0N D;  1ZP0 C;  2N1T D;  4TT3 H;  1MFZ A;  1WRG A;  2ZJS E;  1KQF B;  2I1J A;  4GDO A;  1VQL P;  3HE4 B;  1GDT A;  3GF7 A;  3B5N D;  2WT7 B;  1RF1 A;  5CCH D;  4DJG A;  4C46 A;  4JYB A;  3MUD C;  1L4A C;  1E79 H;  1KYO H;  2DW3 A;  4GIF A;  3M9H A;  1NAY A;  2JJL A;  3KZI E;  1G1I A;  1EQ7 A;  1ZOY C;  3BRV B;  4BWN A;  5AVU B;  4GT1 A;  3AEC C;  4OGQ B;  1S9K D;  1S5L X;  3L37 A;  1DD4 A;  1OW8 A;  2OYI C;  1PGP A;  3H1L D;  3I56 P;  4HB1 A;  4YPC A;  3CLQ A;  1NTZ J;  1QVF O;  1SVF A;  1L4A B;  1SP4 A;  3V2P A;  1N73 A;  4OGQ D;  3EFG A;  3A0H E;  2OAR A;  4JF7 A;  1PP9 G;  3RGU A;  1NGM B;  1L4A D;  4XA4 A;  3AEF C;  2N9B A;  2YNY A;  1LT9 A;  2IBZ I;  3PHL A;  4RKU J;  4IFD K;  2NRG A;  3OJA B;  1RQV A;  1BGY J;  3L74 G;  2FYU G;  1JEK A;  2OYI B;  2WQY C;  5KAF H;  5CMZ A;  1AQ5 A;  3TYY A;  4GOE A;  4PD4 E;  2HG5 D;  2IYO A;  2W8Z A;  3NXS A;  2FYU E;  5AW5 B;  5CCG D;  2WSS H;  1KQL A;  4XE5 B;  4H0L B;  1RF0 A;  5BVZ A;  3AED C;  1BDD A;  2BCC D;  2R5B A;  3CCE P;  3M0D C;  4HH2 A;  1EXI A;  1CI6 B;  3P32 A;  1EZV I;  4NPF X;  2SPZ A;  4H0L D;  1SQV K;  2WSE H;  3CI9 A;  5E79 E;  1ZRT D;  5GTH H;  1LJ2 A;  2JR8 A;  3CXH H;  3H1H D;  5AVZ B;  1JY2 O;  1UIX A;  5AW3 B;  5B66 E;  4A7P A;  2J5U A;  2AEJ A;  1GL2 A;  4DCK A;  4ZKU A;  3CX5 E;  5AVW B;  1S2E A;  1BGY E;  4L76 A;  3HUS A;  1CSB A;  1AQT A;  2P67 A;  1NHL A;  1Q82 Q;  3BAT A;  1DIP A;  3OAK A;  3ABV C;  1QL2 A;  1OW6 A;  5KLV K;  1PZQ A;  1SFC C;  3M9Q A;  2GUS A;  2P7J A;  1KOR A;  2E74 C;  1RHZ B;  1M90 Q;  1LT1 A;  1LTB C;  1SQV J;  3IAO A;  3JSV C;  1OWA A;  3TGU G;  3IR9 A;  3AE8 C;  3C8V A;  3L72 D;  2AEM A;  1H0T B;  3TSI A;  1KD1 Q;  1KIL B;  4ASW A;  1OVU A;  3P8M C;  1Q7Y Q;  1Y47 A;  1UII A;  4ZKP A;  1PGJ A;  3LW5 H;  1L0N K;  3G3Z A;  1R8E A;  1KIL D;  1EZV D;  1NTM D;  1X9V A;  2M3E A;  1FOS F;  2E74 B;  4AQR D;  2FBW C;  2L91 A;  1SQV G;  1IFP A;  3LID A;  1SQX D;  3C1L A;  3CWB J;  4D6T D;  2G3A A;  1T3J A;  1G2C B;  4RES B;  2E74 D;  4IL6 E;  3H1J G;  5GTI E;  3CCS P;  1EDJ A;  4W7Y A;  1SQV E;  2OTK E;  1AFO A;  1BE3 D;  2Y9Z A;  3BCC G;  4OH8 B;  3H1J E;  4EDF A;  1HTL C;  3F5H A;  5APT A;  2ZAE B;  3VMX A;  2C9N Y;  1FBM A;  1HJ0 A;  2G8Y A;  2B88 A;  1K73 Q;  2ZVO B;  3BCC E;  1L0N J;  5AW2 B;  1RE4 A;  1IZN B;  5KLV G;  2NPS C;  3O6Q B;  2QJP C;  2QJK C;  2RMZ A;  1R5L A;  2UWJ E;  2XNX A;  4AYC A;  3P7K A;  5BU5 A;  1KB9 D;  2OTL P;  2IYP A;  2O1J A;  3CWB E;  1VQ5 P;  2YIU C;  3RL0 C;  4N78 E;  1IK9 A;  5AW1 B;  3GMA A;  1VPC A;  1NTK D;  3RK3 E;  2M3B A;  1FDM A;  3P8C E;  4UB8 H;  5TIS H;  2YKO A;  5CJ0 A;  2RN0 A;  1S5L E;  2QJP B;  2QJK B;  3RK2 C;  1G1J A;  2W27 A;  3GHG A;  4OVN F;  3VOP A;  1M1J C;  3H1L J;  1L0N E;  5AVV B;  3CD6 P;  4C7N B;  4EI2 A;  3RL0 B;  1FZC C;  2HPC B;  1OVV A;  3Q2Y A;  2D2C B;  2R5D A;  2HOD A;  3WU2 H;  1KN7 A;  2AEF A;  1URQ C;  2Q9I A;  1PV3 A;  3RL0 D;  1FAV A;  3Q5S A;  1N7S A;  1X79 B;  2D2C D;  1VDF A;  3H1I G;  4JQ0 D;  4K3A A;  1J2J B;  1IK7 A;  3RK2 B;  1JY2 N;  3RBX A;  1GMJ A;  3AE4 C;  3H1K D;  3H1L G;  3USS A;  2Y0E A;  2H89 C;  3H1I E;  2FXM A;  4H13 C;  2M8R A;  5DJT B;  3RK2 D;  4JPZ B;  3W67 A;  5KJ7 C;  1S9K E;  1SQP D;  2H88 C;  4HKZ H;  3H1L E;  3V4W A;  1LTJ B;  3KQG A;  2V7Q H;  2QA4 P;  1URQ B;  4UB6 E;  1SQB D;  5CHX A;  1NYH A;  4HYT B;  1NJI Q;  2WSC J;  3BAS A;  2LR2 A;  2O01 J;  3C9I A;  3H1H J;  1URQ D;  1YTZ I;  4WB4 A;  3FXE A;  1EDI A;  2B87 A;  1KYO D;  4H13 B;  4YXD C;  1JTH B;  4WY4 C;  1MUU A;  2YXR B;  4WVZ A;  2M0B A;  2KP8 A;  5KKZ B;  1YJ9 P;  3AE7 C;  4H13 D;  3IFM A;  2B9B A;  1L2P A;  3CXH I;  2JWA A;  3A0B E;  1RY3 A;  3GG2 A;  2R3C A;  1A02 J;  1QL1 A;  1NH4 A;  5H2F E;  3NFQ A;  1Y8A A;  3D6Y A;  1JB0 J;  3L72 J;  3A0H H;  2O1K A;  1NU1 D;  4WY4 B;  3H1H E;  3CL3 D;  3V4Q A;  1N73 C;  3AEG C;  2E75 C;  2E5T A;  2Z5H A;  1S3J A;  3MHV A;  2M5A B;  4WY4 D;  1VQ7 P;  2KS1 A;  2QJY C;  1LT9 C;  1YIJ P;  4PV1 C;  3RK3 C;  1M8O B;  1NTM J;  2IBZ G;  5L8R J;  3II6 A;  3L73 J;  3A5T A;  2Q5U A;  3BVH A;  4WBA A;  3FX0 A;  3NMD A;  1M56 D;  4PD4 H;  2Y0C A;  2QM8 A;  1SQX J;  2A45 I;  1FZF A;  2IBZ E;  4D6T J;  2WPR A;  1Q90 D;  2J59 M;  2YKQ A;  1ZXG A;  2O3J A;  1FZA A;  3VN0 A;  3U59 A;  1RF0 C;  2XKM A;  4U3F D;  4K35 A;  2E75 B;  2LXC B;  3CC4 P;  4M3L A;  2QJY B;  3CXH D;  5E79 H;  1YTZ T;  4PV1 B;  1H88 A;  1VL2 A;  2WSF H;  3A2A A;  1PFI A;  2WPS A;  1PPJ D;  3L73 G;  2K9J A;  3V2R A;  1FDO A;  5B66 H;  3CX5 H;  1SQQ D;  3I5C A;  3SWY A;  2XND H;  4PV1 D;  1FZE A;  1EZV E;  1VQM P;  1NTM E;  4D6T G;  1NTZ K;  3WUT A;  3L73 E;  1HWT C;  2OYH A;  1NWQ A;  1T2K C;  3JCU H;  4L75 A;  3CME P;  4AUW A;  3A3Y B;  1LWU C;  4D6T E;  5C39 A;  1J1E C;  1OX3 A;  2ZYD A;  1HF9 A;  3S9O A;  3HE5 A;  2AXT E;  1KV4 A;  2YMY A;  3KPE A;  3L71 D;  3TNU A;  2WPQ A;  3RBZ A;  2KI7 B;  3AEA C;  5AW6 B;  4Y99 C;  2KZJ A;  5BU8 B;  4O9B A;  3QH9 A;  5B5E E;  2BAS A;  1P84 H;  3G9R A;  2A06 D;  1LWU B;  2WVR A;  1FZG A;  5EFW B;  3MP7 B;  1CW5 A;  4BRY B;  1OZH A;  3HRN A;  2R3S A;  2W6A A;  3OA7 A;  1QVG O;  1WMK A;  2FFD C;  1DEB A;  3UIA A;  4U7J A;  5GTI H;  2WTY A;  3CPW O;  2LXB A;  5AW7 B;  1U7M A;  2IX7 C;  3SWK A;  1Z56 A;  2JO1 A;  1NTZ G;  4ZNC A;  4GKG A;  4B86 A;  5APS A;  1FDI A;  1OMI A;  2PP6 A;  2N1T A;  3D71 A;  1SQP J;  2AXC A;  3N4X A;  3CCM P;  1GW4 A;  3N7N A;  1MKM A;  1NTZ E;  3B5N A;  1WT6 A;  1K9M Q;  2FFD B;  1NKN A;  1JO5 A;  1FZB A;  2J58 A;  3U1C A;  5CCH A;  3HE4 A;  1IFN A;  3H6P A;  4JYC A;  1BGY G;  1Y9B A;  3L70 D;  2WT7 A;  4IFF A;  1JY3 P;  1OIP A;  3WUU A;  2V4H A;  2KSJ A;  2VRS A;  5TJH A;  1BSN A;  1X22 A;  1JNM A;  4N3Y B;  3M91 A;  5AW9 B;  1IFI A;  3HTK B;  4IOI H;  1L0L K;  1YYC A;  2YO2 A;  3V6I A;  2MJZ A;  1YBK A;  2KB7 P;  2K88 A;  1L4A A;  1NU1 J;  4I2L C;  2B89 A;  5CJ4 A;  1KB9 I;  2LKM A;  1MFT A;  1K05 A;  5KLI C;  1N7S C;  4Y28 J;  1BCC D;  3V2Q A;  5CCG A;  1SFC B;  2PAJ A;  1DX7 A;  1Q86 Q;  2OYI A;  4YXW H;  1LTI C;  1L0L J;  1SLQ A;  5CBO A;  3SWF A;  3L75 J;  2C0W A;  1SFC D;  1FE6 A;  1T6A A;  2JWD A;  1MV8 A;  4Z1M H;  4U3F J;  4UB6 H;  1KZU B;  2IFM A;  2WSE J;  4ZMD A;  1NKZ B;  4BXL A;  5APX A;  3S1K A;  5K5G B;  1NU1 E;  1CI6 A;  2NZ2 A;  1N2D C;  4L74 A;  2IPP A;  2OQQ A;  3HD7 C;  3SFE C;  3SFD C;  1SQQ J;  3VP8 A;  1HH0 A;  3Q1M A;  2CPS A;  1L0L G;  4DZO A;  3IN6 A;  2FXP A;  3CCU P;  3L75 G;  3CWB G;  3MGN A;  1Q2N A;  2KLU A;  1L0L E;  3M0D A;  3WUV A;  3A0B H;  3L75 E;  1NVO A;  4QMA A;  1X0T A;  3B71 A;  5APV A;  1KFN A;  4LLH A;  4U3F E;  3HD7 B;  1RQU A;  3L71 J;  5H2F H;  1HJB A;  1T8Z A;  1H89 A;  2QSI A;  3CXH E;  1R5S A;  2WSC H;  2O01 H;  1EC5 A;  1L0N G;  3HD7 D;  4WWI A;  2NPS B;  1H0T A;  4I1L A;  1TU3 F;  4MN4 C;  1KIL A;  3VMZ A;  1VQ8 P;  3LW5 J;  1KMI Z;  4H44 C;  1PP9 D;  1KYO I;  3PJS K;  2C0X A;  2KYV A;  2NPS D;  2YIU B;  1OXZ A;  2BEQ D;  2Y9Y A;  2W6J H;  4PD4 D;  3L71 G;  3L74 D;  2FYU D;  2I8D A;  2KNC B;  3EWK A;  1ZW0 A;  3E7K A;  3KYQ A;  1HVV A;  1E5W A;  1ZN5 A;  2IFN A;  1JCD A;  4KHX A;  2Q3I A;  1FOS E;  1G2C A;  2A45 G;  3L71 E;  1YIT P;  1PGQ A;  3T97 B;  3E1I A;  2XV5 A;  1M1J B;  4H44 B;  3OW2 O;  1GTW A;  4LC1 A;  1DEE G;  2E76 C;  1FZC B;  3CX5 D;  3MD0 A;  4H44 D;  3G71 P;  2QIW A;  2A06 E;  2BCC J;  2FKW B;  1QLE D;  1T3U A;  3L4F A;  1U57 A;  3CMA P;  1GK6 A;  2Z4E A;  3O6Q A;  3NTN A;  1FC2 C;  2W83 C;  5APW A;  2HLO A;  1YHQ P;  1GZL A;  3B8E B;  3H32 B;  1RF1 C;  2E76 B;  1JMB A;  2AXT H;  2JKV A;  3FWN A;  2XU6 A;  4I7Z C;  3CC7 P;  1YJW P;  3KZI H;  2BCC G;  1NTM K;  1ZME C;  2E76 D;  2KXP B;  3A7O A;  5KJ7 D;  3QWO C;  1P84 D;  3TGU D;  1SQX K;  3VTP C;  2BCC E;  2FXO A;  3M0A A;  3MZW B;  3H1H G;  1W2E A;  1X8Y A;  4C7N A;  1RF1 B;  1ZRT E;  1JM0 A;  1U7J A;  2HPC A;  1OVR A;  2ZFC A;  1USE A;  4I7Z B;  2Z5I A;  1YJN P;  2ZYA A;  1M7L A;  2H8P D;  1MZ9 A;  1FS0 E;  2E43 A;  1SQV D;  2HYN A;  1LP1 A;  1RE3 A;  3H1J D;  3PRJ A;  4RJT A;  4EYY Q;  1VF5 C;  1S4X A;  3BCC D;  3L72 G;  2H43 A;  2C9L Y;  1YQ3 C;  1N73 B;  1K04 A;  1LTJ A;  5AVX B;  2W90 A;  1BE3 J;  1URQ A;  3TK1 A;  2OYO A;  1NTK K;  1J1D C;  2QE7 H;  3BRT B;  3L72 E;  1LGH B;  5AW0 B;  1LT9 B;  3D70 A;  5KLV D;  3FXD A;  2JEE A;  3RK3 B;  1EZV G;  1GK4 A;  1NTM G;  2E75 D;  5APQ A;  1PL5 A;  4OWF A;  1D7M A;  3PP5 A;  2ZT9 C;  1KIL E;  3RK3 D;  3L36 A;  5APY A;  1SQX G;  1JY3 O;  1GL2 C;  1JTH A;  1VQ9 P;  3CCL P;  3P8C D;  3H25 A;  3HUS C;  1KQG B;  1DH3 A;  3F89 A;  1N86 A;  1BE3 G;  3AE1 C;  1SQX E;  2R32 A;  2K9Y A;  3ZDM A;  1ZLL A;  5DJU B;  2KK7 A;  4R4L A;  4DT0 A;  3AE9 C;  1VQO P;  2BEZ F;  1W2B O;  2CPB A;  2H7H A;  1QGK B;  1BE3 E;  2P58 A;  1NTK J;  1FJP A;  1JUN A;  4HJG H;  4OGQ C;  3G4S P;  1EXJ A;  1XTG B;  4PJ0 E;  2ZT9 B;  4N6J A;  1GL2 B;  4WY4 A;  2L5G B;  2ZVN B;  2POH A;  2K1A A;  1HUC A;  3HUS B;  1VQP P;  1PP9 J;  3JC2 2;  2ZT9 D;  1SQP K;  2K37 A;  2KUB A;  1IC2 A;  2M5A A;  1GL2 D;  1J1E B;  2P1J A;  1SQB K;  5KAI E;  3E1R A;  1T2K D;  3H1I D;  3AEB C;  3ITK A;  1VQK P;  3KDP B;  3L74 J;  2FYU J;  1KB9 E;  5CCG C;  1NTK G;  2WWW A;  4Y99 B;  1PGO A;  3G6E P;  4IL6 H;  2K3R A;  3SSU A;  1DD3 A;  2P2U A;  1NTK E;  2FY8 A;  4H0L C;  4NPE A;  2MKV A;  3H1K J;  3PH0 A;  4R4M A;  2WSF J;  1AA0 A;  1NOH A;  5CBN A;  2JDI H;  1PP9 E;  2ZXX A;  2KLV A;  3RL0 g;  1JCC A;  2I1K A;  1SQB J;  1M1K Q;  1RE4 C;  3L74 E;  1NU1 K;  2WZ7 A;  1H8A A;  2PRR A;  3H1K G;  4C7R A;  3FGA D;  1IFJ A;  3U1A A;  1GW3 A;  1IFM A;  3EFF K;  3CCQ P;  1SQP G;  3H1K E;  3CC2 P;  3Q3D A;  1S5L H;  1SQB G;  3V2N A;  3TGU J;  3R4Y A;  5AVQ B;  5APU A;  1JOC A;  1SQP E;  1QEX A;  3PLN A;  1KIL C;  3KHU A;  3S4R A;  3GHG C;  1SQB E;  2Q1K A;  3JCU E;  1LWU A;  1CZQ A;  5AW8 B;  3MUD A;  4RO0 A;  1IO4 A;  5AVR B;  2IDB A;  4BRY A;  2IBZ D;  1N8R Q;  4CPG A;  1KYO E;  2RH0 A;  4GOD A;  2WMM A;  2IZ0 A;  1SQQ K;  1FJK A;  3AE3 C;  1YI2 P;  1VQN P;  1FU1 A;  3H1J J;  3KXD A;  5M1B A;  3GHG B;  1P84 E;  3TGU E;  2A45 H;  1JY3 N;  2O01 N;  3BCC J;  2FYZ A;  3EQ2 A;  4KJM A;  1NU1 G;  1PIX A;  1AVO A;  4W80 A;  3L73 D;  4L73 A;  2HOD B;  3WMM 0;  2FFD A;  3Q5R A;  5KLI B;  5KLV J;  4PD4 I;  1N7S B;  3V5B A;  1N7L A;  1N7S D;  2Q6Q A;  5AVT B;  2QEX P;  4DOJ A;  5KAF E;  3I55 P;  3K5B A;  1HGV A;  1KC8 Q;  1HBW A;  4U3F G;  3HTK A;  3CCV P;  3CX5 I;  1YQ4 C;  1KQS O;  2YKP A;  4I6M C;  1JY2 P;  1PPJ G;  1M57 D;  2ITA A;  5GTH E;  1SS1 A;  1USD A;  3IF4 A;  2P10 A;  1SQQ G;  5AVY B;  3VMA A;  2KOG A;  5KLV E;  3CCJ P;  2B87 B;  3AE5 C;  4XFJ A;  1PPJ E;  3Q5P A;  3L35 A;  2D2C C;  1SQQ E;  2CK3 H;  2ZXE B;  1LNQ A;  3H1I J;  1LTA C;  1BDC A;  4IFM A;  2FYN C;  1SFC A;  1RE3 C;  3VMY A;  1VQ4 P;  3W68 A;  1P84 I;  2HR3 A;  1NAF A;  2PFX A;  2E5Y A;  3GLM A;  2QVA A;  1NTZ D; 
#chains in the Genus database with same CATH homology
 1NTK G;  1P84 H;  1SQP G;  1SQQ G;  1NTZ G;  1KYO H;  4U3F G;  1NU1 G;  1L0N G;  1SQX G;  1KB9 H;  4D6T G;  3CXH H;  3TGU G;  3H1J G;  4PD4 H;  1BGY G;  3H1L G;  3L71 G;  2A06 G;  3H1H G;  1L0L G;  1SQB G;  2IBZ G;  3H1K G;  3L70 G;  1EZV G;  1BCC G;  3CX5 H;  3L72 G;  1NTM G;  3L74 G;  5KLV G;  3L73 G;  2FYU G;  1BE3 G;  2BCC G;  3BCC G;  3L75 G;  3CWB G;  1PPJ G;  1SQV G;  1PP9 G;  3H1I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...