3MP7B

Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
54
structure length
54
Chain Sequence
IRHFWKESRRAFLVTKKPNWATYKRAAKITGLGIILIGLIGMLIRIVGILILGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Preprotein translocase subunit secY
publication title Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Protein transport
total genus 15
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 3mp7B00
1RHZB 2YXQB 1RH5B 3MP7B 3JC22 2YXRB
chains in the Genus database with same CATH superfamily
1EZVI 2O3JA 3AECC 1SQQJ 1GD2E 1JTHA 3Q5SA 5BU5A 1SFCA 1SQPE 4B86A 2OYIC 4UB6H 1BE3J 3OW2O 4H13D 4BRYB 5C39A 1M90Q 3VP8A 1SQVJ 2A45H 1NTKK 2KB7P 2RH0A 1U7MA 1CI6B 3BRTB 3SWYA 2N9YB 1GTWA 5AVQB 4JPZB 2IBZG 1L0ND 3BVHA 2KNCA 2KLUA 5M1BA 1S5LX 4TLFA 3AEBC 3KZIE 4YXDC 2P7JA 1SQXK 4YTPC 3H1IJ 1HBWA 3FXDA 5KAFE 1VQKP 1PGQA 1NVOA 5L8RJ 5AW9B 2ZXEB 3OAKA 3L72D 2NZ2A 5CBOA 1AV1A 4JBZA 3A0BH 3CWBG 4O9BA 1LTTC 4YPCA 1NTZE 3AEEC 1RF1A 1KILB 1SQBJ 1GDTA 1PPJD 3O6QA 2D2CC 3KPEA 1DX7A 5APSA 1XTCC 1SQVK 1ZR4A 1NKNA 3D71A 3L71D 3SWKA 1KYOE 3AE8C 3PTZA 3W67A 2P10A 5CBNA 3CCUP 1ZLLA 1FZBA 1KILD 2B9BA 3AE4C 1Y47A 4JF7A 2Z4EA 2QJKC 3LIEA 1DIPA 3L37A 4EIJA 1PL5A 1JMBA 1GL2C 1SQQG 1OFCX 3GLMA 1MKMA 3F5HA 3CL3D 1L4AC 2XZRA 1QLED 2R5BA 1BE3G 2ITAA 4D6TD 3RL0g 2LXBA 5KKZC 5KLVK 3CMAP 1SQVG 3T97A 3IFMA 3MTUE 2R44A 1GMJA 2IBZD 4LLHA 1NTKE 2WSFJ 1BSHA 5CCGD 1OVRA 1TU3F 3H1IG 1NOHA 3AEFC 1NHLA 1U7JA 4L76A 4WY4C 3PH0A 4C46A 1SQXE 3EQ2A 3CWBD 1FZCA 1KMIZ 3JCUH 1FZGA 2KLVA 1LTJA 1IFNA 3C8VA 5APTA 1SQBG 2P58A 2IZ0A 5GTHH 2PAJA 1OWAA 1YQ3C 1G2CA 2ZT9B 1DD4A 3FWLA 2E43A 3N4XA 2E74C 3M91A 5AW3B 4EYYQ 2OYHB 1X8YA 3G6EP 2N9BA 1URQB 3A5TA 4IL6X 2W27A 4BWNA 1L0LJ 2Y0CA 2ZVNB 4W7ZA 3CCSP 1SQQD 2FBWC 2ZT9D 1RF0A 5KLIB 4PV1C 1LTAC 1PGOA 1LT9B 1BE3D 1BCCE 3TGUE 5AW6B 3H25A 2MKVA 1RE4A 2I8DA 3HE4A 1VDFA 1URQD 3LW5J 2SPZA 3A7OA 3H1KJ 1HUCA 5KLVE 3HD7B 4H44B 5TISE 2H43A 5AVYB 3KDPB 3V6IA 1J2JB 2FFDB 1H0TA 3FGAD 3H1ID 2Q3EA 5E79H 3RK3B 1T8ZA 4EI2A 3IR9A 2O1KA 2IBZI 3B8EB 2BASA 2QM8A 2FYUJ 3P8MC 3HD7D 2P1JA 3CXHI 4H44D 2PFXA 4L73A 1KQLA 3TNUB 1SQBD 2FYNC 4K35A 2BCCJ 1VQ7P 2E5YA 1Q82Q 2PGDA 5AVXB 3Q1MA 1FJKA 2J59M 2HR3A 4C7NA 2AXTE 2B88A 5CJ0A 5APWA 3RK3D 1HWTC 1YTZT 1SQPJ 4HH2A 1S5LH 1FZFA 2XDJA 2KIKA 5AW5B 2YMKA 2QJPC 1P84E 1NU1E 4DZOA 4Y99B 2OTJP 2XNDH 1OMIA 5APUA 3II6A 3PP5A 3K5BA 2AXCA 1N73B 1L0LG 3CX5E 2OYIA 4IFDK 3CLQA 5AW8B 1KB9D 3Q3DA 1FZCC 2YKPA 3H32A 4AQRD 1QGKB 1Q2NA 3CCVP 1LWUB 1FZEA 1EZVD 3USSA 1KQGB 4I7ZC 1JUNA 4UB6E 1PFIA 1Q7YQ 1JM0A 1XTGB 1YQ4C 1H88A 1BDDA 2O01H 1LJ2A 3B5NB 3OA7A 3H1KG 1EQ7A 2V7QJ 1NTZJ 1T3JA 3E1IA 4KHXA 4GT1A 3TYYA 2WVRA 2FY8A 4HYTB 2OGUA 3GHGB 1NKZB 3GF3A 1CW5A 3ITKA 3B5ND 1RF0C 2YKQA 2O1JA 2LXCB 3A0BE 3WMM0 2FYUG 1YJNP 2WZ7A 3AE7C 4W7YA 2KP8A 1M1JC 3L4FA 1JTHB 2WPSA 2BCCG 3AE9C 3TDKA 1S1CX 1SFCB 1IJDB 3CCQP 2KS1B 1N86A 3V4QA 1SQPG 2QG4A 1EDKA 3UIAA 1WRGA 3H1HE 1YJWP 3CCRP 4JYBA 2Q9IA 1GL2A 1VQOP 3I56P 2JR8A 4CPGA 2WTYA 2JO1A 1FBMA 2KNCB 4RO0A 2M8RA 2OTKE 2KZJA 1L4AA 3M9BA 1SP4A 1SFCD 1L0LD 1U57A 1RH5B 2WT7A 3V4WA 3GG2A 2L5GB 1NJIQ 4YXWH 2WPVB 1NTKJ 2M5AA 3L74D 3VMYA 3I55P 4ZKPA 1M8OB 3L75E 1K05A 2Q1KA 1KB9H 3TK1A 4XE5B 1L2PA 1VF5B 2Z5HA 5BVZA 2R3SA 2N1TA 2NPSA 4ASVA 1SQXJ 1W2EA 4U3FE 3JSVC 3CCJP 1RF1B 1ZOYC 2M3EA 3H1KD 5BU8B 1NTMD 5AVWB 1NTZG 3O6QB 4WY4A 1FDIA 3BCCE 4OH8B 3M0AA 3HUSB 5B66H 4UB8H 3KYQA 1ZP0C 4OGQB 1A02F 1NYHA 1L0NE 1P84I 1VF5D 1S2EA 3BRVB 1K73Q 1HJBA 1N7SA 1NH4A 1RQVA 1VQNP 1PV3A 2E76B 2IPPA 3CCLP 2FYUD 1OX3A 1RE3C 1LT1A 3RL0C 3SFDC 3JCUE 2YMYA 3VMZA 2C9NY 3FWNA 3PRJA 2BCCD 4OGQD 5GTHE 1LTSC 3D6ZA 1JY2O 2B87A 1E5WA 2Y0EA 1FAVA 2FFDC 3NTNA 1SQPD 1LTBC 3T97B 5KJ7A 3PHLA 2E76D 1BCCJ 3TGUJ 1QVGO 1QX8A 1OXZA 2M0BA 3H1JE 1PGJA 2G3AA 2CK3H 2DW3A 5KLVJ 1IK7A 1T2KC 1NTKG 2IYOA 2BEZF 4PD4I 1FZAA 2R32A 1CZQA 5AW1B 4NPEA 2WSCH 1IFPA 2CPSA 1M57D 1IZNB 1SQXG 1LTJB 1FJPA 4D6TE 1KV4A 1JCDA 1S9KE 2XU6A 1NTZD 3M06A 3N7NA 2IFMA 2QEXP 1EXJA 4M3LA 3RGUA 2FXOA 1YBKA 1J1DC 1GU5A 3CI9A 3AE1C 1KFNA 5E79E 2ZXXA 3B71A 5KTBA 1HVVA 2PP6A 3S9OA 2YIUC 5CCHC 4MN4C 1KYOD 1W2BO 1NU1J 4WBAA 2N1TC 2NPSC 4OWFA 2IZ1A 3H6PA 1OW7A 3WUVA 2WSEH 4GOFA 2YKOA 3CXHD 3BASA 1S5LE 1AVYA 1HGZA 1PP9E 2HYNA 3TGUG 1BCCG 2Q7CA 4OVNF 1IK9A 1FS0E 2FXPA 1NGMB 2AEMA 2Q3IA 3VN0A 4H0LC 3S1KA 3RK2B 1YJ9P 5KLVG 1N7SC 1J1EB 1NTKD 1D7MA 1LP1B 1NU1K 2YXQB 1IC2A 1Q90D 2KK7A 2ZYGA 1HGVA 5AVUB 4LC1A 1KD1Q 1CSBA 3MD0A 3VTPC 2A06E 2E42A 3CMEP 1SQXD 2QJYC 4NPFX 2W6JH 3L36A 1G1IA 3RK2D 2JP3A 5CCGA 2HPCA 5KJ7C 4XA4A 4IFFA 4I2LC 5B5EH 4C7NB 1T3UA 1IO4A 1YI2P 1VQ6P 3P8CD 2POHA 2W83C 3FX0A 3D6YA 3SFEC 2K1AA 4R4MA 1AA0A 1M1JA 1FOSF 1M56D 2Q5UA 4KJMA 2BEQD 1LNQA 3H1HJ 3U1AA 1FOSE 1JOCA 2H8PD 4W80A 1H89A 1ZV8A 4H13C 1SQVD 1NU1G 3AE2C 3V2NA 1OVUA 2OYIB 1ZMEC 3HTKA 1S4XA 1VQ5P 3AEAC 2KOGA 4C7RA 1WT6A 3RBXA 2JWAA 2KZIA 1KYOI 1MUUA 3L75J 2KXPB 3V2PA 3M9QA 1HJ0A 2ZAEB 3PJSK 3Q5RA 2QIWA 3CXHH 3MUDC 5DJTB 2YNYA 1BCCD 1OIPA 1S3JA 1GW4A 1VL2A 4U3FJ 3R4YA 2A45G 4N78E 1BGYE 2KUBA 3BCCJ 5KLVD 2H88C 2OYHA 1KFMA 2QE7H 2Z5IA 2R5DA 1LGHB 2WWWA 3CCEP 1RQUA 1KB9E 1L0NJ 3CC2P 1JMMA 1URQA 5APQA 3OJAB 1A02J 2D2CB 3QH9A 2CPBA 3Q5PA 5AW4B 3VP9A 1JO5A 5APXA 1EZVE 1Y8AA 1YTZI 1KILC 3R2PA 3W68A 4ASWA 1MFTA 4XFJA 2YXRB 3A3YB 2HFED 5B66E 3PLNA 3VMAA 1IFDA 4UB8E 2HODA 2QJKB 2OTLP 3H1LE 1RE3A 2D2CD 1PZQA 3L70E 2WQYC 4N3YB 3H1HG 2LR2A 3G4SP 4HKZH 2VRSA 3QWOC 5AW0B 1P84D 1L4AB 1YYCA 1JY3P 4IFMA 3U1CA 2FFDA 1IFJA 3H1JJ 1JEKA 1L0NK 2M5AB 5KKZB 3M0DA 3CX5D 3TSIA 2ZYDA 2O01N 5GTIH 2GA1A 5CCGC 3L75G 2C0WA 2RMZA 4U7JA 2K9JA 1L4AD 3L73E 2IYPA 2OYOA 4U3FG 1AQ5A 4WY4B 2V4HA 2QM7A 1USDA 5AVTB 2QA4P 3A2AA 4D6TJ 2Y9ZA 3SSUA 3BCCG 2IDBA 1SS1A 3V2RA 2OARA 1MV8A 3WU2H 1NAYA 1BDCA 3CC7P 1L0NG 5APVA 3E1RA 2AEFA 4PJ0H 5TISH 1JY2N 3L74E 3G3ZA 1ZRTE 2FXMA 4Z1MH 4PD4D 5KAIH 4WY4D 1RY3A 1K9MQ 2E74B 1VPCA 2QRXA 3A0HH 3HE5A 1LWUA 1H8AA 4ZMDA 2MJZA 1NTME 5CCHA 4EOTA 5AVRB 1PGPA 1KN7A 4DT0A 2ZT9C 1G1JA 1AVOA 3CCMP 2ZVOB 1GK6A 2JJLA 3H1HD 2AXTH 1PP9J 2K9YA 4R4LA 2OYHC 3ZDMA 4JQ0D 4PV1B 3O8ZA 1USEA 2E74D 3IN6A 4Y28J 2OQQA 1URQC 3H1JG 1VQ4P 1KC8Q 4BXLA 4GOEA 1P84H 3GHGA 1N8RQ 2GM4A 3AEGC 4TT3H 4IL6H 3MIWA 2WSFH 5KLIC 4DCKA 1EDLA 5AW2B 4KT0J 5AVVB 3L75D 3VMXA 4EDFA 1LT9C 1JB0J 3KHUA 4PV1D 3CX5I 2HLOA 3L72E 2O01J 3V2QA 4U3FD 2KS1A 4D6TG 3B4SA 3HD7C 2E75B 4H44C 4AYCA 3BCCD 3GMAA 1OW8A 2P67A 1PPJE 2JEEA 2FYNB 3C9IA 2A45I 3M0DC 3RK3C 1E79H 1IFMA 1Y9BA 3AE5C 3KQGA 3L71E 2JWDA 1S72P 4PD4H 2E75D 2KSEA 2QJPB 3E7KA 2I1KA 1GK4A 5B5EE 1KILE 1SQQK 5K5GB 4QMAA 4N6JA 5TJHA 3F89A 1W5CE 3AE3C 1N7LA 2KYVA 3KXDA 1FZCB 1PP9G 2KSJA 4LGDE 3HUSA 4Y99C 4L75A 1SVFA 5H2FH 1AQTA 4I7ZB 2XNXA 1N73C 4A7PA 3H1JD 1ZW0A 3LW5H 1G2CB 1N2DC 3MUDA 4BRYA 2Q6QA 1BGYJ 2GUSA 2R3CA 2IBZE 1Z56A 1VQLP 1CI6A 2L91A 1UIXA 3LIDA 2IX7C 3CPWO 1LWUC 2P2UA 3MZWB 1FDOA 3CXHE 3U59A 2YO2A 4GDOA 2NRGA 2A06G 2HPCB 3B5NC 2WPQA 1SLQA 2K88A 2RKLA 3L35A 1X0TA 3VYIA 2IFNA 1EDIA 1QL1A 1SQBK 2B89A 3CWBE 1S9KD 1M1JB 1UIIA 1YHQP 3RBZA 3GHGC 3EFGA 3H1LJ 3HE4B 4AUWA 3Q2YA 3L70J 3CD6P 1KILA 3JC22 5AVSB 3M9HA 4GKGA 3P7KA 1FC2C 4WWIA 2ZFCA 3HTKB 4L74A 5EFWB 4HB1A 2RN0A 2H89C 4RESB 1H0TB 1M7LA 1SFCC 2XV5A 2W8ZA 1MZ9A 2Y0DA 3S4RA 1FU1A 4K3AA 1SQQE 3P8CE 3KZIH 1RHZB 1PP9D 3D70A 5KAFH 1GU4A 1R5LA 1JNMA 4WVZA 1BE3E 3L73J 2W6BA 1VQMP 3GF7A 1AFOA 1SQVE 5CJ4A 4JYCA 1GZLA 1BGYG 1NO4A 2V7QH 1BSNA 1X9VA 5GTIE 4DJGA 2KI7B 1GW3A 1VF5C 3L74J 3EWKA 3H1IE 3HRNA 2WSCJ 2HG5D 2A06D 1FE6A 3MHVA 1EZVG 3C1LA 1RF1C 1KQSO 2GUVA 1ZXGA 1VQ8P 2E5TA 1KYOH 5DJUB 3AEDC 2J5UA 3H32B 1OZHA 3MP7B 3HUSC 1KTMA 2HODB 3P32A 2M3BA 3BATA 3RL0B 4OGQC 1SQBE 1NTMJ 3WU2E 1HF9A 3H1LG 4RJTA 4PJ0E 3L70G 1X22A 3RK3E 1DEEG 5CHXA 3EFFK 3TGUD 1DD3A 5KAIE 2UWJE 2JDIH 2E76C 3V5BA 1DEBA 1EDJA 1LP1A 1R8EA 1K8AQ 1YIJP 2W90A 1L0LK 2LKMA 3A0HE 2C0XA 2K37A 2E75C 3RL0D 1HTLC 2FYZA 2WSEJ 4I6MC 2K3RA 3NFQA 2K9JB 1PIXA 1QL2A 3L73G 1M1KQ 3TF5A 1NTMK 1R5SA 3L72J 5AW7B 2PRRA 1LT9A 4N78D 1BGYD 4IL6E 3WUTA 1T2KD 3NMDA 1IFIA 4DOJA 1VQ9P 1GL2B 1MFZA 1ZN5A 1KORA 1LTIC 3L74G 3HD7A 1FDMA 2Y9YA 1HH0A 3SWFA 1J1DB 2FYUK 1NU1D 1JY3N 1LTJC 2WT7B 3L71J 3HE5B 3GW6A 1ZR2A 2YIUB 1EXIA 4ZKUA 1NTMG 1KQFB 1OVVA 1GL2D 2N1TB 4I1LA 2NPSB 3G71P 4HJGH 1SQPK 1YITP 1KZUB 3IF4A 3MGNA 2C9LY 3H1LD 3L70D 1T6AA 3TNUA 3CC4P 4PD4E 5CCHD 2WMMA 1Q86Q 2ZJSE 3I5CA 4RKUJ 2N1TD 2NPSD 1L0LE 4H0LB 1N7SB 2QVAA 1NWQA 1LTGC 1N73A 1RE4C 4IOIH 2AEJA 2WPRA 2G8YA 4ZNCA 1JCCA 2ZYAA 1QVFO 5H2FE 3L73D 3L72G 1JY2P 1NAFA 1OW6A 2JKVA 5CMZA 2FKWB 1NTZK 1DH3A 3RK2C 2B87B 3ABVC 1K04A 1QEXA 3CWBJ 3H1KE 1J1EC 2QJYB 4H0LD 3G9RA 2J58A 2WITA 2QSIA 3AE6C 3B5NA 1N7SD 1AJYA 3WUUA 4GIFA 3FXEA 2YO3A 1PPJG 1JY3O 2I1JA 1ZRTD 1EC5A 1Q81Q 1WMKA 3L71G 1VQPP 1X79B 3IAOA 3NXSA 4NPDA 5APYA 4H13B 2FYUE 1KB9I 2H7HA 2W6AA 2WSSH 2XKMA 5KJ7D 3CX5H 4GODA 3VOPA 5AVZB 4WB4A 2BCCE
chains in the Genus database with same CATH topology
1RHZB 2YXQB 1RH5B 3MP7B 3JC22 2YXRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHZ B;  2YXQ B;  1RH5 B;  3MP7 B;  3JC2 2;  2YXR B; 
#chains in the Genus database with same CATH topology
 1EZV I;  2O3J A;  3AEC C;  1SQQ J;  1GD2 E;  1JTH A;  3Q5S A;  5BU5 A;  1SFC A;  1SQP E;  4B86 A;  2OYI C;  4UB6 H;  1BE3 J;  3OW2 O;  4H13 D;  4BRY B;  5C39 A;  1M90 Q;  3VP8 A;  1SQV J;  2A45 H;  1NTK K;  2KB7 P;  2RH0 A;  1U7M A;  1CI6 B;  3BRT B;  3SWY A;  2N9Y B;  1GTW A;  5AVQ B;  4JPZ B;  2IBZ G;  1L0N D;  3BVH A;  2KNC A;  2KLU A;  5M1B A;  1S5L X;  4TLF A;  3AEB C;  3KZI E;  4YXD C;  2P7J A;  1SQX K;  4YTP C;  3H1I J;  1HBW A;  3FXD A;  5KAF E;  1VQK P;  1PGQ A;  1NVO A;  5L8R J;  5AW9 B;  2ZXE B;  3OAK A;  3L72 D;  2NZ2 A;  5CBO A;  1AV1 A;  4JBZ A;  3A0B H;  3CWB G;  4O9B A;  1LTT C;  4YPC A;  1NTZ E;  3AEE C;  1RF1 A;  1KIL B;  1SQB J;  1GDT A;  1PPJ D;  3O6Q A;  2D2C C;  3KPE A;  1DX7 A;  5APS A;  1XTC C;  1SQV K;  1ZR4 A;  1NKN A;  3D71 A;  3L71 D;  3SWK A;  1KYO E;  3AE8 C;  3PTZ A;  3W67 A;  2P10 A;  5CBN A;  3CCU P;  1ZLL A;  1FZB A;  1KIL D;  2B9B A;  3AE4 C;  1Y47 A;  4JF7 A;  2Z4E A;  2QJK C;  3LIE A;  1DIP A;  3L37 A;  4EIJ A;  1PL5 A;  1JMB A;  1GL2 C;  1SQQ G;  1OFC X;  3GLM A;  1MKM A;  3F5H A;  3CL3 D;  1L4A C;  2XZR A;  1QLE D;  2R5B A;  1BE3 G;  2ITA A;  4D6T D;  3RL0 g;  2LXB A;  5KKZ C;  5KLV K;  3CMA P;  1SQV G;  3T97 A;  3IFM A;  3MTU E;  2R44 A;  1GMJ A;  2IBZ D;  4LLH A;  1NTK E;  2WSF J;  1BSH A;  5CCG D;  1OVR A;  1TU3 F;  3H1I G;  1NOH A;  3AEF C;  1NHL A;  1U7J A;  4L76 A;  4WY4 C;  3PH0 A;  4C46 A;  1SQX E;  3EQ2 A;  3CWB D;  1FZC A;  1KMI Z;  3JCU H;  1FZG A;  2KLV A;  1LTJ A;  1IFN A;  3C8V A;  5APT A;  1SQB G;  2P58 A;  2IZ0 A;  5GTH H;  2PAJ A;  1OWA A;  1YQ3 C;  1G2C A;  2ZT9 B;  1DD4 A;  3FWL A;  2E43 A;  3N4X A;  2E74 C;  3M91 A;  5AW3 B;  4EYY Q;  2OYH B;  1X8Y A;  3G6E P;  2N9B A;  1URQ B;  3A5T A;  4IL6 X;  2W27 A;  4BWN A;  1L0L J;  2Y0C A;  2ZVN B;  4W7Z A;  3CCS P;  1SQQ D;  2FBW C;  2ZT9 D;  1RF0 A;  5KLI B;  4PV1 C;  1LTA C;  1PGO A;  1LT9 B;  1BE3 D;  1BCC E;  3TGU E;  5AW6 B;  3H25 A;  2MKV A;  1RE4 A;  2I8D A;  3HE4 A;  1VDF A;  1URQ D;  3LW5 J;  2SPZ A;  3A7O A;  3H1K J;  1HUC A;  5KLV E;  3HD7 B;  4H44 B;  5TIS E;  2H43 A;  5AVY B;  3KDP B;  3V6I A;  1J2J B;  2FFD B;  1H0T A;  3FGA D;  3H1I D;  2Q3E A;  5E79 H;  3RK3 B;  1T8Z A;  4EI2 A;  3IR9 A;  2O1K A;  2IBZ I;  3B8E B;  2BAS A;  2QM8 A;  2FYU J;  3P8M C;  3HD7 D;  2P1J A;  3CXH I;  4H44 D;  2PFX A;  4L73 A;  1KQL A;  3TNU B;  1SQB D;  2FYN C;  4K35 A;  2BCC J;  1VQ7 P;  2E5Y A;  1Q82 Q;  2PGD A;  5AVX B;  3Q1M A;  1FJK A;  2J59 M;  2HR3 A;  4C7N A;  2AXT E;  2B88 A;  5CJ0 A;  5APW A;  3RK3 D;  1HWT C;  1YTZ T;  1SQP J;  4HH2 A;  1S5L H;  1FZF A;  2XDJ A;  2KIK A;  5AW5 B;  2YMK A;  2QJP C;  1P84 E;  1NU1 E;  4DZO A;  4Y99 B;  2OTJ P;  2XND H;  1OMI A;  5APU A;  3II6 A;  3PP5 A;  3K5B A;  2AXC A;  1N73 B;  1L0L G;  3CX5 E;  2OYI A;  4IFD K;  3CLQ A;  5AW8 B;  1KB9 D;  3Q3D A;  1FZC C;  2YKP A;  3H32 A;  4AQR D;  1QGK B;  1Q2N A;  3CCV P;  1LWU B;  1FZE A;  1EZV D;  3USS A;  1KQG B;  4I7Z C;  1JUN A;  4UB6 E;  1PFI A;  1Q7Y Q;  1JM0 A;  1XTG B;  1YQ4 C;  1H88 A;  1BDD A;  2O01 H;  1LJ2 A;  3B5N B;  3OA7 A;  3H1K G;  1EQ7 A;  2V7Q J;  1NTZ J;  1T3J A;  3E1I A;  4KHX A;  4GT1 A;  3TYY A;  2WVR A;  2FY8 A;  4HYT B;  2OGU A;  3GHG B;  1NKZ B;  3GF3 A;  1CW5 A;  3ITK A;  3B5N D;  1RF0 C;  2YKQ A;  2O1J A;  2LXC B;  3A0B E;  3WMM 0;  2FYU G;  1YJN P;  2WZ7 A;  3AE7 C;  4W7Y A;  2KP8 A;  1M1J C;  3L4F A;  1JTH B;  2WPS A;  2BCC G;  3AE9 C;  3TDK A;  1S1C X;  1SFC B;  1IJD B;  3CCQ P;  2KS1 B;  1N86 A;  3V4Q A;  1SQP G;  2QG4 A;  1EDK A;  3UIA A;  1WRG A;  3H1H E;  1YJW P;  3CCR P;  4JYB A;  2Q9I A;  1GL2 A;  1VQO P;  3I56 P;  2JR8 A;  4CPG A;  2WTY A;  2JO1 A;  1FBM A;  2KNC B;  4RO0 A;  2M8R A;  2OTK E;  2KZJ A;  1L4A A;  3M9B A;  1SP4 A;  1SFC D;  1L0L D;  1U57 A;  1RH5 B;  2WT7 A;  3V4W A;  3GG2 A;  2L5G B;  1NJI Q;  4YXW H;  2WPV B;  1NTK J;  2M5A A;  3L74 D;  3VMY A;  3I55 P;  4ZKP A;  1M8O B;  3L75 E;  1K05 A;  2Q1K A;  1KB9 H;  3TK1 A;  4XE5 B;  1L2P A;  1VF5 B;  2Z5H A;  5BVZ A;  2R3S A;  2N1T A;  2NPS A;  4ASV A;  1SQX J;  1W2E A;  4U3F E;  3JSV C;  3CCJ P;  1RF1 B;  1ZOY C;  2M3E A;  3H1K D;  5BU8 B;  1NTM D;  5AVW B;  1NTZ G;  3O6Q B;  4WY4 A;  1FDI A;  3BCC E;  4OH8 B;  3M0A A;  3HUS B;  5B66 H;  4UB8 H;  3KYQ A;  1ZP0 C;  4OGQ B;  1A02 F;  1NYH A;  1L0N E;  1P84 I;  1VF5 D;  1S2E A;  3BRV B;  1K73 Q;  1HJB A;  1N7S A;  1NH4 A;  1RQV A;  1VQN P;  1PV3 A;  2E76 B;  2IPP A;  3CCL P;  2FYU D;  1OX3 A;  1RE3 C;  1LT1 A;  3RL0 C;  3SFD C;  3JCU E;  2YMY A;  3VMZ A;  2C9N Y;  3FWN A;  3PRJ A;  2BCC D;  4OGQ D;  5GTH E;  1LTS C;  3D6Z A;  1JY2 O;  2B87 A;  1E5W A;  2Y0E A;  1FAV A;  2FFD C;  3NTN A;  1SQP D;  1LTB C;  3T97 B;  5KJ7 A;  3PHL A;  2E76 D;  1BCC J;  3TGU J;  1QVG O;  1QX8 A;  1OXZ A;  2M0B A;  3H1J E;  1PGJ A;  2G3A A;  2CK3 H;  2DW3 A;  5KLV J;  1IK7 A;  1T2K C;  1NTK G;  2IYO A;  2BEZ F;  4PD4 I;  1FZA A;  2R32 A;  1CZQ A;  5AW1 B;  4NPE A;  2WSC H;  1IFP A;  2CPS A;  1M57 D;  1IZN B;  1SQX G;  1LTJ B;  1FJP A;  4D6T E;  1KV4 A;  1JCD A;  1S9K E;  2XU6 A;  1NTZ D;  3M06 A;  3N7N A;  2IFM A;  2QEX P;  1EXJ A;  4M3L A;  3RGU A;  2FXO A;  1YBK A;  1J1D C;  1GU5 A;  3CI9 A;  3AE1 C;  1KFN A;  5E79 E;  2ZXX A;  3B71 A;  5KTB A;  1HVV A;  2PP6 A;  3S9O A;  2YIU C;  5CCH C;  4MN4 C;  1KYO D;  1W2B O;  1NU1 J;  4WBA A;  2N1T C;  2NPS C;  4OWF A;  2IZ1 A;  3H6P A;  1OW7 A;  3WUV A;  2WSE H;  4GOF A;  2YKO A;  3CXH D;  3BAS A;  1S5L E;  1AVY A;  1HGZ A;  1PP9 E;  2HYN A;  3TGU G;  1BCC G;  2Q7C A;  4OVN F;  1IK9 A;  1FS0 E;  2FXP A;  1NGM B;  2AEM A;  2Q3I A;  3VN0 A;  4H0L C;  3S1K A;  3RK2 B;  1YJ9 P;  5KLV G;  1N7S C;  1J1E B;  1NTK D;  1D7M A;  1LP1 B;  1NU1 K;  2YXQ B;  1IC2 A;  1Q90 D;  2KK7 A;  2ZYG A;  1HGV A;  5AVU B;  4LC1 A;  1KD1 Q;  1CSB A;  3MD0 A;  3VTP C;  2A06 E;  2E42 A;  3CME P;  1SQX D;  2QJY C;  4NPF X;  2W6J H;  3L36 A;  1G1I A;  3RK2 D;  2JP3 A;  5CCG A;  2HPC A;  5KJ7 C;  4XA4 A;  4IFF A;  4I2L C;  5B5E H;  4C7N B;  1T3U A;  1IO4 A;  1YI2 P;  1VQ6 P;  3P8C D;  2POH A;  2W83 C;  3FX0 A;  3D6Y A;  3SFE C;  2K1A A;  4R4M A;  1AA0 A;  1M1J A;  1FOS F;  1M56 D;  2Q5U A;  4KJM A;  2BEQ D;  1LNQ A;  3H1H J;  3U1A A;  1FOS E;  1JOC A;  2H8P D;  4W80 A;  1H89 A;  1ZV8 A;  4H13 C;  1SQV D;  1NU1 G;  3AE2 C;  3V2N A;  1OVU A;  2OYI B;  1ZME C;  3HTK A;  1S4X A;  1VQ5 P;  3AEA C;  2KOG A;  4C7R A;  1WT6 A;  3RBX A;  2JWA A;  2KZI A;  1KYO I;  1MUU A;  3L75 J;  2KXP B;  3V2P A;  3M9Q A;  1HJ0 A;  2ZAE B;  3PJS K;  3Q5R A;  2QIW A;  3CXH H;  3MUD C;  5DJT B;  2YNY A;  1BCC D;  1OIP A;  1S3J A;  1GW4 A;  1VL2 A;  4U3F J;  3R4Y A;  2A45 G;  4N78 E;  1BGY E;  2KUB A;  3BCC J;  5KLV D;  2H88 C;  2OYH A;  1KFM A;  2QE7 H;  2Z5I A;  2R5D A;  1LGH B;  2WWW A;  3CCE P;  1RQU A;  1KB9 E;  1L0N J;  3CC2 P;  1JMM A;  1URQ A;  5APQ A;  3OJA B;  1A02 J;  2D2C B;  3QH9 A;  2CPB A;  3Q5P A;  5AW4 B;  3VP9 A;  1JO5 A;  5APX A;  1EZV E;  1Y8A A;  1YTZ I;  1KIL C;  3R2P A;  3W68 A;  4ASW A;  1MFT A;  4XFJ A;  2YXR B;  3A3Y B;  2HFE D;  5B66 E;  3PLN A;  3VMA A;  1IFD A;  4UB8 E;  2HOD A;  2QJK B;  2OTL P;  3H1L E;  1RE3 A;  2D2C D;  1PZQ A;  3L70 E;  2WQY C;  4N3Y B;  3H1H G;  2LR2 A;  3G4S P;  4HKZ H;  2VRS A;  3QWO C;  5AW0 B;  1P84 D;  1L4A B;  1YYC A;  1JY3 P;  4IFM A;  3U1C A;  2FFD A;  1IFJ A;  3H1J J;  1JEK A;  1L0N K;  2M5A B;  5KKZ B;  3M0D A;  3CX5 D;  3TSI A;  2ZYD A;  2O01 N;  5GTI H;  2GA1 A;  5CCG C;  3L75 G;  2C0W A;  2RMZ A;  4U7J A;  2K9J A;  1L4A D;  3L73 E;  2IYP A;  2OYO A;  4U3F G;  1AQ5 A;  4WY4 B;  2V4H A;  2QM7 A;  1USD A;  5AVT B;  2QA4 P;  3A2A A;  4D6T J;  2Y9Z A;  3SSU A;  3BCC G;  2IDB A;  1SS1 A;  3V2R A;  2OAR A;  1MV8 A;  3WU2 H;  1NAY A;  1BDC A;  3CC7 P;  1L0N G;  5APV A;  3E1R A;  2AEF A;  4PJ0 H;  5TIS H;  1JY2 N;  3L74 E;  3G3Z A;  1ZRT E;  2FXM A;  4Z1M H;  4PD4 D;  5KAI H;  4WY4 D;  1RY3 A;  1K9M Q;  2E74 B;  1VPC A;  2QRX A;  3A0H H;  3HE5 A;  1LWU A;  1H8A A;  4ZMD A;  2MJZ A;  1NTM E;  5CCH A;  4EOT A;  5AVR B;  1PGP A;  1KN7 A;  4DT0 A;  2ZT9 C;  1G1J A;  1AVO A;  3CCM P;  2ZVO B;  1GK6 A;  2JJL A;  3H1H D;  2AXT H;  1PP9 J;  2K9Y A;  4R4L A;  2OYH C;  3ZDM A;  4JQ0 D;  4PV1 B;  3O8Z A;  1USE A;  2E74 D;  3IN6 A;  4Y28 J;  2OQQ A;  1URQ C;  3H1J G;  1VQ4 P;  1KC8 Q;  4BXL A;  4GOE A;  1P84 H;  3GHG A;  1N8R Q;  2GM4 A;  3AEG C;  4TT3 H;  4IL6 H;  3MIW A;  2WSF H;  5KLI C;  4DCK A;  1EDL A;  5AW2 B;  4KT0 J;  5AVV B;  3L75 D;  3VMX A;  4EDF A;  1LT9 C;  1JB0 J;  3KHU A;  4PV1 D;  3CX5 I;  2HLO A;  3L72 E;  2O01 J;  3V2Q A;  4U3F D;  2KS1 A;  4D6T G;  3B4S A;  3HD7 C;  2E75 B;  4H44 C;  4AYC A;  3BCC D;  3GMA A;  1OW8 A;  2P67 A;  1PPJ E;  2JEE A;  2FYN B;  3C9I A;  2A45 I;  3M0D C;  3RK3 C;  1E79 H;  1IFM A;  1Y9B A;  3AE5 C;  3KQG A;  3L71 E;  2JWD A;  1S72 P;  4PD4 H;  2E75 D;  2KSE A;  2QJP B;  3E7K A;  2I1K A;  1GK4 A;  5B5E E;  1KIL E;  1SQQ K;  5K5G B;  4QMA A;  4N6J A;  5TJH A;  3F89 A;  1W5C E;  3AE3 C;  1N7L A;  2KYV A;  3KXD A;  1FZC B;  1PP9 G;  2KSJ A;  4LGD E;  3HUS A;  4Y99 C;  4L75 A;  1SVF A;  5H2F H;  1AQT A;  4I7Z B;  2XNX A;  1N73 C;  4A7P A;  3H1J D;  1ZW0 A;  3LW5 H;  1G2C B;  1N2D C;  3MUD A;  4BRY A;  2Q6Q A;  1BGY J;  2GUS A;  2R3C A;  2IBZ E;  1Z56 A;  1VQL P;  1CI6 A;  2L91 A;  1UIX A;  3LID A;  2IX7 C;  3CPW O;  1LWU C;  2P2U A;  3MZW B;  1FDO A;  3CXH E;  3U59 A;  2YO2 A;  4GDO A;  2NRG A;  2A06 G;  2HPC B;  3B5N C;  2WPQ A;  1SLQ A;  2K88 A;  2RKL A;  3L35 A;  1X0T A;  3VYI A;  2IFN A;  1EDI A;  1QL1 A;  1SQB K;  2B89 A;  3CWB E;  1S9K D;  1M1J B;  1UII A;  1YHQ P;  3RBZ A;  3GHG C;  3EFG A;  3H1L J;  3HE4 B;  4AUW A;  3Q2Y A;  3L70 J;  3CD6 P;  1KIL A;  3JC2 2;  5AVS B;  3M9H A;  4GKG A;  3P7K A;  1FC2 C;  4WWI A;  2ZFC A;  3HTK B;  4L74 A;  5EFW B;  4HB1 A;  2RN0 A;  2H89 C;  4RES B;  1H0T B;  1M7L A;  1SFC C;  2XV5 A;  2W8Z A;  1MZ9 A;  2Y0D A;  3S4R A;  1FU1 A;  4K3A A;  1SQQ E;  3P8C E;  3KZI H;  1RHZ B;  1PP9 D;  3D70 A;  5KAF H;  1GU4 A;  1R5L A;  1JNM A;  4WVZ A;  1BE3 E;  3L73 J;  2W6B A;  1VQM P;  3GF7 A;  1AFO A;  1SQV E;  5CJ4 A;  4JYC A;  1GZL A;  1BGY G;  1NO4 A;  2V7Q H;  1BSN A;  1X9V A;  5GTI E;  4DJG A;  2KI7 B;  1GW3 A;  1VF5 C;  3L74 J;  3EWK A;  3H1I E;  3HRN A;  2WSC J;  2HG5 D;  2A06 D;  1FE6 A;  3MHV A;  1EZV G;  3C1L A;  1RF1 C;  1KQS O;  2GUV A;  1ZXG A;  1VQ8 P;  2E5T A;  1KYO H;  5DJU B;  3AED C;  2J5U A;  3H32 B;  1OZH A;  3MP7 B;  3HUS C;  1KTM A;  2HOD B;  3P32 A;  2M3B A;  3BAT A;  3RL0 B;  4OGQ C;  1SQB E;  1NTM J;  3WU2 E;  1HF9 A;  3H1L G;  4RJT A;  4PJ0 E;  3L70 G;  1X22 A;  3RK3 E;  1DEE G;  5CHX A;  3EFF K;  3TGU D;  1DD3 A;  5KAI E;  2UWJ E;  2JDI H;  2E76 C;  3V5B A;  1DEB A;  1EDJ A;  1LP1 A;  1R8E A;  1K8A Q;  1YIJ P;  2W90 A;  1L0L K;  2LKM A;  3A0H E;  2C0X A;  2K37 A;  2E75 C;  3RL0 D;  1HTL C;  2FYZ A;  2WSE J;  4I6M C;  2K3R A;  3NFQ A;  2K9J B;  1PIX A;  1QL2 A;  3L73 G;  1M1K Q;  3TF5 A;  1NTM K;  1R5S A;  3L72 J;  5AW7 B;  2PRR A;  1LT9 A;  4N78 D;  1BGY D;  4IL6 E;  3WUT A;  1T2K D;  3NMD A;  1IFI A;  4DOJ A;  1VQ9 P;  1GL2 B;  1MFZ A;  1ZN5 A;  1KOR A;  1LTI C;  3L74 G;  3HD7 A;  1FDM A;  2Y9Y A;  1HH0 A;  3SWF A;  1J1D B;  2FYU K;  1NU1 D;  1JY3 N;  1LTJ C;  2WT7 B;  3L71 J;  3HE5 B;  3GW6 A;  1ZR2 A;  2YIU B;  1EXI A;  4ZKU A;  1NTM G;  1KQF B;  1OVV A;  1GL2 D;  2N1T B;  4I1L A;  2NPS B;  3G71 P;  4HJG H;  1SQP K;  1YIT P;  1KZU B;  3IF4 A;  3MGN A;  2C9L Y;  3H1L D;  3L70 D;  1T6A A;  3TNU A;  3CC4 P;  4PD4 E;  5CCH D;  2WMM A;  1Q86 Q;  2ZJS E;  3I5C A;  4RKU J;  2N1T D;  2NPS D;  1L0L E;  4H0L B;  1N7S B;  2QVA A;  1NWQ A;  1LTG C;  1N73 A;  1RE4 C;  4IOI H;  2AEJ A;  2WPR A;  2G8Y A;  4ZNC A;  1JCC A;  2ZYA A;  1QVF O;  5H2F E;  3L73 D;  3L72 G;  1JY2 P;  1NAF A;  1OW6 A;  2JKV A;  5CMZ A;  2FKW B;  1NTZ K;  1DH3 A;  3RK2 C;  2B87 B;  3ABV C;  1K04 A;  1QEX A;  3CWB J;  3H1K E;  1J1E C;  2QJY B;  4H0L D;  3G9R A;  2J58 A;  2WIT A;  2QSI A;  3AE6 C;  3B5N A;  1N7S D;  1AJY A;  3WUU A;  4GIF A;  3FXE A;  2YO3 A;  1PPJ G;  1JY3 O;  2I1J A;  1ZRT D;  1EC5 A;  1Q81 Q;  1WMK A;  3L71 G;  1VQP P;  1X79 B;  3IAO A;  3NXS A;  4NPD A;  5APY A;  4H13 B;  2FYU E;  1KB9 I;  2H7H A;  2W6A A;  2WSS H;  2XKM A;  5KJ7 D;  3CX5 H;  4GOD A;  3VOP A;  5AVZ B;  4WB4 A;  2BCC E; 
#chains in the Genus database with same CATH homology
 1RHZ B;  2YXQ B;  1RH5 B;  3MP7 B;  3JC2 2;  2YXR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...