3MP7B

Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
54
structure length
54
Chain Sequence
IRHFWKESRRAFLVTKKPNWATYKRAAKITGLGIILIGLIGMLIRIVGILILGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Protein transport
molecule keywords Preprotein translocase subunit secY
total genus 15
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 3mp7B00
2YXRB 1RHZB 3JC22 1RH5B 3MP7B 2YXQB
chains in the Genus database with same CATH superfamily
1FZCB 1N73A 1L0LD 3M0AA 3CWBG 3PP5A 4RO0A 3EQ2A 4N6JA 1N7LA 1HWTC 3RL0D 1H88A 3I56P 1L4AD 1EQ7A 3G3ZA 1YHQP 3RGUA 2WSCH 1QL2A 4Y99B 3VMYA 1VQ8P 3E1IA 1PZQA 1URQB 1SVFA 1NTKK 2JEEA 5AVWB 4BWNA 1G2CA 3CXHD 4IFMA 4C7RA 3H32A 3KZIH 1GL2A 3H1LD 2KNCA 1PV3A 2V7QJ 1QGKB 2N1TC 3R4YA 4DT0A 1OW6A 5KLVK 1NJIQ 3L75G 2CPSA 1CI6A 2V7QH 3L74G 4PV1C 4WVZA 1PPJG 5KAFE 1OIPA 4ASVA 2KZIA 2YO2A 2M0BA 5DJUB 2K9JA 2R5BA 5KLVD 1KQFB 1LTJC 1J1DC 2KLVA 1OVUA 2V4HA 2W6JH 3HE4B 2ZYGA 1KB9D 1KFNA 4U3FE 1K05A 1QX8A 1W2BO 1NOHA 2SPZA 2WPQA 1XTCC 1IFJA 4UB8H 3H1KE 2R3SA 3T97A 1M90Q 2I1KA 2OTLP 2ZYAA 4GT1A 1VQOP 4EIJA 1HVVA 1MV8A 5AW2B 2I1JA 4H13D 4WY4B 3M9BA 4KT0J 4AUWA 1X79B 1PL5A 1FDMA 5L8RJ 2Q5UA 1RQVA 1QLED 1HTLC 1SQBG 1WRGA 2AEFA 4TT3H 1Q7YQ 3E1RA 2WPVB 3HRNA 3AEAC 2BCCE 1NU1J 4HJGH 4IL6E 3VTPC 3SWFA 1VQNP 1IFIA 3AE4C 3B5ND 1SQXG 3A2AA 2D2CC 1IFDA 1LNQA 1W5CE 2W6BA 1QEXA 3A7OA 3L72D 4I7ZC 1AA0A 4GOEA 5EFWB 5AVVB 5AVXB 3G6EP 1KQSO 1T3UA 2WSEJ 4U3FG 3V2NA 3ITKA 3L73G 2YNYA 4H13C 3VOPA 2ZT9C 5CCHC 4EOTA 4N3YB 4PJ0H 3BCCD 1KB9E 1X8YA 2K3RA 3MGNA 3RK2C 5GTHE 1PFIA 1PPJE 3P7KA 3T97B 3FWLA 3SSUA 1BDCA 3M9QA 2FYUJ 2AXTE 2W8ZA 2WT7A 2IFNA 1BE3J 1LT9A 3L75D 3JCUH 3Q2YA 1TU3F 4IL6X 4DCKA 2IYPA 3O6QA 2P1JA 5APUA 2FYNB 4RESB 1JMMA 2IBZG 1NO4A 1YQ4C 1JCCA 2KK7A 1FZBA 2W83C 3L70J 3TGUD 2A06G 1M8OB 3CWBD 1S1CX 1KB9I 1VL2A 2BEQD 3MD0A 4N78E 1S5LX 2XDJA 4WWIA 2G8YA 3GHGB 3WUTA 1L4AA 2B89A 1T2KC 1GU4A 1J2JB 1SQQG 5AVUB 3U1CA 1KC8Q 3Q5RA 1NU1K 3AE9C 1AFOA 4H44B 3AEBC 3LIDA 3FXDA 3EFGA 4OVNF 3GLMA 1OFCX 1BCCE 4H44C 2MJZA 2OYOA 1L4AC 3W68A 5B5EH 1N73C 2WMMA 3CXHE 1HUCA 3CD6P 1YQ3C 2C0WA 3GG2A 3M9HA 3TYYA 1S4XA 3A0HH 1NTKJ 3MTUE 1G1JA 4BRYA 2HPCA 1FOSF 1LT1A 5AVSB 1ZXGA 1U7MA 1NH4A 4D6TE 1DEBA 3MHVA 4TLFA 3CCJP 2LR2A 3MP7B 2FYUK 4IFFA 5CCGD 2O01H 3B8EB 4GDOA 2FYUE 4A7PA 1JO5A 4U3FD 1HF9A 1EDIA 2JP3A 2ZXXA 3S1KA 4C7NA 1SQQD 3BCCG 1R5LA 5AW3B 3H1KD 5KAIH 4N78D 4L75A 2D2CD 2FKWB 3P8MC 2NPSB 3W67A 1L0NE 3VP8A 1LTAC 1H8AA 1AQ5A 3H1IJ 2PFXA 2QJYC 2YIUB 1NTZJ 1ZN5A 5KKZB 2M8RA 2P58A 5CCHA 1AV1A 1VQ4P 5CBNA 3V4QA 1SQVJ 3E7KA 3CXHI 3KXDA 3MUDC 2IZ0A 1ZR4A 4OGQD 1YIJP 1JUNA 1NWQA 3KPEA 2OYIA 2OYIB 1MUUA 2O01J 2Y0EA 1MFTA 5AW8B 1SFCA 2D2CB 1JNMA 3G71P 1K9MQ 5CHXA 3A5TA 2QJKB 2W27A 1P84D 5TISH 1NU1E 1DIPA 1AVOA 2WSFJ 1LWUC 2C0XA 1RQUA 5M1BA 4Z1MH 2FFDC 1RF0A 1JCDA 3H6PA 3CCMP 3CCQP 1ZLLA 5B5EE 3WU2H 5KLIB 2RMZA 3IFMA 2YXRB 3BCCE 1VQ7P 2Z4EA 1N2DC 1SQQE 3H1LJ 3V6IA 1PPJD 2E76D 2QEXP 1RE3A 3IN6A 5H2FE 2OTJP 2N1TD 3SFDC 2E42A 2WPSA 4JPZB 3U59A 1L0ND 1N7SB 1URQD 2WITA 3IF4A 3O6QB 4PD4I 3VYIA 2K88A 3CCRP 1H0TB 1YYCA 2R44A 1OX3A 3C9IA 1SS1A 1USDA 3G9RA 2YKQA 3GW6A 2PGDA 3CWBE 1S3JA 1RHZB 2KS1A 2W90A 1L0LJ 2Y0CA 2Z5HA 3GHGC 1RH5B 1FJPA 2I8DA 2N1TB 2FXPA 2HODA 2ZT9D 1URQA 1YBKA 2P7JA 1DD4A 2HLOA 3L74J 3SFEC 1SP4A 2E74C 1HH0A 3L73J 1L0LK 1KILA 3SWYA 1ZMEC 3KDPB 4JBZA 3B4SA 2POHA 2KZJA 1GK6A 2HG5D 1BCCD 3CI9A 2OYHA 2XNDH 5AVTB 4ZNCA 1IK7A 3AE1C 1FE6A 2G3AA 1NKNA 1ZW0A 2KSEA 1SQPD 3AEFC 3RK2B 1FZCC 3M0DC 1SQPG 3I55P 1N7SC 4D6TD 3RBXA 1IK9A 1NYHA 3M91A 5AVRB 2Y0DA 1Y47A 2E75D 2FXMA 2FYUD 4WB4A 1SQBJ 3GF7A 3S4RA 2OGUA 4C7NB 2OYHB 1EXJA 1JY3O 1NU1G 1RY3A 3L35A 2CK3H 2DW3A 4IOIH 2KUBA 1S5LH 3TNUB 1CW5A 4GKGA 5E79H 2HFED 1XTGB 1JY2P 3H1ID 1EZVG 3HD7A 1GDTA 3TNUA 1LWUB 3M06A 1S72P 3CPWO 1NTZK 2KNCB 2QJKC 3AE5C 1T6AA 1EDLA 3OAKA 1PP9J 3H32B 2QA4P 1FDIA 1YJ9P 1FOSE 1KILC 1JY3P 2N1TA 3WU2E 5B66H 1PGOA 3GMAA 1P84E 3BRVB 1NU1D 1SQPE 3RL0B 3CCLP 1HGVA 1J1DB 2HODB 4DZOA 3LIEA 1NAFA 1JY3N 3GHGA 3VMZA 1SQXE 1FC2C 2NPSC 1L0NK 1IFMA 4W7ZA 4RJTA 1HBWA 2O01N 5CJ0A 3EFFK 1FBMA 1FZFA 3V2RA 1NTZG 2K9JB 1SQBK 1JY2N 2OQQA 3KZIE 2ZVOB 3Q1MA 3SWKA 1OMIA 2WTYA 5E79E 2J58A 2E76C 2JO1A 4KJMA 3H25A 3CMEP 1QVGO 2L91A 2C9NY 1PP9G 1RE4A 4IFDK 2NRGA 1PP9D 1N73B 1NHLA 1EZVE 2VRSA 4HB1A 3HE5B 3MZWB 1VPCA 4GOFA 5GTIH 3AEGC 3WUVA 1S9KD 1LTTC 1VQ9P 3L74D 1DH3A 2ZFCA 4I6MC 1USEA 4JQ0D 2P10A 1PGJA 4PD4H 1E5WA 3VP9A 3H1JD 1ZOYC 2IBZI 3NFQA 1P84H 1SQXD 3H1JG 3LW5H 3V2PA 2WSFH 3CC2P 2WZ7A 3BASA 3BCCJ 2FYZA 1VF5C 3L72G 3FGAD 3PTZA 3L36A 4JYCA 4PJ0E 4R4MA 4WY4A 2J59M 3IR9A 1KD1Q 3MUDA 4XFJA 2H8PD 2B87A 1RF1B 2K1AA 3TGUG 2B87B 1KORA 5BU5A 3C1LA 1RF1A 4LC1A 1KZUB 2FYNC 4D6TJ 1QVFO 2WSEH 4HKZH 1EXIA 2HYNA 2Y9ZA 1NTMD 3PH0A 3ZDMA 1JTHB 5APWA 4Y28J 1A02F 1M7LA 2YXQB 3V5BA 1LJ2A 5CCGC 3A3YB 1AJYA 1NVOA 2LKMA 1EZVD 1U57A 3C8VA 1T8ZA 2WSCJ 2JWDA 2A45H 3CX5D 3N7NA 4ZKPA 3Q5SA 3H1IE 1JB0J 3AECC 1S9KE 5TJHA 5DJTB 2YO3A 5APVA 5H2FH 1JM0A 1KILB 3U1AA 1BGYG 3FXEA 4JF7A 1KN7A 2H88C 2QG4A 2NPSD 2K9YA 3AE6C 2IX7C 3CX5I 3H1JE 3JCUE 3K5BA 3R2PA 2Z5IA 4JYBA 4L73A 5APXA 4YPCA 2FYUG 3IAOA 2IDBA 3H1LG 1SFCC 3HTKB 3TK1A 2IYOA 2WVRA 3AE7C 4LGDE 3HD7C 5KLIC 2R5DA 2KP8A 3WMM0 1VQPP 3TGUJ 2M3EA 4OGQB 2LXBA 4OGQC 1OW7A 2Q1KA 5AVZB 4AQRD 3Q5PA 1Q81Q 1HJBA 2A45I 1CZQA 1LTGC 4UB6E 1T2KD 3AE3C 3V2QA 3F5HA 2IFMA 1RE4C 3HD7B 1KYOH 4ASWA 4C46A 3EWKA 1HJ0A 1W2EA 5AVQB 3CX5H 5GTIE 1VQKP 2W6AA 2R32A 2FFDA 2QSIA 2RN0A 3II6A 1PGQA 2JJLA 1SQQJ 2E43A 4DJGA 1GW4A 1AQTA 2Q9IA 1Y9BA 2AEMA 1PIXA 2O1JA 1BGYJ 2QJYB 2YIUC 1SQQK 3HUSC 3PRJA 1SQBD 1X22A 1VF5D 1FZEA 4BRYB 3UIAA 4UB8E 4ZKUA 1FZAA 1PP9E 2PP6A 2KOGA 2FY8A 2XZRA 1GTWA 5KJ7C 1Q90D 2IZ1A 4I1LA 2E74B 1EDKA 1L0NG 1PGPA 1SQPJ 2KYVA 3CMAP 3L74E 1EC5A 2KSJA 2QIWA 2E5TA 2QM7A 3TGUE 4Y99C 1NGMB 5AW7B 3D70A 4O9BA 4WY4D 1Q86Q 1VF5B 2ZXEB 4R4LA 4UB6H 5KTBA 1IZNB 4W80A 1A02J 3G4SP 2QJPC 3S9OA 5AW4B 3L70D 4YXDC 1X9VA 2PRRA 1RE3C 2FBWC 2FXOA 1L4AB 2NZ2A 2Q3EA 2E74D 3A0HE 4U3FJ 3RL0g 4KHXA 2E5YA 1ZR2A 4AYCA 3CLQA 1KQLA 4HH2A 1CSBA 2ZYDA 2QRXA 3B5NB 3H1HD 1VQ5P 1K73Q 2KI7B 3VMXA 1NKZB 3D6ZA 5AW1B 2GM4A 5CJ4A 3P8CD 1GMJA 2KLUA 2H89C 5CMZA 4H0LD 1SQBE 2KIKA 1NTME 3RK3E 1NTMK 1J1EC 1BGYE 2E76B 2JWAA 4MN4C 1NTZD 4OWFA 3CCSP 1L0NJ 2E75C 3L70G 1MZ9A 3CX5E 1IFNA 3NTNA 2OYHC 1N7SD 1VQMP 1Y8AA 1VQ6P 1YTZT 1GW3A 1GL2B 2O1KA 3L72J 1OXZA 1ZRTD 2L5GB 1S2EA 2UWJE 4H0LB 4NPFX 1SQPK 5BU8B 2OYIC 1OW8A 1OWAA 2QE7H 2PAJA 3RBZA 3D71A 2KS1B 4GODA 5AW0B 1KB9H 5APQA 2A06E 2ZT9B 3RK3B 4H13B 4QMAA 3RK3C 1H0TA 1LP1A 2IPPA 3LW5J 3FWNA 1YJNP 5KLVG 3AEEC 3HUSA 4GIFA 1FS0E 1GL2D 5KJ7D 3CCEP 1JTHA 1WT6A 3RL0C 3H1HE 3L71J 2Q7CA 3CC7P 2A45G 3L75J 2P2UA 1LT9C 1L0LG 1NTKG 1SFCD 4I2LC 3P8CE 2NPSA 5CCHD 4H44D 1BDDA 1SQVD 3NMDA 4IL6H 1Z56A 1H89A 5APTA 1VQLP 3L71D 1KTMA 3RK3D 3OA7A 1BGYD 1JEKA 1OZHA 2B88A 2BCCJ 1KILE 1L2PA 2WWWA 1J1EB 3FX0A 2AXCA 2KB7P 2RKLA 3M0DA 4EI2A 2XV5A 1LTJA 1LTBC 2IBZE 1NTMJ 2XKMA 4K3AA 4WY4C 1SFCB 1YI2P 4U7JA 1GU5A 2M3BA 2YKOA 1E79H 1LWUA 2ITAA 1ZRTE 3CWBJ 1M1JC 3NXSA 3PHLA 4PV1D 1KMIZ 1M57D 1UIXA 1RF0C 2WQYC 1OVVA 1KYOD 3AE2C 3CC4P 1LTSC 4YXWH 1DX7A 3CCVP 1BCCG 2YKPA 3MIWA 1SQVG 2A06D 3BVHA 1VDFA 3L73E 1LTJB 1NTKD 1FAVA 5KJ7A 4NPEA 2HR3A 2QJPB 2YMKA 1X0TA 2OTKE 1K04A 3BRTB 4HYTB 1BE3E 1SQXJ 4D6TG 4EYYQ 4PD4D 3RK2D 5K5GB 4PV1B 2H43A 4RKUJ 2N9YB 2OARA 3PJSK 3D6YA 1DD3A 1N86A 3CXHH 1JOCA 1DEEG 1JMBA 3L70E 1ZP0C 1ZV8A 1LTIC 2GUVA 3L37A 2O3JA 3H1HJ 3L71E 4WBAA 3USSA 3N4XA 2WSSH 1UIIA 4OH8B 4XA4A 1IC2A 5TISE 5B66E 1Q2NA 1KILD 3TSIA 1NTMG 1RF1C 1L0LE 1N8RQ 2R3CA 1LP1B 2IBZD 3HUSB 3ABVC 3AEDC 4XE5B 1CI6B 4W7YA 1GZLA 3KHUA 4LLHA 4L76A 1P84I 3KYQA 2H7HA 5AW9B 1BCCJ 3HE5A 5KAIE 1S5LE 3OW2O 3Q3DA 1NTZE 3TDKA 1FZGA 4NPDA 2JKVA 1OVRA 2BASA 4I7ZB 1LGHB 3OJAB 3L73D 1M1JB 2M5AA 5C39A 1NTKE 1M1JA 2M5AB 3VMAA 2P67A 3CCUP 1M1KQ 3WUUA 1IJDB 1BE3D 2Y9YA 1YITP 1YTZI 3QH9A 5AW5B 4CPGA 1FDOA 2K37A 2Q3IA 5KLVE 4B86A 1R8EA 2XNXA 3PLNA 3A0BE 3H1HG 2FFDB 1D7MA 3QWOC 1T3JA 2YMYA 4DOJA 3F89A 2BEZF 2WT7B 2ZJSE 1LT9B 1MKMA 3V4WA 2JR8A 1GK4A 3B5NA 3HTKA 1YJWP 1R5SA 1K8AQ 5AVYB 1JY2O 3H1KG 1SQVE 2ZAEB 1BE3G 1FJKA 5AW6B 5BVZA 1NAYA 1M56D 3HD7D 1WMKA 2KXPB 2CPBA 2N9BA 2Q6QA 2QVAA 2RH0A 3O8ZA 2BCCD 3JSVC 4K35A 5KKZC 1KFMA 3AE8C 3H1JJ 3BATA 1GL2C 3VN0A 4H0LC 1QL1A 1KYOI 1U7JA 1G1IA 2MKVA 3GF3A 1EZVI 3H1IG 1KQGB 2GUSA 3L72E 5GTHH 1Q82Q 1IO4A 1BSHA 1MFZA 1URQC 1KYOE 3TF5A 2E75B 4M3LA 5KLVJ 5CBOA 1FU1A 3B71A 5CCGA 4EDFA 1GD2E 1G2CB 2AXTH 3L71G 3H1LE 3P32A 2JDIH 5KAFH 2XU6A 5APSA 2AEJA 3A0BH 3JC22 2J5UA 2QM8A 4BXLA 4YTPC 2B9BA 4ZMDA 1EDJA 4PD4E 1BSNA 1SQVK 2GA1A 2WPRA 3L75E 5APYA 3B5NC 3H1KJ 1KV4A 2BCCG 4L74A 3I5CA 1AVYA 1SQXK 2LXCB 3CL3D 2C9LY 1FZCA 2ZVNB 1SLQA 3HE4A 2HPCB 1IFPA 3L4FA 1N7SA 3KQGA 1HGZA
chains in the Genus database with same CATH topology
2YXRB 1RHZB 3JC22 1RH5B 3MP7B 2YXQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YXR B;  1RHZ B;  3JC2 2;  1RH5 B;  3MP7 B;  2YXQ B; 
#chains in the Genus database with same CATH topology
 1FZC B;  1N73 A;  1L0L D;  3M0A A;  3CWB G;  3PP5 A;  4RO0 A;  3EQ2 A;  4N6J A;  1N7L A;  1HWT C;  3RL0 D;  1H88 A;  3I56 P;  1L4A D;  1EQ7 A;  3G3Z A;  1YHQ P;  3RGU A;  2WSC H;  1QL2 A;  4Y99 B;  3VMY A;  1VQ8 P;  3E1I A;  1PZQ A;  1URQ B;  1SVF A;  1NTK K;  2JEE A;  5AVW B;  4BWN A;  1G2C A;  3CXH D;  4IFM A;  4C7R A;  3H32 A;  3KZI H;  1GL2 A;  3H1L D;  2KNC A;  1PV3 A;  2V7Q J;  1QGK B;  2N1T C;  3R4Y A;  4DT0 A;  1OW6 A;  5KLV K;  1NJI Q;  3L75 G;  2CPS A;  1CI6 A;  2V7Q H;  3L74 G;  4PV1 C;  4WVZ A;  1PPJ G;  5KAF E;  1OIP A;  4ASV A;  2KZI A;  2YO2 A;  2M0B A;  5DJU B;  2K9J A;  2R5B A;  5KLV D;  1KQF B;  1LTJ C;  1J1D C;  2KLV A;  1OVU A;  2V4H A;  2W6J H;  3HE4 B;  2ZYG A;  1KB9 D;  1KFN A;  4U3F E;  1K05 A;  1QX8 A;  1W2B O;  1NOH A;  2SPZ A;  2WPQ A;  1XTC C;  1IFJ A;  4UB8 H;  3H1K E;  2R3S A;  3T97 A;  1M90 Q;  2I1K A;  2OTL P;  2ZYA A;  4GT1 A;  1VQO P;  4EIJ A;  1HVV A;  1MV8 A;  5AW2 B;  2I1J A;  4H13 D;  4WY4 B;  3M9B A;  4KT0 J;  4AUW A;  1X79 B;  1PL5 A;  1FDM A;  5L8R J;  2Q5U A;  1RQV A;  1QLE D;  1HTL C;  1SQB G;  1WRG A;  2AEF A;  4TT3 H;  1Q7Y Q;  3E1R A;  2WPV B;  3HRN A;  3AEA C;  2BCC E;  1NU1 J;  4HJG H;  4IL6 E;  3VTP C;  3SWF A;  1VQN P;  1IFI A;  3AE4 C;  3B5N D;  1SQX G;  3A2A A;  2D2C C;  1IFD A;  1LNQ A;  1W5C E;  2W6B A;  1QEX A;  3A7O A;  3L72 D;  4I7Z C;  1AA0 A;  4GOE A;  5EFW B;  5AVV B;  5AVX B;  3G6E P;  1KQS O;  1T3U A;  2WSE J;  4U3F G;  3V2N A;  3ITK A;  3L73 G;  2YNY A;  4H13 C;  3VOP A;  2ZT9 C;  5CCH C;  4EOT A;  4N3Y B;  4PJ0 H;  3BCC D;  1KB9 E;  1X8Y A;  2K3R A;  3MGN A;  3RK2 C;  5GTH E;  1PFI A;  1PPJ E;  3P7K A;  3T97 B;  3FWL A;  3SSU A;  1BDC A;  3M9Q A;  2FYU J;  2AXT E;  2W8Z A;  2WT7 A;  2IFN A;  1BE3 J;  1LT9 A;  3L75 D;  3JCU H;  3Q2Y A;  1TU3 F;  4IL6 X;  4DCK A;  2IYP A;  3O6Q A;  2P1J A;  5APU A;  2FYN B;  4RES B;  1JMM A;  2IBZ G;  1NO4 A;  1YQ4 C;  1JCC A;  2KK7 A;  1FZB A;  2W83 C;  3L70 J;  3TGU D;  2A06 G;  1M8O B;  3CWB D;  1S1C X;  1KB9 I;  1VL2 A;  2BEQ D;  3MD0 A;  4N78 E;  1S5L X;  2XDJ A;  4WWI A;  2G8Y A;  3GHG B;  3WUT A;  1L4A A;  2B89 A;  1T2K C;  1GU4 A;  1J2J B;  1SQQ G;  5AVU B;  3U1C A;  1KC8 Q;  3Q5R A;  1NU1 K;  3AE9 C;  1AFO A;  4H44 B;  3AEB C;  3LID A;  3FXD A;  3EFG A;  4OVN F;  3GLM A;  1OFC X;  1BCC E;  4H44 C;  2MJZ A;  2OYO A;  1L4A C;  3W68 A;  5B5E H;  1N73 C;  2WMM A;  3CXH E;  1HUC A;  3CD6 P;  1YQ3 C;  2C0W A;  3GG2 A;  3M9H A;  3TYY A;  1S4X A;  3A0H H;  1NTK J;  3MTU E;  1G1J A;  4BRY A;  2HPC A;  1FOS F;  1LT1 A;  5AVS B;  1ZXG A;  1U7M A;  1NH4 A;  4D6T E;  1DEB A;  3MHV A;  4TLF A;  3CCJ P;  2LR2 A;  3MP7 B;  2FYU K;  4IFF A;  5CCG D;  2O01 H;  3B8E B;  4GDO A;  2FYU E;  4A7P A;  1JO5 A;  4U3F D;  1HF9 A;  1EDI A;  2JP3 A;  2ZXX A;  3S1K A;  4C7N A;  1SQQ D;  3BCC G;  1R5L A;  5AW3 B;  3H1K D;  5KAI H;  4N78 D;  4L75 A;  2D2C D;  2FKW B;  3P8M C;  2NPS B;  3W67 A;  1L0N E;  3VP8 A;  1LTA C;  1H8A A;  1AQ5 A;  3H1I J;  2PFX A;  2QJY C;  2YIU B;  1NTZ J;  1ZN5 A;  5KKZ B;  2M8R A;  2P58 A;  5CCH A;  1AV1 A;  1VQ4 P;  5CBN A;  3V4Q A;  1SQV J;  3E7K A;  3CXH I;  3KXD A;  3MUD C;  2IZ0 A;  1ZR4 A;  4OGQ D;  1YIJ P;  1JUN A;  1NWQ A;  3KPE A;  2OYI A;  2OYI B;  1MUU A;  2O01 J;  2Y0E A;  1MFT A;  5AW8 B;  1SFC A;  2D2C B;  1JNM A;  3G71 P;  1K9M Q;  5CHX A;  3A5T A;  2QJK B;  2W27 A;  1P84 D;  5TIS H;  1NU1 E;  1DIP A;  1AVO A;  2WSF J;  1LWU C;  2C0X A;  1RQU A;  5M1B A;  4Z1M H;  2FFD C;  1RF0 A;  1JCD A;  3H6P A;  3CCM P;  3CCQ P;  1ZLL A;  5B5E E;  3WU2 H;  5KLI B;  2RMZ A;  3IFM A;  2YXR B;  3BCC E;  1VQ7 P;  2Z4E A;  1N2D C;  1SQQ E;  3H1L J;  3V6I A;  1PPJ D;  2E76 D;  2QEX P;  1RE3 A;  3IN6 A;  5H2F E;  2OTJ P;  2N1T D;  3SFD C;  2E42 A;  2WPS A;  4JPZ B;  3U59 A;  1L0N D;  1N7S B;  1URQ D;  2WIT A;  3IF4 A;  3O6Q B;  4PD4 I;  3VYI A;  2K88 A;  3CCR P;  1H0T B;  1YYC A;  2R44 A;  1OX3 A;  3C9I A;  1SS1 A;  1USD A;  3G9R A;  2YKQ A;  3GW6 A;  2PGD A;  3CWB E;  1S3J A;  1RHZ B;  2KS1 A;  2W90 A;  1L0L J;  2Y0C A;  2Z5H A;  3GHG C;  1RH5 B;  1FJP A;  2I8D A;  2N1T B;  2FXP A;  2HOD A;  2ZT9 D;  1URQ A;  1YBK A;  2P7J A;  1DD4 A;  2HLO A;  3L74 J;  3SFE C;  1SP4 A;  2E74 C;  1HH0 A;  3L73 J;  1L0L K;  1KIL A;  3SWY A;  1ZME C;  3KDP B;  4JBZ A;  3B4S A;  2POH A;  2KZJ A;  1GK6 A;  2HG5 D;  1BCC D;  3CI9 A;  2OYH A;  2XND H;  5AVT B;  4ZNC A;  1IK7 A;  3AE1 C;  1FE6 A;  2G3A A;  1NKN A;  1ZW0 A;  2KSE A;  1SQP D;  3AEF C;  3RK2 B;  1FZC C;  3M0D C;  1SQP G;  3I55 P;  1N7S C;  4D6T D;  3RBX A;  1IK9 A;  1NYH A;  3M91 A;  5AVR B;  2Y0D A;  1Y47 A;  2E75 D;  2FXM A;  2FYU D;  4WB4 A;  1SQB J;  3GF7 A;  3S4R A;  2OGU A;  4C7N B;  2OYH B;  1EXJ A;  1JY3 O;  1NU1 G;  1RY3 A;  3L35 A;  2CK3 H;  2DW3 A;  4IOI H;  2KUB A;  1S5L H;  3TNU B;  1CW5 A;  4GKG A;  5E79 H;  2HFE D;  1XTG B;  1JY2 P;  3H1I D;  1EZV G;  3HD7 A;  1GDT A;  3TNU A;  1LWU B;  3M06 A;  1S72 P;  3CPW O;  1NTZ K;  2KNC B;  2QJK C;  3AE5 C;  1T6A A;  1EDL A;  3OAK A;  1PP9 J;  3H32 B;  2QA4 P;  1FDI A;  1YJ9 P;  1FOS E;  1KIL C;  1JY3 P;  2N1T A;  3WU2 E;  5B66 H;  1PGO A;  3GMA A;  1P84 E;  3BRV B;  1NU1 D;  1SQP E;  3RL0 B;  3CCL P;  1HGV A;  1J1D B;  2HOD B;  4DZO A;  3LIE A;  1NAF A;  1JY3 N;  3GHG A;  3VMZ A;  1SQX E;  1FC2 C;  2NPS C;  1L0N K;  1IFM A;  4W7Z A;  4RJT A;  1HBW A;  2O01 N;  5CJ0 A;  3EFF K;  1FBM A;  1FZF A;  3V2R A;  1NTZ G;  2K9J B;  1SQB K;  1JY2 N;  2OQQ A;  3KZI E;  2ZVO B;  3Q1M A;  3SWK A;  1OMI A;  2WTY A;  5E79 E;  2J58 A;  2E76 C;  2JO1 A;  4KJM A;  3H25 A;  3CME P;  1QVG O;  2L91 A;  2C9N Y;  1PP9 G;  1RE4 A;  4IFD K;  2NRG A;  1PP9 D;  1N73 B;  1NHL A;  1EZV E;  2VRS A;  4HB1 A;  3HE5 B;  3MZW B;  1VPC A;  4GOF A;  5GTI H;  3AEG C;  3WUV A;  1S9K D;  1LTT C;  1VQ9 P;  3L74 D;  1DH3 A;  2ZFC A;  4I6M C;  1USE A;  4JQ0 D;  2P10 A;  1PGJ A;  4PD4 H;  1E5W A;  3VP9 A;  3H1J D;  1ZOY C;  2IBZ I;  3NFQ A;  1P84 H;  1SQX D;  3H1J G;  3LW5 H;  3V2P A;  2WSF H;  3CC2 P;  2WZ7 A;  3BAS A;  3BCC J;  2FYZ A;  1VF5 C;  3L72 G;  3FGA D;  3PTZ A;  3L36 A;  4JYC A;  4PJ0 E;  4R4M A;  4WY4 A;  2J59 M;  3IR9 A;  1KD1 Q;  3MUD A;  4XFJ A;  2H8P D;  2B87 A;  1RF1 B;  2K1A A;  3TGU G;  2B87 B;  1KOR A;  5BU5 A;  3C1L A;  1RF1 A;  4LC1 A;  1KZU B;  2FYN C;  4D6T J;  1QVF O;  2WSE H;  4HKZ H;  1EXI A;  2HYN A;  2Y9Z A;  1NTM D;  3PH0 A;  3ZDM A;  1JTH B;  5APW A;  4Y28 J;  1A02 F;  1M7L A;  2YXQ B;  3V5B A;  1LJ2 A;  5CCG C;  3A3Y B;  1AJY A;  1NVO A;  2LKM A;  1EZV D;  1U57 A;  3C8V A;  1T8Z A;  2WSC J;  2JWD A;  2A45 H;  3CX5 D;  3N7N A;  4ZKP A;  3Q5S A;  3H1I E;  1JB0 J;  3AEC C;  1S9K E;  5TJH A;  5DJT B;  2YO3 A;  5APV A;  5H2F H;  1JM0 A;  1KIL B;  3U1A A;  1BGY G;  3FXE A;  4JF7 A;  1KN7 A;  2H88 C;  2QG4 A;  2NPS D;  2K9Y A;  3AE6 C;  2IX7 C;  3CX5 I;  3H1J E;  3JCU E;  3K5B A;  3R2P A;  2Z5I A;  4JYB A;  4L73 A;  5APX A;  4YPC A;  2FYU G;  3IAO A;  2IDB A;  3H1L G;  1SFC C;  3HTK B;  3TK1 A;  2IYO A;  2WVR A;  3AE7 C;  4LGD E;  3HD7 C;  5KLI C;  2R5D A;  2KP8 A;  3WMM 0;  1VQP P;  3TGU J;  2M3E A;  4OGQ B;  2LXB A;  4OGQ C;  1OW7 A;  2Q1K A;  5AVZ B;  4AQR D;  3Q5P A;  1Q81 Q;  1HJB A;  2A45 I;  1CZQ A;  1LTG C;  4UB6 E;  1T2K D;  3AE3 C;  3V2Q A;  3F5H A;  2IFM A;  1RE4 C;  3HD7 B;  1KYO H;  4ASW A;  4C46 A;  3EWK A;  1HJ0 A;  1W2E A;  5AVQ B;  3CX5 H;  5GTI E;  1VQK P;  2W6A A;  2R32 A;  2FFD A;  2QSI A;  2RN0 A;  3II6 A;  1PGQ A;  2JJL A;  1SQQ J;  2E43 A;  4DJG A;  1GW4 A;  1AQT A;  2Q9I A;  1Y9B A;  2AEM A;  1PIX A;  2O1J A;  1BGY J;  2QJY B;  2YIU C;  1SQQ K;  3HUS C;  3PRJ A;  1SQB D;  1X22 A;  1VF5 D;  1FZE A;  4BRY B;  3UIA A;  4UB8 E;  4ZKU A;  1FZA A;  1PP9 E;  2PP6 A;  2KOG A;  2FY8 A;  2XZR A;  1GTW A;  5KJ7 C;  1Q90 D;  2IZ1 A;  4I1L A;  2E74 B;  1EDK A;  1L0N G;  1PGP A;  1SQP J;  2KYV A;  3CMA P;  3L74 E;  1EC5 A;  2KSJ A;  2QIW A;  2E5T A;  2QM7 A;  3TGU E;  4Y99 C;  1NGM B;  5AW7 B;  3D70 A;  4O9B A;  4WY4 D;  1Q86 Q;  1VF5 B;  2ZXE B;  4R4L A;  4UB6 H;  5KTB A;  1IZN B;  4W80 A;  1A02 J;  3G4S P;  2QJP C;  3S9O A;  5AW4 B;  3L70 D;  4YXD C;  1X9V A;  2PRR A;  1RE3 C;  2FBW C;  2FXO A;  1L4A B;  2NZ2 A;  2Q3E A;  2E74 D;  3A0H E;  4U3F J;  3RL0 g;  4KHX A;  2E5Y A;  1ZR2 A;  4AYC A;  3CLQ A;  1KQL A;  4HH2 A;  1CSB A;  2ZYD A;  2QRX A;  3B5N B;  3H1H D;  1VQ5 P;  1K73 Q;  2KI7 B;  3VMX A;  1NKZ B;  3D6Z A;  5AW1 B;  2GM4 A;  5CJ4 A;  3P8C D;  1GMJ A;  2KLU A;  2H89 C;  5CMZ A;  4H0L D;  1SQB E;  2KIK A;  1NTM E;  3RK3 E;  1NTM K;  1J1E C;  1BGY E;  2E76 B;  2JWA A;  4MN4 C;  1NTZ D;  4OWF A;  3CCS P;  1L0N J;  2E75 C;  3L70 G;  1MZ9 A;  3CX5 E;  1IFN A;  3NTN A;  2OYH C;  1N7S D;  1VQM P;  1Y8A A;  1VQ6 P;  1YTZ T;  1GW3 A;  1GL2 B;  2O1K A;  3L72 J;  1OXZ A;  1ZRT D;  2L5G B;  1S2E A;  2UWJ E;  4H0L B;  4NPF X;  1SQP K;  5BU8 B;  2OYI C;  1OW8 A;  1OWA A;  2QE7 H;  2PAJ A;  3RBZ A;  3D71 A;  2KS1 B;  4GOD A;  5AW0 B;  1KB9 H;  5APQ A;  2A06 E;  2ZT9 B;  3RK3 B;  4H13 B;  4QMA A;  3RK3 C;  1H0T A;  1LP1 A;  2IPP A;  3LW5 J;  3FWN A;  1YJN P;  5KLV G;  3AEE C;  3HUS A;  4GIF A;  1FS0 E;  1GL2 D;  5KJ7 D;  3CCE P;  1JTH A;  1WT6 A;  3RL0 C;  3H1H E;  3L71 J;  2Q7C A;  3CC7 P;  2A45 G;  3L75 J;  2P2U A;  1LT9 C;  1L0L G;  1NTK G;  1SFC D;  4I2L C;  3P8C E;  2NPS A;  5CCH D;  4H44 D;  1BDD A;  1SQV D;  3NMD A;  4IL6 H;  1Z56 A;  1H89 A;  5APT A;  1VQL P;  3L71 D;  1KTM A;  3RK3 D;  3OA7 A;  1BGY D;  1JEK A;  1OZH A;  2B88 A;  2BCC J;  1KIL E;  1L2P A;  2WWW A;  1J1E B;  3FX0 A;  2AXC A;  2KB7 P;  2RKL A;  3M0D A;  4EI2 A;  2XV5 A;  1LTJ A;  1LTB C;  2IBZ E;  1NTM J;  2XKM A;  4K3A A;  4WY4 C;  1SFC B;  1YI2 P;  4U7J A;  1GU5 A;  2M3B A;  2YKO A;  1E79 H;  1LWU A;  2ITA A;  1ZRT E;  3CWB J;  1M1J C;  3NXS A;  3PHL A;  4PV1 D;  1KMI Z;  1M57 D;  1UIX A;  1RF0 C;  2WQY C;  1OVV A;  1KYO D;  3AE2 C;  3CC4 P;  1LTS C;  4YXW H;  1DX7 A;  3CCV P;  1BCC G;  2YKP A;  3MIW A;  1SQV G;  2A06 D;  3BVH A;  1VDF A;  3L73 E;  1LTJ B;  1NTK D;  1FAV A;  5KJ7 A;  4NPE A;  2HR3 A;  2QJP B;  2YMK A;  1X0T A;  2OTK E;  1K04 A;  3BRT B;  4HYT B;  1BE3 E;  1SQX J;  4D6T G;  4EYY Q;  4PD4 D;  3RK2 D;  5K5G B;  4PV1 B;  2H43 A;  4RKU J;  2N9Y B;  2OAR A;  3PJS K;  3D6Y A;  1DD3 A;  1N86 A;  3CXH H;  1JOC A;  1DEE G;  1JMB A;  3L70 E;  1ZP0 C;  1ZV8 A;  1LTI C;  2GUV A;  3L37 A;  2O3J A;  3H1H J;  3L71 E;  4WBA A;  3USS A;  3N4X A;  2WSS H;  1UII A;  4OH8 B;  4XA4 A;  1IC2 A;  5TIS E;  5B66 E;  1Q2N A;  1KIL D;  3TSI A;  1NTM G;  1RF1 C;  1L0L E;  1N8R Q;  2R3C A;  1LP1 B;  2IBZ D;  3HUS B;  3ABV C;  3AED C;  4XE5 B;  1CI6 B;  4W7Y A;  1GZL A;  3KHU A;  4LLH A;  4L76 A;  1P84 I;  3KYQ A;  2H7H A;  5AW9 B;  1BCC J;  3HE5 A;  5KAI E;  1S5L E;  3OW2 O;  3Q3D A;  1NTZ E;  3TDK A;  1FZG A;  4NPD A;  2JKV A;  1OVR A;  2BAS A;  4I7Z B;  1LGH B;  3OJA B;  3L73 D;  1M1J B;  2M5A A;  5C39 A;  1NTK E;  1M1J A;  2M5A B;  3VMA A;  2P67 A;  3CCU P;  1M1K Q;  3WUU A;  1IJD B;  1BE3 D;  2Y9Y A;  1YIT P;  1YTZ I;  3QH9 A;  5AW5 B;  4CPG A;  1FDO A;  2K37 A;  2Q3I A;  5KLV E;  4B86 A;  1R8E A;  2XNX A;  3PLN A;  3A0B E;  3H1H G;  2FFD B;  1D7M A;  3QWO C;  1T3J A;  2YMY A;  4DOJ A;  3F89 A;  2BEZ F;  2WT7 B;  2ZJS E;  1LT9 B;  1MKM A;  3V4W A;  2JR8 A;  1GK4 A;  3B5N A;  3HTK A;  1YJW P;  1R5S A;  1K8A Q;  5AVY B;  1JY2 O;  3H1K G;  1SQV E;  2ZAE B;  1BE3 G;  1FJK A;  5AW6 B;  5BVZ A;  1NAY A;  1M56 D;  3HD7 D;  1WMK A;  2KXP B;  2CPB A;  2N9B A;  2Q6Q A;  2QVA A;  2RH0 A;  3O8Z A;  2BCC D;  3JSV C;  4K35 A;  5KKZ C;  1KFM A;  3AE8 C;  3H1J J;  3BAT A;  1GL2 C;  3VN0 A;  4H0L C;  1QL1 A;  1KYO I;  1U7J A;  1G1I A;  2MKV A;  3GF3 A;  1EZV I;  3H1I G;  1KQG B;  2GUS A;  3L72 E;  5GTH H;  1Q82 Q;  1IO4 A;  1BSH A;  1MFZ A;  1URQ C;  1KYO E;  3TF5 A;  2E75 B;  4M3L A;  5KLV J;  5CBO A;  1FU1 A;  3B71 A;  5CCG A;  4EDF A;  1GD2 E;  1G2C B;  2AXT H;  3L71 G;  3H1L E;  3P32 A;  2JDI H;  5KAF H;  2XU6 A;  5APS A;  2AEJ A;  3A0B H;  3JC2 2;  2J5U A;  2QM8 A;  4BXL A;  4YTP C;  2B9B A;  4ZMD A;  1EDJ A;  4PD4 E;  1BSN A;  1SQV K;  2GA1 A;  2WPR A;  3L75 E;  5APY A;  3B5N C;  3H1K J;  1KV4 A;  2BCC G;  4L74 A;  3I5C A;  1AVY A;  1SQX K;  2LXC B;  3CL3 D;  2C9L Y;  1FZC A;  2ZVN B;  1SLQ A;  3HE4 A;  2HPC B;  1IFP A;  3L4F A;  1N7S A;  3KQG A;  1HGZ A; 
#chains in the Genus database with same CATH homology
 2YXR B;  1RHZ B;  3JC2 2;  1RH5 B;  3MP7 B;  2YXQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...