3MP7B

Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
54
structure length
54
Chain Sequence
IRHFWKESRRAFLVTKKPNWATYKRAAKITGLGIILIGLIGMLIRIVGILILGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Preprotein translocase subunit secY
publication title Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 15
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 3mp7B00
2YXQB 1RH5B 3JC22 2YXRB 3MP7B 1RHZB
chains in the Genus database with same CATH superfamily
1PL5A 2JWDA 1RQUA 4K35A 2KLVA 1R5SA 1ZLLA 2OTLP 1KYOD 3CC2P 1VQPP 5B5EE 1KYOI 3AE7C 1HJ0A 1SQVG 3QH9A 3M91A 1T2KD 3S4RA 3VMZA 3GHGB 4R4LA 4W7ZA 1N73B 2H7HA 2KNCA 1JUNA 2G8YA 2JKVA 1JM0A 2Y0DA 2FYNC 3PRJA 3MTUE 4C7NA 2E76B 4H0LB 1OFCX 2KK7A 5CCHC 3CL3D 2PFXA 5AVTB 1IFJA 2HFED 1Q2NA 3ITKA 3A5TA 1L0NJ 1S9KD 1KQLA 1FBMA 4H13C 5TISE 2WPRA 2HODA 1L4AA 3D6ZA 3HUSB 1VQ6P 1LTIC 4OWFA 1AJYA 1JOCA 2NPSA 3RL0B 1VQLP 2M3EA 1N8RQ 1NYHA 3FWLA 2K9JB 1VQ5P 3CX5D 1JY2O 3KPEA 2Q9IA 4UB8H 1KYOH 4JYBA 1NTZG 1Q82Q 1J1EC 3CCSP 1FJPA 2N1TC 1LT9B 1NTMG 2A06G 3V6IA 2WTYA 4D6TE 4HH2A 2BASA 3EWKA 3H1IG 1U57A 1ZV8A 2K1AA 1LTGC 1NTZJ 4ASWA 2YKOA 3H1KG 5AW6B 4XFJA 1SQBG 1VQ7P 1NTMJ 3M9QA 1SVFA 1SQVD 4U3FG 1URQB 3GW6A 5GTHE 2QA4P 1VQMP 3H1IJ 1BE3E 3P7KA 3GMAA 1W5CE 2FFDA 4I6MC 3LIDA 3HD7A 1KTMA 2QIWA 5KJ7D 3MZWB 2Q5UA 5KAIE 2JJLA 3H1KJ 3BCCG 1PGQA 5AW9B 1KQSO 1SQBJ 3G4SP 1M7LA 3U59A 2M0BA 1GU4A 4ZMDA 4U3FJ 1X8YA 4DT0A 1X0TA 3CXHD 2XDJA 3GHGC 2IZ0A 1N73C 1WT6A 2QJKB 3KHUA 2OGUA 4PJ0H 1AQ5A 3L73G 4XA4A 1AVYA 1ZRTD 1JY3P 3BCCJ 1YBKA 1VQ9P 1VL2A 4NPFX 2ZYGA 2ZJSE 3RBZA 1R5LA 2IYPA 4LC1A 2Y9ZA 3HTKA 3L73J 2ZXXA 3H32B 1NKZB 1RE4C 1S1CX 1X79B 3CCMP 1NTZD 3HUSC 1VF5B 3E7KA 2HR3A 1G1JA 1NU1G 1BGYE 5AW3B 1WMKA 1T3UA 4ZKPA 2M3BA 1MFZA 3BRTB 4M3LA 4KT0J 1S3JA 3Q5PA 1OW8A 5CJ0A 1NH4A 1PGOA 1L0LG 1GK6A 3A3YB 3Q2YA 3TF5A 3V2NA 2D2CB 4QMAA 1YITP 3H1KD 1T2KC 3M0AA 1NU1J 1YTZT 1EDLA 4ZKUA 1FZAA 4IL6E 4GOEA 4YXDC 1L0LJ 2O01H 4AUWA 4D6TD 3HE5A 2Y0CA 1KMIZ 1YJ9P 2OYHA 4WY4C 3RK2D 3T97B 1Q81Q 3CWBE 5AW1B 2M8RA 3I55P 3FXDA 2YIUC 3WUTA 3IFMA 2HYNA 1URQC 3VP9A 3AECC 2P1JA 1RF0C 4I7ZC 1OW7A 1SLQA 2W27A 5KKZB 4EYYQ 1YYCA 2POHA 1SQXE 5CCHD 3H1HG 5CBNA 1N7LA 3L72E 3C8VA 4L75A 3JSVC 1E79H 3B5NA 3OA7A 4H13D 2E42A 3CI9A 2XNDH 2J5UA 5CHXA 1PP9E 3A7OA 3MD0A 2AEJA 1NTKG 1PFIA 1QX8A 2M5AB 3HRNA 2FYUK 1LP1A 1AVOA 3H1HJ 4LLHA 3M9HA 1DEEG 4GODA 2PGDA 2YMYA 3K5BA 3R4YA 1LWUC 2N9BA 2R32A 5APVA 5KLVG 4UB8E 3AE9C 1KYOE 3CMEP 3TSIA 1QEXA 1EDJA 4JQ0D 5APYA 1NTKJ 5APWA 2W8ZA 1GMJA 2Q1KA 2J59M 3O6QA 4OH8B 1BSNA 3HE4A 1FZCB 1N7SA 2N1TD 2G3AA 2WSEJ 1BCCE 1T3JA 5APUA 2OYOA 5KLVJ 4L73A 2WZ7A 1SQXK 2YKPA 3M0DA 3V2QA 4BRYB 2WMMA 2WITA 3EFGA 3G6EP 1EDKA 1BGYD 1SQPG 2I1KA 3C1LA 1ZR4A 2RN0A 3H1JG 4OVNF 2ZYDA 2WT7A 1H88A 1PPJG 3VMYA 1WRGA 3OJAB 3UIAA 3NFQA 1SQPJ 1OW6A 4NPDA 3M06A 1SFCA 2FYUD 1YI2P 1YHQP 4U7JA 2RMZA 3FGAD 1VQ4P 3CX5E 3D70A 3A0HH 3AEEC 2OTKE 4PJ0E 4PD4I 1SQQG 1N86A 1RF1B 1DD4A 3JCUH 1X22A 2E76D 1LT1A 4H0LD 3VYIA 1OIPA 2AXCA 3CCUP 3WUVA 1OMIA 1SQXD 4WVZA 3G9RA 3EQ2A 3BATA 1SQQJ 1J1DB 2YNYA 2W6JH 1VDFA 3L72D 3L75G 3WU2H 1EZVG 3G71P 3KXDA 4ASVA 2B88A 3L37A 1JMBA 1SQVE 2LXBA 3KYQA 1KZUB 2OYIC 5BU5A 1FC2C 1PGJA 3Q1MA 3P8CE 2NZ2A 3RL0D 1W2EA 3H1LJ 2N1TA 2FBWC 1LTTC 1AFOA 5APSA 4C46A 1FJKA 3L75J 2ITAA 1JCCA 1M1JC 3CXHE 3RK2C 4PD4H 1CSBA 4C7NB 3H1JD 2QEXP 1IZNB 1ZRTE 2YO2A 1BCCD 3L71G 1L0NG 1H89A 2QG4A 3BASA 4LGDE 5AVSB 4WY4D 1K05A 3L70J 1PIXA 3L36A 2HODB 2Z4EA 4XE5B 1L4AB 1YQ4C 1URQD 3RK3B 1SQVK 3V2PA 1HVVA 3CCVP 2JR8A 1GTWA 3L71J 4W7YA 1FDIA 3S9OA 5KAFE 2NPSB 1NTZE 1SQQD 2GUVA 1T6AA 4RESB 3U1AA 2C9NY 1LGHB 1MZ9A 4AYCA 5EFWB 3H1IE 3MUDC 2BCCG 2ZT9C 2OQQA 5H2FH 1EXJA 2CK3H 1IFIA 2C0XA 1RH5B 3H1KE 1RE3C 1GL2C 1SQBE 2QJPB 5GTIH 4U3FE 4IFFA 1G2CA 2GM4A 3HUSA 2BCCJ 2WPQA 3ZDMA 2V4HA 1DIPA 2KXPB 1KV4A 4EI2A 3TGUG 2E5YA 2FFDB 1Z56A 2OTJP 1FAVA 3HD7B 1VF5D 1NTZK 2CPSA 2YKQA 2NRGA 3AE2C 2WSFJ 5B66H 1LTBC 1OVVA 2C0WA 2ZVNB 1NGMB 4BWNA 4WBAA 3II6A 3P8CD 1NTMK 3V4WA 3Q5SA 1PZQA 3TGUJ 2JP3A 3L71D 2Q6QA 1L0ND 1USDA 4BXLA 2AXTE 4WWIA 3USSA 4WY4A 4TLFA 5AVZB 1R8EA 1CW5A 2P7JA 2KSEA 1SQBK 3PTZA 3AE4C 1KB9H 1LTJA 2YMKA 3R2PA 3HTKB 2PP6A 2HPCA 3A0HE 1EXIA 5E79H 2E76C 4H0LC 3AE3C 3LIEA 4UB6H 3AEGC 2XNXA 1BE3G 5AVUB 2O1KA 3RK3C 1AA0A 1FOSF 3W68A 1OXZA 1L0LE 1H0TA 2E5TA 3L74G 5BU8B 2P67A 1FZFA 3TYYA 2QM8A 3GF7A 1NKNA 4R4MA 2IYOA 1ZXGA 1BE3J 3VN0A 3EFFK 1HTLC 2IBZG 2LR2A 1JNMA 3RL0C 3WU2E 1LWUA 2QVAA 1NTMD 2A06D 2KS1A 5CMZA 1KORA 3L74J 1HBWA 3F5HA 3H1ID 3L4FA 1U7MA 2QJPC 2B89A 1MKMA 2KLUA 3CCRP 3HE5B 3MP7B 2OYHB 1SQBD 3VTPC 1LT9C 4GT1A 2Q3IA 1JO5A 4U3FD 3CPWO 2FYUE 4JYCA 3MHVA 1IFMA 1HF9A 5B5EH 4NPEA 2BEZF 4PD4E 4RKUJ 1GW4A 2FFDC 3H1HE 3BRVB 5KJ7A 3BCCD 2A45G 3HD7C 1L0LK 1S5LH 2B87A 3FWNA 2R3CA 1M57D 1GU5A 3CCEP 4JPZB 2XZRA 3CLQA 3KZIH 1HWTC 2MKVA 1JEKA 2JEEA 3B5NB 3L73D 1EDIA 4CPGA 1USEA 3V2RA 3AEFC 4DCKA 2H43A 3PLNA 2CPBA 4TT3H 5KLIB 1LP1B 3A0BH 2WSFH 1E5WA 3AEBC 1NHLA 2WPSA 1RQVA 3NXSA 1QL2A 5CBOA 2QJKC 1NWQA 1QL1A 3S1KA 3AE1C 2L5GB 3CWBG 3Q5RA 3O6QB 3HE4B 4N78D 5APQA 3KDPB 1N7SB 2ZT9D 4L74A 5H2FE 3WMM0 2KZIA 1FZEA 2IBZI 1NU1D 2E75B 2R5DA 1GL2D 1Y9BA 3CWBJ 2K88A 5GTIE 3I5CA 2IPPA 3PJSK 2IZ1A 3H1JE 4EIJA 1NJIQ 1L0LD 2RKLA 1FDMA 1LTSC 2IX7C 5CJ4A 1PPJE 2OYIA 1VF5C 2H88C 1MFTA 1BSHA 1A02F 1P84I 3MGNA 3IR9A 1JY2P 1PP9G 3TDKA 1K9MQ 2E43A 3CC4P 3NMDA 5CCGC 4EOTA 3TNUA 3I56P 2XKMA 1A02J 3OW2O 5B66E 1M1JA 3P8MC 2D2CC 5GTHH 1SFCB 2FYNB 2QE7H 1IFPA 1SQQE 1QLED 2A45I 1PP9J 1MV8A 1JY3O 2IFNA 3GG2A 3RBXA 4RJTA 1HH0A 2WSSH 1OWAA 1DD3A 1LNQA 3H25A 1ZMEC 2AEMA 3VOPA 1GZLA 2LXCB 4PD4D 5AVQB 5CCHA 3H1HD 3N4XA 3L75E 3CCLP 2K3RA 4HJGH 3SWFA 5KKZC 1CI6A 1Q90D 2IFMA 5E79E 1D7MA 1JTHB 3B5NC 1KQGB 1KILB 1NTKD 1P84H 2ZVOB 2DW3A 3RK3D 5AVWB 4IOIH 3H1LG 5KLIC 1IK7A 4AQRD 5KLVD 1ZN5A 4Y28J 2VRSA 3SSUA 2N1TB 1SQQK 1S5LX 1YTZI 2SPZA 1GL2A 2A45H 4O9BA 3D6YA 1G1IA 2P10A 2QM7A 3FX0A 2KOGA 3L71E 1L0NE 1FE6A 2H89C 2KNCB 1IFNA 5AW0B 2KI7B 2XV5A 1NAFA 1KC8Q 4C7RA 1SQPD 1FZCC 3L70G 1JMMA 4RO0A 4WB4A 2KYVA 5AVXB 1IO4A 2N9YB 2BEQD 2HG5D 1X9VA 2WVRA 4IL6H 5AW4B 1PPJD 4DOJA 3SWKA 3SFEC 1OVUA 3IF4A 1FDOA 3HD7D 1S5LE 1JY3N 3GLMA 1HGZA 3PH0A 2WSEH 2BCCE 4H44B 1KN7A 1XTCC 2WQYC 2YXQB 1SFCC 3KZIE 3A2AA 3VMAA 5DJTB 1OX3A 1SQVJ 2YO3A 3GHGA 2Y9YA 1YJWP 5TJHA 1N73A 2K37A 3G3ZA 3L35A 3QWOC 1JCDA 1HJBA 1L0NK 4OGQB 5APXA 1VQOP 3U1CA 1NTME 2A06E 2WSCJ 3A0BE 3AE6C 1AV1A 4I1LA 1KD1Q 2O3JA 1W2BO 3RL0g 1KB9D 2Q3EA 3TGUE 1G2CB 3H1LD 1KB9I 1RF1C 2JO1A 3AEAC 3L75D 3PHLA 1EZVD 1CZQA 1VPCA 4PV1B 4JBZA 1EZVI 1RE4A 2E74B 4GKGA 1KFNA 4W80A 1KILC 2KUBA 5AW8B 1DX7A 2O01J 1K73Q 1EC5A 2KSJA 3CX5I 3JC22 3ABVC 1Y8AA 1K8AQ 2Y0EA 2YXRB 4MN4C 1J1DC 3BCCE 2K9JA 2P58A 3AEDC 2PAJA 4HKZH 2MJZA 3IAOA 2QJYB 4EDFA 3AE8C 3L70D 2K9YA 2GUSA 1NOHA 1M56D 1SP4A 1U7JA 4YXWH 3L73E 1S2EA 4WY4B 1LT9A 2GA1A 5L8RJ 5C39A 3B8EB 1FU1A 5CCGD 1QVGO 2YIUB 1LTJB 3CCJP 4HB1A 2R3SA 3SFDC 2KB7P 2D2CD 1FOSE 4I7ZB 1SS1A 4KJMA 4GOFA 2HPCB 2OARA 1M1KQ 4D6TG 3Q3DA 4K3AA 3L74E 2R5BA 1URQA 3H6PA 1RF0A 4N3YB 2W6BA 2O01N 2W6AA 4GIFA 4N78E 1H0TB 3CX5H 2IBZE 2ZAEB 3CXHI 4D6TJ 1BDCA 1NU1E 3F89A 2B9BA 3LW5J 1L4AC 3JCUE 4H44C 1N2DC 5M1BA 1KILE 2QRXA 2BCCD 1FS0E 2LKMA 2NPSC 2Z5IA 3B5ND 1LWUB 2H8PD 3MIWA 1P84E 2KS1B 1PV3A 1VQKP 3V4QA 3VMXA 4YPCA 2ZYAA 4OGQC 4IL6X 2V7QJ 4Z1MH 2ZFCA 2P2UA 2JDIH 2Q7CA 4N6JA 5K5GB 2FXPA 1ZP0C 3KQGA 1JY2N 5KTBA 3H32A 3TGUD 4GDOA 4PV1C 2WPVB 2E74C 1IJDB 3C9IA 5AVYB 2AEFA 2WSCH 1N7SD 3B4SA 1M8OB 3E1RA 2B87B 1Y47A 2E75D 3V5BA 1NU1K 1ZW0A 3E1IA 2HLOA 1XTGB 3P32A 3CXHH 2KP8A 5CCGA 3GF3A 1NAYA 1YQ3C 1H8AA 2QJYC 1BGYG 1OZHA 4JF7A 5BVZA 5AW7B 1NTKE 3BVHA 2FY8A 2KIKA 1PGPA 2RH0A 2XU6A 3D71A 1ZR2A 2W83C 3CC7P 2FXMA 3RK3E 1LTJC 2WWWA 1S4XA 1QVFO 1BGYJ 1VQ8P 5KLVE 1SFCD 1GK4A 3T97A 2FYUG 1BE3D 3PP5A 1K04A 5KAFH 1TU3F 5TISH 1J2JB 5AVVB 1HGVA 3L74D 1GDTA 3WUUA 1S72P 1L2PA 2FYUJ 4A7PA 3CCQP 2IBZD 2OYIB 1SQPE 3RGUA 1JB0J 1RHZB 4Y99B 2Z5HA 1EQ7A 2QSIA 2I8DA 4B86A 1SQXG 4IFDK 3OAKA 1NO4A 2O1JA 2L91A 5AVRB 3W67A 1KILD 1IK9A 4HYTB 1OVRA 1NTKK 1Q7YQ 3L72G 1AQTA 1P84D 4YTPC 2FYZA 2M5AA 2R44A 3TNUB 5APTA 1DH3A 1M1JB 1FZBA 3LW5H 5AW5B 1YIJP 5KLVK 1SQXJ 2WT7B 1LJ2A 3RK2B 1DEBA 2I1JA 3L72J 2JWAA 2IDBA 2FKWB 2FXOA 1FZCA 3N7NA 2V7QH 2OYHC 1T8ZA 3CD6P 5KJ7C 3SWYA 1BDDA 3TK1A 1QGKB 1RY3A 4L76A 5KAIH 4BRYA 1ZOYC 1S9KE 1LTAC 1BCCG 2AXTH 1Q86Q 1SQPK 3VP8A 1CI6B 1KB9E 4H13B 3H1LE 1YJNP 3IN6A 1GW3A 1EZVE 1UIXA 3NTNA 5AW2B 1NVOA 3AE5C 1KQFB 3H1JJ 3O8ZA 5DJUB 1BCCJ 1IFDA 4UB6E 2ZT9B 3CWBD 1L4AD 4H44D 2ZXEB 4DJGA 3FXEA 4I2LC 1GL2B 3MUDA 2NPSD 1J1EB 1UIIA 4KHXA 2PRRA 3L70E 4OGQD 1RF1A 1GD2E 1RE3A 1MUUA 1KFMA 1JTHA 2KZJA 3B71A 1HUCA 1KILA 2C9LY 1N7SC 4ZNCA 1VQNP 1IC2A 3M9BA 3CMAP 2UWJE 2W90A 1PP9D 4Y99C 2E75C 4DZOA 4IFMA 1M90Q 1FZGA 4PV1D 3M0DC 2E74D 2J58A
chains in the Genus database with same CATH topology
2YXQB 1RH5B 3JC22 2YXRB 3MP7B 1RHZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YXQ B;  1RH5 B;  3JC2 2;  2YXR B;  3MP7 B;  1RHZ B; 
#chains in the Genus database with same CATH topology
 1PL5 A;  2JWD A;  1RQU A;  4K35 A;  2KLV A;  1R5S A;  1ZLL A;  2OTL P;  1KYO D;  3CC2 P;  1VQP P;  5B5E E;  1KYO I;  3AE7 C;  1HJ0 A;  1SQV G;  3QH9 A;  3M91 A;  1T2K D;  3S4R A;  3VMZ A;  3GHG B;  4R4L A;  4W7Z A;  1N73 B;  2H7H A;  2KNC A;  1JUN A;  2G8Y A;  2JKV A;  1JM0 A;  2Y0D A;  2FYN C;  3PRJ A;  3MTU E;  4C7N A;  2E76 B;  4H0L B;  1OFC X;  2KK7 A;  5CCH C;  3CL3 D;  2PFX A;  5AVT B;  1IFJ A;  2HFE D;  1Q2N A;  3ITK A;  3A5T A;  1L0N J;  1S9K D;  1KQL A;  1FBM A;  4H13 C;  5TIS E;  2WPR A;  2HOD A;  1L4A A;  3D6Z A;  3HUS B;  1VQ6 P;  1LTI C;  4OWF A;  1AJY A;  1JOC A;  2NPS A;  3RL0 B;  1VQL P;  2M3E A;  1N8R Q;  1NYH A;  3FWL A;  2K9J B;  1VQ5 P;  3CX5 D;  1JY2 O;  3KPE A;  2Q9I A;  4UB8 H;  1KYO H;  4JYB A;  1NTZ G;  1Q82 Q;  1J1E C;  3CCS P;  1FJP A;  2N1T C;  1LT9 B;  1NTM G;  2A06 G;  3V6I A;  2WTY A;  4D6T E;  4HH2 A;  2BAS A;  3EWK A;  3H1I G;  1U57 A;  1ZV8 A;  2K1A A;  1LTG C;  1NTZ J;  4ASW A;  2YKO A;  3H1K G;  5AW6 B;  4XFJ A;  1SQB G;  1VQ7 P;  1NTM J;  3M9Q A;  1SVF A;  1SQV D;  4U3F G;  1URQ B;  3GW6 A;  5GTH E;  2QA4 P;  1VQM P;  3H1I J;  1BE3 E;  3P7K A;  3GMA A;  1W5C E;  2FFD A;  4I6M C;  3LID A;  3HD7 A;  1KTM A;  2QIW A;  5KJ7 D;  3MZW B;  2Q5U A;  5KAI E;  2JJL A;  3H1K J;  3BCC G;  1PGQ A;  5AW9 B;  1KQS O;  1SQB J;  3G4S P;  1M7L A;  3U59 A;  2M0B A;  1GU4 A;  4ZMD A;  4U3F J;  1X8Y A;  4DT0 A;  1X0T A;  3CXH D;  2XDJ A;  3GHG C;  2IZ0 A;  1N73 C;  1WT6 A;  2QJK B;  3KHU A;  2OGU A;  4PJ0 H;  1AQ5 A;  3L73 G;  4XA4 A;  1AVY A;  1ZRT D;  1JY3 P;  3BCC J;  1YBK A;  1VQ9 P;  1VL2 A;  4NPF X;  2ZYG A;  2ZJS E;  3RBZ A;  1R5L A;  2IYP A;  4LC1 A;  2Y9Z A;  3HTK A;  3L73 J;  2ZXX A;  3H32 B;  1NKZ B;  1RE4 C;  1S1C X;  1X79 B;  3CCM P;  1NTZ D;  3HUS C;  1VF5 B;  3E7K A;  2HR3 A;  1G1J A;  1NU1 G;  1BGY E;  5AW3 B;  1WMK A;  1T3U A;  4ZKP A;  2M3B A;  1MFZ A;  3BRT B;  4M3L A;  4KT0 J;  1S3J A;  3Q5P A;  1OW8 A;  5CJ0 A;  1NH4 A;  1PGO A;  1L0L G;  1GK6 A;  3A3Y B;  3Q2Y A;  3TF5 A;  3V2N A;  2D2C B;  4QMA A;  1YIT P;  3H1K D;  1T2K C;  3M0A A;  1NU1 J;  1YTZ T;  1EDL A;  4ZKU A;  1FZA A;  4IL6 E;  4GOE A;  4YXD C;  1L0L J;  2O01 H;  4AUW A;  4D6T D;  3HE5 A;  2Y0C A;  1KMI Z;  1YJ9 P;  2OYH A;  4WY4 C;  3RK2 D;  3T97 B;  1Q81 Q;  3CWB E;  5AW1 B;  2M8R A;  3I55 P;  3FXD A;  2YIU C;  3WUT A;  3IFM A;  2HYN A;  1URQ C;  3VP9 A;  3AEC C;  2P1J A;  1RF0 C;  4I7Z C;  1OW7 A;  1SLQ A;  2W27 A;  5KKZ B;  4EYY Q;  1YYC A;  2POH A;  1SQX E;  5CCH D;  3H1H G;  5CBN A;  1N7L A;  3L72 E;  3C8V A;  4L75 A;  3JSV C;  1E79 H;  3B5N A;  3OA7 A;  4H13 D;  2E42 A;  3CI9 A;  2XND H;  2J5U A;  5CHX A;  1PP9 E;  3A7O A;  3MD0 A;  2AEJ A;  1NTK G;  1PFI A;  1QX8 A;  2M5A B;  3HRN A;  2FYU K;  1LP1 A;  1AVO A;  3H1H J;  4LLH A;  3M9H A;  1DEE G;  4GOD A;  2PGD A;  2YMY A;  3K5B A;  3R4Y A;  1LWU C;  2N9B A;  2R32 A;  5APV A;  5KLV G;  4UB8 E;  3AE9 C;  1KYO E;  3CME P;  3TSI A;  1QEX A;  1EDJ A;  4JQ0 D;  5APY A;  1NTK J;  5APW A;  2W8Z A;  1GMJ A;  2Q1K A;  2J59 M;  3O6Q A;  4OH8 B;  1BSN A;  3HE4 A;  1FZC B;  1N7S A;  2N1T D;  2G3A A;  2WSE J;  1BCC E;  1T3J A;  5APU A;  2OYO A;  5KLV J;  4L73 A;  2WZ7 A;  1SQX K;  2YKP A;  3M0D A;  3V2Q A;  4BRY B;  2WMM A;  2WIT A;  3EFG A;  3G6E P;  1EDK A;  1BGY D;  1SQP G;  2I1K A;  3C1L A;  1ZR4 A;  2RN0 A;  3H1J G;  4OVN F;  2ZYD A;  2WT7 A;  1H88 A;  1PPJ G;  3VMY A;  1WRG A;  3OJA B;  3UIA A;  3NFQ A;  1SQP J;  1OW6 A;  4NPD A;  3M06 A;  1SFC A;  2FYU D;  1YI2 P;  1YHQ P;  4U7J A;  2RMZ A;  3FGA D;  1VQ4 P;  3CX5 E;  3D70 A;  3A0H H;  3AEE C;  2OTK E;  4PJ0 E;  4PD4 I;  1SQQ G;  1N86 A;  1RF1 B;  1DD4 A;  3JCU H;  1X22 A;  2E76 D;  1LT1 A;  4H0L D;  3VYI A;  1OIP A;  2AXC A;  3CCU P;  3WUV A;  1OMI A;  1SQX D;  4WVZ A;  3G9R A;  3EQ2 A;  3BAT A;  1SQQ J;  1J1D B;  2YNY A;  2W6J H;  1VDF A;  3L72 D;  3L75 G;  3WU2 H;  1EZV G;  3G71 P;  3KXD A;  4ASV A;  2B88 A;  3L37 A;  1JMB A;  1SQV E;  2LXB A;  3KYQ A;  1KZU B;  2OYI C;  5BU5 A;  1FC2 C;  1PGJ A;  3Q1M A;  3P8C E;  2NZ2 A;  3RL0 D;  1W2E A;  3H1L J;  2N1T A;  2FBW C;  1LTT C;  1AFO A;  5APS A;  4C46 A;  1FJK A;  3L75 J;  2ITA A;  1JCC A;  1M1J C;  3CXH E;  3RK2 C;  4PD4 H;  1CSB A;  4C7N B;  3H1J D;  2QEX P;  1IZN B;  1ZRT E;  2YO2 A;  1BCC D;  3L71 G;  1L0N G;  1H89 A;  2QG4 A;  3BAS A;  4LGD E;  5AVS B;  4WY4 D;  1K05 A;  3L70 J;  1PIX A;  3L36 A;  2HOD B;  2Z4E A;  4XE5 B;  1L4A B;  1YQ4 C;  1URQ D;  3RK3 B;  1SQV K;  3V2P A;  1HVV A;  3CCV P;  2JR8 A;  1GTW A;  3L71 J;  4W7Y A;  1FDI A;  3S9O A;  5KAF E;  2NPS B;  1NTZ E;  1SQQ D;  2GUV A;  1T6A A;  4RES B;  3U1A A;  2C9N Y;  1LGH B;  1MZ9 A;  4AYC A;  5EFW B;  3H1I E;  3MUD C;  2BCC G;  2ZT9 C;  2OQQ A;  5H2F H;  1EXJ A;  2CK3 H;  1IFI A;  2C0X A;  1RH5 B;  3H1K E;  1RE3 C;  1GL2 C;  1SQB E;  2QJP B;  5GTI H;  4U3F E;  4IFF A;  1G2C A;  2GM4 A;  3HUS A;  2BCC J;  2WPQ A;  3ZDM A;  2V4H A;  1DIP A;  2KXP B;  1KV4 A;  4EI2 A;  3TGU G;  2E5Y A;  2FFD B;  1Z56 A;  2OTJ P;  1FAV A;  3HD7 B;  1VF5 D;  1NTZ K;  2CPS A;  2YKQ A;  2NRG A;  3AE2 C;  2WSF J;  5B66 H;  1LTB C;  1OVV A;  2C0W A;  2ZVN B;  1NGM B;  4BWN A;  4WBA A;  3II6 A;  3P8C D;  1NTM K;  3V4W A;  3Q5S A;  1PZQ A;  3TGU J;  2JP3 A;  3L71 D;  2Q6Q A;  1L0N D;  1USD A;  4BXL A;  2AXT E;  4WWI A;  3USS A;  4WY4 A;  4TLF A;  5AVZ B;  1R8E A;  1CW5 A;  2P7J A;  2KSE A;  1SQB K;  3PTZ A;  3AE4 C;  1KB9 H;  1LTJ A;  2YMK A;  3R2P A;  3HTK B;  2PP6 A;  2HPC A;  3A0H E;  1EXI A;  5E79 H;  2E76 C;  4H0L C;  3AE3 C;  3LIE A;  4UB6 H;  3AEG C;  2XNX A;  1BE3 G;  5AVU B;  2O1K A;  3RK3 C;  1AA0 A;  1FOS F;  3W68 A;  1OXZ A;  1L0L E;  1H0T A;  2E5T A;  3L74 G;  5BU8 B;  2P67 A;  1FZF A;  3TYY A;  2QM8 A;  3GF7 A;  1NKN A;  4R4M A;  2IYO A;  1ZXG A;  1BE3 J;  3VN0 A;  3EFF K;  1HTL C;  2IBZ G;  2LR2 A;  1JNM A;  3RL0 C;  3WU2 E;  1LWU A;  2QVA A;  1NTM D;  2A06 D;  2KS1 A;  5CMZ A;  1KOR A;  3L74 J;  1HBW A;  3F5H A;  3H1I D;  3L4F A;  1U7M A;  2QJP C;  2B89 A;  1MKM A;  2KLU A;  3CCR P;  3HE5 B;  3MP7 B;  2OYH B;  1SQB D;  3VTP C;  1LT9 C;  4GT1 A;  2Q3I A;  1JO5 A;  4U3F D;  3CPW O;  2FYU E;  4JYC A;  3MHV A;  1IFM A;  1HF9 A;  5B5E H;  4NPE A;  2BEZ F;  4PD4 E;  4RKU J;  1GW4 A;  2FFD C;  3H1H E;  3BRV B;  5KJ7 A;  3BCC D;  2A45 G;  3HD7 C;  1L0L K;  1S5L H;  2B87 A;  3FWN A;  2R3C A;  1M57 D;  1GU5 A;  3CCE P;  4JPZ B;  2XZR A;  3CLQ A;  3KZI H;  1HWT C;  2MKV A;  1JEK A;  2JEE A;  3B5N B;  3L73 D;  1EDI A;  4CPG A;  1USE A;  3V2R A;  3AEF C;  4DCK A;  2H43 A;  3PLN A;  2CPB A;  4TT3 H;  5KLI B;  1LP1 B;  3A0B H;  2WSF H;  1E5W A;  3AEB C;  1NHL A;  2WPS A;  1RQV A;  3NXS A;  1QL2 A;  5CBO A;  2QJK C;  1NWQ A;  1QL1 A;  3S1K A;  3AE1 C;  2L5G B;  3CWB G;  3Q5R A;  3O6Q B;  3HE4 B;  4N78 D;  5APQ A;  3KDP B;  1N7S B;  2ZT9 D;  4L74 A;  5H2F E;  3WMM 0;  2KZI A;  1FZE A;  2IBZ I;  1NU1 D;  2E75 B;  2R5D A;  1GL2 D;  1Y9B A;  3CWB J;  2K88 A;  5GTI E;  3I5C A;  2IPP A;  3PJS K;  2IZ1 A;  3H1J E;  4EIJ A;  1NJI Q;  1L0L D;  2RKL A;  1FDM A;  1LTS C;  2IX7 C;  5CJ4 A;  1PPJ E;  2OYI A;  1VF5 C;  2H88 C;  1MFT A;  1BSH A;  1A02 F;  1P84 I;  3MGN A;  3IR9 A;  1JY2 P;  1PP9 G;  3TDK A;  1K9M Q;  2E43 A;  3CC4 P;  3NMD A;  5CCG C;  4EOT A;  3TNU A;  3I56 P;  2XKM A;  1A02 J;  3OW2 O;  5B66 E;  1M1J A;  3P8M C;  2D2C C;  5GTH H;  1SFC B;  2FYN B;  2QE7 H;  1IFP A;  1SQQ E;  1QLE D;  2A45 I;  1PP9 J;  1MV8 A;  1JY3 O;  2IFN A;  3GG2 A;  3RBX A;  4RJT A;  1HH0 A;  2WSS H;  1OWA A;  1DD3 A;  1LNQ A;  3H25 A;  1ZME C;  2AEM A;  3VOP A;  1GZL A;  2LXC B;  4PD4 D;  5AVQ B;  5CCH A;  3H1H D;  3N4X A;  3L75 E;  3CCL P;  2K3R A;  4HJG H;  3SWF A;  5KKZ C;  1CI6 A;  1Q90 D;  2IFM A;  5E79 E;  1D7M A;  1JTH B;  3B5N C;  1KQG B;  1KIL B;  1NTK D;  1P84 H;  2ZVO B;  2DW3 A;  3RK3 D;  5AVW B;  4IOI H;  3H1L G;  5KLI C;  1IK7 A;  4AQR D;  5KLV D;  1ZN5 A;  4Y28 J;  2VRS A;  3SSU A;  2N1T B;  1SQQ K;  1S5L X;  1YTZ I;  2SPZ A;  1GL2 A;  2A45 H;  4O9B A;  3D6Y A;  1G1I A;  2P10 A;  2QM7 A;  3FX0 A;  2KOG A;  3L71 E;  1L0N E;  1FE6 A;  2H89 C;  2KNC B;  1IFN A;  5AW0 B;  2KI7 B;  2XV5 A;  1NAF A;  1KC8 Q;  4C7R A;  1SQP D;  1FZC C;  3L70 G;  1JMM A;  4RO0 A;  4WB4 A;  2KYV A;  5AVX B;  1IO4 A;  2N9Y B;  2BEQ D;  2HG5 D;  1X9V A;  2WVR A;  4IL6 H;  5AW4 B;  1PPJ D;  4DOJ A;  3SWK A;  3SFE C;  1OVU A;  3IF4 A;  1FDO A;  3HD7 D;  1S5L E;  1JY3 N;  3GLM A;  1HGZ A;  3PH0 A;  2WSE H;  2BCC E;  4H44 B;  1KN7 A;  1XTC C;  2WQY C;  2YXQ B;  1SFC C;  3KZI E;  3A2A A;  3VMA A;  5DJT B;  1OX3 A;  1SQV J;  2YO3 A;  3GHG A;  2Y9Y A;  1YJW P;  5TJH A;  1N73 A;  2K37 A;  3G3Z A;  3L35 A;  3QWO C;  1JCD A;  1HJB A;  1L0N K;  4OGQ B;  5APX A;  1VQO P;  3U1C A;  1NTM E;  2A06 E;  2WSC J;  3A0B E;  3AE6 C;  1AV1 A;  4I1L A;  1KD1 Q;  2O3J A;  1W2B O;  3RL0 g;  1KB9 D;  2Q3E A;  3TGU E;  1G2C B;  3H1L D;  1KB9 I;  1RF1 C;  2JO1 A;  3AEA C;  3L75 D;  3PHL A;  1EZV D;  1CZQ A;  1VPC A;  4PV1 B;  4JBZ A;  1EZV I;  1RE4 A;  2E74 B;  4GKG A;  1KFN A;  4W80 A;  1KIL C;  2KUB A;  5AW8 B;  1DX7 A;  2O01 J;  1K73 Q;  1EC5 A;  2KSJ A;  3CX5 I;  3JC2 2;  3ABV C;  1Y8A A;  1K8A Q;  2Y0E A;  2YXR B;  4MN4 C;  1J1D C;  3BCC E;  2K9J A;  2P58 A;  3AED C;  2PAJ A;  4HKZ H;  2MJZ A;  3IAO A;  2QJY B;  4EDF A;  3AE8 C;  3L70 D;  2K9Y A;  2GUS A;  1NOH A;  1M56 D;  1SP4 A;  1U7J A;  4YXW H;  3L73 E;  1S2E A;  4WY4 B;  1LT9 A;  2GA1 A;  5L8R J;  5C39 A;  3B8E B;  1FU1 A;  5CCG D;  1QVG O;  2YIU B;  1LTJ B;  3CCJ P;  4HB1 A;  2R3S A;  3SFD C;  2KB7 P;  2D2C D;  1FOS E;  4I7Z B;  1SS1 A;  4KJM A;  4GOF A;  2HPC B;  2OAR A;  1M1K Q;  4D6T G;  3Q3D A;  4K3A A;  3L74 E;  2R5B A;  1URQ A;  3H6P A;  1RF0 A;  4N3Y B;  2W6B A;  2O01 N;  2W6A A;  4GIF A;  4N78 E;  1H0T B;  3CX5 H;  2IBZ E;  2ZAE B;  3CXH I;  4D6T J;  1BDC A;  1NU1 E;  3F89 A;  2B9B A;  3LW5 J;  1L4A C;  3JCU E;  4H44 C;  1N2D C;  5M1B A;  1KIL E;  2QRX A;  2BCC D;  1FS0 E;  2LKM A;  2NPS C;  2Z5I A;  3B5N D;  1LWU B;  2H8P D;  3MIW A;  1P84 E;  2KS1 B;  1PV3 A;  1VQK P;  3V4Q A;  3VMX A;  4YPC A;  2ZYA A;  4OGQ C;  4IL6 X;  2V7Q J;  4Z1M H;  2ZFC A;  2P2U A;  2JDI H;  2Q7C A;  4N6J A;  5K5G B;  2FXP A;  1ZP0 C;  3KQG A;  1JY2 N;  5KTB A;  3H32 A;  3TGU D;  4GDO A;  4PV1 C;  2WPV B;  2E74 C;  1IJD B;  3C9I A;  5AVY B;  2AEF A;  2WSC H;  1N7S D;  3B4S A;  1M8O B;  3E1R A;  2B87 B;  1Y47 A;  2E75 D;  3V5B A;  1NU1 K;  1ZW0 A;  3E1I A;  2HLO A;  1XTG B;  3P32 A;  3CXH H;  2KP8 A;  5CCG A;  3GF3 A;  1NAY A;  1YQ3 C;  1H8A A;  2QJY C;  1BGY G;  1OZH A;  4JF7 A;  5BVZ A;  5AW7 B;  1NTK E;  3BVH A;  2FY8 A;  2KIK A;  1PGP A;  2RH0 A;  2XU6 A;  3D71 A;  1ZR2 A;  2W83 C;  3CC7 P;  2FXM A;  3RK3 E;  1LTJ C;  2WWW A;  1S4X A;  1QVF O;  1BGY J;  1VQ8 P;  5KLV E;  1SFC D;  1GK4 A;  3T97 A;  2FYU G;  1BE3 D;  3PP5 A;  1K04 A;  5KAF H;  1TU3 F;  5TIS H;  1J2J B;  5AVV B;  1HGV A;  3L74 D;  1GDT A;  3WUU A;  1S72 P;  1L2P A;  2FYU J;  4A7P A;  3CCQ P;  2IBZ D;  2OYI B;  1SQP E;  3RGU A;  1JB0 J;  1RHZ B;  4Y99 B;  2Z5H A;  1EQ7 A;  2QSI A;  2I8D A;  4B86 A;  1SQX G;  4IFD K;  3OAK A;  1NO4 A;  2O1J A;  2L91 A;  5AVR B;  3W67 A;  1KIL D;  1IK9 A;  4HYT B;  1OVR A;  1NTK K;  1Q7Y Q;  3L72 G;  1AQT A;  1P84 D;  4YTP C;  2FYZ A;  2M5A A;  2R44 A;  3TNU B;  5APT A;  1DH3 A;  1M1J B;  1FZB A;  3LW5 H;  5AW5 B;  1YIJ P;  5KLV K;  1SQX J;  2WT7 B;  1LJ2 A;  3RK2 B;  1DEB A;  2I1J A;  3L72 J;  2JWA A;  2IDB A;  2FKW B;  2FXO A;  1FZC A;  3N7N A;  2V7Q H;  2OYH C;  1T8Z A;  3CD6 P;  5KJ7 C;  3SWY A;  1BDD A;  3TK1 A;  1QGK B;  1RY3 A;  4L76 A;  5KAI H;  4BRY A;  1ZOY C;  1S9K E;  1LTA C;  1BCC G;  2AXT H;  1Q86 Q;  1SQP K;  3VP8 A;  1CI6 B;  1KB9 E;  4H13 B;  3H1L E;  1YJN P;  3IN6 A;  1GW3 A;  1EZV E;  1UIX A;  3NTN A;  5AW2 B;  1NVO A;  3AE5 C;  1KQF B;  3H1J J;  3O8Z A;  5DJU B;  1BCC J;  1IFD A;  4UB6 E;  2ZT9 B;  3CWB D;  1L4A D;  4H44 D;  2ZXE B;  4DJG A;  3FXE A;  4I2L C;  1GL2 B;  3MUD A;  2NPS D;  1J1E B;  1UII A;  4KHX A;  2PRR A;  3L70 E;  4OGQ D;  1RF1 A;  1GD2 E;  1RE3 A;  1MUU A;  1KFM A;  1JTH A;  2KZJ A;  3B71 A;  1HUC A;  1KIL A;  2C9L Y;  1N7S C;  4ZNC A;  1VQN P;  1IC2 A;  3M9B A;  3CMA P;  2UWJ E;  2W90 A;  1PP9 D;  4Y99 C;  2E75 C;  4DZO A;  4IFM A;  1M90 Q;  1FZG A;  4PV1 D;  3M0D C;  2E74 D;  2J58 A; 
#chains in the Genus database with same CATH homology
 2YXQ B;  1RH5 B;  3JC2 2;  2YXR B;  3MP7 B;  1RHZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...