3MP7B

Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
54
structure length
54
Chain Sequence
b'IRHFWKESRRAFLVTKKPNWATYKRAAKITGLGIILIGLIGMLIRIVGILILGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Preprotein translocase subunit secY
publication title Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Protein transport
total genus 15
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 3mp7B00
2YXRB 3JC22 1RH5B 2YXQB 1RHZB 3MP7B
chains in the Genus database with same CATH superfamily
1DEBA 3F5HA 4Y28J 3HD7B 1S3JA 3AE1C 2GM4A 3CX5H 3HE4A 3IFMA 5GTHH 1H88A 4KT0J 1DIPA 4D6TD 3L4FA 3MD0A 1ZW0A 2YXQB 1IFJA 1FC2C 1OFCX 1RE3A 1OX3A 4WY4C 2FFDB 2PAJA 3VYIA 2JP3A 3CMEP 1S9KE 2KZIA 3AE4C 1NU1G 1GL2D 2SPZA 2WZ7A 1URQB 1BCCE 1PPJG 4C7NA 2WPRA 1IK7A 1K8AQ 2E74B 2A06D 2E42A 3SFEC 3LIEA 1LWUA 4NPDA 3S4RA 2GUVA 3MP7B 3FWNA 3WU2H 2KS1A 1VDFA 1J1DC 3R2PA 1N73A 4RJTA 5BU5A 3H1HE 3D6YA 1KILB 3HD7D 1DEEG 4HKZH 1JTHB 1T3UA 1NAFA 1Q86Q 1LT1A 3ZDMA 1BCCJ 1OW7A 3RK2C 3CWBD 1IC2A 2OYOA 4L74A 3CC7P 3MIWA 1BSNA 2Q7CA 4DT0A 5B66E 1OVVA 3MZWB 1EDLA 3H1LD 1UIXA 1M7LA 1NTKD 1AQ5A 3H1HJ 1USDA 1URQD 1OVRA 1N7LA 1AVYA 1LTGC 5GTIE 4Y99C 2WT7B 4R4MA 3HUSA 2E74D 2QJKC 1JUNA 1IO4A 1U7MA 4UB6E 4JYBA 1GL2A 1JCCA 5DJUB 3KPEA 3EQ2A 3CPWO 3PP5A 4AQRD 4QMAA 1SQBE 1KILD 2H89C 1BCCG 2P67A 3CI9A 5TISH 2KLVA 1LTJA 4N3YB 3A7OA 3C9IA 2HPCB 1X79B 5APTA 2E5TA 3HRNA 1FAVA 1BDDA 3RL0C 2LR2A 3D71A 3NXSA 5CMZA 5H2FE 1K73Q 3SFDC 1HBWA 3HD7A 1PPJD 3H1HG 3CL3D 1YITP 1BGYJ 3CCRP 3TGUE 1K05A 2XV5A 1JO5A 1EDIA 2GUSA 2IDBA 1FZFA 4ZKUA 2OYIC 2Q6QA 3P7KA 4IFFA 1ZP0C 2IFNA 2QEXP 1MKMA 4RO0A 5KLVE 5KAFE 3G9RA 2E75D 1NTMK 5KJ7C 4UB6H 1KQSO 3KDPB 1M1JC 3CC2P 1KYOE 1L0NK 3WUVA 3TGUJ 2KOGA 3H32A 3V2PA 1VF5C 1JY2P 1SQPE 1OVUA 2OARA 3GHGA 1VQ6P 3RK3C 2G3AA 2UWJE 5L8RJ 1HH0A 1SQXG 3HE5B 4C7RA 5KLVJ 1SQBG 2LXBA 3H6PA 3ABVC 4R4LA 5CCHC 1ZR4A 3QH9A 3M9QA 1KFMA 5AW6B 4LC1A 1S9KD 1M1KQ 3TSIA 3AE2C 2PFXA 1QX8A 1SQPJ 3GF7A 1VQ4P 5E79E 1JNMA 1BCCD 1YBKA 1KV4A 1KB9D 1KC8Q 5KTBA 2ITAA 4LLHA 3T97A 1KYOH 3L75E 1NHLA 3H1HD 4TLFA 1Y8AA 1WMKA 3G6EP 1Q81Q 5KLVG 4L73A 4PJ0H 4W7ZA 3M9HA 3H1KG 1EZVI 3H1IE 3CXHD 1CI6B 1VQKP 2ZXEB 1JY3P 1G2CB 2OTLP 3AEDC 5AVTB 2QJYC 1RE3C 1RE4C 3L35A 2ZVNB 2HFED 2WSCH 1SQVG 2CPBA 3RL0g 3L75J 3PHLA 3P8MC 1GD2E 3H1IJ 5AVSB 3MTUE 1T2KC 4M3LA 1SQXD 1LWUC 1KB9I 1ZR2A 3V2RA 1SQBD 1S4XA 1N7SB 1GU5A 1N73C 1FZEA 1PGPA 2V7QJ 2WSEJ 5K5GB 5CHXA 3PTZA 2ZT9C 1SQQE 4DOJA 1DD4A 2WMMA 1QGKB 3CXHI 1FOSF 3L75G 3B5NB 1FZCC 1GW4A 3NMDA 3HE5A 4I7ZB 2WTYA 1NWQA 1FOSE 1VQ5P 4NPEA 2ZAEB 1RHZB 2WSEH 1CW5A 3I55P 1OMIA 1RY3A 3L70E 3CD6P 4PV1D 3LIDA 5KLVD 1X9VA 1SQQJ 4JQ0D 3H1KD 3HUSC 3II6A 4ZKPA 1S5LH 2OQQA 1MFTA 1GL2C 1N7SD 4H13B 3HTKB 5AW4B 5M1BA 3KXDA 4AYCA 3Q1MA 1D7MA 2NPSB 1MUUA 5APQA 1LTJC 1LP1A 3L70J 2KSEA 1ZN5A 1K04A 2Y0DA 2H88C 1BE3E 1T6AA 5KJ7A 3A2AA 2N1TD 1M1JA 2FYUE 3B5ND 3A0HE 4EOTA 3HD7C 1FDMA 3AE3C 1CI6A 4L76A 2IZ1A 1SQQG 1GDTA 1SLQA 1Q7YQ 3CX5E 3EFGA 5GTHE 4XE5B 1L0LG 1EC5A 3IR9A 3L36A 1LGHB 1P84E 1NKNA 2FFDC 1BE3J 1JY2N 2W6BA 1MZ9A 2B89A 2FYUJ 1E5WA 3G71P 5AW1B 2K9YA 1PP9E 2B87B 1URQC 4H13D 3L75D 3L70G 2A45G 2E5YA 2KYVA 1TU3F 2E74C 4ASVA 2NPSD 2YKPA 1J1EB 3GHGC 3H1ID 4C46A 2M5AA 3CCQP 1NTKK 1L4AD 5KLIB 2LKMA 3A5TA 1PFIA 1LT9B 2KSJA 1KILC 1H89A 2H7HA 2IBZE 2OYHB 1PP9J 2QJPB 2N1TA 2YKOA 1ZRTE 2Z4EA 1BE3G 3UIAA 1HGVA 2FY8A 4PD4I 2FYNB 1P84H 2W6JH 1SS1A 2QVAA 2W8ZA 1RE4A 2C9NY 2BASA 3L37A 3LW5H 1NU1K 5APSA 2Q9IA 2KNCA 1PGOA 3B71A 1H8AA 1VQPP 2M0BA 1NTZK 3M0AA 2YIUC 3OW2O 2E75C 2FXOA 5AW9B 1M57D 1SQQD 3MHVA 1IFNA 4OGQB 1PP9G 3AE6C 4EYYQ 1OIPA 2I1KA 4A7PA 2YMYA 1L0LD 2RKLA 1YYCA 2M8RA 3VN0A 1FZAA 1FBMA 2M3EA 1L4AA 1JB0J 5TISE 4HB1A 1VQNP 1RQUA 4OH8B 3WUTA 3U1AA 2JJLA 1HTLC 3L70D 3BATA 1FS0E 2FYZA 1HVVA 3EWKA 4OVNF 2N9YB 1IK9A 1FZCA 2KIKA 1R5SA 1GK6A 3L71E 1S1CX 2JWAA 2O01J 2Q1KA 1DH3A 3H1JE 3PLNA 2RMZA 3EFFK 1FJKA 2YO3A 2KK7A 4OGQD 2B87A 1FDOA 1BE3D 3BCCE 2JKVA 1JEKA 1JMBA 2FYUD 1BGYE 1Y9BA 3NTNA 1NTME 3L71J 2O01H 5CCGD 3Q2YA 3TF5A 2BEZF 3GLMA 1QVGO 3B4SA 3E1IA 3D6ZA 3CX5D 3H1JJ 2QRXA 2Q3EA 2AXTH 2WVRA 2XKMA 3TDKA 1Q82Q 2A45I 2QE7H 2J58A 3BCCJ 3MUDA 3SSUA 1ZXGA 1PP9D 1PGJA 1NTMJ 3VTPC 1KQLA 3JSVC 1YIJP 2KB7P 1L0NJ 4I1LA 1KQFB 4BRYB 4DJGA 2FXPA 2HODB 3V2NA 1QL2A 2FFDA 2OTJP 3O6QB 1N2DC 4U7JA 1HGZA 2QA4P 1URQA 1KTMA 1PGQA 2K9JB 2IBZD 4RKUJ 2QM8A 1SQXK 1ZRTD 4NPFX 3V4QA 1A02J 1H0TB 4PJ0E 2KZJA 3L72E 3A0BH 1SQBK 2B88A 1BGYG 3CX5I 1KILA 1R8EA 1JTHA 3GF3A 3U59A 1NGMB 2KP8A 4IL6H 4PV1C 2H8PD 2JDIH 4GT1A 3AE7C 1VQLP 2AEMA 4K35A 1LTSC 1RF0A 5AVQB 5CJ4A 1NYHA 1GZLA 3L72J 3VMAA 3C8VA 5KKZC 3Q3DA 1OWAA 3TGUG 4CPGA 1N7SC 2WPVB 2ZYDA 1LTBC 4ASWA 4KJMA 5BVZA 2WQYC 1HWTC 5KLVK 3KYQA 2WT7A 2WSCJ 4HJGH 2NRGA 4LGDE 1QEXA 3B8EB 5AVVB 4N6JA 1IZNB 2OYIB 2N1TC 2NZ2A 2YNYA 1GU4A 3B5NC 3V2QA 2K3RA 4I7ZC 1SQVK 4W80A 2POHA 2HPCA 1SQPG 1HUCA 2C0XA 2XNDH 3L72G 1NKZB 3JCUH 1VF5B 1VPCA 1YTZT 3S1KA 1N8RQ 3R4YA 4JBZA 1S5LX 5DJTB 2HR3A 2XZRA 1NO4A 2R44A 1VL2A 1SFCB 3VMZA 3W68A 1FE6A 3BCCD 3A3YB 2Q5UA 4H13C 4XA4A 1ZOYC 1BGYD 1S5LE 5KAIH 5AW0B 3RBXA 4BRYA 3CCEP 1W5CE 4PD4H 2NPSC 3M91A 3RBZA 1IFIA 2D2CB 1L4AC 3AE9C 2WPQA 3KQGA 3CMAP 2K9JA 3O8ZA 1EDKA 3TNUB 4IFMA 3JC22 1AV1A 4I2LC 2C0WA 1KFNA 2JO1A 3FXEA 3TGUD 3H1IG 1YI2P 3CLQA 4H0LB 1CZQA 1FU1A 1SFCD 3BRVB 1YJNP 3HE4B 5APXA 2V4HA 1ZMEC 4H44B 4WWIA 3P32A 3F89A 2IPPA 3OAKA 1KYOD 1J1EC 4EI2A 4N78E 2Q3IA 2QIWA 3U1CA 2D2CD 1SQPD 4IFDK 1AJYA 2OTKE 1JOCA 5KLIC 3OJAB 1U7JA 4U3FE 3L72D 1AVOA 4EIJA 2BCCE 1LT9C 5APUA 2LXCB 4C7NB 2QJPC 1NTKE 1KQGB 3L73E 5AW8B 3SWYA 3MUDC 1SQQK 2K37A 2KS1B 1YQ3C 1GK4A 1KMIZ 1G2CA 2FYNC 3PJSK 1RQVA 2E43A 1L0LK 1OZHA 4H0LD 5CBOA 3ITKA 3IF4A 3CWBJ 1EQ7A 2ZT9B 4U3FJ 1VQ9P 2IZ0A 1HF9A 2BCCJ 1QLED 3KHUA 1S2EA 4H44D 2HLOA 1G1IA 2WSFH 2QSIA 3H1LJ 1MFZA 1NTKJ 2Y9YA 3FWLA 3L73J 4ZNCA 1LJ2A 1GMJA 2L91A 1NU1E 4OGQC 1KYOI 1DD3A 3VP8A 1VQOP 1N86A 1EXIA 1NTZE 1N7SA 1J2JB 3PRJA 2J59M 5CCGC 1M8OB 2C9LY 4GKGA 1YTZI 3LW5J 1T3JA 4L75A 4U3FG 2E76B 1NU1J 4KHXA 2JR8A 1IFDA 2K1AA 2W90A 3B5NA 3FX0A 2FYUG 5AVZB 3L73G 1RF0C 1KN7A 1Z56A 4O9BA 1NTZJ 2Y9ZA 2AXCA 3E1RA 5APYA 1S72P 1EZVE 4I6MC 3M0DA 1FZGA 1T8ZA 4JYCA 5APWA 3GMAA 1MV8A 1JY3N 1XTGB 3SWKA 2ZXXA 2R5BA 3HTKA 4UB8H 2KLUA 4BWNA 1YQ4C 3VMXA 3KZIE 2NPSA 1RF1B 2N9BA 2E76D 1DX7A 3C1LA 3WUUA 2YKQA 1NTZG 4B86A 1YJWP 3H32B 3W67A 2PRRA 1KB9E 2JWDA 3TK1A 3GHGB 3AE5C 2AXTE 3V4WA 1FDIA 2RH0A 3M9BA 2IBZG 1AA0A 3N7NA 1CSBA 1X22A 2RN0A 2KXPB 3BASA 5AW5B 3K5BA 3PH0A 4N78D 3CXHE 5AVYB 3I56P 2M3BA 4U3FD 2BCCD 2AEFA 3CC4P 1EZVG 2ZYGA 2P7JA 1RH5B 3L73D 4Z1MH 1PL5A 1VQ7P 2H43A 3KZIH 3MGNA 3L74E 4WY4B 2I8DA 3TYYA 4YTPC 3T97B 1AQTA 1PIXA 3V5BA 3VOPA 1L0NE 3G3ZA 3D70A 2Y0CA 2YIUB 5CJ0A 2GA1A 2E75B 1LT9A 1KB9H 3A0BE 2ZFCA 1SQXE 3BRTB 2OYHA 1P84D 1NAYA 4IL6X 4HYTB 1OW6A 4HH2A 1A02F 3GG2A 4DCKA 4XFJA 1J1DB 1ZLLA 3I5CA 2YMKA 3L74J 1NU1D 4IL6E 3USSA 3CXHH 1OXZA 4EDFA 4ZMDA 3RK3E 3AEGC 1NTZD 1SQXJ 2AEJA 1VQ8P 3L71G 5B66H 4MN4C 3RK2B 1X8YA 1SQBJ 2KI7B 1SVFA 1KZUB 1NH4A 3S9OA 1EXJA 2MJZA 4WY4D 1OW8A 3H1JG 5TJHA 4BXLA 1XTCC 5GTIH 1ZV8A 4GIFA 5CBNA 3H1KE 3BCCG 2HYNA 3E7KA 1RF1A 4Y99B 2MKVA 4IOIH 5CCGA 1NTMG 1NVOA 2QJKB 3L74G 2O01N 1W2EA 5B5EE 1P84I 3N4XA 4GODA 1UIIA 2WPSA 2YXRB 1EZVD 1L0NG 2QG4A 3FXDA 4GOEA 1SQVE 3JCUE 1SFCC 1KD1Q 2FBWC 5H2FH 3H1KJ 3H25A 3AE8C 2Y0EA 3RK2D 1FZBA 3RL0B 2QM7A 2O1JA 1BDCA 4WBAA 1IFMA 1Q2NA 5KAIE 2BEQD 2D2CC 1PV3A 4PD4E 4YXDC 1SQVJ 2ZVOB 2IBZI 3CCUP 3CCMP 5KAFH 4W7YA 1WT6A 4WY4A 1LP1B 2P1JA 1SQPK 1PZQA 1Y47A 3Q5PA 5B5EH 2R5DA 4YPCA 3P8CE 2WSSH 1NOHA 1M1JB 5C39A 1JY2O 3L71D 4K3AA 4H0LC 2K88A 1G1JA 3M0DC 3FGAD 1W2BO 3H1JD 4H44C 2I1JA 2W27A 3RK3B 5AW2B 5AW3B 3RL0D 2CK3H 2VRSA 2XDJA 2FXMA 3Q5RA 3AEAC 1NTMD 3L74D 2HODA 1BSHA 2Z5IA 5E79H 4PV1B 3O6QA 2YO2A 4D6TE 3CCSP 3CCJP 1L0ND 2WWWA 2OGUA 1AFOA 2M5AB 4OWFA 5KKZB 1WRGA 2R32A 5KJ7D 1HJBA 2J5UA 1H0TA 1YJ9P 2FKWB 3WMM0 2IYOA 1U57A 1LTTC 2O3JA 1VF5D 2IFMA 4DZOA 4D6TJ 2CPSA 2A06E 3RK3D 1GTWA 1JY3O 2L5GB 2N1TB 3AEFC 1L0LE 1K9MQ 3RGUA 1JCDA 2ZJSE 4JPZB 3QWOC 5APVA 2V7QH 2G8YA 5CCHD 2QJYB 2B9BA 1GW3A 1KORA 2KNCB 3CCVP 3VP9A 5AVWB 3M06A 2DW3A 3AEEC 3CWBE 5BU8B 1X0TA 1M56D 3SWFA 1L0LJ 3CCLP 4AUWA 2OYHC 4RESB 3H1LE 2E76C 2JEEA 2WSFJ 4D6TG 1QVFO 1LWUB 2OYIA 1E79H 2P2UA 4WB4A 1SQVD 4TT3H 1N73B 1USEA 2WITA 1LNQA 2R3SA 1L4AB 3AECC 3IAOA 2O1KA 1IFPA 4YXWH 5EFWB 3GW6A 1KILE 2P10A 5AVXB 5AW7B 3IN6A 1FZCB 1Q90D 4PD4D 1SP4A 2A06G 1SFCA 2A45H 4JF7A 4WVZA 2KUBA 3NFQA 2XU6A 5AVRB 5CCHA 3G4SP 3Q5SA 3BVHA 1PPJE 1JMMA 1RF1C 4UB8E 1T2KD 1VQMP 4GOFA 1NJIQ 1M90Q 3HUSB 2IX7C 5AVUB 3P8CD 2XNXA 4GDOA 3OA7A 3V6IA 1R5LA 1GL2B 2PP6A 3CWBG 1FJPA 3TNUA 2IYPA 2BCCG 3AEBC 2FYUK 2W83C 1LTAC 2HG5D 2P58A 2Z5HA 1HJ0A 1L2PA 3H1LG 2ZT9D 2PGDA 1IJDB 1LTJB 2ZYAA 1JM0A 1NTKG 1LTIC 3A0HH 1YHQP 3WU2E 3VMYA 1EDJA 2R3CA 2W6AA 1QL1A
chains in the Genus database with same CATH topology
2YXRB 3JC22 1RH5B 2YXQB 1RHZB 3MP7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YXR B;  3JC2 2;  1RH5 B;  2YXQ B;  1RHZ B;  3MP7 B; 
#chains in the Genus database with same CATH topology
 1DEB A;  3F5H A;  4Y28 J;  3HD7 B;  1S3J A;  3AE1 C;  2GM4 A;  3CX5 H;  3HE4 A;  3IFM A;  5GTH H;  1H88 A;  4KT0 J;  1DIP A;  4D6T D;  3L4F A;  3MD0 A;  1ZW0 A;  2YXQ B;  1IFJ A;  1FC2 C;  1OFC X;  1RE3 A;  1OX3 A;  4WY4 C;  2FFD B;  2PAJ A;  3VYI A;  2JP3 A;  3CME P;  1S9K E;  2KZI A;  3AE4 C;  1NU1 G;  1GL2 D;  2SPZ A;  2WZ7 A;  1URQ B;  1BCC E;  1PPJ G;  4C7N A;  2WPR A;  1IK7 A;  1K8A Q;  2E74 B;  2A06 D;  2E42 A;  3SFE C;  3LIE A;  1LWU A;  4NPD A;  3S4R A;  2GUV A;  3MP7 B;  3FWN A;  3WU2 H;  2KS1 A;  1VDF A;  1J1D C;  3R2P A;  1N73 A;  4RJT A;  5BU5 A;  3H1H E;  3D6Y A;  1KIL B;  3HD7 D;  1DEE G;  4HKZ H;  1JTH B;  1T3U A;  1NAF A;  1Q86 Q;  1LT1 A;  3ZDM A;  1BCC J;  1OW7 A;  3RK2 C;  3CWB D;  1IC2 A;  2OYO A;  4L74 A;  3CC7 P;  3MIW A;  1BSN A;  2Q7C A;  4DT0 A;  5B66 E;  1OVV A;  3MZW B;  1EDL A;  3H1L D;  1UIX A;  1M7L A;  1NTK D;  1AQ5 A;  3H1H J;  1USD A;  1URQ D;  1OVR A;  1N7L A;  1AVY A;  1LTG C;  5GTI E;  4Y99 C;  2WT7 B;  4R4M A;  3HUS A;  2E74 D;  2QJK C;  1JUN A;  1IO4 A;  1U7M A;  4UB6 E;  4JYB A;  1GL2 A;  1JCC A;  5DJU B;  3KPE A;  3EQ2 A;  3CPW O;  3PP5 A;  4AQR D;  4QMA A;  1SQB E;  1KIL D;  2H89 C;  1BCC G;  2P67 A;  3CI9 A;  5TIS H;  2KLV A;  1LTJ A;  4N3Y B;  3A7O A;  3C9I A;  2HPC B;  1X79 B;  5APT A;  2E5T A;  3HRN A;  1FAV A;  1BDD A;  3RL0 C;  2LR2 A;  3D71 A;  3NXS A;  5CMZ A;  5H2F E;  1K73 Q;  3SFD C;  1HBW A;  3HD7 A;  1PPJ D;  3H1H G;  3CL3 D;  1YIT P;  1BGY J;  3CCR P;  3TGU E;  1K05 A;  2XV5 A;  1JO5 A;  1EDI A;  2GUS A;  2IDB A;  1FZF A;  4ZKU A;  2OYI C;  2Q6Q A;  3P7K A;  4IFF A;  1ZP0 C;  2IFN A;  2QEX P;  1MKM A;  4RO0 A;  5KLV E;  5KAF E;  3G9R A;  2E75 D;  1NTM K;  5KJ7 C;  4UB6 H;  1KQS O;  3KDP B;  1M1J C;  3CC2 P;  1KYO E;  1L0N K;  3WUV A;  3TGU J;  2KOG A;  3H32 A;  3V2P A;  1VF5 C;  1JY2 P;  1SQP E;  1OVU A;  2OAR A;  3GHG A;  1VQ6 P;  3RK3 C;  2G3A A;  2UWJ E;  5L8R J;  1HH0 A;  1SQX G;  3HE5 B;  4C7R A;  5KLV J;  1SQB G;  2LXB A;  3H6P A;  3ABV C;  4R4L A;  5CCH C;  1ZR4 A;  3QH9 A;  3M9Q A;  1KFM A;  5AW6 B;  4LC1 A;  1S9K D;  1M1K Q;  3TSI A;  3AE2 C;  2PFX A;  1QX8 A;  1SQP J;  3GF7 A;  1VQ4 P;  5E79 E;  1JNM A;  1BCC D;  1YBK A;  1KV4 A;  1KB9 D;  1KC8 Q;  5KTB A;  2ITA A;  4LLH A;  3T97 A;  1KYO H;  3L75 E;  1NHL A;  3H1H D;  4TLF A;  1Y8A A;  1WMK A;  3G6E P;  1Q81 Q;  5KLV G;  4L73 A;  4PJ0 H;  4W7Z A;  3M9H A;  3H1K G;  1EZV I;  3H1I E;  3CXH D;  1CI6 B;  1VQK P;  2ZXE B;  1JY3 P;  1G2C B;  2OTL P;  3AED C;  5AVT B;  2QJY C;  1RE3 C;  1RE4 C;  3L35 A;  2ZVN B;  2HFE D;  2WSC H;  1SQV G;  2CPB A;  3RL0 g;  3L75 J;  3PHL A;  3P8M C;  1GD2 E;  3H1I J;  5AVS B;  3MTU E;  1T2K C;  4M3L A;  1SQX D;  1LWU C;  1KB9 I;  1ZR2 A;  3V2R A;  1SQB D;  1S4X A;  1N7S B;  1GU5 A;  1N73 C;  1FZE A;  1PGP A;  2V7Q J;  2WSE J;  5K5G B;  5CHX A;  3PTZ A;  2ZT9 C;  1SQQ E;  4DOJ A;  1DD4 A;  2WMM A;  1QGK B;  3CXH I;  1FOS F;  3L75 G;  3B5N B;  1FZC C;  1GW4 A;  3NMD A;  3HE5 A;  4I7Z B;  2WTY A;  1NWQ A;  1FOS E;  1VQ5 P;  4NPE A;  2ZAE B;  1RHZ B;  2WSE H;  1CW5 A;  3I55 P;  1OMI A;  1RY3 A;  3L70 E;  3CD6 P;  4PV1 D;  3LID A;  5KLV D;  1X9V A;  1SQQ J;  4JQ0 D;  3H1K D;  3HUS C;  3II6 A;  4ZKP A;  1S5L H;  2OQQ A;  1MFT A;  1GL2 C;  1N7S D;  4H13 B;  3HTK B;  5AW4 B;  5M1B A;  3KXD A;  4AYC A;  3Q1M A;  1D7M A;  2NPS B;  1MUU A;  5APQ A;  1LTJ C;  1LP1 A;  3L70 J;  2KSE A;  1ZN5 A;  1K04 A;  2Y0D A;  2H88 C;  1BE3 E;  1T6A A;  5KJ7 A;  3A2A A;  2N1T D;  1M1J A;  2FYU E;  3B5N D;  3A0H E;  4EOT A;  3HD7 C;  1FDM A;  3AE3 C;  1CI6 A;  4L76 A;  2IZ1 A;  1SQQ G;  1GDT A;  1SLQ A;  1Q7Y Q;  3CX5 E;  3EFG A;  5GTH E;  4XE5 B;  1L0L G;  1EC5 A;  3IR9 A;  3L36 A;  1LGH B;  1P84 E;  1NKN A;  2FFD C;  1BE3 J;  1JY2 N;  2W6B A;  1MZ9 A;  2B89 A;  2FYU J;  1E5W A;  3G71 P;  5AW1 B;  2K9Y A;  1PP9 E;  2B87 B;  1URQ C;  4H13 D;  3L75 D;  3L70 G;  2A45 G;  2E5Y A;  2KYV A;  1TU3 F;  2E74 C;  4ASV A;  2NPS D;  2YKP A;  1J1E B;  3GHG C;  3H1I D;  4C46 A;  2M5A A;  3CCQ P;  1NTK K;  1L4A D;  5KLI B;  2LKM A;  3A5T A;  1PFI A;  1LT9 B;  2KSJ A;  1KIL C;  1H89 A;  2H7H A;  2IBZ E;  2OYH B;  1PP9 J;  2QJP B;  2N1T A;  2YKO A;  1ZRT E;  2Z4E A;  1BE3 G;  3UIA A;  1HGV A;  2FY8 A;  4PD4 I;  2FYN B;  1P84 H;  2W6J H;  1SS1 A;  2QVA A;  2W8Z A;  1RE4 A;  2C9N Y;  2BAS A;  3L37 A;  3LW5 H;  1NU1 K;  5APS A;  2Q9I A;  2KNC A;  1PGO A;  3B71 A;  1H8A A;  1VQP P;  2M0B A;  1NTZ K;  3M0A A;  2YIU C;  3OW2 O;  2E75 C;  2FXO A;  5AW9 B;  1M57 D;  1SQQ D;  3MHV A;  1IFN A;  4OGQ B;  1PP9 G;  3AE6 C;  4EYY Q;  1OIP A;  2I1K A;  4A7P A;  2YMY A;  1L0L D;  2RKL A;  1YYC A;  2M8R A;  3VN0 A;  1FZA A;  1FBM A;  2M3E A;  1L4A A;  1JB0 J;  5TIS E;  4HB1 A;  1VQN P;  1RQU A;  4OH8 B;  3WUT A;  3U1A A;  2JJL A;  1HTL C;  3L70 D;  3BAT A;  1FS0 E;  2FYZ A;  1HVV A;  3EWK A;  4OVN F;  2N9Y B;  1IK9 A;  1FZC A;  2KIK A;  1R5S A;  1GK6 A;  3L71 E;  1S1C X;  2JWA A;  2O01 J;  2Q1K A;  1DH3 A;  3H1J E;  3PLN A;  2RMZ A;  3EFF K;  1FJK A;  2YO3 A;  2KK7 A;  4OGQ D;  2B87 A;  1FDO A;  1BE3 D;  3BCC E;  2JKV A;  1JEK A;  1JMB A;  2FYU D;  1BGY E;  1Y9B A;  3NTN A;  1NTM E;  3L71 J;  2O01 H;  5CCG D;  3Q2Y A;  3TF5 A;  2BEZ F;  3GLM A;  1QVG O;  3B4S A;  3E1I A;  3D6Z A;  3CX5 D;  3H1J J;  2QRX A;  2Q3E A;  2AXT H;  2WVR A;  2XKM A;  3TDK A;  1Q82 Q;  2A45 I;  2QE7 H;  2J58 A;  3BCC J;  3MUD A;  3SSU A;  1ZXG A;  1PP9 D;  1PGJ A;  1NTM J;  3VTP C;  1KQL A;  3JSV C;  1YIJ P;  2KB7 P;  1L0N J;  4I1L A;  1KQF B;  4BRY B;  4DJG A;  2FXP A;  2HOD B;  3V2N A;  1QL2 A;  2FFD A;  2OTJ P;  3O6Q B;  1N2D C;  4U7J A;  1HGZ A;  2QA4 P;  1URQ A;  1KTM A;  1PGQ A;  2K9J B;  2IBZ D;  4RKU J;  2QM8 A;  1SQX K;  1ZRT D;  4NPF X;  3V4Q A;  1A02 J;  1H0T B;  4PJ0 E;  2KZJ A;  3L72 E;  3A0B H;  1SQB K;  2B88 A;  1BGY G;  3CX5 I;  1KIL A;  1R8E A;  1JTH A;  3GF3 A;  3U59 A;  1NGM B;  2KP8 A;  4IL6 H;  4PV1 C;  2H8P D;  2JDI H;  4GT1 A;  3AE7 C;  1VQL P;  2AEM A;  4K35 A;  1LTS C;  1RF0 A;  5AVQ B;  5CJ4 A;  1NYH A;  1GZL A;  3L72 J;  3VMA A;  3C8V A;  5KKZ C;  3Q3D A;  1OWA A;  3TGU G;  4CPG A;  1N7S C;  2WPV B;  2ZYD A;  1LTB C;  4ASW A;  4KJM A;  5BVZ A;  2WQY C;  1HWT C;  5KLV K;  3KYQ A;  2WT7 A;  2WSC J;  4HJG H;  2NRG A;  4LGD E;  1QEX A;  3B8E B;  5AVV B;  4N6J A;  1IZN B;  2OYI B;  2N1T C;  2NZ2 A;  2YNY A;  1GU4 A;  3B5N C;  3V2Q A;  2K3R A;  4I7Z C;  1SQV K;  4W80 A;  2POH A;  2HPC A;  1SQP G;  1HUC A;  2C0X A;  2XND H;  3L72 G;  1NKZ B;  3JCU H;  1VF5 B;  1VPC A;  1YTZ T;  3S1K A;  1N8R Q;  3R4Y A;  4JBZ A;  1S5L X;  5DJT B;  2HR3 A;  2XZR A;  1NO4 A;  2R44 A;  1VL2 A;  1SFC B;  3VMZ A;  3W68 A;  1FE6 A;  3BCC D;  3A3Y B;  2Q5U A;  4H13 C;  4XA4 A;  1ZOY C;  1BGY D;  1S5L E;  5KAI H;  5AW0 B;  3RBX A;  4BRY A;  3CCE P;  1W5C E;  4PD4 H;  2NPS C;  3M91 A;  3RBZ A;  1IFI A;  2D2C B;  1L4A C;  3AE9 C;  2WPQ A;  3KQG A;  3CMA P;  2K9J A;  3O8Z A;  1EDK A;  3TNU B;  4IFM A;  3JC2 2;  1AV1 A;  4I2L C;  2C0W A;  1KFN A;  2JO1 A;  3FXE A;  3TGU D;  3H1I G;  1YI2 P;  3CLQ A;  4H0L B;  1CZQ A;  1FU1 A;  1SFC D;  3BRV B;  1YJN P;  3HE4 B;  5APX A;  2V4H A;  1ZME C;  4H44 B;  4WWI A;  3P32 A;  3F89 A;  2IPP A;  3OAK A;  1KYO D;  1J1E C;  4EI2 A;  4N78 E;  2Q3I A;  2QIW A;  3U1C A;  2D2C D;  1SQP D;  4IFD K;  1AJY A;  2OTK E;  1JOC A;  5KLI C;  3OJA B;  1U7J A;  4U3F E;  3L72 D;  1AVO A;  4EIJ A;  2BCC E;  1LT9 C;  5APU A;  2LXC B;  4C7N B;  2QJP C;  1NTK E;  1KQG B;  3L73 E;  5AW8 B;  3SWY A;  3MUD C;  1SQQ K;  2K37 A;  2KS1 B;  1YQ3 C;  1GK4 A;  1KMI Z;  1G2C A;  2FYN C;  3PJS K;  1RQV A;  2E43 A;  1L0L K;  1OZH A;  4H0L D;  5CBO A;  3ITK A;  3IF4 A;  3CWB J;  1EQ7 A;  2ZT9 B;  4U3F J;  1VQ9 P;  2IZ0 A;  1HF9 A;  2BCC J;  1QLE D;  3KHU A;  1S2E A;  4H44 D;  2HLO A;  1G1I A;  2WSF H;  2QSI A;  3H1L J;  1MFZ A;  1NTK J;  2Y9Y A;  3FWL A;  3L73 J;  4ZNC A;  1LJ2 A;  1GMJ A;  2L91 A;  1NU1 E;  4OGQ C;  1KYO I;  1DD3 A;  3VP8 A;  1VQO P;  1N86 A;  1EXI A;  1NTZ E;  1N7S A;  1J2J B;  3PRJ A;  2J59 M;  5CCG C;  1M8O B;  2C9L Y;  4GKG A;  1YTZ I;  3LW5 J;  1T3J A;  4L75 A;  4U3F G;  2E76 B;  1NU1 J;  4KHX A;  2JR8 A;  1IFD A;  2K1A A;  2W90 A;  3B5N A;  3FX0 A;  2FYU G;  5AVZ B;  3L73 G;  1RF0 C;  1KN7 A;  1Z56 A;  4O9B A;  1NTZ J;  2Y9Z A;  2AXC A;  3E1R A;  5APY A;  1S72 P;  1EZV E;  4I6M C;  3M0D A;  1FZG A;  1T8Z A;  4JYC A;  5APW A;  3GMA A;  1MV8 A;  1JY3 N;  1XTG B;  3SWK A;  2ZXX A;  2R5B A;  3HTK A;  4UB8 H;  2KLU A;  4BWN A;  1YQ4 C;  3VMX A;  3KZI E;  2NPS A;  1RF1 B;  2N9B A;  2E76 D;  1DX7 A;  3C1L A;  3WUU A;  2YKQ A;  1NTZ G;  4B86 A;  1YJW P;  3H32 B;  3W67 A;  2PRR A;  1KB9 E;  2JWD A;  3TK1 A;  3GHG B;  3AE5 C;  2AXT E;  3V4W A;  1FDI A;  2RH0 A;  3M9B A;  2IBZ G;  1AA0 A;  3N7N A;  1CSB A;  1X22 A;  2RN0 A;  2KXP B;  3BAS A;  5AW5 B;  3K5B A;  3PH0 A;  4N78 D;  3CXH E;  5AVY B;  3I56 P;  2M3B A;  4U3F D;  2BCC D;  2AEF A;  3CC4 P;  1EZV G;  2ZYG A;  2P7J A;  1RH5 B;  3L73 D;  4Z1M H;  1PL5 A;  1VQ7 P;  2H43 A;  3KZI H;  3MGN A;  3L74 E;  4WY4 B;  2I8D A;  3TYY A;  4YTP C;  3T97 B;  1AQT A;  1PIX A;  3V5B A;  3VOP A;  1L0N E;  3G3Z A;  3D70 A;  2Y0C A;  2YIU B;  5CJ0 A;  2GA1 A;  2E75 B;  1LT9 A;  1KB9 H;  3A0B E;  2ZFC A;  1SQX E;  3BRT B;  2OYH A;  1P84 D;  1NAY A;  4IL6 X;  4HYT B;  1OW6 A;  4HH2 A;  1A02 F;  3GG2 A;  4DCK A;  4XFJ A;  1J1D B;  1ZLL A;  3I5C A;  2YMK A;  3L74 J;  1NU1 D;  4IL6 E;  3USS A;  3CXH H;  1OXZ A;  4EDF A;  4ZMD A;  3RK3 E;  3AEG C;  1NTZ D;  1SQX J;  2AEJ A;  1VQ8 P;  3L71 G;  5B66 H;  4MN4 C;  3RK2 B;  1X8Y A;  1SQB J;  2KI7 B;  1SVF A;  1KZU B;  1NH4 A;  3S9O A;  1EXJ A;  2MJZ A;  4WY4 D;  1OW8 A;  3H1J G;  5TJH A;  4BXL A;  1XTC C;  5GTI H;  1ZV8 A;  4GIF A;  5CBN A;  3H1K E;  3BCC G;  2HYN A;  3E7K A;  1RF1 A;  4Y99 B;  2MKV A;  4IOI H;  5CCG A;  1NTM G;  1NVO A;  2QJK B;  3L74 G;  2O01 N;  1W2E A;  5B5E E;  1P84 I;  3N4X A;  4GOD A;  1UII A;  2WPS A;  2YXR B;  1EZV D;  1L0N G;  2QG4 A;  3FXD A;  4GOE A;  1SQV E;  3JCU E;  1SFC C;  1KD1 Q;  2FBW C;  5H2F H;  3H1K J;  3H25 A;  3AE8 C;  2Y0E A;  3RK2 D;  1FZB A;  3RL0 B;  2QM7 A;  2O1J A;  1BDC A;  4WBA A;  1IFM A;  1Q2N A;  5KAI E;  2BEQ D;  2D2C C;  1PV3 A;  4PD4 E;  4YXD C;  1SQV J;  2ZVO B;  2IBZ I;  3CCU P;  3CCM P;  5KAF H;  4W7Y A;  1WT6 A;  4WY4 A;  1LP1 B;  2P1J A;  1SQP K;  1PZQ A;  1Y47 A;  3Q5P A;  5B5E H;  2R5D A;  4YPC A;  3P8C E;  2WSS H;  1NOH A;  1M1J B;  5C39 A;  1JY2 O;  3L71 D;  4K3A A;  4H0L C;  2K88 A;  1G1J A;  3M0D C;  3FGA D;  1W2B O;  3H1J D;  4H44 C;  2I1J A;  2W27 A;  3RK3 B;  5AW2 B;  5AW3 B;  3RL0 D;  2CK3 H;  2VRS A;  2XDJ A;  2FXM A;  3Q5R A;  3AEA C;  1NTM D;  3L74 D;  2HOD A;  1BSH A;  2Z5I A;  5E79 H;  4PV1 B;  3O6Q A;  2YO2 A;  4D6T E;  3CCS P;  3CCJ P;  1L0N D;  2WWW A;  2OGU A;  1AFO A;  2M5A B;  4OWF A;  5KKZ B;  1WRG A;  2R32 A;  5KJ7 D;  1HJB A;  2J5U A;  1H0T A;  1YJ9 P;  2FKW B;  3WMM 0;  2IYO A;  1U57 A;  1LTT C;  2O3J A;  1VF5 D;  2IFM A;  4DZO A;  4D6T J;  2CPS A;  2A06 E;  3RK3 D;  1GTW A;  1JY3 O;  2L5G B;  2N1T B;  3AEF C;  1L0L E;  1K9M Q;  3RGU A;  1JCD A;  2ZJS E;  4JPZ B;  3QWO C;  5APV A;  2V7Q H;  2G8Y A;  5CCH D;  2QJY B;  2B9B A;  1GW3 A;  1KOR A;  2KNC B;  3CCV P;  3VP9 A;  5AVW B;  3M06 A;  2DW3 A;  3AEE C;  3CWB E;  5BU8 B;  1X0T A;  1M56 D;  3SWF A;  1L0L J;  3CCL P;  4AUW A;  2OYH C;  4RES B;  3H1L E;  2E76 C;  2JEE A;  2WSF J;  4D6T G;  1QVF O;  1LWU B;  2OYI A;  1E79 H;  2P2U A;  4WB4 A;  1SQV D;  4TT3 H;  1N73 B;  1USE A;  2WIT A;  1LNQ A;  2R3S A;  1L4A B;  3AEC C;  3IAO A;  2O1K A;  1IFP A;  4YXW H;  5EFW B;  3GW6 A;  1KIL E;  2P10 A;  5AVX B;  5AW7 B;  3IN6 A;  1FZC B;  1Q90 D;  4PD4 D;  1SP4 A;  2A06 G;  1SFC A;  2A45 H;  4JF7 A;  4WVZ A;  2KUB A;  3NFQ A;  2XU6 A;  5AVR B;  5CCH A;  3G4S P;  3Q5S A;  3BVH A;  1PPJ E;  1JMM A;  1RF1 C;  4UB8 E;  1T2K D;  1VQM P;  4GOF A;  1NJI Q;  1M90 Q;  3HUS B;  2IX7 C;  5AVU B;  3P8C D;  2XNX A;  4GDO A;  3OA7 A;  3V6I A;  1R5L A;  1GL2 B;  2PP6 A;  3CWB G;  1FJP A;  3TNU A;  2IYP A;  2BCC G;  3AEB C;  2FYU K;  2W83 C;  1LTA C;  2HG5 D;  2P58 A;  2Z5H A;  1HJ0 A;  1L2P A;  3H1L G;  2ZT9 D;  2PGD A;  1IJD B;  1LTJ B;  2ZYA A;  1JM0 A;  1NTK G;  1LTI C;  3A0H H;  1YHQ P;  3WU2 E;  3VMY A;  1EDJ A;  2R3C A;  2W6A A;  1QL1 A; 
#chains in the Genus database with same CATH homology
 2YXR B;  3JC2 2;  1RH5 B;  2YXQ B;  1RHZ B;  3MP7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...