3MP7B

Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
54
structure length
54
Chain Sequence
b'IRHFWKESRRAFLVTKKPNWATYKRAAKITGLGIILIGLIGMLIRIVGILILGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Preprotein translocase subunit secY
molecule tags Protein transport
source organism Pyrococcus furiosus
publication title Lateral opening of a translocon upon entry of protein suggests the mechanism of insertion into membranes.
pubmed doi rcsb
total genus 15
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2010-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 3mp7B00
3MP7B 1RHZB 2YXRB 1RH5B 3JC22 2YXQB
chains in the Genus database with same CATH superfamily
2Q9IA 1JUNA 1FOSE 4AUWA 5KAFH 1BCCJ 2FXMA 1USDA 1HTLC 4TLFA 1VF5B 2QE7H 5KAIH 2B9BA 3CCEP 1GL2C 3H1JE 3RGUA 4JQ0D 3A5TA 2Q3EA 1DX7A 1ZR2A 4OGQB 1SFCC 4BRYB 1GK4A 1SQXG 2Q7CA 2J5UA 3VMZA 3AECC 3EQ2A 1NTMG 1NKZB 2BCCD 1M1JC 1NU1G 5KLVJ 3H1KE 3H32A 2H8PD 3HUSA 1CI6A 1VPCA 3H1IE 3L73E 1EZVI 1SQPK 1USEA 3HD7C 1NTMK 1SP4A 4DT0A 5AVQB 1N7SD 2WT7A 3FXDA 4U3FE 1SQPD 1NTMD 2BCCG 2LKMA 1G1JA 3L75J 1Q81Q 3ZDMA 2Y0DA 2YIUB 4WWIA 3HE5B 5E79H 1L0NJ 1L4AA 1T3UA 3C1LA 4HB1A 3VP8A 1VQ4P 1YQ3C 2E43A 2N9BA 1EZVE 3T97A 1NTZJ 3JC22 3S1KA 3U1AA 3CMEP 2N1TB 4GT1A 2IYOA 5CHXA 2PP6A 1Q86Q 1L0LK 2QJKC 3LIEA 1YJWP 3RK2C 2E5YA 2O01N 3S4RA 2WSFH 2OTLP 1L0LD 3HD7B 3H1JG 3L72D 1SQBK 1NOHA 1VL2A 2WVRA 1Z56A 3P8CE 4LLHA 1BGYE 1DD4A 2ZYGA 1XTGB 3H1LJ 1SQVK 1SQBD 4BWNA 2RH0A 3BVHA 1BCCE 3P32A 2J59M 2JDIH 3CWBD 2OQQA 3HE4A 3V2NA 1FZAA 2V7QJ 3RK3D 5CCGD 1BE3G 2FYNC 2P2UA 1URQA 4PV1D 2WPQA 2E42A 1GU4A 1J1EC 5AVWB 2D2CD 3WU2H 1IFDA 1OXZA 3CCLP 3AE2C 1KMIZ 1ZV8A 1L4AC 1QVFO 1VQ6P 5CCHD 1NTZE 5KAIE 2PRRA 2HLOA 2KZJA 3RK2B 2FYUJ 1T6AA 3N4XA 4XE5B 3FWLA 1K73Q 4RESB 4H13C 3KZIH 4H0LC 1BE3J 3H25A 1AVYA 1SQQK 4ZNCA 2I1KA 3RBZA 1YQ4C 1PP9J 2B88A 2BCCE 1U57A 2FKWB 2KI7B 4IFFA 1OFCX 4K3AA 5AVRB 1J1DB 1SQXD 1KYOI 1NTMJ 1KFNA 4PD4H 5AVVB 1BSNA 3WUUA 4ASWA 2OYIB 3PLNA 3L71J 3MUDC 1N8RQ 2IFMA 3JSVC 3AE8C 3M06A 1FZFA 1ZLLA 1L0ND 1JMBA 3AE6C 2P67A 3L37A 3P7KA 3VOPA 5B5EH 3CI9A 2Q6QA 1QL1A 1LT9B 1URQC 2ZXXA 1ZP0C 3IF4A 5C39A 3RL0D 2AEJA 3UIAA 1Q7YQ 1H89A 1NH4A 1EQ7A 1JM0A 2KZIA 4D6TJ 1EDJA 1PGQA 2QJYC 3B5NC 1T2KD 3H1JJ 2IDBA 2P58A 1SFCA 4N78D 3CCQP 3CL3D 1KYOH 4PD4I 3W67A 2R5DA 3EWKA 1KB9D 1SQBJ 3CX5H 1VQPP 2IBZE 1YYCA 1LP1B 1NTZG 2Q1KA 2O01H 3RL0B 5B5EE 1SQVJ 3TF5A 3D70A 3V4QA 4W7ZA 5KJ7A 4EOTA 3U1CA 1FJKA 1NTKG 2CPSA 1ZMEC 3B71A 3TNUB 3MUDA 1S5LH 3V5BA 3IN6A 1JY3P 4YXWH 3B4SA 2QEXP 4WY4C 4NPEA 1TU3F 2XNXA 3GHGB 2Y0EA 2KNCA 4HYTB 4IL6X 4R4MA 3AEGC 3CCJP 3C9IA 2E75D 2QSIA 3F5HA 1YI2P 1JOCA 1T3JA 2FYUD 1N7SB 4QMAA 4UB6E 5TISE 4CPGA 2I8DA 3V4WA 1BE3D 4KHXA 1M1KQ 1M56D 3AE5C 5APQA 5GTHH 1JO5A 1K04A 1PP9E 4HJGH 1X79B 1D7MA 4TT3H 1NAYA 2KNCB 1BDDA 5H2FE 1KC8Q 3H1LG 3VMAA 2E76D 3JCUH 1S5LE 1S9KD 3AEDC 1K05A 2OTKE 1BSHA 3HTKA 3L71D 1RF1B 1FS0E 2WSEH 1VQLP 1YTZT 2CPBA 1RE3A 3MGNA 1CW5A 4ZKUA 1KQFB 5KLVK 3CCSP 4U3FG 1FBMA 1KN7A 1PFIA 1U7MA 1Q2NA 5AVSB 1JY3N 2IX7C 2WSEJ 3L70D 1GDTA 1GL2B 4D6TD 1KILB 1DH3A 2P1JA 4ASVA 1S2EA 4WB4A 3H1IJ 3KXDA 3LW5H 1OX3A 3G9RA 3D6YA 1LTAC 1KD1Q 2FFDA 1GW3A 3O6QA 1MUUA 3T97B 1FC2C 1AFOA 2YO3A 1FDOA 3AEFC 1AVOA 1LTJA 1PP9G 3LW5J 3TK1A 5KKZC 1EXJA 1RQUA 4C7NB 1Q90D 1JTHA 1WMKA 2J58A 4IFDK 1OW8A 2PFXA 2R32A 1K9MQ 3HE5A 5AW9B 2KLUA 2R3CA 1KQGB 2OGUA 3AE9C 3BATA 3HE4B 3P8MC 1RY3A 1RE3C 1RE4A 4ZKPA 1FZCB 2YKQA 2JJLA 1ZRTE 2KYVA 4RJTA 2E75B 3A7OA 5B66E 2ZXEB 5E79E 5AW5B 5DJUB 4NPDA 2KSJA 4U3FJ 1AJYA 3CC7P 2POHA 1YTZI 1IFNA 1LT9A 1RHZB 4DJGA 3E1IA 1JB0J 2LXBA 1FZCA 2JP3A 2NPSA 2WPVB 1OZHA 1L0NE 3I55P 2M3EA 4RO0A 3ABVC 4GKGA 1AQ5A 1HJ0A 1IFJA 2K88A 3KHUA 1LTJB 2C0XA 1ZRTD 1X8YA 2Y9ZA 5APWA 1MFTA 5KTBA 3CCVP 2IBZI 2UWJE 3L73G 2P7JA 1R5LA 4DCKA 2RN0A 2C9NY 2WWWA 3L74E 4U7JA 1NVOA 2FYNB 1RE4C 2E74C 2O1JA 4I7ZB 1PGPA 1LTTC 2M5AA 2MKVA 3H1ID 1N7LA 1KILC 1PIXA 3ITKA 1EC5A 3NXSA 1P84D 4WY4A 4EIJA 3Q5SA 4MN4C 2YO2A 4U3FD 3SWKA 2CK3H 3WMM0 2BEZF 2JWAA 1DEEG 5EFWB 3BCCD 1OVUA 5AW4B 3GG2A 1SQQG 4H0LB 1FZCC 1KILD 3EFGA 4M3LA 2E74D 2E75C 2FYUG 2ZFCA 3D6ZA 3PRJA 1EZVD 1LP1A 1S1CX 1H88A 3PP5A 3B8EB 3PTZA 5CCHC 4OVNF 5AVTB 1AQTA 2R44A 5KAFE 2D2CC 2GM4A 1RH5B 1ZR4A 2JEEA 1LTBC 1NHLA 1PPJD 5APVA 5APYA 1MKMA 4ZMDA 1QL2A 2N1TA 2FXOA 1N7SA 1KILA 1BGYD 2HG5D 2Q3IA 5AW8B 1QEXA 2FXPA 1KZUB 2E76C 3CWBE 2LXCB 3L71E 1BCCD 3V2QA 3L74G 5AW1B 3L75D 5AW0B 3W68A 3GW6A 1S4XA 3B5ND 2KB7P 1PPJG 3SWYA 4D6TG 1T2KC 1RQVA 1KYOE 3L70E 1UIIA 1NTZK 1WRGA 1RF0A 1URQD 3CX5E 2B89A 2K9JA 1LTJC 2O1KA 4KT0J 1N73C 2D2CB 1JY2O 2ITAA 1NTZD 2KS1A 2YKOA 1MZ9A 1NTKK 2YNYA 4GODA 1NGMB 5CCHA 4WY4D 4L75A 1BDCA 1NKNA 4Y99B 4KJMA 2M3BA 3HUSC 1NTKD 2W6AA 4YXDC 2KS1B 1G1IA 4C46A 1GK6A 1JNMA 3L75E 3WUVA 5BU5A 2HYNA 1W2BO 3R4YA 1SQXE 3I5CA 5M1BA 1QVGO 1LTIC 1PGJA 1SQPJ 4PJ0E 1N7SC 5AW3B 3K5BA 5AW7B 2M8RA 3CMAP 3Q5RA 4UB6H 5TISH 4O9BA 4BRYA 5KLVG 3HTKB 2JR8A 1L0LE 1X22A 3L72E 3CC4P 3WUTA 3MZWB 2KOGA 3M0DA 3G71P 1NTKE 3CD6P 3SFEC 1DD3A 1NU1K 1SQVG 5L8RJ 2WSFJ 1N2DC 2XV5A 3A0HE 4H13B 2B87B 1VDFA 2WSSH 5CCGC 1LTSC 3RK3C 3H1KD 1K8AQ 5KKZB 3USSA 1EDKA 3GLMA 1CZQA 2W6JH 4PD4D 1W2EA 2VRSA 2Z5IA 5APXA 1BGYJ 2XKMA 3AEAC 1BGYG 2Y0CA 2I1JA 1SQPE 3OJAB 3TGUG 1IK7A 1XTCC 3CPWO 2K1AA 2QM8A 1PPJE 1OW7A 2NRGA 2OYIA 4I1LA 3L75G 1Y47A 2QVAA 2OYOA 3RK2D 5BVZA 1JTHB 3D71A 1A02F 3KZIE 1HWTC 1DIPA 1EXIA 5KLIC 2QM7A 3CXHD 2AEFA 2IZ1A 2WPSA 2V4HA 2BEQD 1IC2A 1PL5A 4HH2A 1J1EB 3TYYA 1JY2N 2A06D 4UB8H 4PD4E 3H1LE 1SVFA 3MD0A 1IZNB 3AE4C 2NZ2A 1YJ9P 1N73B 2BCCJ 1KB9H 1NTKJ 1SQQD 3CX5D 3QH9A 5CCGA 1GZLA 1VF5C 3AEEC 3H1JD 1L0LG 3L72G 3BCCE 2QJPC 3MP7B 1PV3A 1R5SA 2H89C 4A7PA 3TGUD 2W8ZA 4EI2A 1ZW0A 1SQXK 2V7QH 3HD7D 3IFMA 1SQBG 4XA4A 4XFJA 1S9KE 2HODA 1CSBA 1J2JB 1G2CB 1KB9I 1NU1J 3AEBC 4GOFA 4IFMA 3RBXA 3G3ZA 4H44B 2KSEA 1L2PA 3MHVA 4EYYQ 1LWUB 1HGZA 2JWDA 5AVYB 2OYIC 1JY2P 3RK3E 5K5GB 2OTJP 1EDLA 1ZOYC 3HRNA 1LGHB 1Y8AA 3H1HG 2K37A 1UIXA 3L73D 2P10A 1KB9E 1OMIA 3RL0C 3LIDA 4BXLA 3B5NA 1KTMA 1S3JA 3VMYA 1JEKA 2OYHB 3O8ZA 4C7RA 1BCCG 1M8OB 2GUSA 3H1KJ 2KIKA 2M5AB 2K3RA 2O3JA 4OH8B 5KLVD 1KV4A 1OW6A 4H44D 3SWFA 1N73A 3KDPB 1HUCA 1GU5A 3A0HH 1QLED 2IPPA 1NAFA 2WSCH 2PAJA 2KK7A 2QG4A 3BCCG 3CX5I 3AE7C 1GMJA 4I6MC 1SQVD 3AE3C 2KUBA 4JYBA 1U7JA 3PHLA 2XDJA 4H0LD 1HH0A 2AXTH 3CWBJ 4H13D 5CJ0A 1FAVA 2WSCJ 1GD2E 1S5LX 1L0NG 1MFZA 2PGDA 3P8CD 3V2PA 4Z1MH 5GTHE 1JCCA 2WT7B 1AV1A 2FBWC 1HVVA 1L4AD 1MV8A 2H88C 2YIUC 2ZT9B 2YMKA 3M9QA 3H32B 1HJBA 3L70J 2HPCB 1KILE 4GDOA 3GHGC 4PV1C 4L76A 2M0BA 2NPSC 1KQSO 3IR9A 1SQQJ 4Y28J 1L0LJ 2QJKB 1GL2D 3L72J 3M0DC 1LWUC 3M91A 3M9BA 4N78E 2WTYA 3U59A 5AW6B 1PZQA 3H1LD 4AQRD 3WU2E 1J1DC 3TSIA 1YIJP 3FX0A 3II6A 1HGVA 1SQQE 1L4AB 1M1JA 1NTME 1NU1D 2ZT9D 1SQXJ 2L91A 4LC1A 3H6PA 1M57D 1ZN5A 4OWFA 2H7HA 2XZRA 3KPEA 3Q1MA 3EFFK 1FZBA 5CMZA 1FU1A 2E5TA 2WQYC 3Q2YA 3BRVB 4AYCA 5BU8B 5APUA 2WMMA 3L73J 1IFPA 5AVUB 1N86A 3L74D 2QJYB 1FDIA 1FZEA 1GTWA 2FYUE 2FFDB 2QRXA 2G3AA 3GF7A 4N6JA 1PGOA 3M9HA 3MTUE 1LJ2A 4JPZB 2RKLA 2HPCA 1P84E 1HF9A 1KQLA 1VQMP 1EZVG 4JBZA 1PP9D 1E79H 2JO1A 5GTIE 1VQOP 2Z4EA 1QX8A 1ZXGA 3SSUA 2ZVOB 4N3YB 3VP9A 1JMMA 2WZ7A 3OW2O 1HBWA 4PV1B 1KORA 2IFNA 4OGQD 3BRTB 1LT1A 2A45H 1OVVA 2WPRA 4K35A 3RK3B 3S9OA 3TDKA 3OAKA 3V6IA 5DJTB 5KJ7C 4GIFA 4PJ0H 3CCUP 1KFMA 3L71G 1M7LA 1JY3O 4WVZA 1SFCD 2E74B 2AXTE 3L70G 4D6TE 4IL6H 2ZYAA 1S72P 1P84H 2HODB 1SQPG 4YPCA 3IAOA 2YXQB 4IOIH 1E5WA 3CXHI 3CLQA 2MJZA 2HR3A 2R3SA 2BASA 2YXRB 3B5NB 1T8ZA 3VN0A 3G6EP 3PJSK 3NMDA 2WITA 2JKVA 2N1TD 3N7NA 3E7KA 3V2RA 5KLIB 1RF0C 2H43A 3BCCJ 2IZ0A 2ZYDA 4I7ZC 1OWAA 3NFQA 1NWQA 3TNUA 1X9VA 2IBZG 1KYOD 2LR2A 4EDFA 1IO4A 3BASA 3L35A 1IJDB 4IL6E 1H8AA 1BE3E 5AVXB 5APTA 4RKUJ 1FZGA 2A45G 1YBKA 2A06G 1G2CA 5H2FH 3L74J 1IK9A 5KLVE 3A0BE 1NJIQ 1EDIA 1P84I 1JCDA 3KYQA 3CXHE 1X0TA 3FXEA 1FOSF 3CC2P 3GMAA 3A2AA 1VQ8P 2E76B 1GL2A 1Y9BA 4DOJA 2OYHA 4UB8E 2A45I 3A3YB 3F89A 3GHGA 3OA7A 4L73A 1YJNP 3FGAD 1VQ7P 2W6BA 2KXPB 1OIPA 1NO4A 2K9YA 1Q82Q 2QJPB 2G8YA 1LWUA 2KP8A 2W83C 3A0BH 2FYUK 2HFED 3R2PA 5GTIH 3TGUE 1GW4A 2FYZA 5CJ4A 1VQ5P 1VQ9P 5AVZB 3HD7A 3PH0A 3HUSB 3MIWA 5AW2B 4WBAA 5CBOA 1H0TB 2RMZA 3KQGA 4JF7A 2KLVA 2SPZA 1AA0A 4W80A 2C0WA 1LNQA 2FY8A 2Q5UA 4JYCA 2C9LY 1H0TA 3H1HD 2OARA 1SLQA 2OYHC 4Y99C 1YHQP 1LT9C 1URQB 3FWNA 3L36A 2K9JB 1SQBE 4C7NA 2ZVNB 5B66H 1FE6A 2N9YB 2L5GB 2NPSB 2A06E 2O01J 1SS1A 3O6QB 1RF1A 3VTPC 3GF3A 2QA4P 2DW3A 3Q3DA 3CCRP 3I56P 1M1JB 3E1RA 1IFIA 3H1HE 4LGDE 2IBZD 2ZJSE 2B87A 5KJ7D 1W5CE 2AEMA 2AXCA 4L74A 2ZT9C 3QWOC 1YITP 4OGQC 4B86A 1OVRA 1LTGC 2IYPA 2YKPA 2XNDH 3CXHH 1VQNP 3RL0g 2Y9YA 1WT6A 2R5BA 2Z5HA 3SFDC 2ZAEB 4R4LA 3CCMP 2NPSD 3L4FA 3C8VA 2GUVA 1VF5D 1M90Q 4HKZH 4DZOA 1R8EA 2FFDC 1IFMA 3H1IG 3NTNA 3VYIA 4I2LC 4NPFX 3AE1C 3Q5PA 1NU1E 1RF1C 1SFCB 1DEBA 2GA1A 3M0AA 1NYHA 1QGKB 2W90A 1CI6B 3CWBG 3H1KG 3G4SP 3JCUE 4W7YA 1A02J 1L0NK 4GOEA 4WY4B 1FJPA 5TJHA 2QIWA 3H1HJ 3VMXA 5CBNA 1FDMA 4YTPC 2XU6A 3TGUJ 1SQVE 1VQKP 2YMYA 2N1TC 2W27A 5APSA 4H44C
chains in the Genus database with same CATH topology
3MP7B 1RHZB 2YXRB 1RH5B 3JC22 2YXQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP7 B;  1RHZ B;  2YXR B;  1RH5 B;  3JC2 2;  2YXQ B; 
#chains in the Genus database with same CATH topology
 2Q9I A;  1JUN A;  1FOS E;  4AUW A;  5KAF H;  1BCC J;  2FXM A;  1USD A;  1HTL C;  4TLF A;  1VF5 B;  2QE7 H;  5KAI H;  2B9B A;  3CCE P;  1GL2 C;  3H1J E;  3RGU A;  4JQ0 D;  3A5T A;  2Q3E A;  1DX7 A;  1ZR2 A;  4OGQ B;  1SFC C;  4BRY B;  1GK4 A;  1SQX G;  2Q7C A;  2J5U A;  3VMZ A;  3AEC C;  3EQ2 A;  1NTM G;  1NKZ B;  2BCC D;  1M1J C;  1NU1 G;  5KLV J;  3H1K E;  3H32 A;  2H8P D;  3HUS A;  1CI6 A;  1VPC A;  3H1I E;  3L73 E;  1EZV I;  1SQP K;  1USE A;  3HD7 C;  1NTM K;  1SP4 A;  4DT0 A;  5AVQ B;  1N7S D;  2WT7 A;  3FXD A;  4U3F E;  1SQP D;  1NTM D;  2BCC G;  2LKM A;  1G1J A;  3L75 J;  1Q81 Q;  3ZDM A;  2Y0D A;  2YIU B;  4WWI A;  3HE5 B;  5E79 H;  1L0N J;  1L4A A;  1T3U A;  3C1L A;  4HB1 A;  3VP8 A;  1VQ4 P;  1YQ3 C;  2E43 A;  2N9B A;  1EZV E;  3T97 A;  1NTZ J;  3JC2 2;  3S1K A;  3U1A A;  3CME P;  2N1T B;  4GT1 A;  2IYO A;  5CHX A;  2PP6 A;  1Q86 Q;  1L0L K;  2QJK C;  3LIE A;  1YJW P;  3RK2 C;  2E5Y A;  2O01 N;  3S4R A;  2WSF H;  2OTL P;  1L0L D;  3HD7 B;  3H1J G;  3L72 D;  1SQB K;  1NOH A;  1VL2 A;  2WVR A;  1Z56 A;  3P8C E;  4LLH A;  1BGY E;  1DD4 A;  2ZYG A;  1XTG B;  3H1L J;  1SQV K;  1SQB D;  4BWN A;  2RH0 A;  3BVH A;  1BCC E;  3P32 A;  2J59 M;  2JDI H;  3CWB D;  2OQQ A;  3HE4 A;  3V2N A;  1FZA A;  2V7Q J;  3RK3 D;  5CCG D;  1BE3 G;  2FYN C;  2P2U A;  1URQ A;  4PV1 D;  2WPQ A;  2E42 A;  1GU4 A;  1J1E C;  5AVW B;  2D2C D;  3WU2 H;  1IFD A;  1OXZ A;  3CCL P;  3AE2 C;  1KMI Z;  1ZV8 A;  1L4A C;  1QVF O;  1VQ6 P;  5CCH D;  1NTZ E;  5KAI E;  2PRR A;  2HLO A;  2KZJ A;  3RK2 B;  2FYU J;  1T6A A;  3N4X A;  4XE5 B;  3FWL A;  1K73 Q;  4RES B;  4H13 C;  3KZI H;  4H0L C;  1BE3 J;  3H25 A;  1AVY A;  1SQQ K;  4ZNC A;  2I1K A;  3RBZ A;  1YQ4 C;  1PP9 J;  2B88 A;  2BCC E;  1U57 A;  2FKW B;  2KI7 B;  4IFF A;  1OFC X;  4K3A A;  5AVR B;  1J1D B;  1SQX D;  1KYO I;  1NTM J;  1KFN A;  4PD4 H;  5AVV B;  1BSN A;  3WUU A;  4ASW A;  2OYI B;  3PLN A;  3L71 J;  3MUD C;  1N8R Q;  2IFM A;  3JSV C;  3AE8 C;  3M06 A;  1FZF A;  1ZLL A;  1L0N D;  1JMB A;  3AE6 C;  2P67 A;  3L37 A;  3P7K A;  3VOP A;  5B5E H;  3CI9 A;  2Q6Q A;  1QL1 A;  1LT9 B;  1URQ C;  2ZXX A;  1ZP0 C;  3IF4 A;  5C39 A;  3RL0 D;  2AEJ A;  3UIA A;  1Q7Y Q;  1H89 A;  1NH4 A;  1EQ7 A;  1JM0 A;  2KZI A;  4D6T J;  1EDJ A;  1PGQ A;  2QJY C;  3B5N C;  1T2K D;  3H1J J;  2IDB A;  2P58 A;  1SFC A;  4N78 D;  3CCQ P;  3CL3 D;  1KYO H;  4PD4 I;  3W67 A;  2R5D A;  3EWK A;  1KB9 D;  1SQB J;  3CX5 H;  1VQP P;  2IBZ E;  1YYC A;  1LP1 B;  1NTZ G;  2Q1K A;  2O01 H;  3RL0 B;  5B5E E;  1SQV J;  3TF5 A;  3D70 A;  3V4Q A;  4W7Z A;  5KJ7 A;  4EOT A;  3U1C A;  1FJK A;  1NTK G;  2CPS A;  1ZME C;  3B71 A;  3TNU B;  3MUD A;  1S5L H;  3V5B A;  3IN6 A;  1JY3 P;  4YXW H;  3B4S A;  2QEX P;  4WY4 C;  4NPE A;  1TU3 F;  2XNX A;  3GHG B;  2Y0E A;  2KNC A;  4HYT B;  4IL6 X;  4R4M A;  3AEG C;  3CCJ P;  3C9I A;  2E75 D;  2QSI A;  3F5H A;  1YI2 P;  1JOC A;  1T3J A;  2FYU D;  1N7S B;  4QMA A;  4UB6 E;  5TIS E;  4CPG A;  2I8D A;  3V4W A;  1BE3 D;  4KHX A;  1M1K Q;  1M56 D;  3AE5 C;  5APQ A;  5GTH H;  1JO5 A;  1K04 A;  1PP9 E;  4HJG H;  1X79 B;  1D7M A;  4TT3 H;  1NAY A;  2KNC B;  1BDD A;  5H2F E;  1KC8 Q;  3H1L G;  3VMA A;  2E76 D;  3JCU H;  1S5L E;  1S9K D;  3AED C;  1K05 A;  2OTK E;  1BSH A;  3HTK A;  3L71 D;  1RF1 B;  1FS0 E;  2WSE H;  1VQL P;  1YTZ T;  2CPB A;  1RE3 A;  3MGN A;  1CW5 A;  4ZKU A;  1KQF B;  5KLV K;  3CCS P;  4U3F G;  1FBM A;  1KN7 A;  1PFI A;  1U7M A;  1Q2N A;  5AVS B;  1JY3 N;  2IX7 C;  2WSE J;  3L70 D;  1GDT A;  1GL2 B;  4D6T D;  1KIL B;  1DH3 A;  2P1J A;  4ASV A;  1S2E A;  4WB4 A;  3H1I J;  3KXD A;  3LW5 H;  1OX3 A;  3G9R A;  3D6Y A;  1LTA C;  1KD1 Q;  2FFD A;  1GW3 A;  3O6Q A;  1MUU A;  3T97 B;  1FC2 C;  1AFO A;  2YO3 A;  1FDO A;  3AEF C;  1AVO A;  1LTJ A;  1PP9 G;  3LW5 J;  3TK1 A;  5KKZ C;  1EXJ A;  1RQU A;  4C7N B;  1Q90 D;  1JTH A;  1WMK A;  2J58 A;  4IFD K;  1OW8 A;  2PFX A;  2R32 A;  1K9M Q;  3HE5 A;  5AW9 B;  2KLU A;  2R3C A;  1KQG B;  2OGU A;  3AE9 C;  3BAT A;  3HE4 B;  3P8M C;  1RY3 A;  1RE3 C;  1RE4 A;  4ZKP A;  1FZC B;  2YKQ A;  2JJL A;  1ZRT E;  2KYV A;  4RJT A;  2E75 B;  3A7O A;  5B66 E;  2ZXE B;  5E79 E;  5AW5 B;  5DJU B;  4NPD A;  2KSJ A;  4U3F J;  1AJY A;  3CC7 P;  2POH A;  1YTZ I;  1IFN A;  1LT9 A;  1RHZ B;  4DJG A;  3E1I A;  1JB0 J;  2LXB A;  1FZC A;  2JP3 A;  2NPS A;  2WPV B;  1OZH A;  1L0N E;  3I55 P;  2M3E A;  4RO0 A;  3ABV C;  4GKG A;  1AQ5 A;  1HJ0 A;  1IFJ A;  2K88 A;  3KHU A;  1LTJ B;  2C0X A;  1ZRT D;  1X8Y A;  2Y9Z A;  5APW A;  1MFT A;  5KTB A;  3CCV P;  2IBZ I;  2UWJ E;  3L73 G;  2P7J A;  1R5L A;  4DCK A;  2RN0 A;  2C9N Y;  2WWW A;  3L74 E;  4U7J A;  1NVO A;  2FYN B;  1RE4 C;  2E74 C;  2O1J A;  4I7Z B;  1PGP A;  1LTT C;  2M5A A;  2MKV A;  3H1I D;  1N7L A;  1KIL C;  1PIX A;  3ITK A;  1EC5 A;  3NXS A;  1P84 D;  4WY4 A;  4EIJ A;  3Q5S A;  4MN4 C;  2YO2 A;  4U3F D;  3SWK A;  2CK3 H;  3WMM 0;  2BEZ F;  2JWA A;  1DEE G;  5EFW B;  3BCC D;  1OVU A;  5AW4 B;  3GG2 A;  1SQQ G;  4H0L B;  1FZC C;  1KIL D;  3EFG A;  4M3L A;  2E74 D;  2E75 C;  2FYU G;  2ZFC A;  3D6Z A;  3PRJ A;  1EZV D;  1LP1 A;  1S1C X;  1H88 A;  3PP5 A;  3B8E B;  3PTZ A;  5CCH C;  4OVN F;  5AVT B;  1AQT A;  2R44 A;  5KAF E;  2D2C C;  2GM4 A;  1RH5 B;  1ZR4 A;  2JEE A;  1LTB C;  1NHL A;  1PPJ D;  5APV A;  5APY A;  1MKM A;  4ZMD A;  1QL2 A;  2N1T A;  2FXO A;  1N7S A;  1KIL A;  1BGY D;  2HG5 D;  2Q3I A;  5AW8 B;  1QEX A;  2FXP A;  1KZU B;  2E76 C;  3CWB E;  2LXC B;  3L71 E;  1BCC D;  3V2Q A;  3L74 G;  5AW1 B;  3L75 D;  5AW0 B;  3W68 A;  3GW6 A;  1S4X A;  3B5N D;  2KB7 P;  1PPJ G;  3SWY A;  4D6T G;  1T2K C;  1RQV A;  1KYO E;  3L70 E;  1UII A;  1NTZ K;  1WRG A;  1RF0 A;  1URQ D;  3CX5 E;  2B89 A;  2K9J A;  1LTJ C;  2O1K A;  4KT0 J;  1N73 C;  2D2C B;  1JY2 O;  2ITA A;  1NTZ D;  2KS1 A;  2YKO A;  1MZ9 A;  1NTK K;  2YNY A;  4GOD A;  1NGM B;  5CCH A;  4WY4 D;  4L75 A;  1BDC A;  1NKN A;  4Y99 B;  4KJM A;  2M3B A;  3HUS C;  1NTK D;  2W6A A;  4YXD C;  2KS1 B;  1G1I A;  4C46 A;  1GK6 A;  1JNM A;  3L75 E;  3WUV A;  5BU5 A;  2HYN A;  1W2B O;  3R4Y A;  1SQX E;  3I5C A;  5M1B A;  1QVG O;  1LTI C;  1PGJ A;  1SQP J;  4PJ0 E;  1N7S C;  5AW3 B;  3K5B A;  5AW7 B;  2M8R A;  3CMA P;  3Q5R A;  4UB6 H;  5TIS H;  4O9B A;  4BRY A;  5KLV G;  3HTK B;  2JR8 A;  1L0L E;  1X22 A;  3L72 E;  3CC4 P;  3WUT A;  3MZW B;  2KOG A;  3M0D A;  3G71 P;  1NTK E;  3CD6 P;  3SFE C;  1DD3 A;  1NU1 K;  1SQV G;  5L8R J;  2WSF J;  1N2D C;  2XV5 A;  3A0H E;  4H13 B;  2B87 B;  1VDF A;  2WSS H;  5CCG C;  1LTS C;  3RK3 C;  3H1K D;  1K8A Q;  5KKZ B;  3USS A;  1EDK A;  3GLM A;  1CZQ A;  2W6J H;  4PD4 D;  1W2E A;  2VRS A;  2Z5I A;  5APX A;  1BGY J;  2XKM A;  3AEA C;  1BGY G;  2Y0C A;  2I1J A;  1SQP E;  3OJA B;  3TGU G;  1IK7 A;  1XTC C;  3CPW O;  2K1A A;  2QM8 A;  1PPJ E;  1OW7 A;  2NRG A;  2OYI A;  4I1L A;  3L75 G;  1Y47 A;  2QVA A;  2OYO A;  3RK2 D;  5BVZ A;  1JTH B;  3D71 A;  1A02 F;  3KZI E;  1HWT C;  1DIP A;  1EXI A;  5KLI C;  2QM7 A;  3CXH D;  2AEF A;  2IZ1 A;  2WPS A;  2V4H A;  2BEQ D;  1IC2 A;  1PL5 A;  4HH2 A;  1J1E B;  3TYY A;  1JY2 N;  2A06 D;  4UB8 H;  4PD4 E;  3H1L E;  1SVF A;  3MD0 A;  1IZN B;  3AE4 C;  2NZ2 A;  1YJ9 P;  1N73 B;  2BCC J;  1KB9 H;  1NTK J;  1SQQ D;  3CX5 D;  3QH9 A;  5CCG A;  1GZL A;  1VF5 C;  3AEE C;  3H1J D;  1L0L G;  3L72 G;  3BCC E;  2QJP C;  3MP7 B;  1PV3 A;  1R5S A;  2H89 C;  4A7P A;  3TGU D;  2W8Z A;  4EI2 A;  1ZW0 A;  1SQX K;  2V7Q H;  3HD7 D;  3IFM A;  1SQB G;  4XA4 A;  4XFJ A;  1S9K E;  2HOD A;  1CSB A;  1J2J B;  1G2C B;  1KB9 I;  1NU1 J;  3AEB C;  4GOF A;  4IFM A;  3RBX A;  3G3Z A;  4H44 B;  2KSE A;  1L2P A;  3MHV A;  4EYY Q;  1LWU B;  1HGZ A;  2JWD A;  5AVY B;  2OYI C;  1JY2 P;  3RK3 E;  5K5G B;  2OTJ P;  1EDL A;  1ZOY C;  3HRN A;  1LGH B;  1Y8A A;  3H1H G;  2K37 A;  1UIX A;  3L73 D;  2P10 A;  1KB9 E;  1OMI A;  3RL0 C;  3LID A;  4BXL A;  3B5N A;  1KTM A;  1S3J A;  3VMY A;  1JEK A;  2OYH B;  3O8Z A;  4C7R A;  1BCC G;  1M8O B;  2GUS A;  3H1K J;  2KIK A;  2M5A B;  2K3R A;  2O3J A;  4OH8 B;  5KLV D;  1KV4 A;  1OW6 A;  4H44 D;  3SWF A;  1N73 A;  3KDP B;  1HUC A;  1GU5 A;  3A0H H;  1QLE D;  2IPP A;  1NAF A;  2WSC H;  2PAJ A;  2KK7 A;  2QG4 A;  3BCC G;  3CX5 I;  3AE7 C;  1GMJ A;  4I6M C;  1SQV D;  3AE3 C;  2KUB A;  4JYB A;  1U7J A;  3PHL A;  2XDJ A;  4H0L D;  1HH0 A;  2AXT H;  3CWB J;  4H13 D;  5CJ0 A;  1FAV A;  2WSC J;  1GD2 E;  1S5L X;  1L0N G;  1MFZ A;  2PGD A;  3P8C D;  3V2P A;  4Z1M H;  5GTH E;  1JCC A;  2WT7 B;  1AV1 A;  2FBW C;  1HVV A;  1L4A D;  1MV8 A;  2H88 C;  2YIU C;  2ZT9 B;  2YMK A;  3M9Q A;  3H32 B;  1HJB A;  3L70 J;  2HPC B;  1KIL E;  4GDO A;  3GHG C;  4PV1 C;  4L76 A;  2M0B A;  2NPS C;  1KQS O;  3IR9 A;  1SQQ J;  4Y28 J;  1L0L J;  2QJK B;  1GL2 D;  3L72 J;  3M0D C;  1LWU C;  3M91 A;  3M9B A;  4N78 E;  2WTY A;  3U59 A;  5AW6 B;  1PZQ A;  3H1L D;  4AQR D;  3WU2 E;  1J1D C;  3TSI A;  1YIJ P;  3FX0 A;  3II6 A;  1HGV A;  1SQQ E;  1L4A B;  1M1J A;  1NTM E;  1NU1 D;  2ZT9 D;  1SQX J;  2L91 A;  4LC1 A;  3H6P A;  1M57 D;  1ZN5 A;  4OWF A;  2H7H A;  2XZR A;  3KPE A;  3Q1M A;  3EFF K;  1FZB A;  5CMZ A;  1FU1 A;  2E5T A;  2WQY C;  3Q2Y A;  3BRV B;  4AYC A;  5BU8 B;  5APU A;  2WMM A;  3L73 J;  1IFP A;  5AVU B;  1N86 A;  3L74 D;  2QJY B;  1FDI A;  1FZE A;  1GTW A;  2FYU E;  2FFD B;  2QRX A;  2G3A A;  3GF7 A;  4N6J A;  1PGO A;  3M9H A;  3MTU E;  1LJ2 A;  4JPZ B;  2RKL A;  2HPC A;  1P84 E;  1HF9 A;  1KQL A;  1VQM P;  1EZV G;  4JBZ A;  1PP9 D;  1E79 H;  2JO1 A;  5GTI E;  1VQO P;  2Z4E A;  1QX8 A;  1ZXG A;  3SSU A;  2ZVO B;  4N3Y B;  3VP9 A;  1JMM A;  2WZ7 A;  3OW2 O;  1HBW A;  4PV1 B;  1KOR A;  2IFN A;  4OGQ D;  3BRT B;  1LT1 A;  2A45 H;  1OVV A;  2WPR A;  4K35 A;  3RK3 B;  3S9O A;  3TDK A;  3OAK A;  3V6I A;  5DJT B;  5KJ7 C;  4GIF A;  4PJ0 H;  3CCU P;  1KFM A;  3L71 G;  1M7L A;  1JY3 O;  4WVZ A;  1SFC D;  2E74 B;  2AXT E;  3L70 G;  4D6T E;  4IL6 H;  2ZYA A;  1S72 P;  1P84 H;  2HOD B;  1SQP G;  4YPC A;  3IAO A;  2YXQ B;  4IOI H;  1E5W A;  3CXH I;  3CLQ A;  2MJZ A;  2HR3 A;  2R3S A;  2BAS A;  2YXR B;  3B5N B;  1T8Z A;  3VN0 A;  3G6E P;  3PJS K;  3NMD A;  2WIT A;  2JKV A;  2N1T D;  3N7N A;  3E7K A;  3V2R A;  5KLI B;  1RF0 C;  2H43 A;  3BCC J;  2IZ0 A;  2ZYD A;  4I7Z C;  1OWA A;  3NFQ A;  1NWQ A;  3TNU A;  1X9V A;  2IBZ G;  1KYO D;  2LR2 A;  4EDF A;  1IO4 A;  3BAS A;  3L35 A;  1IJD B;  4IL6 E;  1H8A A;  1BE3 E;  5AVX B;  5APT A;  4RKU J;  1FZG A;  2A45 G;  1YBK A;  2A06 G;  1G2C A;  5H2F H;  3L74 J;  1IK9 A;  5KLV E;  3A0B E;  1NJI Q;  1EDI A;  1P84 I;  1JCD A;  3KYQ A;  3CXH E;  1X0T A;  3FXE A;  1FOS F;  3CC2 P;  3GMA A;  3A2A A;  1VQ8 P;  2E76 B;  1GL2 A;  1Y9B A;  4DOJ A;  2OYH A;  4UB8 E;  2A45 I;  3A3Y B;  3F89 A;  3GHG A;  3OA7 A;  4L73 A;  1YJN P;  3FGA D;  1VQ7 P;  2W6B A;  2KXP B;  1OIP A;  1NO4 A;  2K9Y A;  1Q82 Q;  2QJP B;  2G8Y A;  1LWU A;  2KP8 A;  2W83 C;  3A0B H;  2FYU K;  2HFE D;  3R2P A;  5GTI H;  3TGU E;  1GW4 A;  2FYZ A;  5CJ4 A;  1VQ5 P;  1VQ9 P;  5AVZ B;  3HD7 A;  3PH0 A;  3HUS B;  3MIW A;  5AW2 B;  4WBA A;  5CBO A;  1H0T B;  2RMZ A;  3KQG A;  4JF7 A;  2KLV A;  2SPZ A;  1AA0 A;  4W80 A;  2C0W A;  1LNQ A;  2FY8 A;  2Q5U A;  4JYC A;  2C9L Y;  1H0T A;  3H1H D;  2OAR A;  1SLQ A;  2OYH C;  4Y99 C;  1YHQ P;  1LT9 C;  1URQ B;  3FWN A;  3L36 A;  2K9J B;  1SQB E;  4C7N A;  2ZVN B;  5B66 H;  1FE6 A;  2N9Y B;  2L5G B;  2NPS B;  2A06 E;  2O01 J;  1SS1 A;  3O6Q B;  1RF1 A;  3VTP C;  3GF3 A;  2QA4 P;  2DW3 A;  3Q3D A;  3CCR P;  3I56 P;  1M1J B;  3E1R A;  1IFI A;  3H1H E;  4LGD E;  2IBZ D;  2ZJS E;  2B87 A;  5KJ7 D;  1W5C E;  2AEM A;  2AXC A;  4L74 A;  2ZT9 C;  3QWO C;  1YIT P;  4OGQ C;  4B86 A;  1OVR A;  1LTG C;  2IYP A;  2YKP A;  2XND H;  3CXH H;  1VQN P;  3RL0 g;  2Y9Y A;  1WT6 A;  2R5B A;  2Z5H A;  3SFD C;  2ZAE B;  4R4L A;  3CCM P;  2NPS D;  3L4F A;  3C8V A;  2GUV A;  1VF5 D;  1M90 Q;  4HKZ H;  4DZO A;  1R8E A;  2FFD C;  1IFM A;  3H1I G;  3NTN A;  3VYI A;  4I2L C;  4NPF X;  3AE1 C;  3Q5P A;  1NU1 E;  1RF1 C;  1SFC B;  1DEB A;  2GA1 A;  3M0A A;  1NYH A;  1QGK B;  2W90 A;  1CI6 B;  3CWB G;  3H1K G;  3G4S P;  3JCU E;  4W7Y A;  1A02 J;  1L0N K;  4GOE A;  4WY4 B;  1FJP A;  5TJH A;  2QIW A;  3H1H J;  3VMX A;  5CBN A;  1FDM A;  4YTP C;  2XU6 A;  3TGU J;  1SQV E;  1VQK P;  2YMY A;  2N1T C;  2W27 A;  5APS A;  4H44 C; 
#chains in the Genus database with same CATH homology
 3MP7 B;  1RHZ B;  2YXR B;  1RH5 B;  3JC2 2;  2YXQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...