3P8MC

Human dynein light chain (dynll2) in complex with an in vitro evolved peptide dimerized by leucine zipper
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
42
structure length
42
Chain Sequence
SVSRGTQTEGGSGMKQLEDKVEELLSKNYHLENEVARLKKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Dynein light chain 2
publication title Directed evolution reveals the binding motif preference of the LC8/DYNLL hub protein and predicts large numbers of novel binders in the human proteome.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 42
sequence length 42
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3p8mC00
3LIEA 3P7KA 2WPSA 1G2CB 1DH3A 3M0AA 1NAFA 3P32A 3VMZA 3VN0A 5APUA 4B86A 4EOTA 2W27A 1GK6A 2WTYA 1GZLA 3L37A 1J2JB 4AUWA 4GT1A 2WT7B 4HYTB 4JYBA 4C7NA 4I6MC 2W6AA 1NWQA 3HE5A 4XE5B 1CZQA 5AVSB 3OAKA 3VMYA 3A7OA 1H89A 3M9HA 1MFZA 1A02J 3M06A 5AW0B 2R3CA 2XZRA 3L35A 3TNUA 2H7HA 2JJLA 5APSA 1OWAA 4JYCA 2QM8A 4AYCA 2P2UA 5AW3B 1FOSE 3MD0A 1KQLA 3MGNA 1HBWA 2VRSA 1SP4A 5AVUB 1GK4A 3V5BA 1IO4A 2WPRA 1CI6A 4GKGA 5APQA 3L36A 2N9BA 5AW9B 2YNYA 3VMXA 4LC1A 2ZFCA 3HE5B 1SLQA 5AVTB 1GU5A 5AW7B 3NFQA 1JNMA 1GD2E 2P67A 5AW2B 1GTWA 1HJBA 3VYIA 1H88A 2YO3A 2C9NY 1T2KC 2WWWA 3V4QA 3M9BA 3TK1A 1YYCA 2IPPA 1JUNA 2C9LY 5AW8B 4I2LC 4KHXA 3A5TA 3IR9A 2Q3IA 3B8EB 1MUUA 2BASA 1CI6B 1MV8A 3NXSA 5AW6B 3VTPC 4C46A 2KP8A 4AQRD 5AVWB 4RESB 4C7NB 2Q7CA 1FOSF 2XV5A 2ZXEB 5APVA 1A02F 2R5DA 3TYYA 5AVQB 3O8ZA 5AVVB 5AW4B 3HE4A 3NMDA 2R5BA 3T97A 1FAVA 3V4WA 3M91A 2P7JA 5APYA 3KQGA 3TNUB 3I5CA 3SWFA 1OXZA 3NTNA 1S9KE 5AVYB 2E43A 5CMZA 4M3LA 1HWTC 2E42A 5AW5B 2YO2A 5APTA 1X8YA 1CSBA 1HUCA 2WPQA 2Z5IA 4DZOA 2XU6A 5AVXB 2WT7A 1S9KD 3A3YB 3A2AA 5APXA 3UIAA 1H8AA 3M0DA 2Q5UA 3HE4B 5AVZB 1T2KD 3HTKA 5AW1B 2R32A 2Z5HA 3LIDA 3KDPB 5APWA 5AVRB 3P8MC 1GU4A 2QM7A
chains in the Genus database with same CATH superfamily
1LTIC 1BE3D 1DH3A 4EOTA 2HPCA 4OH8B 2N1TC 1NWQA 3HE5A 2E5TA 1RQVA 3MHVA 2WSFJ 1BE3E 3OAKA 1NTKJ 3CWBJ 1SS1A 3O6QA 2XZRA 2E76B 2H7HA 4OGQC 1FU1A 4PJ0E 2HFED 2WITA 3EWKA 4U3FG 1S2EA 1N73B 1W2EA 3CC4P 2YNYA 2E5YA 5K5GB 3RL0g 3BVHA 3V2QA 2KS1A 2P58A 3M9BA 1Q7YQ 2J58A 3U1CA 3M0DC 1MUUA 1QGKB 3TGUJ 4WY4B 1PZQA 3V6IA 3N7NA 2JR8A 3AEGC 2CK3H 1BGYE 1NU1G 1YTZI 4TT3H 3L74D 5TISH 1VQLP 1N7SA 1VQMP 2YMYA 5GTIH 3Q1MA 1BCCJ 4HJGH 4BRYA 3HTKA 1HTLC 2R32A 4QMAA 3LIDA 2ZT9D 4GODA 1GU4A 3H1KJ 1RE3C 3FWLA 3PH0A 3B5NC 2OYIC 2LXCB 1RY3A 4GT1A 2QJKB 5APSA 3CD6P 3V2NA 5AVUB 3IN6A 2J59M 1IO4A 3Q5PA 1HGZA 2YKOA 1SLQA 4UB8E 1GL2C 1SFCD 1SQVJ 2FYUJ 1W2BO 5KAFH 1FZCC 3H1HG 4HB1A 1N2DC 2OYHC 3AEFC 3H1LE 4R4LA 3CXHD 3CCRP 1JEKA 2AEFA 4Y28J 3HRNA 1JTHA 2G8YA 5AVWB 3M9QA 3TYYA 1RH5B 1DEBA 5AVVB 2IZ1A 1OVUA 2P7JA 2KB7P 1NH4A 3K5BA 1LWUB 1NTZJ 1BE3J 1SQXG 1EZVG 3UIAA 3M0DA 2D2CD 1T2KD 2GUSA 4GOEA 5AVRB 2QJYC 1PV3A 5KLIB 2QSIA 2IFMA 2OQQA 4I6MC 1ZR4A 4XE5B 5H2FH 2AEMA 3KZIE 1U57A 4YTPC 1IJDB 4JYCA 2NPSC 1JMMA 1T3UA 2QG4A 5L8RJ 1RE3A 1PPJG 1KORA 4PV1D 3B5NA 2OYIA 2WSEH 3FX0A 2ITAA 4HH2A 2AEJA 1YYCA 1L0NK 1USDA 4GOFA 2E75D 2K9YA 4D6TD 2ZXXA 4EI2A 1L0ND 3L74J 4D6TE 4K3AA 1ZRTE 2W6BA 4OWFA 1AFOA 1VL2A 1GL2A 3BRVB 3I5CA 1L0NE 1M57D 1FZCA 2E43A 3N4XA 1KB9D 3BCCD 2KLVA 2POHA 1S9KD 3G3ZA 3H6PA 3L70G 2IFNA 4L76A 5AVZB 2KUBA 3RK3B 3AEAC 1DX7A 5APWA 4N78E 1IFNA 3BCCE 2JWAA 1PP9D 2RMZA 1SQQD 2BCCG 3L75G 3CCJP 1CZQA 3H1IE 1FBMA 1PP9E 3AE4C 4H13D 4PV1B 1L0LK 4H0LD 3LW5H 3OJAB 3HUSB 2O1KA 3R2PA 2HR3A 4IFDK 1JY3P 2Y0DA 2Z4EA 3BRTB 3TSIA 1DD3A 1H88A 1KILC 2C9NY 3MUDC 3L72D 1QVFO 4TLFA 2WSCJ 3P8CD 1L0LE 2FXOA 1QX8A 5AW8B 3IR9A 1SQPG 2B9BA 3S4RA 2N1TD 2NPSA 1DIPA 1URQB 2XV5A 3P8CE 1VF5C 1Y9BA 1U7JA 4DOJA 1EQ7A 1ZR2A 3D71A 4WWIA 1RF1B 2QRXA 2M3EA 4OGQD 2B87A 4ASVA 4C7RA 3E7KA 1KTMA 4M3LA 3RL0B 1M1JB 2E42A 1KYOH 3PLNA 2YXQB 2YKPA 1T8ZA 2K9JA 2J5UA 3D6YA 1LT9C 3SWKA 2YMKA 3HD7B 4ZMDA 1SQBG 1N8RQ 1NTMG 3ABVC 3P8MC 2O01H 2WPSA 1YITP 2KXPB 1RHZB 5TISE 2WT7B 1GDTA 1FE6A 2A45G 1ZOYC 5KJ7C 1MFZA 2K88A 1FZGA 1AQ5A 1FS0E 1NTKG 3CWBG 4D6TJ 1LNQA 3PHLA 4UB6E 3H1JD 1KZUB 5DJUB 2JWDA 1JY2P 2QE7H 1L0NJ 2H8PD 1AVYA 2RN0A 3L73E 1K8AQ 3GW6A 4JPZB 2E74C 4JQ0D 5TJHA 1CI6B 1FOSF 1JO5A 3BCCJ 3HE4A 3NMDA 1FAVA 1N7SC 2W83C 3OW2O 3H32A 1OZHA 3NTNA 3MUDA 3TGUG 1PP9J 2WQYC 1YJWP 3PTZA 4ZKPA 2WSSH 2IZ0A 1JM0A 1SQQJ 2LR2A 3L71D 5C39A 4YPCA 1KQSO 1RF0C 3T97B 1K9MQ 2KNCA 5AW1B 2Z5HA 5KTBA 1JB0J 1OW6A 1BCCG 3VMZA 1LTSC 3TF5A 2IBZG 2KI7B 3AE7C 4N6JA 1FDIA 3H1KG 4JYBA 2RH0A 1IK7A 2FYNC 1KQFB 2A06G 2MJZA 3EQ2A 4CPGA 2PAJA 2JJLA 3L72J 1G1IA 3GHGB 4L75A 1LT9A 1S5LH 4U3FE 3PRJA 2KLUA 5AW9B 1YIJP 3VP8A 5H2FE 1NU1K 1OW7A 1OVVA 1L4AB 5KJ7A 3CI9A 1SQVG 2FYUG 1EXJA 2YIUC 2K1AA 4EYYQ 2BEZF 2Q7CA 3AE2C 4L73A 5GTHH 5APVA 3G4SP 1A02F 1VPCA 2G3AA 5KKZC 1NU1E 3TNUB 2R44A 3CCUP 2NPSD 3CCMP 1HWTC 3SWYA 2JO1A 2A45H 5BU8B 1BGYD 5APXA 2ZVNB 2OTJP 1NTZG 1KC8Q 1FDOA 3A0BH 1BE3G 5E79H 3IF4A 3KXDA 2QM7A 1Q2NA 4LGDE 1OX3A 2IX7C 2W8ZA 1K05A 1URQA 4H44D 1KFNA 3H1JJ 4W7ZA 2Y0CA 3M9HA 3M06A 1RF1A 3WMM0 3IFMA 3WUVA 3KYQA 1JY2N 3E1IA 1RF0A 2M5AB 3AE6C 1NGMB 3R4YA 2V4HA 3ITKA 3V5BA 4UB6H 1R5SA 3CC7P 3Q5RA 1LP1A 3H1HE 1OMIA 3V4QA 2WPVB 4GDOA 2L91A 1JUNA 2IDBA 2Y9ZA 1QL1A 1RQUA 3A5TA 2QJPB 1EZVI 5AW6B 3H1LD 2KP8A 5BVZA 2E76C 3C8VA 3O8ZA 1J1DB 3L71J 3OA7A 3L74G 2N9YB 1N73C 4A7PA 2C0XA 4DJGA 1KYOI 1EZVE 1X22A 1CSBA 2XU6A 2FBWC 1KILD 3RK2D 3JC22 3CPWO 3GF3A 1KYOD 4H44B 1DEEG 2GA1A 2LKMA 3P7KA 3C9IA 1NVOA 1L2PA 2FKWB 2ZT9B 1KILE 1GK6A 4WY4C 3A0HH 1KYOE 4HYTB 3CCSP 2KZJA 2V7QJ 1T3JA 1VF5D 1MKMA 3VMYA 5CCGD 3I55P 1JCDA 3L35A 2JEEA 1M7LA 2P2UA 1FOSE 1K73Q 1SP4A 2WSEJ 2N9BA 4LC1A 1GU5A 2H43A 3U1AA 1GD2E 2IYOA 1LTGC 1OW8A 3CL3D 1WMKA 1SFCB 1PGPA 2KOGA 4OVNF 3FXDA 2QJKC 1YQ3C 4YXDC 1EXIA 4R4MA 1BGYJ 2KSJA 4NPEA 5B5EH 2AXCA 3RK2B 3RK3E 1ZRTD 3ZDMA 3II6A 4RKUJ 1S5LX 1KFMA 2WPQA 3L70E 3AEEC 1ZXGA 3USSA 3CLQA 4BXLA 3G9RA 3AE8C 1L4AA 3G6EP 2AXTH 2D2CB 4O9BA 2CPBA 5APUA 3L75E 2FFDB 4N78D 1NKZB 1N73A 3LW5J 1HGVA 1LWUC 1YQ4C 3TNUA 1N7SD 1SQPK 3H1ID 1LJ2A 3GMAA 5M1BA 2Y9YA 1GK4A 3EFGA 5EFWB 2LXBA 1VQ9P 3HE5B 1GMJA 2P67A 5AW2B 3H1LJ 1HJBA 2XKMA 1OIPA 2KYVA 4D6TG 1AVOA 4WY4A 3O6QB 5KLIC 2IPPA 3RBZA 1X9VA 1RE4A 1SQPE 1L0NG 2HLOA 1ZP0C 1S5LE 4HKZH 2E75B 1MV8A 1IFIA 2JP3A 4C46A 3FXEA 4AQRD 4C7NB 1L0LD 4I7ZB 1SQBK 3AE5C 1NTMK 2KS1B 1LTJB 3V4WA 3SWFA 3BCCG 4Y99B 1FZEA 2W6JH 4W7YA 3C1LA 2JDIH 5APTA 3SFDC 1Y47A 3W67A 2A45I 1AA0A 1KN7A 5GTHE 3JCUH 1PP9G 1NTME 1P84H 1NTKK 1SQQG 2O01N 1J1EB 1LGHB 1VQOP 1H0TB 1NAFA 2Q3EA 3VN0A 1IFJA 2XNDH 2W27A 1IFDA 3CCVP 1FJPA 1S4XA 4ZNCA 3CXHH 1T6AA 1S72P 1KV4A 1E5WA 4BRYB 4PD4I 2DW3A 3A0BE 1HVVA 5E79E 3AEDC 3V2RA 1VQ5P 1NTKE 3CWBE 4H13B 1VDFA 4WB4A 2VRSA 4H0LB 3AE3C 1Q86Q 2C0WA 3L72G 3RK3C 3NFQA 1LTAC 2WMMA 4PD4E 4LLHA 4DCKA 3L4FA 3TK1A 1ZN5A 4I2LC 1ZV8A 2FY8A 1LWUA 3L73D 3JSVC 4RESB 4PV1C 2YXRB 2H89C 2R5DA 2N1TB 2M3BA 3S1KA 3HUSC 4EIJA 3M91A 5KLVK 1M90Q 3TGUE 1QEXA 3B5ND 1XTCC 4OGQB 4ZKUA 1EC5A 1PGJA 5KLVD 1H8AA 2QEXP 1TU3F 3S9OA 4XA4A 1PL5A 1R5LA 5KAIH 1IZNB 1EDJA 1IFMA 2FXPA 5KLVE 1AV1A 1EDIA 1G2CB 1N86A 3E1RA 3M0AA 4B86A 1URQC 3H1IJ 1VQ7P 4AUWA 5CJ4A 3SFEC 1RF1C 2E76D 1GL2D 1KMIZ 5CJ0A 1SQVK 3AEBC 3RL0C 2ZVOB 1M1JC 5AW3B 3H1JG 1M56D 3L36A 2GM4A 3VMXA 3HD7C 3KHUA 3A0HE 4BWNA 4U3FD 2B89A 1KB9H 1BSHA 1L0LJ 5CBOA 1SQVE 2KSEA 3F5HA 2C9LY 3FGAD 3CCLP 2KZIA 2MKVA 2Q3IA 1KQGB 4WY4D 2FFDA 3NXSA 4GIFA 1NTZK 1NAYA 3B5NB 2OYIB 2ZXEB 2ZYDA 3B71A 3I56P 1PFIA 5AW4B 1QL2A 3TDKA 1XTGB 1NKNA 5CMZA 2OARA 3L71G 3W68A 1NU1D 1BSNA 1PGOA 1BDDA 3A2AA 1NTZE 3D6ZA 2PP6A 5CHXA 4I1LA 2HODB 3Q2YA 3MTUE 1GL2B 4ASWA 4IOIH 2WZ7A 5B5EE 1FZCB 3HUSA 2OYHB 3PJSK 1WT6A 4IFMA 4C7NA 4U7JA 3MZWB 1LTJA 2W90A 1H89A 5AW0B 3MIWA 4IL6H 2WSFH 2QA4P 1KQLA 2AXTE 3AE9C 3L73J 1K04A 1JNMA 4PD4H 3CX5H 1HH0A 3CMEP 2BEQD 2QVAA 3AE1C 1LTBC 1H0TA 3H1HD 3QH9A 1M1JA 2Q1KA 2KK7A 2Q6QA 2QJYB 1FC2C 3VTPC 1KD1Q 3GHGC 5KLVJ 5B66H 3L74E 3HD7A 5APYA 1FJKA 1JCCA 1BGYG 1SQXK 2NPSB 1HUCA 1JY3O 2WT7A 2Q5UA 1L4AC 4YXWH 2XDJA 1SQXD 3WU2H 1EZVD 2B87B 2P10A 1P84I 1HJ0A 5CBNA 2ZYAA 1JOCA 3H25A 1WRGA 3PP5A 1P84D 5CCHC 4K35A 1SQXE 2K9JB 2W6AA 5AVSB 3CXHI 2N1TA 2O3JA 3A7OA 1FZAA 4U3FJ 1NO4A 3JCUE 1P84E 2O1JA 1YJNP 1DD4A 3MD0A 4Z1MH 4JBZA 2OTKE 1HBWA 1IFPA 1AQTA 2WPRA 1CI6A 2ZFCA 5AW7B 3CXHE 1RE4C 1PPJD 3F89A 1Z56A 3AECC 2Y0EA 1OFCX 3EFFK 3H1LG 1G2CA 1OVRA 1LT1A 1PPJE 1NU1J 4L74A 3KPEA 1UIXA 1UIIA 1FDMA 3T97A 2FYZA 4N3YB 4EDFA 3G71P 4W80A 2YO2A 2NZ2A 2Z5IA 4DZOA 3RK3D 3A3YB 1Q81Q 5KJ7D 3HE4B 1JY2O 2L5GB 2V7QH 2WVRA 2QJPC 4PJ0H 3L70D 1KILB 1X0TA 3H32B 3GHGA 4WVZA 1GZLA 3WUUA 4JF7A 1J1DC 4KJMA 2NRGA 2BCCD 3QWOC 3L75D 3Q3DA 2KNCB 3SSUA 1OWAA 2E74D 1VF5B 2QM8A 2I8DA 5KAIE 1S1CX 3GG2A 3VOPA 1VQKP 1GW4A 1QVGO 2BCCE 1PGQA 3H1HJ 5APQA 3CCQP 1GW3A 2GUVA 5AVTB 1YHQP 4H44C 2OYOA 3VYIA 2HODA 1KB9I 2I1JA 3V2PA 5CCHA 1CW5A 1YTZT 2ZT9C 1G1JA 1LT9B 3D70A 2HYNA 4KHXA 2OYHA 1URQD 1AJYA 2OGUA 2HPCB 4NPFX 1SQPD 1SQQK 1VQ8P 1KB9E 1YBKA 2R5BA 2PRRA 3RL0D 2FXMA 3KQGA 5BU5A 1SQXJ 1S9KE 4WBAA 2PFXA 5AVYB 3FWNA 4IL6X 1NJIQ 1Q82Q 1IK9A 3CC2P 3HD7D 1SFCC 2B88A 1SQQE 2CPSA 4IFFA 2QIWA 2M5AA 3Q5SA 1SQBD 1ZMEC 1NTMD 2E74B 2WTYA 1NOHA 1Y8AA 4UB8H 1YI2P 2I1KA 3RK2C 3H1IG 2O01J 1SQBE 2R3CA 3GF7A 3VP9A 4AYCA 3MGNA 1VQ6P 2PGDA 1PIXA 1IC2A 1N7SB 3L72E 1NTKD 3CWBD 1GTWA 2YO3A 2D2CC 3CX5I 3HTKB 1T2KC 2WWWA 5CCGC 3WUTA 4RJTA 4IL6E 1YJ9P 2FFDC 4RO0A 1L0LG 4PD4D 2K37A 3CX5D 2M8RA 2WSCH 1R8EA 1LP1B 3MP7B 2ZJSE 2YKQA 3CX5E 2FYNB 2R3SA 3B4SA 1OXZA 3CCEP 2HG5D 3L70J 1USEA 2K3RA 1X8YA 1ZW0A 1MFTA 3TGUD 5GTIE 1U7MA 5AVXB 1SVFA 1ZLLA 1MZ9A 3KZIH 1BDCA 2BCCJ 2OTLP 5B66E 3KDPB 3GLMA 3L75J 1VQ4P 2E75C 2UWJE 3LIEA 2ZAEB 3P32A 2IBZI 4I7ZC 3IAOA 1J2JB 3L37A 1LTJC 1LTTC 1BCCD 1JTHB 3RBXA 2RKLA 2YIUB 1FZBA 2IBZD 2Q9IA 1M8OB 3H1KD 4Y99C 4KT0J 1A02J 1NYHA 2A06D 1SFCA 1D7MA 3WU2E 1HF9A 1BCCE 3H1JE 5KKZB 2IBZE 3U59A 1VQPP 4XFJA 2M0BA 3H1KE 4DT0A 4GKGA 3BATA 2A06E 1X79B 1L4AD 1S3JA 1SQPJ 1J1EC 5KAFE 1QLED 3L73G 2FYUK 1KILA 2P1JA 3CMAP 3VMAA 2ZYGA 3B8EB 4MN4C 2BASA 5CCHD 1SQVD 2FYUD 1VQNP 1JMBA 2IYPA 5AVQB 1N7LA 1EDLA 4H13C 2JKVA 1EDKA 1NHLA 4H0LC 2SPZA 3BASA 2FYUE 2H88C 3L71E 4NPDA 5KLVG 5CCGA 5AW5B 1M1KQ 1SQBJ 1W5CE 1NTMJ 3RGUA 1JY3N 2XNXA 1FZFA 5DJTB 1Q90D 2KIKA 1NTZD 1E79H
chains in the Genus database with same CATH topology
1LTIC 4O9BA 2WPSA 1DH3A 2CPBA 1JOCA 4EOTA 2HPCA 5APUA 4OH8B 1WRGA 2N1TC 3PP5A 2FFDB 4N78D 1NKZB 5CCHC 1N73A 2WT7B 1GDTA 2W6AA 1NWQA 3HE5A 5AVSB 2A45G 2N1TA 3OAKA 5KJ7C 3A7OA 1FZAA 1NO4A 1MFZA 1HGVA 1LWUC 2XZRA 1FZGA 3TNUA 2H7HA 1FU1A 1N7SD 1SQPK 2O1JA 1AQ5A 2HFED 2WITA 3MD0A 1HBWA 1GK4A 1N73B 1W2EA 2WPRA 1CI6A 3EFGA 2YNYA 1KZUB 2ZFCA 3HE5B 5AW7B 3BVHA 1JY2P 2P67A 5AW2B 3V2QA 1HJBA 2XKMA 2KYVA 1RE4C 4WY4A 2H8PD 1Z56A 3M9BA 2IPPA 1X9VA 1RE4A 2J58A 3U1CA 1G2CA 2HLOA 3M0DC 1MUUA 1CI6B 1IFIA 1MV8A 4C46A 4AQRD 4C7NB 1FOSF 1JO5A 1SQBK 3KPEA 1FDMA 1NTMK 4WY4B 1LTJB 3N7NA 3HE4A 3NMDA 3T97A 3V4WA 1FAVA 2FYZA 4N3YB 1N7SC 3SWFA 3H32A 3NTNA 3MUDA 1YTZI 4Y99B 1FZEA 4W7YA 4W80A 2YO2A 1N7SA 5APTA 2YMYA 4ZKPA 2A45I 2Z5IA 4DZOA 3RK3D 3A3YB 1RF0C 5KJ7D 3HE4B 1JY2O 2L5GB 3HTKA 5AW1B 1HTLC 2R32A 2Z5HA 3LIDA 1NTKK 1GU4A 3H32B 1KILB 5KTBA 3GHGA 1J1EB 1LGHB 1RE3C 3B5NC 1NAFA 3VN0A 3VMZA 1IFJA 2OYIC 1LTSC 2W27A 1IFDA 1GZLA 1RY3A 4JF7A 4GT1A 4N6JA 1FJPA 1J1DC 4JYBA 1E5WA 2MJZA 3EQ2A 1HVVA 2PAJA 2JJLA 3V2RA 5APSA 1OWAA 1G1IA 3GHGB 2QM8A 1LT9A 3VOPA 1VDFA 1GW4A 4WB4A 3V2NA 2VRSA 5AVUB 2J59M 1IO4A 5APQA 1HGZA 2C0WA 2YKOA 1GW3A 5AW9B 2GUVA 1SLQA 5AVTB 3RK3C 3NFQA 1GL2C 1SFCD 3VP8A 1LTAC 3VYIA 2HODA 2I1JA 4LLHA 3V2PA 5CCHA 1NU1K 1FZCC 1CW5A 3L4FA 1YTZT 1N2DC 3TK1A 2OYHC 1L4AB 1G1JA 1LT9B 1ZN5A 5KJ7A 3CI9A 4I2LC 2HYNA 1ZV8A 4KHXA 2OYHA 1URQD 1LWUA 2HPCB 3HRNA 1JTHA 5AVWB 4RESB 2Q7CA 5APVA 1A02F 2R5DA 3M9QA 3TYYA 1VPCA 2N1TB 1SQQK 2M3BA 1DEBA 5AVVB 3HUSC 2R5BA 4EIJA 3M91A 3RL0D 2FXMA 2P7JA 3KQGA 3TNUB 5KLVK 2KB7P 2NPSD 5BU5A 1S9KE 1NH4A 4WBAA 5AVYB 1LWUB 3B5ND 3SWYA 1HWTC 1XTCC 1IK9A 4ZKUA 2A45H 5BU8B 3HD7D 5APXA 3UIAA 1SFCC 1H8AA 3M0DA 4XA4A 1T2KD 2GUSA 5AVRB 1IFMA 2QM7A 2CPSA 4IFFA 4LGDE 1G2CB 1N86A 3M0AA 2IX7C 4B86A 1URQC 2IFMA 2WTYA 1NOHA 4AUWA 5CJ4A 4I6MC 1ZR4A 1URQA 1RF1C 4XE5B 1GL2D 2I1KA 1KFNA 3RK2C 4W7ZA 3M9HA 5CJ0A 1SQVK 3M06A 1RF1A 2R3CA 3RL0C 3IFMA 3WMM0 3KYQA 1IJDB 1M1JC 1JY2N 4JYCA 3VP9A 2NPSC 1JMMA 4AYCA 3E1IA 1RF0A 5AW3B 3MGNA 1T3UA 1IC2A 1N7SB 3V5BA 3L36A 1RE3A 2GM4A 3VMXA 3HD7C 3B5NA 2OYIA 2WSEH 1GTWA 4HH2A 2YO3A 3HTKB 1T2KC 2WWWA 5CCGC 3V4QA 1YYCA 1L0NK 1JUNA 2C9LY 2FFDC 1QL1A 3A5TA 2M8RA 2WSCH 2Q3IA 4WY4D 2FFDA 3NXSA 4GIFA 5AW6B 1NTZK 2KP8A 3B5NB 5BVZA 2OYIB 2ZXEB 3O8ZA 1PFIA 1J1DB 2YKQA 5AW4B 2W6BA 3OA7A 1QL2A 1AFOA 1GL2A 1XTGB 3BRVB 3I5CA 1OXZA 1NKNA 1N73C 2C0XA 2E43A 1FZCA 2HG5D 5CMZA 3N4XA 2OARA 1X8YA 1CSBA 2XU6A 2KLVA 5AVXB 2POHA 1S9KD 1SVFA 1ZLLA 3A2AA 3G3ZA 3H6PA 2PP6A 1MZ9A 5CHXA 1KILD 4I1LA 3RK2D 2HODB 2IFNA 5AVZB 3MTUE 3RK3B 1DX7A 1GL2B 3KDPB 5APWA 4N78E 1IFNA 2LKMA 2WZ7A 3LIEA 3P7KA 3C9IA 1FZCB 2FKWB 3HUSA 3P32A 2OYHB 1WT6A 1GK6A 4IFMA 3L37A 1J2JB 4WY4C 1LTJC 1LTTC 1JTHB 4HYTB 4C7NA 1CZQA 1FZBA 1T3JA 1FBMA 2Q9IA 1LTJA 3VMYA 1H89A 4Y99C 1A02J 5AW0B 5CCGD 3MIWA 1JCDA 3L35A 1L0LK 2WSFH 2JEEA 1M7LA 1SFCA 3LW5H 3OJAB 2P2UA 3HUSB 1FOSE 1KQLA 2O1KA 3R2PA 4IFDK 3U59A 1SP4A 1JY3P 4GKGA 3BATA 2Z4EA 2N9BA 4LC1A 3BRTB 1GU5A 3TSIA 2H43A 1JNMA 1X79B 3U1AA 1GD2E 1L4AD 1H88A 1LTGC 1KILC 2C9NY 1HH0A 1J1EC 3CL3D 1SFCB 2FYUK 2KOGA 1KILA 2P1JA 3P8CD 1LTBC 5AW8B 3IR9A 1M1JA 3B8EB 2N1TD 2BASA 2NPSA 5CCHD 3VTPC 1URQB 2XV5A 3P8CE 5AVQB 1N7LA 3GHGC 4DOJA 1EQ7A 1ZR2A 3HD7A 1RF1B 2KSJA 5APYA 1NHLA 3RK2B 3BASA 4C7RA 1FJKA 1JCCA 4M3LA 5CCGA 3RL0B 1M1JB 2E42A 5AW5B 3II6A 1SQXK 2NPSB 1KFMA 2YKPA 1T8ZA 1HUCA 1JY3O 2WPQA 2WT7A 1JY3N 2XNXA 2Q5UA 1FZFA 1L4AC 1LT9C 2XDJA 3CLQA 3HD7B 3P8MC 1L4AA 2O01H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIE A;  3P7K A;  2WPS A;  1G2C B;  1DH3 A;  3M0A A;  1NAF A;  3P32 A;  3VMZ A;  3VN0 A;  5APU A;  4B86 A;  4EOT A;  2W27 A;  1GK6 A;  2WTY A;  1GZL A;  3L37 A;  1J2J B;  4AUW A;  4GT1 A;  2WT7 B;  4HYT B;  4JYB A;  4C7N A;  4I6M C;  2W6A A;  1NWQ A;  3HE5 A;  4XE5 B;  1CZQ A;  5AVS B;  3OAK A;  3VMY A;  3A7O A;  1H89 A;  3M9H A;  1MFZ A;  1A02 J;  3M06 A;  5AW0 B;  2R3C A;  2XZR A;  3L35 A;  3TNU A;  2H7H A;  2JJL A;  5APS A;  1OWA A;  4JYC A;  2QM8 A;  4AYC A;  2P2U A;  5AW3 B;  1FOS E;  3MD0 A;  1KQL A;  3MGN A;  1HBW A;  2VRS A;  1SP4 A;  5AVU B;  1GK4 A;  3V5B A;  1IO4 A;  2WPR A;  1CI6 A;  4GKG A;  5APQ A;  3L36 A;  2N9B A;  5AW9 B;  2YNY A;  3VMX A;  4LC1 A;  2ZFC A;  3HE5 B;  1SLQ A;  5AVT B;  1GU5 A;  5AW7 B;  3NFQ A;  1JNM A;  1GD2 E;  2P67 A;  5AW2 B;  1GTW A;  1HJB A;  3VYI A;  1H88 A;  2YO3 A;  2C9N Y;  1T2K C;  2WWW A;  3V4Q A;  3M9B A;  3TK1 A;  1YYC A;  2IPP A;  1JUN A;  2C9L Y;  5AW8 B;  4I2L C;  4KHX A;  3A5T A;  3IR9 A;  2Q3I A;  3B8E B;  1MUU A;  2BAS A;  1CI6 B;  1MV8 A;  3NXS A;  5AW6 B;  3VTP C;  4C46 A;  2KP8 A;  4AQR D;  5AVW B;  4RES B;  4C7N B;  2Q7C A;  1FOS F;  2XV5 A;  2ZXE B;  5APV A;  1A02 F;  2R5D A;  3TYY A;  5AVQ B;  3O8Z A;  5AVV B;  5AW4 B;  3HE4 A;  3NMD A;  2R5B A;  3T97 A;  1FAV A;  3V4W A;  3M91 A;  2P7J A;  5APY A;  3KQG A;  3TNU B;  3I5C A;  3SWF A;  1OXZ A;  3NTN A;  1S9K E;  5AVY B;  2E43 A;  5CMZ A;  4M3L A;  1HWT C;  2E42 A;  5AW5 B;  2YO2 A;  5APT A;  1X8Y A;  1CSB A;  1HUC A;  2WPQ A;  2Z5I A;  4DZO A;  2XU6 A;  5AVX B;  2WT7 A;  1S9K D;  3A3Y B;  3A2A A;  5APX A;  3UIA A;  1H8A A;  3M0D A;  2Q5U A;  3HE4 B;  5AVZ B;  1T2K D;  3HTK A;  5AW1 B;  2R32 A;  2Z5H A;  3LID A;  3KDP B;  5APW A;  5AVR B;  3P8M C;  1GU4 A;  2QM7 A; 
#chains in the Genus database with same CATH topology
 1LTI C;  1BE3 D;  1DH3 A;  4EOT A;  2HPC A;  4OH8 B;  2N1T C;  1NWQ A;  3HE5 A;  2E5T A;  1RQV A;  3MHV A;  2WSF J;  1BE3 E;  3OAK A;  1NTK J;  3CWB J;  1SS1 A;  3O6Q A;  2XZR A;  2E76 B;  2H7H A;  4OGQ C;  1FU1 A;  4PJ0 E;  2HFE D;  2WIT A;  3EWK A;  4U3F G;  1S2E A;  1N73 B;  1W2E A;  3CC4 P;  2YNY A;  2E5Y A;  5K5G B;  3RL0 g;  3BVH A;  3V2Q A;  2KS1 A;  2P58 A;  3M9B A;  1Q7Y Q;  2J58 A;  3U1C A;  3M0D C;  1MUU A;  1QGK B;  3TGU J;  4WY4 B;  1PZQ A;  3V6I A;  3N7N A;  2JR8 A;  3AEG C;  2CK3 H;  1BGY E;  1NU1 G;  1YTZ I;  4TT3 H;  3L74 D;  5TIS H;  1VQL P;  1N7S A;  1VQM P;  2YMY A;  5GTI H;  3Q1M A;  1BCC J;  4HJG H;  4BRY A;  3HTK A;  1HTL C;  2R32 A;  4QMA A;  3LID A;  2ZT9 D;  4GOD A;  1GU4 A;  3H1K J;  1RE3 C;  3FWL A;  3PH0 A;  3B5N C;  2OYI C;  2LXC B;  1RY3 A;  4GT1 A;  2QJK B;  5APS A;  3CD6 P;  3V2N A;  5AVU B;  3IN6 A;  2J59 M;  1IO4 A;  3Q5P A;  1HGZ A;  2YKO A;  1SLQ A;  4UB8 E;  1GL2 C;  1SFC D;  1SQV J;  2FYU J;  1W2B O;  5KAF H;  1FZC C;  3H1H G;  4HB1 A;  1N2D C;  2OYH C;  3AEF C;  3H1L E;  4R4L A;  3CXH D;  3CCR P;  1JEK A;  2AEF A;  4Y28 J;  3HRN A;  1JTH A;  2G8Y A;  5AVW B;  3M9Q A;  3TYY A;  1RH5 B;  1DEB A;  5AVV B;  2IZ1 A;  1OVU A;  2P7J A;  2KB7 P;  1NH4 A;  3K5B A;  1LWU B;  1NTZ J;  1BE3 J;  1SQX G;  1EZV G;  3UIA A;  3M0D A;  2D2C D;  1T2K D;  2GUS A;  4GOE A;  5AVR B;  2QJY C;  1PV3 A;  5KLI B;  2QSI A;  2IFM A;  2OQQ A;  4I6M C;  1ZR4 A;  4XE5 B;  5H2F H;  2AEM A;  3KZI E;  1U57 A;  4YTP C;  1IJD B;  4JYC A;  2NPS C;  1JMM A;  1T3U A;  2QG4 A;  5L8R J;  1RE3 A;  1PPJ G;  1KOR A;  4PV1 D;  3B5N A;  2OYI A;  2WSE H;  3FX0 A;  2ITA A;  4HH2 A;  2AEJ A;  1YYC A;  1L0N K;  1USD A;  4GOF A;  2E75 D;  2K9Y A;  4D6T D;  2ZXX A;  4EI2 A;  1L0N D;  3L74 J;  4D6T E;  4K3A A;  1ZRT E;  2W6B A;  4OWF A;  1AFO A;  1VL2 A;  1GL2 A;  3BRV B;  3I5C A;  1L0N E;  1M57 D;  1FZC A;  2E43 A;  3N4X A;  1KB9 D;  3BCC D;  2KLV A;  2POH A;  1S9K D;  3G3Z A;  3H6P A;  3L70 G;  2IFN A;  4L76 A;  5AVZ B;  2KUB A;  3RK3 B;  3AEA C;  1DX7 A;  5APW A;  4N78 E;  1IFN A;  3BCC E;  2JWA A;  1PP9 D;  2RMZ A;  1SQQ D;  2BCC G;  3L75 G;  3CCJ P;  1CZQ A;  3H1I E;  1FBM A;  1PP9 E;  3AE4 C;  4H13 D;  4PV1 B;  1L0L K;  4H0L D;  3LW5 H;  3OJA B;  3HUS B;  2O1K A;  3R2P A;  2HR3 A;  4IFD K;  1JY3 P;  2Y0D A;  2Z4E A;  3BRT B;  3TSI A;  1DD3 A;  1H88 A;  1KIL C;  2C9N Y;  3MUD C;  3L72 D;  1QVF O;  4TLF A;  2WSC J;  3P8C D;  1L0L E;  2FXO A;  1QX8 A;  5AW8 B;  3IR9 A;  1SQP G;  2B9B A;  3S4R A;  2N1T D;  2NPS A;  1DIP A;  1URQ B;  2XV5 A;  3P8C E;  1VF5 C;  1Y9B A;  1U7J A;  4DOJ A;  1EQ7 A;  1ZR2 A;  3D71 A;  4WWI A;  1RF1 B;  2QRX A;  2M3E A;  4OGQ D;  2B87 A;  4ASV A;  4C7R A;  3E7K A;  1KTM A;  4M3L A;  3RL0 B;  1M1J B;  2E42 A;  1KYO H;  3PLN A;  2YXQ B;  2YKP A;  1T8Z A;  2K9J A;  2J5U A;  3D6Y A;  1LT9 C;  3SWK A;  2YMK A;  3HD7 B;  4ZMD A;  1SQB G;  1N8R Q;  1NTM G;  3ABV C;  3P8M C;  2O01 H;  2WPS A;  1YIT P;  2KXP B;  1RHZ B;  5TIS E;  2WT7 B;  1GDT A;  1FE6 A;  2A45 G;  1ZOY C;  5KJ7 C;  1MFZ A;  2K88 A;  1FZG A;  1AQ5 A;  1FS0 E;  1NTK G;  3CWB G;  4D6T J;  1LNQ A;  3PHL A;  4UB6 E;  3H1J D;  1KZU B;  5DJU B;  2JWD A;  1JY2 P;  2QE7 H;  1L0N J;  2H8P D;  1AVY A;  2RN0 A;  3L73 E;  1K8A Q;  3GW6 A;  4JPZ B;  2E74 C;  4JQ0 D;  5TJH A;  1CI6 B;  1FOS F;  1JO5 A;  3BCC J;  3HE4 A;  3NMD A;  1FAV A;  1N7S C;  2W83 C;  3OW2 O;  3H32 A;  1OZH A;  3NTN A;  3MUD A;  3TGU G;  1PP9 J;  2WQY C;  1YJW P;  3PTZ A;  4ZKP A;  2WSS H;  2IZ0 A;  1JM0 A;  1SQQ J;  2LR2 A;  3L71 D;  5C39 A;  4YPC A;  1KQS O;  1RF0 C;  3T97 B;  1K9M Q;  2KNC A;  5AW1 B;  2Z5H A;  5KTB A;  1JB0 J;  1OW6 A;  1BCC G;  3VMZ A;  1LTS C;  3TF5 A;  2IBZ G;  2KI7 B;  3AE7 C;  4N6J A;  1FDI A;  3H1K G;  4JYB A;  2RH0 A;  1IK7 A;  2FYN C;  1KQF B;  2A06 G;  2MJZ A;  3EQ2 A;  4CPG A;  2PAJ A;  2JJL A;  3L72 J;  1G1I A;  3GHG B;  4L75 A;  1LT9 A;  1S5L H;  4U3F E;  3PRJ A;  2KLU A;  5AW9 B;  1YIJ P;  3VP8 A;  5H2F E;  1NU1 K;  1OW7 A;  1OVV A;  1L4A B;  5KJ7 A;  3CI9 A;  1SQV G;  2FYU G;  1EXJ A;  2YIU C;  2K1A A;  4EYY Q;  2BEZ F;  2Q7C A;  3AE2 C;  4L73 A;  5GTH H;  5APV A;  3G4S P;  1A02 F;  1VPC A;  2G3A A;  5KKZ C;  1NU1 E;  3TNU B;  2R44 A;  3CCU P;  2NPS D;  3CCM P;  1HWT C;  3SWY A;  2JO1 A;  2A45 H;  5BU8 B;  1BGY D;  5APX A;  2ZVN B;  2OTJ P;  1NTZ G;  1KC8 Q;  1FDO A;  3A0B H;  1BE3 G;  5E79 H;  3IF4 A;  3KXD A;  2QM7 A;  1Q2N A;  4LGD E;  1OX3 A;  2IX7 C;  2W8Z A;  1K05 A;  1URQ A;  4H44 D;  1KFN A;  3H1J J;  4W7Z A;  2Y0C A;  3M9H A;  3M06 A;  1RF1 A;  3WMM 0;  3IFM A;  3WUV A;  3KYQ A;  1JY2 N;  3E1I A;  1RF0 A;  2M5A B;  3AE6 C;  1NGM B;  3R4Y A;  2V4H A;  3ITK A;  3V5B A;  4UB6 H;  1R5S A;  3CC7 P;  3Q5R A;  1LP1 A;  3H1H E;  1OMI A;  3V4Q A;  2WPV B;  4GDO A;  2L91 A;  1JUN A;  2IDB A;  2Y9Z A;  1QL1 A;  1RQU A;  3A5T A;  2QJP B;  1EZV I;  5AW6 B;  3H1L D;  2KP8 A;  5BVZ A;  2E76 C;  3C8V A;  3O8Z A;  1J1D B;  3L71 J;  3OA7 A;  3L74 G;  2N9Y B;  1N73 C;  4A7P A;  2C0X A;  4DJG A;  1KYO I;  1EZV E;  1X22 A;  1CSB A;  2XU6 A;  2FBW C;  1KIL D;  3RK2 D;  3JC2 2;  3CPW O;  3GF3 A;  1KYO D;  4H44 B;  1DEE G;  2GA1 A;  2LKM A;  3P7K A;  3C9I A;  1NVO A;  1L2P A;  2FKW B;  2ZT9 B;  1KIL E;  1GK6 A;  4WY4 C;  3A0H H;  1KYO E;  4HYT B;  3CCS P;  2KZJ A;  2V7Q J;  1T3J A;  1VF5 D;  1MKM A;  3VMY A;  5CCG D;  3I55 P;  1JCD A;  3L35 A;  2JEE A;  1M7L A;  2P2U A;  1FOS E;  1K73 Q;  1SP4 A;  2WSE J;  2N9B A;  4LC1 A;  1GU5 A;  2H43 A;  3U1A A;  1GD2 E;  2IYO A;  1LTG C;  1OW8 A;  3CL3 D;  1WMK A;  1SFC B;  1PGP A;  2KOG A;  4OVN F;  3FXD A;  2QJK C;  1YQ3 C;  4YXD C;  1EXI A;  4R4M A;  1BGY J;  2KSJ A;  4NPE A;  5B5E H;  2AXC A;  3RK2 B;  3RK3 E;  1ZRT D;  3ZDM A;  3II6 A;  4RKU J;  1S5L X;  1KFM A;  2WPQ A;  3L70 E;  3AEE C;  1ZXG A;  3USS A;  3CLQ A;  4BXL A;  3G9R A;  3AE8 C;  1L4A A;  3G6E P;  2AXT H;  2D2C B;  4O9B A;  2CPB A;  5APU A;  3L75 E;  2FFD B;  4N78 D;  1NKZ B;  1N73 A;  3LW5 J;  1HGV A;  1LWU C;  1YQ4 C;  3TNU A;  1N7S D;  1SQP K;  3H1I D;  1LJ2 A;  3GMA A;  5M1B A;  2Y9Y A;  1GK4 A;  3EFG A;  5EFW B;  2LXB A;  1VQ9 P;  3HE5 B;  1GMJ A;  2P67 A;  5AW2 B;  3H1L J;  1HJB A;  2XKM A;  1OIP A;  2KYV A;  4D6T G;  1AVO A;  4WY4 A;  3O6Q B;  5KLI C;  2IPP A;  3RBZ A;  1X9V A;  1RE4 A;  1SQP E;  1L0N G;  2HLO A;  1ZP0 C;  1S5L E;  4HKZ H;  2E75 B;  1MV8 A;  1IFI A;  2JP3 A;  4C46 A;  3FXE A;  4AQR D;  4C7N B;  1L0L D;  4I7Z B;  1SQB K;  3AE5 C;  1NTM K;  2KS1 B;  1LTJ B;  3V4W A;  3SWF A;  3BCC G;  4Y99 B;  1FZE A;  2W6J H;  4W7Y A;  3C1L A;  2JDI H;  5APT A;  3SFD C;  1Y47 A;  3W67 A;  2A45 I;  1AA0 A;  1KN7 A;  5GTH E;  3JCU H;  1PP9 G;  1NTM E;  1P84 H;  1NTK K;  1SQQ G;  2O01 N;  1J1E B;  1LGH B;  1VQO P;  1H0T B;  1NAF A;  2Q3E A;  3VN0 A;  1IFJ A;  2XND H;  2W27 A;  1IFD A;  3CCV P;  1FJP A;  1S4X A;  4ZNC A;  3CXH H;  1T6A A;  1S72 P;  1KV4 A;  1E5W A;  4BRY B;  4PD4 I;  2DW3 A;  3A0B E;  1HVV A;  5E79 E;  3AED C;  3V2R A;  1VQ5 P;  1NTK E;  3CWB E;  4H13 B;  1VDF A;  4WB4 A;  2VRS A;  4H0L B;  3AE3 C;  1Q86 Q;  2C0W A;  3L72 G;  3RK3 C;  3NFQ A;  1LTA C;  2WMM A;  4PD4 E;  4LLH A;  4DCK A;  3L4F A;  3TK1 A;  1ZN5 A;  4I2L C;  1ZV8 A;  2FY8 A;  1LWU A;  3L73 D;  3JSV C;  4RES B;  4PV1 C;  2YXR B;  2H89 C;  2R5D A;  2N1T B;  2M3B A;  3S1K A;  3HUS C;  4EIJ A;  3M91 A;  5KLV K;  1M90 Q;  3TGU E;  1QEX A;  3B5N D;  1XTC C;  4OGQ B;  4ZKU A;  1EC5 A;  1PGJ A;  5KLV D;  1H8A A;  2QEX P;  1TU3 F;  3S9O A;  4XA4 A;  1PL5 A;  1R5L A;  5KAI H;  1IZN B;  1EDJ A;  1IFM A;  2FXP A;  5KLV E;  1AV1 A;  1EDI A;  1G2C B;  1N86 A;  3E1R A;  3M0A A;  4B86 A;  1URQ C;  3H1I J;  1VQ7 P;  4AUW A;  5CJ4 A;  3SFE C;  1RF1 C;  2E76 D;  1GL2 D;  1KMI Z;  5CJ0 A;  1SQV K;  3AEB C;  3RL0 C;  2ZVO B;  1M1J C;  5AW3 B;  3H1J G;  1M56 D;  3L36 A;  2GM4 A;  3VMX A;  3HD7 C;  3KHU A;  3A0H E;  4BWN A;  4U3F D;  2B89 A;  1KB9 H;  1BSH A;  1L0L J;  5CBO A;  1SQV E;  2KSE A;  3F5H A;  2C9L Y;  3FGA D;  3CCL P;  2KZI A;  2MKV A;  2Q3I A;  1KQG B;  4WY4 D;  2FFD A;  3NXS A;  4GIF A;  1NTZ K;  1NAY A;  3B5N B;  2OYI B;  2ZXE B;  2ZYD A;  3B71 A;  3I56 P;  1PFI A;  5AW4 B;  1QL2 A;  3TDK A;  1XTG B;  1NKN A;  5CMZ A;  2OAR A;  3L71 G;  3W68 A;  1NU1 D;  1BSN A;  1PGO A;  1BDD A;  3A2A A;  1NTZ E;  3D6Z A;  2PP6 A;  5CHX A;  4I1L A;  2HOD B;  3Q2Y A;  3MTU E;  1GL2 B;  4ASW A;  4IOI H;  2WZ7 A;  5B5E E;  1FZC B;  3HUS A;  2OYH B;  3PJS K;  1WT6 A;  4IFM A;  4C7N A;  4U7J A;  3MZW B;  1LTJ A;  2W90 A;  1H89 A;  5AW0 B;  3MIW A;  4IL6 H;  2WSF H;  2QA4 P;  1KQL A;  2AXT E;  3AE9 C;  3L73 J;  1K04 A;  1JNM A;  4PD4 H;  3CX5 H;  1HH0 A;  3CME P;  2BEQ D;  2QVA A;  3AE1 C;  1LTB C;  1H0T A;  3H1H D;  3QH9 A;  1M1J A;  2Q1K A;  2KK7 A;  2Q6Q A;  2QJY B;  1FC2 C;  3VTP C;  1KD1 Q;  3GHG C;  5KLV J;  5B66 H;  3L74 E;  3HD7 A;  5APY A;  1FJK A;  1JCC A;  1BGY G;  1SQX K;  2NPS B;  1HUC A;  1JY3 O;  2WT7 A;  2Q5U A;  1L4A C;  4YXW H;  2XDJ A;  1SQX D;  3WU2 H;  1EZV D;  2B87 B;  2P10 A;  1P84 I;  1HJ0 A;  5CBN A;  2ZYA A;  1JOC A;  3H25 A;  1WRG A;  3PP5 A;  1P84 D;  5CCH C;  4K35 A;  1SQX E;  2K9J B;  2W6A A;  5AVS B;  3CXH I;  2N1T A;  2O3J A;  3A7O A;  1FZA A;  4U3F J;  1NO4 A;  3JCU E;  1P84 E;  2O1J A;  1YJN P;  1DD4 A;  3MD0 A;  4Z1M H;  4JBZ A;  2OTK E;  1HBW A;  1IFP A;  1AQT A;  2WPR A;  1CI6 A;  2ZFC A;  5AW7 B;  3CXH E;  1RE4 C;  1PPJ D;  3F89 A;  1Z56 A;  3AEC C;  2Y0E A;  1OFC X;  3EFF K;  3H1L G;  1G2C A;  1OVR A;  1LT1 A;  1PPJ E;  1NU1 J;  4L74 A;  3KPE A;  1UIX A;  1UII A;  1FDM A;  3T97 A;  2FYZ A;  4N3Y B;  4EDF A;  3G71 P;  4W80 A;  2YO2 A;  2NZ2 A;  2Z5I A;  4DZO A;  3RK3 D;  3A3Y B;  1Q81 Q;  5KJ7 D;  3HE4 B;  1JY2 O;  2L5G B;  2V7Q H;  2WVR A;  2QJP C;  4PJ0 H;  3L70 D;  1KIL B;  1X0T A;  3H32 B;  3GHG A;  4WVZ A;  1GZL A;  3WUU A;  4JF7 A;  1J1D C;  4KJM A;  2NRG A;  2BCC D;  3QWO C;  3L75 D;  3Q3D A;  2KNC B;  3SSU A;  1OWA A;  2E74 D;  1VF5 B;  2QM8 A;  2I8D A;  5KAI E;  1S1C X;  3GG2 A;  3VOP A;  1VQK P;  1GW4 A;  1QVG O;  2BCC E;  1PGQ A;  3H1H J;  5APQ A;  3CCQ P;  1GW3 A;  2GUV A;  5AVT B;  1YHQ P;  4H44 C;  2OYO A;  3VYI A;  2HOD A;  1KB9 I;  2I1J A;  3V2P A;  5CCH A;  1CW5 A;  1YTZ T;  2ZT9 C;  1G1J A;  1LT9 B;  3D70 A;  2HYN A;  4KHX A;  2OYH A;  1URQ D;  1AJY A;  2OGU A;  2HPC B;  4NPF X;  1SQP D;  1SQQ K;  1VQ8 P;  1KB9 E;  1YBK A;  2R5B A;  2PRR A;  3RL0 D;  2FXM A;  3KQG A;  5BU5 A;  1SQX J;  1S9K E;  4WBA A;  2PFX A;  5AVY B;  3FWN A;  4IL6 X;  1NJI Q;  1Q82 Q;  1IK9 A;  3CC2 P;  3HD7 D;  1SFC C;  2B88 A;  1SQQ E;  2CPS A;  4IFF A;  2QIW A;  2M5A A;  3Q5S A;  1SQB D;  1ZME C;  1NTM D;  2E74 B;  2WTY A;  1NOH A;  1Y8A A;  4UB8 H;  1YI2 P;  2I1K A;  3RK2 C;  3H1I G;  2O01 J;  1SQB E;  2R3C A;  3GF7 A;  3VP9 A;  4AYC A;  3MGN A;  1VQ6 P;  2PGD A;  1PIX A;  1IC2 A;  1N7S B;  3L72 E;  1NTK D;  3CWB D;  1GTW A;  2YO3 A;  2D2C C;  3CX5 I;  3HTK B;  1T2K C;  2WWW A;  5CCG C;  3WUT A;  4RJT A;  4IL6 E;  1YJ9 P;  2FFD C;  4RO0 A;  1L0L G;  4PD4 D;  2K37 A;  3CX5 D;  2M8R A;  2WSC H;  1R8E A;  1LP1 B;  3MP7 B;  2ZJS E;  2YKQ A;  3CX5 E;  2FYN B;  2R3S A;  3B4S A;  1OXZ A;  3CCE P;  2HG5 D;  3L70 J;  1USE A;  2K3R A;  1X8Y A;  1ZW0 A;  1MFT A;  3TGU D;  5GTI E;  1U7M A;  5AVX B;  1SVF A;  1ZLL A;  1MZ9 A;  3KZI H;  1BDC A;  2BCC J;  2OTL P;  5B66 E;  3KDP B;  3GLM A;  3L75 J;  1VQ4 P;  2E75 C;  2UWJ E;  3LIE A;  2ZAE B;  3P32 A;  2IBZ I;  4I7Z C;  3IAO A;  1J2J B;  3L37 A;  1LTJ C;  1LTT C;  1BCC D;  1JTH B;  3RBX A;  2RKL A;  2YIU B;  1FZB A;  2IBZ D;  2Q9I A;  1M8O B;  3H1K D;  4Y99 C;  4KT0 J;  1A02 J;  1NYH A;  2A06 D;  1SFC A;  1D7M A;  3WU2 E;  1HF9 A;  1BCC E;  3H1J E;  5KKZ B;  2IBZ E;  3U59 A;  1VQP P;  4XFJ A;  2M0B A;  3H1K E;  4DT0 A;  4GKG A;  3BAT A;  2A06 E;  1X79 B;  1L4A D;  1S3J A;  1SQP J;  1J1E C;  5KAF E;  1QLE D;  3L73 G;  2FYU K;  1KIL A;  2P1J A;  3CMA P;  3VMA A;  2ZYG A;  3B8E B;  4MN4 C;  2BAS A;  5CCH D;  1SQV D;  2FYU D;  1VQN P;  1JMB A;  2IYP A;  5AVQ B;  1N7L A;  1EDL A;  4H13 C;  2JKV A;  1EDK A;  1NHL A;  4H0L C;  2SPZ A;  3BAS A;  2FYU E;  2H88 C;  3L71 E;  4NPD A;  5KLV G;  5CCG A;  5AW5 B;  1M1K Q;  1SQB J;  1W5C E;  1NTM J;  3RGU A;  1JY3 N;  2XNX A;  1FZF A;  5DJT B;  1Q90 D;  2KIK A;  1NTZ D;  1E79 H; 
#chains in the Genus database with same CATH homology
 1LTI C;  4O9B A;  2WPS A;  1DH3 A;  2CPB A;  1JOC A;  4EOT A;  2HPC A;  5APU A;  4OH8 B;  1WRG A;  2N1T C;  3PP5 A;  2FFD B;  4N78 D;  1NKZ B;  5CCH C;  1N73 A;  2WT7 B;  1GDT A;  2W6A A;  1NWQ A;  3HE5 A;  5AVS B;  2A45 G;  2N1T A;  3OAK A;  5KJ7 C;  3A7O A;  1FZA A;  1NO4 A;  1MFZ A;  1HGV A;  1LWU C;  2XZR A;  1FZG A;  3TNU A;  2H7H A;  1FU1 A;  1N7S D;  1SQP K;  2O1J A;  1AQ5 A;  2HFE D;  2WIT A;  3MD0 A;  1HBW A;  1GK4 A;  1N73 B;  1W2E A;  2WPR A;  1CI6 A;  3EFG A;  2YNY A;  1KZU B;  2ZFC A;  3HE5 B;  5AW7 B;  3BVH A;  1JY2 P;  2P67 A;  5AW2 B;  3V2Q A;  1HJB A;  2XKM A;  2KYV A;  1RE4 C;  4WY4 A;  2H8P D;  1Z56 A;  3M9B A;  2IPP A;  1X9V A;  1RE4 A;  2J58 A;  3U1C A;  1G2C A;  2HLO A;  3M0D C;  1MUU A;  1CI6 B;  1IFI A;  1MV8 A;  4C46 A;  4AQR D;  4C7N B;  1FOS F;  1JO5 A;  1SQB K;  3KPE A;  1FDM A;  1NTM K;  4WY4 B;  1LTJ B;  3N7N A;  3HE4 A;  3NMD A;  3T97 A;  3V4W A;  1FAV A;  2FYZ A;  4N3Y B;  1N7S C;  3SWF A;  3H32 A;  3NTN A;  3MUD A;  1YTZ I;  4Y99 B;  1FZE A;  4W7Y A;  4W80 A;  2YO2 A;  1N7S A;  5APT A;  2YMY A;  4ZKP A;  2A45 I;  2Z5I A;  4DZO A;  3RK3 D;  3A3Y B;  1RF0 C;  5KJ7 D;  3HE4 B;  1JY2 O;  2L5G B;  3HTK A;  5AW1 B;  1HTL C;  2R32 A;  2Z5H A;  3LID A;  1NTK K;  1GU4 A;  3H32 B;  1KIL B;  5KTB A;  3GHG A;  1J1E B;  1LGH B;  1RE3 C;  3B5N C;  1NAF A;  3VN0 A;  3VMZ A;  1IFJ A;  2OYI C;  1LTS C;  2W27 A;  1IFD A;  1GZL A;  1RY3 A;  4JF7 A;  4GT1 A;  4N6J A;  1FJP A;  1J1D C;  4JYB A;  1E5W A;  2MJZ A;  3EQ2 A;  1HVV A;  2PAJ A;  2JJL A;  3V2R A;  5APS A;  1OWA A;  1G1I A;  3GHG B;  2QM8 A;  1LT9 A;  3VOP A;  1VDF A;  1GW4 A;  4WB4 A;  3V2N A;  2VRS A;  5AVU B;  2J59 M;  1IO4 A;  5APQ A;  1HGZ A;  2C0W A;  2YKO A;  1GW3 A;  5AW9 B;  2GUV A;  1SLQ A;  5AVT B;  3RK3 C;  3NFQ A;  1GL2 C;  1SFC D;  3VP8 A;  1LTA C;  3VYI A;  2HOD A;  2I1J A;  4LLH A;  3V2P A;  5CCH A;  1NU1 K;  1FZC C;  1CW5 A;  3L4F A;  1YTZ T;  1N2D C;  3TK1 A;  2OYH C;  1L4A B;  1G1J A;  1LT9 B;  1ZN5 A;  5KJ7 A;  3CI9 A;  4I2L C;  2HYN A;  1ZV8 A;  4KHX A;  2OYH A;  1URQ D;  1LWU A;  2HPC B;  3HRN A;  1JTH A;  5AVW B;  4RES B;  2Q7C A;  5APV A;  1A02 F;  2R5D A;  3M9Q A;  3TYY A;  1VPC A;  2N1T B;  1SQQ K;  2M3B A;  1DEB A;  5AVV B;  3HUS C;  2R5B A;  4EIJ A;  3M91 A;  3RL0 D;  2FXM A;  2P7J A;  3KQG A;  3TNU B;  5KLV K;  2KB7 P;  2NPS D;  5BU5 A;  1S9K E;  1NH4 A;  4WBA A;  5AVY B;  1LWU B;  3B5N D;  3SWY A;  1HWT C;  1XTC C;  1IK9 A;  4ZKU A;  2A45 H;  5BU8 B;  3HD7 D;  5APX A;  3UIA A;  1SFC C;  1H8A A;  3M0D A;  4XA4 A;  1T2K D;  2GUS A;  5AVR B;  1IFM A;  2QM7 A;  2CPS A;  4IFF A;  4LGD E;  1G2C B;  1N86 A;  3M0A A;  2IX7 C;  4B86 A;  1URQ C;  2IFM A;  2WTY A;  1NOH A;  4AUW A;  5CJ4 A;  4I6M C;  1ZR4 A;  1URQ A;  1RF1 C;  4XE5 B;  1GL2 D;  2I1K A;  1KFN A;  3RK2 C;  4W7Z A;  3M9H A;  5CJ0 A;  1SQV K;  3M06 A;  1RF1 A;  2R3C A;  3RL0 C;  3IFM A;  3WMM 0;  3KYQ A;  1IJD B;  1M1J C;  1JY2 N;  4JYC A;  3VP9 A;  2NPS C;  1JMM A;  4AYC A;  3E1I A;  1RF0 A;  5AW3 B;  3MGN A;  1T3U A;  1IC2 A;  1N7S B;  3V5B A;  3L36 A;  1RE3 A;  2GM4 A;  3VMX A;  3HD7 C;  3B5N A;  2OYI A;  2WSE H;  1GTW A;  4HH2 A;  2YO3 A;  3HTK B;  1T2K C;  2WWW A;  5CCG C;  3V4Q A;  1YYC A;  1L0N K;  1JUN A;  2C9L Y;  2FFD C;  1QL1 A;  3A5T A;  2M8R A;  2WSC H;  2Q3I A;  4WY4 D;  2FFD A;  3NXS A;  4GIF A;  5AW6 B;  1NTZ K;  2KP8 A;  3B5N B;  5BVZ A;  2OYI B;  2ZXE B;  3O8Z A;  1PFI A;  1J1D B;  2YKQ A;  5AW4 B;  2W6B A;  3OA7 A;  1QL2 A;  1AFO A;  1GL2 A;  1XTG B;  3BRV B;  3I5C A;  1OXZ A;  1NKN A;  1N73 C;  2C0X A;  2E43 A;  1FZC A;  2HG5 D;  5CMZ A;  3N4X A;  2OAR A;  1X8Y A;  1CSB A;  2XU6 A;  2KLV A;  5AVX B;  2POH A;  1S9K D;  1SVF A;  1ZLL A;  3A2A A;  3G3Z A;  3H6P A;  2PP6 A;  1MZ9 A;  5CHX A;  1KIL D;  4I1L A;  3RK2 D;  2HOD B;  2IFN A;  5AVZ B;  3MTU E;  3RK3 B;  1DX7 A;  1GL2 B;  3KDP B;  5APW A;  4N78 E;  1IFN A;  2LKM A;  2WZ7 A;  3LIE A;  3P7K A;  3C9I A;  1FZC B;  2FKW B;  3HUS A;  3P32 A;  2OYH B;  1WT6 A;  1GK6 A;  4IFM A;  3L37 A;  1J2J B;  4WY4 C;  1LTJ C;  1LTT C;  1JTH B;  4HYT B;  4C7N A;  1CZQ A;  1FZB A;  1T3J A;  1FBM A;  2Q9I A;  1LTJ A;  3VMY A;  1H89 A;  4Y99 C;  1A02 J;  5AW0 B;  5CCG D;  3MIW A;  1JCD A;  3L35 A;  1L0L K;  2WSF H;  2JEE A;  1M7L A;  1SFC A;  3LW5 H;  3OJA B;  2P2U A;  3HUS B;  1FOS E;  1KQL A;  2O1K A;  3R2P A;  4IFD K;  3U59 A;  1SP4 A;  1JY3 P;  4GKG A;  3BAT A;  2Z4E A;  2N9B A;  4LC1 A;  3BRT B;  1GU5 A;  3TSI A;  2H43 A;  1JNM A;  1X79 B;  3U1A A;  1GD2 E;  1L4A D;  1H88 A;  1LTG C;  1KIL C;  2C9N Y;  1HH0 A;  1J1E C;  3CL3 D;  1SFC B;  2FYU K;  2KOG A;  1KIL A;  2P1J A;  3P8C D;  1LTB C;  5AW8 B;  3IR9 A;  1M1J A;  3B8E B;  2N1T D;  2BAS A;  2NPS A;  5CCH D;  3VTP C;  1URQ B;  2XV5 A;  3P8C E;  5AVQ B;  1N7L A;  3GHG C;  4DOJ A;  1EQ7 A;  1ZR2 A;  3HD7 A;  1RF1 B;  2KSJ A;  5APY A;  1NHL A;  3RK2 B;  3BAS A;  4C7R A;  1FJK A;  1JCC A;  4M3L A;  5CCG A;  3RL0 B;  1M1J B;  2E42 A;  5AW5 B;  3II6 A;  1SQX K;  2NPS B;  1KFM A;  2YKP A;  1T8Z A;  1HUC A;  1JY3 O;  2WPQ A;  2WT7 A;  1JY3 N;  2XNX A;  2Q5U A;  1FZF A;  1L4A C;  1LT9 C;  2XDJ A;  3CLQ A;  3HD7 B;  3P8M C;  1L4A A;  2O01 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...