3P8MC

Human dynein light chain (dynll2) in complex with an in vitro evolved peptide dimerized by leucine zipper
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
42
structure length
42
Chain Sequence
b'SVSRGTQTEGGSGMKQLEDKVEELLSKNYHLENEVARLKKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dynein light chain 2
publication title Directed evolution reveals the binding motif preference of the LC8/DYNLL hub protein and predicts large numbers of novel binders in the human proteome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 42
sequence length 42
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3p8mC00
4I6MC 1FAVA 5APUA 5AW9B 1A02J 1GU5A 3A2AA 3VTPC 5APWA 3V5BA 2VRSA 3VMXA 4KHXA 3HE4A 4XE5B 1OWAA 5AW2B 1H88A 1OXZA 2W27A 5AW1B 3HE5A 5APVA 4AQRD 3LIDA 3A7OA 3M9HA 5AVUB 2XZRA 4DZOA 3OAKA 5APQA 1JUNA 4JYCA 1KQLA 2YNYA 3V4QA 4AUWA 1CI6A 2WWWA 3MGNA 4I2LC 1JNMA 3L36A 3KQGA 5APYA 3A5TA 2W6AA 2WPSA 2C9NY 2P7JA 2WT7B 3T97A 1GZLA 1NAFA 1YYCA 1A02F 2R3CA 2IPPA 1GK6A 2XV5A 1G2CB 3L35A 2WPQA 5AVWB 5APXA 2E42A 2QM8A 3VMZA 1SP4A 1CZQA 2R5BA 5AW3B 3LIEA 1X8YA 4HYTB 1GD2E 3HE4B 5CMZA 1CSBA 3KDPB 3M91A 3VYIA 2JJLA 4C7NA 1T2KC 3HTKA 1IO4A 1GK4A 2R32A 3M9BA 1HJBA 2BASA 5AVSB 3B8EB 3I5CA 5AW5B 4AYCA 5AVYB 3O8ZA 2P2UA 3A3YB 3TNUB 1CI6B 1H8AA 2E43A 1SLQA 3M0DA 5AW7B 3SWFA 5AVTB 4GT1A 1DH3A 3L37A 2Q5UA 5APTA 1HUCA 2N9BA 2WTYA 3M06A 1NWQA 1FOSF 5AVXB 1GTWA 3NXSA 4RESB 4EOTA 1MFZA 2QM7A 2KP8A 1J2JB 3IR9A 2Q3IA 1HWTC 3NFQA 1MV8A 3TK1A 3HE5B 3TYYA 3VMYA 4GKGA 2YO3A 5AW6B 2Z5HA 4C7NB 2Z5IA 5AW0B 5AVZB 4LC1A 2WPRA 2Q7CA 3NTNA 3VN0A 1MUUA 2C9LY 1H89A 3P32A 2ZFCA 3NMDA 2P67A 2YO2A 5AW4B 1S9KE 3UIAA 2XU6A 2H7HA 3M0AA 4B86A 5AVQB 3P7KA 3P8MC 3TNUA 1S9KD 1GU4A 2WT7A 5APSA 5AVVB 1FOSE 3MD0A 4M3LA 3V4WA 2ZXEB 1HBWA 4JYBA 2R5DA 4C46A 1T2KD 5AW8B 5AVRB
chains in the Genus database with same CATH superfamily
3A0BH 3L71G 2KS1A 2Y0CA 2ZVOB 3H1KJ 2B87A 4H13D 4H44D 4WY4D 3H1HJ 2E5TA 3CCQP 1JY3P 2YXQB 3RK2D 1SFCD 3CX5E 3RBZA 5CJ0A 1RF1B 1YITP 3AECC 2LXCB 1FZGA 1URQD 3F89A 3L35A 5CBOA 2E42A 3VMZA 3W67A 2Y9ZA 4JBZA 5KAIH 3FGAD 2BCCJ 3AE8C 3G6EP 4DCKA 4PD4I 1VF5D 1K05A 4IFFA 2R3SA 4XFJA 3TNUB 1WMKA 2A06E 2NZ2A 2A45H 2G3AA 5CCHA 3TSIA 3H1JD 3NXSA 4RESB 2WSEJ 1JY2O 1FZCC 3C8VA 3IR9A 2ZVNB 1HWTC 3TYYA 1S72P 1BDDA 1JY2N 3H25A 3H1LD 2WSCJ 4K35A 2CPBA 3S9OA 3UIAA 2XU6A 4W7ZA 2FYUJ 1FZCB 1S9KD 5KJ7A 5GTIE 5AVVB 1KILD 3WU2H 2W6JH 1FAVA 4N3YB 2QEXP 3EWKA 1LT9C 3L71J 5CCGD 3A7OA 3GF7A 1RH5B 1OFCX 1BE3E 2K9JA 1OVRA 1GK6A 1LT9B 2KS1B 1YJWP 1SQBJ 3I56P 2KUBA 3M91A 5KLVJ 5BU8B 3CMAP 1T2KC 4R4LA 4L74A 3M0DA 5AVTB 2K1AA 1IFJA 1FU1A 1OVUA 5CCHC 2G8YA 2Q3IA 3L72D 1BCCG 2Z5HA 2BEZF 1GDTA 3O6QA 1KB9H 2IBZI 2KIKA 4LC1A 1JEKA 1VPCA 1L4AA 2KZJA 2KYVA 3AE7C 1RE3A 4D6TJ 3G9RA 1NKNA 4OGQC 2YMKA 2ZYGA 3MZWB 2R5DA 1R5LA 3H1LE 5KJ7C 5AVRB 2WSEH 3TGUE 5B5EE 3HE4A 5AW2B 3CWBG 2XZRA 1SQXE 4PJ0H 4OGQB 1OIPA 2HYNA 3L36A 2WPSA 1FZBA 3WUVA 4U3FG 1FZAA 5APXA 2QRXA 1KZUB 3BATA 2R5BA 3SWKA 5TJHA 2FYZA 4WVZA 1BCCD 2P10A 3CLQA 2K9JB 3S4RA 5E79H 1U7JA 2L5GB 3IN6A 1DH3A 1PIXA 1NTMJ 3M0DC 4GDOA 1ZRTE 1J1EC 3FWLA 2Q9IA 3WUUA 2V4HA 3G3ZA 2PP6A 3CD6P 1NYHA 1KYOD 3AE6C 5AW6B 1N7SA 1OMIA 1L0NE 3CXHH 3CWBD 1VQKP 1YI2P 3CCRP 1J1EB 3D71A 4LLHA 1JM0A 4YXDC 3L72E 1L4AC 1SQVJ 1RE3C 3BCCE 1M1KQ 1KQFB 5AW9B 1JB0J 1IJDB 2VRSA 3O6QB 2I1KA 4L76A 1JMMA 1EZVE 4Y99C 1L4AB 3F5HA 1NU1D 3P8CD 5CBNA 1LTIC 1YYCA 1A02F 1PP9D 1IZNB 1SQQJ 2XV5A 3E7KA 3CCMP 3CCEP 3R4YA 1NTZD 4U3FJ 2Z4EA 3HE4B 3L70J 3KDPB 3HD7C 4Y99B 3HTKA 2B9BA 3GF3A 2QJPC 5KAFE 1H8AA 2M8RA 4GODA 1PGQA 1NTKJ 2YKOA 1YJ9P 3CMEP 1X79B 3Q5PA 1EXIA 3HD7B 1M57D 1QX8A 2QJPB 2CK3H 2HR3A 3PJSK 1X0TA 2O1KA 1N7SC 2C9LY 1FZEA 2YO2A 1M1JA 3C1LA 3E1IA 3L73G 4NPDA 4M3LA 1KYOE 1T2KD 1VQ6P 1JOCA 5APUA 1JCCA 5EFWB 3B5NA 1VQMP 3VMXA 4KHXA 3KXDA 3KZIE 4UB6H 1N7SB 2H8PD 3D6YA 1YQ3C 3LIDA 5GTHH 1S5LH 1LNQA 5CCHD 1JNMA 3GW6A 5KLIC 3AEFC 3VOPA 2KNCA 4L73A 2R3CA 4GOFA 3CX5D 1KB9I 3L74D 4WB4A 2N1TA 2POHA 1K73Q 1NJIQ 3CC2P 2JO1A 5CMZA 5B66H 1NU1E 3M9BA 3A0HE 4OGQD 1PP9E 5KLIB 1BE3G 2I1JA 2A06D 3MIWA 1AV1A 2QM7A 1BGYE 3HE5B 1M90Q 3V2NA 3HTKB 5H2FE 1FJPA 2OQQA 3NTNA 2IDBA 3N4XA 3VN0A 1Y47A 3P32A 2B88A 4W80A 3CCLP 1AQTA 1H0TA 1PZQA 1S5LX 1M1JC 1ZMEC 1YJNP 3L73J 1MFTA 4OH8B 1RQVA 1FJKA 1SQPE 1OWAA 2YMYA 2NRGA 2HFED 3B5NC 5AVUB 1J1DC 1OVVA 2QSIA 2PAJA 4AUWA 1FC2C 1OW6A 1M1JB 1NTZK 1BE3D 1GMJA 3H1HD 1RE4A 4KT0J 2JWAA 1WT6A 2WPQA 3H1LG 3CXHI 2XKMA 5AW3B 1Q86Q 3B5NB 2N1TC 1J1DB 1S4XA 3VYIA 1XTGB 5AVSB 2BCCD 1L4AD 1SQXG 3L74E 2R44A 4H0LD 1LTSC 2KNCB 2OTKE 1PGJA 1KFMA 4DJGA 2N1TB 1OW8A 3CL3D 1LP1B 3L75E 1DEEG 2HLOA 2ZT9C 1PFIA 2GM4A 1AQ5A 4L75A 2PGDA 3GLMA 4NPEA 1OX3A 2P67A 1N7LA 1U7MA 2H7HA 4B86A 3IF4A 1M8OB 2W90A 3BVHA 4GIFA 1KQSO 3VP8A 3HD7D 2WVRA 1Q81Q 2RN0A 2ZT9B 2FYUD 2O3JA 3CC4P 1PV3A 1S3JA 4EYYQ 3CCJP 3TGUD 1LTGC 3R2PA 4PV1C 3M9HA 1L0NG 4YPCA 2ZXXA 2C0XA 4I1LA 1SQXD 1H0TB 1L0LE 3H1JJ 3RBXA 3H1IE 3Q1MA 3L72G 2FY8A 1RE4C 1WRGA 4IOIH 2J59M 3PLNA 1IK9A 2RH0A 3H32A 3H1KE 1N7SD 1UIXA 2JJLA 3SFEC 2R32A 3H1HE 2BASA 3MHVA 1VQOP 2H43A 4BRYA 5CHXA 1EZVG 4GT1A 5KKZC 1USDA 2J5UA 1M56D 2H88C 4OWFA 2AEMA 4R4MA 2B87B 1ZRTD 2J58A 5M1BA 4HB1A 1KD1Q 2BCCE 3AE1C 5GTIH 4NPFX 5KKZB 1T6AA 3IAOA 1L0ND 1R8EA 1FDIA 1FOSE 1PPJE 3E1RA 2OARA 1G2CA 4WBAA 1RF0A 3BCCD 4A7PA 4D6TD 1A02J 5APWA 1KC8Q 1FE6A 1IFPA 2E5YA 3JSVC 4AQRD 2M0BA 1W2BO 4Y28J 1ZP0C 2QG4A 1VQ9P 2JWDA 2FYUE 1IFMA 1QEXA 1EZVD 2B89A 3RL0C 3V2QA 4HJGH 3Q5SA 2I8DA 3SSUA 1SFCA 3V6IA 4JF7A 1RY3A 4OVNF 4EI2A 1N73A 2QJYC 2OYIA 3L71E 4BWNA 5DJUB 2HODA 5E79E 1IO4A 1GK4A 1P84E 2JP3A 3A3YB 3RL0B 5TISH 3II6A 4RJTA 3CPWO 2Q5UA 1ZN5A 3EFGA 1FOSF 3M06A 2KK7A 1HVVA 1U57A 2QJYB 3B5ND 3H32B 1SQBE 3PP5A 3H6PA 1EDIA 3VMYA 5KLVE 3B4SA 1XTCC 1DD4A 1NU1G 3ABVC 2OYHA 2YKPA 4BRYB 1SVFA 4KJMA 5B5EH 1PP9G 1IC2A 2D2CC 5AVQB 2NPSA 1NTZG 2N1TD 2FXMA 3AE9C 2M5AA 3K5BA 1BGYG 1SQXK 2WITA 1RF0C 4PD4E 1BCCJ 2KSEA 5BU5A 1OXZA 2D2CB 1DEBA 4DZOA 3RK3C 5APQA 1W5CE 3V4QA 1HF9A 2ZJSE 2QJKC 1S2EA 1AFOA 3KQGA 4D6TE 2FXPA 1EC5A 1KORA 3M9QA 2ZT9D 4RO0A 2JEEA 1G2CB 5AVWB 3FWNA 4UB8H 1CZQA 1GD2E 3SFDC 2KLUA 1OW7A 1SFCC 3RK3B 3N7NA 4BXLA 1N73C 1SS1A 3CWBJ 4EDFA 1ZR4A 2OYIC 1EQ7A 1Q2NA 2KXPB 4ASWA 1UIIA 1QGKB 1W2EA 1T3JA 4IL6E 3QH9A 1SFCB 2WZ7A 1NTKD 1L0NK 2AXTH 1MV8A 1N73B 2OYIB 1BGYD 2HODB 3WUTA 1GW3A 3U1CA 1VDFA 4ZNCA 2A45G 3JCUE 3L74G 5AW4B 1NTME 2OYHC 2HPCA 1K8AQ 1JY3O 1PP9J 2NPSC 1JY3N 1NTZJ 3AEBC 1GU5A 2WSSH 1LTJA 2IFMA 2OYHB 1SQPD 2A06G 2JR8A 4N78E 1KQLA 5C39A 3A5TA 2NPSB 2WQYC 3T97A 1SQVE 1VQ7P 1T8ZA 5KAFH 2M5AB 3FXEA 2M3BA 2YXRB 2YIUC 5K5GB 4I7ZC 3GHGA 2IBZE 2K9YA 5AW5B 2P2UA 2E43A 2C0WA 2N9BA 1L0LG 2P58A 1SQQE 2YIUB 3H1IG 3V2PA 3GMAA 3ITKA 4I7ZB 2KP8A 1FDMA 1T3UA 4U3FE 2P1JA 1Y9BA 3L70E 1KYOH 1HGVA 3L75D 4IFDK 4IFMA 3RL0D 2AEJA 5KJ7D 3H1HG 2Q7CA 1IFNA 4ZKPA 3KZIH 3M0AA 1NTKE 3FXDA 5CJ4A 1RQUA 3TNUA 3AE2C 2E75C 4JYBA 3U1AA 1CW5A 3KHUA 3A2AA 2SPZA 2BCCG 4TLFA 1FDOA 1HJ0A 2RKLA 3AEDC 3HRNA 2YNYA 1USEA 1LTJC 3PH0A 3QWOC 3VP9A 2E75B 4I2LC 1N86A 2W6AA 3A0BE 1PPJG 1L0LD 3H1ID 3USSA 3JC22 1NU1K 1SP4A 1LWUA 2XNDH 1GW4A 1KV4A 3H1KD 1LTJB 1JCDA 3GHGC 2W83C 4K3AA 3L4FA 1NAYA 5KTBA 4TT3H 1RHZB 2GA1A 4ZKUA 2FYUG 3L37A 5H2FH 5KAIE 2ZYDA 1DX7A 2WTYA 1NKZB 2Q3EA 2FBWC 1Q82Q 2KI7B 3TGUG 1MFZA 3GG2A 1J2JB 3B71A 3RK3D 3GHGB 3SWYA 1KB9D 2MKVA 5AVZB 3OW2O 1MZ9A 2ZYAA 1H89A 1BE3J 3OA7A 2Y0DA 4WWIA 1VQ5P 2O1JA 2ITAA 2WT7A 2AXCA 1SQPK 1VQPP 1PPJD 1LGHB 1YBKA 3C9IA 1SQBG 3Q5RA 4EIJA 5KLVG 3V2RA 2YKQA 5AW1B 3U59A 5APVA 1NOHA 3EQ2A 3OJAB 1N8RQ 1CI6A 1FS0E 3WU2E 1BSHA 2DW3A 2K3RA 3BRVB 1GZLA 2CPSA 2WSFH 3CX5H 3L73E 3TDKA 3W68A 3G4SP 1HH0A 1LJ2A 1X8YA 1LTTC 3MUDA 3EFFK 3CI9A 4XA4A 1IFIA 3FX0A 1LWUC 3L71D 1IFDA 4AYCA 2XDJA 3O8ZA 1P84D 1EZVI 2NPSD 3RGUA 2GUSA 3BCCG 1JTHA 4D6TG 1HTLC 1HUCA 1GTWA 1YQ4C 4EOTA 4PV1B 2Q6QA 1AVOA 3H1LJ 1VQNP 1LWUB 3TGUJ 1ZLLA 1GL2A 1SQBD 1Q90D 1ZXGA 5KLVD 1JO5A 3CXHD 1SQXJ 3LW5H 4N6JA 2O01J 1IK7A 1K04A 3RK3E 1Q7YQ 2OGUA 3V4WA 2ZXEB 1ZV8A 2FKWB 2E74C 1KB9E 1ZR2A 1KFNA 4DOJA 4I6MC 1G1IA 3VTPC 4ZMDA 2PFXA 2Y0EA 3D70A 1QVFO 4XE5B 1H88A 3VMAA 4PD4D 1L0LK 4Z1MH 2E74B 1BSNA 2LR2A 1NTMG 2C9NY 2WT7B 1NAFA 1L2PA 1KYOI 4PJ0E 3LIEA 1X9VA 1VQLP 1KTMA 2GUVA 5BVZA 2KZIA 5TISE 3MUDC 1L0NJ 2E75D 3PTZA 1CI6B 1LTAC 4WY4A 2K37A 3TF5A 3H1JE 1NWQA 1SQVG 1M7LA 3L72J 3BCCJ 1DIPA 2IFNA 1BDCA 2KSJA 2IZ0A 1URQA 3TK1A 4GKGA 3BRTB 3PHLA 2JKVA 2BEQD 2MJZA 2IBZG 1K9MQ 2FXOA 1GL2C 1X22A 1AA0A 2KOGA 2O01N 2E76C 1YIJP 1S9KE 1HGZA 1PL5A 1VL2A 1JTHB 2WSCH 1KILE 1JMBA 4W7YA 1NTMD 4MN4C 1HBWA 3MD0A 1SQQG 5L8RJ 1QL2A 3AEGC 5AW8B 3CXHE 3KPEA 3L70G 1GL2B 3MTUE 3HD7A 2V7QJ 2E76B 2FYUK 2W27A 1NO4A 2Y9YA 2Q1KA 3OAKA 2L91A 2W6BA 1JY2P 4N78D 5APYA 2IZ1A 1NTKG 2O01H 1P84H 1S1CX 4UB8E 2IPPA 1SQVD 2WMMA 3Q3DA 1VQ4P 1KILA 2QVAA 3CC7P 1NHLA 1CSBA 4C7NA 4GOEA 1D7MA 5CCGA 5AVYB 2IBZD 3MP7B 4H13C 5DJTB 2LKMA 2FYNC 4H44C 1SQBK 4WY4C 4YXWH 1NVOA 1LTBC 5AVXB 5KLVK 2AXTE 3RK2C 1SQQD 2FFDA 4C7RA 4JQ0D 3CCVP 1SQPG 3ZDMA 4RKUJ 2QJKB 4U3FD 2QE7H 2YO3A 3RL0g 1URQC 4H0LC 3L70D 4H13B 4QMAA 4DT0A 2PRRA 2IX7C 3Q2YA 2WPRA 2FYNB 3I55P 4H44B 4WY4B 3CX5I 2A45I 2M3EA 1FBMA 1G1JA 3KYQA 1VF5C 4PD4H 1NGMB 3RK2B 3P7KA 3P8MC 4PV1D 1EDLA 4C46A 1URQB 4H0LB 3V5BA 2OTJP 4CPGA 1VF5B 3HE5A 1NU1J 2IYPA 1YHQP 4JYCA 3HUSA 3MGNA 3IFMA 2P7JA 2JDIH 2N9YB 4UB6E 4JPZB 3BASA 3L75G 5GTHE 1BGYJ 1S5LE 4O9BA 1BCCE 1KILC 4IL6H 1KQGB 1HJBA 2V7QH 3B8EB 2E74D 2OYOA 5AW7B 5CCGC 3AE5C 1AJYA 5APTA 5B66E 1E5WA 1EXJA 3JCUH 1KILB 1QLED 1YTZT 3NFQA 1AVYA 2AEFA 1MKMA 2FFDC 2K88A 1Z56A 4C7NB 1LT1A 2Z5IA 1NTMK 1SQPJ 2HG5D 3CWBE 5AW0B 2KLVA 1KN7A 2UWJE 2KB7P 3AEEC 1TU3F 1GU4A 1RF1A 5APSA 1ZW0A 2XNXA 2FFDB 2H89C 3H1KG 3WMM0 1N2DC 4U7JA 1OZHA 3CCSP 1FZFA 2LXBA 1LP1A 1SQVK 1JUNA 1QL1A 2QIWA 4IL6X 2WSFJ 4HH2A 2WWWA 3P8CE 3L74J 4YTPC 2ZAEB 1VQ8P 3HUSC 2WPVB 1PGPA 2IYOA 1NTZE 2QM8A 3L73D 1GL2D 1YTZI 3PRJA 4HYTB 3L75J 2E76D 3AE3C 1EDJA 2HPCB 3I5CA 3HUSB 1SQQK 3G71P 1SLQA 1Y8AA 2OTLP 3SWFA 3A0HH 4LGDE 3AE4C 1KMIZ 4HKZH 1FZCA 3CCUP 1ZOYC 1QVGO 1E79H 3AEAC 1R5SA 2D2CD 2QA4P 3S1KA 3LW5J 1NTKK 1P84I 1EDKA 1PGOA 3D6ZA 1MUUA 3T97B 2RMZA 2ZFCA 3NMDA 1DD3A 3H1JG 2W8ZA 1L0LJ 1NH4A 3H1IJ 4ASVA 1LT9A 1RF1C
chains in the Genus database with same CATH topology
4I6MC 1JOCA 5APUA 1JCCA 1G1IA 3VTPC 1SQXK 3B5NA 2WITA 3VMXA 4KHXA 1RF0C 4XE5B 1N7SB 2H8PD 5BU5A 1H88A 1OXZA 3LIDA 1DEBA 4DZOA 1L0LK 4WY4D 3RK3C 5APQA 3V4QA 1JY3P 5CCHD 3RK2D 1JNMA 1AFOA 3KQGA 1SFCD 2C9NY 2WT7B 5CJ0A 1RF1B 1NAFA 3VOPA 2R3CA 3M9QA 1FZGA 1URQD 2JEEA 1G2CB 3L35A 4WB4A 5AVWB 2N1TA 2E42A 3VMZA 2POHA 1CZQA 3LIEA 1GD2E 1X9VA 1SFCC 3RK3B 3N7NA 5CMZA 2GUVA 5BVZA 1N73C 4IFFA 3M9BA 1ZR4A 2OYIC 3TNUB 1CI6B 1EQ7A 1LTAC 2I1JA 4WY4A 2A45H 5CCHA 1W2EA 1T3JA 1NWQA 3TSIA 1M7LA 3NXSA 4RESB 3MIWA 1SFCB 1JY2O 2IFNA 1FZCC 2QM7A 3IR9A 2WZ7A 2KSJA 1L0NK 1URQA 1HWTC 1MV8A 3TK1A 3HE5B 1N73B 3TYYA 2OYIB 4GKGA 1JY2N 3V2NA 3HTKB 2HODB 3BRTB 1FJPA 2MJZA 1GW3A 2CPBA 3U1CA 1GL2C 1VDFA 3NTNA 2KOGA 3N4XA 3VN0A 3P32A 2A45G 5AW4B 1S9KE 3UIAA 1HGZA 2OYHC 4W80A 2XU6A 1JTHB 2WSCH 2HPCA 4W7ZA 1FZCB 1JY3O 4W7YA 5KJ7A 1S9KD 5AVVB 1HBWA 3MD0A 1M1JC 1QL2A 1KILD 2NPSC 5AW8B 1JY3N 4OH8B 1FAVA 3KPEA 4N3YB 1GU5A 1LT9C 1GL2B 1FJKA 3MTUE 1OWAA 3HD7A 2YMYA 5CCGD 2FYUK 2HFED 2W27A 1LTJA 2IFMA 3B5NC 3A7OA 2OYHB 1NO4A 5AVUB 1J1DC 4N78E 3OAKA 1KQLA 2W6BA 1JY2P 2PAJA 4AUWA 4N78D 1M1JB 1NTZK 5APYA 3A5TA 2NPSB 2O01H 3T97A 1RE4A 1T8ZA 2IPPA 1GK6A 1LT9B 1WT6A 2M3BA 2WPQA 1KILA 2XKMA 5AW3B 3B5NB 2N1TC 1J1DB 1NHLA 3GHGA 1CSBA 3M91A 3VYIA 5BU8B 4C7NA 1T2KC 1XTGB 5AVSB 5AW5B 5CCGA 1L4AD 5AVYB 2P2UA 2E43A 2C0WA 3M0DA 5AVTB 2LKMA 1IFJA 1LTSC 1SQBK 4WY4C 1LTBC 2N9BA 1FU1A 1KFMA 5AVXB 3V2PA 5KLVK 5CCHC 2N1TB 3RK2C 2FFDA 4C7RA 2KP8A 1FDMA 1T3UA 2Q3IA 2P1JA 3CL3D 2YO3A 2HLOA 2Z5HA 1GDTA 1URQC 1HGVA 1PFIA 2GM4A 1AQ5A 4IFDK 2IX7C 4IFMA 4LC1A 3RL0D 5KJ7D 2WPRA 2Q7CA 1IFNA 4ZKPA 1VPCA 4WY4B 2A45I 1FBMA 1G1JA 1N7LA 2P67A 3KYQA 1L4AA 2KYVA 2H7HA 1RE3A 3M0AA 4B86A 3RK2B 5CJ4A 3BVHA 3P7KA 3P8MC 1NKNA 4GIFA 3TNUA 4JYBA 2R5DA 3VP8A 3HD7D 4C46A 5KJ7C 3U1AA 5AVRB 1CW5A 1URQB 2WSEH 3A2AA 3V5BA 3HE4A 5AW2B 1LTGC 3R2PA 3HE5A 3M9HA 2XZRA 2C0XA 3HRNA 4JYCA 2YNYA 3HUSA 4I1LA 1LTJC 3VP9A 2HYNA 3MGNA 4I2LC 3L36A 1N86A 2W6AA 2WPSA 3IFMA 2P7JA 1FZBA 1FZAA 3BASA 5APXA 1RE4C 1KZUB 1WRGA 1NU1K 2J59M 3BATA 1SP4A 2R5BA 1IK9A 4O9BA 3H32A 1LWUA 2FYZA 1N7SD 1KILC 1GW4A 2JJLA 1LTJB 2R32A 1JCDA 1HJBA 2BASA 3GHGC 3B8EB 3CLQA 2H43A 3L4FA 2L5GB 5CHXA 5AW7B 4GT1A 5KTBA 1DH3A 5CCGC 4ZKUA 3L37A 5APTA 1DX7A 3M0DC 2WTYA 1NKZB 1J1EC 2Q9IA 1E5WA 1MFZA 1KILB 1J2JB 2J58A 3G3ZA 2PP6A 1YTZT 3NFQA 3RK3D 3GHGB 2FFDC 5AW6B 1Z56A 3SWYA 4C7NB 2Z5IA 1N7SA 1NTMK 2HG5D 5AW0B 5AVZB 2KLVA 1MZ9A 2KB7P 1H89A 3OA7A 1J1EB 2O1JA 4LLHA 1GU4A 2WT7A 1RF1A 1L4AC 5APSA 1FOSE 2OARA 1RE3C 2XNXA 1SQPK 2FFDB 3WMM0 1G2CA 4WBAA 1RF0A 1N2DC 1LGHB 5AW9B 1A02J 5APWA 3C9IA 1IJDB 2VRSA 4EIJA 3V2RA 2YKQA 2I1KA 1FZFA 5AW1B 3U59A 4AQRD 5APVA 1NOHA 3EQ2A 1SQVK 3OJAB 1JUNA 1JMMA 4Y99C 1QL1A 1CI6A 1L4AB 4HH2A 2WWWA 3P8CE 1IFMA 3HUSC 3RL0C 3BRVB 3P8CD 1GZLA 3V2QA 1LTIC 1YYCA 1A02F 2CPSA 2WSFH 2XV5A 2QM8A 1SFCA 4JF7A 1RY3A 1HH0A 1GL2D 1YTZI 1X8YA 1LTTC 4HYTB 3MUDA 1N73A 2Z4EA 3HE4B 3CI9A 2OYIA 4XA4A 1IFIA 3KDPB 3HD7C 4Y99B 3HTKA 2HODA 1LWUC 1IO4A 1GK4A 1IFDA 2HPCB 3I5CA 4AYCA 2XDJA 3HUSB 3O8ZA 3A3YB 3RL0B 1SQQK 1H8AA 1SLQA 3II6A 3SWFA 2M8RA 2NPSD 4LGDE 2GUSA 2Q5UA 1JTHA 1ZN5A 3EFGA 2YKOA 1HTLC 1FZCA 1HUCA 1FOSF 3M06A 1X79B 1GTWA 1HVVA 4EOTA 3HD7B 3B5ND 3H32B 1LWUB 3PP5A 3H6PA 3VMYA 1ZLLA 1GL2A 1XTCC 1NTKK 1JO5A 2O1KA 2OYHA 2YKPA 1SVFA 1MUUA 1N7SC 2C9LY 1FZEA 2ZFCA 3NMDA 2YO2A 1IC2A 3LW5H 4N6JA 1M1JA 5AVQB 3E1IA 2NPSA 2N1TD 4M3LA 2ZXEB 1ZV8A 2FKWB 3V4WA 1NH4A 1ZR2A 2FXMA 1KFNA 4DOJA 1T2KD 1LT9A 1RF1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6M C;  1FAV A;  5APU A;  5AW9 B;  1A02 J;  1GU5 A;  3A2A A;  3VTP C;  5APW A;  3V5B A;  2VRS A;  3VMX A;  4KHX A;  3HE4 A;  4XE5 B;  1OWA A;  5AW2 B;  1H88 A;  1OXZ A;  2W27 A;  5AW1 B;  3HE5 A;  5APV A;  4AQR D;  3LID A;  3A7O A;  3M9H A;  5AVU B;  2XZR A;  4DZO A;  3OAK A;  5APQ A;  1JUN A;  4JYC A;  1KQL A;  2YNY A;  3V4Q A;  4AUW A;  1CI6 A;  2WWW A;  3MGN A;  4I2L C;  1JNM A;  3L36 A;  3KQG A;  5APY A;  3A5T A;  2W6A A;  2WPS A;  2C9N Y;  2P7J A;  2WT7 B;  3T97 A;  1GZL A;  1NAF A;  1YYC A;  1A02 F;  2R3C A;  2IPP A;  1GK6 A;  2XV5 A;  1G2C B;  3L35 A;  2WPQ A;  5AVW B;  5APX A;  2E42 A;  2QM8 A;  3VMZ A;  1SP4 A;  1CZQ A;  2R5B A;  5AW3 B;  3LIE A;  1X8Y A;  4HYT B;  1GD2 E;  3HE4 B;  5CMZ A;  1CSB A;  3KDP B;  3M91 A;  3VYI A;  2JJL A;  4C7N A;  1T2K C;  3HTK A;  1IO4 A;  1GK4 A;  2R32 A;  3M9B A;  1HJB A;  2BAS A;  5AVS B;  3B8E B;  3I5C A;  5AW5 B;  4AYC A;  5AVY B;  3O8Z A;  2P2U A;  3A3Y B;  3TNU B;  1CI6 B;  1H8A A;  2E43 A;  1SLQ A;  3M0D A;  5AW7 B;  3SWF A;  5AVT B;  4GT1 A;  1DH3 A;  3L37 A;  2Q5U A;  5APT A;  1HUC A;  2N9B A;  2WTY A;  3M06 A;  1NWQ A;  1FOS F;  5AVX B;  1GTW A;  3NXS A;  4RES B;  4EOT A;  1MFZ A;  2QM7 A;  2KP8 A;  1J2J B;  3IR9 A;  2Q3I A;  1HWT C;  3NFQ A;  1MV8 A;  3TK1 A;  3HE5 B;  3TYY A;  3VMY A;  4GKG A;  2YO3 A;  5AW6 B;  2Z5H A;  4C7N B;  2Z5I A;  5AW0 B;  5AVZ B;  4LC1 A;  2WPR A;  2Q7C A;  3NTN A;  3VN0 A;  1MUU A;  2C9L Y;  1H89 A;  3P32 A;  2ZFC A;  3NMD A;  2P67 A;  2YO2 A;  5AW4 B;  1S9K E;  3UIA A;  2XU6 A;  2H7H A;  3M0A A;  4B86 A;  5AVQ B;  3P7K A;  3P8M C;  3TNU A;  1S9K D;  1GU4 A;  2WT7 A;  5APS A;  5AVV B;  1FOS E;  3MD0 A;  4M3L A;  3V4W A;  2ZXE B;  1HBW A;  4JYB A;  2R5D A;  4C46 A;  1T2K D;  5AW8 B;  5AVR B; 
#chains in the Genus database with same CATH topology
 3A0B H;  3L71 G;  2KS1 A;  2Y0C A;  2ZVO B;  3H1K J;  2B87 A;  4H13 D;  4H44 D;  4WY4 D;  3H1H J;  2E5T A;  3CCQ P;  1JY3 P;  2YXQ B;  3RK2 D;  1SFC D;  3CX5 E;  3RBZ A;  5CJ0 A;  1RF1 B;  1YIT P;  3AEC C;  2LXC B;  1FZG A;  1URQ D;  3F89 A;  3L35 A;  5CBO A;  2E42 A;  3VMZ A;  3W67 A;  2Y9Z A;  4JBZ A;  5KAI H;  3FGA D;  2BCC J;  3AE8 C;  3G6E P;  4DCK A;  4PD4 I;  1VF5 D;  1K05 A;  4IFF A;  2R3S A;  4XFJ A;  3TNU B;  1WMK A;  2A06 E;  2NZ2 A;  2A45 H;  2G3A A;  5CCH A;  3TSI A;  3H1J D;  3NXS A;  4RES B;  2WSE J;  1JY2 O;  1FZC C;  3C8V A;  3IR9 A;  2ZVN B;  1HWT C;  3TYY A;  1S72 P;  1BDD A;  1JY2 N;  3H25 A;  3H1L D;  2WSC J;  4K35 A;  2CPB A;  3S9O A;  3UIA A;  2XU6 A;  4W7Z A;  2FYU J;  1FZC B;  1S9K D;  5KJ7 A;  5GTI E;  5AVV B;  1KIL D;  3WU2 H;  2W6J H;  1FAV A;  4N3Y B;  2QEX P;  3EWK A;  1LT9 C;  3L71 J;  5CCG D;  3A7O A;  3GF7 A;  1RH5 B;  1OFC X;  1BE3 E;  2K9J A;  1OVR A;  1GK6 A;  1LT9 B;  2KS1 B;  1YJW P;  1SQB J;  3I56 P;  2KUB A;  3M91 A;  5KLV J;  5BU8 B;  3CMA P;  1T2K C;  4R4L A;  4L74 A;  3M0D A;  5AVT B;  2K1A A;  1IFJ A;  1FU1 A;  1OVU A;  5CCH C;  2G8Y A;  2Q3I A;  3L72 D;  1BCC G;  2Z5H A;  2BEZ F;  1GDT A;  3O6Q A;  1KB9 H;  2IBZ I;  2KIK A;  4LC1 A;  1JEK A;  1VPC A;  1L4A A;  2KZJ A;  2KYV A;  3AE7 C;  1RE3 A;  4D6T J;  3G9R A;  1NKN A;  4OGQ C;  2YMK A;  2ZYG A;  3MZW B;  2R5D A;  1R5L A;  3H1L E;  5KJ7 C;  5AVR B;  2WSE H;  3TGU E;  5B5E E;  3HE4 A;  5AW2 B;  3CWB G;  2XZR A;  1SQX E;  4PJ0 H;  4OGQ B;  1OIP A;  2HYN A;  3L36 A;  2WPS A;  1FZB A;  3WUV A;  4U3F G;  1FZA A;  5APX A;  2QRX A;  1KZU B;  3BAT A;  2R5B A;  3SWK A;  5TJH A;  2FYZ A;  4WVZ A;  1BCC D;  2P10 A;  3CLQ A;  2K9J B;  3S4R A;  5E79 H;  1U7J A;  2L5G B;  3IN6 A;  1DH3 A;  1PIX A;  1NTM J;  3M0D C;  4GDO A;  1ZRT E;  1J1E C;  3FWL A;  2Q9I A;  3WUU A;  2V4H A;  3G3Z A;  2PP6 A;  3CD6 P;  1NYH A;  1KYO D;  3AE6 C;  5AW6 B;  1N7S A;  1OMI A;  1L0N E;  3CXH H;  3CWB D;  1VQK P;  1YI2 P;  3CCR P;  1J1E B;  3D71 A;  4LLH A;  1JM0 A;  4YXD C;  3L72 E;  1L4A C;  1SQV J;  1RE3 C;  3BCC E;  1M1K Q;  1KQF B;  5AW9 B;  1JB0 J;  1IJD B;  2VRS A;  3O6Q B;  2I1K A;  4L76 A;  1JMM A;  1EZV E;  4Y99 C;  1L4A B;  3F5H A;  1NU1 D;  3P8C D;  5CBN A;  1LTI C;  1YYC A;  1A02 F;  1PP9 D;  1IZN B;  1SQQ J;  2XV5 A;  3E7K A;  3CCM P;  3CCE P;  3R4Y A;  1NTZ D;  4U3F J;  2Z4E A;  3HE4 B;  3L70 J;  3KDP B;  3HD7 C;  4Y99 B;  3HTK A;  2B9B A;  3GF3 A;  2QJP C;  5KAF E;  1H8A A;  2M8R A;  4GOD A;  1PGQ A;  1NTK J;  2YKO A;  1YJ9 P;  3CME P;  1X79 B;  3Q5P A;  1EXI A;  3HD7 B;  1M57 D;  1QX8 A;  2QJP B;  2CK3 H;  2HR3 A;  3PJS K;  1X0T A;  2O1K A;  1N7S C;  2C9L Y;  1FZE A;  2YO2 A;  1M1J A;  3C1L A;  3E1I A;  3L73 G;  4NPD A;  4M3L A;  1KYO E;  1T2K D;  1VQ6 P;  1JOC A;  5APU A;  1JCC A;  5EFW B;  3B5N A;  1VQM P;  3VMX A;  4KHX A;  3KXD A;  3KZI E;  4UB6 H;  1N7S B;  2H8P D;  3D6Y A;  1YQ3 C;  3LID A;  5GTH H;  1S5L H;  1LNQ A;  5CCH D;  1JNM A;  3GW6 A;  5KLI C;  3AEF C;  3VOP A;  2KNC A;  4L73 A;  2R3C A;  4GOF A;  3CX5 D;  1KB9 I;  3L74 D;  4WB4 A;  2N1T A;  2POH A;  1K73 Q;  1NJI Q;  3CC2 P;  2JO1 A;  5CMZ A;  5B66 H;  1NU1 E;  3M9B A;  3A0H E;  4OGQ D;  1PP9 E;  5KLI B;  1BE3 G;  2I1J A;  2A06 D;  3MIW A;  1AV1 A;  2QM7 A;  1BGY E;  3HE5 B;  1M90 Q;  3V2N A;  3HTK B;  5H2F E;  1FJP A;  2OQQ A;  3NTN A;  2IDB A;  3N4X A;  3VN0 A;  1Y47 A;  3P32 A;  2B88 A;  4W80 A;  3CCL P;  1AQT A;  1H0T A;  1PZQ A;  1S5L X;  1M1J C;  1ZME C;  1YJN P;  3L73 J;  1MFT A;  4OH8 B;  1RQV A;  1FJK A;  1SQP E;  1OWA A;  2YMY A;  2NRG A;  2HFE D;  3B5N C;  5AVU B;  1J1D C;  1OVV A;  2QSI A;  2PAJ A;  4AUW A;  1FC2 C;  1OW6 A;  1M1J B;  1NTZ K;  1BE3 D;  1GMJ A;  3H1H D;  1RE4 A;  4KT0 J;  2JWA A;  1WT6 A;  2WPQ A;  3H1L G;  3CXH I;  2XKM A;  5AW3 B;  1Q86 Q;  3B5N B;  2N1T C;  1J1D B;  1S4X A;  3VYI A;  1XTG B;  5AVS B;  2BCC D;  1L4A D;  1SQX G;  3L74 E;  2R44 A;  4H0L D;  1LTS C;  2KNC B;  2OTK E;  1PGJ A;  1KFM A;  4DJG A;  2N1T B;  1OW8 A;  3CL3 D;  1LP1 B;  3L75 E;  1DEE G;  2HLO A;  2ZT9 C;  1PFI A;  2GM4 A;  1AQ5 A;  4L75 A;  2PGD A;  3GLM A;  4NPE A;  1OX3 A;  2P67 A;  1N7L A;  1U7M A;  2H7H A;  4B86 A;  3IF4 A;  1M8O B;  2W90 A;  3BVH A;  4GIF A;  1KQS O;  3VP8 A;  3HD7 D;  2WVR A;  1Q81 Q;  2RN0 A;  2ZT9 B;  2FYU D;  2O3J A;  3CC4 P;  1PV3 A;  1S3J A;  4EYY Q;  3CCJ P;  3TGU D;  1LTG C;  3R2P A;  4PV1 C;  3M9H A;  1L0N G;  4YPC A;  2ZXX A;  2C0X A;  4I1L A;  1SQX D;  1H0T B;  1L0L E;  3H1J J;  3RBX A;  3H1I E;  3Q1M A;  3L72 G;  2FY8 A;  1RE4 C;  1WRG A;  4IOI H;  2J59 M;  3PLN A;  1IK9 A;  2RH0 A;  3H32 A;  3H1K E;  1N7S D;  1UIX A;  2JJL A;  3SFE C;  2R32 A;  3H1H E;  2BAS A;  3MHV A;  1VQO P;  2H43 A;  4BRY A;  5CHX A;  1EZV G;  4GT1 A;  5KKZ C;  1USD A;  2J5U A;  1M56 D;  2H88 C;  4OWF A;  2AEM A;  4R4M A;  2B87 B;  1ZRT D;  2J58 A;  5M1B A;  4HB1 A;  1KD1 Q;  2BCC E;  3AE1 C;  5GTI H;  4NPF X;  5KKZ B;  1T6A A;  3IAO A;  1L0N D;  1R8E A;  1FDI A;  1FOS E;  1PPJ E;  3E1R A;  2OAR A;  1G2C A;  4WBA A;  1RF0 A;  3BCC D;  4A7P A;  4D6T D;  1A02 J;  5APW A;  1KC8 Q;  1FE6 A;  1IFP A;  2E5Y A;  3JSV C;  4AQR D;  2M0B A;  1W2B O;  4Y28 J;  1ZP0 C;  2QG4 A;  1VQ9 P;  2JWD A;  2FYU E;  1IFM A;  1QEX A;  1EZV D;  2B89 A;  3RL0 C;  3V2Q A;  4HJG H;  3Q5S A;  2I8D A;  3SSU A;  1SFC A;  3V6I A;  4JF7 A;  1RY3 A;  4OVN F;  4EI2 A;  1N73 A;  2QJY C;  2OYI A;  3L71 E;  4BWN A;  5DJU B;  2HOD A;  5E79 E;  1IO4 A;  1GK4 A;  1P84 E;  2JP3 A;  3A3Y B;  3RL0 B;  5TIS H;  3II6 A;  4RJT A;  3CPW O;  2Q5U A;  1ZN5 A;  3EFG A;  1FOS F;  3M06 A;  2KK7 A;  1HVV A;  1U57 A;  2QJY B;  3B5N D;  3H32 B;  1SQB E;  3PP5 A;  3H6P A;  1EDI A;  3VMY A;  5KLV E;  3B4S A;  1XTC C;  1DD4 A;  1NU1 G;  3ABV C;  2OYH A;  2YKP A;  4BRY B;  1SVF A;  4KJM A;  5B5E H;  1PP9 G;  1IC2 A;  2D2C C;  5AVQ B;  2NPS A;  1NTZ G;  2N1T D;  2FXM A;  3AE9 C;  2M5A A;  3K5B A;  1BGY G;  1SQX K;  2WIT A;  1RF0 C;  4PD4 E;  1BCC J;  2KSE A;  5BU5 A;  1OXZ A;  2D2C B;  1DEB A;  4DZO A;  3RK3 C;  5APQ A;  1W5C E;  3V4Q A;  1HF9 A;  2ZJS E;  2QJK C;  1S2E A;  1AFO A;  3KQG A;  4D6T E;  2FXP A;  1EC5 A;  1KOR A;  3M9Q A;  2ZT9 D;  4RO0 A;  2JEE A;  1G2C B;  5AVW B;  3FWN A;  4UB8 H;  1CZQ A;  1GD2 E;  3SFD C;  2KLU A;  1OW7 A;  1SFC C;  3RK3 B;  3N7N A;  4BXL A;  1N73 C;  1SS1 A;  3CWB J;  4EDF A;  1ZR4 A;  2OYI C;  1EQ7 A;  1Q2N A;  2KXP B;  4ASW A;  1UII A;  1QGK B;  1W2E A;  1T3J A;  4IL6 E;  3QH9 A;  1SFC B;  2WZ7 A;  1NTK D;  1L0N K;  2AXT H;  1MV8 A;  1N73 B;  2OYI B;  1BGY D;  2HOD B;  3WUT A;  1GW3 A;  3U1C A;  1VDF A;  4ZNC A;  2A45 G;  3JCU E;  3L74 G;  5AW4 B;  1NTM E;  2OYH C;  2HPC A;  1K8A Q;  1JY3 O;  1PP9 J;  2NPS C;  1JY3 N;  1NTZ J;  3AEB C;  1GU5 A;  2WSS H;  1LTJ A;  2IFM A;  2OYH B;  1SQP D;  2A06 G;  2JR8 A;  4N78 E;  1KQL A;  5C39 A;  3A5T A;  2NPS B;  2WQY C;  3T97 A;  1SQV E;  1VQ7 P;  1T8Z A;  5KAF H;  2M5A B;  3FXE A;  2M3B A;  2YXR B;  2YIU C;  5K5G B;  4I7Z C;  3GHG A;  2IBZ E;  2K9Y A;  5AW5 B;  2P2U A;  2E43 A;  2C0W A;  2N9B A;  1L0L G;  2P58 A;  1SQQ E;  2YIU B;  3H1I G;  3V2P A;  3GMA A;  3ITK A;  4I7Z B;  2KP8 A;  1FDM A;  1T3U A;  4U3F E;  2P1J A;  1Y9B A;  3L70 E;  1KYO H;  1HGV A;  3L75 D;  4IFD K;  4IFM A;  3RL0 D;  2AEJ A;  5KJ7 D;  3H1H G;  2Q7C A;  1IFN A;  4ZKP A;  3KZI H;  3M0A A;  1NTK E;  3FXD A;  5CJ4 A;  1RQU A;  3TNU A;  3AE2 C;  2E75 C;  4JYB A;  3U1A A;  1CW5 A;  3KHU A;  3A2A A;  2SPZ A;  2BCC G;  4TLF A;  1FDO A;  1HJ0 A;  2RKL A;  3AED C;  3HRN A;  2YNY A;  1USE A;  1LTJ C;  3PH0 A;  3QWO C;  3VP9 A;  2E75 B;  4I2L C;  1N86 A;  2W6A A;  3A0B E;  1PPJ G;  1L0L D;  3H1I D;  3USS A;  3JC2 2;  1NU1 K;  1SP4 A;  1LWU A;  2XND H;  1GW4 A;  1KV4 A;  3H1K D;  1LTJ B;  1JCD A;  3GHG C;  2W83 C;  4K3A A;  3L4F A;  1NAY A;  5KTB A;  4TT3 H;  1RHZ B;  2GA1 A;  4ZKU A;  2FYU G;  3L37 A;  5H2F H;  5KAI E;  2ZYD A;  1DX7 A;  2WTY A;  1NKZ B;  2Q3E A;  2FBW C;  1Q82 Q;  2KI7 B;  3TGU G;  1MFZ A;  3GG2 A;  1J2J B;  3B71 A;  3RK3 D;  3GHG B;  3SWY A;  1KB9 D;  2MKV A;  5AVZ B;  3OW2 O;  1MZ9 A;  2ZYA A;  1H89 A;  1BE3 J;  3OA7 A;  2Y0D A;  4WWI A;  1VQ5 P;  2O1J A;  2ITA A;  2WT7 A;  2AXC A;  1SQP K;  1VQP P;  1PPJ D;  1LGH B;  1YBK A;  3C9I A;  1SQB G;  3Q5R A;  4EIJ A;  5KLV G;  3V2R A;  2YKQ A;  5AW1 B;  3U59 A;  5APV A;  1NOH A;  3EQ2 A;  3OJA B;  1N8R Q;  1CI6 A;  1FS0 E;  3WU2 E;  1BSH A;  2DW3 A;  2K3R A;  3BRV B;  1GZL A;  2CPS A;  2WSF H;  3CX5 H;  3L73 E;  3TDK A;  3W68 A;  3G4S P;  1HH0 A;  1LJ2 A;  1X8Y A;  1LTT C;  3MUD A;  3EFF K;  3CI9 A;  4XA4 A;  1IFI A;  3FX0 A;  1LWU C;  3L71 D;  1IFD A;  4AYC A;  2XDJ A;  3O8Z A;  1P84 D;  1EZV I;  2NPS D;  3RGU A;  2GUS A;  3BCC G;  1JTH A;  4D6T G;  1HTL C;  1HUC A;  1GTW A;  1YQ4 C;  4EOT A;  4PV1 B;  2Q6Q A;  1AVO A;  3H1L J;  1VQN P;  1LWU B;  3TGU J;  1ZLL A;  1GL2 A;  1SQB D;  1Q90 D;  1ZXG A;  5KLV D;  1JO5 A;  3CXH D;  1SQX J;  3LW5 H;  4N6J A;  2O01 J;  1IK7 A;  1K04 A;  3RK3 E;  1Q7Y Q;  2OGU A;  3V4W A;  2ZXE B;  1ZV8 A;  2FKW B;  2E74 C;  1KB9 E;  1ZR2 A;  1KFN A;  4DOJ A;  4I6M C;  1G1I A;  3VTP C;  4ZMD A;  2PFX A;  2Y0E A;  3D70 A;  1QVF O;  4XE5 B;  1H88 A;  3VMA A;  4PD4 D;  1L0L K;  4Z1M H;  2E74 B;  1BSN A;  2LR2 A;  1NTM G;  2C9N Y;  2WT7 B;  1NAF A;  1L2P A;  1KYO I;  4PJ0 E;  3LIE A;  1X9V A;  1VQL P;  1KTM A;  2GUV A;  5BVZ A;  2KZI A;  5TIS E;  3MUD C;  1L0N J;  2E75 D;  3PTZ A;  1CI6 B;  1LTA C;  4WY4 A;  2K37 A;  3TF5 A;  3H1J E;  1NWQ A;  1SQV G;  1M7L A;  3L72 J;  3BCC J;  1DIP A;  2IFN A;  1BDC A;  2KSJ A;  2IZ0 A;  1URQ A;  3TK1 A;  4GKG A;  3BRT B;  3PHL A;  2JKV A;  2BEQ D;  2MJZ A;  2IBZ G;  1K9M Q;  2FXO A;  1GL2 C;  1X22 A;  1AA0 A;  2KOG A;  2O01 N;  2E76 C;  1YIJ P;  1S9K E;  1HGZ A;  1PL5 A;  1VL2 A;  1JTH B;  2WSC H;  1KIL E;  1JMB A;  4W7Y A;  1NTM D;  4MN4 C;  1HBW A;  3MD0 A;  1SQQ G;  5L8R J;  1QL2 A;  3AEG C;  5AW8 B;  3CXH E;  3KPE A;  3L70 G;  1GL2 B;  3MTU E;  3HD7 A;  2V7Q J;  2E76 B;  2FYU K;  2W27 A;  1NO4 A;  2Y9Y A;  2Q1K A;  3OAK A;  2L91 A;  2W6B A;  1JY2 P;  4N78 D;  5APY A;  2IZ1 A;  1NTK G;  2O01 H;  1P84 H;  1S1C X;  4UB8 E;  2IPP A;  1SQV D;  2WMM A;  3Q3D A;  1VQ4 P;  1KIL A;  2QVA A;  3CC7 P;  1NHL A;  1CSB A;  4C7N A;  4GOE A;  1D7M A;  5CCG A;  5AVY B;  2IBZ D;  3MP7 B;  4H13 C;  5DJT B;  2LKM A;  2FYN C;  4H44 C;  1SQB K;  4WY4 C;  4YXW H;  1NVO A;  1LTB C;  5AVX B;  5KLV K;  2AXT E;  3RK2 C;  1SQQ D;  2FFD A;  4C7R A;  4JQ0 D;  3CCV P;  1SQP G;  3ZDM A;  4RKU J;  2QJK B;  4U3F D;  2QE7 H;  2YO3 A;  3RL0 g;  1URQ C;  4H0L C;  3L70 D;  4H13 B;  4QMA A;  4DT0 A;  2PRR A;  2IX7 C;  3Q2Y A;  2WPR A;  2FYN B;  3I55 P;  4H44 B;  4WY4 B;  3CX5 I;  2A45 I;  2M3E A;  1FBM A;  1G1J A;  3KYQ A;  1VF5 C;  4PD4 H;  1NGM B;  3RK2 B;  3P7K A;  3P8M C;  4PV1 D;  1EDL A;  4C46 A;  1URQ B;  4H0L B;  3V5B A;  2OTJ P;  4CPG A;  1VF5 B;  3HE5 A;  1NU1 J;  2IYP A;  1YHQ P;  4JYC A;  3HUS A;  3MGN A;  3IFM A;  2P7J A;  2JDI H;  2N9Y B;  4UB6 E;  4JPZ B;  3BAS A;  3L75 G;  5GTH E;  1BGY J;  1S5L E;  4O9B A;  1BCC E;  1KIL C;  4IL6 H;  1KQG B;  1HJB A;  2V7Q H;  3B8E B;  2E74 D;  2OYO A;  5AW7 B;  5CCG C;  3AE5 C;  1AJY A;  5APT A;  5B66 E;  1E5W A;  1EXJ A;  3JCU H;  1KIL B;  1QLE D;  1YTZ T;  3NFQ A;  1AVY A;  2AEF A;  1MKM A;  2FFD C;  2K88 A;  1Z56 A;  4C7N B;  1LT1 A;  2Z5I A;  1NTM K;  1SQP J;  2HG5 D;  3CWB E;  5AW0 B;  2KLV A;  1KN7 A;  2UWJ E;  2KB7 P;  3AEE C;  1TU3 F;  1GU4 A;  1RF1 A;  5APS A;  1ZW0 A;  2XNX A;  2FFD B;  2H89 C;  3H1K G;  3WMM 0;  1N2D C;  4U7J A;  1OZH A;  3CCS P;  1FZF A;  2LXB A;  1LP1 A;  1SQV K;  1JUN A;  1QL1 A;  2QIW A;  4IL6 X;  2WSF J;  4HH2 A;  2WWW A;  3P8C E;  3L74 J;  4YTP C;  2ZAE B;  1VQ8 P;  3HUS C;  2WPV B;  1PGP A;  2IYO A;  1NTZ E;  2QM8 A;  3L73 D;  1GL2 D;  1YTZ I;  3PRJ A;  4HYT B;  3L75 J;  2E76 D;  3AE3 C;  1EDJ A;  2HPC B;  3I5C A;  3HUS B;  1SQQ K;  3G71 P;  1SLQ A;  1Y8A A;  2OTL P;  3SWF A;  3A0H H;  4LGD E;  3AE4 C;  1KMI Z;  4HKZ H;  1FZC A;  3CCU P;  1ZOY C;  1QVG O;  1E79 H;  3AEA C;  1R5S A;  2D2C D;  2QA4 P;  3S1K A;  3LW5 J;  1NTK K;  1P84 I;  1EDK A;  1PGO A;  3D6Z A;  1MUU A;  3T97 B;  2RMZ A;  2ZFC A;  3NMD A;  1DD3 A;  3H1J G;  2W8Z A;  1L0L J;  1NH4 A;  3H1I J;  4ASV A;  1LT9 A;  1RF1 C; 
#chains in the Genus database with same CATH homology
 4I6M C;  1JOC A;  5APU A;  1JCC A;  1G1I A;  3VTP C;  1SQX K;  3B5N A;  2WIT A;  3VMX A;  4KHX A;  1RF0 C;  4XE5 B;  1N7S B;  2H8P D;  5BU5 A;  1H88 A;  1OXZ A;  3LID A;  1DEB A;  4DZO A;  1L0L K;  4WY4 D;  3RK3 C;  5APQ A;  3V4Q A;  1JY3 P;  5CCH D;  3RK2 D;  1JNM A;  1AFO A;  3KQG A;  1SFC D;  2C9N Y;  2WT7 B;  5CJ0 A;  1RF1 B;  1NAF A;  3VOP A;  2R3C A;  3M9Q A;  1FZG A;  1URQ D;  2JEE A;  1G2C B;  3L35 A;  4WB4 A;  5AVW B;  2N1T A;  2E42 A;  3VMZ A;  2POH A;  1CZQ A;  3LIE A;  1GD2 E;  1X9V A;  1SFC C;  3RK3 B;  3N7N A;  5CMZ A;  2GUV A;  5BVZ A;  1N73 C;  4IFF A;  3M9B A;  1ZR4 A;  2OYI C;  3TNU B;  1CI6 B;  1EQ7 A;  1LTA C;  2I1J A;  4WY4 A;  2A45 H;  5CCH A;  1W2E A;  1T3J A;  1NWQ A;  3TSI A;  1M7L A;  3NXS A;  4RES B;  3MIW A;  1SFC B;  1JY2 O;  2IFN A;  1FZC C;  2QM7 A;  3IR9 A;  2WZ7 A;  2KSJ A;  1L0N K;  1URQ A;  1HWT C;  1MV8 A;  3TK1 A;  3HE5 B;  1N73 B;  3TYY A;  2OYI B;  4GKG A;  1JY2 N;  3V2N A;  3HTK B;  2HOD B;  3BRT B;  1FJP A;  2MJZ A;  1GW3 A;  2CPB A;  3U1C A;  1GL2 C;  1VDF A;  3NTN A;  2KOG A;  3N4X A;  3VN0 A;  3P32 A;  2A45 G;  5AW4 B;  1S9K E;  3UIA A;  1HGZ A;  2OYH C;  4W80 A;  2XU6 A;  1JTH B;  2WSC H;  2HPC A;  4W7Z A;  1FZC B;  1JY3 O;  4W7Y A;  5KJ7 A;  1S9K D;  5AVV B;  1HBW A;  3MD0 A;  1M1J C;  1QL2 A;  1KIL D;  2NPS C;  5AW8 B;  1JY3 N;  4OH8 B;  1FAV A;  3KPE A;  4N3Y B;  1GU5 A;  1LT9 C;  1GL2 B;  1FJK A;  3MTU E;  1OWA A;  3HD7 A;  2YMY A;  5CCG D;  2FYU K;  2HFE D;  2W27 A;  1LTJ A;  2IFM A;  3B5N C;  3A7O A;  2OYH B;  1NO4 A;  5AVU B;  1J1D C;  4N78 E;  3OAK A;  1KQL A;  2W6B A;  1JY2 P;  2PAJ A;  4AUW A;  4N78 D;  1M1J B;  1NTZ K;  5APY A;  3A5T A;  2NPS B;  2O01 H;  3T97 A;  1RE4 A;  1T8Z A;  2IPP A;  1GK6 A;  1LT9 B;  1WT6 A;  2M3B A;  2WPQ A;  1KIL A;  2XKM A;  5AW3 B;  3B5N B;  2N1T C;  1J1D B;  1NHL A;  3GHG A;  1CSB A;  3M91 A;  3VYI A;  5BU8 B;  4C7N A;  1T2K C;  1XTG B;  5AVS B;  5AW5 B;  5CCG A;  1L4A D;  5AVY B;  2P2U A;  2E43 A;  2C0W A;  3M0D A;  5AVT B;  2LKM A;  1IFJ A;  1LTS C;  1SQB K;  4WY4 C;  1LTB C;  2N9B A;  1FU1 A;  1KFM A;  5AVX B;  3V2P A;  5KLV K;  5CCH C;  2N1T B;  3RK2 C;  2FFD A;  4C7R A;  2KP8 A;  1FDM A;  1T3U A;  2Q3I A;  2P1J A;  3CL3 D;  2YO3 A;  2HLO A;  2Z5H A;  1GDT A;  1URQ C;  1HGV A;  1PFI A;  2GM4 A;  1AQ5 A;  4IFD K;  2IX7 C;  4IFM A;  4LC1 A;  3RL0 D;  5KJ7 D;  2WPR A;  2Q7C A;  1IFN A;  4ZKP A;  1VPC A;  4WY4 B;  2A45 I;  1FBM A;  1G1J A;  1N7L A;  2P67 A;  3KYQ A;  1L4A A;  2KYV A;  2H7H A;  1RE3 A;  3M0A A;  4B86 A;  3RK2 B;  5CJ4 A;  3BVH A;  3P7K A;  3P8M C;  1NKN A;  4GIF A;  3TNU A;  4JYB A;  2R5D A;  3VP8 A;  3HD7 D;  4C46 A;  5KJ7 C;  3U1A A;  5AVR B;  1CW5 A;  1URQ B;  2WSE H;  3A2A A;  3V5B A;  3HE4 A;  5AW2 B;  1LTG C;  3R2P A;  3HE5 A;  3M9H A;  2XZR A;  2C0X A;  3HRN A;  4JYC A;  2YNY A;  3HUS A;  4I1L A;  1LTJ C;  3VP9 A;  2HYN A;  3MGN A;  4I2L C;  3L36 A;  1N86 A;  2W6A A;  2WPS A;  3IFM A;  2P7J A;  1FZB A;  1FZA A;  3BAS A;  5APX A;  1RE4 C;  1KZU B;  1WRG A;  1NU1 K;  2J59 M;  3BAT A;  1SP4 A;  2R5B A;  1IK9 A;  4O9B A;  3H32 A;  1LWU A;  2FYZ A;  1N7S D;  1KIL C;  1GW4 A;  2JJL A;  1LTJ B;  2R32 A;  1JCD A;  1HJB A;  2BAS A;  3GHG C;  3B8E B;  3CLQ A;  2H43 A;  3L4F A;  2L5G B;  5CHX A;  5AW7 B;  4GT1 A;  5KTB A;  1DH3 A;  5CCG C;  4ZKU A;  3L37 A;  5APT A;  1DX7 A;  3M0D C;  2WTY A;  1NKZ B;  1J1E C;  2Q9I A;  1E5W A;  1MFZ A;  1KIL B;  1J2J B;  2J58 A;  3G3Z A;  2PP6 A;  1YTZ T;  3NFQ A;  3RK3 D;  3GHG B;  2FFD C;  5AW6 B;  1Z56 A;  3SWY A;  4C7N B;  2Z5I A;  1N7S A;  1NTM K;  2HG5 D;  5AW0 B;  5AVZ B;  2KLV A;  1MZ9 A;  2KB7 P;  1H89 A;  3OA7 A;  1J1E B;  2O1J A;  4LLH A;  1GU4 A;  2WT7 A;  1RF1 A;  1L4A C;  5APS A;  1FOS E;  2OAR A;  1RE3 C;  2XNX A;  1SQP K;  2FFD B;  3WMM 0;  1G2C A;  4WBA A;  1RF0 A;  1N2D C;  1LGH B;  5AW9 B;  1A02 J;  5APW A;  3C9I A;  1IJD B;  2VRS A;  4EIJ A;  3V2R A;  2YKQ A;  2I1K A;  1FZF A;  5AW1 B;  3U59 A;  4AQR D;  5APV A;  1NOH A;  3EQ2 A;  1SQV K;  3OJA B;  1JUN A;  1JMM A;  4Y99 C;  1QL1 A;  1CI6 A;  1L4A B;  4HH2 A;  2WWW A;  3P8C E;  1IFM A;  3HUS C;  3RL0 C;  3BRV B;  3P8C D;  1GZL A;  3V2Q A;  1LTI C;  1YYC A;  1A02 F;  2CPS A;  2WSF H;  2XV5 A;  2QM8 A;  1SFC A;  4JF7 A;  1RY3 A;  1HH0 A;  1GL2 D;  1YTZ I;  1X8Y A;  1LTT C;  4HYT B;  3MUD A;  1N73 A;  2Z4E A;  3HE4 B;  3CI9 A;  2OYI A;  4XA4 A;  1IFI A;  3KDP B;  3HD7 C;  4Y99 B;  3HTK A;  2HOD A;  1LWU C;  1IO4 A;  1GK4 A;  1IFD A;  2HPC B;  3I5C A;  4AYC A;  2XDJ A;  3HUS B;  3O8Z A;  3A3Y B;  3RL0 B;  1SQQ K;  1H8A A;  1SLQ A;  3II6 A;  3SWF A;  2M8R A;  2NPS D;  4LGD E;  2GUS A;  2Q5U A;  1JTH A;  1ZN5 A;  3EFG A;  2YKO A;  1HTL C;  1FZC A;  1HUC A;  1FOS F;  3M06 A;  1X79 B;  1GTW A;  1HVV A;  4EOT A;  3HD7 B;  3B5N D;  3H32 B;  1LWU B;  3PP5 A;  3H6P A;  3VMY A;  1ZLL A;  1GL2 A;  1XTC C;  1NTK K;  1JO5 A;  2O1K A;  2OYH A;  2YKP A;  1SVF A;  1MUU A;  1N7S C;  2C9L Y;  1FZE A;  2ZFC A;  3NMD A;  2YO2 A;  1IC2 A;  3LW5 H;  4N6J A;  1M1J A;  5AVQ B;  3E1I A;  2NPS A;  2N1T D;  4M3L A;  2ZXE B;  1ZV8 A;  2FKW B;  3V4W A;  1NH4 A;  1ZR2 A;  2FXM A;  1KFN A;  4DOJ A;  1T2K D;  1LT9 A;  1RF1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...