3QWOC

Crystal structure of a motavizumab epitope-scaffold bound to motavizumab fab
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
53
structure length
53
Chain Sequence
SYNDEKKLASNEIANLPNLNEEQRSAFLSSINDDPSQSANLLAEAKKLNDAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords motavizumab light chain
publication title Design and characterization of epitope-scaffold immunogens that present the motavizumab epitope from respiratory syncytial virus.
pubmed doi rcsb
source organism Mus musculus
total genus 22
structure length 53
sequence length 53
chains with identical sequence P
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3qwoC00
1S3JA 2KUBA 2KZJA 4ASWA 2KS1B 4WWIA 3RGUA 5CBOA 1LP1B 1SS1A 1LP1A 4K3AA 2Q1KA 2I8DA 5CBNA 4BXLA 1X0TA 4CPGA 1JMBA 1NVOA 4ASVA 5EFWB 2WMMA 2M5AB 4MN4C 2M5AA 2ZAEB 2KZIA 1EDKA 4HJGH 1EC5A 3S1KA 2K3RA 1U7MA 4NPDA 3MZWB 2SPZA 1BDCA 2B88A 2P58A 3FXEA 1EDIA 2UWJE 4NPEA 1Q2NA 2KI7B 2LXCB 1EDLA 4ZMDA 3QWOC 4GODA 1MFTA 2JWDA 4EYYQ 3MHVA 4IOIH 4GOEA 1OVUA 1ZXGA 1LT1A 1OVRA 4JBZA 1DEEG 2B89A 4HB1A 1Y47A 1H0TA 5K5GB 2LXBA 2QRXA 1FC2C 4K35A 1BDDA 1JM0A 3ZDMA 2QVAA 4NPFX 1EDJA 5C39A 2RKLA 3FXDA 5DJTB 2LR2A 4ZNCA 2OTKE 4KJMA 3PH0A 2R44A 1H0TB 1ZW0A 4HKZH 1OVVA 2B87B 1U7JA 2B87A 2HR3A 2M0BA 4GOFA 2KIKA 5DJUB
chains in the Genus database with same CATH superfamily
2DW3A 1IFNA 5AW0B 3L71D 3CWBJ 3AE9C 3B71A 3BCCJ 4I7ZC 3CMAP 3BVHA 1RF0A 1LTTC 2A45G 1KQFB 1VQLP 3CXHI 1EZVE 4IL6H 2K3RA 3LW5J 4NPDA 1VPCA 1NWQA 1M90Q 1IK7A 2C0WA 2AEMA 3CC7P 2NPSA 3QWOC 4EYYQ 5KAIE 4C7NA 1Q7YQ 1WMKA 5APVA 1MUUA 3L71E 4Y99B 1OW8A 1FC2C 4Y28J 5B66H 1NTMD 4C7NB 1FZEA 3WMM0 2QJKB 1L4AB 1JEKA 2OYIB 2C0XA 3A0BH 4PD4H 2Z4EA 1NTZJ 2OTKE 3HUSA 1L0ND 3W67A 3AE2C 3PJSK 2BASA 2QE7H 1KD1Q 1PGPA 2I1KA 1MZ9A 2IBZD 3JC22 3KQGA 1M1JC 2E5TA 2R5DA 1X9VA 2WITA 2WPRA 3G9RA 2E76B 3B8EB 3HUSB 2ZAEB 2XKMA 1J1EC 1KQGB 2E5YA 1NTME 4U3FG 3M06A 3P32A 2B88A 3E1RA 2UWJE 2LXCB 1QVGO 2A45I 3AE6C 3MGNA 2IYOA 3MHVA 1N73B 5APQA 3M0DC 4D6TG 4IFMA 1T3JA 3L74G 2KSEA 1SQPD 3BRTB 1USEA 1YJ9P 1NTKG 2IBZE 2YNYA 3H32A 3WUTA 3KZIH 3L73E 5H2FH 3CCUP 3A7OA 1S5LX 3Q2YA 2HPCB 3CPWO 3KHUA 1LTAC 3CCSP 3LIEA 2LR2A 1NO4A 1WRGA 3CCVP 1KILE 3A0HH 4IL6E 1S9KD 2KLUA 4GOFA 2WTYA 1OZHA 1JY2O 3FGAD 2XNDH 3CMEP 1NAFA 1WT6A 5AVUB 2WSEJ 1BE3G 2AXTH 3V2NA 3JCUH 3O6QA 1KN7A 2E74C 2HG5D 2D2CD 1NTKK 2GUSA 4DJGA 2QJYB 2RH0A 2W6AA 1PP9D 1SQPE 1JY3P 3L70D 1RE3A 3VP8A 2KP8A 1K04A 1FZFA 1NJIQ 1G1IA 1P84D 2WSFJ 3V2QA 1LJ2A 3O6QB 1DD4A 1N8RQ 5B66E 1YI2P 2D2CC 2WPVB 3RK2B 1T3UA 3VMYA 3ITKA 1GL2A 1S9KE 1ZXGA 2G8YA 2P10A 2W8ZA 1S5LH 1H0TA 1BCCJ 2IPPA 2QRXA 4K35A 1Y9BA 2M3BA 5AW3B 2Z5HA 5M1BA 2W6JH 5C39A 2PGDA 1PP9E 2IYPA 1GL2B 3M0DA 4TLFA 3Q3DA 1XTGB 3VMAA 3L70E 4JYCA 1JNMA 3GLMA 1KILA 2R44A 1P84E 1IJDB 1H0TB 1GU5A 3CCLP 2Y0EA 2FYUD 1NTMJ 3GMAA 4RKUJ 1NH4A 1USDA 1LTIC 1N86A 1RHZB 2K9JA 4HYTB 5B5EE 3FWNA 1SP4A 1LT9C 1KILB 1JOCA 2OARA 1X0TA 1L0NJ 1RH5B 3CWBG 4PD4I 2FFDA 1ZLLA 1N2DC 3IR9A 3QH9A 3L75G 3R4YA 1NU1D 3VMZA 1EDKA 1U7MA 2K9JB 1FE6A 5KKZB 2KNCA 3I55P 4AUWA 1ZMEC 1JY3N 3KZIE 5H2FE 1FU1A 5AVVB 2FFDB 1NKZB 1YTZT 5CCGA 2FYUE 1DX7A 2OYHC 3AE5C 3PRJA 1AVYA 1W5CE 4GIFA 3CL3D 1KQLA 2YXQB 3A0HE 3CCMP 1BDDA 1NKNA 3VN0A 1JM0A 2JR8A 1PGOA 2QG4A 4L75A 4TT3H 1JCDA 1FDIA 2OYOA 2AXTE 3U1AA 3JCUE 1VQNP 3AE1C 1IFDA 1SQPJ 2P2UA 3AE4C 1L0LD 2B87A 2A06G 3HRNA 2FYZA 3AEBC 3EWKA 1KORA 4PJ0E 1AA0A 2Q3EA 1OMIA 1D7MA 3L72D 1QEXA 5CBOA 2WPSA 4DT0A 1FDMA 2LKMA 1BGYD 3HTKB 1KB9I 2FXOA 2I8DA 1RF0C 3CX5I 3H1JD 3GG2A 3F5HA 1QL1A 3CXHD 3D6YA 1L4AD 2M5AA 2ZXXA 5GTHE 3PTZA 3RL0B 2FYNB 1PIXA 3ABVC 3TNUA 1FAVA 4YXWH 3AEAC 2L5GB 3WUVA 5KLIB 3B4SA 4Y99C 1EXIA 2JP3A 1X22A 2WZ7A 1PP9J 1IFJA 2RMZA 3IFMA 3C1LA 1L0LE 4JYBA 1LTSC 1ZOYC 2HYNA 1L4AC 1GZLA 3TGUD 1DEBA 2GA1A 2OYIC 1KYOI 3SSUA 4HB1A 4YXDC 1TU3F 1Z56A 2E76D 3L72E 2XZRA 3S9OA 3UIAA 1AQ5A 3H1JE 1KV4A 1VQOP 2H7HA 3CXHE 2HLOA 1IZNB 2KOGA 1N7LA 3H1KD 1JTHA 3H1LD 2K9YA 4EOTA 2KIKA 5BU8B 2E76C 3D71A 1H8AA 3HUSC 2YMKA 4R4LA 1FZBA 3CCRP 1SS1A 4W7YA 3MD0A 3VOPA 3TGUE 2FYUJ 1JTHB 2OGUA 1FDOA 4YTPC 2BCCD 3S1KA 1PGQA 3IAOA 5AVXB 1LTJA 1A02J 3H1KE 2Y9ZA 2JWDA 1NU1J 1LWUA 3H1LE 1YBKA 1SQQG 1VL2A 2KK7A 4QMAA 1LTJB 3C8VA 4GT1A 3AEFC 4RO0A 2BEZF 3ZDMA 1X79B 2QVAA 1LWUB 5APTA 1L4AA 1BCCG 2E75B 2OYIA 2BCCE 3WUUA 3P8CD 3HD7D 3CCEP 3RK2D 2N1TA 2QJYC 1QGKB 1CW5A 1SQVJ 1MKMA 1S3JA 3V6IA 3VP9A 2N9BA 2O01H 1SQQK 2YXRB 2QEXP 5AVWB 1L0LJ 2P7JA 3RK3B 5AW1B 2N1TB 3I56P 3K5BA 1JMBA 4L74A 1GL2D 3E7KA 2KXPB 2PP6A 1VDFA 1RE3C 3L72J 1BSHA 1BGYJ 3CLQA 3H1JJ 3M9QA 1L0NG 4ZMDA 1RE4A 3L73D 3P8CE 1S1CX 2WPQA 2IBZG 1YITP 3H1IG 1N73A 3RL0g 1GL2C 1OW7A 3VTPC 1KILD 1Q86Q 2O01N 2H43A 4RESB 4ZKUA 2B89A 4UB6H 4H0LB 3V5BA 3U1CA 3BATA 4U3FD 2M8RA 1EDJA 2HPCA 1YHQP 3TGUJ 2C9NY 1KC8Q 4ZNCA 5BU5A 1L0NK 4KJMA 1Y8AA 4D6TD 2I1JA 1KILC 1S4XA 1U7JA 3OA7A 3L74D 3V2RA 3FX0A 3TF5A 1NTKD 1KB9H 1VQ7P 3CX5H 4ZKPA 4W7ZA 3T97B 2Z5IA 5AVTB 3BASA 1AFOA 1LP1B 3H1KJ 5KKZC 4BXLA 1VQ5P 1YJNP 3H1LJ 2H89C 4JPZB 5CCGD 1T6AA 2WQYC 4PD4D 2FFDC 3GF7A 4U3FE 1G2CB 3USSA 3A5TA 1BDCA 3SFDC 3AECC 2YKQA 1BE3D 5AVRB 3MUDA 3CCQP 3HD7A 4OGQB 2BCCJ 4D6TE 1KYOH 3L71J 1FBMA 3L74E 4GDOA 1QLED 5CCGC 2Q7CA 1NTKE 2ZJSE 2W27A 1SQXG 1G1JA 2BEQD 3MIWA 2LXBA 5KAFH 3RL0D 3A2AA 3HD7B 2YKOA 2CPSA 5KLVG 3R2PA 1BSNA 2RKLA 2XDJA 1QL2A 1FOSE 3A0BE 4PD4E 1VQ9P 2KLVA 4WB4A 2FBWC 1SQBD 1OFCX 4HKZH 4L73A 3H1HG 1AVOA 1BE3E 3P8MC 3RL0C 2FYNC 1SQXK 4UB8H 1M1JB 1H89A 2GM4A 3TYYA 3M0AA 5AW5B 1K73Q 1KB9D 1M1KQ 2R5BA 5KLIC 1CI6A 2JKVA 2V4HA 1OXZA 3SFEC 5KLVK 5EFWB 1Q82Q 4LC1A 4KHXA 1M57D 2ZYGA 2W90A 2C9LY 1HH0A 5KJ7D 1T2KD 4UB6E 5AVZB 1HGVA 4LGDE 3G6EP 1HBWA 1EDIA 3F89A 3RBXA 1DD3A 2MKVA 1CI6B 1HF9A 1SQBE 3S4RA 3BCCG 4IOIH 4M3LA 2WT7B 3M9BA 1HTLC 1LT1A 3CWBD 1FOSF 3L75D 3CC4P 1NYHA 1NU1G 3L73J 5KJ7C 1T2KC 1JO5A 1KB9E 3CX5E 5AVQB 1E5WA 1HUCA 2KS1A 3M9HA 4AQRD 3MP7B 1S2EA 2Y0CA 4KT0J 2AEJA 1ZV8A 3E1IA 4XFJA 4U3FJ 4I1LA 2M0BA 3MTUE 1JY2P 2KS1B 1XTCC 1GDTA 3Q5PA 2AXCA 4K3AA 1NU1K 3HTKA 4D6TJ 1YYCA 3B5NA 3CWBE 5AW6B 1SQVG 3L75E 2QJPB 3L74J 3N7NA 1KYOE 2IFNA 1NTKJ 4MN4C 2E75D 3GHGA 1NTZG 1EC5A 1QX8A 2POHA 2WWWA 2XU6A 5KAFE 1ZR4A 5CHXA 4IFFA 3B5NB 1R5SA 2O01J 1LTBC 2V7QH 1LTJC 2WSEH 5CCHA 3SWKA 1URQB 2IX7C 1BGYG 3GHGB 3H1JG 4BRYB 2QA4P 1LWUC 2FKWB 1R8EA 3G3ZA 1IFMA 4OH8B 4WBAA 1OVRA 1S5LE 4EDFA 2E75C 1DEEG 3RK3D 1GK6A 2N1TD 1BE3J 1SQVK 2R3SA 3HE4A 2PAJA 1LGHB 5AW8B 2ZVOB 2PRRA 2WSFH 5AW7B 3L70J 1M56D 1NTZK 4UB8E 3Q5SA 2ZT9B 3WU2H 5APXA 2QJKC 4B86A 3O8ZA 4WY4D 2WSCH 3PH0A 5KJ7A 3U59A 5APWA 2W6BA 3HE4B 2HR3A 3RK3C 3TGUG 2N1TC 4EIJA 2OTJP 3M91A 4H0LD 1RQUA 3TSIA 2IFMA 2GUVA 1M7LA 1SQBJ 3JSVC 3L37A 1KQSO 3NXSA 1GMJA 1X8YA 1K8AQ 3RK3E 1JY2N 4IFDK 2KZIA 4EI2A 4N78E 1EZVG 1JUNA 1UIIA 1VQMP 2ZYDA 1PL5A 1J1DB 1VQKP 3VMXA 3CCJP 1FJPA 4H0LC 2JDIH 5AW9B 1EDLA 1RE4C 3SWFA 4R4MA 4GOEA 5GTIH 2OYHB 1PPJD 1N73C 3KPEA 1IO4A 1Y47A 2J58A 1OW6A 2XV5A 1W2BO 3PLNA 3L71G 2OTLP 2Q3IA 1SLQA 4BWNA 1HJBA 1GD2E 3L75J 2R3CA 4JF7A 1M8OB 2YKPA 1FJKA 4LLHA 4OGQD 3SWYA 1H88A 3W68A 1SQQD 2QM8A 4PV1B 4H44B 2L91A 4OVNF 1U57A 2ZVNB 1T8ZA 1N7SA 4O9BA 2IZ0A 2Q1KA 3L4FA 5TISH 2CPBA 2QSIA 1PPJE 1BCCD 1AV1A 3P7KA 1JY3O 3G71P 2WMMA 3OW2O 4OGQC 1VQ4P 1N7SB 1PFIA 1YIJP 3HE5A 1NTMG 1Q2NA 2KI7B 2Q5UA 4JQ0D 2QM7A 4WY4A 3KDPB 2NPSB 5APSA 4C7RA 3MUDC 3HD7C 4XE5B 3Q5RA 3RK2C 1SQQE 3WU2E 3LIDA 1HJ0A 1YTZI 5L8RJ 1FZCA 1OWAA 1VF5B 1EZVI 1SFCA 3HE5B 2YIUB 3OAKA 2YO3A 5AW4B 4WY4B 3BRVB 2O3JA 1RF1A 1BCCE 1PGJA 2HODA 2KYVA 2ITAA 2XNXA 3L73G 3VYIA 3H1ID 1FZCB 1NTMK 4H13B 1YQ4C 1SFCB 1OVVA 2Q6QA 1P84H 2B9BA 3AEDC 1IK9A 4I6MC 2OQQA 1RF1B 1FS0E 2KZJA 2HODB 1AQTA 4GKGA 3T97A 4WWIA 4OWFA 3RGUA 1LP1A 1HGZA 2ZXEB 5CBNA 2WSSH 2P67A 5B5EH 2G3AA 2KSJA 1YJWP 5GTIE 2Y0DA 5CJ0A 3NMDA 3CD6P 4I7ZB 1G2CA 1L0NE 1SQPG 1IC2A 5AW2B 1W2EA 1K05A 5KTBA 3NTNA 1E79H 3H1IE 4DCKA 2E74D 3AE3C 1NHLA 3AE7C 3AE8C 5TJHA 2JO1A 1UIXA 4A7PA 4Z1MH 5K5GB 3H32B 2AEFA 4HH2A 3TK1A 3NFQA 1SQPK 2V7QJ 1GW4A 1GTWA 3B5ND 3EFFK 5TISE 1PP9G 2M3EA 2VRSA 4N3YB 2QIWA 1URQD 3L70G 1VQ8P 1SQXD 2QJPC 3LW5H 2KB7P 2RN0A 3KXDA 3H25A 5DJUB 1ZN5A 3EFGA 4PJ0H 3L36A 3IN6A 4I2LC 5KLVD 1M1JA 2IBZI 5CCHD 2O1JA 1SQQJ 3B5NC 3II6A 1NVOA 2WSCJ 3GF3A 4XA4A 2ZT9D 3N4XA 1URQC 3D6ZA 1SQBG 4HJGH 5GTHH 3GHGC 3H1HD 2SPZA 2P58A 3Q1MA 4NPEA 1J2JB 3CX5D 4U7JA 1YQ3C 5CCHC 1OVUA 1SQXE 2WT7A 1J1EB 4DOJA 1LTGC 4JBZA 2W83C 2ZT9C 1KFNA 1NOHA 1JB0J 1GW3A 2FYUG 3IF4A 1L2PA 5KLVE 2IZ1A 2Y9YA 4RJTA 3A3YB 1SQBK 3I5CA 2N9YB 2MJZA 3CXHH 1Q90D 1DIPA 3AEGC 3BCCD 1FZAA 2JJLA 3H1HE 1KYOD 3H6PA 1ZW0A 1R5LA 4C46A 4ASWA 3GW6A 1NGMB 2J5UA 2JWAA 1JMMA 3H1IJ 1VQ6P 2FYUK 1K9MQ 2CK3H 5E79H 1RY3A 1J1DC 2FXMA 5APYA 1EXJA 4ASVA 2H88C 1IFIA 2JEEA 1P84I 5AVYB 2FY8A 2K88A 3RBZA 2E74B 4DZOA 2KNCB 4PV1D 4H44D 1CZQA 1LNQA 3BCCE 4GODA 5BVZA 1URQA 1GU4A 1S72P 1SQVD 4BRYA 2A06D 1NU1E 1L0LG 1RQVA 1AJYA 1NTZD 1VQPP 1JCCA 1ZR2A 1KZUB 4AYCA 3D70A 1IFPA 2D2CB 1KFMA 4NPFX 3L72G 1N7SD 4PV1C 4H44C 4N6JA 5KAIH 3L35A 5DJTB 3PP5A 1GK4A 2WVRA 2NPSD 2J59M 1FZGA 2K1AA 4W80A 5CMZA 3TDKA 2B87B 1HVVA 1PZQA 4N78D 3OJAB 2KUBA 3KYQA 1L0LK 1VF5D 2K37A 1SQVE 1N7SC 2A45H 2YO2A 5APUA 1LT9A 1MV8A 2O1KA 2HFED 4WVZA 1ZP0C 2A06E 1SQXJ 3CC2P 2R32A 4CPGA 1NTZE 2NPSC 2M5AB 3V4QA 2ZFCA 1DH3A 1SVFA 1ZRTD 2IDBA 2Q9IA 5KLVJ 4H13D 1A02F 3TNUB 1SFCD 5CJ4A 2YMYA 1QVFO 1KTMA 3MZWB 3CI9A 1LT9B 3FXEA 1VF5C 4IL6X 1BGYE 2YIUC 4WY4C 1MFTA 3FWLA 1KMIZ 5AVSB 3H1HJ 2OYHA 3H1KG 2E42A 3AEEC 4YPCA 1Q81Q 2P1JA 3H1LG 1OIPA 1EQ7A 1FZCC 2E43A 1EZVD 4H13C 3G4SP 1SFCC 2NZ2A 3C9IA 1NAYA 1HWTC 1RF1C 3EQ2A 5E79E 3FXDA 1PV3A 4L76A 3PHLA 2ZYAA 1ZRTE 2FXPA 3V4WA 1MFZA 2NRGA 2PFXA 1CSBA 1OX3A 2BCCG 2H8PD 1PPJG 3V2PA
chains in the Genus database with same CATH topology
1S3JA 2KUBA 2KZJA 4ASWA 2KS1B 4WWIA 3RGUA 5CBOA 1LP1B 1SS1A 1LP1A 4K3AA 2Q1KA 2I8DA 5CBNA 4BXLA 1X0TA 4CPGA 1JMBA 1NVOA 4ASVA 5EFWB 2WMMA 2M5AB 4MN4C 2M5AA 2ZAEB 2KZIA 1EDKA 4HJGH 1EC5A 3S1KA 2K3RA 1U7MA 4NPDA 3MZWB 2SPZA 1BDCA 2B88A 2P58A 3FXEA 1EDIA 2UWJE 4NPEA 1Q2NA 2KI7B 2LXCB 1EDLA 4ZMDA 3QWOC 4GODA 1MFTA 2JWDA 4EYYQ 3MHVA 4IOIH 4GOEA 1OVUA 1ZXGA 1LT1A 1OVRA 4JBZA 1DEEG 2B89A 4HB1A 1Y47A 1H0TA 5K5GB 2LXBA 2QRXA 1FC2C 4K35A 1BDDA 1JM0A 3ZDMA 2QVAA 4NPFX 1EDJA 5C39A 2RKLA 3FXDA 5DJTB 2LR2A 4ZNCA 2OTKE 4KJMA 3PH0A 2R44A 1H0TB 1ZW0A 4HKZH 1OVVA 2B87B 1U7JA 2B87A 2HR3A 2M0BA 4GOFA 2KIKA 5DJUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3J A;  2KUB A;  2KZJ A;  4ASW A;  2KS1 B;  4WWI A;  3RGU A;  5CBO A;  1LP1 B;  1SS1 A;  1LP1 A;  4K3A A;  2Q1K A;  2I8D A;  5CBN A;  4BXL A;  1X0T A;  4CPG A;  1JMB A;  1NVO A;  4ASV A;  5EFW B;  2WMM A;  2M5A B;  4MN4 C;  2M5A A;  2ZAE B;  2KZI A;  1EDK A;  4HJG H;  1EC5 A;  3S1K A;  2K3R A;  1U7M A;  4NPD A;  3MZW B;  2SPZ A;  1BDC A;  2B88 A;  2P58 A;  3FXE A;  1EDI A;  2UWJ E;  4NPE A;  1Q2N A;  2KI7 B;  2LXC B;  1EDL A;  4ZMD A;  3QWO C;  4GOD A;  1MFT A;  2JWD A;  4EYY Q;  3MHV A;  4IOI H;  4GOE A;  1OVU A;  1ZXG A;  1LT1 A;  1OVR A;  4JBZ A;  1DEE G;  2B89 A;  4HB1 A;  1Y47 A;  1H0T A;  5K5G B;  2LXB A;  2QRX A;  1FC2 C;  4K35 A;  1BDD A;  1JM0 A;  3ZDM A;  2QVA A;  4NPF X;  1EDJ A;  5C39 A;  2RKL A;  3FXD A;  5DJT B;  2LR2 A;  4ZNC A;  2OTK E;  4KJM A;  3PH0 A;  2R44 A;  1H0T B;  1ZW0 A;  4HKZ H;  1OVV A;  2B87 B;  1U7J A;  2B87 A;  2HR3 A;  2M0B A;  4GOF A;  2KIK A;  5DJU B; 
#chains in the Genus database with same CATH topology
 2DW3 A;  1IFN A;  5AW0 B;  3L71 D;  3CWB J;  3AE9 C;  3B71 A;  3BCC J;  4I7Z C;  3CMA P;  3BVH A;  1RF0 A;  1LTT C;  2A45 G;  1KQF B;  1VQL P;  3CXH I;  1EZV E;  4IL6 H;  2K3R A;  3LW5 J;  4NPD A;  1VPC A;  1NWQ A;  1M90 Q;  1IK7 A;  2C0W A;  2AEM A;  3CC7 P;  2NPS A;  3QWO C;  4EYY Q;  5KAI E;  4C7N A;  1Q7Y Q;  1WMK A;  5APV A;  1MUU A;  3L71 E;  4Y99 B;  1OW8 A;  1FC2 C;  4Y28 J;  5B66 H;  1NTM D;  4C7N B;  1FZE A;  3WMM 0;  2QJK B;  1L4A B;  1JEK A;  2OYI B;  2C0X A;  3A0B H;  4PD4 H;  2Z4E A;  1NTZ J;  2OTK E;  3HUS A;  1L0N D;  3W67 A;  3AE2 C;  3PJS K;  2BAS A;  2QE7 H;  1KD1 Q;  1PGP A;  2I1K A;  1MZ9 A;  2IBZ D;  3JC2 2;  3KQG A;  1M1J C;  2E5T A;  2R5D A;  1X9V A;  2WIT A;  2WPR A;  3G9R A;  2E76 B;  3B8E B;  3HUS B;  2ZAE B;  2XKM A;  1J1E C;  1KQG B;  2E5Y A;  1NTM E;  4U3F G;  3M06 A;  3P32 A;  2B88 A;  3E1R A;  2UWJ E;  2LXC B;  1QVG O;  2A45 I;  3AE6 C;  3MGN A;  2IYO A;  3MHV A;  1N73 B;  5APQ A;  3M0D C;  4D6T G;  4IFM A;  1T3J A;  3L74 G;  2KSE A;  1SQP D;  3BRT B;  1USE A;  1YJ9 P;  1NTK G;  2IBZ E;  2YNY A;  3H32 A;  3WUT A;  3KZI H;  3L73 E;  5H2F H;  3CCU P;  3A7O A;  1S5L X;  3Q2Y A;  2HPC B;  3CPW O;  3KHU A;  1LTA C;  3CCS P;  3LIE A;  2LR2 A;  1NO4 A;  1WRG A;  3CCV P;  1KIL E;  3A0H H;  4IL6 E;  1S9K D;  2KLU A;  4GOF A;  2WTY A;  1OZH A;  1JY2 O;  3FGA D;  2XND H;  3CME P;  1NAF A;  1WT6 A;  5AVU B;  2WSE J;  1BE3 G;  2AXT H;  3V2N A;  3JCU H;  3O6Q A;  1KN7 A;  2E74 C;  2HG5 D;  2D2C D;  1NTK K;  2GUS A;  4DJG A;  2QJY B;  2RH0 A;  2W6A A;  1PP9 D;  1SQP E;  1JY3 P;  3L70 D;  1RE3 A;  3VP8 A;  2KP8 A;  1K04 A;  1FZF A;  1NJI Q;  1G1I A;  1P84 D;  2WSF J;  3V2Q A;  1LJ2 A;  3O6Q B;  1DD4 A;  1N8R Q;  5B66 E;  1YI2 P;  2D2C C;  2WPV B;  3RK2 B;  1T3U A;  3VMY A;  3ITK A;  1GL2 A;  1S9K E;  1ZXG A;  2G8Y A;  2P10 A;  2W8Z A;  1S5L H;  1H0T A;  1BCC J;  2IPP A;  2QRX A;  4K35 A;  1Y9B A;  2M3B A;  5AW3 B;  2Z5H A;  5M1B A;  2W6J H;  5C39 A;  2PGD A;  1PP9 E;  2IYP A;  1GL2 B;  3M0D A;  4TLF A;  3Q3D A;  1XTG B;  3VMA A;  3L70 E;  4JYC A;  1JNM A;  3GLM A;  1KIL A;  2R44 A;  1P84 E;  1IJD B;  1H0T B;  1GU5 A;  3CCL P;  2Y0E A;  2FYU D;  1NTM J;  3GMA A;  4RKU J;  1NH4 A;  1USD A;  1LTI C;  1N86 A;  1RHZ B;  2K9J A;  4HYT B;  5B5E E;  3FWN A;  1SP4 A;  1LT9 C;  1KIL B;  1JOC A;  2OAR A;  1X0T A;  1L0N J;  1RH5 B;  3CWB G;  4PD4 I;  2FFD A;  1ZLL A;  1N2D C;  3IR9 A;  3QH9 A;  3L75 G;  3R4Y A;  1NU1 D;  3VMZ A;  1EDK A;  1U7M A;  2K9J B;  1FE6 A;  5KKZ B;  2KNC A;  3I55 P;  4AUW A;  1ZME C;  1JY3 N;  3KZI E;  5H2F E;  1FU1 A;  5AVV B;  2FFD B;  1NKZ B;  1YTZ T;  5CCG A;  2FYU E;  1DX7 A;  2OYH C;  3AE5 C;  3PRJ A;  1AVY A;  1W5C E;  4GIF A;  3CL3 D;  1KQL A;  2YXQ B;  3A0H E;  3CCM P;  1BDD A;  1NKN A;  3VN0 A;  1JM0 A;  2JR8 A;  1PGO A;  2QG4 A;  4L75 A;  4TT3 H;  1JCD A;  1FDI A;  2OYO A;  2AXT E;  3U1A A;  3JCU E;  1VQN P;  3AE1 C;  1IFD A;  1SQP J;  2P2U A;  3AE4 C;  1L0L D;  2B87 A;  2A06 G;  3HRN A;  2FYZ A;  3AEB C;  3EWK A;  1KOR A;  4PJ0 E;  1AA0 A;  2Q3E A;  1OMI A;  1D7M A;  3L72 D;  1QEX A;  5CBO A;  2WPS A;  4DT0 A;  1FDM A;  2LKM A;  1BGY D;  3HTK B;  1KB9 I;  2FXO A;  2I8D A;  1RF0 C;  3CX5 I;  3H1J D;  3GG2 A;  3F5H A;  1QL1 A;  3CXH D;  3D6Y A;  1L4A D;  2M5A A;  2ZXX A;  5GTH E;  3PTZ A;  3RL0 B;  2FYN B;  1PIX A;  3ABV C;  3TNU A;  1FAV A;  4YXW H;  3AEA C;  2L5G B;  3WUV A;  5KLI B;  3B4S A;  4Y99 C;  1EXI A;  2JP3 A;  1X22 A;  2WZ7 A;  1PP9 J;  1IFJ A;  2RMZ A;  3IFM A;  3C1L A;  1L0L E;  4JYB A;  1LTS C;  1ZOY C;  2HYN A;  1L4A C;  1GZL A;  3TGU D;  1DEB A;  2GA1 A;  2OYI C;  1KYO I;  3SSU A;  4HB1 A;  4YXD C;  1TU3 F;  1Z56 A;  2E76 D;  3L72 E;  2XZR A;  3S9O A;  3UIA A;  1AQ5 A;  3H1J E;  1KV4 A;  1VQO P;  2H7H A;  3CXH E;  2HLO A;  1IZN B;  2KOG A;  1N7L A;  3H1K D;  1JTH A;  3H1L D;  2K9Y A;  4EOT A;  2KIK A;  5BU8 B;  2E76 C;  3D71 A;  1H8A A;  3HUS C;  2YMK A;  4R4L A;  1FZB A;  3CCR P;  1SS1 A;  4W7Y A;  3MD0 A;  3VOP A;  3TGU E;  2FYU J;  1JTH B;  2OGU A;  1FDO A;  4YTP C;  2BCC D;  3S1K A;  1PGQ A;  3IAO A;  5AVX B;  1LTJ A;  1A02 J;  3H1K E;  2Y9Z A;  2JWD A;  1NU1 J;  1LWU A;  3H1L E;  1YBK A;  1SQQ G;  1VL2 A;  2KK7 A;  4QMA A;  1LTJ B;  3C8V A;  4GT1 A;  3AEF C;  4RO0 A;  2BEZ F;  3ZDM A;  1X79 B;  2QVA A;  1LWU B;  5APT A;  1L4A A;  1BCC G;  2E75 B;  2OYI A;  2BCC E;  3WUU A;  3P8C D;  3HD7 D;  3CCE P;  3RK2 D;  2N1T A;  2QJY C;  1QGK B;  1CW5 A;  1SQV J;  1MKM A;  1S3J A;  3V6I A;  3VP9 A;  2N9B A;  2O01 H;  1SQQ K;  2YXR B;  2QEX P;  5AVW B;  1L0L J;  2P7J A;  3RK3 B;  5AW1 B;  2N1T B;  3I56 P;  3K5B A;  1JMB A;  4L74 A;  1GL2 D;  3E7K A;  2KXP B;  2PP6 A;  1VDF A;  1RE3 C;  3L72 J;  1BSH A;  1BGY J;  3CLQ A;  3H1J J;  3M9Q A;  1L0N G;  4ZMD A;  1RE4 A;  3L73 D;  3P8C E;  1S1C X;  2WPQ A;  2IBZ G;  1YIT P;  3H1I G;  1N73 A;  3RL0 g;  1GL2 C;  1OW7 A;  3VTP C;  1KIL D;  1Q86 Q;  2O01 N;  2H43 A;  4RES B;  4ZKU A;  2B89 A;  4UB6 H;  4H0L B;  3V5B A;  3U1C A;  3BAT A;  4U3F D;  2M8R A;  1EDJ A;  2HPC A;  1YHQ P;  3TGU J;  2C9N Y;  1KC8 Q;  4ZNC A;  5BU5 A;  1L0N K;  4KJM A;  1Y8A A;  4D6T D;  2I1J A;  1KIL C;  1S4X A;  1U7J A;  3OA7 A;  3L74 D;  3V2R A;  3FX0 A;  3TF5 A;  1NTK D;  1KB9 H;  1VQ7 P;  3CX5 H;  4ZKP A;  4W7Z A;  3T97 B;  2Z5I A;  5AVT B;  3BAS A;  1AFO A;  1LP1 B;  3H1K J;  5KKZ C;  4BXL A;  1VQ5 P;  1YJN P;  3H1L J;  2H89 C;  4JPZ B;  5CCG D;  1T6A A;  2WQY C;  4PD4 D;  2FFD C;  3GF7 A;  4U3F E;  1G2C B;  3USS A;  3A5T A;  1BDC A;  3SFD C;  3AEC C;  2YKQ A;  1BE3 D;  5AVR B;  3MUD A;  3CCQ P;  3HD7 A;  4OGQ B;  2BCC J;  4D6T E;  1KYO H;  3L71 J;  1FBM A;  3L74 E;  4GDO A;  1QLE D;  5CCG C;  2Q7C A;  1NTK E;  2ZJS E;  2W27 A;  1SQX G;  1G1J A;  2BEQ D;  3MIW A;  2LXB A;  5KAF H;  3RL0 D;  3A2A A;  3HD7 B;  2YKO A;  2CPS A;  5KLV G;  3R2P A;  1BSN A;  2RKL A;  2XDJ A;  1QL2 A;  1FOS E;  3A0B E;  4PD4 E;  1VQ9 P;  2KLV A;  4WB4 A;  2FBW C;  1SQB D;  1OFC X;  4HKZ H;  4L73 A;  3H1H G;  1AVO A;  1BE3 E;  3P8M C;  3RL0 C;  2FYN C;  1SQX K;  4UB8 H;  1M1J B;  1H89 A;  2GM4 A;  3TYY A;  3M0A A;  5AW5 B;  1K73 Q;  1KB9 D;  1M1K Q;  2R5B A;  5KLI C;  1CI6 A;  2JKV A;  2V4H A;  1OXZ A;  3SFE C;  5KLV K;  5EFW B;  1Q82 Q;  4LC1 A;  4KHX A;  1M57 D;  2ZYG A;  2W90 A;  2C9L Y;  1HH0 A;  5KJ7 D;  1T2K D;  4UB6 E;  5AVZ B;  1HGV A;  4LGD E;  3G6E P;  1HBW A;  1EDI A;  3F89 A;  3RBX A;  1DD3 A;  2MKV A;  1CI6 B;  1HF9 A;  1SQB E;  3S4R A;  3BCC G;  4IOI H;  4M3L A;  2WT7 B;  3M9B A;  1HTL C;  1LT1 A;  3CWB D;  1FOS F;  3L75 D;  3CC4 P;  1NYH A;  1NU1 G;  3L73 J;  5KJ7 C;  1T2K C;  1JO5 A;  1KB9 E;  3CX5 E;  5AVQ B;  1E5W A;  1HUC A;  2KS1 A;  3M9H A;  4AQR D;  3MP7 B;  1S2E A;  2Y0C A;  4KT0 J;  2AEJ A;  1ZV8 A;  3E1I A;  4XFJ A;  4U3F J;  4I1L A;  2M0B A;  3MTU E;  1JY2 P;  2KS1 B;  1XTC C;  1GDT A;  3Q5P A;  2AXC A;  4K3A A;  1NU1 K;  3HTK A;  4D6T J;  1YYC A;  3B5N A;  3CWB E;  5AW6 B;  1SQV G;  3L75 E;  2QJP B;  3L74 J;  3N7N A;  1KYO E;  2IFN A;  1NTK J;  4MN4 C;  2E75 D;  3GHG A;  1NTZ G;  1EC5 A;  1QX8 A;  2POH A;  2WWW A;  2XU6 A;  5KAF E;  1ZR4 A;  5CHX A;  4IFF A;  3B5N B;  1R5S A;  2O01 J;  1LTB C;  2V7Q H;  1LTJ C;  2WSE H;  5CCH A;  3SWK A;  1URQ B;  2IX7 C;  1BGY G;  3GHG B;  3H1J G;  4BRY B;  2QA4 P;  1LWU C;  2FKW B;  1R8E A;  3G3Z A;  1IFM A;  4OH8 B;  4WBA A;  1OVR A;  1S5L E;  4EDF A;  2E75 C;  1DEE G;  3RK3 D;  1GK6 A;  2N1T D;  1BE3 J;  1SQV K;  2R3S A;  3HE4 A;  2PAJ A;  1LGH B;  5AW8 B;  2ZVO B;  2PRR A;  2WSF H;  5AW7 B;  3L70 J;  1M56 D;  1NTZ K;  4UB8 E;  3Q5S A;  2ZT9 B;  3WU2 H;  5APX A;  2QJK C;  4B86 A;  3O8Z A;  4WY4 D;  2WSC H;  3PH0 A;  5KJ7 A;  3U59 A;  5APW A;  2W6B A;  3HE4 B;  2HR3 A;  3RK3 C;  3TGU G;  2N1T C;  4EIJ A;  2OTJ P;  3M91 A;  4H0L D;  1RQU A;  3TSI A;  2IFM A;  2GUV A;  1M7L A;  1SQB J;  3JSV C;  3L37 A;  1KQS O;  3NXS A;  1GMJ A;  1X8Y A;  1K8A Q;  3RK3 E;  1JY2 N;  4IFD K;  2KZI A;  4EI2 A;  4N78 E;  1EZV G;  1JUN A;  1UII A;  1VQM P;  2ZYD A;  1PL5 A;  1J1D B;  1VQK P;  3VMX A;  3CCJ P;  1FJP A;  4H0L C;  2JDI H;  5AW9 B;  1EDL A;  1RE4 C;  3SWF A;  4R4M A;  4GOE A;  5GTI H;  2OYH B;  1PPJ D;  1N73 C;  3KPE A;  1IO4 A;  1Y47 A;  2J58 A;  1OW6 A;  2XV5 A;  1W2B O;  3PLN A;  3L71 G;  2OTL P;  2Q3I A;  1SLQ A;  4BWN A;  1HJB A;  1GD2 E;  3L75 J;  2R3C A;  4JF7 A;  1M8O B;  2YKP A;  1FJK A;  4LLH A;  4OGQ D;  3SWY A;  1H88 A;  3W68 A;  1SQQ D;  2QM8 A;  4PV1 B;  4H44 B;  2L91 A;  4OVN F;  1U57 A;  2ZVN B;  1T8Z A;  1N7S A;  4O9B A;  2IZ0 A;  2Q1K A;  3L4F A;  5TIS H;  2CPB A;  2QSI A;  1PPJ E;  1BCC D;  1AV1 A;  3P7K A;  1JY3 O;  3G71 P;  2WMM A;  3OW2 O;  4OGQ C;  1VQ4 P;  1N7S B;  1PFI A;  1YIJ P;  3HE5 A;  1NTM G;  1Q2N A;  2KI7 B;  2Q5U A;  4JQ0 D;  2QM7 A;  4WY4 A;  3KDP B;  2NPS B;  5APS A;  4C7R A;  3MUD C;  3HD7 C;  4XE5 B;  3Q5R A;  3RK2 C;  1SQQ E;  3WU2 E;  3LID A;  1HJ0 A;  1YTZ I;  5L8R J;  1FZC A;  1OWA A;  1VF5 B;  1EZV I;  1SFC A;  3HE5 B;  2YIU B;  3OAK A;  2YO3 A;  5AW4 B;  4WY4 B;  3BRV B;  2O3J A;  1RF1 A;  1BCC E;  1PGJ A;  2HOD A;  2KYV A;  2ITA A;  2XNX A;  3L73 G;  3VYI A;  3H1I D;  1FZC B;  1NTM K;  4H13 B;  1YQ4 C;  1SFC B;  1OVV A;  2Q6Q A;  1P84 H;  2B9B A;  3AED C;  1IK9 A;  4I6M C;  2OQQ A;  1RF1 B;  1FS0 E;  2KZJ A;  2HOD B;  1AQT A;  4GKG A;  3T97 A;  4WWI A;  4OWF A;  3RGU A;  1LP1 A;  1HGZ A;  2ZXE B;  5CBN A;  2WSS H;  2P67 A;  5B5E H;  2G3A A;  2KSJ A;  1YJW P;  5GTI E;  2Y0D A;  5CJ0 A;  3NMD A;  3CD6 P;  4I7Z B;  1G2C A;  1L0N E;  1SQP G;  1IC2 A;  5AW2 B;  1W2E A;  1K05 A;  5KTB A;  3NTN A;  1E79 H;  3H1I E;  4DCK A;  2E74 D;  3AE3 C;  1NHL A;  3AE7 C;  3AE8 C;  5TJH A;  2JO1 A;  1UIX A;  4A7P A;  4Z1M H;  5K5G B;  3H32 B;  2AEF A;  4HH2 A;  3TK1 A;  3NFQ A;  1SQP K;  2V7Q J;  1GW4 A;  1GTW A;  3B5N D;  3EFF K;  5TIS E;  1PP9 G;  2M3E A;  2VRS A;  4N3Y B;  2QIW A;  1URQ D;  3L70 G;  1VQ8 P;  1SQX D;  2QJP C;  3LW5 H;  2KB7 P;  2RN0 A;  3KXD A;  3H25 A;  5DJU B;  1ZN5 A;  3EFG A;  4PJ0 H;  3L36 A;  3IN6 A;  4I2L C;  5KLV D;  1M1J A;  2IBZ I;  5CCH D;  2O1J A;  1SQQ J;  3B5N C;  3II6 A;  1NVO A;  2WSC J;  3GF3 A;  4XA4 A;  2ZT9 D;  3N4X A;  1URQ C;  3D6Z A;  1SQB G;  4HJG H;  5GTH H;  3GHG C;  3H1H D;  2SPZ A;  2P58 A;  3Q1M A;  4NPE A;  1J2J B;  3CX5 D;  4U7J A;  1YQ3 C;  5CCH C;  1OVU A;  1SQX E;  2WT7 A;  1J1E B;  4DOJ A;  1LTG C;  4JBZ A;  2W83 C;  2ZT9 C;  1KFN A;  1NOH A;  1JB0 J;  1GW3 A;  2FYU G;  3IF4 A;  1L2P A;  5KLV E;  2IZ1 A;  2Y9Y A;  4RJT A;  3A3Y B;  1SQB K;  3I5C A;  2N9Y B;  2MJZ A;  3CXH H;  1Q90 D;  1DIP A;  3AEG C;  3BCC D;  1FZA A;  2JJL A;  3H1H E;  1KYO D;  3H6P A;  1ZW0 A;  1R5L A;  4C46 A;  4ASW A;  3GW6 A;  1NGM B;  2J5U A;  2JWA A;  1JMM A;  3H1I J;  1VQ6 P;  2FYU K;  1K9M Q;  2CK3 H;  5E79 H;  1RY3 A;  1J1D C;  2FXM A;  5APY A;  1EXJ A;  4ASV A;  2H88 C;  1IFI A;  2JEE A;  1P84 I;  5AVY B;  2FY8 A;  2K88 A;  3RBZ A;  2E74 B;  4DZO A;  2KNC B;  4PV1 D;  4H44 D;  1CZQ A;  1LNQ A;  3BCC E;  4GOD A;  5BVZ A;  1URQ A;  1GU4 A;  1S72 P;  1SQV D;  4BRY A;  2A06 D;  1NU1 E;  1L0L G;  1RQV A;  1AJY A;  1NTZ D;  1VQP P;  1JCC A;  1ZR2 A;  1KZU B;  4AYC A;  3D70 A;  1IFP A;  2D2C B;  1KFM A;  4NPF X;  3L72 G;  1N7S D;  4PV1 C;  4H44 C;  4N6J A;  5KAI H;  3L35 A;  5DJT B;  3PP5 A;  1GK4 A;  2WVR A;  2NPS D;  2J59 M;  1FZG A;  2K1A A;  4W80 A;  5CMZ A;  3TDK A;  2B87 B;  1HVV A;  1PZQ A;  4N78 D;  3OJA B;  2KUB A;  3KYQ A;  1L0L K;  1VF5 D;  2K37 A;  1SQV E;  1N7S C;  2A45 H;  2YO2 A;  5APU A;  1LT9 A;  1MV8 A;  2O1K A;  2HFE D;  4WVZ A;  1ZP0 C;  2A06 E;  1SQX J;  3CC2 P;  2R32 A;  4CPG A;  1NTZ E;  2NPS C;  2M5A B;  3V4Q A;  2ZFC A;  1DH3 A;  1SVF A;  1ZRT D;  2IDB A;  2Q9I A;  5KLV J;  4H13 D;  1A02 F;  3TNU B;  1SFC D;  5CJ4 A;  2YMY A;  1QVF O;  1KTM A;  3MZW B;  3CI9 A;  1LT9 B;  3FXE A;  1VF5 C;  4IL6 X;  1BGY E;  2YIU C;  4WY4 C;  1MFT A;  3FWL A;  1KMI Z;  5AVS B;  3H1H J;  2OYH A;  3H1K G;  2E42 A;  3AEE C;  4YPC A;  1Q81 Q;  2P1J A;  3H1L G;  1OIP A;  1EQ7 A;  1FZC C;  2E43 A;  1EZV D;  4H13 C;  3G4S P;  1SFC C;  2NZ2 A;  3C9I A;  1NAY A;  1HWT C;  1RF1 C;  3EQ2 A;  5E79 E;  3FXD A;  1PV3 A;  4L76 A;  3PHL A;  2ZYA A;  1ZRT E;  2FXP A;  3V4W A;  1MFZ A;  2NRG A;  2PFX A;  1CSB A;  1OX3 A;  2BCC G;  2H8P D;  1PPJ G;  3V2P A; 
#chains in the Genus database with same CATH homology
 1S3J A;  2KUB A;  2KZJ A;  4ASW A;  2KS1 B;  4WWI A;  3RGU A;  5CBO A;  1LP1 B;  1SS1 A;  1LP1 A;  4K3A A;  2Q1K A;  2I8D A;  5CBN A;  4BXL A;  1X0T A;  4CPG A;  1JMB A;  1NVO A;  4ASV A;  5EFW B;  2WMM A;  2M5A B;  4MN4 C;  2M5A A;  2ZAE B;  2KZI A;  1EDK A;  4HJG H;  1EC5 A;  3S1K A;  2K3R A;  1U7M A;  4NPD A;  3MZW B;  2SPZ A;  1BDC A;  2B88 A;  2P58 A;  3FXE A;  1EDI A;  2UWJ E;  4NPE A;  1Q2N A;  2KI7 B;  2LXC B;  1EDL A;  4ZMD A;  3QWO C;  4GOD A;  1MFT A;  2JWD A;  4EYY Q;  3MHV A;  4IOI H;  4GOE A;  1OVU A;  1ZXG A;  1LT1 A;  1OVR A;  4JBZ A;  1DEE G;  2B89 A;  4HB1 A;  1Y47 A;  1H0T A;  5K5G B;  2LXB A;  2QRX A;  1FC2 C;  4K35 A;  1BDD A;  1JM0 A;  3ZDM A;  2QVA A;  4NPF X;  1EDJ A;  5C39 A;  2RKL A;  3FXD A;  5DJT B;  2LR2 A;  4ZNC A;  2OTK E;  4KJM A;  3PH0 A;  2R44 A;  1H0T B;  1ZW0 A;  4HKZ H;  1OVV A;  2B87 B;  1U7J A;  2B87 A;  2HR3 A;  2M0B A;  4GOF A;  2KIK A;  5DJU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...