3QWOC

Crystal structure of a motavizumab epitope-scaffold bound to motavizumab fab
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
53
structure length
53
Chain Sequence
SYNDEKKLASNEIANLPNLNEEQRSAFLSSINDDPSQSANLLAEAKKLNDAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords motavizumab light chain
publication title Design and characterization of epitope-scaffold immunogens that present the motavizumab epitope from respiratory syncytial virus.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 22
structure length 53
sequence length 53
chains with identical sequence P
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3qwoC00
5CBNA 2B87B 2P58A 2ZAEB 4HKZH 2KUBA 1EDIA 1H0TB 3QWOC 1NVOA 4ASWA 3PH0A 1EC5A 4K3AA 3ZDMA 2M5AB 3FXEA 2I8DA 2KI7B 1JMBA 2KIKA 2B89A 2Q1KA 3MZWB 1OVVA 1Q2NA 5C39A 2QRXA 4EYYQ 4KJMA 2B87A 2LR2A 4GODA 4MN4C 1LP1B 4ZNCA 1EDLA 1Y47A 2RKLA 2HR3A 2OTKE 1EDKA 1MFTA 1H0TA 3S1KA 5K5GB 1SS1A 1U7JA 2QVAA 1OVUA 4JBZA 1LT1A 2JWDA 2M5AA 2LXCB 2SPZA 1DEEG 4GOFA 5DJUB 2WMMA 1FC2C 3RGUA 1BDDA 1ZW0A 1ZXGA 4HJGH 2KZJA 1BDCA 5CBOA 4NPEA 4NPDA 3FXDA 4K35A 4GOEA 4IOIH 1S3JA 2KS1B 4ASVA 5EFWB 1OVRA 1X0TA 1LP1A 2B88A 2LXBA 4WWIA 2KZIA 5DJTB 1JM0A 4CPGA 2M0BA 2R44A 4NPFX 2UWJE 4ZMDA 3MHVA 1U7MA 2K3RA 1EDJA 4HB1A 4BXLA
chains in the Genus database with same CATH superfamily
3FWNA 2B9BA 3LW5J 1G2CA 3L73E 1FZFA 3L72G 3GHGA 2V4HA 3H1JE 1Q7YQ 2QM7A 1L0LJ 2HFED 3CMAP 1NTKK 5AVXB 2GA1A 2KLUA 3H1IE 2WSCH 2E5TA 1NTMK 2Q3EA 2ZFCA 1EDLA 3JC22 1GMJA 1JCCA 5KTBA 5GTIH 3VP8A 1JEKA 2RMZA 3USSA 1S4XA 3H1LJ 2WSSH 2R3CA 1IFNA 1ZW0A 2J5UA 2FYZA 2A06D 1SFCC 2O1JA 2QE7H 4IFFA 1L0LE 5AW0B 1OX3A 2A45H 1LWUA 2I1JA 5DJTB 1BCCD 1FZBA 2WPSA 3IR9A 4PD4I 2I1KA 2M0BA 2OTJP 2V7QJ 1QVGO 4WBAA 3MP7B 1LT9A 2E75D 3JCUE 1NOHA 2B87B 1NTZD 3L75D 3O8ZA 3P7KA 1L0NG 2PGDA 1K73Q 3CC2P 1E79H 2O01N 3E1IA 3TGUG 1HJBA 3HTKA 4ZKPA 2KI7B 1J1DB 2DW3A 2B89A 1YTZI 1YTZT 3C8VA 3PRJA 2IBZE 3K5BA 1YITP 1KYOI 5H2FE 3I5CA 1BE3G 2YIUB 4OWFA 4MN4C 1NTZK 1N7SC 3HE4B 1T6AA 1JB0J 1KYOD 1L4AA 1S9KD 3H32B 2W6AA 1T3UA 1YJWP 2N9BA 1N73C 1FZCC 4YPCA 2ZYAA 3CWBG 2FFDC 4XFJA 2C0XA 2E76C 4D6TD 1ZRTE 1KB9E 3I55P 1AV1A 2YKPA 2B88A 3AE4C 5M1BA 4H0LB 1L0NJ 2OTLP 4WWIA 1NKZB 3TGUJ 1YHQP 5AVRB 1XTCC 4Z1MH 2R32A 4CPGA 4IL6E 2R44A 2BCCJ 2UWJE 1IC2A 3BCCD 2NPSD 1OZHA 2XNXA 4I7ZB 1BE3J 1R5SA 2IYOA 2QG4A 1NAFA 4DZOA 3CPWO 3L73D 3H6PA 4ASWA 3Q2YA 3M0DA 1E5WA 1OW7A 1PIXA 2MJZA 2YKQA 1LJ2A 5C39A 3CWBJ 4N78E 4R4LA 5GTHE 2BASA 1URQA 1RH5B 1L0NE 2M3EA 5KJ7A 4EI2A 3TGUE 3B5NA 4OVNF 1KQGB 2BCCE 1RF1B 4N6JA 1W2EA 5AVVB 1K8AQ 1KILC 5CCHC 3OJAB 2JWAA 1QEXA 1IK9A 1BE3E 3V2RA 2FY8A 5AW5B 4UB6E 2D2CB 1HF9A 2KXPB 2N1TB 1L0LD 2ZVNB 1NU1G 3JSVC 4C7NA 2WT7A 4WY4A 4OGQC 3HD7B 1SQQE 3O6QB 3G4SP 1HGZA 3SWFA 2OYIA 2K3RA 3CWBE 1ZMEC 1GL2A 2XZRA 4PD4H 4W7YA 2H43A 2QEXP 2XV5A 5APYA 4JPZB 1QL2A 3B4SA 3GF3A 4L76A 4OH8B 5AW4B 5KAFH 3CL3D 1KILE 3LIEA 3A7OA 1L0LK 3ZDMA 3FXEA 1M1JC 1VQ9P 1PGOA 1S5LH 1GD2E 3EQ2A 1CI6A 4U7JA 3FGAD 5AW2B 3PJSK 2IBZD 1BGYE 1JY3N 1L4AC 2ITAA 1RE4C 2R3SA 2BEZF 3E7KA 1KYOH 5BU5A 1NU1J 2PFXA 1T3JA 2JWDA 3V4QA 2SPZA 3RBZA 2KSJA 2HODB 1TU3F 2H7HA 1PGQA 1RHZB 1KB9D 3RL0C 1T2KC 1A02J 1KN7A 3TNUB 3A0HE 1HJ0A 3L74D 2QSIA 2O3JA 4ZMDA 2IYPA 4PV1C 4RO0A 2GUSA 2QJPC 3CC4P 1ZOYC 5CBNA 1H88A 1SFCA 1IJDB 3AE8C 4JYBA 5CCGA 1SQVJ 2HLOA 4KHXA 1Q86Q 3G6EP 1NU1E 3M91A 1K05A 3L4FA 1IO4A 2E75B 3QH9A 4H44D 1AA0A 3AEEC 1URQC 1WMKA 1H89A 2WSEJ 2J58A 2OARA 3B5NC 1OW6A 3VTPC 4N78D 3HE5B 1Y47A 1FDIA 1IK7A 1VF5C 3GF7A 1MFTA 1L0ND 1LGHB 2OYHC 3RK2C 1SQXG 1LTSC 5B66H 1LT1A 1J2JB 3FWLA 3IF4A 5DJUB 1PV3A 2BCCD 3CXHD 2FYUD 4Y99B 2O01H 1YQ3C 2FYNB 1SQVE 1VQPP 2YO3A 5AW8B 1EZVI 1JY2P 3PTZA 5KLVD 2Q9IA 1YIJP 2OYIC 1JTHB 1MV8A 1QL1A 3SWYA 4XA4A 1N7SA 2HPCB 1Q81Q 1L0NK 1N86A 2QM8A 5APVA 3EFGA 4UB8E 4U3FG 1WRGA 4H13C 3MHVA 3L36A 1SQQD 2Q3IA 2QJYC 1EDJA 4BXLA 1FZCA 2FFDA 3AE3C 1KTMA 2FYUK 2FKWB 1QLED 1RF0C 1LNQA 3C1LA 5KLVK 1X9VA 4PJ0E 5E79H 1NVOA 1PPJG 3PLNA 3PH0A 1SQXJ 1Q82Q 2NPSB 3V4WA 3H1HG 1RY3A 2KB7P 3CX5E 5TJHA 3VOPA 1SQQK 1PFIA 1FE6A 1BGYD 1OFCX 1X8YA 1EDKA 3TF5A 1PP9E 2W6JH 5K5GB 1U7JA 1VQNP 2Y0EA 1YYCA 3M9BA 1OVUA 1FOSE 2ZJSE 1SQBD 3CCUP 3BRVB 5KKZC 4GT1A 4U3FJ 1IFJA 2QA4P 1BDDA 3Q1MA 1ZXGA 2WSFH 5AW9B 3CCEP 3VN0A 4K35A 1ZV8A 1OVRA 4JQ0D 2KP8A 2KZIA 2WITA 1HBWA 1S5LX 1AQ5A 1L4AD 3HUSB 5CCGC 1SQBK 3EWKA 1W2BO 3HD7A 1N7LA 3L72J 3T97A 1KILA 5CCHA 2C9LY 3BRTB 3TK1A 1GTWA 2AXTH 1EDIA 4I1LA 1FZGA 1CW5A 2OGUA 1IFPA 1D7MA 1J1DC 4I2LC 1NU1D 1KC8Q 2M5AB 5B5EH 3F89A 1YBKA 4A7PA 1LTBC 2A45G 2Q1KA 4BRYB 5APTA 3CCQP 3IN6A 3CD6P 2YIUC 4AYCA 1HVVA 4EYYQ 3OW2O 3WUUA 2H8PD 4KJMA 3V2PA 1UIIA 4YXDC 3RK3C 1LP1B 2E5YA 5AW1B 2WSCJ 2HR3A 3H1LE 1KQFB 1PZQA 1PPJE 1RQUA 5APSA 2H89C 1NU1K 1M1JA 3CXHH 2Y0CA 4DOJA 3L72E 3L71D 1A02F 5TISE 4NPDA 3A0BH 4GKGA 2KS1B 4H0LC 1QVFO 1SQVD 1P84I 1RE4A 4JF7A 1NH4A 2RN0A 1DD4A 3AEAC 1ZR4A 2K9JA 2POHA 5KJ7D 3RK3E 1JO5A 2JP3A 4NPFX 1ZR2A 2KLVA 3PP5A 3I56P 4I7ZC 1P84D 4HB1A 1KQLA 1DD3A 4LGDE 3Q5RA 3BASA 3H1KD 1EZVG 3M0AA 3H25A 1DIPA 1EXIA 2CK3H 2E74D 1R8EA 1NTKG 1SQVK 1HGVA 2FBWC 2CPSA 3OA7A 5GTIE 1AQTA 2KNCB 1VQMP 3BVHA 4B86A 1KFNA 4WY4D 4GIFA 3B8EB 1CZQA 1Q2NA 2OYOA 3V6IA 2XKMA 2QRXA 1YQ4C 4AUWA 3ITKA 2W27A 3CX5D 2LR2A 2ZT9D 3H1JD 3G71P 1GL2D 4H44B 2KK7A 3HE5A 3SWKA 1H0TA 4I6MC 3HRNA 1RF1C 1PP9D 1VL2A 1GZLA 3CMEP 4GOFA 1Y8AA 3H1ID 1FDMA 1FJPA 1WT6A 5KLIB 3CI9A 3VMZA 1U57A 2JR8A 1G2CB 4IOIH 3GHGB 2D2CC 2N1TC 1N8RQ 2E42A 1NTKJ 1MUUA 2Y0DA 1FOSF 1M90Q 1USDA 1Y9BA 3MD0A 3HD7C 3BATA 2IZ1A 4RJTA 2OYHA 1FDOA 2AXCA 2K1AA 1J1EB 2YMYA 1SLQA 2A06G 1VQ7P 1DX7A 1GK4A 2ZAEB 2RH0A 2NRGA 1M8OB 2P10A 2PAJA 2OQQA 3NFQA 1SP4A 3UIAA 4LLHA 3G3ZA 5KAIH 2NPSA 3KHUA 1OW8A 2N9YB 3VP9A 2IBZI 3SFDC 3L75G 1NTKE 4YXWH 2JEEA 2PP6A 1SFCD 1RF0A 1LWUB 2WVRA 3H1LD 4IL6X 1KV4A 2W90A 3WUTA 1FBMA 1FS0E 1T8ZA 1LT9B 3CCVP 1BDCA 1NO4A 3L72D 2G8YA 3R2PA 3AECC 2G3AA 3U59A 2WPVB 3N7NA 2W8ZA 1NGMB 1KB9I 3HTKB 1P84H 4ZKUA 4XE5B 1NAYA 1U7MA 2YXRB 3KDPB 3RK3D 1AJYA 1ZRTD 4D6TG 1QX8A 2YNYA 2WPQA 4HKZH 3WMM0 3GW6A 3AE2C 2AEMA 3WU2H 2NZ2A 1L4AB 3OAKA 1JY3O 2E75C 2WTYA 3VMAA 1N7SD 2XDJA 3BCCG 3D6ZA 2HYNA 1K9MQ 2B87A 1GK6A 1VQ6P 3AE7C 4GODA 2R5BA 3W68A 2RKLA 1YJ9P 3L73G 3B71A 1FJKA 2E76D 3IFMA 3SFEC 1DH3A 4O9BA 4JBZA 1JUNA 3RGUA 1K04A 4Y99C 4HJGH 2FYNC 4C7RA 4EOTA 3CXHI 1S3JA 5L8RJ 4PD4E 5APUA 3Q3DA 2LXBA 3TGUD 3HE4A 3KZIE 5KAFE 4C46A 1RE3C 5AW6B 4RKUJ 3H32A 3LW5H 2YXQB 4L74A 1OMIA 1S5LE 3BCCJ 1BE3D 4KT0J 5BVZA 2P58A 3E1RA 3MGNA 2QJKB 3QWOC 2NPSC 1KYOE 3AE1C 2IX7C 2JDIH 1VPCA 1VQLP 4BWNA 1S9KE 1NWQA 1XTGB 3CLQA 1VQ8P 5AVUB 3V5BA 1Z56A 1OXZA 3G9RA 3JCUH 2KYVA 3L37A 3CWBD 1MZ9A 3F5HA 2KNCA 2E74B 1SQPG 1R5LA 2QIWA 3V2NA 3M9QA 4C7NB 1LTJB 1KILD 5CCHD 4WY4B 2WQYC 2K9YA 1JCDA 1YI2P 5H2FH 2OYIB 4DT0A 5AVYB 2ZT9B 3SSUA 5AW3B 4IFDK 1HTLC 4WVZA 1GL2B 1FZEA 4OGQD 2IBZG 4ASVA 4AQRD 2P7JA 3MUDA 2O01J 5AVWB 5BU8B 1OWAA 4TLFA 2V7QH 3A3YB 3M9HA 1JM0A 3HUSC 2KOGA 1RF1A 4WB4A 1CI6B 1PGJA 1KB9H 3N4XA 2YMKA 2Z5IA 1GDTA 1SQPJ 1SQXE 1Q90D 2KUBA 3CCSP 3II6A 3RL0g 2N1TA 3CCLP 3PHLA 4IL6H 3H1HJ 1KFMA 2ZXEB 3D70A 2WWWA 3U1CA 3O6QA 5B66E 3LIDA 3L74G 3MZWB 1VDFA 3M06A 3D71A 5KKZB 4ZNCA 1S2EA 3FX0A 1FZAA 4EDFA 1N2DC 1JY2N 4U3FE 2Y9ZA 3A5TA 1SS1A 3RL0D 1T2KD 1SVFA 2HG5D 5GTHH 1RQVA 2IFNA 4NPEA 1AFOA 1SFCB 1SQPE 1ZN5A 2WSFJ 1HUCA 3IAOA 4PV1D 1GW3A 3H1HE 1UIXA 4PD4D 1NYHA 2E43A 5E79E 2O1KA 1EXJA 1QGKB 1DEBA 3RBXA 1EQ7A 3L74J 2HODA 3MTUE 2BCCG 2MKVA 1JY2O 2FYUG 4UB6H 3VMYA 1PGPA 2GM4A 5KLVG 3NXSA 1M7LA 1URQD 1USEA 3W67A 3D6YA 3TNUA 3B5ND 1VQ4P 2Y9YA 3RK3B 3P32A 1VF5D 3WUVA 2YO2A 4LC1A 1OVVA 3RK2D 1SQQG 3L70G 3GMAA 5AVSB 1HWTC 5APQA 5CMZA 4H44C 2IPPA 2FXPA 3CX5I 3S1KA 1N7SB 3Q5SA 2P1JA 2QVAA 2KSEA 5AVTB 2J59M 3L74E 3L35A 1FC2C 5KLIC 1NTMG 1JY3P 3GLMA 1LTGC 2AEFA 1W5CE 3MUDC 1N73B 2KZJA 1FZCB 3GHGC 2FFDB 4EIJA 2E76B 2FYUJ 1KORA 1X79B 1GU4A 4H13D 3EFFK 5APXA 5KLVJ 1BGYG 1IZNB 3CCRP 2M3BA 3VMXA 1J1EC 2AXTE 2CPBA 4HYTB 1PL5A 3KYQA 1SQBG 5B5EE 2Q6QA 1SQQJ 2WZ7A 3L70J 4M3LA 4L73A 1NKNA 1M1KQ 2XNDH 2L91A 2W6BA 3A0HH 1SQXD 3AEGC 1JTHA 1EC5A 1JMMA 2Q5UA 5APWA 2HPCA 2I8DA 1G1IA 3KXDA 1JMBA 2KIKA 3S4RA 1FAVA 1RE3A 2JKVA 5CHXA 1NTMJ 2WPRA 3ABVC 3CXHE 3U1AA 2FYUE 3NTNA 5KLVE 4JYCA 3A0BE 1LWUC 1BGYJ 3AE9C 1BCCG 1JOCA 1S1CX 1ZP0C 3CCJP 2LKMA 4IFMA 2FXMA 1SQXK 4U3FD 2LXCB 1LTJA 1CSBA 2P67A 2VRSA 1LT9C 1EZVE 3VYIA 1SQBJ 3L70E 5CBOA 3T97B 1NTZG 2YKOA 1KILB 5CCGD 1SQPD 2IZ0A 1KQSO 1PPJD 3AEDC 1YJNP 3KZIH 3H1HD 3TYYA 3P8CE 1ZLLA 4OGQB 3AEBC 1G1JA 1NTME 3NMDA 1VQOP 3L71G 2ZYDA 3Q5PA 2M8RA 1LTAC 1SQVG 3KQGA 4TT3H 1SQPK 1MKMA 1BCCJ 4UB8H 3KPEA 2ZVOB 4K3AA 1MFZA 2Z5HA 2WSEH 1GU5A 1SQBE 1M1JB 2ZXXA 2R5DA 4R4MA 3HUSA 1S72P 1HH0A 1VQ5P 3TSIA 4RESB 1NTZJ 3H1KG 3L75J 2IDBA 4PJ0H 3CC7P 2Q7CA 1IFIA 1KZUB 2AEJA 1AVOA 3GG2A 2K9JB 2M5AA 1IFDA 4HH2A 1H8AA 1DEEG 3V2QA 4H0LD 2H88C 2A06E 2K37A 3CX5H 2PRRA 4BRYA 4QMAA 4DJGA 3AEFC 3L71J 2C0WA 2A45I 4GOEA 4W7ZA 3R4YA 4YTPC 1FU1A 3P8MC 5EFWB 3H1JG 1LP1A 1X0TA 1BCCE 3S9OA 3RL0B 3CCMP 2BEQD 3M0DC 2ZYGA 1PP9G 1KMIZ 3H1IG 5KAIE 2Z4EA 4DCKA 4GDOA 4D6TJ 4PV1B 1NTZE 1GW4A 3L75E 1VQKP 5CJ0A 2QJPB 3H1KJ 2QJKC 5KJ7C 2XU6A 2KS1A 1KD1Q 1H0TB 1BSNA 3MIWA 3AE6C 5AW7B 2E74C 1IFMA 5CJ4A 3L71E 2GUVA 1URQB 5AVZB 3L73J 3B5NB 2C9NY 1L0LG 1LTJC 3H1JJ 4WY4C 2OTKE 2W83C 1X22A 1VF5B 4N3YB 1NJIQ 2OYHB 3RK2B 2IFMA 2ZT9C 1LTIC 2D2CD 2N1TD 1PP9J 1L2PA 2JJLA 2WMMA 2P2UA 3TDKA 4D6TE 3H1IJ 1GL2C 1OIPA 2L5GB 1NHLA 1P84E 1EZVD 1M56D 3HD7D 5AVQB 3FXDA 3H1KE 1N73A 3L70D 4L75A 2WT7B 3C9IA 1AVYA 1NTKD 1BSHA 2FXOA 4W80A 1M57D 3AE5C 3WU2E 3H1LG 2JO1A 3BCCE 1LTTC 3P8CD 5TISH 4H13B 4Y28J 1NTMD 3A2AA 1JNMA 2QJYB 2K88A
chains in the Genus database with same CATH topology
5CBNA 2B87B 2P58A 2ZAEB 4HKZH 2KUBA 1EDIA 1H0TB 3QWOC 1NVOA 4ASWA 3PH0A 1EC5A 4K3AA 3ZDMA 2M5AB 3FXEA 2I8DA 2KI7B 1JMBA 2KIKA 2B89A 2Q1KA 3MZWB 1OVVA 1Q2NA 5C39A 2QRXA 4EYYQ 4KJMA 2B87A 2LR2A 4GODA 4MN4C 1LP1B 4ZNCA 1EDLA 1Y47A 2RKLA 2HR3A 2OTKE 1EDKA 1MFTA 1H0TA 3S1KA 5K5GB 1SS1A 1U7JA 2QVAA 1OVUA 4JBZA 1LT1A 2JWDA 2M5AA 2LXCB 2SPZA 1DEEG 4GOFA 5DJUB 2WMMA 1FC2C 3RGUA 1BDDA 1ZW0A 1ZXGA 4HJGH 2KZJA 1BDCA 5CBOA 4NPEA 4NPDA 3FXDA 4K35A 4GOEA 4IOIH 1S3JA 2KS1B 4ASVA 5EFWB 1OVRA 1X0TA 1LP1A 2B88A 2LXBA 4WWIA 2KZIA 5DJTB 1JM0A 4CPGA 2M0BA 2R44A 4NPFX 2UWJE 4ZMDA 3MHVA 1U7MA 2K3RA 1EDJA 4HB1A 4BXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBN A;  2B87 B;  2P58 A;  2ZAE B;  4HKZ H;  2KUB A;  1EDI A;  1H0T B;  3QWO C;  1NVO A;  4ASW A;  3PH0 A;  1EC5 A;  4K3A A;  3ZDM A;  2M5A B;  3FXE A;  2I8D A;  2KI7 B;  1JMB A;  2KIK A;  2B89 A;  2Q1K A;  3MZW B;  1OVV A;  1Q2N A;  5C39 A;  2QRX A;  4EYY Q;  4KJM A;  2B87 A;  2LR2 A;  4GOD A;  4MN4 C;  1LP1 B;  4ZNC A;  1EDL A;  1Y47 A;  2RKL A;  2HR3 A;  2OTK E;  1EDK A;  1MFT A;  1H0T A;  3S1K A;  5K5G B;  1SS1 A;  1U7J A;  2QVA A;  1OVU A;  4JBZ A;  1LT1 A;  2JWD A;  2M5A A;  2LXC B;  2SPZ A;  1DEE G;  4GOF A;  5DJU B;  2WMM A;  1FC2 C;  3RGU A;  1BDD A;  1ZW0 A;  1ZXG A;  4HJG H;  2KZJ A;  1BDC A;  5CBO A;  4NPE A;  4NPD A;  3FXD A;  4K35 A;  4GOE A;  4IOI H;  1S3J A;  2KS1 B;  4ASV A;  5EFW B;  1OVR A;  1X0T A;  1LP1 A;  2B88 A;  2LXB A;  4WWI A;  2KZI A;  5DJT B;  1JM0 A;  4CPG A;  2M0B A;  2R44 A;  4NPF X;  2UWJ E;  4ZMD A;  3MHV A;  1U7M A;  2K3R A;  1EDJ A;  4HB1 A;  4BXL A; 
#chains in the Genus database with same CATH topology
 3FWN A;  2B9B A;  3LW5 J;  1G2C A;  3L73 E;  1FZF A;  3L72 G;  3GHG A;  2V4H A;  3H1J E;  1Q7Y Q;  2QM7 A;  1L0L J;  2HFE D;  3CMA P;  1NTK K;  5AVX B;  2GA1 A;  2KLU A;  3H1I E;  2WSC H;  2E5T A;  1NTM K;  2Q3E A;  2ZFC A;  1EDL A;  3JC2 2;  1GMJ A;  1JCC A;  5KTB A;  5GTI H;  3VP8 A;  1JEK A;  2RMZ A;  3USS A;  1S4X A;  3H1L J;  2WSS H;  2R3C A;  1IFN A;  1ZW0 A;  2J5U A;  2FYZ A;  2A06 D;  1SFC C;  2O1J A;  2QE7 H;  4IFF A;  1L0L E;  5AW0 B;  1OX3 A;  2A45 H;  1LWU A;  2I1J A;  5DJT B;  1BCC D;  1FZB A;  2WPS A;  3IR9 A;  4PD4 I;  2I1K A;  2M0B A;  2OTJ P;  2V7Q J;  1QVG O;  4WBA A;  3MP7 B;  1LT9 A;  2E75 D;  3JCU E;  1NOH A;  2B87 B;  1NTZ D;  3L75 D;  3O8Z A;  3P7K A;  1L0N G;  2PGD A;  1K73 Q;  3CC2 P;  1E79 H;  2O01 N;  3E1I A;  3TGU G;  1HJB A;  3HTK A;  4ZKP A;  2KI7 B;  1J1D B;  2DW3 A;  2B89 A;  1YTZ I;  1YTZ T;  3C8V A;  3PRJ A;  2IBZ E;  3K5B A;  1YIT P;  1KYO I;  5H2F E;  3I5C A;  1BE3 G;  2YIU B;  4OWF A;  4MN4 C;  1NTZ K;  1N7S C;  3HE4 B;  1T6A A;  1JB0 J;  1KYO D;  1L4A A;  1S9K D;  3H32 B;  2W6A A;  1T3U A;  1YJW P;  2N9B A;  1N73 C;  1FZC C;  4YPC A;  2ZYA A;  3CWB G;  2FFD C;  4XFJ A;  2C0X A;  2E76 C;  4D6T D;  1ZRT E;  1KB9 E;  3I55 P;  1AV1 A;  2YKP A;  2B88 A;  3AE4 C;  5M1B A;  4H0L B;  1L0N J;  2OTL P;  4WWI A;  1NKZ B;  3TGU J;  1YHQ P;  5AVR B;  1XTC C;  4Z1M H;  2R32 A;  4CPG A;  4IL6 E;  2R44 A;  2BCC J;  2UWJ E;  1IC2 A;  3BCC D;  2NPS D;  1OZH A;  2XNX A;  4I7Z B;  1BE3 J;  1R5S A;  2IYO A;  2QG4 A;  1NAF A;  4DZO A;  3CPW O;  3L73 D;  3H6P A;  4ASW A;  3Q2Y A;  3M0D A;  1E5W A;  1OW7 A;  1PIX A;  2MJZ A;  2YKQ A;  1LJ2 A;  5C39 A;  3CWB J;  4N78 E;  4R4L A;  5GTH E;  2BAS A;  1URQ A;  1RH5 B;  1L0N E;  2M3E A;  5KJ7 A;  4EI2 A;  3TGU E;  3B5N A;  4OVN F;  1KQG B;  2BCC E;  1RF1 B;  4N6J A;  1W2E A;  5AVV B;  1K8A Q;  1KIL C;  5CCH C;  3OJA B;  2JWA A;  1QEX A;  1IK9 A;  1BE3 E;  3V2R A;  2FY8 A;  5AW5 B;  4UB6 E;  2D2C B;  1HF9 A;  2KXP B;  2N1T B;  1L0L D;  2ZVN B;  1NU1 G;  3JSV C;  4C7N A;  2WT7 A;  4WY4 A;  4OGQ C;  3HD7 B;  1SQQ E;  3O6Q B;  3G4S P;  1HGZ A;  3SWF A;  2OYI A;  2K3R A;  3CWB E;  1ZME C;  1GL2 A;  2XZR A;  4PD4 H;  4W7Y A;  2H43 A;  2QEX P;  2XV5 A;  5APY A;  4JPZ B;  1QL2 A;  3B4S A;  3GF3 A;  4L76 A;  4OH8 B;  5AW4 B;  5KAF H;  3CL3 D;  1KIL E;  3LIE A;  3A7O A;  1L0L K;  3ZDM A;  3FXE A;  1M1J C;  1VQ9 P;  1PGO A;  1S5L H;  1GD2 E;  3EQ2 A;  1CI6 A;  4U7J A;  3FGA D;  5AW2 B;  3PJS K;  2IBZ D;  1BGY E;  1JY3 N;  1L4A C;  2ITA A;  1RE4 C;  2R3S A;  2BEZ F;  3E7K A;  1KYO H;  5BU5 A;  1NU1 J;  2PFX A;  1T3J A;  2JWD A;  3V4Q A;  2SPZ A;  3RBZ A;  2KSJ A;  2HOD B;  1TU3 F;  2H7H A;  1PGQ A;  1RHZ B;  1KB9 D;  3RL0 C;  1T2K C;  1A02 J;  1KN7 A;  3TNU B;  3A0H E;  1HJ0 A;  3L74 D;  2QSI A;  2O3J A;  4ZMD A;  2IYP A;  4PV1 C;  4RO0 A;  2GUS A;  2QJP C;  3CC4 P;  1ZOY C;  5CBN A;  1H88 A;  1SFC A;  1IJD B;  3AE8 C;  4JYB A;  5CCG A;  1SQV J;  2HLO A;  4KHX A;  1Q86 Q;  3G6E P;  1NU1 E;  3M91 A;  1K05 A;  3L4F A;  1IO4 A;  2E75 B;  3QH9 A;  4H44 D;  1AA0 A;  3AEE C;  1URQ C;  1WMK A;  1H89 A;  2WSE J;  2J58 A;  2OAR A;  3B5N C;  1OW6 A;  3VTP C;  4N78 D;  3HE5 B;  1Y47 A;  1FDI A;  1IK7 A;  1VF5 C;  3GF7 A;  1MFT A;  1L0N D;  1LGH B;  2OYH C;  3RK2 C;  1SQX G;  1LTS C;  5B66 H;  1LT1 A;  1J2J B;  3FWL A;  3IF4 A;  5DJU B;  1PV3 A;  2BCC D;  3CXH D;  2FYU D;  4Y99 B;  2O01 H;  1YQ3 C;  2FYN B;  1SQV E;  1VQP P;  2YO3 A;  5AW8 B;  1EZV I;  1JY2 P;  3PTZ A;  5KLV D;  2Q9I A;  1YIJ P;  2OYI C;  1JTH B;  1MV8 A;  1QL1 A;  3SWY A;  4XA4 A;  1N7S A;  2HPC B;  1Q81 Q;  1L0N K;  1N86 A;  2QM8 A;  5APV A;  3EFG A;  4UB8 E;  4U3F G;  1WRG A;  4H13 C;  3MHV A;  3L36 A;  1SQQ D;  2Q3I A;  2QJY C;  1EDJ A;  4BXL A;  1FZC A;  2FFD A;  3AE3 C;  1KTM A;  2FYU K;  2FKW B;  1QLE D;  1RF0 C;  1LNQ A;  3C1L A;  5KLV K;  1X9V A;  4PJ0 E;  5E79 H;  1NVO A;  1PPJ G;  3PLN A;  3PH0 A;  1SQX J;  1Q82 Q;  2NPS B;  3V4W A;  3H1H G;  1RY3 A;  2KB7 P;  3CX5 E;  5TJH A;  3VOP A;  1SQQ K;  1PFI A;  1FE6 A;  1BGY D;  1OFC X;  1X8Y A;  1EDK A;  3TF5 A;  1PP9 E;  2W6J H;  5K5G B;  1U7J A;  1VQN P;  2Y0E A;  1YYC A;  3M9B A;  1OVU A;  1FOS E;  2ZJS E;  1SQB D;  3CCU P;  3BRV B;  5KKZ C;  4GT1 A;  4U3F J;  1IFJ A;  2QA4 P;  1BDD A;  3Q1M A;  1ZXG A;  2WSF H;  5AW9 B;  3CCE P;  3VN0 A;  4K35 A;  1ZV8 A;  1OVR A;  4JQ0 D;  2KP8 A;  2KZI A;  2WIT A;  1HBW A;  1S5L X;  1AQ5 A;  1L4A D;  3HUS B;  5CCG C;  1SQB K;  3EWK A;  1W2B O;  3HD7 A;  1N7L A;  3L72 J;  3T97 A;  1KIL A;  5CCH A;  2C9L Y;  3BRT B;  3TK1 A;  1GTW A;  2AXT H;  1EDI A;  4I1L A;  1FZG A;  1CW5 A;  2OGU A;  1IFP A;  1D7M A;  1J1D C;  4I2L C;  1NU1 D;  1KC8 Q;  2M5A B;  5B5E H;  3F89 A;  1YBK A;  4A7P A;  1LTB C;  2A45 G;  2Q1K A;  4BRY B;  5APT A;  3CCQ P;  3IN6 A;  3CD6 P;  2YIU C;  4AYC A;  1HVV A;  4EYY Q;  3OW2 O;  3WUU A;  2H8P D;  4KJM A;  3V2P A;  1UII A;  4YXD C;  3RK3 C;  1LP1 B;  2E5Y A;  5AW1 B;  2WSC J;  2HR3 A;  3H1L E;  1KQF B;  1PZQ A;  1PPJ E;  1RQU A;  5APS A;  2H89 C;  1NU1 K;  1M1J A;  3CXH H;  2Y0C A;  4DOJ A;  3L72 E;  3L71 D;  1A02 F;  5TIS E;  4NPD A;  3A0B H;  4GKG A;  2KS1 B;  4H0L C;  1QVF O;  1SQV D;  1P84 I;  1RE4 A;  4JF7 A;  1NH4 A;  2RN0 A;  1DD4 A;  3AEA C;  1ZR4 A;  2K9J A;  2POH A;  5KJ7 D;  3RK3 E;  1JO5 A;  2JP3 A;  4NPF X;  1ZR2 A;  2KLV A;  3PP5 A;  3I56 P;  4I7Z C;  1P84 D;  4HB1 A;  1KQL A;  1DD3 A;  4LGD E;  3Q5R A;  3BAS A;  3H1K D;  1EZV G;  3M0A A;  3H25 A;  1DIP A;  1EXI A;  2CK3 H;  2E74 D;  1R8E A;  1NTK G;  1SQV K;  1HGV A;  2FBW C;  2CPS A;  3OA7 A;  5GTI E;  1AQT A;  2KNC B;  1VQM P;  3BVH A;  4B86 A;  1KFN A;  4WY4 D;  4GIF A;  3B8E B;  1CZQ A;  1Q2N A;  2OYO A;  3V6I A;  2XKM A;  2QRX A;  1YQ4 C;  4AUW A;  3ITK A;  2W27 A;  3CX5 D;  2LR2 A;  2ZT9 D;  3H1J D;  3G71 P;  1GL2 D;  4H44 B;  2KK7 A;  3HE5 A;  3SWK A;  1H0T A;  4I6M C;  3HRN A;  1RF1 C;  1PP9 D;  1VL2 A;  1GZL A;  3CME P;  4GOF A;  1Y8A A;  3H1I D;  1FDM A;  1FJP A;  1WT6 A;  5KLI B;  3CI9 A;  3VMZ A;  1U57 A;  2JR8 A;  1G2C B;  4IOI H;  3GHG B;  2D2C C;  2N1T C;  1N8R Q;  2E42 A;  1NTK J;  1MUU A;  2Y0D A;  1FOS F;  1M90 Q;  1USD A;  1Y9B A;  3MD0 A;  3HD7 C;  3BAT A;  2IZ1 A;  4RJT A;  2OYH A;  1FDO A;  2AXC A;  2K1A A;  1J1E B;  2YMY A;  1SLQ A;  2A06 G;  1VQ7 P;  1DX7 A;  1GK4 A;  2ZAE B;  2RH0 A;  2NRG A;  1M8O B;  2P10 A;  2PAJ A;  2OQQ A;  3NFQ A;  1SP4 A;  3UIA A;  4LLH A;  3G3Z A;  5KAI H;  2NPS A;  3KHU A;  1OW8 A;  2N9Y B;  3VP9 A;  2IBZ I;  3SFD C;  3L75 G;  1NTK E;  4YXW H;  2JEE A;  2PP6 A;  1SFC D;  1RF0 A;  1LWU B;  2WVR A;  3H1L D;  4IL6 X;  1KV4 A;  2W90 A;  3WUT A;  1FBM A;  1FS0 E;  1T8Z A;  1LT9 B;  3CCV P;  1BDC A;  1NO4 A;  3L72 D;  2G8Y A;  3R2P A;  3AEC C;  2G3A A;  3U59 A;  2WPV B;  3N7N A;  2W8Z A;  1NGM B;  1KB9 I;  3HTK B;  1P84 H;  4ZKU A;  4XE5 B;  1NAY A;  1U7M A;  2YXR B;  3KDP B;  3RK3 D;  1AJY A;  1ZRT D;  4D6T G;  1QX8 A;  2YNY A;  2WPQ A;  4HKZ H;  3WMM 0;  3GW6 A;  3AE2 C;  2AEM A;  3WU2 H;  2NZ2 A;  1L4A B;  3OAK A;  1JY3 O;  2E75 C;  2WTY A;  3VMA A;  1N7S D;  2XDJ A;  3BCC G;  3D6Z A;  2HYN A;  1K9M Q;  2B87 A;  1GK6 A;  1VQ6 P;  3AE7 C;  4GOD A;  2R5B A;  3W68 A;  2RKL A;  1YJ9 P;  3L73 G;  3B71 A;  1FJK A;  2E76 D;  3IFM A;  3SFE C;  1DH3 A;  4O9B A;  4JBZ A;  1JUN A;  3RGU A;  1K04 A;  4Y99 C;  4HJG H;  2FYN C;  4C7R A;  4EOT A;  3CXH I;  1S3J A;  5L8R J;  4PD4 E;  5APU A;  3Q3D A;  2LXB A;  3TGU D;  3HE4 A;  3KZI E;  5KAF E;  4C46 A;  1RE3 C;  5AW6 B;  4RKU J;  3H32 A;  3LW5 H;  2YXQ B;  4L74 A;  1OMI A;  1S5L E;  3BCC J;  1BE3 D;  4KT0 J;  5BVZ A;  2P58 A;  3E1R A;  3MGN A;  2QJK B;  3QWO C;  2NPS C;  1KYO E;  3AE1 C;  2IX7 C;  2JDI H;  1VPC A;  1VQL P;  4BWN A;  1S9K E;  1NWQ A;  1XTG B;  3CLQ A;  1VQ8 P;  5AVU B;  3V5B A;  1Z56 A;  1OXZ A;  3G9R A;  3JCU H;  2KYV A;  3L37 A;  3CWB D;  1MZ9 A;  3F5H A;  2KNC A;  2E74 B;  1SQP G;  1R5L A;  2QIW A;  3V2N A;  3M9Q A;  4C7N B;  1LTJ B;  1KIL D;  5CCH D;  4WY4 B;  2WQY C;  2K9Y A;  1JCD A;  1YI2 P;  5H2F H;  2OYI B;  4DT0 A;  5AVY B;  2ZT9 B;  3SSU A;  5AW3 B;  4IFD K;  1HTL C;  4WVZ A;  1GL2 B;  1FZE A;  4OGQ D;  2IBZ G;  4ASV A;  4AQR D;  2P7J A;  3MUD A;  2O01 J;  5AVW B;  5BU8 B;  1OWA A;  4TLF A;  2V7Q H;  3A3Y B;  3M9H A;  1JM0 A;  3HUS C;  2KOG A;  1RF1 A;  4WB4 A;  1CI6 B;  1PGJ A;  1KB9 H;  3N4X A;  2YMK A;  2Z5I A;  1GDT A;  1SQP J;  1SQX E;  1Q90 D;  2KUB A;  3CCS P;  3II6 A;  3RL0 g;  2N1T A;  3CCL P;  3PHL A;  4IL6 H;  3H1H J;  1KFM A;  2ZXE B;  3D70 A;  2WWW A;  3U1C A;  3O6Q A;  5B66 E;  3LID A;  3L74 G;  3MZW B;  1VDF A;  3M06 A;  3D71 A;  5KKZ B;  4ZNC A;  1S2E A;  3FX0 A;  1FZA A;  4EDF A;  1N2D C;  1JY2 N;  4U3F E;  2Y9Z A;  3A5T A;  1SS1 A;  3RL0 D;  1T2K D;  1SVF A;  2HG5 D;  5GTH H;  1RQV A;  2IFN A;  4NPE A;  1AFO A;  1SFC B;  1SQP E;  1ZN5 A;  2WSF J;  1HUC A;  3IAO A;  4PV1 D;  1GW3 A;  3H1H E;  1UIX A;  4PD4 D;  1NYH A;  2E43 A;  5E79 E;  2O1K A;  1EXJ A;  1QGK B;  1DEB A;  3RBX A;  1EQ7 A;  3L74 J;  2HOD A;  3MTU E;  2BCC G;  2MKV A;  1JY2 O;  2FYU G;  4UB6 H;  3VMY A;  1PGP A;  2GM4 A;  5KLV G;  3NXS A;  1M7L A;  1URQ D;  1USE A;  3W67 A;  3D6Y A;  3TNU A;  3B5N D;  1VQ4 P;  2Y9Y A;  3RK3 B;  3P32 A;  1VF5 D;  3WUV A;  2YO2 A;  4LC1 A;  1OVV A;  3RK2 D;  1SQQ G;  3L70 G;  3GMA A;  5AVS B;  1HWT C;  5APQ A;  5CMZ A;  4H44 C;  2IPP A;  2FXP A;  3CX5 I;  3S1K A;  1N7S B;  3Q5S A;  2P1J A;  2QVA A;  2KSE A;  5AVT B;  2J59 M;  3L74 E;  3L35 A;  1FC2 C;  5KLI C;  1NTM G;  1JY3 P;  3GLM A;  1LTG C;  2AEF A;  1W5C E;  3MUD C;  1N73 B;  2KZJ A;  1FZC B;  3GHG C;  2FFD B;  4EIJ A;  2E76 B;  2FYU J;  1KOR A;  1X79 B;  1GU4 A;  4H13 D;  3EFF K;  5APX A;  5KLV J;  1BGY G;  1IZN B;  3CCR P;  2M3B A;  3VMX A;  1J1E C;  2AXT E;  2CPB A;  4HYT B;  1PL5 A;  3KYQ A;  1SQB G;  5B5E E;  2Q6Q A;  1SQQ J;  2WZ7 A;  3L70 J;  4M3L A;  4L73 A;  1NKN A;  1M1K Q;  2XND H;  2L91 A;  2W6B A;  3A0H H;  1SQX D;  3AEG C;  1JTH A;  1EC5 A;  1JMM A;  2Q5U A;  5APW A;  2HPC A;  2I8D A;  1G1I A;  3KXD A;  1JMB A;  2KIK A;  3S4R A;  1FAV A;  1RE3 A;  2JKV A;  5CHX A;  1NTM J;  2WPR A;  3ABV C;  3CXH E;  3U1A A;  2FYU E;  3NTN A;  5KLV E;  4JYC A;  3A0B E;  1LWU C;  1BGY J;  3AE9 C;  1BCC G;  1JOC A;  1S1C X;  1ZP0 C;  3CCJ P;  2LKM A;  4IFM A;  2FXM A;  1SQX K;  4U3F D;  2LXC B;  1LTJ A;  1CSB A;  2P67 A;  2VRS A;  1LT9 C;  1EZV E;  3VYI A;  1SQB J;  3L70 E;  5CBO A;  3T97 B;  1NTZ G;  2YKO A;  1KIL B;  5CCG D;  1SQP D;  2IZ0 A;  1KQS O;  1PPJ D;  3AED C;  1YJN P;  3KZI H;  3H1H D;  3TYY A;  3P8C E;  1ZLL A;  4OGQ B;  3AEB C;  1G1J A;  1NTM E;  3NMD A;  1VQO P;  3L71 G;  2ZYD A;  3Q5P A;  2M8R A;  1LTA C;  1SQV G;  3KQG A;  4TT3 H;  1SQP K;  1MKM A;  1BCC J;  4UB8 H;  3KPE A;  2ZVO B;  4K3A A;  1MFZ A;  2Z5H A;  2WSE H;  1GU5 A;  1SQB E;  1M1J B;  2ZXX A;  2R5D A;  4R4M A;  3HUS A;  1S72 P;  1HH0 A;  1VQ5 P;  3TSI A;  4RES B;  1NTZ J;  3H1K G;  3L75 J;  2IDB A;  4PJ0 H;  3CC7 P;  2Q7C A;  1IFI A;  1KZU B;  2AEJ A;  1AVO A;  3GG2 A;  2K9J B;  2M5A A;  1IFD A;  4HH2 A;  1H8A A;  1DEE G;  3V2Q A;  4H0L D;  2H88 C;  2A06 E;  2K37 A;  3CX5 H;  2PRR A;  4BRY A;  4QMA A;  4DJG A;  3AEF C;  3L71 J;  2C0W A;  2A45 I;  4GOE A;  4W7Z A;  3R4Y A;  4YTP C;  1FU1 A;  3P8M C;  5EFW B;  3H1J G;  1LP1 A;  1X0T A;  1BCC E;  3S9O A;  3RL0 B;  3CCM P;  2BEQ D;  3M0D C;  2ZYG A;  1PP9 G;  1KMI Z;  3H1I G;  5KAI E;  2Z4E A;  4DCK A;  4GDO A;  4D6T J;  4PV1 B;  1NTZ E;  1GW4 A;  3L75 E;  1VQK P;  5CJ0 A;  2QJP B;  3H1K J;  2QJK C;  5KJ7 C;  2XU6 A;  2KS1 A;  1KD1 Q;  1H0T B;  1BSN A;  3MIW A;  3AE6 C;  5AW7 B;  2E74 C;  1IFM A;  5CJ4 A;  3L71 E;  2GUV A;  1URQ B;  5AVZ B;  3L73 J;  3B5N B;  2C9N Y;  1L0L G;  1LTJ C;  3H1J J;  4WY4 C;  2OTK E;  2W83 C;  1X22 A;  1VF5 B;  4N3Y B;  1NJI Q;  2OYH B;  3RK2 B;  2IFM A;  2ZT9 C;  1LTI C;  2D2C D;  2N1T D;  1PP9 J;  1L2P A;  2JJL A;  2WMM A;  2P2U A;  3TDK A;  4D6T E;  3H1I J;  1GL2 C;  1OIP A;  2L5G B;  1NHL A;  1P84 E;  1EZV D;  1M56 D;  3HD7 D;  5AVQ B;  3FXD A;  3H1K E;  1N73 A;  3L70 D;  4L75 A;  2WT7 B;  3C9I A;  1AVY A;  1NTK D;  1BSH A;  2FXO A;  4W80 A;  1M57 D;  3AE5 C;  3WU2 E;  3H1L G;  2JO1 A;  3BCC E;  1LTT C;  3P8C D;  5TIS H;  4H13 B;  4Y28 J;  1NTM D;  3A2A A;  1JNM A;  2QJY B;  2K88 A; 
#chains in the Genus database with same CATH homology
 5CBN A;  2B87 B;  2P58 A;  2ZAE B;  4HKZ H;  2KUB A;  1EDI A;  1H0T B;  3QWO C;  1NVO A;  4ASW A;  3PH0 A;  1EC5 A;  4K3A A;  3ZDM A;  2M5A B;  3FXE A;  2I8D A;  2KI7 B;  1JMB A;  2KIK A;  2B89 A;  2Q1K A;  3MZW B;  1OVV A;  1Q2N A;  5C39 A;  2QRX A;  4EYY Q;  4KJM A;  2B87 A;  2LR2 A;  4GOD A;  4MN4 C;  1LP1 B;  4ZNC A;  1EDL A;  1Y47 A;  2RKL A;  2HR3 A;  2OTK E;  1EDK A;  1MFT A;  1H0T A;  3S1K A;  5K5G B;  1SS1 A;  1U7J A;  2QVA A;  1OVU A;  4JBZ A;  1LT1 A;  2JWD A;  2M5A A;  2LXC B;  2SPZ A;  1DEE G;  4GOF A;  5DJU B;  2WMM A;  1FC2 C;  3RGU A;  1BDD A;  1ZW0 A;  1ZXG A;  4HJG H;  2KZJ A;  1BDC A;  5CBO A;  4NPE A;  4NPD A;  3FXD A;  4K35 A;  4GOE A;  4IOI H;  1S3J A;  2KS1 B;  4ASV A;  5EFW B;  1OVR A;  1X0T A;  1LP1 A;  2B88 A;  2LXB A;  4WWI A;  2KZI A;  5DJT B;  1JM0 A;  4CPG A;  2M0B A;  2R44 A;  4NPF X;  2UWJ E;  4ZMD A;  3MHV A;  1U7M A;  2K3R A;  1EDJ A;  4HB1 A;  4BXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...