3QWOC

Crystal structure of a motavizumab epitope-scaffold bound to motavizumab fab
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
53
structure length
53
Chain Sequence
SYNDEKKLASNEIANLPNLNEEQRSAFLSSINDDPSQSANLLAEAKKLNDAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and characterization of epitope-scaffold immunogens that present the motavizumab epitope from respiratory syncytial virus.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords motavizumab light chain
total genus 22
structure length 53
sequence length 53
chains with identical sequence P
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3qwoC00
2KIKA 5K5GB 3RGUA 3MZWB 2B88A 2UWJE 4NPEA 2LR2A 1DEEG 1MFTA 1SS1A 4HB1A 4GOFA 3QWOC 1EDKA 4K35A 2WMMA 1X0TA 2LXCB 5EFWB 4HKZH 1U7MA 1JMBA 4GOEA 4EYYQ 1LP1B 1U7JA 4KJMA 3S1KA 2LXBA 2R44A 5DJTB 4MN4C 3ZDMA 2K3RA 4HJGH 1EC5A 2B87A 4ZNCA 2KUBA 2M5AA 2KZJA 1LT1A 2P58A 5C39A 4NPFX 2B89A 2KS1B 1ZW0A 1Q2NA 2M0BA 2KI7B 1H0TB 1EDJA 1Y47A 2I8DA 2KZIA 4BXLA 2ZAEB 1OVRA 1LP1A 1ZXGA 1OVUA 4ZMDA 4ASVA 1FC2C 5CBOA 1BDCA 1EDLA 4K3AA 1H0TA 4NPDA 2RKLA 3FXEA 4IOIH 2HR3A 3MHVA 1EDIA 2SPZA 5DJUB 4CPGA 4WWIA 4GODA 4JBZA 2JWDA 3PH0A 2M5AB 3FXDA 2QVAA 2OTKE 5CBNA 1S3JA 1BDDA 4ASWA 1NVOA 2QRXA 2B87B 2Q1KA 1JM0A 1OVVA
chains in the Genus database with same CATH superfamily
1USEA 3M0AA 1VQ5P 2WSEH 3BCCE 2Q3EA 1VQKP 3Q1MA 4DT0A 3HUSB 1OW8A 1J1EB 2AXTE 1X8YA 3L36A 5B5EE 2Q7CA 2Y0EA 2QE7H 2AXTH 1L0ND 1Y9BA 3OJAB 2M3EA 3B71A 4NPEA 1GDTA 2W83C 1DEEG 1LTIC 2KLVA 3PRJA 1BSNA 2P1JA 2YO3A 5CCHD 1FE6A 1S72P 1AFOA 1BE3G 5B66H 2ZYGA 2W8ZA 4KT0J 4I7ZC 1SQBE 3CC2P 1VQ4P 3CCSP 3H1IE 3ABVC 4GOFA 2IBZE 3L74J 3F5HA 2JKVA 3H32B 5AVTB 4DOJA 3W67A 1PP9J 1M1JB 3CC4P 3BVHA 2M8RA 2NRGA 3NFQA 3TGUD 1H88A 2ZXEB 1VF5C 2K9JA 1T3UA 1EDKA 1NTKD 4K35A 3T97A 1FOSE 2I1JA 4PV1C 2FFDB 1BE3D 1NU1D 2ZT9C 1NGMB 5KAIE 1ZN5A 1AV1A 1KB9E 1GD2E 2YXRB 2WSCJ 4D6TE 2FFDC 3PLNA 2C9NY 3JCUH 4EYYQ 1HVVA 2QG4A 3U1AA 3HE4B 2WVRA 3D6YA 5KKZB 1PV3A 1U7JA 2FYNB 3H1HE 1RF1A 2JP3A 2NPSC 1PFIA 3E1RA 1ZR4A 3G71P 3HTKA 3A0BE 2FXPA 1HTLC 2BCCD 2Q3IA 1QLED 5DJTB 1K04A 2C0WA 5TJHA 5APQA 2H7HA 1IFJA 1N7LA 2G8YA 3CCJP 1N7SD 2GUVA 3B5NB 3BCCD 1SQVJ 2C0XA 2N9YB 5AW2B 1VQ8P 1YQ3C 2R5BA 1GL2A 1PP9G 1LT1A 3VMZA 4NPFX 1JTHB 3L74G 2WWWA 1EZVG 2KS1B 3H1HD 1NOHA 1VPCA 1EQ7A 4AYCA 3P8CE 4U3FE 1Q2NA 5KJ7A 1G2CB 3M9BA 4XE5B 4WY4B 2IDBA 3KZIE 3RK2B 4N3YB 3Q3DA 1VQOP 1KQFB 1DD4A 1JOCA 3RL0g 1PPJG 4I2LC 1SFCD 1Y47A 2ZJSE 1RY3A 1NTKE 1PGJA 2JR8A 4OWFA 1L0LJ 2I1KA 2WSFH 2A45G 1KN7A 2JDIH 3H6PA 1JY3O 2FBWC 2FKWB 1IK9A 2RMZA 4H13D 4ZMDA 3H1LJ 1Q86Q 1CI6A 5CBOA 3KXDA 1S2EA 2O1KA 2Q6QA 3BASA 1EDLA 1SQQG 3AEAC 3RBXA 5KJ7C 2HPCA 1ZP0C 4RKUJ 2FYUJ 1NU1E 2FXMA 2QSIA 2ZYAA 3LIDA 1H0TA 4WY4C 3R4YA 3CWBE 2Z4EA 1DD3A 1IFMA 1Q82Q 3TYYA 1NWQA 1OZHA 5AW0B 1LJ2A 1BGYE 1NTZJ 1URQA 1RQUA 2FYNC 3MHVA 1WT6A 2E74C 1L0LE 2WSCH 3CXHD 3E7KA 1R5SA 1L4AC 2WSFJ 2JJLA 4KHXA 1GW3A 4CPGA 4RJTA 3B5NC 1K73Q 2FY8A 1KILA 4WWIA 1YI2P 2QEXP 3Q5RA 4H0LD 4L75A 2GUSA 5BU5A 3A3YB 2IFMA 2JWDA 2ZT9B 3GHGA 1L2PA 3KYQA 4PD4E 3L72J 1H8AA 3USSA 3CXHI 4PD4H 4U3FJ 1MFZA 1S3JA 4R4MA 2YO2A 4Y99B 1LTJA 5KLIC 1T3JA 2O01N 3V2PA 4D6TG 3TF5A 4WVZA 4XA4A 3H1JD 1KFMA 3OAKA 4Z1MH 1T2KD 2GM4A 1KC8Q 5AVVB 1S9KD 1RE4A 5KAFH 1NO4A 4H13B 2IX7C 3RL0B 1ZR2A 1RF1B 1JUNA 4W7YA 5KAFE 2KIKA 2PFXA 1NHLA 4YXDC 1GTWA 1Y8AA 1L4AB 4YTPC 3RGUA 4EOTA 1VF5B 5APVA 5AVQB 1G2CA 1NU1K 3A0HH 1KZUB 1ZOYC 2KSJA 3GHGC 1J1EC 3GG2A 5GTHH 1DIPA 3BATA 1MFTA 2R5DA 1FOSF 3L70J 2XU6A 3CCMP 4I7ZB 1KILD 2Q9IA 3SSUA 4HB1A 1GW4A 3H1LE 2P7JA 2W27A 1EXJA 2YIUC 1BCCE 1RE3A 3CCLP 1YJWP 1SP4A 4RESB 4N78E 1SQPK 1NTMK 1QGKB 1L4AD 1SQVD 1SQXG 2H88C 1X0TA 3AE5C 4EI2A 3OW2O 2LXCB 1M90Q 2Q5UA 3AE8C 5EFWB 3KPEA 3KDPB 1U7MA 4HKZH 4C7NA 2BCCG 2IBZI 2ITAA 2QJYB 1VL2A 2QJPC 2ZFCA 2JWAA 2OQQA 2WPQA 4GOEA 4I1LA 5APWA 4R4LA 3G9RA 3MUDA 4GT1A 1VQMP 1LP1B 1OXZA 1YHQP 3RK2C 1AQ5A 3H1KJ 4KJMA 1FU1A 1SQXD 2IYOA 4L76A 4EIJA 3S1KA 5KLVE 2LXBA 2R44A 2P2UA 2WSSH 3IR9A 1NU1G 5CHXA 4OGQC 3SWFA 1FDOA 5GTIH 3WUVA 4PJ0H 1K9MQ 3CWBG 3WUUA 1JY3P 2E76D 4PJ0E 4HJGH 1N73C 1EC5A 4ZNCA 1NTKJ 1OW7A 5APUA 2KK7A 1KYOH 1IJDB 3L4FA 4L73A 5KLVJ 1W2EA 2FFDA 3P8MC 4JYCA 4U7JA 2P58A 3HUSA 2B89A 1DX7A 2FYUE 3TGUE 1OX3A 3M9HA 1J2JB 3R2PA 1X9VA 1ZW0A 3AEFC 3IFMA 3H25A 1KTMA 2KI7B 4IL6X 2W6JH 3IN6A 2NPSB 3KQGA 4WBAA 1CW5A 1H0TB 3D70A 1BSHA 3C1LA 3B8EB 1LNQA 5KKZC 1KQSO 5B5EH 2RH0A 1YIJP 3CI9A 1HWTC 1GK4A 1IK7A 4UB6E 2H43A 3HD7C 1VQ9P 4UB6H 1SQVE 1URQB 1KYOD 4BXLA 1ZRTE 2ZAEB 1FAVA 1OVRA 1ZXGA 1OVUA 5B66E 3L74E 3CLQA 1FC2C 3AEBC 1KILE 3H1KG 1BDCA 2QM7A 3TNUB 3P7KA 5AW4B 1NAYA 3L75G 1T2KC 1MKMA 5CMZA 1PGQA 3V4QA 5CCGA 4TT3H 3GF3A 3L73G 3N4XA 3G3ZA 1NH4A 1SFCB 3V6IA 2OYHC 1YQ4C 2YKPA 2RKLA 4LLHA 2NZ2A 2PAJA 3PTZA 3MP7B 2N9BA 1GL2B 1IFDA 1SLQA 1CZQA 3H1KD 2WSEJ 1LWUB 1SQQD 2CPBA 2HODB 4GKGA 4L74A 5CCHC 3CCUP 3CX5D 3H1JG 4BRYA 1DH3A 5AVWB 3TDKA 3GLMA 1FS0E 1NTMJ 3EWKA 3EQ2A 4GODA 3C9IA 5CJ4A 4JBZA 1JCDA 1WMKA 2H8PD 3PH0A 1NYHA 1YJ9P 2BCCJ 1URQC 4DJGA 2E75B 4M3LA 1RH5B 3JSVC 3RK3C 1SQBJ 4C7NB 4ZKUA 1AJYA 2XNDH 2YNYA 3L37A 3A7OA 3H1IG 5E79H 2E76C 1J1DC 1SQQJ 1BGYG 1FZEA 5BVZA 5KTBA 3I5CA 5BU8B 2QM8A 1LT9C 1NVOA 3M9QA 2YMKA 5APSA 3RK3E 3CXHH 4PD4I 2OYIB 1QVFO 1OVVA 1L0LD 2FYUK 2HLOA 2PP6A 1LTJC 3CXHE 3HRNA 1VQ6P 4O9BA 2D2CC 3N7NA 3V2NA 2AXCA 1RF0C 3M0DA 5CJ0A 2HG5D 2V4HA 1M1KQ 1IZNB 1FZCB 2B88A 2BCCE 1N7SB 3KZIH 2J5UA 3RBZA 3NXSA 4H44B 4WB4A 1CI6B 1LTJB 1EZVI 3D71A 3CC7P 5AVRB 1L0LG 1SS1A 3M0DC 4OGQB 2K9JB 3MIWA 5L8RJ 3T97B 1LT9B 1OWAA 1S4XA 3QWOC 4N78D 1ZLLA 1HF9A 4XFJA 2POHA 5APTA 1KB9D 2WITA 1MV8A 2D2CD 1L0NG 2OYHA 1L0NJ 1AVYA 2MJZA 1H89A 1AVOA 1T8ZA 1WRGA 1E79H 1M1JA 1Q90D 2WPRA 1P84E 4GDOA 1RE3C 1JMBA 4W80A 1JB0J 1P84H 1YYCA 1NTMD 1W5CE 2MKVA 1VDFA 2YXQB 3P32A 1KILB 2Z5HA 1ZMEC 1NJIQ 2FYUG 3TGUG 1USDA 3TK1A 2OGUA 4AUWA 1SQVG 1AQTA 3EFFK 2HYNA 2O1JA 3Q5SA 3F89A 2NPSA 3CMEP 2E75C 3NTNA 5KLVK 2Z5IA 5H2FH 1SQPJ 4BRYB 2RN0A 2W6BA 1LTBC 3CX5H 1NTMG 1QL2A 1LTGC 2K3RA 1SQXK 4Y28J 1JTHA 4N6JA 3ZDMA 3CX5E 4DCKA 3CCRP 4C7RA 1L0LK 2FYUD 3U1CA 1N7SC 1YJNP 1Q7YQ 2AEJA 3EFGA 2XKMA 2WTYA 2E5YA 1JY2O 1GL2C 2N1TC 2KOGA 1M8OB 2A06E 2V7QJ 2XDJA 4JYBA 1QL1A 1KQLA 3GW6A 1HGVA 1PGPA 3CL3D 3RL0C 1BE3J 3A2AA 3TNUA 2KNCB 1OIPA 2HPCB 1KORA 1EDJA 2DW3A 3O6QB 1JNMA 2OYIA 1VQPP 4QMAA 3L71D 1UIXA 1KV4A 2E74D 2P10A 4H0LC 1YTZT 1NTZE 3VYIA 2E76B 5AVXB 4Y99C 1LTAC 4GIFA 3CCVP 2Y9ZA 3I55P 2KZIA 3A0HE 4B86A 3II6A 3L74D 5APYA 2ZYDA 2M3BA 1SVFA 1K8AQ 2W6AA 1FZGA 5CCHA 1SQVK 1XTCC 3L70D 1FZFA 1LP1A 3C8VA 3H1HJ 2YKOA 2N1TB 3MUDC 1GU5A 3HD7B 1KD1Q 3RL0D 1SQPE 4IL6E 4LC1A 2CPSA 2W90A 1HJ0A 3L75J 1OMIA 3G6EP 3L72E 4IL6H 1XTGB 4K3AA 2XNXA 1QEXA 2ZXXA 4WY4D 1P84D 4H0LB 5KLVD 1LT9A 3L71J 2E74B 3RK2D 3H32A 4NPDA 3W68A 2R3SA 2WQYC 3V2RA 1VQLP 1FDMA 1FZCA 5KAIH 1KB9H 3AE9C 1M7LA 5M1BA 3B5ND 3JCUE 5C39A 2PGDA 3FXEA 3WMM0 2ZVOB 1IFNA 2HR3A 1N73A 1FZBA 2O01H 3HE5B 3H1JJ 2J59M 3H1ID 5APXA 4YPCA 1EDIA 3CD6P 1FJPA 4TLFA 2A45I 1KYOI 3H1IJ 1FDIA 1KILC 1GK6A 2HFED 2IFNA 2D2CB 3A0BH 3L70E 1SQBG 4JF7A 3PP5A 1JEKA 3BRTB 1SQPD 4IFFA 2P67A 5AW7B 1NU1J 2M5AB 3V5BA 2YMYA 1M57D 3L73J 3FXDA 3L73E 1NKNA 3VOPA 3AE7C 3GMAA 2OTKE 2QJKC 3VMAA 1FZAA 2L91A 4I6MC 2WT7A 4H44D 1KQGB 1GL2D 3S9OA 2IZ0A 1G1JA 1U57A 1N8RQ 2QJKB 1NTZD 1BDDA 1RE4C 4ASWA 2Q1KA 3LW5J 1JY2P 2R32A 3L75E 4UB8E 3VTPC 1ZV8A 3L35A 3SWYA 1EXIA 1GZLA 3AE3C 1YITP 3H1KE 4UB8H 5AW1B 2QJYC 5CCGD 4IFDK 4JPZB 5AVZB 3CPWO 2J58A 5AVYB 5K5GB 2KS1A 1MUUA 3NMDA 5AW5B 1W2BO 3MZWB 1RHZB 3U59A 3Q5PA 1PZQA 3V4WA 2UWJE 4D6TD 1BGYD 1M56D 3PJSK 2LR2A 2KNCA 2G3AA 5AW9B 3SFDC 3B5NA 1QX8A 2QA4P 3H1LD 1L4AA 1D7MA 1JO5A 3QH9A 2PRRA 2E43A 1X79B 1NKZB 2B9BA 1DEBA 1LWUA 2HODA 1SQBK 4PV1D 3V2QA 3VP8A 3CCEP 3P8CD 2QIWA 1BCCJ 3UIAA 1KB9I 1PP9E 5AW6B 3CMAP 3FWLA 4DZOA 3MTUE 2IBZD 1G1IA 2CK3H 1FZCC 1EZVE 2N1TA 2WMMA 2WZ7A 2Y9YA 4U3FD 2IZ1A 3RK3B 3L72D 1E5WA 3CWBJ 2Y0DA 1A02F 3S4RA 4HH2A 3MGNA 2BEQD 2L5GB 3AE1C 1IC2A 1CSBA 3CCQP 2O01J 4H13C 1URQD 1Z56A 1S9KE 5AW8B 1BE3E 2KLUA 4HYTB 4PV1B 3BCCG 1PPJE 3MD0A 3A5TA 1LWUC 1J1DB 5TISE 2IBZG 3AE4C 1QVGO 3HD7A 1NTKG 1S5LH 3BCCJ 1IFPA 3GF7A 2XV5A 1JY3N 1P84I 3E1IA 3LIEA 4U3FG 5TISH 3L72G 1PIXA 1S5LE 2V7QH 1IFIA 2K1AA 3WUTA 2E5TA 2AEMA 4MN4C 3Q2YA 1L0NK 2JO1A 3WU2E 1RF0A 3TSIA 3ITKA 3WU2H 1FJKA 1SQXE 1LTSC 2B87A 2KUBA 3GHGB 1RQVA 3VMXA 4EDFA 1UIIA 1VQ7P 2M5AA 2XZRA 3AEEC 5E79E 1HBWA 1PPJD 2KZJA 1KMIZ 3M91A 3PHLA 1N73B 1L0NE 2OARA 2K9YA 3FX0A 1R5LA 3HE4A 1SQQK 3HUSC 4A7PA 1R8EA 1OFCX 1S5LX 2N1TD 3AE6C 3M06A 3VN0A 2OTLP 2YKQA 2M0BA 3L70G 1SFCC 1N7SA 3CX5I 2OYHB 1JCCA 1T6AA 3CWBD 5AVSB 1JY2N 1MZ9A 1X22A 4OVNF 1NTZK 3I56P 1BGYJ 5AW3B 1OW6A 5GTHE 3TGUJ 5KLVG 1NTME 1TU3F 3L75D 1PP9D 1AA0A 4C46A 2WT7B 2I8DA 3JC22 1KFNA 1S1CX 2FXOA 1EZVD 3H1HG 3H1JE 2JEEA 2QJPB 4ZKPA 1NTKK 4IFMA 4RO0A 2BASA 4AQRD 3SFEC 2A06G 2H89C 4ASVA 2LKMA 1HJBA 1PL5A 3AECC 1FBMA 1N2DC 2VRSA 3L71G 1HGZA 4D6TJ 3HTKB 1SFCA 3B4SA 2GA1A 1K05A 2KYVA 2K37A 2YIUB 3O6QA 5CCGC 1ZRTD 2ZT9D 1SQBD 1VF5D 3IAOA 4PD4D 2E75D 1GMJA 4OH8B 5AVUB 3K5BA 2E42A 1N86A 2IYPA 2R3CA 2A06D 4IOIH 3SWKA 2C9LY 4H44C 1LTTC 2O3JA 1NAFA 1HUCA 2WPSA 3FWNA 4BWNA 2IPPA 1PGOA 1YTZI 2OYOA 2SPZA 5DJUB 1GU4A 1BCCG 5KJ7D 3OA7A 1NTZG 2WPVB 3VP9A 2KXPB 2KB7P 1SQQE 3L73D 4YXWH 5GTIE 2KSEA 4W7ZA 3G4SP 1RF1C 3VMYA 2NPSD 4JQ0D 1IO4A 4LGDE 3RK3D 1A02J 1YBKA 2OYIC 3L71E 2AEFA 5H2FE 2QVAA 1JMMA 1KYOE 1LGHB 1SQXJ 5CBNA 2A45H 5KLIB 3BRVB 1Q81Q 2K88A 2Y0CA 2OTJP 1M1JC 3KHUA 3AEDC 3D6ZA 1BCCD 2FYZA 3HE5A 3LW5H 2BEZF 2QRXA 3H1LG 2B87B 3AEGC 2KP8A 1HH0A 3AE2C 3O8ZA 4OGQD 1SQPG 1JM0A 4WY4A 3HD7D 2ZVNB 1VQNP 3FGAD 3IF4A
chains in the Genus database with same CATH topology
2KIKA 5K5GB 3RGUA 3MZWB 2B88A 2UWJE 4NPEA 2LR2A 1DEEG 1MFTA 1SS1A 4HB1A 4GOFA 3QWOC 1EDKA 4K35A 2WMMA 1X0TA 2LXCB 5EFWB 4HKZH 1U7MA 1JMBA 4GOEA 4EYYQ 1LP1B 1U7JA 4KJMA 3S1KA 2LXBA 2R44A 5DJTB 4MN4C 3ZDMA 2K3RA 4HJGH 1EC5A 2B87A 4ZNCA 2KUBA 2M5AA 2KZJA 1LT1A 2P58A 5C39A 4NPFX 2B89A 2KS1B 1ZW0A 1Q2NA 2M0BA 2KI7B 1H0TB 1EDJA 1Y47A 2I8DA 2KZIA 4BXLA 2ZAEB 1OVRA 1LP1A 1ZXGA 1OVUA 4ZMDA 4ASVA 1FC2C 5CBOA 1BDCA 1EDLA 4K3AA 1H0TA 4NPDA 2RKLA 3FXEA 4IOIH 2HR3A 3MHVA 1EDIA 2SPZA 5DJUB 4CPGA 4WWIA 4GODA 4JBZA 2JWDA 3PH0A 2M5AB 3FXDA 2QVAA 2OTKE 5CBNA 1S3JA 1BDDA 4ASWA 1NVOA 2QRXA 2B87B 2Q1KA 1JM0A 1OVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIK A;  5K5G B;  3RGU A;  3MZW B;  2B88 A;  2UWJ E;  4NPE A;  2LR2 A;  1DEE G;  1MFT A;  1SS1 A;  4HB1 A;  4GOF A;  3QWO C;  1EDK A;  4K35 A;  2WMM A;  1X0T A;  2LXC B;  5EFW B;  4HKZ H;  1U7M A;  1JMB A;  4GOE A;  4EYY Q;  1LP1 B;  1U7J A;  4KJM A;  3S1K A;  2LXB A;  2R44 A;  5DJT B;  4MN4 C;  3ZDM A;  2K3R A;  4HJG H;  1EC5 A;  2B87 A;  4ZNC A;  2KUB A;  2M5A A;  2KZJ A;  1LT1 A;  2P58 A;  5C39 A;  4NPF X;  2B89 A;  2KS1 B;  1ZW0 A;  1Q2N A;  2M0B A;  2KI7 B;  1H0T B;  1EDJ A;  1Y47 A;  2I8D A;  2KZI A;  4BXL A;  2ZAE B;  1OVR A;  1LP1 A;  1ZXG A;  1OVU A;  4ZMD A;  4ASV A;  1FC2 C;  5CBO A;  1BDC A;  1EDL A;  4K3A A;  1H0T A;  4NPD A;  2RKL A;  3FXE A;  4IOI H;  2HR3 A;  3MHV A;  1EDI A;  2SPZ A;  5DJU B;  4CPG A;  4WWI A;  4GOD A;  4JBZ A;  2JWD A;  3PH0 A;  2M5A B;  3FXD A;  2QVA A;  2OTK E;  5CBN A;  1S3J A;  1BDD A;  4ASW A;  1NVO A;  2QRX A;  2B87 B;  2Q1K A;  1JM0 A;  1OVV A; 
#chains in the Genus database with same CATH topology
 1USE A;  3M0A A;  1VQ5 P;  2WSE H;  3BCC E;  2Q3E A;  1VQK P;  3Q1M A;  4DT0 A;  3HUS B;  1OW8 A;  1J1E B;  2AXT E;  1X8Y A;  3L36 A;  5B5E E;  2Q7C A;  2Y0E A;  2QE7 H;  2AXT H;  1L0N D;  1Y9B A;  3OJA B;  2M3E A;  3B71 A;  4NPE A;  1GDT A;  2W83 C;  1DEE G;  1LTI C;  2KLV A;  3PRJ A;  1BSN A;  2P1J A;  2YO3 A;  5CCH D;  1FE6 A;  1S72 P;  1AFO A;  1BE3 G;  5B66 H;  2ZYG A;  2W8Z A;  4KT0 J;  4I7Z C;  1SQB E;  3CC2 P;  1VQ4 P;  3CCS P;  3H1I E;  3ABV C;  4GOF A;  2IBZ E;  3L74 J;  3F5H A;  2JKV A;  3H32 B;  5AVT B;  4DOJ A;  3W67 A;  1PP9 J;  1M1J B;  3CC4 P;  3BVH A;  2M8R A;  2NRG A;  3NFQ A;  3TGU D;  1H88 A;  2ZXE B;  1VF5 C;  2K9J A;  1T3U A;  1EDK A;  1NTK D;  4K35 A;  3T97 A;  1FOS E;  2I1J A;  4PV1 C;  2FFD B;  1BE3 D;  1NU1 D;  2ZT9 C;  1NGM B;  5KAI E;  1ZN5 A;  1AV1 A;  1KB9 E;  1GD2 E;  2YXR B;  2WSC J;  4D6T E;  2FFD C;  3PLN A;  2C9N Y;  3JCU H;  4EYY Q;  1HVV A;  2QG4 A;  3U1A A;  3HE4 B;  2WVR A;  3D6Y A;  5KKZ B;  1PV3 A;  1U7J A;  2FYN B;  3H1H E;  1RF1 A;  2JP3 A;  2NPS C;  1PFI A;  3E1R A;  1ZR4 A;  3G71 P;  3HTK A;  3A0B E;  2FXP A;  1HTL C;  2BCC D;  2Q3I A;  1QLE D;  5DJT B;  1K04 A;  2C0W A;  5TJH A;  5APQ A;  2H7H A;  1IFJ A;  1N7L A;  2G8Y A;  3CCJ P;  1N7S D;  2GUV A;  3B5N B;  3BCC D;  1SQV J;  2C0X A;  2N9Y B;  5AW2 B;  1VQ8 P;  1YQ3 C;  2R5B A;  1GL2 A;  1PP9 G;  1LT1 A;  3VMZ A;  4NPF X;  1JTH B;  3L74 G;  2WWW A;  1EZV G;  2KS1 B;  3H1H D;  1NOH A;  1VPC A;  1EQ7 A;  4AYC A;  3P8C E;  4U3F E;  1Q2N A;  5KJ7 A;  1G2C B;  3M9B A;  4XE5 B;  4WY4 B;  2IDB A;  3KZI E;  3RK2 B;  4N3Y B;  3Q3D A;  1VQO P;  1KQF B;  1DD4 A;  1JOC A;  3RL0 g;  1PPJ G;  4I2L C;  1SFC D;  1Y47 A;  2ZJS E;  1RY3 A;  1NTK E;  1PGJ A;  2JR8 A;  4OWF A;  1L0L J;  2I1K A;  2WSF H;  2A45 G;  1KN7 A;  2JDI H;  3H6P A;  1JY3 O;  2FBW C;  2FKW B;  1IK9 A;  2RMZ A;  4H13 D;  4ZMD A;  3H1L J;  1Q86 Q;  1CI6 A;  5CBO A;  3KXD A;  1S2E A;  2O1K A;  2Q6Q A;  3BAS A;  1EDL A;  1SQQ G;  3AEA C;  3RBX A;  5KJ7 C;  2HPC A;  1ZP0 C;  4RKU J;  2FYU J;  1NU1 E;  2FXM A;  2QSI A;  2ZYA A;  3LID A;  1H0T A;  4WY4 C;  3R4Y A;  3CWB E;  2Z4E A;  1DD3 A;  1IFM A;  1Q82 Q;  3TYY A;  1NWQ A;  1OZH A;  5AW0 B;  1LJ2 A;  1BGY E;  1NTZ J;  1URQ A;  1RQU A;  2FYN C;  3MHV A;  1WT6 A;  2E74 C;  1L0L E;  2WSC H;  3CXH D;  3E7K A;  1R5S A;  1L4A C;  2WSF J;  2JJL A;  4KHX A;  1GW3 A;  4CPG A;  4RJT A;  3B5N C;  1K73 Q;  2FY8 A;  1KIL A;  4WWI A;  1YI2 P;  2QEX P;  3Q5R A;  4H0L D;  4L75 A;  2GUS A;  5BU5 A;  3A3Y B;  2IFM A;  2JWD A;  2ZT9 B;  3GHG A;  1L2P A;  3KYQ A;  4PD4 E;  3L72 J;  1H8A A;  3USS A;  3CXH I;  4PD4 H;  4U3F J;  1MFZ A;  1S3J A;  4R4M A;  2YO2 A;  4Y99 B;  1LTJ A;  5KLI C;  1T3J A;  2O01 N;  3V2P A;  4D6T G;  3TF5 A;  4WVZ A;  4XA4 A;  3H1J D;  1KFM A;  3OAK A;  4Z1M H;  1T2K D;  2GM4 A;  1KC8 Q;  5AVV B;  1S9K D;  1RE4 A;  5KAF H;  1NO4 A;  4H13 B;  2IX7 C;  3RL0 B;  1ZR2 A;  1RF1 B;  1JUN A;  4W7Y A;  5KAF E;  2KIK A;  2PFX A;  1NHL A;  4YXD C;  1GTW A;  1Y8A A;  1L4A B;  4YTP C;  3RGU A;  4EOT A;  1VF5 B;  5APV A;  5AVQ B;  1G2C A;  1NU1 K;  3A0H H;  1KZU B;  1ZOY C;  2KSJ A;  3GHG C;  1J1E C;  3GG2 A;  5GTH H;  1DIP A;  3BAT A;  1MFT A;  2R5D A;  1FOS F;  3L70 J;  2XU6 A;  3CCM P;  4I7Z B;  1KIL D;  2Q9I A;  3SSU A;  4HB1 A;  1GW4 A;  3H1L E;  2P7J A;  2W27 A;  1EXJ A;  2YIU C;  1BCC E;  1RE3 A;  3CCL P;  1YJW P;  1SP4 A;  4RES B;  4N78 E;  1SQP K;  1NTM K;  1QGK B;  1L4A D;  1SQV D;  1SQX G;  2H88 C;  1X0T A;  3AE5 C;  4EI2 A;  3OW2 O;  2LXC B;  1M90 Q;  2Q5U A;  3AE8 C;  5EFW B;  3KPE A;  3KDP B;  1U7M A;  4HKZ H;  4C7N A;  2BCC G;  2IBZ I;  2ITA A;  2QJY B;  1VL2 A;  2QJP C;  2ZFC A;  2JWA A;  2OQQ A;  2WPQ A;  4GOE A;  4I1L A;  5APW A;  4R4L A;  3G9R A;  3MUD A;  4GT1 A;  1VQM P;  1LP1 B;  1OXZ A;  1YHQ P;  3RK2 C;  1AQ5 A;  3H1K J;  4KJM A;  1FU1 A;  1SQX D;  2IYO A;  4L76 A;  4EIJ A;  3S1K A;  5KLV E;  2LXB A;  2R44 A;  2P2U A;  2WSS H;  3IR9 A;  1NU1 G;  5CHX A;  4OGQ C;  3SWF A;  1FDO A;  5GTI H;  3WUV A;  4PJ0 H;  1K9M Q;  3CWB G;  3WUU A;  1JY3 P;  2E76 D;  4PJ0 E;  4HJG H;  1N73 C;  1EC5 A;  4ZNC A;  1NTK J;  1OW7 A;  5APU A;  2KK7 A;  1KYO H;  1IJD B;  3L4F A;  4L73 A;  5KLV J;  1W2E A;  2FFD A;  3P8M C;  4JYC A;  4U7J A;  2P58 A;  3HUS A;  2B89 A;  1DX7 A;  2FYU E;  3TGU E;  1OX3 A;  3M9H A;  1J2J B;  3R2P A;  1X9V A;  1ZW0 A;  3AEF C;  3IFM A;  3H25 A;  1KTM A;  2KI7 B;  4IL6 X;  2W6J H;  3IN6 A;  2NPS B;  3KQG A;  4WBA A;  1CW5 A;  1H0T B;  3D70 A;  1BSH A;  3C1L A;  3B8E B;  1LNQ A;  5KKZ C;  1KQS O;  5B5E H;  2RH0 A;  1YIJ P;  3CI9 A;  1HWT C;  1GK4 A;  1IK7 A;  4UB6 E;  2H43 A;  3HD7 C;  1VQ9 P;  4UB6 H;  1SQV E;  1URQ B;  1KYO D;  4BXL A;  1ZRT E;  2ZAE B;  1FAV A;  1OVR A;  1ZXG A;  1OVU A;  5B66 E;  3L74 E;  3CLQ A;  1FC2 C;  3AEB C;  1KIL E;  3H1K G;  1BDC A;  2QM7 A;  3TNU B;  3P7K A;  5AW4 B;  1NAY A;  3L75 G;  1T2K C;  1MKM A;  5CMZ A;  1PGQ A;  3V4Q A;  5CCG A;  4TT3 H;  3GF3 A;  3L73 G;  3N4X A;  3G3Z A;  1NH4 A;  1SFC B;  3V6I A;  2OYH C;  1YQ4 C;  2YKP A;  2RKL A;  4LLH A;  2NZ2 A;  2PAJ A;  3PTZ A;  3MP7 B;  2N9B A;  1GL2 B;  1IFD A;  1SLQ A;  1CZQ A;  3H1K D;  2WSE J;  1LWU B;  1SQQ D;  2CPB A;  2HOD B;  4GKG A;  4L74 A;  5CCH C;  3CCU P;  3CX5 D;  3H1J G;  4BRY A;  1DH3 A;  5AVW B;  3TDK A;  3GLM A;  1FS0 E;  1NTM J;  3EWK A;  3EQ2 A;  4GOD A;  3C9I A;  5CJ4 A;  4JBZ A;  1JCD A;  1WMK A;  2H8P D;  3PH0 A;  1NYH A;  1YJ9 P;  2BCC J;  1URQ C;  4DJG A;  2E75 B;  4M3L A;  1RH5 B;  3JSV C;  3RK3 C;  1SQB J;  4C7N B;  4ZKU A;  1AJY A;  2XND H;  2YNY A;  3L37 A;  3A7O A;  3H1I G;  5E79 H;  2E76 C;  1J1D C;  1SQQ J;  1BGY G;  1FZE A;  5BVZ A;  5KTB A;  3I5C A;  5BU8 B;  2QM8 A;  1LT9 C;  1NVO A;  3M9Q A;  2YMK A;  5APS A;  3RK3 E;  3CXH H;  4PD4 I;  2OYI B;  1QVF O;  1OVV A;  1L0L D;  2FYU K;  2HLO A;  2PP6 A;  1LTJ C;  3CXH E;  3HRN A;  1VQ6 P;  4O9B A;  2D2C C;  3N7N A;  3V2N A;  2AXC A;  1RF0 C;  3M0D A;  5CJ0 A;  2HG5 D;  2V4H A;  1M1K Q;  1IZN B;  1FZC B;  2B88 A;  2BCC E;  1N7S B;  3KZI H;  2J5U A;  3RBZ A;  3NXS A;  4H44 B;  4WB4 A;  1CI6 B;  1LTJ B;  1EZV I;  3D71 A;  3CC7 P;  5AVR B;  1L0L G;  1SS1 A;  3M0D C;  4OGQ B;  2K9J B;  3MIW A;  5L8R J;  3T97 B;  1LT9 B;  1OWA A;  1S4X A;  3QWO C;  4N78 D;  1ZLL A;  1HF9 A;  4XFJ A;  2POH A;  5APT A;  1KB9 D;  2WIT A;  1MV8 A;  2D2C D;  1L0N G;  2OYH A;  1L0N J;  1AVY A;  2MJZ A;  1H89 A;  1AVO A;  1T8Z A;  1WRG A;  1E79 H;  1M1J A;  1Q90 D;  2WPR A;  1P84 E;  4GDO A;  1RE3 C;  1JMB A;  4W80 A;  1JB0 J;  1P84 H;  1YYC A;  1NTM D;  1W5C E;  2MKV A;  1VDF A;  2YXQ B;  3P32 A;  1KIL B;  2Z5H A;  1ZME C;  1NJI Q;  2FYU G;  3TGU G;  1USD A;  3TK1 A;  2OGU A;  4AUW A;  1SQV G;  1AQT A;  3EFF K;  2HYN A;  2O1J A;  3Q5S A;  3F89 A;  2NPS A;  3CME P;  2E75 C;  3NTN A;  5KLV K;  2Z5I A;  5H2F H;  1SQP J;  4BRY B;  2RN0 A;  2W6B A;  1LTB C;  3CX5 H;  1NTM G;  1QL2 A;  1LTG C;  2K3R A;  1SQX K;  4Y28 J;  1JTH A;  4N6J A;  3ZDM A;  3CX5 E;  4DCK A;  3CCR P;  4C7R A;  1L0L K;  2FYU D;  3U1C A;  1N7S C;  1YJN P;  1Q7Y Q;  2AEJ A;  3EFG A;  2XKM A;  2WTY A;  2E5Y A;  1JY2 O;  1GL2 C;  2N1T C;  2KOG A;  1M8O B;  2A06 E;  2V7Q J;  2XDJ A;  4JYB A;  1QL1 A;  1KQL A;  3GW6 A;  1HGV A;  1PGP A;  3CL3 D;  3RL0 C;  1BE3 J;  3A2A A;  3TNU A;  2KNC B;  1OIP A;  2HPC B;  1KOR A;  1EDJ A;  2DW3 A;  3O6Q B;  1JNM A;  2OYI A;  1VQP P;  4QMA A;  3L71 D;  1UIX A;  1KV4 A;  2E74 D;  2P10 A;  4H0L C;  1YTZ T;  1NTZ E;  3VYI A;  2E76 B;  5AVX B;  4Y99 C;  1LTA C;  4GIF A;  3CCV P;  2Y9Z A;  3I55 P;  2KZI A;  3A0H E;  4B86 A;  3II6 A;  3L74 D;  5APY A;  2ZYD A;  2M3B A;  1SVF A;  1K8A Q;  2W6A A;  1FZG A;  5CCH A;  1SQV K;  1XTC C;  3L70 D;  1FZF A;  1LP1 A;  3C8V A;  3H1H J;  2YKO A;  2N1T B;  3MUD C;  1GU5 A;  3HD7 B;  1KD1 Q;  3RL0 D;  1SQP E;  4IL6 E;  4LC1 A;  2CPS A;  2W90 A;  1HJ0 A;  3L75 J;  1OMI A;  3G6E P;  3L72 E;  4IL6 H;  1XTG B;  4K3A A;  2XNX A;  1QEX A;  2ZXX A;  4WY4 D;  1P84 D;  4H0L B;  5KLV D;  1LT9 A;  3L71 J;  2E74 B;  3RK2 D;  3H32 A;  4NPD A;  3W68 A;  2R3S A;  2WQY C;  3V2R A;  1VQL P;  1FDM A;  1FZC A;  5KAI H;  1KB9 H;  3AE9 C;  1M7L A;  5M1B A;  3B5N D;  3JCU E;  5C39 A;  2PGD A;  3FXE A;  3WMM 0;  2ZVO B;  1IFN A;  2HR3 A;  1N73 A;  1FZB A;  2O01 H;  3HE5 B;  3H1J J;  2J59 M;  3H1I D;  5APX A;  4YPC A;  1EDI A;  3CD6 P;  1FJP A;  4TLF A;  2A45 I;  1KYO I;  3H1I J;  1FDI A;  1KIL C;  1GK6 A;  2HFE D;  2IFN A;  2D2C B;  3A0B H;  3L70 E;  1SQB G;  4JF7 A;  3PP5 A;  1JEK A;  3BRT B;  1SQP D;  4IFF A;  2P67 A;  5AW7 B;  1NU1 J;  2M5A B;  3V5B A;  2YMY A;  1M57 D;  3L73 J;  3FXD A;  3L73 E;  1NKN A;  3VOP A;  3AE7 C;  3GMA A;  2OTK E;  2QJK C;  3VMA A;  1FZA A;  2L91 A;  4I6M C;  2WT7 A;  4H44 D;  1KQG B;  1GL2 D;  3S9O A;  2IZ0 A;  1G1J A;  1U57 A;  1N8R Q;  2QJK B;  1NTZ D;  1BDD A;  1RE4 C;  4ASW A;  2Q1K A;  3LW5 J;  1JY2 P;  2R32 A;  3L75 E;  4UB8 E;  3VTP C;  1ZV8 A;  3L35 A;  3SWY A;  1EXI A;  1GZL A;  3AE3 C;  1YIT P;  3H1K E;  4UB8 H;  5AW1 B;  2QJY C;  5CCG D;  4IFD K;  4JPZ B;  5AVZ B;  3CPW O;  2J58 A;  5AVY B;  5K5G B;  2KS1 A;  1MUU A;  3NMD A;  5AW5 B;  1W2B O;  3MZW B;  1RHZ B;  3U59 A;  3Q5P A;  1PZQ A;  3V4W A;  2UWJ E;  4D6T D;  1BGY D;  1M56 D;  3PJS K;  2LR2 A;  2KNC A;  2G3A A;  5AW9 B;  3SFD C;  3B5N A;  1QX8 A;  2QA4 P;  3H1L D;  1L4A A;  1D7M A;  1JO5 A;  3QH9 A;  2PRR A;  2E43 A;  1X79 B;  1NKZ B;  2B9B A;  1DEB A;  1LWU A;  2HOD A;  1SQB K;  4PV1 D;  3V2Q A;  3VP8 A;  3CCE P;  3P8C D;  2QIW A;  1BCC J;  3UIA A;  1KB9 I;  1PP9 E;  5AW6 B;  3CMA P;  3FWL A;  4DZO A;  3MTU E;  2IBZ D;  1G1I A;  2CK3 H;  1FZC C;  1EZV E;  2N1T A;  2WMM A;  2WZ7 A;  2Y9Y A;  4U3F D;  2IZ1 A;  3RK3 B;  3L72 D;  1E5W A;  3CWB J;  2Y0D A;  1A02 F;  3S4R A;  4HH2 A;  3MGN A;  2BEQ D;  2L5G B;  3AE1 C;  1IC2 A;  1CSB A;  3CCQ P;  2O01 J;  4H13 C;  1URQ D;  1Z56 A;  1S9K E;  5AW8 B;  1BE3 E;  2KLU A;  4HYT B;  4PV1 B;  3BCC G;  1PPJ E;  3MD0 A;  3A5T A;  1LWU C;  1J1D B;  5TIS E;  2IBZ G;  3AE4 C;  1QVG O;  3HD7 A;  1NTK G;  1S5L H;  3BCC J;  1IFP A;  3GF7 A;  2XV5 A;  1JY3 N;  1P84 I;  3E1I A;  3LIE A;  4U3F G;  5TIS H;  3L72 G;  1PIX A;  1S5L E;  2V7Q H;  1IFI A;  2K1A A;  3WUT A;  2E5T A;  2AEM A;  4MN4 C;  3Q2Y A;  1L0N K;  2JO1 A;  3WU2 E;  1RF0 A;  3TSI A;  3ITK A;  3WU2 H;  1FJK A;  1SQX E;  1LTS C;  2B87 A;  2KUB A;  3GHG B;  1RQV A;  3VMX A;  4EDF A;  1UII A;  1VQ7 P;  2M5A A;  2XZR A;  3AEE C;  5E79 E;  1HBW A;  1PPJ D;  2KZJ A;  1KMI Z;  3M91 A;  3PHL A;  1N73 B;  1L0N E;  2OAR A;  2K9Y A;  3FX0 A;  1R5L A;  3HE4 A;  1SQQ K;  3HUS C;  4A7P A;  1R8E A;  1OFC X;  1S5L X;  2N1T D;  3AE6 C;  3M06 A;  3VN0 A;  2OTL P;  2YKQ A;  2M0B A;  3L70 G;  1SFC C;  1N7S A;  3CX5 I;  2OYH B;  1JCC A;  1T6A A;  3CWB D;  5AVS B;  1JY2 N;  1MZ9 A;  1X22 A;  4OVN F;  1NTZ K;  3I56 P;  1BGY J;  5AW3 B;  1OW6 A;  5GTH E;  3TGU J;  5KLV G;  1NTM E;  1TU3 F;  3L75 D;  1PP9 D;  1AA0 A;  4C46 A;  2WT7 B;  2I8D A;  3JC2 2;  1KFN A;  1S1C X;  2FXO A;  1EZV D;  3H1H G;  3H1J E;  2JEE A;  2QJP B;  4ZKP A;  1NTK K;  4IFM A;  4RO0 A;  2BAS A;  4AQR D;  3SFE C;  2A06 G;  2H89 C;  4ASV A;  2LKM A;  1HJB A;  1PL5 A;  3AEC C;  1FBM A;  1N2D C;  2VRS A;  3L71 G;  1HGZ A;  4D6T J;  3HTK B;  1SFC A;  3B4S A;  2GA1 A;  1K05 A;  2KYV A;  2K37 A;  2YIU B;  3O6Q A;  5CCG C;  1ZRT D;  2ZT9 D;  1SQB D;  1VF5 D;  3IAO A;  4PD4 D;  2E75 D;  1GMJ A;  4OH8 B;  5AVU B;  3K5B A;  2E42 A;  1N86 A;  2IYP A;  2R3C A;  2A06 D;  4IOI H;  3SWK A;  2C9L Y;  4H44 C;  1LTT C;  2O3J A;  1NAF A;  1HUC A;  2WPS A;  3FWN A;  4BWN A;  2IPP A;  1PGO A;  1YTZ I;  2OYO A;  2SPZ A;  5DJU B;  1GU4 A;  1BCC G;  5KJ7 D;  3OA7 A;  1NTZ G;  2WPV B;  3VP9 A;  2KXP B;  2KB7 P;  1SQQ E;  3L73 D;  4YXW H;  5GTI E;  2KSE A;  4W7Z A;  3G4S P;  1RF1 C;  3VMY A;  2NPS D;  4JQ0 D;  1IO4 A;  4LGD E;  3RK3 D;  1A02 J;  1YBK A;  2OYI C;  3L71 E;  2AEF A;  5H2F E;  2QVA A;  1JMM A;  1KYO E;  1LGH B;  1SQX J;  5CBN A;  2A45 H;  5KLI B;  3BRV B;  1Q81 Q;  2K88 A;  2Y0C A;  2OTJ P;  1M1J C;  3KHU A;  3AED C;  3D6Z A;  1BCC D;  2FYZ A;  3HE5 A;  3LW5 H;  2BEZ F;  2QRX A;  3H1L G;  2B87 B;  3AEG C;  2KP8 A;  1HH0 A;  3AE2 C;  3O8Z A;  4OGQ D;  1SQP G;  1JM0 A;  4WY4 A;  3HD7 D;  2ZVN B;  1VQN P;  3FGA D;  3IF4 A; 
#chains in the Genus database with same CATH homology
 2KIK A;  5K5G B;  3RGU A;  3MZW B;  2B88 A;  2UWJ E;  4NPE A;  2LR2 A;  1DEE G;  1MFT A;  1SS1 A;  4HB1 A;  4GOF A;  3QWO C;  1EDK A;  4K35 A;  2WMM A;  1X0T A;  2LXC B;  5EFW B;  4HKZ H;  1U7M A;  1JMB A;  4GOE A;  4EYY Q;  1LP1 B;  1U7J A;  4KJM A;  3S1K A;  2LXB A;  2R44 A;  5DJT B;  4MN4 C;  3ZDM A;  2K3R A;  4HJG H;  1EC5 A;  2B87 A;  4ZNC A;  2KUB A;  2M5A A;  2KZJ A;  1LT1 A;  2P58 A;  5C39 A;  4NPF X;  2B89 A;  2KS1 B;  1ZW0 A;  1Q2N A;  2M0B A;  2KI7 B;  1H0T B;  1EDJ A;  1Y47 A;  2I8D A;  2KZI A;  4BXL A;  2ZAE B;  1OVR A;  1LP1 A;  1ZXG A;  1OVU A;  4ZMD A;  4ASV A;  1FC2 C;  5CBO A;  1BDC A;  1EDL A;  4K3A A;  1H0T A;  4NPD A;  2RKL A;  3FXE A;  4IOI H;  2HR3 A;  3MHV A;  1EDI A;  2SPZ A;  5DJU B;  4CPG A;  4WWI A;  4GOD A;  4JBZ A;  2JWD A;  3PH0 A;  2M5A B;  3FXD A;  2QVA A;  2OTK E;  5CBN A;  1S3J A;  1BDD A;  4ASW A;  1NVO A;  2QRX A;  2B87 B;  2Q1K A;  1JM0 A;  1OVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...