3QWOC

Crystal structure of a motavizumab epitope-scaffold bound to motavizumab fab
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
53
structure length
53
Chain Sequence
b'SYNDEKKLASNEIANLPNLNEEQRSAFLSSINDDPSQSANLLAEAKKLNDAQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords motavizumab light chain
publication title Design and characterization of epitope-scaffold immunogens that present the motavizumab epitope from respiratory syncytial virus.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 22
structure length 53
sequence length 53
chains with identical sequence P
ec nomenclature
pdb deposition date 2011-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3qwoC00
4HKZH 4BXLA 4MN4C 2KS1B 4EYYQ 1EDJA 4JBZA 4IOIH 5K5GB 4KJMA 1OVUA 2Q1KA 2R44A 1LT1A 1S3JA 2SPZA 4HB1A 3S1KA 1U7JA 2B89A 2B87A 1OVVA 2B87B 5CBOA 3MHVA 3ZDMA 4K35A 1U7MA 4NPEA 2B88A 5CBNA 4GODA 1EDIA 1BDCA 1ZXGA 4ASWA 1BDDA 1JM0A 2KIKA 1MFTA 4CPGA 2M5AA 3PH0A 2ZAEB 5DJUB 4ASVA 1EC5A 2K3RA 4K3AA 2KUBA 5DJTB 4WWIA 3MZWB 3FXEA 2HR3A 1FC2C 1NVOA 2P58A 2OTKE 5EFWB 2QVAA 1OVRA 2M0BA 1JMBA 4ZMDA 3QWOC 5C39A 2RKLA 1SS1A 1Q2NA 2JWDA 4GOFA 2UWJE 1H0TA 2M5AB 2KZIA 1EDKA 1DEEG 2I8DA 1X0TA 2KZJA 1H0TB 2LXCB 4GOEA 2LXBA 3FXDA 1Y47A 2LR2A 1EDLA 1ZW0A 2QRXA 4NPFX 3RGUA 4NPDA 2KI7B 1LP1A 4ZNCA 1LP1B 4HJGH 2WMMA
chains in the Genus database with same CATH superfamily
2RH0A 4XA4A 1FZFA 1PIXA 4OGQC 2I1JA 2YKOA 1T2KD 4N78E 1A02J 1M8OB 1NGMB 2IX7C 2Y0DA 2Q1KA 2O01H 1KZUB 1CW5A 3BASA 3V2QA 3L71J 1PV3A 1N7LA 2K37A 3KDPB 2GM4A 1QVFO 5CCHA 3HD7C 1FJPA 1JCCA 1L0NE 1Z56A 4GT1A 4D6TE 1J1EC 4N3YB 3K5BA 3M9BA 2QJPB 3A5TA 3CX5D 3Q5SA 2BCCJ 3HE5B 1NVOA 1RE3A 3L72J 3VMAA 2NPSD 3HD7B 2GUSA 1SQQK 3H1ID 2CPSA 2RKLA 2OYIC 3G71P 1GW3A 3WU2E 1S5LX 2UWJE 3D70A 3CCEP 1FZBA 1NO4A 2NZ2A 5AVSB 1R5LA 3FWNA 2R3CA 1KILD 2XDJA 3AE7C 3N7NA 1NTME 1ZRTE 1AV1A 1L4AC 3GF7A 3CCSP 3L73D 1RF0A 1RQUA 2KNCA 2YKQA 1OZHA 3H1JD 3VMXA 3E7KA 1T6AA 2YXQB 2Q3IA 2YIUB 1L0NG 1URQA 4H13C 2YO3A 1IFIA 3HRNA 4D6TG 1LTAC 4RJTA 1SQPE 2FXPA 5GTIH 1KYOI 4ZKPA 1JUNA 3A0BH 5KLVE 3UIAA 3TF5A 1LNQA 5H2FH 4QMAA 2KUBA 5CCGD 3GF3A 3KHUA 4PV1C 1DH3A 1H8AA 2M0BA 5KAFH 4Z1MH 3QWOC 5C39A 1NTMG 2ZVNB 2A45H 1VQ5P 1IK7A 1X0TA 4PV1B 1JY2O 4BRYB 2OYHC 1ZP0C 1IFDA 3KZIH 3BCCE 1Y47A 3LW5J 2N1TA 1L0LK 1NTZE 3S9OA 3E1RA 1EZVI 4ZNCA 3JSVC 4HJGH 4JF7A 1J1DC 2JR8A 2OYHB 1FZCA 2E75D 5TJHA 1RF1B 1QL1A 2YO2A 1OMIA 1SQPG 5E79E 3GMAA 2IYOA 3AEFC 3RBZA 1NAYA 5KLVG 1JY2N 1KB9I 1DIPA 1VDFA 4YXDC 1JY3O 2E74C 1BGYJ 1L0ND 4PD4I 2HPCB 4K35A 1M1JB 1HTLC 4D6TD 1LTSC 4OGQD 1ZLLA 1IFNA 3RK2B 1VQKP 1K8AQ 3H6PA 1VL2A 2VRSA 2ZT9C 2WVRA 1NTZK 3MZWB 2WSFH 1NTZG 3EWKA 2RMZA 1LWUA 3L71E 2KS1A 1NTMD 1ZRTD 3G9RA 3B4SA 3WUUA 4WY4B 1IZNB 2WPVB 2WSEH 1USEA 3W68A 5APUA 2W6JH 3V6IA 3F89A 4W7ZA 5AVTB 3AEBC 2HYNA 2BCCE 3NXSA 2WSSH 2ZYDA 4EI2A 3VMYA 1T2KC 3CXHE 2KS1B 3L72E 2WSCH 4IOIH 4KJMA 3G4SP 3A3YB 1M7LA 2QIWA 2IZ0A 4H44C 4DJGA 1SQPD 2B89A 1L0NJ 1OVVA 1S72P 5KLVD 3HUSB 3F5HA 5KJ7C 5AW6B 1KQSO 1SQBJ 2AXCA 1KORA 4Y28J 4TLFA 3G3ZA 1MFTA 2ZAEB 1S5LE 3L71G 4H13D 5APWA 3CWBJ 3P8CE 3V2NA 1SFCA 2XNDH 3L37A 4AQRD 1NKZB 1VQNP 1N86A 3HTKA 3JCUE 1LTJA 4GOFA 1NTMJ 1GL2A 1YBKA 1NTZD 2QA4P 2NPSB 1YIJP 2BCCG 1YI2P 3L72G 2FYNC 3L70J 3AE4C 3V2RA 1KILC 2M3EA 2O01J 1SFCB 5AVVB 2OARA 4JQ0D 3H32B 1R8EA 2BASA 2J59M 3GW6A 2E42A 2A06E 3MUDC 3OJAB 2R32A 2YKPA 3CL3D 1SQPJ 1N73B 2Q7CA 5KLVJ 3RK3C 1KFNA 1AA0A 3MHVA 1KYOH 1BCCE 1Q82Q 1VQ6P 1BDCA 2P1JA 4ASWA 3I5CA 1FAVA 2C0WA 3WUVA 3TYYA 3IN6A 3SWKA 1HGVA 1PGPA 3B5NA 2ZYGA 3CC2P 1VQOP 1IC2A 1FZAA 2E74D 3L71D 3BCCJ 1NAFA 4HH2A 5BU5A 3RK3E 1KQGB 4W7YA 1BGYE 1DEEG 1PGOA 1MUUA 2V7QH 2XV5A 1FJKA 2HODB 2ZT9D 1P84I 2RN0A 2BCCD 2FY8A 2A06G 1N7SD 1T3UA 3CXHD 3M9HA 2FFDC 3L72D 3AEEC 1LP1A 3AEGC 5APVA 2YXRB 2H8PD 5AW0B 1LGHB 2IDBA 2WMMA 2MJZA 2E75C 1BCCG 1RE4C 2FFDB 1MV8A 1KB9H 3M0DC 3V2PA 5AW4B 3CCLP 1RHZB 5KKZB 1IFPA 2E75B 4PD4H 1EXJA 1U7JA 1KC8Q 1NU1E 3KYQA 1VQ9P 5CBOA 5AVXB 3CLQA 1Y8AA 2Z5HA 3RL0B 1IFMA 3PH0A 5B5EH 3P8CD 5B66E 1IFJA 2Y9ZA 1BGYG 1RH5B 4H44D 3HE5A 4OGQB 4R4LA 2QJYC 1W2BO 1YTZI 3CMAP 2OTKE 3HD7A 5EFWB 2JJLA 4PJ0E 5KJ7D 2D2CD 1UIIA 4ZMDA 1Q2NA 3SFDC 4UB6E 1YTZT 2KXPB 4O9BA 4I7ZC 3SSUA 1H0TB 1OW6A 1HUCA 1SQBE 1JCDA 1X79B 3Q3DA 1LJ2A 1WRGA 1IO4A 1FS0E 1J1EB 2N9YB 2A06D 5CCHC 1BE3E 1NU1G 2IBZE 3CWBE 3MTUE 3V5BA 2WTYA 2P67A 2KK7A 1HWTC 1NHLA 2WPQA 1HGZA 1L4AA 1OVUA 2R44A 2OYIB 1KV4A 1RE3C 2P10A 1BCCD 3IFMA 1JEKA 3L70E 3TK1A 4I1LA 3ZDMA 2WSFJ 1L0NK 2AXTH 4GODA 1D7MA 2Z5IA 1L4AB 1NH4A 2KB7P 1SQBK 3AE1C 1JMMA 1CZQA 1FC2C 2JWAA 4U3FJ 3RK3D 1JTHB 1BGYD 1SQBG 2Q5UA 2WSEJ 2ZYAA 1H88A 4H0LD 5GTHH 5AW8B 1USDA 4H13B 5AW9B 2MKVA 4BRYA 2I8DA 2K1AA 1URQC 5KAIH 2HG5D 2LXCB 2WSCJ 1GTWA 1T3JA 2IBZG 1NTMK 3CWBG 4I6MC 1OXZA 2KP8A 3R2PA 3M06A 3QH9A 2P2UA 1CSBA 4TT3H 2WWWA 3WUTA 2OYHA 2IYPA 1RF1A 1EDJA 3L70G 3U59A 3PJSK 4IL6X 3C9IA 1NU1D 1BCCJ 3B5ND 3T97B 1LT1A 4HB1A 4N78D 2JDIH 1KQLA 1SQPK 3AEDC 3AE3C 2HPCA 2B87B 2BEQD 1M1JA 1GD2E 2W27A 2E76D 5KLVK 1U7MA 3EQ2A 4C46A 5AVZB 1GK6A 2CPBA 3CCVP 4JPZB 1JB0J 5DJUB 1J1DB 3B71A 1S4XA 3Q5PA 4KT0J 1JO5A 1PFIA 4L76A 5GTIE 1X22A 2E43A 3A0BE 1FZCC 3CCMP 3H1KJ 3M0AA 5AVYB 5H2FE 2M8RA 3BRVB 1Y9BA 3AE5C 1SS1A 1SQBD 3AE2C 3PLNA 1W5CE 1P84H 2E74B 2AEMA 5APTA 1S2EA 4GOEA 2AEJA 2L91A 5KAFE 1T8ZA 1GDTA 4WY4A 1N7SC 3AEAC 3FXDA 1BE3D 2HLOA 3IAOA 1EDLA 3BCCG 2IBZD 3CWBD 1MFZA 2ZT9B 1PP9J 1VPCA 1K04A 1KN7A 2C9NY 3KZIE 3Q1MA 1LTBC 4EYYQ 1NU1J 5APYA 2K9YA 1U57A 1NYHA 1RY3A 3I55P 5L8RJ 2QE7H 3L70D 2Y9YA 3AECC 1ZMEC 1FZEA 1ZN5A 1HJ0A 1SQQJ 3HUSA 5CCHD 1LWUC 3MP7B 2ZVOB 1VF5C 1AQTA 1XTCC 2C9LY 2WPRA 3CC4P 2O1KA 3GHGC 5AVUB 2QG4A 3CX5H 5BVZA 5DJTB 2V7QJ 5CJ4A 5AVWB 3P7KA 3PTZA 1SQVJ 1PZQA 2D2CC 4UB8H 2POHA 1P84E 3GHGB 4H44B 3H1HJ 1JMBA 2H43A 1GU5A 4XFJA 2ITAA 2A45G 3O6QB 2NPSA 2KZIA 1EDKA 1DX7A 1JOCA 2YMYA 3PP5A 1BE3J 2JP3A 1FDMA 2R5BA 2LR2A 3LIEA 1AJYA 1KTMA 4IL6H 3D71A 1YQ4C 3H32A 3PHLA 1HJBA 2QM7A 3V4QA 1BSNA 1QX8A 3BCCD 2N9BA 5APXA 1OIPA 5AVQB 4Y99C 1KILA 4U3FE 1VQPP 2FKWB 2Q3EA 4I2LC 1URQD 1NWQA 3CMEP 1IK9A 2J58A 1N73A 5CJ0A 3Q2YA 2GA1A 4WB4A 4YPCA 4Y99B 1G1JA 2FYNB 3WMM0 1GL2C 5AW1B 1KILB 2G3AA 4L73A 1FOSF 4GDOA 1MZ9A 1VQ4P 4EOTA 2FYUE 2KIKA 4K3AA 4WWIA 4LC1A 2Z4EA 1ZOYC 4H0LC 5CCGA 3RK3B 2N1TD 2K9JB 3FWLA 2HODA 4H0LB 3IF4A 2OQQA 4U3FG 1K73Q 1YHQP 3AE6C 1ZW0A 4NPFX 1A02F 3TGUJ 1S9KE 3L75J 4YXWH 2WT7B 3RL0g 2FFDA 1NJIQ 3H1KE 3B5NC 1G1IA 3NFQA 1J2JB 3O8ZA 1RQVA 1NOHA 3KPEA 1LT9C 2FYUG 2NRGA 3S1KA 2W6BA 2CK3H 3SFEC 2E76C 2QJKC 3M0DA 1VQMP 1MKMA 3A2AA 2YNYA 3LIDA 1M1KQ 1Q86Q 1LT9B 1EDIA 2W6AA 1FDIA 1PP9E 3VP9A 4IFDK 2QJKB 4A7PA 1KYOE 3CCQP 1K05A 1P84D 2IPPA 1NTKJ 4RESB 4XE5B 3WU2H 2FXMA 3BVHA 3II6A 3OA7A 1HVVA 3I56P 2Q9IA 2O1JA 1VQ8P 1E5WA 1VF5D 3HE4B 1EQ7A 3L74J 3KQGA 1H0TA 1SQQE 3GLMA 5AW5B 1X8YA 3L36A 1IJDB 1PGQA 2R5DA 3CX5I 3H1KG 1SVFA 3M91A 4U3FD 3ITKA 1G2CA 3VMZA 3VYIA 1YJWP 1LTGC 2QJYB 3BATA 3PRJA 4GKGA 1SQVE 1W2EA 2QJPC 1EZVE 1DD3A 3H1HE 2OYIA 1NU1K 2L5GB 1SP4A 2FBWC 1PP9G 4I7ZB 2OGUA 1SQXJ 1G2CB 2WPSA 3CC7P 1GK4A 1AFOA 1KB9E 2FYUD 3H25A 4NPEA 2B88A 1OWAA 2XU6A 4PD4E 3Q5RA 3U1AA 4CPGA 4OWFA 2C0XA 2IFNA 2K3RA 2V4HA 1SQQG 1SFCD 2IFMA 3TNUA 2H7HA 1JTHA 5AW3B 1XTGB 1Q81Q 2E5YA 1GL2D 2JO1A 5B5EE 1S1CX 1SQVK 5APQA 2FYZA 1CI6A 2YIUC 5AW7B 1YJNP 1KD1Q 2B9BA 3IR9A 1PL5A 1JY2P 4KHXA 1SQVG 1S9KD 1RF0C 1EZVG 3TNUB 3RBXA 2GUVA 3H1HG 3D6YA 1FU1A 4RKUJ 5KLIC 4BWNA 3L35A 3OW2O 3H1KD 3VN0A 2KI7B 4EIJA 5E79H 1L0LE 4ZKUA 3P8MC 1CI6B 4HKZH 1BE3G 1AVOA 2Y0CA 2KNCB 4L75A 5AW2B 1PPJE 2OTLP 1VQ7P 5KLIB 2ZJSE 1EXIA 3T97A 1YYCA 3M9QA 4EDFA 4R4MA 1FDOA 1QLED 4AUWA 1X9VA 5TISH 4M3LA 3MGNA 1URQB 3ABVC 1UIXA 2FYUJ 4DCKA 3MD0A 2B87A 1AQ5A 1JY3P 1PP9D 1DD4A 3H1IJ 5CMZA 4JYBA 3E1IA 1GU4A 1KYOD 1ZR4A 4N6JA 3TGUE 4JYCA 2E5TA 2JEEA 3H1LE 1BDDA 3L75E 1Q90D 4ASVA 1VQLP 3USSA 2AXTE 1BSHA 2PAJA 2KSEA 4IFFA 2W83C 1RF1C 2KSJA 1SQQD 3FGAD 2ZXXA 3A7OA 5BU8B 1FBMA 3L73J 2PFXA 4DOJA 2N1TC 3S4RA 3H1JJ 1L0LG 1FOSE 4RO0A 1OX3A 2PP6A 5GTHE 1PPJG 2LKMA 2FXOA 3CXHH 3NMDA 1M1JC 3KXDA 2QRXA 2KOGA 2N1TB 1SQVD 1YQ3C 1EZVD 3RK2C 1SLQA 2IBZI 3SWFA 5KAIE 1NTKE 3H1HD 3RL0D 1QL2A 1OFCX 1N7SA 4BXLA 2HFED 1L2PA 3FX0A 1FZCB 4JBZA 5TISE 3VTPC 3TGUG 1E79H 1KB9D 3B8EB 1S3JA 3H1LG 3L74E 3L75G 2JKVA 4C7NA 4OH8B 3EFFK 4PD4D 3V4WA 2P7JA 2WQYC 1S5LH 1N7SB 1H89A 2G8YA 5CBNA 4WY4C 4OVNF 3U1CA 1JY3N 4HYTB 3CPWO 4C7RA 2IZ1A 3HD7D 2ZXEB 4C7NB 2W90A 3JCUH 1KMIZ 2P58A 1NTKK 3GHGA 2I1KA 2H88C 3O6QA 3C1LA 1SQXE 2JWDA 3A0HH 1NTKG 5KJ7A 1QVGO 1LWUB 1HBWA 2OTJP 3CD6P 2QEXP 1VF5B 1L0LD 1N2DC 1KQFB 3HUSC 1M57D 3CCUP 1PPJD 1M90Q 3L74G 4WBAA 4W80A 1NKNA 1L4AD 3CCRP 4DT0A 4MN4C 3JC22 5AVRB 4D6TJ 2XKMA 2D2CB 2KLVA 4B86A 3TSIA 5K5GB 3P32A 3LW5H 1JNMA 2SPZA 3EFGA 1WT6A 1LTIC 3MIWA 1OW8A 3TGUD 1PGJA 3H1LD 2NPSC 3L75D 2XNXA 1SQXK 3CI9A 2OYOA 1ZXGA 1ZV8A 1FZGA 3G6EP 1SQXG 1SFCC 3N4XA 3L4FA 1EC5A 4AYCA 2KYVA 2Q6QA 3FXEA 1LTJC 3VOPA 3MUDA 1KFMA 4DZOA 1K9MQ 1N8RQ 2QVAA 4PV1D 4L74A 4YTPC 1WMKA 3A0HE 3CX5E 1HF9A 1YITP 3W67A 1N73C 2WZ7A 2K9JA 3HTKB 1LTJB 1GL2B 2KZJA 3TDKA 1L0LJ 3H1IE 4GIFA 4UB8E 5APSA 2R3SA 1NTKD 4IFMA 2A45I 3OAKA 4LGDE 2QM8A 2WITA 1ZR2A 1GZLA 2DW3A 4WVZA 2WT7A 2BEZF 1QEXA 1KILE 3GG2A 3L74D 4IL6E 3AE9C 3L73E 5CHXA 1LTTC 3CCJP 3H1JE 5CCGC 3NTNA 3CXHI 3H1LJ 4U7JA 2J5UA 2M3BA 3RK2D 1OW7A 2QSIA 5B66H 1HH0A 2YMKA 2FYUK 2K88A 1LT9A 1M56D 2O01N 2O3JA 2PGDA 2Y0EA 3BRTB 1NTZJ 1JM0A 2KLUA 3VP8A 2M5AA 5KTBA 3AE8C 4PJ0H 2HR3A 4UB6H 1RE4A 1AVYA 1SQXD 3H1IG 3B5NB 1YJ9P 1DEBA 3R4YA 1GW4A 1OVRA 1FE6A 3HE4A 2ZFCA 3SWYA 1QGKB 1R5SA 2W8ZA 4WY4D 2E76B 5KKZC 1TU3F 2H89C 2M5AB 3D6ZA 2PRRA 5M1BA 3C8VA 2LXBA 2AEFA 3L73G 1Q7YQ 1GMJA 3RGUA 4LLHA 3RL0C 4NPDA 3H1JG 2XZRA 1LP1B
chains in the Genus database with same CATH topology
4HKZH 4BXLA 4MN4C 2KS1B 4EYYQ 1EDJA 4JBZA 4IOIH 5K5GB 4KJMA 1OVUA 2Q1KA 2R44A 1LT1A 1S3JA 2SPZA 4HB1A 3S1KA 1U7JA 2B89A 2B87A 1OVVA 2B87B 5CBOA 3MHVA 3ZDMA 4K35A 1U7MA 4NPEA 2B88A 5CBNA 4GODA 1EDIA 1BDCA 1ZXGA 4ASWA 1BDDA 1JM0A 2KIKA 1MFTA 4CPGA 2M5AA 3PH0A 2ZAEB 5DJUB 4ASVA 1EC5A 2K3RA 4K3AA 2KUBA 5DJTB 4WWIA 3MZWB 3FXEA 2HR3A 1FC2C 1NVOA 2P58A 2OTKE 5EFWB 2QVAA 1OVRA 2M0BA 1JMBA 4ZMDA 3QWOC 5C39A 2RKLA 1SS1A 1Q2NA 2JWDA 4GOFA 2UWJE 1H0TA 2M5AB 2KZIA 1EDKA 1DEEG 2I8DA 1X0TA 2KZJA 1H0TB 2LXCB 4GOEA 2LXBA 3FXDA 1Y47A 2LR2A 1EDLA 1ZW0A 2QRXA 4NPFX 3RGUA 4NPDA 2KI7B 1LP1A 4ZNCA 1LP1B 4HJGH 2WMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKZ H;  4BXL A;  4MN4 C;  2KS1 B;  4EYY Q;  1EDJ A;  4JBZ A;  4IOI H;  5K5G B;  4KJM A;  1OVU A;  2Q1K A;  2R44 A;  1LT1 A;  1S3J A;  2SPZ A;  4HB1 A;  3S1K A;  1U7J A;  2B89 A;  2B87 A;  1OVV A;  2B87 B;  5CBO A;  3MHV A;  3ZDM A;  4K35 A;  1U7M A;  4NPE A;  2B88 A;  5CBN A;  4GOD A;  1EDI A;  1BDC A;  1ZXG A;  4ASW A;  1BDD A;  1JM0 A;  2KIK A;  1MFT A;  4CPG A;  2M5A A;  3PH0 A;  2ZAE B;  5DJU B;  4ASV A;  1EC5 A;  2K3R A;  4K3A A;  2KUB A;  5DJT B;  4WWI A;  3MZW B;  3FXE A;  2HR3 A;  1FC2 C;  1NVO A;  2P58 A;  2OTK E;  5EFW B;  2QVA A;  1OVR A;  2M0B A;  1JMB A;  4ZMD A;  3QWO C;  5C39 A;  2RKL A;  1SS1 A;  1Q2N A;  2JWD A;  4GOF A;  2UWJ E;  1H0T A;  2M5A B;  2KZI A;  1EDK A;  1DEE G;  2I8D A;  1X0T A;  2KZJ A;  1H0T B;  2LXC B;  4GOE A;  2LXB A;  3FXD A;  1Y47 A;  2LR2 A;  1EDL A;  1ZW0 A;  2QRX A;  4NPF X;  3RGU A;  4NPD A;  2KI7 B;  1LP1 A;  4ZNC A;  1LP1 B;  4HJG H;  2WMM A; 
#chains in the Genus database with same CATH topology
 2RH0 A;  4XA4 A;  1FZF A;  1PIX A;  4OGQ C;  2I1J A;  2YKO A;  1T2K D;  4N78 E;  1A02 J;  1M8O B;  1NGM B;  2IX7 C;  2Y0D A;  2Q1K A;  2O01 H;  1KZU B;  1CW5 A;  3BAS A;  3V2Q A;  3L71 J;  1PV3 A;  1N7L A;  2K37 A;  3KDP B;  2GM4 A;  1QVF O;  5CCH A;  3HD7 C;  1FJP A;  1JCC A;  1L0N E;  1Z56 A;  4GT1 A;  4D6T E;  1J1E C;  4N3Y B;  3K5B A;  3M9B A;  2QJP B;  3A5T A;  3CX5 D;  3Q5S A;  2BCC J;  3HE5 B;  1NVO A;  1RE3 A;  3L72 J;  3VMA A;  2NPS D;  3HD7 B;  2GUS A;  1SQQ K;  3H1I D;  2CPS A;  2RKL A;  2OYI C;  3G71 P;  1GW3 A;  3WU2 E;  1S5L X;  2UWJ E;  3D70 A;  3CCE P;  1FZB A;  1NO4 A;  2NZ2 A;  5AVS B;  1R5L A;  3FWN A;  2R3C A;  1KIL D;  2XDJ A;  3AE7 C;  3N7N A;  1NTM E;  1ZRT E;  1AV1 A;  1L4A C;  3GF7 A;  3CCS P;  3L73 D;  1RF0 A;  1RQU A;  2KNC A;  2YKQ A;  1OZH A;  3H1J D;  3VMX A;  3E7K A;  1T6A A;  2YXQ B;  2Q3I A;  2YIU B;  1L0N G;  1URQ A;  4H13 C;  2YO3 A;  1IFI A;  3HRN A;  4D6T G;  1LTA C;  4RJT A;  1SQP E;  2FXP A;  5GTI H;  1KYO I;  4ZKP A;  1JUN A;  3A0B H;  5KLV E;  3UIA A;  3TF5 A;  1LNQ A;  5H2F H;  4QMA A;  2KUB A;  5CCG D;  3GF3 A;  3KHU A;  4PV1 C;  1DH3 A;  1H8A A;  2M0B A;  5KAF H;  4Z1M H;  3QWO C;  5C39 A;  1NTM G;  2ZVN B;  2A45 H;  1VQ5 P;  1IK7 A;  1X0T A;  4PV1 B;  1JY2 O;  4BRY B;  2OYH C;  1ZP0 C;  1IFD A;  3KZI H;  3BCC E;  1Y47 A;  3LW5 J;  2N1T A;  1L0L K;  1NTZ E;  3S9O A;  3E1R A;  1EZV I;  4ZNC A;  3JSV C;  4HJG H;  4JF7 A;  1J1D C;  2JR8 A;  2OYH B;  1FZC A;  2E75 D;  5TJH A;  1RF1 B;  1QL1 A;  2YO2 A;  1OMI A;  1SQP G;  5E79 E;  3GMA A;  2IYO A;  3AEF C;  3RBZ A;  1NAY A;  5KLV G;  1JY2 N;  1KB9 I;  1DIP A;  1VDF A;  4YXD C;  1JY3 O;  2E74 C;  1BGY J;  1L0N D;  4PD4 I;  2HPC B;  4K35 A;  1M1J B;  1HTL C;  4D6T D;  1LTS C;  4OGQ D;  1ZLL A;  1IFN A;  3RK2 B;  1VQK P;  1K8A Q;  3H6P A;  1VL2 A;  2VRS A;  2ZT9 C;  2WVR A;  1NTZ K;  3MZW B;  2WSF H;  1NTZ G;  3EWK A;  2RMZ A;  1LWU A;  3L71 E;  2KS1 A;  1NTM D;  1ZRT D;  3G9R A;  3B4S A;  3WUU A;  4WY4 B;  1IZN B;  2WPV B;  2WSE H;  1USE A;  3W68 A;  5APU A;  2W6J H;  3V6I A;  3F89 A;  4W7Z A;  5AVT B;  3AEB C;  2HYN A;  2BCC E;  3NXS A;  2WSS H;  2ZYD A;  4EI2 A;  3VMY A;  1T2K C;  3CXH E;  2KS1 B;  3L72 E;  2WSC H;  4IOI H;  4KJM A;  3G4S P;  3A3Y B;  1M7L A;  2QIW A;  2IZ0 A;  4H44 C;  4DJG A;  1SQP D;  2B89 A;  1L0N J;  1OVV A;  1S72 P;  5KLV D;  3HUS B;  3F5H A;  5KJ7 C;  5AW6 B;  1KQS O;  1SQB J;  2AXC A;  1KOR A;  4Y28 J;  4TLF A;  3G3Z A;  1MFT A;  2ZAE B;  1S5L E;  3L71 G;  4H13 D;  5APW A;  3CWB J;  3P8C E;  3V2N A;  1SFC A;  2XND H;  3L37 A;  4AQR D;  1NKZ B;  1VQN P;  1N86 A;  3HTK A;  3JCU E;  1LTJ A;  4GOF A;  1NTM J;  1GL2 A;  1YBK A;  1NTZ D;  2QA4 P;  2NPS B;  1YIJ P;  2BCC G;  1YI2 P;  3L72 G;  2FYN C;  3L70 J;  3AE4 C;  3V2R A;  1KIL C;  2M3E A;  2O01 J;  1SFC B;  5AVV B;  2OAR A;  4JQ0 D;  3H32 B;  1R8E A;  2BAS A;  2J59 M;  3GW6 A;  2E42 A;  2A06 E;  3MUD C;  3OJA B;  2R32 A;  2YKP A;  3CL3 D;  1SQP J;  1N73 B;  2Q7C A;  5KLV J;  3RK3 C;  1KFN A;  1AA0 A;  3MHV A;  1KYO H;  1BCC E;  1Q82 Q;  1VQ6 P;  1BDC A;  2P1J A;  4ASW A;  3I5C A;  1FAV A;  2C0W A;  3WUV A;  3TYY A;  3IN6 A;  3SWK A;  1HGV A;  1PGP A;  3B5N A;  2ZYG A;  3CC2 P;  1VQO P;  1IC2 A;  1FZA A;  2E74 D;  3L71 D;  3BCC J;  1NAF A;  4HH2 A;  5BU5 A;  3RK3 E;  1KQG B;  4W7Y A;  1BGY E;  1DEE G;  1PGO A;  1MUU A;  2V7Q H;  2XV5 A;  1FJK A;  2HOD B;  2ZT9 D;  1P84 I;  2RN0 A;  2BCC D;  2FY8 A;  2A06 G;  1N7S D;  1T3U A;  3CXH D;  3M9H A;  2FFD C;  3L72 D;  3AEE C;  1LP1 A;  3AEG C;  5APV A;  2YXR B;  2H8P D;  5AW0 B;  1LGH B;  2IDB A;  2WMM A;  2MJZ A;  2E75 C;  1BCC G;  1RE4 C;  2FFD B;  1MV8 A;  1KB9 H;  3M0D C;  3V2P A;  5AW4 B;  3CCL P;  1RHZ B;  5KKZ B;  1IFP A;  2E75 B;  4PD4 H;  1EXJ A;  1U7J A;  1KC8 Q;  1NU1 E;  3KYQ A;  1VQ9 P;  5CBO A;  5AVX B;  3CLQ A;  1Y8A A;  2Z5H A;  3RL0 B;  1IFM A;  3PH0 A;  5B5E H;  3P8C D;  5B66 E;  1IFJ A;  2Y9Z A;  1BGY G;  1RH5 B;  4H44 D;  3HE5 A;  4OGQ B;  4R4L A;  2QJY C;  1W2B O;  1YTZ I;  3CMA P;  2OTK E;  3HD7 A;  5EFW B;  2JJL A;  4PJ0 E;  5KJ7 D;  2D2C D;  1UII A;  4ZMD A;  1Q2N A;  3SFD C;  4UB6 E;  1YTZ T;  2KXP B;  4O9B A;  4I7Z C;  3SSU A;  1H0T B;  1OW6 A;  1HUC A;  1SQB E;  1JCD A;  1X79 B;  3Q3D A;  1LJ2 A;  1WRG A;  1IO4 A;  1FS0 E;  1J1E B;  2N9Y B;  2A06 D;  5CCH C;  1BE3 E;  1NU1 G;  2IBZ E;  3CWB E;  3MTU E;  3V5B A;  2WTY A;  2P67 A;  2KK7 A;  1HWT C;  1NHL A;  2WPQ A;  1HGZ A;  1L4A A;  1OVU A;  2R44 A;  2OYI B;  1KV4 A;  1RE3 C;  2P10 A;  1BCC D;  3IFM A;  1JEK A;  3L70 E;  3TK1 A;  4I1L A;  3ZDM A;  2WSF J;  1L0N K;  2AXT H;  4GOD A;  1D7M A;  2Z5I A;  1L4A B;  1NH4 A;  2KB7 P;  1SQB K;  3AE1 C;  1JMM A;  1CZQ A;  1FC2 C;  2JWA A;  4U3F J;  3RK3 D;  1JTH B;  1BGY D;  1SQB G;  2Q5U A;  2WSE J;  2ZYA A;  1H88 A;  4H0L D;  5GTH H;  5AW8 B;  1USD A;  4H13 B;  5AW9 B;  2MKV A;  4BRY A;  2I8D A;  2K1A A;  1URQ C;  5KAI H;  2HG5 D;  2LXC B;  2WSC J;  1GTW A;  1T3J A;  2IBZ G;  1NTM K;  3CWB G;  4I6M C;  1OXZ A;  2KP8 A;  3R2P A;  3M06 A;  3QH9 A;  2P2U A;  1CSB A;  4TT3 H;  2WWW A;  3WUT A;  2OYH A;  2IYP A;  1RF1 A;  1EDJ A;  3L70 G;  3U59 A;  3PJS K;  4IL6 X;  3C9I A;  1NU1 D;  1BCC J;  3B5N D;  3T97 B;  1LT1 A;  4HB1 A;  4N78 D;  2JDI H;  1KQL A;  1SQP K;  3AED C;  3AE3 C;  2HPC A;  2B87 B;  2BEQ D;  1M1J A;  1GD2 E;  2W27 A;  2E76 D;  5KLV K;  1U7M A;  3EQ2 A;  4C46 A;  5AVZ B;  1GK6 A;  2CPB A;  3CCV P;  4JPZ B;  1JB0 J;  5DJU B;  1J1D B;  3B71 A;  1S4X A;  3Q5P A;  4KT0 J;  1JO5 A;  1PFI A;  4L76 A;  5GTI E;  1X22 A;  2E43 A;  3A0B E;  1FZC C;  3CCM P;  3H1K J;  3M0A A;  5AVY B;  5H2F E;  2M8R A;  3BRV B;  1Y9B A;  3AE5 C;  1SS1 A;  1SQB D;  3AE2 C;  3PLN A;  1W5C E;  1P84 H;  2E74 B;  2AEM A;  5APT A;  1S2E A;  4GOE A;  2AEJ A;  2L91 A;  5KAF E;  1T8Z A;  1GDT A;  4WY4 A;  1N7S C;  3AEA C;  3FXD A;  1BE3 D;  2HLO A;  3IAO A;  1EDL A;  3BCC G;  2IBZ D;  3CWB D;  1MFZ A;  2ZT9 B;  1PP9 J;  1VPC A;  1K04 A;  1KN7 A;  2C9N Y;  3KZI E;  3Q1M A;  1LTB C;  4EYY Q;  1NU1 J;  5APY A;  2K9Y A;  1U57 A;  1NYH A;  1RY3 A;  3I55 P;  5L8R J;  2QE7 H;  3L70 D;  2Y9Y A;  3AEC C;  1ZME C;  1FZE A;  1ZN5 A;  1HJ0 A;  1SQQ J;  3HUS A;  5CCH D;  1LWU C;  3MP7 B;  2ZVO B;  1VF5 C;  1AQT A;  1XTC C;  2C9L Y;  2WPR A;  3CC4 P;  2O1K A;  3GHG C;  5AVU B;  2QG4 A;  3CX5 H;  5BVZ A;  5DJT B;  2V7Q J;  5CJ4 A;  5AVW B;  3P7K A;  3PTZ A;  1SQV J;  1PZQ A;  2D2C C;  4UB8 H;  2POH A;  1P84 E;  3GHG B;  4H44 B;  3H1H J;  1JMB A;  2H43 A;  1GU5 A;  4XFJ A;  2ITA A;  2A45 G;  3O6Q B;  2NPS A;  2KZI A;  1EDK A;  1DX7 A;  1JOC A;  2YMY A;  3PP5 A;  1BE3 J;  2JP3 A;  1FDM A;  2R5B A;  2LR2 A;  3LIE A;  1AJY A;  1KTM A;  4IL6 H;  3D71 A;  1YQ4 C;  3H32 A;  3PHL A;  1HJB A;  2QM7 A;  3V4Q A;  1BSN A;  1QX8 A;  3BCC D;  2N9B A;  5APX A;  1OIP A;  5AVQ B;  4Y99 C;  1KIL A;  4U3F E;  1VQP P;  2FKW B;  2Q3E A;  4I2L C;  1URQ D;  1NWQ A;  3CME P;  1IK9 A;  2J58 A;  1N73 A;  5CJ0 A;  3Q2Y A;  2GA1 A;  4WB4 A;  4YPC A;  4Y99 B;  1G1J A;  2FYN B;  3WMM 0;  1GL2 C;  5AW1 B;  1KIL B;  2G3A A;  4L73 A;  1FOS F;  4GDO A;  1MZ9 A;  1VQ4 P;  4EOT A;  2FYU E;  2KIK A;  4K3A A;  4WWI A;  4LC1 A;  2Z4E A;  1ZOY C;  4H0L C;  5CCG A;  3RK3 B;  2N1T D;  2K9J B;  3FWL A;  2HOD A;  4H0L B;  3IF4 A;  2OQQ A;  4U3F G;  1K73 Q;  1YHQ P;  3AE6 C;  1ZW0 A;  4NPF X;  1A02 F;  3TGU J;  1S9K E;  3L75 J;  4YXW H;  2WT7 B;  3RL0 g;  2FFD A;  1NJI Q;  3H1K E;  3B5N C;  1G1I A;  3NFQ A;  1J2J B;  3O8Z A;  1RQV A;  1NOH A;  3KPE A;  1LT9 C;  2FYU G;  2NRG A;  3S1K A;  2W6B A;  2CK3 H;  3SFE C;  2E76 C;  2QJK C;  3M0D A;  1VQM P;  1MKM A;  3A2A A;  2YNY A;  3LID A;  1M1K Q;  1Q86 Q;  1LT9 B;  1EDI A;  2W6A A;  1FDI A;  1PP9 E;  3VP9 A;  4IFD K;  2QJK B;  4A7P A;  1KYO E;  3CCQ P;  1K05 A;  1P84 D;  2IPP A;  1NTK J;  4RES B;  4XE5 B;  3WU2 H;  2FXM A;  3BVH A;  3II6 A;  3OA7 A;  1HVV A;  3I56 P;  2Q9I A;  2O1J A;  1VQ8 P;  1E5W A;  1VF5 D;  3HE4 B;  1EQ7 A;  3L74 J;  3KQG A;  1H0T A;  1SQQ E;  3GLM A;  5AW5 B;  1X8Y A;  3L36 A;  1IJD B;  1PGQ A;  2R5D A;  3CX5 I;  3H1K G;  1SVF A;  3M91 A;  4U3F D;  3ITK A;  1G2C A;  3VMZ A;  3VYI A;  1YJW P;  1LTG C;  2QJY B;  3BAT A;  3PRJ A;  4GKG A;  1SQV E;  1W2E A;  2QJP C;  1EZV E;  1DD3 A;  3H1H E;  2OYI A;  1NU1 K;  2L5G B;  1SP4 A;  2FBW C;  1PP9 G;  4I7Z B;  2OGU A;  1SQX J;  1G2C B;  2WPS A;  3CC7 P;  1GK4 A;  1AFO A;  1KB9 E;  2FYU D;  3H25 A;  4NPE A;  2B88 A;  1OWA A;  2XU6 A;  4PD4 E;  3Q5R A;  3U1A A;  4CPG A;  4OWF A;  2C0X A;  2IFN A;  2K3R A;  2V4H A;  1SQQ G;  1SFC D;  2IFM A;  3TNU A;  2H7H A;  1JTH A;  5AW3 B;  1XTG B;  1Q81 Q;  2E5Y A;  1GL2 D;  2JO1 A;  5B5E E;  1S1C X;  1SQV K;  5APQ A;  2FYZ A;  1CI6 A;  2YIU C;  5AW7 B;  1YJN P;  1KD1 Q;  2B9B A;  3IR9 A;  1PL5 A;  1JY2 P;  4KHX A;  1SQV G;  1S9K D;  1RF0 C;  1EZV G;  3TNU B;  3RBX A;  2GUV A;  3H1H G;  3D6Y A;  1FU1 A;  4RKU J;  5KLI C;  4BWN A;  3L35 A;  3OW2 O;  3H1K D;  3VN0 A;  2KI7 B;  4EIJ A;  5E79 H;  1L0L E;  4ZKU A;  3P8M C;  1CI6 B;  4HKZ H;  1BE3 G;  1AVO A;  2Y0C A;  2KNC B;  4L75 A;  5AW2 B;  1PPJ E;  2OTL P;  1VQ7 P;  5KLI B;  2ZJS E;  1EXI A;  3T97 A;  1YYC A;  3M9Q A;  4EDF A;  4R4M A;  1FDO A;  1QLE D;  4AUW A;  1X9V A;  5TIS H;  4M3L A;  3MGN A;  1URQ B;  3ABV C;  1UIX A;  2FYU J;  4DCK A;  3MD0 A;  2B87 A;  1AQ5 A;  1JY3 P;  1PP9 D;  1DD4 A;  3H1I J;  5CMZ A;  4JYB A;  3E1I A;  1GU4 A;  1KYO D;  1ZR4 A;  4N6J A;  3TGU E;  4JYC A;  2E5T A;  2JEE A;  3H1L E;  1BDD A;  3L75 E;  1Q90 D;  4ASV A;  1VQL P;  3USS A;  2AXT E;  1BSH A;  2PAJ A;  2KSE A;  4IFF A;  2W83 C;  1RF1 C;  2KSJ A;  1SQQ D;  3FGA D;  2ZXX A;  3A7O A;  5BU8 B;  1FBM A;  3L73 J;  2PFX A;  4DOJ A;  2N1T C;  3S4R A;  3H1J J;  1L0L G;  1FOS E;  4RO0 A;  1OX3 A;  2PP6 A;  5GTH E;  1PPJ G;  2LKM A;  2FXO A;  3CXH H;  3NMD A;  1M1J C;  3KXD A;  2QRX A;  2KOG A;  2N1T B;  1SQV D;  1YQ3 C;  1EZV D;  3RK2 C;  1SLQ A;  2IBZ I;  3SWF A;  5KAI E;  1NTK E;  3H1H D;  3RL0 D;  1QL2 A;  1OFC X;  1N7S A;  4BXL A;  2HFE D;  1L2P A;  3FX0 A;  1FZC B;  4JBZ A;  5TIS E;  3VTP C;  3TGU G;  1E79 H;  1KB9 D;  3B8E B;  1S3J A;  3H1L G;  3L74 E;  3L75 G;  2JKV A;  4C7N A;  4OH8 B;  3EFF K;  4PD4 D;  3V4W A;  2P7J A;  2WQY C;  1S5L H;  1N7S B;  1H89 A;  2G8Y A;  5CBN A;  4WY4 C;  4OVN F;  3U1C A;  1JY3 N;  4HYT B;  3CPW O;  4C7R A;  2IZ1 A;  3HD7 D;  2ZXE B;  4C7N B;  2W90 A;  3JCU H;  1KMI Z;  2P58 A;  1NTK K;  3GHG A;  2I1K A;  2H88 C;  3O6Q A;  3C1L A;  1SQX E;  2JWD A;  3A0H H;  1NTK G;  5KJ7 A;  1QVG O;  1LWU B;  1HBW A;  2OTJ P;  3CD6 P;  2QEX P;  1VF5 B;  1L0L D;  1N2D C;  1KQF B;  3HUS C;  1M57 D;  3CCU P;  1PPJ D;  1M90 Q;  3L74 G;  4WBA A;  4W80 A;  1NKN A;  1L4A D;  3CCR P;  4DT0 A;  4MN4 C;  3JC2 2;  5AVR B;  4D6T J;  2XKM A;  2D2C B;  2KLV A;  4B86 A;  3TSI A;  5K5G B;  3P32 A;  3LW5 H;  1JNM A;  2SPZ A;  3EFG A;  1WT6 A;  1LTI C;  3MIW A;  1OW8 A;  3TGU D;  1PGJ A;  3H1L D;  2NPS C;  3L75 D;  2XNX A;  1SQX K;  3CI9 A;  2OYO A;  1ZXG A;  1ZV8 A;  1FZG A;  3G6E P;  1SQX G;  1SFC C;  3N4X A;  3L4F A;  1EC5 A;  4AYC A;  2KYV A;  2Q6Q A;  3FXE A;  1LTJ C;  3VOP A;  3MUD A;  1KFM A;  4DZO A;  1K9M Q;  1N8R Q;  2QVA A;  4PV1 D;  4L74 A;  4YTP C;  1WMK A;  3A0H E;  3CX5 E;  1HF9 A;  1YIT P;  3W67 A;  1N73 C;  2WZ7 A;  2K9J A;  3HTK B;  1LTJ B;  1GL2 B;  2KZJ A;  3TDK A;  1L0L J;  3H1I E;  4GIF A;  4UB8 E;  5APS A;  2R3S A;  1NTK D;  4IFM A;  2A45 I;  3OAK A;  4LGD E;  2QM8 A;  2WIT A;  1ZR2 A;  1GZL A;  2DW3 A;  4WVZ A;  2WT7 A;  2BEZ F;  1QEX A;  1KIL E;  3GG2 A;  3L74 D;  4IL6 E;  3AE9 C;  3L73 E;  5CHX A;  1LTT C;  3CCJ P;  3H1J E;  5CCG C;  3NTN A;  3CXH I;  3H1L J;  4U7J A;  2J5U A;  2M3B A;  3RK2 D;  1OW7 A;  2QSI A;  5B66 H;  1HH0 A;  2YMK A;  2FYU K;  2K88 A;  1LT9 A;  1M56 D;  2O01 N;  2O3J A;  2PGD A;  2Y0E A;  3BRT B;  1NTZ J;  1JM0 A;  2KLU A;  3VP8 A;  2M5A A;  5KTB A;  3AE8 C;  4PJ0 H;  2HR3 A;  4UB6 H;  1RE4 A;  1AVY A;  1SQX D;  3H1I G;  3B5N B;  1YJ9 P;  1DEB A;  3R4Y A;  1GW4 A;  1OVR A;  1FE6 A;  3HE4 A;  2ZFC A;  3SWY A;  1QGK B;  1R5S A;  2W8Z A;  4WY4 D;  2E76 B;  5KKZ C;  1TU3 F;  2H89 C;  2M5A B;  3D6Z A;  2PRR A;  5M1B A;  3C8V A;  2LXB A;  2AEF A;  3L73 G;  1Q7Y Q;  1GMJ A;  3RGU A;  4LLH A;  3RL0 C;  4NPD A;  3H1J G;  2XZR A;  1LP1 B; 
#chains in the Genus database with same CATH homology
 4HKZ H;  4BXL A;  4MN4 C;  2KS1 B;  4EYY Q;  1EDJ A;  4JBZ A;  4IOI H;  5K5G B;  4KJM A;  1OVU A;  2Q1K A;  2R44 A;  1LT1 A;  1S3J A;  2SPZ A;  4HB1 A;  3S1K A;  1U7J A;  2B89 A;  2B87 A;  1OVV A;  2B87 B;  5CBO A;  3MHV A;  3ZDM A;  4K35 A;  1U7M A;  4NPE A;  2B88 A;  5CBN A;  4GOD A;  1EDI A;  1BDC A;  1ZXG A;  4ASW A;  1BDD A;  1JM0 A;  2KIK A;  1MFT A;  4CPG A;  2M5A A;  3PH0 A;  2ZAE B;  5DJU B;  4ASV A;  1EC5 A;  2K3R A;  4K3A A;  2KUB A;  5DJT B;  4WWI A;  3MZW B;  3FXE A;  2HR3 A;  1FC2 C;  1NVO A;  2P58 A;  2OTK E;  5EFW B;  2QVA A;  1OVR A;  2M0B A;  1JMB A;  4ZMD A;  3QWO C;  5C39 A;  2RKL A;  1SS1 A;  1Q2N A;  2JWD A;  4GOF A;  2UWJ E;  1H0T A;  2M5A B;  2KZI A;  1EDK A;  1DEE G;  2I8D A;  1X0T A;  2KZJ A;  1H0T B;  2LXC B;  4GOE A;  2LXB A;  3FXD A;  1Y47 A;  2LR2 A;  1EDL A;  1ZW0 A;  2QRX A;  4NPF X;  3RGU A;  4NPD A;  2KI7 B;  1LP1 A;  4ZNC A;  1LP1 B;  4HJG H;  2WMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...