4LC1A

Meab, a bacterial homolog of mmaa, bound to gdp and crystallized in the presence of gdp and [alf4]-
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
326
structure length
315
Chain Sequence
TLPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Autoinhibition and Signaling by the Switch II Motif in the G-protein Chaperone of a Radical B12 Enzyme.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
molecule keywords Methylmalonyl-CoA mutase accessory protein
total genus 122
structure length 315
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4lc1A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4lc1A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lc1A02
1EFCA 4QPKA 2BMFA 3TR0A 4EAQA 3GJ8A 4EJSA 3TAHA 3J81k 1S9KD 4U00A 3CRQA 1ZD9A 4FI3C 2JEOA 4RZUA 3VU9B 1MO5A 2B7CA 3QXSA 3B13B 1JI0A 2ZRNA 4LHZA 3TGPA 2IK8A 3EZ2A 4EDHA 3CKLA 5LD2B 4GZMA 3EIHA 3SBDA 2QSZA 4DBLC 3CF0A 1KY2A 5F3WB 4LBWA 1BYUA 4OI1A 5APWA 1T8TA 4ZIRA 4W5WA 1KSJA 2GTPA 3KTAB 4PAQA 1YZKA 1OPXA 1JXMA 1WE2A 1AQYA 4B3BA 2R9VA 2UZ3A 1NIJA 2ZJAA 4URXR 2IHBA 1DO2A 1D9ZA 3H86A 3KQNA 5TDHA 3GLIE 4A0FA 1T5IA 1ZIOA 2A5JA 4X8HA 3H0KA 1UBGA 1P60A 1KSGA 5JECA 1QHGA 5C1BA 3ZD6A 4NBSA 1BYIA 4TQ9A 4OL0A 1CJMA 1MKYA 4X8LA 2HJVA 3AVUA 1XD2B 1G7RA 5GJWC 3QE0A 4LPKA 4D4KA 4ESVA 4TYQA 2CJWA 3U6KA 4UNNA 1GTWA 5FBVB 1CR4A 4A82A 2J7KA 1II0A 1NVUQ 2YC4C 1E79D 1XTSA 3OAAD 1L4UA 4PX9A 1X86B 1SVKA 5EZ5A 3CRRA 1S1CA 2ODEA 1OHHD 2REBA 3I73A 1YVDA 2VEDA 4IDHA 4Q4JA 2JAQA 2ZE8A 1QHHB 1BH2A 5FUVA 5HCIA 3B2EA 1OH5A 2RKOA 1OFIA 2ZJBA 1KO1A 4DC9A 1T91A 2D74A 5K8UA 1MRSA 3DKVA 4JJKA 4BLRA 5KUTA 3O8CA 3UWOA 1ANKA 1I2MA 1DH3A 2CE2X 4LYHA 3ASZA 1MR3F 1KK1A 2P2LA 1VHTA 2EW1A 3QBVA 2YKGA 4JL6A 1SHKA 2RH5A 3NKVA 4DLTA 4J0QA 2WSSD 3BERA 2E1RA 2GETA 2ZI6A 3MFYA 5G53C 1G17A 1YQTA 3MLEA 5JWHA 5DN6D 4B34A 4AYWA 4DDTA 1BS1A 1OSNA 1F2UB 1KO4A 3GJ7A 4ZI2A 3R8FA 1G1MA 1KKMA 2C2AA 1XXHA 4PO9A 3T1QA 3T5DA 1WA5A 4U7DA 3L8YA 4H1VA 4DIDA 2LWIA 5EE9A 3Q7PA 4M1YA 5EQTA 4E09A 4IVRA 4HB2A 1JUNA 2V4ZA 3HJNA 4DSTA 1H8HD 1OB5A 3U44B 3VFDA 2MSCB 2V55B 3K0AB 3TVTA 3LX8A 1FP6A 4V0ME 1WBBA 4JMPA 3WBJA 4ZI3A 1NF3A 1NVVQ 1DAEA 2JDIA 4BEJA 2ZRFA 5A0FA 3AGPA 3VHXA 3TE6A 1JJVA 3IHLA 4EPTA 1FTNA 3L82B 521PA 3THXB 3A1UA 4XOIA 2W83A 3QKRA 4A9AA 4C0AC 3B60A 3C5HA 1TQ2A 3DEFA 1TNDA 4K8OA 1H8ED 1EFRA 3P32A 2XNDA 1W5TA 1IXRC 2QN6A 2D2EA 2AWOA 5CLQA 3NDBB 2ZYTX 1BMFA 3SE0A 4F4CA 3PEWA 1AN0A 4TSFD 1KI9A 1YRAA 1UF9A 1HQCA 1VIAA 4FMCF 4PSKA 4W7SA 4C0LA 4RD2A 3LD9A 3F3YA 5FUYA 4LCBA 2AWNA 3PEYA 4CEHA 3BFVA 3BH7A 1KOFA 3ZRWA 4KFTA 3K9GA 4E03A 2WBLC 1VHLA 4B3GA 1XCGB 1W4RA 4QGGA 1RRCA 1DG1G 2CJWB 3L43A 5CM9C 1LVGA 3VR3A 2IW3A 1XCMA 4MQBA 2GJ8A 3RRZA 1PLKA 1ESMA 3WMGA 3AB3A 2Z5IA 4F92B 4O2RA 2C96A 1CR1A 4D2IA 2J46A 4WZAE 1VTKA 1A2KC 4HDQB 2F55A 3AVQA 4QHSA 4AKIA 4RCYA 3U2QA 5AVSB 3BK7A 3KJIA 2QM8A 4QGFA 3L0OA 1XB2A 2ANBA 4LHVA 2ZM5A 4U7OA 2LFSA 2XTZA 2ZIAA 2GJKA 3CWQA 3BD9A 2J45A 4LJ5A 3SC3A 5TVKA 2VSOA 4HB3A 2FZLA 2KBFA 1G291 4O2LA 4TL6A 4Q02A 1RJ9A 1GM5A 4TMZA 4BEBA 4URVR 3CH4B 3GLFA 3LIEA 2FFBA 5AW6B 2GJSA 2BHRA 4KFRA 1G3UA 4DDWA 1RPZA 3U6BA 4G3XA 5CJPA 1EG7A 4EPVA 1W0KA 4I1OA 2BKEA 5DO9A 4IOKA 4PTLA 2F43B 3K09A 4AYTA 2OM2A 4MRPA 2GAAA 3UG6A 1Q57A 3FFAA 3N70A 5FBLB 4TLDA 4V0OA 1N5IA 4BIUA 1JXOA 3I5YA 3QENA 5D3QA 1XNJA 3ZVRA 2J7PD 3JVUA 2O8CA 4OJKA 5JSZA 4IFEA 2ZANA 2QAGA 2WKQA 3TR5A 3NTNA 4RD4A 1SKQA 2RMKA 3K0AA 1E0SA 1MH1A 2IXGA 2ZQ5A 1E2HA 5BW8A 5FUWA 4F91B 5LPNA 1XPRA 3CRMA 1P2VA 3W90A 1TUIA 3O8ZA 2VHJA 1UADA 1SXJD 3E5HA 3PUZA 5CYOA 3ZS9A 5JMTA 2EWVA 1TF2A 1VG1A 1OF1A 2DBYA 1G5PA 1Z8FA 2NO0A 3C8UA 1Z0KA 3U3RA 3WHKA 2GZHA 2QGNA 4S35A 3ZRVA 2ANCA 1SXJE 1P9WA 4ZKEA 5KOYA 1IQPA 1V43A 1ZM9A 4HAUA 4QG7A 5TV2A 2IX3A 2QRNA 4LJYA 3FWYA 1QG4A 4PHGA 3JZAA 2I3BA 4HYYA 4ON9A 1KMQA 3OESA 4RSGA 2BBWA 4NONA 2IA5A 1HUCA 4PHTA 4TZ6A 3RLFA 1GKIA 5DE3A 3WRXC 1SVIA 2RHMA 4V0KA 3VX3A 1QF9A 3L35A 3R9WA 5G40A 221PA 2F1RA 4UNRA 4P33A 3UMRA 2OXCA 1SLQA 2DR3A 1FW6A 4A0RA 3DMNA 3SJAA 4JLPA 3A4MA 1CF4A 4B33A 4ZPXA 3NEYA 5AJYA 2PMDA 3AEZA 4BECA 1HURA 1E2MA 1P5ZB 1SVOA 4L16A 2CL6X 3TQFA 3ONWA 4C3ZA 2IYQA 4ZCLA 1K6MA 3BORA 1U8YA 2Q3FA 5FOSA 1S9KE 3FYHA 1ZNYA 1M34E 4NDZA 2YO3A 3B6EA 3DGEA 3QF7A 1FL9A 3VTKA 1ZU5A 4GMDA 5SZKB 4JBYA 4D4JA 1G8HA 1J90A 1KAGA 4LC0A 3FTQA 1E4VA 4WXPA 1E9CA 3M0DA 1KK3A 1L4YA 1RJ9B 2VBCA 3P4YA 3HTKA 4Q1CA 1GZSA 3KUDA 3SYKA 4KVGA 4IW3B 1I2DA 4II7A 1IJFA 2FSHA 2WIBA 4WOPA 4KO8A 2CCGA 4B3FX 5KNDA 2WIAA 1AS2A 2QP3A 1XTRA 5JEDA 1E1QD 4E22A 1T2KC 5FTKA 3T06B 2RGGA 3A4NA 1D9XA 5DLQC 4RFSB 2O8EB 1YR7A 2ASEA 2C9YA 2FV8A 2ORWA 2EFEB 4DZZA 4UQOA 1K8RA 1TADA 2CL7X 3OE7D 4ZCIA 1N5JA 5LD2C 3GD7A 1XBTA 2DWQA 5KDOA 3A1TA 3EC1A 3LA6A 1W0JD 1UKVY 5AJVB 4NL4H 4URWR 1UEIA 2WWIA 4V03A 3MGNA 1DS6A 2O8BA 2FFHA 1KI2A 2C5LA 5AUQA 4HLQB 2QTFA 3OAAA 4D6PA 1G8YA 3FVQA 3B85A 3LBHA 1U2RA 2FZ4A 2X2EA 3IPXA 3B8EB 3HR8A 1ZYUA 2IXEA 5H1YA 1CBUA 1E9AA 4Q00A 1IY0A 4OHYA 3MMPA 3RC3A 1IN7A 1NLZA 4D0GA 5ELXA 2ORIA 1ZNWA 3TJZA 2ZRAA 2X8AA 3BWDD 3A1VA 3IO5A 4GNKA 1XXHB 4HATA 5EE1A 4DEYA 2CLSA 2GAOA 4PANA 3Q72A 5IT5A 1Z2CA 4CW7A 4FCWA 1NY6A 1UKYA 4X8OA 4MT8A 5J4YA 1Y3AA 2EYUA 2VQSA 2D7CA 3EAQA 5D3MB 5KPDA 2KWIA 2NQ2C 3U60B 3SQXA 3FHCB 1G3MA 1JALA 5APTA 2KI5A 4MDEA 2QQEA 1KZGB 3T12A 1KK0A 3IDQA 1VPLA 4TLEA 4JL5A 1RW4A 2ZRLA 2XJ4A 2ZRBA 4RY2A 1YR6A 4TWZA 3GFTA 1N6NA 1XF9A 3BOSA 5DISB 3WP1B 1H8EA 2PJZA 5JI3E 4P4SB 1YHNA 3QKRB 1X8LA 2ZI7A 2TMKA 2ZI4A 3M9HA 2HDNB 4Q18A 4PC7A 3WP0A 121PA 3SJBA 4B71A 2RGAA 3AKCA 4B44A 2C98A 4QNRA 2VF7A 1UEJA 3T1VA 2ZFCA 1KI3A 2G6BA 4GCZA 4CT4B 5F9FA 4A15A 4I81A 1SVLA 4OI2A 1UFQA 3GLIB 1I4TD 1E2GA 1E32A 3ND9A 4HI0E 3TK1A 2H18A 2R5DA 4XWAA 4EPRA 3AUYA 3IIJA 4CIDA 5BN5A 3QEOA 4LY6A 2WAYA 3OAKA 4L9SA 5CJ2A 1NIPA 4O3MA 2OBLA 2ZROA 1Z08A 3BAFA 4POAA 4FINA 1XMVA 4BZPA 2DWOA 2PL3A 1N25A 3KQGA 1OE0A 2NZJA 4MKIA 4OK5A 3KZ1E 4JLNA 1P72A 1U98A 4FPPA 4KV9A 4DDVA 2Z83A 4PQYA 3U7GA 2VO1A 2G88A 1OB2A 2YWEA 3B1VA 5KO2A 4TTRA 5AW1B 3X1WA 2H7HA 2XSZD 2YC2C 3NEJA 4FCTA 4I6MC 4PC6A 3DO6A 5FL7A 3U5ZB 2QU8A 4FN5A 4LBYA 4KJZA 2J59A 3K53A 5UKDA 1GRNA 4R98A 1A02F 3RC8A 1CRPA 1EX6A 1C4OA 3IBGA 2GCNA 3MRSA 4BWYA 5J4LA 1PV4A 4QGAA 2IUTA 4FMCB 2ZSFA 2QG6A 1OV4A 3GLFB 1FMLA 2WKRA 3ZQJA 3IUYA 2OHFA 1GK4A 2Q0HA 3MWYW 4IDNA 4M9QA 3OHMA 3RWMB 1BOFA 4DLUA 4NYJQ 3HE5B 2PT7A 2VHQA 2VP6A 1WB9A 1CRQA 2F43A 4C9BA 4DEXA 3PEVA 2IHYA 3T97A 1E2DA 1H65A 1ZVQA 1Q1BA 2IUSA 3D8BA 3IIKA 5FH9A 2AX4A 2R32A 1E2EA 2NZ8A 4IRUB 1GDDA 4MH0R 4EIWA 4F38A 1RVDA 2GCOB 4G5OA 2OFWA 2HF8A 1KDRA 1ZUNB 2QPOA 4B35A 5TARA 1IJEA 2ZUBA 1ZCBA 5JSZB 2G83A 4OBEA 4IDQA 1B23P 1Z6TA 4DRZA 2ZVPX 1P7CA 2GNOA 3EZ7A 3CPHA 5EE0A 3TUJC 3T34A 1A2BA 4FW9A 2QUZA 2HLDA 1OXZA 1BKDR 1NKTA 3SOPA 5GJCA 3EWAA 3T35A 2OCYC 3W8NA 4NYIR 2ZXEB 1MRNA 2Q6TA 1SP4A 1DAKA 4M1WA 1RE0A 1AZSC 3C14C 3AH8A 5B1OA 3GLHA 2J0UB 4LJ4A 1Z29A 4PQFA 4PZYA 4D26A 3FDIA 5K8TA 1G4AE 1VYVA 1YZUA 4QBIA 1N6LA 1UKZA 4I1VA 1E9FA 4BRWA 4XE5B 1P2SA 3UIAA 2C9LY 2ATVA 3QIAA 3KKOA 4NCKA 4KSCA 1XCPA 2ZSAA 2WWHA 4LBVA 4W5JA 5KTYA 1OFUX 2WICA 4TN1A 1O87A 3DPUA 2VL7A 1TEXA 2XB4A 3A37A 3GLGE 4C0HA 5FOXA 4DLVA 4YXWA 4ZO4A 3LWNA 4B75A 5BQ5A 1U81A 3CPEA 1TUEA 2CLCX 3PENA 2IT1A 4MITA 4AG5A 1MO3A 4G0NA 1CJUC 1L8QA 3DOFA 2K5UA 4QFMA 2O8BB 3OEED 5IK2A 2WOOA 1OKKD 3H1TA 2NO6A 2P3SA 4JLJA 2XSZA 1OFHA 1E9SA 1W4AA 4LJ7A 3QNUA 3RS4A 1LV7A 3RRYA 2ZXUA 4DSUA 2FH5B 3FMOB 2XZOA 4CEJA 1G19A 5FPHA 3THWA 1SQ5A 1HE8B 1XJQA 2QPAA 1GL9B 2XJ9A 1JAHA 1GWNA 2Q9BA 4MKGA 2F1IA 1ZJ6A 4IJMA 4EFMA 5BXQC 2UKDA 5KNCA 2FG5A 3C15C 3ZVNA 5FI0B 5DGXA 2YWFA 1EFTA 1KJWA 5LB2A 3MD0A 2BJVA 3K09C 1E69A 2OAQ1 4PO1A 1R0YA 4TYYA 4OQFA 4EKDA 2DPXA 2FSIA 2KP8A 1HA3A 2BOVA 1RRPA 3BB3A 3R7WB 2IWRA 3LAWA 1X8JA 2ZR0A 3WMFA 3UIEA 2VLIA 4OQMA 1EFRD 5FPYA 1X6VA 3IILA 1AGPA 4PFSA 3KXKA 3D6TB 2LCFA 3TVDA 1Z0IA 1LNZA 4UJ5A 3B9PA 3QSYA 3GQBA 4DVGA 4ZIRB 4ASUA 1KSHA 4PSVA 4Q9IA 1KO7A 1CI6B 3EC2A 4PSAA 1T5LA 3I62A 1ZAKA 4PR0A 2ZS9A 4PQRA 5JWOA 1CJVC 3GLGB 2F1HA 2P2UA 3BFXA 2YOHA 4D81A 1S0UA 2GRJA 2R8RA 1VCNA 2REOA 2J5XA 2J87A 4C30A 5DHFA 2NG1A 4TZ0A 1VMAA 3AVPA 1DOAA 2IL1A 4QM7A 4XD7D 3FMPB 1HT2E 4XWKA 4V0MA 4M8NE 5CITA 3HE4B 1W5SA 2VP2A 3PFIA 1PLLA 1Q3TA 2UZIR 3QVVA 3ZZ0A 4B6EA 2RGXA 2B8TA 1D8TA 4NPHA 5F98A 2DCUA 2C9NY 2NPIA 4ABYA 1GNRA 3EA5A 1G8FA 4KXFB 3D3QA 2EVWX 2YYZA 4BGDA 2J0UA 4JBWA 2BDTA 1FQKA 5M04A 4HAXA 2CCKA 2W0MA 1RYFA 1DAFA 5P21A 4QXAA 3ADCA 5C4MA 1WBDA 3WYFA 1P61B 1H88A 4B2LA 1F51A 1NWQA 3B1YA 4B48A 3TRFA 3M91A 2NO9A 4OHVA 2ONJA 4PC2A 2EFDB 1QHHA 2NGRA 5EP2A 2VYFA 4JLAA 2RB4A 3TYYA 1R5NA 2QP9X 5AJZA 1YJ5A 4ZCMA 2OO7A 1J2JB 1U94A 1T3SA 1Z22A 3MJRA 3ZIAA 3WY9A 1X8KA 4JBXA 5EZ6B 3UATA 3BH6A 1NY5A 2BMEA 4M9XA 4TQAA 3ZD7A 1G7SA 2WM9B 3CRW1 5AW3B 1ZC4A 2WPQA 3RRMA 1E9DA 2J0SA 4JAVA 3VR6A 3CNOA 1N5KA 4RZ3A 4WZ6A 3SQWA 1Z0JA 1Q44A 1J8MF 1T4GA 1YR8A 4AYCA 2YJTD 2ZEJA 3DM9B 4JS0A 4YLGA 5L3SA 2R6CA 1AJEA 1SVMA 3GLIA 3PUYA 4O25A 3IQWA 5FR2A 1KK2A 3PCRB 3RDPA 2VP4A 3S1AB 1FAVA 5EJEA 1OH7A 3QKSB 5EP1A 5BN3A 4IOMA 4M9SA 5G41A 1RIFA 3ICQB 3B7GA 1CKEA 1OLOA 2AR7A 3QG5A 1KSFX 2IYXA 4LHWA 4MYCA 2QPTA 4LUCA 1IN5A 1W0JA 4YXWD 1RC8A 3QY0A 4JAUA 2B21A 3U3OA 4URZR 3EG5A 4UXJA 3WYGA 3RANA 1DTSA 4HLUC 4TLAA 1PZNA 4AWXA 3QEJA 4A0HA 3W6NA 2IYZA 1OIVA 1MABB 3QPWA 3U3KA 4LHYA 1GITA 5HKKD 5TMPA 2D7DA 1CR0A 4OQXA 5AVZB 2C95A 1CULC 5FTJA 1EFHA 4DHEA 1JR6A 3N5CA 4Q03A 1QHIA 2Z43A 2GEVA 5APSA 4XVRA 3V5BA 1U0HC 1D2MA 1II8B 3AF1A 1ZUIA 1L7VC 3PXGA 2L0XA 3GLGA 4JLOA 4OI4A 4MKFA 2FWRA 4RD3A 2Z6VA 1NRJB 1CIPA 4A8JC 3EWSA 3T5GA 2CK3D 1S96A 1ZMXA 1MO4A 3W3AA 4B74A 2CDNA 1KDOA 1P9RA 3SHWA 5B57C 5KSZA 3OIYA 2IF2A 4WBSA 3QXCA 4GP6A 1KYIA 5FL3A 2CNWA 1X1RA 3ZRWB 4JT2A 2FSGA 3HE5A 2P65A 4JL8A 3G82C 2FPMA 2Q3IA 2CE7A 2VP5A 4IOJA 3K9NA 2J1LA 2R6AA 3ICEA 1HY3A 2SHKA 2GESA 4YMUA 1ZIPA 4BZXA 2JA1A 1WRBA 2C03A 4Q01A 1LF5A 3KJGA 1ZM3A 4KFUA 4HLUA 3PITA 3PUXA 2JLXA 1AZTA 4CEJB 3THWB 3EIQA 5KHOC 3UKDA 4BPBA 4ASUD 1EWRA 2QMEA 1GKUB 1M8PA 3THYB 1EFUA 5AVVB 2GILA 1I4LD 3VKHA 1T2KD 2PX0A 3U7EB 4DKXA 2VP9A 3H84A 4JLVA 1KI7A 2H16A 1ZRHA 3L36A 2AHOA 2D06A 2HF9A 3VQTA 2NO7A 2CVHA 1M6NA 2HJGA 3I61A 2JJ2D 3SYLA 2IYVA 4HSEA 3O8BA 4DCSA 2VIIA 3REFA 2Q5UA 4BLTA 5IDJA 2ZRGA 3FHOA 4FMDF 2AN9A 2RGNA 4Z8YA 2O8FB 4XD7A 5DI9A 1GRQA 3M0AA 4N3NA 1U8AA 3BBPA 5KSYA 4YDSA 3GLHB 4IXMA 2GCPA 3Q9LA 5L3QB 2XZRA 3VKGA 2XITA 4A6XA 1A1VA 3TQCA 1QBKC 2P5TB 4B2IA 2JDID 1XU4A 1KI1A 3SYNA 3GFOA 3EW9A 4GI7A 621PA 1YR9A 2ODBA 2PJRA 4HB4A 5L3SB 3CF6R 1XEXA 1M74A 2CL0X 4HUTA 3I8SA 4Q48A 3K70C 3N2IA 3P8MC 2O52A 3QKSA 4K46A 4LDJA 2R5BA 5K8LA 1Q1EA 2OFXA 4C2UA 2P6UA 3KL4A 3M9BA 1X1SA 1IY1A 4C4PA 2YWHA 2IS1A 2A5FA 2QT0A 2CEAA 2FGKA 4AIIA 3MCAA 1YZLA 5FOWA 4M1SA 4OK6A 2BCGY 1FUUA 2FMXA 1D6JA 3C16C 3VNUA 1QHSA 2ZJZA 1IONA 5SZIA 3V00A 5JCPA 4YQFA 3ZDQA 1M2OB 1E4YA 2R44A 1Z83A 2W00A 3PR1A 2GHIA 4JSTA 1DAMA 2Q9CA 1EX7A 4ZKDA 2V54A 2X2FA 2XZPA 3R8CA 2AD1A 1FX0A 1OW3B 4PPNA 2XU6A 4PPGA 4Q1AA 4C0SA 4HLDA 1OKKA 3CUEF 2A30A 2O5VA 3RYTC 5CB6A 2Z0MA 3RHFA 4M53A 2FPKA 2EQBA 3BE4A 4GPTA 1CLUA 1Z6XA 3I8XA 1COWD 1JR3A 1ZC3A 1YYCA 4TMXA 3R7WA 2Z5FA 3QBTA 2QTVB 3VR4A 4Q20A 1C9KA 3FFBA 4FMDB 4HZIA 1IOZA 2AXNA 4KVAA 1IBRA 5APYA 3GJ0A 4MYTA 3PVSA 4Q1BA 5AWFC 1R8QA 2AK3A 1W36C 1CI6A 4DCTA 3GEEA 4NKRA 3X1ZA 2PLRA 1T3HA 4OYHA 1G7TA 1R2QA 4RKEA 2DY1A 2ZS7A 5J4KA 3K0EA 4NCHA 3EXAA 4Y0VA 3E2IA 5FBWB 3TBKA 3AVWA 2HV8A 2QY9A 1H8HA 4FIDA 4JZKA 4E07A 4YMSA 2Y8EA 4NU0A 3S1AA 1KO5A 1YZQA 2PX3A 2PLFA 4DIEA 5KNBA 2GXSA 3HE4A 3L8ZA 3PIRA 2PEZA 3QOFA 1X8YA 2ZR9A 1ZINA 4UKDA 2NIPA 5CYPA 5AW8B 2REXB 1E2LA 1U0LA 1OWAA 4FCVA 4DCUA 3EARA 3DL0A 3CX8A 2H8KA 4BFZA 1KJYA 5G3YA 2NO1A 2F6RA 2H1LA 4DB2A 4OK3A 2PZEA 4TYNA 4ZDWA 4N0DA 2W6IA 4W5HA 5TY0A 1Q22A 4D0NA 2Q3HA 5H70A 4Q1DA 2JLWA 5F2EA 2JLRA 1TAGA 2EYQA 2ZI3A 1GK6A 1R4AA 3TUIC 3A6PC 2PBRA 4Q4AB 1U90A 4LYJA 5KU1A 4E5UA 3K70D 4JIMA 2ZI5A 1II8A 2OG2A 4QGHA 2ZRMA 3NIBA 3TH5A 3VX4A 4XVQA 8OHMA 3OFNA 3U7HB 5FOVA 4AQRD 2J0QA 5E7MA 1S3GA 3VHLB 2IS4A 1NSFA 2FX3A 3AP3A 4KAXA 2FN4A 4FMBB 2E42A 3MWLA 1Z3IX 5CK5A 2J0VA 1Y63A 2PMKA 4MRSA 4MYHA 4GRAA 4OHZA 2AFIE 4TL8A 2ERYA 4UJ3A 1NP6A 4BRUA 1E2JA 1G8GA 1K5DA 3WHLA 3WNDA 3KQLA 5AW0B 1E2QA 2Z4RA 1U8ZA 1R5BA 2F9LA 4JASA 1XX6A 4DZOA 4A2QA 2MMCA 1WP9A 2EFHB 2IS6A 1G6OA 1ZNZA 1HYQA 4Z1MA 4AC9A 1P2UA 2WPDD 4JLMA 3KKMA 4BZQA 1JECA 2W0SA 1NVXQ 3IIMA 1AS0A 3TSWA 3NH6A 1ZP6A 3FKSA 1Z5ZA 4AURA 4R2IA 3SFZA 4PPQA 3AM1A 3VN0A 1HV8A 1VCOA 2KE5A 1P9NA 3ECCA 3SJZA 4DT1A 3DKPA 4KFSA 4LJAA 3FB4A 4UXIA 1R8SA 1OIXA 1Q12A 2WSMA 1NBMD 4BFTA 4D82A 4TT3D 1DE0A 1MABA 1XMJA 1OXUA 1Q0UA 3CB4A 4C46A 3IQXA 4AI6A 4GOKA 1KDTA 1N6RA 5AJXA 5CDFE 5CK4A 5L3QA 4LC1A 5AVYB 1A82A 1G16A 5AVUB 1S9HA 3ZZTA 1AQUA 2JLSA 1P73A 4PZLA 3C41J 1DO0A 3B1XA 3P20A 1S9DA 2YOGA 1NN1A 5FTMA 2QP4A 4YMWA 1FP7A 2B8WA 2IYSA 4B3DA 3B1WA 3HYRA 2AD5A 4GSYA 1Q1QA 5B2ZA 1XP8A 3C5CA 5JWRA 1QHXA 4DB4A 1KNXA 2OBNA 1WXQA 2V1UA 1G5TA 1G41A 2QI9C 4Q7JB 1ESNA 1G20E 2ZREA 3K0FB 2YVUA 5CM8B 3SR0A 2IEZA 3OEHA 2KSQA 3UANA 3FPAA 4HAWA 1CZQA 1KGDA 2Q7CA 3KKPA 4KCGA 3LXXA 3U3MA 4HAZA 4G5RA 4LSGA 2HXYA 2QL6A 4V02A 1HTWA 2LKCA 1XDBA 1TPZA 5IF9A 2PT5A 4XJXA 4MGYR 5FBQB 4PC1A 3QXXA 4GDFA 4AUWA 5C4GB 2V6IA 1OIWA 4Q4AA 3VR2A 4KHZA 4MDFA 2X19A 3LH5A 4LZZA 3NFQA 4MTXA 2BWJA 4IVQA 4TMVA 1FX0B 5EE5B 3NC1C 4EFNA 2QMOA 4L8GA 1GILA 1VG9B 4TMWA 1TF7A 1F6BA 1W2GA 4KLNA 4N0EA 5DH9A 3MG9A 4LRWA 4QNMA 5JS8A 2Q9AA 1MT0A 5IDVA 3HU3A 3NH9A 2O8FA 1N6PA 2ZRKA 1NN3A 3LLMA 5HR5A 5JRJA 3W5JA 4JVNA 3T61A 2B6HA 4IEIA 2WWFA 4YC7A 1Z06A 5JHGB 2QE7D 3I72A 1G21E 2ZJ8A 1G6HA 5SZHB 3LBIA 4QJ3A 2V3CC 4F93B 4WXRA 3VMFA 2JJ2A 1NVWQ 2YINC 2P7JA 3AKYA 2YWGA 1KMHB 3VYIA 3I92A 4R9UC 1MO6A 2FFQA 1RRFA 2MMGA 2GEDA 1Q1ZA 1NAFA 5FPTA 2JLVA 1QVAA 3EZ6A 1E98A 2O0HA 2BMDA 4D0LB 1NJGA 2A5GA 2AKYA 4LOAA 3NBZC 3P4XA 2FOLA 2KBEA 3BB4A 4UNPA 4Q5IA 2AXPA 1O3YA 1XMSA 2ZAOA 3E70C 3MUFA 3E1SA 2H5EA 1YZTA 3OIUA 1W7AA 4RVCA 3GCGA 4C0KA 1ZM4A 3HPQA 1F3OA 1P3JA 3V9PA 4US1R 3NBXX 3B8HA 2JGNA 1G3QA 1HJBA 4WVFA 4TLBA 3W6PA 5F9HA 1YRBA 4H9GA 2ZRCA 2O8DB 4MKHA 2C9OA 3LXRA 4M1TA 2BC9A 4RD1A 2AKAB 2VRSA 2C2HA 4FWIB 3K0SA 1Z63A 3H4MA 2PH1A 5JJIA 1TU3A 1AGRA 2LKDA 1FUKA 2OBMA 2ECKA 4BLSA 1JAIA 4LK2A 2GZAA 3ZZUA 3I3SR 1KJZA 1XEWX 1QHYA 3ZYCA 2WJHA 3AF0A 5HKKA 3TW8B 2W6JA 4WIAA 3ZJYA 4G5GA 5JLJA 1SXJC 1AK2A 2C77A 3I5XA 4BQSA 1F5NA 3T15A 1XTQA 1ONBA 2IBMA 4G5QA 3T1OA 5IHPA 2RGNC 3QPVA 3F0TA 4JT4A 3CR8A 2A9KA 4PAMA 3SHFA 4PZZA 1R7RA 3GLHE 3KB1A 5BYJA 1Z6AA 2GK6A 3X1YA 1QHNA 3NMDA 1WMSA 4JKYA 3KJHA 1G8PA 2BVNA 2QMUA 4C7NB 4K81B 3RRNA 2W6AA 3AP2A 2HCJB 1KI4A 3CZPA 2BV3A 2WMOB 3QPUA 1GL7A 2ZE5A 2WPRA 4M21A 5H8WA 3AVTA 2W6ID 4GMXA 4B86A 5HE8A 1SULA 2IYLD 2ZSBA 4BFYA 1P6XA 2ZRDA 3P27A 1PUJA 4LWZA 3GEHA 1XMIA 3OEHD 5JHHB 5DNYB 1FMJA 4AKGA 1G5RA 1HEIA 1NMXA 1QZXA 3CWZA 4HZUA 4NTZA 3B9QA 4QBGB 4URUR 2XNSA 3TKLA 4H1UA 2A5DA 1QVRA 3PG5A 4XSGA 5DI3A 3KXIA 1E0KA 4US0R 3DMDA 1IY2A 4OHXA 1TEVA 2V7QD 2ZJOA 1K5GA 2ZR7A 1PLJA 3IPYA 2C04A 3KJEA 4R2HA 4AY2A 5ANRB 2QAJA 4DJTA 2DFKB 2OEPA 2P6NA 4B3CA 4QRHA 1EK0A 2ZUDA 2C78A 4NYJR 2QQ0A 2WZQA 2R2AA 5AVRB 2YHSA 4MUAA 3A1SA 4IDPA 1P2TA 4MRVA 2C99A 2OV2A 2WT7A 4ACAA 4BLQA 3BS4A 2QEQA 4TTQA 5AJWA 4JLDA 4D4MA 1FFHA 1A02J 3DZDA 4NH0A 4Q7LA 2RAPA 4Q9LA 2ODWA 3HWSA 2WPDA 3UPUA 5EXPA 3NC0C 1V5WA 5GVRA 3I5CA 3EPKA 2IC5A 3SI7A 2FSFA 1LF0A 2D62A 4R7ZA 3IHWA 4B43A 1XJCA 5AR1A 1T9HA 4RD6A 3KUCA 1US8B 5E3HA 2GKSA 2VPPA 2OCPA 1TQ6A 1HT1E 5JBQA 3BJIC 2XAUA 3U4QA 3ZVMA 5CB8A 2O0KA 4I2LC 4Q4HB 1GL6A 3CX7A 3KKQA 3ZIAD 2GEUA 2ONKA 1M7GA 5KPJA 2HUPA 3V4RA 1DARA 5E7JA 1J2JA 4C0BA 1U99A 1W44A 4ZKIA 1AKEA 3MAAC 5BWMA 4HB0A 4C0QC 1NMYA 2FDCA 2XZLA 1DBSA 1N2CE 4IEEA 1SZPA 3BGWA 5DYGA 2WTYA 4FXPA 2WKPA 4BLOA 4M0LA 2XGJA 4OKSA 1MV5A 3BFKA 1F60A 3I4LA 2FA9A 3LFUA 4X8MA 2JIZA 2Q3MA 1T8UA 4RD0A 4PHFA 3K9HA 1JB1A 2V1XA 4R71A 5HZKA 2C8VA 2FFAA 3G5UA 3AP1A 3SNHA 4ITRC 3TAUA 1G2CB 4CGZA 2GDJA 2ZS8A 3KFVA 4GZLA 4L5BA 5J4VA 3O8DA 4C7OA 4BE7B 3K0FA 1UM8A 4JLBA 5L8VA 3NBFA 1T6NA 3ZQ6A 4EQ6B 3RVBA 3RS2A 3VMXA 3ZRXA 5FL7D 3HU1A 1KIMA 3M4YA 1XRJA 3DOEA 4FD2A 4LBZA 4Q47A 4D80A 5BN4A 3C4JA 2VHCA 1I4DD 2ODNA 3O47A 4P4UA 1IXZA 2NOAA 2CHQA 3ASYA 1A7JA 2QTHA 2ZETA 2FE4A 3NVAA 5JEEA 1UBFA 3LDAA 2A7QA 4AKHA 3VTPC 2YZ2A 3CNNA 4LI0A 3TLXA 5DHAA 1QDEA 4UNQA 3L0IB 3BIFA 1LY1A 3RAPR 1E2IA 5EE3A 3SBEA 2GJ9A 1N6OA 2IYRA 3CIOA 1LS1A 2G1KA 3B78A 3PV0A 4LV5B 3X1XA 2VP0A 5J47A 3KQHA 4LPSA 2GBLC 3LW7A 4Q4LA 2A3RA 2FNAA 2QNRA 4DSOA 3CH5A 1JEEA 5APUA 1TU4A 3KQKA 5E95A 1OXTA 1EXMA 1JEDA 5B30A 3QXJA 2H17A 2ATXA 3F5FA 3TMKA 1W1WA 821PA 2GXAA 5FOUA 1TL7C 2HEIA 2GZDA 2WT7B 2CMKA 3AKDA 4BLPA 3CNLA 2JJ8A 2ZUCA 1FTSA 2VTKA 3MGCA 4Q9JA 4MGIR 3ADDA 1JPJA 1ODFA 5FFMA 1XD8A 2VH5R 3LY5A 3LVRE 4QBFA 2G9NA 2Z5HA 4TQUS 2ZI9A 1G3RA 1KMHA 2BEKA 2CK3A 1OH6A 4MUBA 3LQRA 5AVXB 1E79A 3THYA 1W46A 2OE2A 4Y0AA 4W9MC 1LW7A 3OIVA 4M3LA 4BUJA 4TL9A 4ACBA 2FEOA 1Q21A 2WJGA 4NE2A 2JLUA 2EU8A 4RZXA 1P62B 4XH9B 1DAIA 1RRGA 3SU8A 1KDPA 1F2TB 1OT3A 4CZ2A 1M1YE 2IPPA 2I1VB 5AUPB 5HZHA 5TXGA 1IN6A 2QENA 1BMFD 5CLLA 4ZDKA 5JI2E 4DUGD 2RGDA 5AW5B 1FOSE 5HE9A 2ZRPA 1KI6B 4A8JA 3KFXA 3OFND 5FI1B 4QKQA 2AFHE 4G5SA 3QKTA 5H68A 1CTQA 2WHXA 2QBYA 4RFVA 3TUZC 1E0JA 1XEXB 1UJ2A 3KDSE 3D31A 721PA 4I5SA 4P31A 3CW2A 3MJHA 4PC3A 4AD8A 3K0CA 2J41A 5J40A 2ZYVX 1FQJA 3HDTA 3PQCA 4U02A 3LBNA 1LS6A 2D3WA 4XTRA 4GOJA 4OQLA 4PPFA 4TYWA 1VCIA 1W36D 1IAQA 3LQQA 2CLDX 4EQ6A 2A5YB 2GXQA 2JASA 4ZV4A 3B5JA 3GFPA 1GG2A 1NSTA 3RS3A 4A0GA 4RCZA 4HEJA 3GJXC 2UVQA 1GKYA 2IEYA 3BB1A 4KI0A 3O8RA 1N5LA 4RESB 5DIFA 3WNBA 1JQLB 1T0JB 1W49A 4KODA 3LLUA 1GUAA 4Z8XA 5EUMA 2BM0A 3TSZA 4JLKA 2GF0A 1IHUA 2DFNA 3QJYA 3W34A 1GP2A 5FOTA 1KZ7B 1CJTC 3BC1A 1YU9A 1QG2A 1US8A 2CBZA 1HBWA 4IFBA 2C9CA 1E94E 3LX5A 4M9ZA 2WJJA 3DVLA 3UMFA 4Z1MD 3ADKA 2P67A 1RZ3A 1RYHA 1WF3A 4US2R 5L3VA 3CBQA 1JPNA 4Q4HA 2YNYA 3QUSA 2G0TA 4V0LA 2W2XA 4CRWB 1YZGA 3CPJB 2ZSEA 3GEIA 5SZJA 1XTKA 3HPRA 2WVJA 3A5TA 2PCLA 2X1VA 5L3RA 3ZS8A 1PVOA 2JLYA 1NJFA 4M4SA 1OYYA 2AL7A 2E9SA 4NCIA 5C18A 2BCJQ 1S1MA 4M1MA 4QC2A 1COWA 1JR3D 4YMVA 1DEKA 1UKEA 2OESA 1XZQA 4PAOA 4JJZA 1DADA 1GRRA 2QA5A 1IXMA 3W6OA 1ZM2A 4B47A 2XB2A 2IXFA 4LX0A 3K70B 3L37A 2KJQA 4N1AA 3FKQA 3KKNA 4LJ9A 1N6HA 2OILA 3RS7A 4YMTA 2YO2A 2QE7A 5JS7A 4AK9A 3EPHA 3A2AA 1TMKA 2QRZA 4NZYA 5EP4A 4A1FA 5FPSA 1CEEA 4DSNA 4JSYA 3NHAA 5B64A 5DSZA 4TT3A 3AV0B 1B0UA 4PXAA 3AKEA 3A8TA 4DLRA 4LYFA 1MOZA 2DYKA 2FU5C 4Q7KA 3REGA 2OT3B 1KNQA 1UPTA 2BBTA 1GOTA 1L2TA 1ZM7A 4QHTA 4A2PA 3UG7A 2QAGC 4AG6A 4EFLA 5C46F 3U4QB 3OIWA 2HYDA 4BFVA 4WA7A 1CU1A 3M06A 2VSXA 3NTUA 5JJKA 1Z6GA 4P3YA 3UXMA 4DCNA 1IM2A 3NG1A 2J7PA 1XPUA 1EWQA 1J99A 4PHHA 3IKJA 1E6CA 3VMYA 1JQJC 4GT1A 2GWHA 1S2MA 2E87A 1WCV1 3TSOA 2ZU0C 1NG9A 2R6FA 1GNPA 2OZEA 4CT5A 5JJLA 2JJ1A 1W2HA 2FJUA 3GJ3A 4JKIA 1MFZA 2FPLA 1KI8A 4TLCA 2OUKA 4MGZR 2VA8A 1C1YA 3X1DA 4DUGA 1FZQA 2XV5A 1ZD1A 4CYMA 5GADl 2Q21A 3LV8A 1VG0B 1HUQA 4RJLA 2R62A 4RZ2A 3VNVA 4D25A 1XZPA 1VKJA 4Q4JB 2GBLA 4FMTA 1JBKA 4IVPA 1DAGA 3WMEA 2B92A 3HP1A 2ZE6A 3DHWC 3A58B 2WOJA 1SXJB 4Q1EA 4BFXA 1Z28A 4S2EA 2ZRHA 3SFVA 4DT1B 2G0NA 2A78A 1KAOA 2X77A 1HE1C 5K8IA 1NLYA 1ZW6A 3L0SA 1HQYE 1N6KA 1Z47A 2F1JA 2NPFA 3JVVA 3R20A 4QM6A 2R3CA 5EXXA 2P0EA 3M1IA 1GD2E 3B82A 2BMJA 3QG1A 4B6FA 3LO5A 5J5CA 2JATA 1N6IA 5G3ZA 4OI0A 3EA0A 3EZFA 4YONB 5EXSA 3PUVA 3GLFE 4TL7A 2FEMA 3A36A 3OEEA 4QJ4A 4DWJA 2V9PA 1NN0A 4F4IA 5IK2D 5JZVA 2BBSA 3CM0A 1GAJA 4ZDIA 4QL3A 2DFTA 3NHBA 4I1SA 3ZLJA 4KBFA 4CEIA 1T0HB 3A7OA 2ZTSA 1E2NA 1R0WA 2F3RA 3I1FA 4B76A 2OCAA 1D2NA 5LBIA 1XD9A 5GJBA 4I99A 2JLQA 1FNNA 3Q3JB 2PCJA 1SKYB 3AF3A 2WMNB 3V4FA 4LV6A 2WAXA 4DLYA 5E4FA 5JCZA 3THXA 4UNSA 1XWIA 3P26A 2XTMA 3SEAA 3VMZA 1W4CA 2ZITA 2ZSDA 1IO4A 2EWWA 421PA 4DLZA 2WWWA 4M1OA 1CSBA 4NP6A 1R0XA 4DLXA 2IYWA 1TTTA 2YOFA 1U0JA 3FGNA 4JYCA 1NMZA 5A5GA 4Q7MB 5C2JB 4URYR 1NNEA 4BFSA 3LNCA 3TNFA 1XTIA 1DPFA 3LW8A 4GP7A 2RGEA 4WZBE 1H89A 4AKEA 2XTNA 1BIFA 4NMMA 4GL2A 2JJLA 3RSOA 4B32A 3SDZA 1F48A 4Q19A 5FR1A 1E1RD 5B58C 1E0AA 5DYIA 1KHTA 4CF7A 4Q1FA 1AS3A 1M7HA 2H7VA 3KB2A 1GZLA 3AF2A 2WJYA 4OQNA 4EJSC 4FWTA 1A4RA 3EPLA 5GJVC 2W6JD 1SHZA 3PUWA 3I32A 4DLWA 1P75A 5LB4A 1YKSA 3FOZA 2HXSA 5AW9B 1Z07A 3GMTA 1AKYA 3GP8A 3PEUA 3Q7QA 2RCNA 1VG8A 6Q21A 1M7BA 2RHDA 2QSYA 1U9IA 3ZVLA 1D5CA 1XXHE 4F7WA 4KBGA 2JCSA 4Q66C 2WTUA 1VYTA 3FKSD 1RFLA 3UWKA 1FOSF 4A36A 3CX6A 2H92A 3DDCA 4Z54A 1LB1B 4ZDJA 3THOA 5LDDC 1GU4A 2VHUA 4NYMQ 1JNYA 1NG1A 2XOKD 3WXMA 1G64A 3OE7A 4HYTB 3M0EA 4CDGA 2IUUA 2JLZA 1W4BA 2OLKA 5E7IA 5KSPA 4P4TA 3M6AA 4TMTA 4LGMA 2O8DA 1CR2A 4KLZA 4UXHA 2OAP1 1MUUA 3SJCA 2WSSA 4HUQB 3NXSA 1GFIA 2QORA 4D4LA 2O8CB 1ZCAA 3WNCA 4G1UC 5AUOB 4JVMA 3QF4B 2QAGB 3K1JA 1E9RA 4TMKA 4A4DA 4EPWA 2HT1A 2CHGA 1S4QA 1TX4B 2V7QA 3WYAA 1XFAA 2DHRA 2G3YA 1E9EA 4KITB 2CCJA 5FTLA 4PO8A 2XXAB 3ZCCA 2H57A 1J70A 2V8OA 4MRRA 2BKUA 5B1NA 1II9A 1NKSA 2OCBA 3MWJA 3R9XA 5CDFA 2W58A 3TNUA 4WAUA 2A2ZA 1TQDA 5CMZA 1SVWA 4Q9HA 1DVRA 2OXRA 3AQ4A 2XNDD 4L15A 4GKGA 3W8RA 3CONA 4NHOA 4P0TA 4C7NA 3EASA 3H2YA 1OXVA 4IOLA 2ZVQX 2E43A 3QVUA 1D2EA 4IXNA 1EESA 1PJRA 1W0KD 2Z4SA 1W36B 4JVSB 3KQUA 3EPJA 5EXTA 4KYIB 4U7NA 4DCVA 3TW4A 2ZJ2A 3X2SA 1U9IC 4IDOA 2GF9A 2ZYUX 4DLSA 4I4LA 3C7KA 3LRPA 1JJ7A 1E3MA 1S8FA 4HAYA 3BXZA 2D4HA 4QJ5A 1DELA 5AW4B 2FF7A 4HZUB 2ZPTX 5JFGA 4A2WA 1G3IA 4HDOB 2EFGA 1JR3E 2XX3A 4MYUA 1SGWA 3Q5DA 1GU5A 2ZYWX 1AIPA 5C93A 3QXHA 2PEYA 5FTNA 2N9BA 1UDXA 1T3LA 3RWOA 3VAAA 4OJQA 5DI3B 4M1KA 2W2TA 2CNWD 4KHXA 4CEIB 4L9WA 1CP2A 4TTPA 3N2EA 2R6GA 2FGJA 3SN6A 3QQ5A 4EJSB 4O0MA 4ESHA 2WWGA 2YNMA 4A6PA 3UK6A 3WRYC 3K9LA 1VECA 2QROA 2WV9A 1NBME 1KKLA 4DXAA 1EGAA 2NTYC 4G01B 3G0HA 4GOXA 2N42A 3R9IA 3U7FB 1UBCA 3QI2A 2ZJ5A 3ADBA 4GFDA 1DG3A 1HWTC 3DM5A 1KO8A 4XTCS 1A5TA 4RFSA 2O8EA 3A4LA 4LHXA 3HR7A 1OFTA 1PUIA 4NCJA 4QHYA 4EUNA 4RKFA 1AM4D 1OXXK 5FBRB 4WW0A 3RS0A 1UBEA 2J9RA 3BH0A 3Q85A 4HUQA 3ZGXA 2OFOA 4NYMR 2CVFA 1ZNXA 3W5IA 1SXJA 2F9MA 3AF4A 1J7KA 2F7SA 3JZMA 4QPJA 4JVLA 1LFDB 2MSDB 3HU2A 2IYTA 4QOSA 2QZ4A 3RSLA 1G18A 1R10A 1IXSB 1XD2A 3L2OB 5CIQA 2XXAA 4XSHA 3ETLA 1N3BA 1UDWA 2LFRA 2G77B 3ZH9B 3AUXA 5HCNA 4ARZA 2O0JA 4EOTA 1G4UR 1N0UA 4NYIQ 2CHVA 3D36A 5J4HA 5KYKA 1E96A 1IN4A 3IEUA 3AVOA 1UAAA 1CXZA 2NMVA 2GVZC 4NCNA 1WQ1R 2RGCA 3GJ6A 4LV8B 3CR7A 3SZRA 5D3MA 4B3XA 5KSOA 2ORVA 2QGZA 1Q3HA 3KX2A 3IO3A 2CXXA 4F4JA 1R0ZA 5DN6A 3CO5A 3NBYC 4C7OB 2AK2A 5FPKA 2IWHA 4BASA 3AVYA 1J8YF 2J3EA 1NI3A 3GPLA 2VRWA 1IN8A 1E1QA 3NDPA 3IBYA 5HTKA 1VDZA 3P7KA 4HAVA 2WWXA 3GJ5A 2WJVA 4M2LA 4YDHB 4P4SA 2OSBA 3VR1A 1ZD8A 3RABA 2KB0A 3KTAA 2R65A 4LJ8A 1E2FA 2P6RA 1Z6YA 3L0PA 5EUQB 4OHWA 3VR5A 1JNMA 1TQ4A 3DZ8A 3Q5EA 1R6BX 3U3JA 1NL3A 2W27A 1ETUA 4QBHA 5GVSA 3B1ZA 5APQA 3D7MA 1MV8A 1Z0AA 1Z0FA 2DFLA 3WBKA 4MGKR 5HPYB 3V4QA 2BEJA 2MSEB 3FE2A 1QRAA 2W2VA 4DDUA 2G1JA 1CS4C 1Z0DA 1HH4A 4B73A 2WWYA 1GIAA 1OJLA 3A3YB 4Q9KA 1FNMA 3LVQE 2ZAMA 3U61B 4M22A 2ZU6A 3ND8A 2PZFA 4U5XA 5A4JA 1OH8A 2VHTA 5JRZA 3VKWA 1JOYA 2BM1A 4EPXA 1DAHA 1ZUHA 4TYPA 2P5SA 2EFCB 3A1WA 4KYUA 1OXSC 1Q20A 1X3SA 3K0CC 5AVWB 4BFWA 1W48A 2BASA 3TIFA 4MA4A 1Z2AA 1OYWA 1XEWY 3EIEA 4IKEA 4KSBA 5APVA 1N0WA 2HCBA 4Z51A 4B2PA 5FUXA 5AVQB 2V6JA 3CLVA 4CVNA 3IGFA 3FHTA 1SKYE 4ERNA 3VU9A 4TSFA 2GK7A 3SS8A 4L4UA 3IEVA 3OZXA 5IRCD 1F2TA 1BO6A 2N1BA 2VF8A 4I1UA 1WDTA 2GVDC 4C2TA 3W9YA 1YZNA 3MSXA 1GNQA 2RGBA 4AYXA 1E99A 2ZRIA 1ZBDA 3KDPB 3LIDA 2HLDD 4Q21A 1S3SA 2IF0A 5EP3A 3P1JA 4ARZB 3BRWD 2IYUA 5AW7B 1F2UA 1KI6A 1OHHA 2DWPA 3FMIA 3OF5A 2OLJA 3UMSA 4A8JB 2VSFA 4JYBA 2GCOA 3NWJA 2ERXA 4C0JA 1XTJA 2QBYB 4LJ6A 1XEFA 5AW2B 3T1TA 3QF4A 3U44A 3A0RA 3SWFA 3RS5A 2ZJYA 4BIZA 3IR9A 2GA8A 1VIYA 5CIWA 1GVNB 1ZU4A 5TB5A 2XOKA 2WJIA 3QKUA 4BFUA 2WPSA 3RNLA 4ILEA 1FPMA 1P4SA 3MWKA 1AA9A 5APXA 2ZE7A 3W3ZB 4HDCA 1RKBA 5AVTB 3V4WA 3Q8XB 1E1RA 2GXUA 5AK0A 4XWOA 4A92A 3F8TA 1E2PA 3PJRA 2XEXA 2HT6A 3EX7C 3TNUB 1NLFA 4P32A 2PZGA 3HYTA 2QM7A 4MRNA 5KDLA 4HLCA 1CJKC 1NBMA 2I4IA 1GSIA 2D2FA 3K8YA 3CRVA 2HYIC 4XVUA 2DB3A 4XIGS 4GBMA 1XPOA 4V0NA 3CF2A 3AGQA 5KDDA 2IS2A 1VYUA 2F3TA 1SVSA 2BIFA 3KXLA 4CEHB 3GJ4A 1KY3A 1XJ0A 4KU4A 1E2KA 3AVXA 1GTVA 3EZ9A 1KQLA 2I1QA 2B7BA 1N0VC 2ZRJA 1LTQA 1FOEB 1G9XA 4EPYA 5BYKA 1H8AA 5AUNB 1W47A 2IYYA 1R5OA 1TF5A 4IHQA 4LYAA 1E9BA 2JIZD 3FMFA 1G7CA 2N46A 2YV5A 2GJAA 4KP4A 1ELOA 2R6DA 2FTKA 2JJ1D 1VCMA 2BJWA 1KTVA 1NVVR 2BBOA 1NN5A 3CZQA 2QMHA 3AVVA 2QT1A 1YE8A
chains in the Genus database with same CATH superfamily
1EFCA 4QPKA 1NF2A 1DLJA 4PYOA 5F35A 2UUCB 1SS1A 3N0VA 4MB6A 3TAHA 4U00A 3CRQA 2JI6A 3R5XA 4CLRB 3J81k 4FNOA 3KLMX 1TPYA 4FFMA 3EXIB 2OR3A 4ID9A 4KDCA 1ORWA 1U2SA 2OSVA 4PFQA 5COQA 4LHZA 5I9MA 3I1JA 3SHVA 1Z5VA 2ZNJA 2RKLA 3CKLA 3EZ2A 4EDHA 1JX6A 1NW3A 3N8KA 3ZWOA 3ESQA 1KEEA 2QSZA 4IFDK 3IBCA 2AW9A 2O0MA 3K0HA 1QQTA 4LBWA 5K3FB 2DQKA 1EKXA 3DVQX 4NSNA 2GFHA 3GRRA 3GQBB 3WK6A 1NKDA 1LWUB 1B1AA 2GZ2A 1HLPA 2O7QA 2V65A 4W5WA 4FSDA 3UH0A 2GTPA 4ZIRA 4PAQA 5B1SA 2OTKE 5THKA 1GNSA 1RC8A 1CHDA 3KAPA 1WE2A 1KB9I 1AQYA 2UZ3A 4LYDA 4XGRA 1LBHA 1AG9A 3RU7A 4B3BA 5IPFA 2X5OA 1QZTA 2W6ZA 3CB2A 4DA7A 3SLRA 2WITA 4YPOA 1CQJB 3S1KA 1D9ZA 4KXMA 2FW7A 4TKUB 5AHRA 5TDHA 3SG0A 4CMEC 4RJJA 4DA0A 3GLIE 4DUYB 4DLKA 4FWBA 5HX7A 4J9VA 3U59A 2Y0CA 4A0FA 1T5IA 2A5JA 3V1YA 4Q9NA 1CUSA 2X7RB 3L70G 5DTQA 3UFXA 4CIXA 4EGSA 2FEWB 4BAYA 5C1BA 4H7DA 1EFKA 2GPSA 4DT0A 3HD7D 1EQUA 2RHWA 4TQ9A 1MKYA 1NQAO 3V2IA 1PQYA 1W2WB 4NFSA 5KSPA 3ZZ1A 4PW0A 4NPCA 1R1DA 4RLFA 4UUAA 1FXKC 3FPKA 5L3DA 3SEZA 5BWLA 4EHLA 3BY6A 3DHNA 3TLCA 3HI4A 2P2NA 2QKSA 2WSEH 2YMLA 5FBVB 1CR4A 4DADA 1YQXA 5TT0A 3M5WA 1F0KA 1XJ5A 4QQ8A 4BDTA 4G2TA 3KXPA 3L02A 4UM9D 4DMFA 2ZAGA 3KSDO 2UYGA 4UPDA 1CJCA 1US6A 2QUAA 1VJGA 3V5NA 1UIXA 3IP8A 1GPNA 2FW0A 1RSOA 1QJCA 3ASOB 1NWHA 4GVPA 5I9SA 4CU5A 3FOZA 1YVDA 3NCHA 4IDHA 5CX1A 2BI8A 3LPMA 1L5HA 4BIMA 3ZXUB 2JAQA 4I14A 1JHQA 5H9VA 3VJLA 2JAPA 4KQIA 4NICA 5HCIA 3VH1A 2B9EA 1OH5A 2HMUA 1H0TA 2JKYA 3FSGD 2FG6C 2ZJBA 3P52A 4BWVA 1MMFB 2Q7OE 2D74A 2IELA 3PHHA 1YS6A 4PYLA 3RUIA 4UUJC 2BGMA 4JJKA 2UDPA 3H6PA 3ROKA 3ZHCA 1UC4B 2WU1A 2WAMA 3OMAB 1BHO1 4IYJA 4Q15A 4PIPA 4WKGA 1FJ2A 4H7HA 3FB8C 4WADA 4HEA6 3PHCA 1MR3F 1RCUA 2X8BA 4KQCA 2EW1A 3LWDA 1M54A 4MWGA 5GGYA 5K5GB 1PGJA 1O6BA 4F72A 1U1IA 3ZTWA 4C6SA 1L8AA 3DAHA 3TZBA 3BGIA 5IVKA 2QGFA 1YQTA 2AFRA 2C58A 4B34A 5HOEA 3G85A 1BS1A 1YIJP 1F2UB 1WZCA 2JEZA 3GELA 3R8FA 1WM1A 3R4CA 1G6KA 1XXHA 3B3JA 3T5DA 1WA5A 1SC4A 4U7DA 4QFCA 4X85A 3DBHB 4H1VA 4W5TA 4J0GA 1PKXA 4WGGA 4YRTA 4L5AA 3Q7PA 4M1YA 1KEZA 1HX7A 3OUZA 3SE7A 1WHTB 4QFBA 3WS7A 3BIWA 1WKBA 4HB2A 3IDOA 4DSTA 2Z9CA 3OGCC 2G67A 3C4QA 4DBLE 3VR5H 1A7UA 3R6WA 3VFDA 2O4CA 4DK1A 2NAFA 2V55B 5CDUA 1ZN2A 1JFVA 3KPVA 1ZN5A 2Q5JA 1FP6A 4UHEA 1VE9A 2Y93A 4ZI3A 4UUPA 2F4VO 2JIPA 1LI5A 1AO3A 2P5UA 2J9YB 2IUYA 3C1UA 2VDNB 5J58A 2BH2A 2CHFA 2QVCA 3RD5A 2IZ6A 1V54C 4RKQA 3GXOA 3L82B 3HSSA 3THXB 5BWOA 4WDQA 2W83A 3WNVA 3DAPA 1WPBA 1HNNA 2HBYA 4BKOA 3DEFA 3GX1A 4HNSA 2HBQA 4Z4CA 3HO1A 3HUSA 4K87A 5JSKA 5I7RA 4QJFB 4ZCQA 2D2EA 4CR6A 2ZYTX 2C3UA 3OC6A 3IEMA 1SUFA 3SE0A 3SOZA 1ZVMA 3PEWA 1AN0A 3BTUA 5EIFA 2YC0A 1B06A 1WL8A 2HN9A 1SC1A 3CCMP 4L6AA 4FMCF 1VIAA 3GUVA 4G41A 1L7OA 1DPGA 1V3TA 4K1XA 4PSKA 5K7SA 3WB2A 2WD8A 3MBOA 2E37A 3F3YA 3LD9A 4H7IA 4B45A 3K2IA 2ITAA 1HDIA 5DU2A 5FUYA 3X43A 3GJYA 3H6GA 3HJTA 4G1FA 1ZV8A 1UP4A 3TZCA 3ZJUA 1CUDA 2AWNA 3Q1MA 1KOFA 5CAEB 1I1NA 3D70A 5JZSA 1C81A 1POWA 1SCIA 2VRNA 3H2IA 4KFTA 1UMDB 1M5TA 2I33A 3L77A 4BMSA 4PN3A 4Q3EA 1UXJA 1DKQA 2HGSA 2HNKA 3L43A 4YQEA 1FS4A 1B8OA 2IW3A 1V9PA 2GJ8A 1YHZA 4DJEC 3WMGA 2QRLA 5ICSA 4XDJA 1QYRA 2C96A 2P69A 1IL0A 3MSCA 4F92B 3HCCA 2VLBA 2J46A 3R6LA 4WZAE 1AD2A 1Y3HA 1Q90D 1A2KC 3CEMA 3GL9A 3AEUA 2G5GX 4XSVA 4PZ9A 2V4MA 3C6KA 4ITUA 3U2QA 3WLQA 3ICOA 4XYBA 4BWFB 3IX7A 2NVWA 3L0OA 5K05A 3FTPA 1NYHA 1XB2A 2DTDA 2UXBB 4YRRA 1BN7A 3KQVA 2LFSA 4AB1A 2GJKA 4WF9V 3CWQA 4LJ5A 4DCOA 2Q1KA 5TVKA 3L8HA 4DY4A 3HJRA 2FYUE 4LFBO 1G291 2KBFA 4O2LA 4Q02A 1ZSNA 4TMZA 5BSUA 5JC1A 3KCNA 1W73A 1FDMA 2GJSA 5I45A 2B4KA 2WABA 2VH2A 3FRJA 3O94A 2PAAA 4RQTA 2GEBA 5GINE 3I04A 1P8JA 1E1NA 3QVGA 1FQWA 3CMAV 1Z7EA 2I80A 3IA7A 4G3XA 1EG7A 2FYUD 4JUDX 5CJPA 3H32A 1YE3A 5CVJA 1C30B 5AVKA 4B4VA 2KG7B 2P78A 3ROQA 2VWPA 2AT1A 3OFKA 5E6RB 1IUOA 3DH0A 4PTLA 4L75A 1KZUB 3USSA 4WY4C 4EYEA 2XDAA 1LTIC 4AF8A 2GAAA 3FFAA 2WLIA 4YMIA 2C2XA 4TLDA 5ALFA 4MEJA 2BCCH 3QXGA 1N5IA 4BIUA 1G8JA 2XQGA 3K73O 3QENA 5D3QA 5EOVA 4J76A 5EY5B 5F1OA 2Q5ZA 4JBZA 1SXGA 2G0AA 3K15A 1ZBQA 3VYUB 3ZVRA 3FKJA 1H05A 4J7UA 4BW9A 1NU1K 3AX6A 4OJKA 3H65A 4IFEA 4YP6A 1QLNA 1R4MA 4OHBA 5IAJA 4C5CA 4MPJA 5JAUA 1IHPA 4N65A 1NTOA 3B5EA 1IZYA 1SU6A 3U10A 2O3TA 4J4TA 4W99A 1E89A 2PGNA 2CKMA 2V45A 3CRMA 1Z2DA 4MNTA 1GQYA 2R8EA 3EMDA 3IEKA 4Q24A 3HXPA 3O8ZA 5F33A 2XUMA 1SXJD 3PUZA 2IZ5A 3WJ7A 5CYGA 3UFBA 2CXRA 2EWVA 4I5FA 4EHBA 1OF1A 2OOSA 2VJKA 2OPHA 4C43A 2HK7A 4JQ0D 3P0EA 1OGIA 1G5PA 2C2MA 5HG0A 1Z8FA 4MUAA 3WHKA 1C3OB 4BNDA 2QGNA 2QUHA 4RENA 4ZCTA 1SXJE 3G02A 1N2DC 4HQNA 3RV4A 5EIWA 1DLIA 5KOYA 2V74B 1V43A 5TV2A 1NXTA 3PGKA 1HETA 2IPNA 2QRNA 4MK4A 4LJYA 3X0DA 2WWRA 3JZAA 1PJ2A 1RBMA 4V2IA 2ET6A 4XCVA 5A7FA 1OROA 5KWVA 4IGGA 3PI6A 3TZ6A 1VQNV 3EVBA 2XCTB 1OI4A 1DFHA 3KDAA 4UHDA 2BOCC 3CC8A 3MJSA 1LC0A 4NONA 2OTCA 4P5DA 5LGNA 4PHTA 5D2CA 3VOBA 4HPJB 1AB5A 1E6KA 3QE4A 3CXHF 4EGJA 4NEHB 1QK4A 4W1QA 5E3JA 5EYPB 1FB5A 3L35A 1WR8A 2SCUA 1KFKB 4IYRA 1M4UA 5G40A 1GMGA 1HRDA 3BGOS 1BJTA 2F1RA 2OWEA 3E3NA 2B89A 4ZZ3A 5C37A 3UMRA 4A8PA 3SLKA 3N2NA 4JZGA 1IQUA 4JHXA 3JVIA 4BNNA 2DHQA 2H06A 3TL3A 2CMHA 2YMPA 4MVJI 1DXYA 4IGEA 1RF1B 1NI4A 1N2JA 3HWRA 1CF4A 5CDYA 1TYEB 1PFQA 3U56A 2DF8A 1ULUA 1L5MA 5TQ0A 3JC22 1BVHA 1EZ1A 1HURA 4ZPJA 3M1AA 3MTBA 3R3XA 3ONWA 4QUIA 1EFRG 3CN9A 1Y6JA 1Q16A 3AE1C 4NS4A 5FL7G 3AQIA 3FYHA 1SBIA 1U9CA 1ESZA 1XRQA 3D7LA 3T3OA 1BS3A 1EUDB 2XUQA 4NTWA 3IJPA 4DC0A 4DQ0A 3N7TA 5T6BA 4FZ1A 2WU0A 1J90A 4FC7A 4LC0A 3P9XA 3HTKA 3ZLVA 1GZSA 3KUDA 2JRLA 2NU9A 3OZAA 3OPYI 3TFQA 1L5OA 1MT3A 3COWA 3JQRA 2WIBA 3TL2A 1DEHA 2CCGA 4KO8A 2OFFA 3UJ6A 1I08A 2WIAA 3WICA 4B3FX 2HPZA 4Y2UA 5JATA 4RAIA 1I94O 3W5HA 4E7PA 5M2QA 1Q6UA 5C8ZA 2LW1A 1RXSA 3M70A 5FF9A 5B58T 2V6MA 1YA8A 4J80A 4NBLA 3HCDA 4RH1A 5CVVA 2BFEB 3O7WA 5LGTA 1A8HA 1D9XA 2GERA 1RC0A 3H1JG 3DW1X 1ENVA 1I9CA 3UAZA 3ZDAA 3Q2KA 4UATA 5CNMA 2XY4A 2FV8A 2EFEB 1VJRA 1JZSA 1Q92A 2F4VB 1I01A 4J42A 1YWGO 2UYYA 1K8RA 1NVKA 1TADA 1KYQA 1QBZA 1L5HB 4X20B 2CL7X 4IH4A 4XCQA 1RXVA 3PC6A 4OFZA 1S5LE 3HJHA 3OT5A 1T0BA 4BBPA 3EC1A 4TXJA 1N7JA 4PXYA 1GZVA 3LA6A 1W0JD 2TMGA 1UKVY 2BT4A 2X8LA 5AJVB 3WWEA 1Q17A 2WWIA 3H1GA 4R68A 2BW0A 3NO4A 1N4CA 3WG7B 4HLQB 3JYQA 3NP7A 3I34X 1T8RA 3L7YA 1U2RA 1Y42X 4K9OA 2WT9A 5DMXA 3IPXA 4PYJA 4TWIA 1DKLA 5IT4A 1NU1J 2FZKA 2I7XA 1ZYUA 2ZVJA 4UB6E 4BDSA 4D96A 4EP1A 4Q00A 8ADHA 3K5HA 3RC3A 3KM0A 4OO3A 5LWQA 1NLZA 4D0GA 2ORIA 5B3KA 1GM9A 2DWCA 1GZUA 3HSYA 3TJZA 4GNKA 3VBEA 4EEZA 2W6PA 4W6ZA 5EE1A 4UQPA 4MA0A 1VE3A 4LOLA 3ML0A 1K8XB 2M5AB 3P0RA 1EM8A 4UEJA 5IT5A 1NGSA 1IDOA 4ZGBA 3C8MA 1P0PA 1S2NA 1ZUNA 3R5JA 5J4YA 1Y3AA 2EYUA 3UHPA 3GMDA 2D7CA 1Y6RA 5HMLA 2QN2A 3LY9A 4RETA 3L8GA 2VTBA 3SQXA 2WNHA 3FHCB 2ZKIA 3EMVA 3K08A 4CMIB 3WUVA 2FUG1 2QQEA 2YJNA 2GF2A 4R01A 4X84A 3AK1A 1NE7A 3B40A 2OB1A 2PKXA 4BFYA 3QI7A 1RW4A 4MV3A 4FGZA 3KBOA 2R9IA 3GFTA 2Z9BA 5DISB 2UUBO 1DB3A 2XNJA 5T4FA 2H2IA 3WZMA 4KWIA 4P4SB 4KPGA 2TMKA 2K2WA 1D2RA 3M9HA 4KHPB 5LQSA 1NI4B 2HDNB 3WP0A 1NP3A 4JQOA 4QMAA 4TM8A 4B71A 1B1CA 3LBFA 4GR9A 1E1RG 3ABSB 3PUKA 2LP7A 4B46A 4XUDA 1NTMH 5DNWA 2Z6AA 1UEJA 2B4YA 1ZQ1A 1GHTA 2G6BA 1QIHA 2PIDA 1HFWA 1PR3A 4CT4B 5K0FA 4U9UA 4S1WA 5J1SB 1HJ0A 1SVLA 2ZYGA 4OI2A 2ADPA 1UFQA 2EZUA 3D3WB 2WB2A 1EM6A 2H94A 1Z73A 1GZDA 2XUAA 5CBPA 1JAXA 2XTAA 3TK1A 2PJUA 4HI0E 2R5DA 1AQIA 1CY0A 2W4MA 4GSLA 1U1GA 4JFRA 4KQGA 1TGOA 1LZLA 3ZV6A 3A04A 4KX5A 3HR4A 4ER0A 1TVMA 1ZY2A 3IIEA 5CAEA 3H97A 3FBGA 2CSXA 1L3BA 1NIPA 1Q19A 2WLLA 2OAGA 3ELDA 4RE6A 3UO3A 4CKBA 5KAFH 5C5IA 1P6UA 4EY8A 4YP5A 3AK3A 3KQGA 2JFFA 5DM60 2HQ1A 2NZJA 4L2IA 3VJRA 1MAVA 4OK5A 4OIFA 2V7XA 2HOQA 4JLNA 3N2KA 1KYVA 4FPPA 1U98A 2LXBA 4MVWA 2G88A 4QULA 1OB2A 2ISCA 3B1VA 1B8VA 1AY0A 2GX6A 3ER6A 3L4BA 3M49A 4CI0B 3IUBA 4PWZA 3X1WA 3RUDA 2ZPUA 2NNUA 1P84D 5K0BA 4X20A 2ETNA 4LBYA 2MTBA 4KJZA 4OXYA 3K53A 4Q7EA 1AQ6A 1C0EA 3O65A 1NBOA 4U9IS 5KKCA 1A02F 1U3TA 1CRPA 3E9QA 1KVRA 4AIRA 4BWYA 5BWCA 2HFED 4Y9UA 3OZDA 3RC7A 1AZLA 2IUTA 1PYGA 2XDQB 3LQ4A 5CBFA 3W4KA 2IH1C 2P6JA 3DZBA 1PWHA 1NTRA 4MV6A 1YQWA 4TZTA 2Q0HA 1GK4A 2W7TA 1ZJ4A 3MWYW 1TAQA 1U1CA 2GZ3A 4IDNA 2AI1A 3RWMB 1YK0A 3S28A 4QBTA 5AMXA 5L51A 2VHQA 2KG7A 1W8IA 3RVPA 2F43A 4BAZA 1QPGA 2DOSA 3PEVA 3H1JJ 1EFPA 1JY3P 1YHQV 1H65A 1Q1BA 1U4SA 2IUSA 3C6XA 3D8BA 3GLTA 2P0AA 2WLIB 2AX4A 1ZAUA 1S8OA 3OKCA 3NLLA 1GDDA 4MH0R 4O5OA 3PICA 2GCOB 4G5OA 3FKSG 2OFWA 4MV9A 4CPDA 3VSBA 1LLUA 3FH0A 4E13A 4P0PB 2E3CA 5EESA 3USCS 4B35A 1QFSA 3EVKA 5D8DA 2J9XB 3C3SA 2XOEA 1ZK2A 4BP8A 2EILC 1FTYA 1P7CA 2DW4A 3AEEC 2BELA 2GNOA 1YR2A 2QUIA 3EZ7A 3BRTB 3ONVA 4G0PA 3T34A 5BW5A 1GFSA 3P0FA 1TA8A 1BKDR 4BATA 3T9AA 3SOPA 2C3YA 2YTZA 2QQGA 3PA8A 1EE1A 5GJCA 1PI3A 2H43A 3H19A 4J7JA 3SAJA 3T35A 2ZXEB 1AKTA 1MRNA 4ZT6A 4CL2A 1LPNA 1YNOA 4C01A 5ICMA 3C8ZA 4WLOA 5JJNB 3CCSP 4Z2YA 1RE0A 3C14C 3UYKA 3BABA 3GLHA 2YKOA 1T4CB 2VR1A 4PQFA 4DQUA 1V8BA 4KN8A 1ZSYA 1J95A 1FE6A 1G4AE 1YZUA 2I6SA 3HJCA 4QBIA 1XVAA 3QUTA 3WVNA 5JXGA 1E9FA 4IHAA 4QUGA 4XE5B 2C9LY 4DHWA 4B7AA 4NR1A 1KZ4A 3CLSD 4BC1A 5BT8A 3CGGA 4MV5A 2WICA 2XF2A 4MI3A 3TLGA 2PRZA 4YAKA 1PTJA 1X7WB 4JUCA 4AY5A 1C0PA 1WXEA 2GKGA 1P9OA 5FOXA 5KJ1A 2A1TS 4ZO4A 3OQJA 5FYDA 1HE4A 4ATNA 3TG8A 1U81A 3CPEA 4ME6A 2CLCX 4G89A 1G2IA 2UZ1B 3WGHA 4WOCA 1RM5A 1HDJA 1MO3A 5GM2A 3EPPA 2R1ZA 3H1IG 2K5UA 3FNBA 1ZOOA 5KC8A 1ILEA 3W8EA 2WOOA 1OKKD 2WLLB 5LBTA 2RD2A 1DKRA 2R66A 4IZHA 2P4VA 5DJ5A 3PDWA 2SKDA 1FDTA 2WYWA 4LJ7A 5E79Z 1GD1O 3RS4A 1ND5A 4DSUA 1IIRA 1KHHA 1TMOA 4HLNA 5EAIA 1YJXA 1GRVA 2XZOA 1G19A 4JTDB 1H6BA 3N2KB 2XMZA 3FBWA 4ZJYA 1LEHA 1L9KA 1PX0A 2BMAA 3H9GA 1XJQA 5B3SC 1RP3B 1KB9E 1BX0A 2XJ9A 3CC4V 1GWNA 4D8WA 4H1TA 4NB5A 4MKGA 4RQFA 2PKQO 1ZJ6A 4IJMA 4BNXA 3I09A 3HJAA 1F06A 4EFMA 2UKDA 3Q0IA 2Q45A 4KP7A 3A2FA 3F3MA 3KFLA 4H6WA 4O8CA 3ZVNA 1OFUA 1K9MW 2OTLV 4FNMA 1AGYA 5DGXA 2YWFA 4K6FA 1EFTA 1HL7A 5DGDA 1LDNA 2OBFA 3TKAA 5J43A 5KYKA 5DEOA 4LYGA 4O4HA 1WHSA 5I7WA 2IBSA 3GJQA 2BR4A 3KJZA 1JU9A 4KWTA 2DPXA 3SQOA 2FSIA 5HJ5A 3HTKB 3PXBA 1EJ6A 3E58A 3ZJTA 1JJ2U 3BB3A 2Y1CA 1M9NA 4UFOA 3RAJA 3V48A 4R1MA 4CFSA 2AOUB 5AXCA 3DE1X 3KT8A 2XMBA 4JROA 3WMFA 1EFRD 4DS3A 1P31A 1X6VA 1WUTA 3DFIA 1DIRA 2Q5OA 4PFSA 5FJIA 3SYQA 2C4UA 3F9IA 2LCFA 3TVDA 3ZKWA 1XT6A 2X0JA 1Z0IA 4KRGA 5C80A 1L4GA 3R7NA 5EMMA 1XRLA 3E7KA 4HTFA 2Z98A 1SVFA 5EINA 4AUKA 4ZO7A 2PFSA 1P2GA 1UPXA 1BCCH 2EJWA 1NHGA 4NZPA 1FXWF 3KSRA 4PQRA 4F97A 2W2KB 3HBJA 3VC2A 2JFGA 1R3KC 1CJVC 2FW8A 5IARA 5I48A 5JWOA 3GLGB 1VQMP 2XNDG 2P2UA 1A5BB 4XKJA 3ZWNA 1EPUA 4I7ZC 2VUHB 2GRJA 1SETA 1ZK4A 2DBZA 2J5XA 3EIWA 3GU3A 4PAGA 2G4VA 5DHFA 2NG1A 3I01M 4TZ0A 3BMCB 1VMAA 3AVPA 5HMMA 1UK8A 1WSAA 1GFZA 5DOVA 2VZLA 2QJKC 2Y99A 4V0MA 3TETA 4XWKA 5J9FA 1YC2A 1AB3A 4G09A 4DAOA 2VP2A 3QVVA 1QBGA 5JW6A 2B8TA 2I6UA 3AZOA 3MZ0A 4UOQA 4WKBA 1HNZB 1N0IA 3R3HA 1O6FA 3WLKX 4GECA 1UBMS 4I1IA 3D3QA 1YJ9P 2EVWX 2R1VA 5JCXA 4DO2A 2J6HA 4NXMO 3BJMA 1DAOA 1GPLA 3AK4A 3DPSA 3E9YA 3HXQA 3A06A 2HP8A 1XRPA 2KHZA 1VRVA 3LYUA 3B9BA 5I4BA 2I1JA 5EJ6A 2J3JA 4YYEA 1TYBE 3MAJA 3ZZMA 3RW9A 2XCOA 4PI0A 3I04M 4MV1A 4U3FH 4P7KA 4PZLA 4TN5A 1DBQA 3L0DA 4PA9A 1W0CA 1H88A 2Q49A 1XZNA 5FJJA 3GHGB 3B1YA 1YCIA 3K6KA 4G86A 4B48A 3V4VB 1JJOA 3M91A 3DEYX 2JP3A 3G8DA 4OHVA 1YDEA 2ONJA 1BMTA 1ODJA 2Q3LA 2Z5UA 4AMGA 4OU4A 4GYJA 4V39A 4FONA 4MO2A 5JJBA 4ABMA 1HKHA 2EINC 3BA9A 1P18A 2AYYA 4CQJA 1J2JB 1U94A 2G36A 1E1LA 3MJRA 2WKWA 3PNYA 2IOYA 1GCGA 1QR6A 2BFOA 3F7YC 4JBXA 1KJQA 4Q93A 4D42A 1NY5A 3LDFA 4G65A 4U6QA 1OVUA 3CKKA 1G7SA 2WM9B 1QR9A 4MRMB 1HZZA 1ZC4A 1A76A 3RRMA 1E9DA 1IU9A 3VR6A 4YT8A 4FTWA 2UZAA 3D6NB 2W83C 1IOWA 4PG6A 4WZ6A 1KZYC 3ML1A 2NSDA 1RI2A 1YTZT 1J8MF 1L0ND 1YR8A 1Z0JA 2ZEJA 1W0KG 5CNKA 1TUBB 2W42A 3RIEA 1R16A 2QA4V 3ENNA 5BR4A 2QRUA 2MU1A 4BKPA 1OW8A 1IQRA 1C4WA 1SVMA 3D3WA 3SEFA 5EZYB 1AJEA 1NVTA 3PUYA 1OA0A 3IQWA 3QP9A 4KT0J 3PCRB 4O25A 3RDPA 2WA2A 1FAVA 4EHIA 1BA2A 2PGAA 1PR0A 3S1SA 4JQCA 5JYBA 4NULA 4Y6LA 5BN3A 4UARA 3VH4A 5LQAA 1K86A 5G41A 1RIFA 2YDEA 3KTDA 5FCDA 5I8ZA 4GPZA 1MZFA 1B41A 1OLOA 2RHRA 3A3KA 3ICQB 1O58A 2IYXA 4HL6A 3AE9C 3N4XA 4LHWA 2INGX 2QPTA 1IN5A 3EVZA 4WHMA 5MN6A 2XKJE 4Q4DA 3OR6C 2JCYA 3JR3A 4JAUA 3IPCA 3QY0A 2EF0A 3EG5A 1X7HA 4UXJA 4W82A 3SJ7A 3NMUF 3TGWA 1KQOA 3ONNA 5A6VA 1PK8A 3WR5A 2GM9A 3QEJA 1MENA 3ZD8A 4A0HA 1YDWA 3CUUA 3MOSA 1K73W 3I56P 5FPQA 2NP7A 3EHDA 3Q88A 3EQ7A 3BHIA 3ROEA 1CR0A 1TO6A 2EW2A 2Y77A 1EUQA 3D3KA 2C95A 3LUGA 1VQKP 4IJKA 2J9FB 4HPWA 1RRKA 4AQ7A 2OYHA 3N5CA 4Q03A 1JCHA 2Z43A 4EARA 3KXDA 5APSA 5KLVJ 3DZIA 4XVRA 4OHPA 1D2MA 1CUBA 2X0FA 4QSMA 4FYHA 1ZUIA 1L7VC 2L0XA 2EJ7A 1LK0A 3IHKA 4OI4A 5I51A 4RD3A 2Z6VA 1JSCA 3OTFA 3OPNA 4ICGA 3ZCTA 4BO6A 1VFPA 2CK3D 2HIAA 4HXGA 1ZMXA 1MO4A 2PTHA 2FQ1A 1YF2A 2G09A 3ZU6A 5CMLA 4KL8S 2QX9A 4V1CB 3F2IA 2O1EA 4UU7A 3FCOA 5D6OA 2H00A 1R37A 2JB9A 2QW8A 4F84A 4YRDA 3QXCA 4GP6A 4DY6A 1OLSA 1TW2A 2P0YA 1OXMA 2QTGA 3PD1A 1KF0A 4JT2A 3FPLA 5FA8A 4C3VA 2FPMA 2CE7A 4IOJA 2H8PD 3PK0A 2Y9PB 4W5NA 3V2QA 2CUKA 3EK2A 5IYDO 3BRCA 4N7MA 3G2LA 2EERA 3VZSA 3ICEA 2GESA 2YNMD 1ZIPA 4GNRA 4MB0A 1Q15A 2JA1A 2JI4A 3KUUA 1WRBA 3KZOA 1OREA 2EKZA 4BZXA 2G70A 1QCYA 3LXMA 5F77A 4HLUA 4FW8A 3PUXA 3UJHA 1AZTA 2HH9A 2VHEA 4YCSA 1TAHA 5EWLB 4CEJB 2EARA 2BSKB 3PXXA 2ETVA 3MJTA 5IMBA 5KHOC 3JQFC 1JIKA 2QMEA 3GFGA 5CCBA 4L87A 1M8PA 1PWZA 2JIMA 4CIWA 3VP9A 5AVVB 2GILA 2D2CC 2GKOA 2JC3A 1U5AA 4DKXA 3WOVA 1KI7A 2A1UA 2H16A 3QU4A 3L36A 1NNUA 1SUIA 2GCIA 5G0SA 2CVHA 1M6NA 1GPDG 3B53X 3W5DA 1I1QB 3KZVA 3DTVD 4HSEA 3O8BA 4CF3A 4YH1A 4HQ0A 5BYBA 1K3UB 1OY1A 2FXIA 3L1HA 3REFA 3TTYA 3LKVA 4F9FA 2Y6VA 3CSDA 2YI9A 1UJWB 1XLTA 1KETA 3S27A 4C07A 5B1AB 1DHRA 1YJQA 2RGNA 3Q6IA 4FMDF 3K2QA 1UDRA 4EI2A 3K7EA 3NTOA 5K3DA 3ABUA 3M0AA 2CDRA 3EZYA 3ELWA 3R3WA 2GGSA 3VOTA 3GLHB 5L3QB 2XZRA 2ZBGA 2XITA 3AU8A 4OXIA 3IF4A 4URHA 4B2IA 2JDID 2QRVA 1KI1A 3ABOB 3T5CA 4YT2A 2Y4NA 2IJJA 2P41A 4GI7A 1TUBA 1YR9A 1AO0A 1KY4A 1ZUD1 1TZ2A 2DJ5A 3DBLA 3JQ8A 4O2AF 4P35A 1EG2A 2VCHA 1ZMOA 1SOWA 1VL5A 3M2PA 4AUEA 4EI9A 4LX8A 4HQ6A 2W6NA 2XGSA 2C31A 3SHQA 4M6WA 4NU6A 1G5HA 4W5OA 1TIPA 3KL4A 4PLCA 2RHOA 1GADO 1RPNA 1WCYA 1EZVE 3ZWBA 5B66H 4DYLA 4P9OA 2O8NA 4HGQA 4HGRA 3ZQ4A 4BVKA 1E1CB 1SJ9A 4ZYYA 3HKDB 3I9V1 1PD0A 5K0CA 2QT0A 3S3WA 1FP4B 1RAEA 1LK5A 2AZDA 3JRWA 1YZLA 4BVJA 5HQ3B 4M1SA 5F5LA 2BCCE 4OK6A 3MYYA 3VPCA 2HWWA 2VH1A 3OAAG 3GF4A 4X1KB 5ALZA 5ESRA 2ZXXA 3C16C 1M1JB 1JKMA 1FXSA 3H11B 4L4RA 4BVFA 3VNUA 1WXDA 2J5RA 1Q2XA 1IONA 2BPOA 2WILA 3MS7A 1IB0A 1RHQA 4HDNB 5GWXA 4Z3OA 1UXKA 3RSHA 4D6TE 2P6MA 1XTGB 2X2FA 4LN1A 1L7AA 3R8CA 1WPRA 5ALJA 5DBEX 4ZCPA 5F4BA 2P2DA 4HLDA 1VRWA 1YONA 4RM3A 4C0SA 1UMCA 5ECWA 4L76A 3CUEF 3QZUA 4R1NA 4DUYO 3AE5C 4IOIH 4NNOA 2GD0A 4L0MA 2GLXA 3K5NA 1GCIA 3C6BA 4FSXA 2GS9A 3E22B 4I0XB 5CB6A 5ITSA 4I1LA 3WIUA 4DBZA 1Y6GA 2FPKA 1X7ZB 2FPGB 3L8DA 4DR4O 1YUNA 3BE4A 4GPTA 2V6FA 1JR3A 1ZC3A 4TMXA 1TK9A 5BNFA 2Q5HA 1VFNA 2CTRA 2JHCA 1HO3A 2Z5FA 3HZOA 2QTVB 3D8RA 1U31A 2WF5A 1KBHA 1C9KA 3FFBA 5H9CA 3QBTA 4FFLA 3WKBA 2QRJA 1KILA 1RAAA 3VC1A 4KR2A 4X7BA 5BUQA 3PJFA 4BCCA 4KVAA 3RIYA 4Q1BA 2ALJA 1SHLA 2AK3A 2CK3G 4N5HX 2OCHA 4OYRA 2HG5C 1LX6A 1ZFNA 4J1SA 1HR0O 4N8DA 4FJ0A 4TV9B 2PLRA 4FZ0A 1T3HA 1WVIA 3P2OA 4OYHA 4IT5A 5G1PA 5CIYA 3OU7A 4GE0A 1JKJB 5GMOA 2ZSUA 2YY6A 3ZXIA 2WLTA 5FWDA 4Y0VA 2PX8A 1VQKV 3E2IA 3RRBA 2ZP1A 4YXWH 4GH5A 5AKLA 1H8HA 4MXDA 5EGSA 5JY6A 1X1TA 4GI5A 2JW5A 4OLHA 4H0LB 2OY0A 5AI0A 4KXYA 3ASUA 3DJYA 3N86A 1T6AA 5AI6A 4HWSA 3C7TA 4BUZA 4DIEA 1RM1B 1XLWA 2FDXA 4JZ2A 2WMYA 3QOFA 1YBMA 4P1ZA 4UBJA 3DNPA 4PELA 3L7CA 5AW8B 2REXB 1CRZA 4DCUA 1OWAA 3KYDB 4XLTA 2X6RA 3DL0A 4E1VA 3KSBC 3M9XA 3V80A 4CTOA 2NO1A 4MKRA 4DBVO 2B9ZA 2HSDA 4N0DA 1B3BA 1SC3A 2W6IA 5IXYA 4JKOA 1O89A 1YCFA 1QP0A 4FMPA 1TA9A 2JLRA 1D4ZA 4P7BA 1QMGA 3SEQA 1NDQA 2ZI3A 4X66B 1UP6A 3TUIC 3A6PC 1ND6A 5JWPA 4F71A 2YBEA 3PE6A 3LNTA 3K70D 3RARA 3SGLA 1SQQH 2BLNA 1EXJA 1Y4ZA 3F5DA 4BOYA 3IQGX 4QGHA 2ZRMA 3NIBA 3L92A 2CNNA 3TH5A 1AXRA 1SQPJ 3VX4A 1TT5B 3BZBA 5AIAA 2ZAYA 1RWQA 1TK2A 2JAWA 1NSFA 4KAXA 4XWWA 1K88A 3AEGC 3B9RA 4K2AA 4FYWA 4ZAWA 1KAQA 3K8ZA 3OCWA 4R6ZA 1H2YA 2O59A 3AJAA 1EFLA 1G1JA 1N5MA 1Z3IX 3BXFA 3CH7A 3MWLA 2PMKA 3OT4A 5CK5A 4OHZA 2YWXA 3I4FA 3PB3A 3II6X 2I7VA 2B1JA 2QTBA 3QQPA 4W7IA 4LCJA 4UTRA 2X3FA 1K5DA 2PWAA 3G5LA 1SOUA 4EEKA 5HA5A 3K06A 2F9LA 1FDWA 1R6VA 3E9NA 1CPYA 1XX6A 4PCAA 5DULA 2WZBA 1IHOA 2C00A 2GV9A 2OCDA 4ADSG 4RO0A 4LOKA 1T1GA 4DZOA 2DUUA 2F66C 1F4MA 1EMDA 1XHLA 1FYD<