4LC1A

Meab, a bacterial homolog of mmaa, bound to gdp and crystallized in the presence of gdp and [alf4]-
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
326
structure length
315
Chain Sequence
b'TLPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylmalonyl-CoA mutase accessory protein
publication title Autoinhibition and Signaling by the Switch II Motif in the G-protein Chaperone of a Radical B12 Enzyme.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
total genus 122
structure length 315
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4lc1A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4lc1A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lc1A02
2HF9A 4TQUS 4UJ5A 4W7SA 5GJBA 3A58B 2ZM5A 1TTTA 1NAFA 1UM8A 1YR7A 1YZUA 1W36B 4C2TA 2J5XA 1QHHA 3HP1A 2BCJQ 2HDNB 5AUNB 4GBMA 4QFMA 5F9HA 5AVYB 2ZAOA 2Z5IA 4M1OA 4BFWA 2OEPA 1FNNA 1CSBA 4OI1A 3RWOA 4A15A 2H7HA 2DWQA 1W0KA 3NIBA 3U3JA 5EP3A 5KPJA 4PAOA 4CT5A 3ZD7A 2V6IA 3D6TB 2O8FA 2CNWD 1QBKC 3H84A 1G5RA 2CBZA 1SVLA 4V0ME 3TSZA 1ZBDA 3GJ8A 3AF4A 3S1AB 4US0R 5FUYA 3K0SA 1TUEA 2JCSA 2WWWA 2IWRA 3GEIA 3THYB 2IYXA 2UZIR 2P5TB 3CKLA 1WBBA 3A6PC 2IPPA 1KO4A 4AYTA 4O3MA 2H16A 4AYXA 4Q9IA 3P8MC 1GITA 3V4FA 1GNQA 3TBKA 2VA8A 1M1YE 1XXHA 1LNZA 1F2UB 2DY1A 2FH5B 3BH7A 4QNRA 3B9PA 2BEKA 5C4GB 3WMEA 5FR1A 4AKEA 1E6CA 4YLGA 5EQTA 3SBDA 2ZRDA 4TMKA 1XJCA 1PV4A 1SVIA 4URUR 1UBEA 1JQJC 1OH7A 2N46A 5FI0B 1VPLA 3B82A 1UJ2A 2C8VA 3BRWD 3X1XA 4BFSA 5EE1A 3A36A 4Q9JA 5FBVB 2BIFA 1E2PA 1FPMA 1MRSA 1B0UA 4OK6A 1BO6A 2WPDA 4PC6A 2QY9A 3SZRA 4DCVA 3BB1A 2IX3A 5CDFA 1CJUC 3GJ6A 3K70C 1T3LA 5BYJA 3KXKA 4OHXA 5TARA 1SKQA 1DAEA 1NN1A 3H1TA 3SE0A 4B2PA 3HR7A 3RS5A 3THOA 2FTKA 1Z2CA 4PAQA 2GBLA 2F9LA 3KFXA 1ZP6A 4YQFA 1LF5A 4OHYA 2GF0A 2I1VB 2ZJ8A 3SFVA 3EW9A 4IDPA 2ECKA 2REOA 1LV7A 2ZRGA 4NCKA 4IEIA 3OIYA 2FA9A 3BGWA 4URWR 4GKGA 3HTKA 1Z0DA 4KVAA 5DSZA 2R2AA 1OYWA 3MWLA 1JBKA 3SHFA 3SEAA 3BWDD 4E07A 4EPYA 2F43B 1IOZA 1QHXA 1DO0A 3Q7QA 1T8TA 3CR7A 2AKYA 3ZDQA 4M9ZA 4MDFA 3QXXA 4GP7A 3AF1A 4KV9A 2FSFA 1F2TA 1KSJA 2GXUA 2R6FA 3WHLA 4HAWA 2Z6VA 4FN5A 3RAPR 2RGNC 4NYIR 3GFTA 4TYNA 1LY1A 4MDEA 2ZAMA 2ZRJA 2JAQA 1SVMA 2IT1A 4LCBA 4MUBA 1XPUA 4A2WA 2PJZA 4OYHA 3U61B 2D2FA 1T91A 3JZMA 4F4CA 4JL8A 1GWNA 1XMJA 1SULA 5J4LA 4DB4A 4PO1A 4RJLA 1M8PA 5FTMA 4RD4A 2EWVA 2EWWA 3R20A 1GRNA 2OG2A 1NKTA 1W4BA 1Q12A 1WE2A 4OJQA 4GMDA 4M53A 3KTAA 4RY2A 1WP9A 1W44A 1D2NA 3QKRB 3ZJYA 3KKMA 2Y8EA 1WB9A 1XEXB 2VSFA 4S35A 2C5LA 1G4UR 5JS8A 3K9LA 4O25A 3P1JA 3EPJA 4DKXA 5DIFA 2J0UA 2CE2X 2IYQA 1SXJE 3VYIA 1OE0A 4DZOA 3DL0A 2EQBA 4ZPXA 4CVNA 4PC3A 2XNSA 4NCJA 2CK3D 3LAWA 4R71A 3VR3A 4B43A 4BRUA 1IBRA 4BRWA 2XTZA 2NO9A 2VLIA 1RJ9B 1FMLA 721PA 4P32A 1QZXA 1YR6A 3U5ZB 2PMKA 1XZQA 1Z5ZA 3PENA 4V0MA 2CHQA 1H65A 5FBRB 1CP2A 3EC2A 1G3QA 2J46A 1IXMA 3FKQA 3B7GA 3K9HA 3U7EB 1TF7A 2IUTA 5FBLB 3L0IB 1J90A 2FE4A 3OEEA 4DDVA 1OWAA 2RHMA 2ZSBA 3TYYA 2YOHA 1XRJA 2OBNA 3HE5A 3KJHA 2JLXA 2I1QA 1G8FA 2OFXA 4WZAE 4G1UC 1KJZA 1H8HD 6Q21A 3I8SA 3VQTA 1GTWA 1G7RA 3VKHA 2W00A 2WWHA 3B1XA 3P20A 2F55A 1DADA 2P6RA 2V55B 1OH6A 1WDTA 3L0SA 2VF8A 2C9LY 4HLCA 4C3ZA 3KXIA 4C7NA 3GJ3A 2ZYUX 5DO9A 1E2FA 3L2OB 4GOKA 1XTSA 2W2TA 4H1VA 2ORVA 4RCZA 3I5XA 3A4MA 5FOVA 1Q0UA 1YQTA 1TU4A 3U60B 4RD1A 1DARA 5EXSA 4KVGA 2XXAB 4ZIRA 3QXJA 1Z8FA 2WWIA 3HJNA 5LBIA 4DRZA 5IK2D 3DM5A 4MRRA 1S96A 4IXMA 1Z28A 5GVRA 5CIWA 1U0JA 1NVVR 2OLJA 3H2YA 4HLDA 3CF2A 4BFUA 4ESHA 1W5TA 1UKZA 2JA1A 4KYIB 4OI2A 2YKGA 2A5YB 2D4HA 2IYYA 1CULC 3B1ZA 4JZKA 3DHWC 4M1WA 4QGHA 1FOEB 1E0KA 1YR8A 4A4DA 1II8B 4E09A 2JLQA 3E5HA 5KDOA 4Q7KA 4RSGA 3HU3A 1PLJA 1ZVQA 3ADDA 1DAKA 3VNVA 1JEDA 4LJ8A 5LB2A 3W6OA 4BGDA 3UIAA 4LZZA 3KDPB 2E9SA 1G8YA 1NJGA 4GT1A 5AUQA 2GTPA 1S1MA 2WMOB 4B3BA 5APUA 2ODWA 2WIAA 4BFXA 1AS2A 3R9XA 2GRJA 2DYKA 2W6ID 3ZZUA 3X1YA 4DLTA 1UPTA 3L82B 2RGCA 4P4SB 1NBMD 3FVQA 4ZCIA 3QIAA 2H57A 1W4RA 2BMFA 2AHOA 1N6PA 1LS6A 4JLNA 1II9A 2QPAA 4LHVA 5JSZA 3TH5A 1I4TD 5EUMA 3NMDA 3T1OA 3QXHA 1NVWQ 4ZDKA 3CX7A 4PC7A 4DEYA 4B6FA 2PLFA 1ETUA 2ZUCA 3RS7A 3LIDA 1EESA 1ZC3A 5J40A 2CJWB 2WT7B 1HE1C 2D3WA 1BKDR 2PLRA 2DFKB 2XX3A 2J7PA 3HPRA 3QF4B 4URZR 2ZYWX 5JFGA 3PJRA 2BHRA 1OXSC 3SOPA 3K0CA 4HDOB 1ZMXA 4L4UA 1ZM4A 4M21A 1OF1A 4EJSB 4B44A 4C2UA 1MV5A 1US8A 3A8TA 4NPHA 3U3RA 3T1VA 1NN3A 3LDAA 5AJZA 4BFZA 2GJSA 3TSOA 5P21A 1P9NA 1UF9A 4C0KA 1G8GA 2OESA 5B64A 2FSIA 3LVQE 4B74A 3VX3A 2A78A 4KU4A 5L3SA 2BBWA 2G83A 2NO0A 4GI7A 4XD7A 5E7JA 1KJYA 4B2IA 1W4CA 2GZAA 2VTKA 4NCNA 4YMUA 1SXJA 1PUIA 4HI0E 5GJVC 2D2EA 4AD8A 2Q3HA 3TGPA 1W7AA 1QVRA 1S3GA 2VPPA 4KBGA 4NYMQ 3IR9A 4QNMA 1BYUA 2BBSA 3GMTA 5FPSA 3NFQA 3C8UA 3K0FB 3KX2A 3EZFA 3EWAA 4D4MA 3UPUA 2J0SA 4BPBA 2IXFA 2CMKA 4TN1A 4BFYA 3ASZA 2KE5A 1KO1A 2O8BB 1OLOA 2GXSA 1V43A 3MJHA 4A8JB 5DN6A 3OHMA 4B48A 5LDDC 4JLVA 2A5DA 1P2TA 2XAUA 3QEOA 4Q21A 5IHPA 3U2QA 1OXVA 4OQMA 4A0HA 1N5LA 1HEIA 1E4YA 1HURA 4OK5A 5A0FA 1WQ1R 3W34A 3LO5A 3U3MA 3HYRA 1MRNA 4KLNA 3K09A 5FFMA 2YJTD 1T0JB 3B9QA 5SZHB 3U4QA 1RKBA 2NMVA 1EWQA 4XIGS 1U99A 1A82A 3T1QA 3QF7A 1ZJ6A 3ZVNA 1CIPA 3IHWA 2QORA 1KDRA 4UXHA 2QTHA 3FMIA 4JJZA 1GZSA 1G20E 3I62A 4G0NA 3ZRWA 4MGZR 3KUDA 2D06A 3BOSA 4IOMA 4NYMR 4BEBA 4DJTA 5JCZA 1E9BA 3I5CA 3IQWA 2WWYA 2VEDA 1UEIA 3M9HA 2Q7CA 3MAAC 5KOYA 3F8TA 3RS4A 1DEKA 4XTRA 1RE0A 2EFEB 2F1RA 2ANBA 4B47A 3O8ZA 4IDOA 5FBWB 3HU2A 5G41A 3VMFA 2IYVA 2DFNA 2MSCB 4W9MC 4Q02A 3GFOA 2RGAA 1AS3A 1XEWY 1ZINA 3IQXA 1R5OA 2BV3A 3BIFA 3GLGB 1W49A 4DBLC 3OFND 4BZQA 1U8YA 2CL7X 4MGYR 2JLVA 3WYAA 3K0EA 3CNOA 5C2JB 1KHTA 4ZCMA 2DHRA 5A5GA 4Z51A 2ZVQX 1Q3TA 4ARZB 3PUXA 3GEHA 2GVZC 5FOUA 2ZJBA 2G0TA 2DFTA 1NN0A 2DR3A 3AKYA 4NYJQ 5EZ6B 1SGWA 3MGCA 3VKGA 1UDWA 3Q3JB 1A2KC 3RRYA 4P4TA 4AWXA 1IN8A 1P2UA 3NDPA 2QRNA 1BMFA 1T5IA 1T5LA 4P4UA 3GLFE 3LQRA 3DOEA 4QHYA 2EYQA 5EP4A 5JJKA 1RIFA 1JPNA 4A6XA 2WPDD 4DSNA 4N3NA 4D26A 3AVVA 4WBSA 4Q4HA 3FB4A 3SDZA 4AQRD 3TE6A 2OBLA 1W4AA 1U2RA 3ZZTA 3X1WA 4TL7A 2B8TA 1IQPA 3C7KA 1Q1ZA 2AKAB 1ZIPA 4WA7A 1FAVA 5AJYA 2O8DA 3KKPA 2JDIA 3LX5A 2Q5UA 2WJVA 3TNFA 1T0HB 1X8LA 1P2SA 2GJAA 5DH9A 4EQ6A 3EAQA 3G82C 1K6MA 1UBFA 2OILA 4GNKA 2HCBA 2JGNA 2XZLA 2BASA 3NBXX 5AVVB 1ZUNB 2BOVA 1E2MA 3CF0A 4BLSA 3BERA 3I32A 2CCKA 4HDCA 3WYGA 3QXSA 1NMZA 2JJLA 2FFAA 2W0SA 5HPYB 2CEAA 1Q1EA 4ILEA 2HV8A 3ZCCA 4C7OA 2WJGA 1MO5A 2QTFA 1CBUA 1GG2A 2QEQA 1M6NA 3BH0A 5B1NA 3W3AA 4GRAA 4QPKA 2H5EA 3IPYA 4LBYA 1AK2A 4TZ6A 4RFSA 2JLYA 2Z0MA 1VMAA 4M1YA 5DISB 3A1TA 1XNJA 3OEHA 2J7KA 1GL6A 1WBDA 3KB2A 1TEVA 2ODEA 3MUFA 1LF0A 2BWJA 4D4JA 1N6IA 3KQHA 4URVR 1OKKA 2E1RA 3B60A 3AVOA 4B2LA 4MKHA 3NTUA 3VMZA 1MR3F 3L43A 4GZLA 3KKNA 3CPJB 3EPKA 4QJ4A 2B6HA 3EZ6A 4LBWA 3CRRA 3IHLA 5HE9A 2ZE5A 4M0LA 2VSXA 1E69A 2ONKA 2IYTA 3GJ0A 3NHAA 1DE0A 2ZU6A 4LHYA 4HUQB 1R5NA 2QMHA 1PVOA 4AKGA 4WW0A 3V5BA 4ACBA 2GCOA 2ZRFA 3A0RA 3KQUA 2ZSAA 3ZQJA 1QF9A 3W8NA 4FI3C 1TQ2A 2X2FA 4L9SA 4DSUA 2W58A 2IS6A 5HTKA 4FWTA 3K1JA 4JKIA 1HQCA 4TT3A 1GD2E 4GL2A 4M3LA 1XX6A 2XEXA 3RS3A 1DAMA 1EFTA 1M2OB 3VNUA 2GK7A 3L35A 2WOJA 4IDHA 1KIMA 1CRPA 4B3GA 3PEUA 2FOLA 3IDQA 1ZU4A 4DCNA 1ANKA 5EXPA 3K70B 5L3RA 1KTVA 2FG5A 4Q1FA 1YHNA 1TPZA 5KSOA 1M74A 2JLSA 3EIQA 3IIKA 4L5BA 4PC1A 1DS6A 3T5GA 1KQLA 1F6BA 4Q03A 1SKYE 2IHYA 3OEED 1DG1G 4KFUA 4MH0R 3RS2A 3V4RA 3C41J 3TMKA 4NE2A 2ZI9A 4M2LA 1E94E 3CRW1 1Q21A 1RRPA 2WTUA 1H89A 4KJZA 1D6JA 2XJ4A 3RWMB 2EFCB 1GSIA 4HZUA 5HZKA 3T06B 2HYIC 3FGNA 1HE8B 2IC5A 4JKYA 1CJMA 1NRJB 2QSZA 2GHIA 1MKYA 4E5UA 4NDZA 4PHFA 4HDQB 1DTSA 1OIXA 3B6EA 2JLZA 1GKIA 1FL9A 3UXMA 1OFHA 2CHVA 3NEJA 3CM0A 3B1YA 4B6EA 3MWYW 5APQA 3A37A 1KNQA 3K0AB 3OE7A 5B58C 2HEIA 3GLFA 4NMMA 3GLHE 3TW8B 3V4QA 4B75A 1Z3IX 2QM8A 4M1KA 1LVGA 4ZKDA 5LD2C 2Q3FA 1WXQA 2VRSA 4A1FA 3SYKA 5JI3E 1O87A 4YMWA 2NZJA 3K53A 4FD2A 4IVQA 3A1WA 1L4YA 2F3TA 2IW3A 2ANCA 1T8UA 4YONB 4FMDF 3THXB 1A2BA 2WSMA 1FW6A 3PUVA 4JLAA 4Q4LA 4QBFA 2GJKA 1KSGA 4XVRA 2NOAA 2NPFA 4U7DA 3K9GA 3PV0A 4OK3A 521PA 1FX0A 5C93A 4RESB 3QVUA 2VP5A 3FYHA 4HB3A 3TNUB 2C96A 3BE4A 2O8CA 1UKEA 1P61B 2FFBA 1RFLA 2AWOA 4MGKR 4YXWA 2X2EA 4Q18A 3LBHA 4A0GA 4BIUA 1I2DA 1IN7A 2ZANA 2IA5A 4QGGA 1R7RA 4DIDA 4QG7A 5IF9A 3FKSA 3MJRA 4OHZA 5AVRB 1HUCA 4CF7A 1Z0IA 2OAQ1 3PR1A 4IVRA 2C98A 4KXFB 1E0SA 1DH3A 2FMXA 3Q5DA 3U44A 2C2HA 1NVUQ 2IF2A 1N6LA 5G40A 4HLQB 1SP4A 5TY0A 4ASUA 1NG9A 2ASEA 121PA 4KP4A 2F1HA 4D25A 2J7PD 1M7GA 4GFDA 3Q8XB 2R9VA 5JJLA 2PMDA 1P9RA 1OH8A 4GOXA 1F60A 2O8EA 1EFHA 3CIOA 3VX4A 1ZUIA 2FU5C 2WWFA 4MKIA 1MABA 4FPPA 2RGXA 5DI3B 5AW0B 2IBMA 4CEIA 4TMWA 1FZQA 3KZ1E 3NBZC 4C0JA 1MO3A 1GKYA 1LW7A 1OXXK 2YZ2A 1OB2A 4D82A 4XVUA 4XD7D 2BDTA 4Z54A 1MV8A 2D74A 2OO7A 3A7OA 2WM9B 1UADA 2XNDA 2FGKA 3IKJA 1U94A 3CPHA 3AVPA 4Q00A 2V1XA 1Z6TA 4ZV4A 4NP6A 3HYTA 2PT7A 2LKCA 2VH5R 2J41A 4U5XA 1GAJA 2HJVA 3SBEA 1G291 3QOFA 4D4KA 5L3VA 1JR3D 4EFMA 3RABA 2HT6A 4TYQA 1R0XA 1P2VA 2YC2C 4TLDA 3W9YA 2QBYB 3PEVA 5KPDA 2YHSA 2ZR9A 2MSDB 4AYCA 1G6HA 5DN6D 3ADBA 1CI6A 2EW1A 2HYDA 2XTNA 3HWSA 5FOWA 4HSEA 2ERYA 3O8BA 2ZS7A 5CYPA 4AK9A 2NO7A 3R7WA 1W47A 3HE4A 1F3OA 3BK7A 4CEHA 2YOFA 3CO5A 1XTQA 1ZD9A 5JBQA 2IS2A 2ZRMA 3AUXA 2NPIA 3F5FA 3EZ9A 4I4LA 3C5HA 3R8FA 4DDWA 3RC3A 4DDTA 3NHBA 4QHTA 1L2TA 4PQYA 2FNAA 4BUJA 3JVUA 2WHXA 3SWFA 2RH5A 4Q7JB 4ZDJA 2OZEA 3T61A 5FL7A 2A30A 1D5CA 1Z07A 3LIEA 2QAGA 2PZFA 1XMIA 3AF3A 3B5JA 4I81A 4L8GA 3GLHA 3W8RA 4CGZA 4Q48A 2GXAA 4IW3B 3U3OA 3SHWA 3U3KA 2A7QA 1II0A 1VYTA 1Y63A 2Z43A 1KAOA 2GESA 2CE7A 3CBQA 3T5DA 2ZRCA 4PZYA 1KO5A 1N0UA 3CX6A 1E9SA 2QTVB 3I4LA 5FPHA 2GBLC 3WMGA 3G0HA 2XOKA 1N5IA 1NLZA 5SZKB 5J4KA 2R62A 1KSHA 2JASA 2WSSA 4MQBA 2EU8A 1X6VA 1N5KA 2V7QA 4FCVA 2VQSA 3DMDA 3KXLA 3N2EA 1JEEA 2ZXEB 3LLMA 2G1KA 2PX3A 4LJ4A 2VP6A 4PO8A 4K8OA 2F9MA 2OAP1 1G1MA 5JHGB 5K8IA 1HQYE 1OT3A 4LJAA 1EG7A 3AVYA 3C4JA 1C1YA 3KB1A 1VDZA 2DBYA 3TUZC 1ZIOA 2X8AA 3GLIE 3L0OA 4Q4JB 1NG1A 2V4ZA 3UANA 3RNLA 4I1OA 1LS1A 2GEUA 3THWA 1C4OA 3BFVA 2YO3A 4IOJA 3LXXA 2VIIA 2QE7A 4KCGA 5FH9A 2Z83A 3N70A 2PCLA 3TR0A 4A82A 2BBTA 4I1UA 4MYTA 5FTJA 4Q66C 1NP6A 3REGA 2QM7A 3AP3A 2F6RA 2FEOA 4PPNA 1F5NA 2F7SA 3D8BA 4XTCS 2ZI4A 4PANA 2GZHA 3CW2A 1Z0AA 3O8DA 5J47A 2LKDA 2YWHA 1J2JB 1U90A 2PX0A 5CJ2A 2DFLA 1E79D 1XB2A 2AFHE 2QA5A 3V00A 1FOSF 5AW3B 4JL5A 4KFRA 2G1JA 1KKLA 1NI3A 1TQ4A 5APXA 2JLRA 4F7WA 2PZEA 4XWAA 2KB0A 1VG9B 1XU4A 1YZLA 5AK0A 5AVSB 1HT2E 4LI0A 2CHGA 2ONJA 2JIZD 2XJ9A 3I1FA 2VL7A 3MG9A 3FE2A 1CZQA 3TKLA 3AVTA 2CLDX 1P6XA 1U0HC 3FHOA 4U7NA 1W0JD 4EPXA 1UEJA 4TLEA 3O8CA 3VTPC 2GKSA 3AGQA 4H1UA 3PUZA 3P4YA 4BZXA 1N6HA 2WTYA 2IXEA 1G8PA 4FCTA 3KL4A 2RGBA 2P6UA 1W2HA 4ZKEA 5HCNA 4II7A 1L4UA 3C5CA 1E2KA 3OEHD 3QXCA 4KYUA 3LRPA 4LV6A 4PQFA 1G3UA 2WPSA 1GDDA 3CLVA 3M6AA 5D3MA 2P7JA 1OKKD 1SVSA 4W5JA 5EP2A 4AUWA 3VHXA 4RZXA 4AKHA 4DDUA 4EKDA 1WRBA 5B1OA 2CL6X 1P72A 4C0HA 2AFIE 4LV8B 3OIWA 3MGNA 2C2AA 4LK2A 3QKSA 1KZGB 4PXAA 3M4YA 4M9SA 4CEJA 3B1WA 3KQNA 4U00A 2H7VA 2JEOA 3F3YA 1EK0A 2PCJA 4WOPA 5EE5B 1GNPA 2H92A 2KJQA 5L3QA 3V9PA 4B32A 2RCNA 1YZKA 1FFHA 5AVWB 4UXJA 3FDIA 4A2PA 1DBSA 4TSFA 4GDFA 1G19A 5FTKA 5DLQC 3FOZA 4QM6A 4TT3D 1E2JA 1FP7A 2BJVA 4I1VA 3SYNA 1N6KA 4PR0A 2CXXA 4KITB 2UZ3A 1NLYA 4ZDWA 5EE0A 2QUZA 2ERXA 1JALA 2OHFA 3GQBA 2FX3A 4LHZA 1OYYA 1IAQA 1RYFA 2GVDC 4URXR 2A3RA 2GAOA 4UKDA 2AL7A 4JLOA 4V02A 1T2KD 1JNYA 3QNUA 3ND9A 2FDCA 1K8RA 2WICA 3CF6R 4S2EA 4OHVA 2NZ8A 2A5GA 1ODFA 3T15A 4C9BA 1OSNA 1EX7A 4JBYA 4Q4AA 5AJWA 5A4JA 4IOKA 3GLIA 4RD6A 1HT1E 1TF2A 3AUYA 3QKUA 4PSKA 3QJYA 5L8VA 4JLDA 3TAHA 2XZOA 2FV8A 3RYTC 2HLDA 1E99A 3IILA 4Q01A 2ZI5A 2QAJA 4DCTA 4JLPA 621PA 1CR0A 4EAQA 1R4AA 5SZIA 3TQFA 5JHHB 3LWNA 5CITA 3QPVA 2UVQA 3Q85A 1UKYA 4AIIA 1U0LA 4TMVA 2R6DA 3OE7D 3PXGA 2ODNA 4IFEA 1S0UA 3AVQA 1VCMA 3K0CC 3GP8A 5DHAA 1OJLA 4IEEA 4DB2A 5E95A 1PLKA 2GJ8A 1NNEA 5AJXA 3AGPA 3LVRE 2VRWA 3NBFA 3S1AA 1Z0FA 3WBKA 3DGEA 4LJ9A 4CT4B 1F48A 1Q20A 4TMXA 3G5UA 3THYA 1N6RA 3NVAA 2QP4A 2B21A 4PPFA 1RVDA 4XVQA 1VCNA 2QGZA 5J4YA 1SXJC 4N0EA 4FMCF 1AN0A 3F0TA 5APWA 1KGDA 3W5IA 3Q5EA 4BFTA 4PPQA 3AVWA 2EFDB 2ZJ2A 4OI4A 4PHTA 1F2UA 1VG0B 4KHZA 2VP0A 4FMDB 1KDOA 4POAA 2R65A 2D7CA 2NO6A 5KNDA 1KI6A 3I61A 1VG1A 1VKJA 3EASA 3CWZA 2RKOA 5BYKA 4A2QA 1FQJA 1E9FA 4LBZA 4LHWA 1GNRA 3EC1A 2WBLC 3L8YA 3QEJA 4Q5IA 5FI1B 4EFNA 1M7BA 2QN6A 4DT1B 1Z63A 3ONWA 4WZ6A 2O0KA 1ZAKA 1N0VC 1D8TA 3JZAA 3SN6A 5AUOB 2ZRHA 1ZNYA 4BLQA 1MO4A 3B1VA 2YVUA 4P3YA 3C14C 3VR1A 4GMXA 4KFTA 3K09C 4RD3A 3BXZA 2H1LA 3CX8A 2OXCA 5HR5A 4RCYA 5KO2A 3RC8A 3B8EB 2VHJA 2JJ1A 4E03A 4LUCA 4TMZA 4ASUD 4BLPA 2IYRA 5AR1A 5IDVA 5J5CA 4DCUA 3LW8A 2BKUA 3R9IA 4XWKA 2C78A 2PL3A 1KK0A 3EPLA 5CLQA 2ZS9A 3UK6A 3A2AA 2KBEA 3QKTA 1CF4A 1COWA 3HU1A 3REFA 4MUAA 1P62B 2F43A 2N1BA 4PZZA 2NIPA 2Z4RA 3A1VA 1P73A 1G64A 1E2HA 3AP1A 4AC9A 1KK3A 2VHQA 1QG4A 4P33A 3WYFA 4DUGA 1GRRA 2XNDD 4ERNA 4HAZA 2EFGA 4OI0A 4WZBE 2QPTA 2X77A 1HWTC 1RPZA 2IEYA 4PAMA 2Q21A 4ITRC 1GZLA 2OE2A 4P0TA 2ZYTX 3KFVA 1KO7A 1DAGA 2C77A 4B73A 5CM9C 1M34E 2GAAA 5LD2B 3AF0A 1W0KD 2KSQA 1XJ0A 1NY6A 1TUIA 2PH1A 1ESMA 1IY0A 1CJTC 4EPWA 3NWJA 1I2MA 4JT4A 4TQ9A 3A5TA 4Y0AA 4DLXA 1R0WA 2PT5A 2IYWA 3A4NA 1UAAA 2A5FA 1VIYA 1UFQA 2ODBA 4R7ZA 3IO5A 3VMYA 1XD2B 1E1RA 1AZSC 1I4DD 3Q7PA 3QKRA 2HT1A 3VU9B 3H0KA 1XEXA 3PUYA 4ZI3A 3W5JA 1FTNA 1KMHB 2B7BA 2ORWA 1FTSA 4QBIA 3CB4A 2RAPA 1KJWA 5KU1A 4HLUA 2DB3A 1S9DA 2WKRA 4LV5B 1OHHA 4ZCLA 3I72A 2GF9A 4UNSA 2WKQA 2WJHA 3IGFA 4RZUA 5AW1B 1R0ZA 2FWRA 3RRMA 2J1LA 1RJ9A 2GEVA 2ZS8A 4G5GA 3FPAA 1SVOA 2ZPTX 2ZUDA 3VKWA 4D6PA 1MUUA 3B13B 4KHXA 3PQCA 1VCIA 1U98A 1CKEA 1E32A 1MABB 4BZPA 1L7VC 3K9NA 2XOKD 4EFLA 3H86A 3P32A 3B78A 1GVNB 3SJAA 1VTKA 2V7QD 1QHGA 5E7IA 5C18A 1UBCA 3CRVA 1KDTA 4O2RA 1SLQA 1N0WA 1TU3A 3U7GA 1G7SA 3NBYC 4JS0A 2J0VA 4OHWA 1JNMA 2VSOA 3QG1A 3ZRVA 1QHHB 3TLXA 1JAHA 3DM9B 1RRGA 5EE9A 3FMPB 4EPRA 1YRBA 2EVWX 2GNOA 2IUUA 3ADKA 1YRAA 2Q9CA 1DOAA 2WJJA 2W27A 2O8FB 2VP2A 2V9PA 5FL3A 2XXAA 1V5WA 3B8HA 3SJCA 3R9WA 4BASA 1Z0JA 2F1JA 4UNRA 1XWIA 2YOGA 4DLVA 2QE7D 3KJIA 4NYJR 3I8XA 1H8EA 5KUTA 4CIDA 2IXGA 2N42A 1AS0A 3AB3A 1YZQA 3SI7A 3SNHA 1N5JA 5AUPB 3EPHA 1QRAA 2WAXA 1VYUA 1VECA 2XGJA 4PC2A 5DHFA 3KDSE 1JPJA 5F3WB 3PIRA 1II8A 1XXHB 3VTKA 1E9AA 5UKDA 5B30A 3UIEA 5HKKA 2YYZA 4PQRA 1HH4A 4TTRA 3GLGE 4R2IA 5JLJA 4MRVA 1U8ZA 1G3RA 5HCIA 2XB2A 4JSTA 1XPRA 1GIAA 2GCPA 4GOJA 1T3SA 1YR9A 1GK6A 4RVCA 5KSYA 3A3YB 1NJFA 3BORA 3QVVA 1CJKC 2FF7A 4O0MA 4P4SA 5H1YA 1FNMA 4HZIA 3CONA 1AIPA 1WF3A 2DCUA 3MFYA 1FUKA 4JVMA 5IDJA 1G7CA 3WHKA 2V6JA 3KUCA 4A9AA 1CU1A 1RW4A 1XP8A 4AURA 2IWHA 1YVDA 4LPSA 1T2KC 5KTYA 2FEMA 4LJ7A 1F51A 1KY2A 1VIAA 4NCIA 2CJWA 2WT7A 4MRPA 1A4RA 1IY2A 5BQ5A 5BN4A 3QF4A 2ZSDA 1OB5A 2GA8A 2ZFCA 2MMGA 3VAAA 3TRFA 4HUTA 1JECA 3NC1C 4JLJA 1FMJA 4EJSA 2VHTA 4D2IA 1R2QA 2WAYA 4V0KA 3QENA 1IJEA 2FGJA 1NL3A 3MD0A 2R6GA 4X8LA 1QDEA 4I6MC 2LFRA 1KMQA 2YNMA 5EP1A 1NWQA 1IONA 3TUJC 4OJKA 1BOFA 1FQKA 1X86B 3C16C 3EA0A 4E22A 3U6KA 4JL6A 3HPQA 4JSYA 4LRWA 2ZRIA 4OQFA 4DLWA 3SJZA 5GVSA 4MYCA 1F2TB 5IK2A 4CW7A 3E1SA 1KI7A 4JVNA 2XSZA 4AY2A 4JAUA 4MRNA 4QHSA 1G9XA 1ZM9A 4XOIA 1TEXA 1EXMA 1UDXA 1KSFX 1YE8A 2ZRBA 5K8TA 3K0FA 1ZW6A 3EG5A 4EOTA 1DG3A 1VCOA 4M4SA 2O8BA 1N6OA 4A8JA 1P5ZB 5J4HA 4L9WA 1TNDA 2XZPA 5AW8B 4WXPA 3OIUA 2C9NY 1M7HA 4U02A 4HB0A 4R2HA 5F2EA 4AG5A 4G5OA 4RD2A 5EE3A 4DZZA 3GJXC 3GJ7A 3NH6A 4PHGA 3EWSA 1H88A 2WJIA 3KTAB 2GEDA 5APYA 1IJFA 4KBFA 4LGMA 5E3HA 3DDCA 4XWOA 4JIMA 4F4JA 4NTZA 1E2DA 4OKSA 1A7JA 2Q3MA 4Q9LA 2J0UB 4W5HA 1IXRC 3Q72A 1NY5A 1G4AE 1IM2A 2IL1A 4UXIA 2WMNB 3ECCA 1E98A 1HV8A 1N3BA 2QMEA 4NU0A 2QT0A 2CLSA 4LJ5A 1E3MA 3RRZA 2ZE7A 5CDFE 1UKVY 2AD1A 1XBTA 2HLDD 1IHUA 2ZJOA 4LHXA 3ADCA 3P7KA 1W36D 1NMYA 2J9RA 3SR0A 3OIVA 5E7MA 4YMTA 1KAGA 1PLLA 3ZIAA 4M8NE 5DGXA 3RSLA 1SHKA 1AGPA 4IDNA 3CZPA 2RHDA 1E0JA 1T6NA 3WMFA 3FFBA 2X1VA 1JOYA 5BN5A 2GCNA 2HXSA 3OZXA 2OM2A 2VO1A 2RGGA 3HE5B 4PSAA 2P2UA 3GD7A 3LY5A 4CYMA 1J8MF 1XJQA 4TZ0A 2J87A 3ETLA 4FINA 1XTKA 2R44A 1JJ7A 1TQ6A 4M1SA 3FHCB 3I73A 3X1ZA 3BB4A 1U9IA 3W6PA 4XSHA 3GLGA 2C9YA 4UNPA 3WNDA 2QGNA 5CK4A 4R9UC 4C7NB 2ZTSA 4PX9A 3RANA 4ARZA 2Z4SA 4RFVA 3GEEA 2BJWA 3DPUA 1OXUA 3AF2A 2OSBA 2RMKA 2W2XA 3BAFA 4B3DA 4NH0A 1GFIA 2WPQA 1VHLA 1S3SA 3B85A 4TL6A 3WRXC 2BCGY 4ZIRB 4FMCB 2Q6TA 1S1CA 2GDJA 4O2LA 1SXJD 1X3SA 1YJ5A 5KDDA 5TMPA 1XCPA 3GJ5A 1MH1A 3ZVLA 1GRQA 2Q0HA 3SYLA 1KYIA 3ND8A 4G01B 4WAUA 4C4PA 2PEZA 2OFWA 1NMXA 2TMKA 5JEDA 5F98A 1AJEA 2QG6A 3LV8A 5KHOC 5KSZA 2I3BA 4HYYA 1JB1A 2YWEA 4LWZA 4US2R 5K8UA 2QRZA 4L15A 3GCGA 5FUXA 5KNCA 3H4MA 3QI2A 2QQEA 2P5SA 5LB4A 3ZLJA 2YC4C 1TADA 4Q1DA 3BH6A 3L37A 3W90A 4HAVA 1GL7A 2CVHA 2EFHB 3BC1A 1K5GA 1E2QA 3E2IA 5JZVA 4EPVA 1P60A 3BBPA 2FPLA 4C30A 3T35A 1U81A 3ZVMA 4TYWA 2QROA 5FUWA 2BKEA 4Q9HA 2H18A 5EXXA 3SS8A 5JWRA 3LH5A 4EPTA 3TQCA 1KKMA 5FPTA 1C9KA 4XE5B 1JR6A 2NQ2C 4DLRA 3JVVA 4JT2A 2MSEB 2QAGC 4MT8A 3U6BA 1W1WA 2ZRLA 3NEYA 4CZ2A 4LC1A 3AEZA 3EIHA 2Z5FA 2ZRKA 1COWD 1KZ7B 2OCPA 5JSZB 1H8AA 2ZSFA 3NH9A 1S2MA 2BMDA 1RYHA 3LW7A 5C46F 3N5CA 3IEVA 3GPLA 1XCGB 1ZU5A 4A92A 4DHEA 4A6PA 1S8FA 4DUGD 1G16A 1NSTA 1R10A 5JI2E 1Q1BA 1TL7C 4Q9KA 3OFNA 1DAHA 1VG8A 1J99A 2GK6A 4YDSA 4G5RA 4Z8XA 3A1SA 3IEUA 2D7DA 1X1SA 1YZGA 1US8B 3MWKA 5CB6A 2XITA 2Z5HA 2O0HA 1KI8A 1MO6A 1XTIA 1OXZA 3ZS8A 2WWGA 1XPOA 2V54A 4D0NA 5L3SB 1KI6B 3VR6A 4Q7LA 2YINC 3LX8A 3QPUA 1TQDA 4NYIQ 4BIZA 4HUQA 5JWHA 3ZZ0A 3EX7C 1SXJB 4MTXA 1E9EA 3IBYA 5IRCD 2WKPA 5CM8B 1OXTA 3LQQA 1TAGA 1GILA 1TX4B 5D3QA 3UG6A 1P3JA 1DO2A 4DLSA 1Z47A 2BEJA 4GPTA 1E1RD 4DCSA 2OCYC 2V1UA 1JQLB 5TV2A 4JLBA 1CR2A 3VHLB 5EXTA 3OAAA 4M1TA 1AM4D 4Q7MB 3PFIA 4TLCA 4LSGA 3QBVA 3ZGXA 1N6NA 2CL0X 3V4WA 1TMKA 2QZ4A 1OHHD 4ZDIA 1RC8A 1CLUA 3M9BA 3CWQA 5JS7A 3QBTA 4Q1EA 4DXAA 2HF8A 821PA 5ELXA 2AXPA 4HAXA 3CUEF 4HB4A 2ZR0A 2FJUA 5AW9B 4EIWA 1BMFD 1ZNZA 2QP9X 3PITA 1KI9A 1LTQA 2ZI6A 4LDJA 4C0QC 2ZJ5A 1ZC4A 4A0FA 4C46A 4W5WA 5C1BA 1J7KA 1W5SA 5JMTA 3U4QB 3FMOB 3RDPA 4DC9A 3TSWA 1S9KE 1EFCA 4DEXA 4I1SA 4KFSA 3AM1A 1OFUX 1X8YA 2CCGA 4B3CA 4HAYA 1JUNA 3B2EA 4G3XA 2AK3A 2OBMA 1Z6AA 1GL9B 2CCJA 4TYPA 1OV4A 5IT5A 2JDID 4MYHA 5CJPA 2GILA 1NVXQ 4HEJA 1EX6A 4GZMA 1BH2A 5FOSA 1NN5A 1OIWA 3ZRWB 4V0LA 4DLYA 4V0OA 1BIFA 3BB3A 5CMZA 3EIEA 4QKQA 1E0AA 2PBRA 3DZDA 5JRJA 3K0AA 4Q1AA 4B33A 1ESNA 2RGNA 1DPFA 2NTYC 1D9XA 1KI1A 5JJIA 4LJYA 2QMUA 1XF9A 3IO3A 1E2IA 2G0NA 2QL6A 2J0QA 3MMPA 1P7CA 1KK2A 4CRWB 1H8ED 1Q22A 4LX0A 3LD9A 1KI3A 4WIAA 2AK2A 1EFRA 1P75A 5CK5A 5AVQB 4XSGA 3THXA 5FOTA 1AKEA 1SHZA 4TQAA 4F92B 3X1DA 4US1R 2VF7A 4HATA 2GZDA 1YKSA 2P2LA 1L8QA 4PFSA 3QPWA 3D36A 2W6JA 4I99A 3PEYA 3TNUA 1GKUB 5HKKD 2OT3B 4KAXA 4I5SA 2FSHA 4TMTA 4M9XA 1IN6A 4JJKA 2UKDA 4BEJA 1NVVQ 2LCFA 5AVXB 3CH5A 3KQLA 2OFOA 3M0AA 3M06A 1AKYA 1BYIA 1JR3E 2ZRPA 3P26A 4FWIB 2O5VA 2WZQA 4C0BA 2JJ2A 4YC7A 3RSOA 4JBWA 4FMBB 1ZCBA 4Q1BA 1NLFA 2IUSA 3ICEA 2CVFA 1RRFA 3DEFA 4Q4HB 1CTQA 5H68A 2ZEJA 3PVSA 3TR5A 5GJWC 3RRNA 1QHIA 4AI6A 4FIDA 1EFUA 4JMPA 3SC3A 1G18A 2ZI3A 1XMSA 4YMSA 1GTVA 2JLWA 3CZQA 4B34A 4C0SA 1AA9A 1E2GA 4Y0VA 5TVKA 3RHFA 4PSVA 2O8DB 1DAIA 2VP9A 1J8YF 4HAUA 4EQ6B 1XD8A 2WOOA 1IXZA 1XZPA 1GP2A 1KOFA 2QQ0A 4TL9A 5DI3A 4QJ5A 4AYWA 1D2EA 1SVWA 2B8WA 2DWPA 4LY6A 4JYBA 1W36C 2JJ8A 2OCAA 1JXOA 4BWYA 3PEWA 4C7OB 3M91A 4JVSB 4PO9A 2BM1A 2OLKA 4QL3A 1TF5A 4LPKA 1A02F 2BM0A 1CR1A 4RFSB 3UWKA 3HR8A 421PA 5HZHA 4I2LC 3BD9A 1HA3A 4IDQA 2XSZD 1KNXA 1OPXA 2D62A 2AD5A 1FUUA 1PJRA 1KO8A 2IK8A 3AKEA 4NL4H 3RVBA 4JASA 4IXNA 2W83A 1IN4A 5AVUB 4WXRA 2A2ZA 1JXMA 1VHTA 3AP2A 5FOXA 3L36A 1G5TA 1T4GA 2ZETA 5BN3A 2QBYA 3LXRA 3WP1B 3M1IA 4D80A 4PZLA 1XCMA 2YWFA 3TVDA 2OXRA 5CIQA 4F91B 4LOAA 5APVA 1XMVA 2REXB 1DELA 3D3QA 4OQLA 2QI9C 4JLKA 2C9CA 3MLEA 2JLUA 1BS1A 5AW6B 4ACAA 1A5TA 3KQKA 2GCOB 1I4LD 3HDTA 3VFDA 3KQGA 3D7MA 1T9HA 4N1AA 1IY1A 1KK1A 1WMSA 2FZLA 3MRSA 2FFQA 2KBFA 4QM7A 3OAKA 3I5YA 2ZIAA 1MT0A 2H8KA 1UBGA 2PEYA 1KDPA 2ZYVX 3QE0A 1KI4A 1XTJA 2WJYA 4Q20A 4OL0A 1JI0A 3BFKA 4LBVA 4MA4A 4QBHA 5FBQB 1E2LA 4YXWD 4M1MA 4BLOA 2BVNA 2G3YA 2YV5A 2P6NA 1FP6A 3EARA 1AQUA 2BMEA 5AWFC 4X8MA 1QVAA 4ESVA 5AW4B 1EWRA 5B57C 1KY3A 3FKSD 2KWIA 2R8RA 5J4VA 2ZVPX 1B23P 4LYFA 3A1UA 2W0MA 3W3ZB 2RGDA 3E70C 3ZIAD 4RD0A 5AW7B 4G5QA 2FPMA 4KODA 3WP0A 3QSYA 3LBIA 4Z1MA 3ZS9A 5CYOA 1ZRHA 5APSA 4N0DA 1Z22A 5F9FA 3TAUA 1E1QA 1DVRA 1YU9A 2AR7A 2EYUA 3KJEA 4DIEA 2ZE8A 1OFIA 4DWJA 2P0EA 2F1IA 4HZUB 4B35A 2IYUA 4HB2A 3FMFA 221PA 2RGEA 3AKCA 4IFBA 4KSCA 4DSOA 4JVLA 3NXSA 3SQWA 4URYR 1XDBA 1G8HA 3MSXA 2YNYA 3EZ2A 4NHOA 3SQXA 5FTLA 1JR3A 4B71A 2IHBA 4Q4JA 5G3ZA 4ZI2A 3GLFB 2ZJYA 2ZRAA 4KLZA 3BS4A 1CR4A 2CNWA 4RKEA 4YMVA 4G5SA 3AVXA 4QOSA 2YO2A 2ATVA 4NKRA 3UKDA 2QP3A 4X8HA 1YYCA 3AV0B 4BLTA 4QGFA 2V3CC 1N25A 2VP4A 5G53C 1NIJA 1ZM2A 4AG6A 2ZQ5A 5EUQB 2A9KA 2JATA 2W6AA 1ZNWA 2ATXA 1J2JA 1FX0B 2ZUBA 4WVFA 5KDLA 1MFZA 1NF3A 2O8CB 1X8JA 2GETA 5JCPA 3PCRB 3SFZA 1IXSB 3A4LA 1Z2AA 4OBEA 4FW9A 4D0LB 3OF5A 4GCZA 2IYSA 4HLUC 4Q19A 3AQ4A 1YZNA 3T97A 1E4VA 3ZVRA 4UJ3A 2HXYA 4ZO4A 5FUVA 3SU8A 3CRQA 1Z06A 2ZREA 1Q57A 4DSTA 3NC0C 3TUIC 5FPYA 3NG1A 4UNNA 4BQSA 2ZITA 2QU8A 4X8OA 2LFSA 1HYQA 4A36A 4JAVA 4A0RA 2VHCA 3U44B 2ZU0C 2C9OA 3IIMA 3L0PA 4H9GA 4K46A 3I92A 3VMXA 5FL7D 2AXNA 2QT1A 3Q9LA 1W2GA 4R98A 1Z0KA 3DO6A 1OFTA 5JECA 4BFVA 3WNCA 2H17A 2ZXUA 1HJBA 2C99A 2WPRA 5APTA 1Z83A 2RB4A 2XV5A 3N2IA 4K81B 4TTPA 4ON9A 5GJCA 3IBGA 4V03A 5JWOA 2O8EB 2X19A 3FFAA 1G7TA 4IKEA 1KI2A 3ZD6A 3LA6A 4ABYA 2DWOA 1R6BX 2WVJA 1P9WA 1Z29A 4CEIB 1XD9A 4OQNA 2WSSD 2FFHA 2WV9A 4PPGA 5KNBA 4NBSA 4KSBA 1ZM7A 4IVPA 3TW4A 2CLCX 1WA5A 4J0QA 1R8SA 2CDNA 1NBME 3CR8A 3CNNA 3QY0A 4Q47A 4RZ3A 3R8CA 2C03A 2AWNA 2ZR7A 1YZTA 1G3MA 3ZH9B 5AVTB 4B3XA 5CB8A 2G77B 3VN0A 4Z8YA 3MWJA 5JEEA 3T1TA 1A1VA 1SZPA 3OAAD 4M22A 1GOTA 2OV2A 4F38A 5AW5B 4DLUA 1Z08A 4FXPA 4TWZA 4EUNA 4D81A 1E79A 1CRQA 1NSFA 3M0EA 2IYLD 1CI6B 2C95A 5G3YA 3UMFA 2G88A 2IS1A 3O47A 3DVLA 1SKYB 2E42A 2C04A 5EZ5A 3R7WB 1GK4A 2FSGA 5FTNA 3UMRA 1X8KA 5EJEA 3HE4B 3X2SA 4MGIR 3K70D 1N2CE 4CEHB 2QMOA 2G6BA 3TK1A 2ZE6A 4B76A 5AJVB 2K5UA 4BLRA 1ZYUA 1RZ3A 2FPKA 2FN4A 2JIZA 2SHKA 2V8OA 4LC0A 2HCJB 4NONA 1AZTA 1HY3A 4B86A 3QG5A 3C15C 3DKPA 1W0JA 5DNYB 2IEZA 4LYHA 4Q1CA 4HYTB 1HBWA 5DE3A 2O52A 2CK3A 3AKDA 1P4SA 3DKVA 3PG5A 4LYAA 5GADl 1OIVA 3ASYA 3VR4A 2QAGB 3ZQ6A 4C0AC 3GLHB 4QC2A 3FTQA 3LFUA 4U7OA 1E2NA 4UQOA 4FCWA 3K8YA 5ANRB 3T12A 3GFPA 5SZJA 2NGRA 2AN9A 1R5BA 1Z6YA 4QPJA 2I4IA 4P31A 1GUAA 3TIFA 3DOFA 3P27A 1G3IA 1O3YA 2REBA 2MMCA 2Q9AA 3PUWA 1T3HA 3KKQA 5AW2B 1OH5A 3KJGA 2W2VA 4TTQA 4EDHA 3IPXA 2XU6A 4M9QA 4EJSC 2ZI7A 4RZ2A 3EZ7A 3WNBA 1E9DA 3P4XA 2P67A 1H8HA 4OQXA 2PJRA 4ZKIA 1U8AA 1K5DA 3BFXA 5DYIA 5TDHA 2ZROA 1ONBA 4V0NA 4DLZA 2P3SA 1EFRD 3M0DA 3LNCA 3RS0A 3J81k 3WRYC 4MYUA 4TLBA 4MITA 2E43A 4YDHB 2W6JD 2B7CA 2YWGA 3EXAA 2A5JA 4GSYA 5JRZA 2OCBA 1S4QA 3QUSA 5TXGA 1RRCA 3THWB 3AVUA 1DAFA 2VHUA 3GJ4A 1CS4C 3LLUA 3MCAA 4QJ3A 1Q1QA 2ZJZA 3L8ZA 5BXQC 2F3RA 4JLMA 4A8JC 2R5DA 2GWHA 4F93B 4DT1A 2JJ2D 2IS4A 1X1RA 3KKOA 1NIPA 3CRMA 3LBNA 2R5BA 2KI5A 3WY9A 1G6OA 4TSFD 3DZ8A 3ICQB 3I3SR 1AQYA 2R3CA 3DMNA 2IF0A 5FPKA 4XJXA 1GU4A 3FHTA 4MKGA 1HUQA 4TL8A 3SJBA 3D31A 5CLLA 3ZYCA 4B3FX 5C4MA 2LWIA 3IIJA 4NCHA 3UG7A 1W46A 2PZGA 4D0GA 1ZNXA 1XEWX 3OESA 5KYKA 1XXHE 2W6IA 4F4IA 2ZJAA 3IUYA 3CH4B 4KI0A 3WXMA 2BBOA 1Q44A 2FZ4A 3EA5A 1OW3B 3NTNA 1A02J 1NBMA 1ZM3A 1E9RA 5H8WA 4XH9B 5K8LA 5HE8A 4C0LA 2WWXA 1D2MA 1SVKA 2WIBA 3BJIC 4LYJA 2VYFA 4DVGA 1IN5A 4TYYA 1W48A 2O0JA 3T34A 5FR2A 5LPNA 2HJGA 4CDGA 1ZD1A 1PZNA 1XFAA 8OHMA 1FOSE 2P65A 2R6AA 1VYVA 4IHQA 1E96A 3O8RA 1QG2A 4IJMA 3UATA 4PHHA 1D9ZA 2Q3IA 1SQ5A 2R6CA 2HUPA 5D3MB 2OUKA 5E4FA 4QXAA 3CNLA 1CJVC 5TB5A 1EGAA 2G9NA 2E87A 1LFDB 1MOZA 1G21E 2QENA 3U7HB 1U9IC 4LJ6A 1G41A 4FMTA 2XB4A 2QNRA 2QSYA 4QGAA 2BMJA 3U7FB 4JBXA 4IOLA 2XTMA 4NZYA 1IO4A 1JJVA 1Z6GA 1CEEA 1G2CB 4MKFA 5B2ZA 3QKSB 1QHYA 2J59A 5DI9A 1AGRA 2L0XA 1S9KD 3AH8A 4CEJB 1CXZA 1J70A 1GU5A 1XEFA 1XD2A 4L16A 5DYGA 2NG1A 5AVZB 1Q3HA 4PTLA 3NDBB 2ZSEA 3VU9A 3ZRXA 2XZRA 4UNQA 5L3QB 5KSPA 1KMHA 4KO8A 1S9HA 1NKSA 1Y3AA 2ORIA 1G17A 3UWOA 1R0YA 2J3EA 3VR5A 2GJ9A 1Z6XA 5BWMA 1ELOA 5BW8A 3FWYA 1E9CA 4GP6A 2BC9A 3UMSA 4QRHA 3VR2A 1WCV1 2GXQA 4BE7B 4AKIA 2NO1A 4JYCA 5H70A 1QHSA 1R8QA 1JAIA 2N9BA 3NKVA 4D4LA 3TJZA 1GM5A 4BECA 4QBGB 1ZCAA 3TVTA 1XTRA 2QPOA 1QHNA 2IYZA 2ZRNA 4TLAA 2J45A 2B92A 4Z1MD 3CPEA 2DPXA 5M04A 4IRUB 1LB1B 3WBJA 1HTWA 1ZUHA 2VBCA 4RKFA 1ZD8A 1G5PA 3QQ5A 1E1QD 4Q4AB 2R32A 1E2EA 2KP8A 1PUJA 3GLIB 2Q9BA 3W6NA 2AX4A 2JJ1D 4MRSA 3RLFA
chains in the Genus database with same CATH superfamily
4UD6A 3OJ0A 2JEYA 3ADPA 3E7XA 3RVMA 3APOA 1COZA 2OEPA 4K5QA 3NIBA 4MB6A 4MV8A 1ZX1A 1D7MA 5FWDA 3GVIA 2HJHA 5CHEA 5F2NA 5KYNA 4KPYA 5JANA 3VYRB 1M1JA 4GKAA 1YHYA 4HNUA 1SQ0A 4EGQA 1PJ4A 2HBZA 4TVSA 1GITA 4DPKA 4I50B 5C4GB 1Y89A 4A03A 4F9GA 1NOIA 3ABVC 3B6JA 2O01H 2FBWC 3X1XA 5EE1A 2ADMA 5IABA 1E2PA 4EG6A 3BB1A 3DDNA 2PJDA 3SG0A 1A88A 5BYJA 1KFJB 3MRTA 2JIRA 3KFXA 3BDIA 3LUDA 1F1BA 2V65A 2ECKA 2Z5LA 1DIPA 4TS3A 3SDLA 3KCXA 4RJIA 4KVAA 2DT8A 1QWSA 3KZIE 1OYWA 1WLSA 4RAOA 1CUUA 3ZDQA 5ED0A 3C3TA 1M1ZA 2GYUA 4F5DA 2QDOA 2Q4TA 3AY3A 1OC2A 4QUHA 2J5RA 2OXFA 1NAIA 1HT3A 1PD3A 1JZTA 3VZRA 4E51A 4EA7A 1D2NA 1RF1A 2C5LA 1G4UR 3K9LA 5CVTA 1IVYA 3JRWA 4E7PA 4DZOA 5FHQA 4JYMA 4LGCA 1CY8A 3U5ZB 3BMOB 3VNRA 3TLKA 1YJNP 3EC2A 3JSNA 4ZHQB 1GPAA 3T1YB 1JSCA 3AL2A 1CUCA 4MUMA 4XUDA 3N8IA 3RROA 4H1VA 3DLAA 2C0PA 3B77A 5KI6A 4DAEA 2IDBA 4NEHB 2UU9B 3R3ZA 4R5MA 3TOVA 1XA3A 3OD5A 2KS6A 3L73J 4F6EA 3IC9A 5LL6Y 2O2DA 3QLEA 5CDSA 4MV5A 1T1RA 1ORDA 4NHEA 3DHWC 1EFLA 4S1TA 5K5GB 4L3VA 2IBSA 2LPMA 1UOQA 3E5RA 3ZZUA 3LSTA 3TNLA 1NBMD 1JFFA 1E5WA 3EMVA 3VJLA 1LS6A 1II9A 4UHCA 1V2HE 2DHQA 1WIWA 1Y6XA 3T1OA 2G1UA 1VBFA 1EESA 3L72D 2J7PA 3CCUV 2BHRA 1ORTA 2OO5C 3O6QA 2OENG 4ZCPA 4X1OA 4EHKA 5EQJB 1P9NA 1WS6A 1IZ3A 5DTIA 2PAAA 4KU4A 3OECA 1KJYA 3S70A 3TGPA 4M0KA 1PZGA 2FYUD 5DCUA 1QVVA 3FTDA 3I8OA 4FU0A 4RK0A 2GV9A 1VE6A 2GXSA 5E4TA 1ZR4A 1JKMA 3GZNB 1DC8A 1URQC 4FQ8A 4RTPA 3W34A 3B9QA 2ACWA 5C32A 4NYKA 4LP8A 1U99A 4KLCA 2FEAA 1ZJ6A 1J56A 3OCVA 3PT5A 1KDRA 3ZXXA 1MW8X 2IPAB 5DX0A 4NYMR 1I2ZA 5CXSA 3I5CA 1MLDA 3TM5A 2Q7CA 4NOLA 3I12A 3VR0A 2Q5CA 4MW4A 2PD3A 2GN2A 1L7DA 2BV3A 2VXCA 4HNVA 3WYAA 4B08A 4FYMA 4PZPA 1YZHA 2A3NA 2OO3A 1V4VA 2IZ7A 1A2KC 2HFED 1NBOA 2RH9B 1C0PA 1BZKA 3DOEA 3BGDA 1YKGA 1WF6A 1T26A 1WVMA 4BNDB 4PAWA 1FS4A 4OXQA 1DXOA 4X8AA 2O8DA 3KKPA 4CM9A 1RWWA 2FG7C 4EF5A 4BLSA 1CE8A 1UJMA 1Y9BA 2FUG1 3JQGB 4LBYA 4RFSA 5H9WA 3P2JA 2J7KA 3HKBB 4EI9A 2J07A 2NNUA 3B60A 2O14A 3M8AA 4DV2B 1Q7CA 2ZE5A 4MS1A 2ONKA 4WRRA 2QXTA 4AKGA 3BPSA 1TZ2A 1OJHA 3RKRA 1H0HA 1N5DA 3VA7A 3BJEA 4LFCO 1MO2A 2AN4A 1PNLA 3R3UA 4N23A 1XDGA 1UFIA 3F6YA 1UBKS 2WOJA 3BBLA 4MKZA 1PJCA 2O3JA 5BZBA 2WQ6A 3CLUD 1VL0A 4EVSA 1TPZA 2P30A 3FJYA 4PC1A 4B7CA 1JIUA 1TMOA 2Q5OA 3KWMA 2VYVD 2Q9LA 3EIXA 4JKOA 2WU3A 5HZKA 1GSIA 4OLFA 3T06B 3CE9A 4XWGA 4WFIA 4ZJUA 4IYIA 4MLCA 2V9CA 1KE2A 5B58C 2ITCC 5EJAA 3VTAA 3ZUGA 1E5VA 4FD2A 4YONB 3PL1A 521PA 3LQKA 1FX0A 3QVUA 3KOZA 1NF8A 2E4WA 1U1CA 2IA5A 3VOPA 1CQIB 4RF3A 2FMLA 3MJRA 1X14A 3H4VA 1JHRA 3ULKA 3L5KA 4WD3A 3A70A 4KXFB 3ERCA 2V4UA 3FAKA 3V42A 1N6LA 4BO8A 4JTDB 3S5UA 5IJZA 5KWSA 2DQKA 5C7YA 4JYAO 5EESA 3E61A 4EGSA 2RGXA 4FB5A 4CEIA 1MO3A 2A1UB 2VDVE 2OAEA 5A9SB 1RLTA 4IS3A 2D74A 4D8YA 3G9QA 3JYLA 2I6XA 1U6KA 1NTZJ 1XTUA 3OOHA 1R0XA 2TRSB 2QBYB 4AYCA 1CI6A 1MTOA 2ZYGA 3CC2P 1N9KA 2OCXA 2QUHA 4BNHA 4WEQA 2X14A 2EZ9A 5LHHA 1Z8DA 3R8FA 2O3TA 1UODA 4QLAA 1EBOA 3WTBA 4IG4A 2BR5A 2YIDA 3E9NA 1KFBB 2PAFA 1KSHA 3OFVA 4IDDA 5TISH 2G1KA 2XYHA 2WHPA 1L0LJ 3TUZC 1ZIOA 3BWEA 5DHQA 4IL6H 2F2TA 3F9CA 4X91A 2PSHA 4CIWA 1IBKB 2QE7A 4KCGA 5FNVA 3WIVA 2K6GA 2N9YB 4C89A 1KMCA 4N03A 2IYPA 2YY5A 1ZUD1 4B3RB 3QBJA 4RLQA 1ZK3A 4EQZA 2QA5A 1C9JA 4XWAA 1YZLA 4IP0A 1H1DA 2E49A 5CA1B 4V2IA 3M3DA 1AR5A 4NOMA 4C87A 3FHOA 2EDAA 5DW3A 1W0JD 4KV7A 3H1IJ 4GS5A 4R8RA 3PUZA 3W3AD 2IXEA 4FCTA 2A9HA 2AOWA 2VJKA 2ZBUA 5TGZA 2MR6A 2WTBA 4L8WB 4W5JA 5B1DA 3LWBA 3QU5A 4ZI7F 1QS0B 4IQ8A 4O4IA 3X1KA 2QR5A 4LV8B 3VM6A 1FU1A 1FP2A 4U00A 4IH1A 4WOPA 3HLYA 3K0GA 5HGXA 3V4SA 1JB0J 4MVJE 3FDIA 5FTKA 4QM6A 3FOZA 2YHIB 5CB4F 2BJVA 1QE5A 1CVRA 3PJSK 5TPWA 2CLKB 1KH3A 2OHFA 2V0CA 3UAYA 1IAQA 1PVDA 4BMCA 4LWSA 5IF3A 4JLOA 3EISA 2IUFA 5EI5A 3F7YC 1U3WA 4DV0O 4S2EA 2G07A 3T15A 3QFHA 3RVRA 3TCUA 2VK8A 2P1ZA 2C3UA 1MZ9A 2NNLD 1IB6A 2BLNA 3HRKA 1PNQA 1PR5A 5FQNA 5SZIA 2XWBF 4LFBB 3QPVA 5KB3A 1ITZA 2JKZA 2P7TC 2MYPA 1JPVA 2VRCD 2IPLA 5DSTA 3UTDA 4KQXA 2F9FA 5J4YA 3WHPA 2FHPA 2EFDB 2ZJ2A 4WFGA 4HWTA 3BCHA 4A2QA 4NR0A 2Q4PA 1L5SA 4LHWA 3TSAA 5CN0A 1VF6A 1NYTA 1Z63A 3O7WA 4J1QA 1RWNA 5AUOB 5KNBH 1PQUA 4AN1A 2UZ1A 2RC6A 3BXZA 1B8NA 3CZAA 4N78E 4PZDA 5J9PC 1OIPA 2BKUA 1M1NA 2H6EA 1S5HC 3K0HA 2XE4A 4ENVA 3SIPA 3A7EA 3UK6A 3C3WA 1EZJA 3MP7B 4OYLA 4PZZA 4AC9A 4B79A 4IBOA 2HTEA 4RIEA 3ET4A 2O48X 3ON5A 1IOVA 4HDAA 2IHJA 1HK7A 1NVBA 1KO7A 2PZLA 3CY6A 1M6YA 3REQB 1QHTA 2YH2A 2A88A 2WMMA 2ZGVA 5LNK1 1UFQA 4XGKA 3H0KA 2W6BA 1KWKA 3BFJA 1E58A 4IDFA 3B38A 4K9PA 5CLHA 4G0XA 1MX1A 5K0LA 1V47A 4YJ3A 2ZWIA 3W67A 1XZFA 1JI3A 3INGA 3R3SA 1WETA 3DFFA 1EK2A 3W1WA 1SCBA 1K4YA 1Q83A 3SJAA 2POQX 1QHGA 3JYNA 1DKPA 2XYGA 4O2RA 4KACA 5ERXA 3VSAA 4CMEC 3QG1A 1FDMA 4NU5A 1E5QA 1NYQA 3LWZA 1PV0A 4DC0A 1JHXA 4IHJB 5KYXA 1J1DC 2IBZG 2XXAA 4XCQA 3JQAA 1N5RA 4DF3A 1FJXA 4Q1VA 1G6KA 3AB3A 4UU7A 1N5JA 1QRAA 1SIWA 5IEJA 4EHJA 1G1IA 5F3WB 4OFWA 1PDVA 1GZ5A 2YIVX 5UKDA 2C9DA 5HKKA 3WG7B 2V7QJ 3FSRA 2XMQA 1YGPA 1Z8HA 5HCIA 3A3YB 3FXAA 1DLIA 1Q17A 3MT8A 3F46A 3I56P 2JGKA 2BH2A 4MRPA 1ZUQA 2H4HA 4QGBA 2Q5EA 3ETJA 1MENA 2GA8A 3NTOA 1PL8A 4LIPD 3BIOA 4GWLA 1RQ2A 1FMJA 3MTIA 4V0KA 3PZRA 4R40A 2PBFA 2ATKC 3ME5A 2B0JA 1X7XA 4K9MA 4B87A 1TYAE 2GUSA 1N2HA 2BYTA 1EXNA 5D87A 3A0BZ 1JM0A 4F1WA 3VTZA 2V03A 2H3OA 1D4FA 3OM3B 1CZNA 1P81A 4MIEA 1YUNA 3EVKA 2K7FA 3RYCA 2I8LA 1R9JA 3FVWA 2QX7A 3H1LJ 4CKBA 5TLSA 4FR5A 3TO5A 3H11B 3WGVA 3RRZA 1KF0A 5CDFE 1UKVY 1IFPA 1JVBA 3ADCA 1RLJA 2P4EA 1DBPA 3AE8C 3WOHA 1JJOA 3H1HH 1IXKA 2QVCA 4GO1A 5TJ9A 1Y5LA 3ZEAA 3ROGA 5H82A 1O2DA 1XI2A 1VLLA 3KBOA 2Q27A 4BJ3A 4PX9A 1RWVA 1QRRA 4UEJA 2OSBA 1EH5A 5EBLC 4TWJA 3B85A 2VUUA 4M8KA 1XCPA 3EMKA 2GBIA 1RR6A 3O9MA 4WAUA 1DMSA 1RP7A 3EGWA 2O2IA 2QRZA 3TJMA 1V25A 1IFJA 3UM7A 2XGSA 1E2QA 1THGA 2NVWA 2J67A 2IHTA 1KTIA 4TYWA 4Q9AA 5JWRA 3SS8A 4DNFA 1UJWB 2V8BA 5CBPB 1MGPA 2QAGC 4ZRMA 2OG1A 4RULA 3IEVA 3ZWVA 1O95C 3S6JA 3CC4V 3AUSA 1E3WA 5H2FH 5BORA 1HFJA 3IEUA 1P9OA 5K20A 2I1WA 3SHTA 4BNUA 3P0JA 1YTUA 1GPMA 4NYIQ 4G9BA 5JPDA 2WFAA 5I47A 3L05A 3BXFA 1WDWB 3VV2A 2XAAA 1GV0A 1ENZA 1MZFA 1HFWA 4C3UA 5EIXA 3MJFA 3ELUA 3V4WA 1CSEE 3O8QB 1TVKB 4L22A 2REQA 4PWZA 5ELXA 2P5UA 4QEZA 4YCMA 3U4QB 3DFUA 3ABLB 4X1KB 1Z82A 5F76A 1S9KE 5C1OA 4B3CA 1YITV 4MGEA 1DQRA 3U4GA 2OBMA 1MB0A 4HYEA 4BFCA 3WL6A 4QKQA 4FFMA 1ZICA 1DRWA 1KI1A 1XYYA 3LD9A 4WIAA 5KHKA 4GIFA 4Z9BA 5JD3A 1IPFA 3H1KJ 3X1DA 1MXHA 4US1R 3PNQA 1VQNP 3MRVA 3D1VA 3HA5A 4J16C 4HZ3A 4YIHA 1KTMA 3KEGA 3UHFA 1BYIA 1A5AB 5CGZA 3BMQB 4F84A 3PPXA 3HFJA 1NLFA 5K1ZA 2AZXA 1I0IA 5LC1A 3SC3A 1G18A 2FW7A 2JLWA 4F4DA 2FPOA 3RHFA 1KJ9A 2M7WA 3E0QA 1T8YA 2DYRC 4P6VF 2BM0A 3HR8A 3IAS1 4R3NA 1SBNE 3ICWA 4RMGA 1ZS9A 4MUHA 3AG3B 4X41A 1HDEA 1SC9A 1T1GA 5I7SA 2P90A 3RT9A 1VHTA 3DGEC 1NAHA 3LYLA 1UT5A 2OXRA 3SFDC 1LTBC 4K9KA 1YASA 2C9CA 3MLEA 3HN6A 4JJAA 4ZOCA 2P9FA 4HRYA 4XUGB 1FFDA 2ZYVX 4YP9A 1E66A 1RQPA 4NS4A 4QBHA 4YO8A 4YXWD 2HA3A 2QLFA 3B1FA 3DC6A 5LMUO 1VXOA 2BMEA 1J1IA 4UBMA 3HRIA 3MJ4A 5HW0A 2EZ4A 4Z1MA 2XUAA 4PINA 3IJRA 3AQIA 4PLYA 4HZUB 4B35A 1U2ZA 4L5YA 2CXNA 4URYR 4YR7A 1XDBA 1WP7A 4XM0A 2X7JA 9LDBA 3AUKA 1K5QA 4KLZA 3P7MA 1VP3A 2ZG6A 3AVXA 4QOSA 3G6KA 3Q3VA 2IXDA 3FYIB 3D3WA 1YYCA 1JO5A 1NO4A 2W6ZA 1E62A 2AHZA 5CNKA 1SERA 1OPRA 2CK3H 1USGA 2EEZA 5GONA 2Q9UA 1NF3A 2O8CB 5EZYA 4JH0A 3WLQA 4FNMA 3FX0A 2Z8YA 3KSZO 4XDYA 4GLLA 3LRXA 4NTWA 4D43A 4FKMA 4FT2A 3TUIC 4A0RA 2C9OA 4YXDC 1FYDA 3I92A 1MG5A 1V3TA 5I7EA 4HX9A 1W2GA 2P1JA 4L8YA 1DEHA 4L72A 4BQNA 3DNPA 4UCUA 3VNAA 3NZEA 3MXOA 1WCYA 2GUZA 5LA6A 2RKLA 3TW4A 1KBHA 4B7AA 3AU9A 4ZT7A 3L1JA 5JC8A 1DI0A 2C03A 2ZR7A 1UJ6A 1N33B 5CG1A 3DV0B 2C3OA 1E79A 2G88A 4N8EA 3F8SA 2FSGA 3M9LA 4MGIR 1N2CE 4DA8A 3D5EA 5DDIP 2P62A 2H54A 3HZRA 5DE3A 1U7HA 4AQYO 2JBWA 1O0BA 1L4KA 3LFUA 1THTA 3GFPA 1PI3A 1GDHA 4QPJA 4L51A 3PUWA 5AW2B 4FJ0A 3ZDZB 4BC1A 3IPXA 3PPVA 2PXXA 1QR6A 4OQXA 1L5OA 3ILSA 4DUZB 3PT9A 3ZG6A 4MITA 4LF5B 2W6JD 3D4BA 3K08A 1M56B 1DAFA 3MCAA 2B2NA 4DV4O 1NW8A 2IS4A 3KPVA 4KJMA 1A9XB 1PFKA 4V39A 4F6RB 4GKKB 3N2GA 5CLLA 3M1YA 2H8PD 5ITZA 2QJKB 1NBMA 1A02J 3LQ1A 2HG5C 2PSFA 2AQ8A 3WGJA 1N7JA 3P9SA 2J3DA 2JFXA 3PC7A 4LZAA 5I4KA 2ENWA 4HL6A 2VNHA 4YRNA 1MP0A 3CNLA 3I1YA 2HWXA 2DKFA 2Q1UA 3PKZA 1J0EA 1JPUA 1FLNA 1ZRSA 2I3DA 1V48A 2QSYA 4W7HA 3EQ2A 3OFKA 5L7YA 4NARA 3TXYA 4P54A 3U1CA 3OEWA 3DMTC 3PX2A 4LHEA 3DYBA 5CNIA 1S9HA 2CXOA 1EEXB 2X41A 1ELOA 1TCCA 1EFPB 5DM2A 1WCV1 1FXUA 1QHSA 3E2PA 4QYXA 1GGHA 1N8NA 1CNEA 4B09A 3P0HA 4EECA 1NRIA 3CMEV 3PWKA 4Q4AB 4CR7A 1SB9A 2PYIA 3BD7A 3ABSB 3SXJA 3IKMB 5AVVA 4P98A 4CCYA 1G5RA 3BD8A 1ZBDA 2BN4A 5T4HA 5FUYA 3DL7A 3AE2C 4OQPA 3OEYA 3THYB 1WBBA 3P8MC 2VA8A 3DCNA 4BX8A 1ORIA 4HNRA 4OA8A 4CFZA 5FR1A 2I29A 3KZMA 3CJHB 1DFHA 2ZYSA 1NU1H 4D0RA 1KQPA 2XA9A 1OBOA 2D2CB 1Z38A 1CR6A 4RY8A 5K3BA 3KXKA 2EL7A 3JWHA 4KH0A 5BR8B 2GF0A 1C8KA 2A4MA 2XVAA 1V54B 2ZAIA 4URWR 4RH0A 3OQVA 1J7JA 4GP7A 2CXUA 4HAWA 1QCCA 3KR1A 1LLDA 1A7AA 1K7XB 5K3SA 5BWOA 4JL8A 3FWNA 3OPXA 5FTMA 4WK2B 3R20A 2OG2A 3G6EP 1IK9A 3C7TA 3OUUA 2PPLA 2O6HA 3ISJA 2OKCA 13PKA 4D7SA 1M6EX 3OQHA 1C8LA 2C3YA 4C43A 3L74J 3K5HA 2QTSA 1X77A 1YI2P 4NCJA 4LJKA 1ZL8A 4IGKA 4UUQA 1BEZA 4JI1O 3B48A 4CLRB 5FBLB 1NP7A 3D4PA 3RU9A 1SXHA 1UJNA 4DJDC 1OWMA 3K5NA 4EB3A 3STYA 5IW8A 3FFXA 1FZCB 2YQZA 2OCDA 1K05A 1NURA 2V55B 1PV3A 1OH6A 3LZ6A 2OMEA 4C7NA 2Y66A 4EA6A 1YJNV 1TU4A 5EXSA 2Q2OA 3ZKWB 2W83C 4RANA 2VWHA 5LBIA 1QVGU 5KVQA 1S96A 4HTAA 3K31A 2QRXA 1TZCA 4CF3A 3H2YA 4Z2WA 2D4HA 3U10A 3THSA 1F4MA 3ZOZA 3NIFB 4EKIA 4S1PA 5HIKA 3LOPA 1A9YA 2X0JA 2H9AA 3KLPX 5LP6F 2IZ6A 1AVMA 1E3DA 1XVAA 5E8RA 1J09A 2ODWA 2FFDB 3N59A 1EDEA 5LGNA 2KOGA 4I1IA 3NP7A 2IBZE 3QXHA 4ENTA 1JE1A 3G4SP 1XT6A 2D3WA 1IZZA 3QF4B 2P2YA 4U3FD 3WAJA 1AUXA 4Z5XA 4L4UA 3A6HA 3GEBA 3A8TA 3UA3A 1YFZA 4EKNB 2GJSA 1VE1A 4MCJA 4GI7A 3LDFA 1ZN7A 5TT1A 4Q7EA 1R1BA 1WPRA 1SESA 4XLTA 4PBTA 4C05A 3L4SO 3QFCA 2I4OA 3L70J 3ASVA 3EVCA 3D0RA 3U2QA 3C5EA 3QUTA 1O96B 3HYRA 5HFAA 3TOSA 3MS7A 4F0JA 1U5BA 4TUYF 4G9EA 3D1JA 4FLFA 4AAYA 3TCXB 1G20E 3I62A 4H13D 3P3NA 4JI0B 4B17A 4NXNB 4PXYA 3PFKA 5JFTA 5J1SB 2FN8A 3ZJZA 4L5IA 1SA0A 1JLLB 4F8JA 1SD1A 1PS8A 4RL4A 5FBWB 1YJQA 1V6SA 4LI3X 3WGUA 2FMIA 4QYTA 1R5OA 2AZ4A 3I6QA 2I55A 3PDCA 3E7WA 2CL7X 2ZQZA 4F06A 2ZVQX 2C4TA 4ND1A 4OLBA 3D3JA 3GPBA 4X20B 5DTMA 3AFOA 3VKGA 3O91A 4M6WB 4FM2A 1CUZA 4TLFA 2COEA 5E0KB 4BNFA 4CLXA 4E46A 1K98A 4QHYA 2E6UX 1BWRA 4LHSA 3AVVA 4UHBA 1QG0A 4GZRB 4FGZA 3UMCA 3WGHA 4RKYA 1GQ2A 1DV2A 2YIUC 1BHJA 3HABA 3NLLA 1Y8RB 4A26A 3QXSA 3HCAA 4PELA 1Q1EA 4XD2A 2R7LA 3A26A 5KTMA 2QTFA 1RAEA 1XQ1A 3W3AA 4OGGA 3BH0A 4BNWA 3ZPXA 4TS4A 3S8YA 3VOTA 4G25A 2DBVO 1RRMA 4GZLA 1KB9E 3ECSA 3MIWA 4M0LA 3RV4A 2Q49A 2RFLA 4JCOA 4DILA 2AMFA 3R0ZA 1Y1PA 3DL2A 3A0RA 3GVHA 2PKCA 4FFSA 1QC5A 2EIJC 4GL2A 4WCEV 2JANA 4UAUA 4Z0TA 5ECYA 1U8CB 1JTHB 2QX8A 3O4HA 3RBZA 1QBGA 5EIFA 3F6PA 1AZWA 3T5GA 1I5YA 4KFUA 2XNDH 2XVZA 1HOTA 3C41J 1P84D 1DQSA 3LBFA 2CB9A 2OYSA 1MKYA 3QP9A 3G89A 1QIDA 4XPIB 1KNQA 1PP9D 1TYCA 3EZNA 3SM3A 3EXG2 2ODQA 2VRCA 1JG1A 3M6FA 4YRGA 2VRSA 4A1FA 1YS9A 3HUSB 5BUZA 2P3LA 2AR0A 4ZT5A 1DIRA 2HZ7A 2C96A 4RCVA 1YRWA 4N7JA 4KQ1A 3J80A 3H9EO 1UPUA 2YJ4A 2JAXA 4G24A 5GTDA 2C2HA 1BJKA 3CLSD 4MVSA 4XDGA 2R11A 1NG9A 4XDLA 1SQXD 2HSGA 3EGXA 1LBQA 3HE3A 5JJLA 1P9RA 1F60A 1EFHA 2OHJA 3H8SA 5DI3B 3WJAA 5JZOA 4K9RA 5JADA 2YZ2A 4D82A 2AI1A 2OCLA 3IJPA 2LKCA 1UFKA 3QOFA 2GTIA 4RU1A 2WSCJ 1BX1A 2YXRB 4EG4A 3B3FA 4AK9A 3JAKA 1DRUA 2Y27A 4JXZA 3U48A 1ML3A 2HSDA 3CZRA 3IQEA 4V2UA 2R97A 1D5CA 3LIEA 2LRHA 3ANNA 3CC2V 3SHWA 2A7QA 4QIHA 2HO5A 2FF5A 3UJ8A 2Q3EA 3CX6A 3B40A 1PTJA 2NXEA 5J4KA 1Q0SA 1UAGA 2Q6OA 2EF0A 5GTHH 2C4VA 3U5TA 4K8OA 3KQTA 2JR8A 4TRRA 4CUJA 1RAGA 3AVYA 1NQWA 1H85A 1VDZA 2H2GA 2NZWA 3UANA 4DEVA 4IOJA 1QYWA 2FUCA 2PNFA 4UBLA 1BCCE 4IFFA 1Z0AA 3O8DA 5J47A 2YWHA 5I9TA 4DSZA 2OAGA 3UK0A 1WNFA 4CLDA 2PX0A 2HK6A 3CLTD 3H4IA 2PN1A 2OZPA 1RI5A 5HQ3A 4YCBA 3AE1C 3TCNA 3KHSA 2XCSB 1ADCA 1U1GA 3VTPC 4FSDA 1XEQA 2CEKA 4RZQA 4RM3A 1L4LA 4DV5O 3PQ7A 4AUEA 5U4QA 3VHXA 3ZDYB 5CD1A 1M6HA 1HNWB 1P2FA 2E5FA 3OKPA 1AK9A 4PZEA 4D74A 3QU9A 2PO7A 4AZVA 3ZU3A 4M9SA 1ZLZA 4CIAA 5C1IA 2JEOA 5ERYA 1TJYA 1VDMA 4KQKA 1GNPA 4FNAA 1FLAA 3GDGA 5L3QA 2MW2B 2R4QA 2QRVA 4A2PA 2D3OW 1L8DA 1V6AA 4LYYA 1ARZA 2ZFUA 2CXXA 1IQRA 1UXHA 2UZ3A 2QTGA 4Q9DA 3AG2C 1Q0ZA 2QUZA 2FX3A 4O4HA 4LHZA 4URXR 2FAXA 1FYXA 1WB7A 1Y42X 3ICCA 4QA9A 3TRDA 1DUSA 2Y4NA 1HT1E 3AUYA 1CP3A 1M67A 1OUMA 4JLPA 5JYCA 4KHPB 3LWNA 4C7XA 4RXUA 3H5RA 2R6DA 3PXGA 4HJRA 4CKXA 3LSQA 1ECFA 5IKEA 3AERB 1N6RA 4C14A 4M55A 3F0TA 3Q5EA 2TS1A 3GGPA 3MCTA 4MVCA 5H3LA 2KB7P 1VKJA 3SF8B 3WQBA 3CWZA 1M8OB 4Q5IA 1NBIA 1QDLB 4JI8B 1ZAKA 2QD1A 2UVPA 5HZGA 3DMRA 1ZNYA 3I28A 5EJ4A 3DEJA 4F9EA 1Y5RA 2J5QA 3RK2B 1EX9A 3BWCA 2JJ1A 3BULA 3DMFA 2PL3A 2CLLB 5IEBA 1P7WA 1FYVA 4HDKB 3UO8B 2KW5A 5EKTA 3AP1A 5BWLA 2VHQA 4UTXA 1GRRA 4HAZA 1XRPA 5FJIA 3WYCA 5HIAA 4P36A 4E5YA 4Y6RA 5JSKA 1APBA 4K6GA 1W0KD 1XJ0A 4ENWA 5AIBA 1P31A 1RHJA 3Q3DA 2A5FA 4JUDX 1DHTA 1PP4A 1BXKA 1CXZB 2F59A 4P34A 1QB8A 4L4RA 1GM9A 1FJ2A 4DIFA 4KR2A 1JQBA 4MVJG 1CY1A 1G8KA 3U62A 1F4VA 4H59A 4UEKA 1YQ4C 4G5GA 4CKWB 1DCKA 1XVUA 4BQOA 3K9NA 4U9UA 2ZDQA 5A5VA 3ZQ4A 5I7RA 2NSLA 1G7SA 2J0VA 4KIWA 3T4ZA 1T4MA 2VZ8A 3ADKA 2W27A 2G9ZA 4GGOA 4BASA 4RZSA 1UMDB 4AZ0A 2H52A 3DEHA 4RWZA 3R0XA 5EG5A 4WXMA 2X0NA 1WMBA 1TIPA 3KDSE 2NU8B 1T34A 2H07A 3GX1A 4R2IA 4MRVA 4I14A 3NDJA 3LL4A 4WB4A 4QATA 1T3JA 2VJDA 1UQRA 2D5CA 2VT6A 3F5WC 4UUMA 4PY2A 1DIBA 3OO1A 2A06G 2FEMA 4R7TA 2QWOB 3K1TA 3O4IA 2YMPA 4DHWA 1P39A 3IOMA 1DG9A 1HEUA 4FHZA 3HPQA 4J9YB 2E89A 2OHVA 5JAOA 1XDZA 4MRNA 3LXUX 1CCWA 2YJ3A 3BCSA 1NSYA 2DETA 1FU8A 5KNCH 3K0FA 3Q2OA 3KJZA 1SOWA 2O8BA 3RFRA 5J4HA 3PXUA 3GWGA 2XZPA 4WXPA 4HB0A 4G5OA 4Y2PA 5KCZA 1IFMA 4GEGA 4DYDA 3TIVA 3OQNA 3S1SA 3H3FA 4DW0A 4AP9A 6GPBA 3E86A 3ECCA 3TGUJ 3DOIA 5T8KA 1H69A 1EK5A 3KT8A 1PLLA 1F0PA 2VP3A 4B6OA 3VR6H 2X1VA 3VYWA 3GD7A 1J8MF 4FINA 4NCXA 4BN0A 1TM7E 4L9AA 5EK0A 2OCHA 4DR1B 5GQSA 2GCIA 3B2EE 3AEUA 1Y67A 5F4ZA 1K75A 3E35A 3AF2A 3BZUA 5CDUA 2G9VA 1BFDA 1OVGA 3WV5A 5CCHC 5EKUA 1BW9B 2Q6TA 4O2LA 3GJ5A 4PYOA 2Q0HA 3SYLA 4IOIH 5D5HA 3L75H 2QG6A 5KSZA 3O4JA 4US2R 5AKHA 4XYEA 3C6KA 3GCGA 3VHQA 1S4XA 3CCJP 1C81A 1PJTA 2GPTA 3KJQA 3ML1A 1DIAA 3P9IA 3I30X 3Q0TA 4DLRA 2Q1YA 2I2BA 3EIHA 1LDEA 4W82A 1QV7A 4AJ2A 5C46F 2AC4A 4DHEA 2PMFA 3WIEA 4F4HA 2YXYA 4B8YA 3VPSA 1T6YA 2VRNA 1RQVA 3OHSX 4RVUA 1QGZA 3ASNC 1QQCA 3JTMA 2CUTA 2JLCA 4N3AA 2V54A 1EN4A 3LX8A 3AR5A 4BIZA 4HUQA 3LQQA 4H44C 2E76B 4KIUA 1RXIA 1TXGA 4O8ZA 3AI7A 3LU1A 3VHLB 2OPBA 3AG4B 1URPA 3ZGXA 1RC8A 3IP7A 1WPXA 4JSRA 3IFXA 3CSSA 4UBKA 2OR3A 3P8CD 1EFCA 4N5DA 2W2OA 1R6NA 3OM8A 1A4IA 5DP1A 2MTBA 2WTNA 2HR3A 2EHJA 4DLYA 4UFPA 1NE7A 3OTOO 1EGVB 4EKYA 3TYXA 2Q4DA 2C2MA 4MV3A 4C4SA 2GPNA 5E1AC 2VAPA 1JVNA 2GLTA 4DIMA 4MPTA 4IILA 1YKSA 1ZEMA 5KQGA 2W6JA 3HH8A 1T0UA 1BXZA 4TMTA 4M9XA 5FEMA 2ESRA 3CH5A 4TSRA 4CIBA 2ZRPA 1PFVA 2C5BA 5K1XA 1LTJC 1TCAA 2G9UA 3R40A 5CVCA 2EILC 2Y1FA 1VQNV 3S3TA 1UIIA 3O83A 4MI6A 3EF3A 2V0NA 2ONZA 1XHEA 1GP2A 3DLCA 1QYIA 4FC6A 5HS6A 1Z4MA 3D64A 4WNYA 1OAKA 5H3HA 4BWYA 2V9ZA 1LWUC 5T4EA 1GK9A 1Z62A 1FUUA 4HK4A 4LTNA 2O4UX 1ONPA 1HMPA 5BSEA 3R3JA 3T8YA 2MJLA 1HNZB 4W5OA 5BN3A 2REXB 1N8KA 2BCCD 1I4LD 4ZVVA 2MSNA 2FZLA 1M57B 3EHEA 2FFQA 1E2BA 3I5YA 3PX7A 3DTVD 1A96A 3WHIA 1RFYA 5BNFA 1G5FA 4QQNA 2ZT8A 1C7QA 5LP1A 4ESVA 2HPCA 2Y69B 5B57C 5ALSA 4F86A 4X3CA 3W3ZB 1K7CA 4HN4B 4R8KA 2DTEA 3W7VA 1ZRHA 4EB8A 3EFGA 5BVZA 1DVRA 4D02A 3ABMC 1NKZB 3PQEA 1YS6A 2PSSA 1YUBA 2J6IA 5JCOC 4PLZA 1SBQA 2G82A 3H3JA 3ZBUA 2IHBA 4MVRA 2B94A 5ADVA 4LXIA 2B69A 3BA9A 1X9GA 3FROA 1M8FA 1EQ2A 1OBHA 4I50F 4BLTA 1LRLA 2JAPA 2RK3A 1NIJA 3FCOA 4HBNA 2ZQ5A 4OVNF 3F7MA 2WKWA 5CCHD 4ZQIA 1I5XA 5SY6A 1Z2AA 1SFRA 1DBIA 4OBEA 3TLEA 1DT3A 2YV4A 1AI5A 3R41A 1LJ2A 4UJ3A 4ZO4A 5FUVA 5DNCA 1WSAA 5JCXA 3ISVA 3B6MA 1K33A 3PPYA 4JAVA 1GZ6A 3L0PA 4K46A 2WQZA 5F7OA 3OJFA 4NTYA 4QYWA 3E7KA 1X9HA 1I2AA 1VL5A 3UMYA 1OJ7A 1BHAA 2IXBA 4ITVA 2AOTB 2XZDA 1EVJA 1W2BO 3CX5I 3DC2A 4XA8A 3CR8A 4B84A 1ZV8A 2WZCA 1I3KA 1YZTA 1G3MA 3K6RA 4H3SA 4FXPA 2PTMA 3SSUA 2ECOA 5IKOA 1Y4UA 2K4MA 3OMNB 4IWNA 4IF4A 3AF6A 2PHZA 4EYGA 4C6SA 1RZ3A 3AY0A 3WK5A 2JCXA 2HCJB 5AKGA 4B86A 3Q0EA 2GO1A 3V8NA 3V7NA 1I6WA 5IKXA 4WESB 4Y9TA 4KMRA 4UQOA 3ZX4A 1LTGC 3DOFA 4R05A 1KYOE 1K6EA 1IULA 1ICIA 2WJ3A 3GO4A 1E7YA 4G97A 1VMIA 3HJAA 3K94A 1K5DA 3OZRA 2K88A 3J81k <