4LC1A

Meab, a bacterial homolog of mmaa, bound to gdp and crystallized in the presence of gdp and [alf4]-
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
326
structure length
315
Chain Sequence
TLPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylmalonyl-CoA mutase accessory protein
publication title Autoinhibition and Signaling by the Switch II Motif in the G-protein Chaperone of a Radical B12 Enzyme.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
total genus 122
structure length 315
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4lc1A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4lc1A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lc1A02
2ZJOA 3L37A 3QKUA 4Q1EA 1P2TA 1B0UA 4B6EA 4DDTA 2C9CA 4US2R 3KB1A 2D74A 5SZHB 5EJEA 4TQAA 4UKDA 3VR2A 4DLXA 3AH8A 5DHAA 4RFVA 2RHMA 3LW7A 4JBWA 2ZUCA 1KMHA 1FNMA 2HEIA 1W4BA 1Z2AA 3CKLA 3QVVA 2AWOA 2KSQA 2ZI9A 3UMSA 3GLFA 3GLGE 3QXJA 1NG9A 5A4JA 4US0R 2RHDA 1TU4A 1XCPA 2NO1A 3T12A 2QN6A 4W5JA 2VHQA 3W6NA 2GAOA 5KOYA 2J3EA 2RMKA 1F48A 4OHWA 3ZDQA 1CJVC 2Z4SA 4DCNA 3TAUA 4TL7A 4ZV4A 4LHVA 2WVJA 3GLIA 3QKRB 4YMSA 1G3MA 1VMAA 3RRNA 4EKDA 3M6AA 1YKSA 2F3RA 1N25A 2YHSA 4MKHA 5KDLA 4MYCA 1ZD9A 1MKYA 3T1OA 3KKQA 1YZNA 1U8ZA 4IDPA 3T15A 1GRQA 5CIQA 2QPAA 4L9SA 1UKEA 1S1MA 3MWJA 3B9QA 5EE1A 3QG5A 4RZ2A 2CCKA 3B6EA 4F38A 4HUQB 4FPPA 3ZVRA 3K9NA 4Z51A 2ZE6A 3S1AA 3HDTA 3NHBA 3ZZUA 4Q02A 1N6LA 1P9WA 2WIAA 3TNUA 1KNQA 3NBFA 1J7KA 3FMIA 4LWZA 5GVSA 3U6BA 3F3YA 1ELOA 2GCOA 3FHCB 4E07A 2XTMA 1RZ3A 2VP5A 4B3XA 3HP1A 5EP2A 2CXXA 4C30A 3B7GA 3T5GA 1D9XA 4ZO4A 1IM2A 4GCZA 4U7NA 5IHPA 3GJ7A 2ZSBA 4PFSA 2B7BA 2V54A 2CMKA 3LBNA 4Q4AA 2W00A 4C3ZA 2JLXA 1KZ7B 3FKSA 3KFXA 2XAUA 1OXVA 2OFXA 2ZUBA 5LB2A 3HWSA 4DLRA 2OFOA 2P7JA 4EFMA 4BLRA 1GTWA 4EPWA 5EZ5A 2EW1A 1R2QA 2QRNA 5FL7D 1W5TA 3I5YA 2P3SA 3I8SA 2O8DA 1U94A 2EU8A 2FPKA 5EE0A 1TAGA 1R4AA 2J1LA 1L4YA 3HPRA 2HUPA 4HZIA 1P73A 2C9OA 2VH5R 2GVZC 2C99A 1J8YF 1NL3A 2PCLA 1XEFA 3IILA 1Z06A 1UPTA 4NDZA 2HT6A 2XITA 4URYR 3PEUA 1F6BA 3SJZA 4PPGA 3RANA 3MJHA 5APWA 3HE4A 1H65A 3EXAA 5KHOC 1MABA 5K8LA 2W83A 2BEJA 2QQ0A 3K0SA 3SBEA 5JS7A 2PLRA 4ZDIA 1A5TA 1NLZA 5FTJA 2G3YA 1K6MA 4RY2A 4UXIA 1KKLA 1Z28A 1U0JA 3FFBA 1GK4A 2OO7A 4EFLA 3LO5A 1OFHA 1UJ2A 5ELXA 1K5GA 4C46A 1FX0A 1KI6A 2ORVA 4XVQA 5EP1A 3TE6A 1US8B 4GT1A 5JRZA 4I81A 3GLGB 1VDZA 2PT5A 3K70C 2FA9A 1JUNA 5CJPA 3GJ4A 3RHFA 1M2OB 3QPVA 4Q9JA 1NY6A 2ZI7A 2ZRMA 4DEYA 2XGJA 2XU6A 4QNMA 3V9PA 3R9XA 2GF9A 2GXSA 3F8TA 4Q4JB 2O8EA 3DGEA 3A58B 1IXZA 2PLFA 1OHHD 2ZR9A 3FYHA 4IXNA 1NVXQ 4X8OA 5AJWA 5UKDA 3EPJA 3UMFA 5JI2E 1WMSA 4B32A 4QG7A 4DCTA 4DLVA 4M3LA 1YRAA 4MQBA 1KI4A 2A7QA 4GRAA 2ZJ8A 4C2TA 4PAOA 4MDEA 2F1HA 3SBDA 4ZI2A 2Q9BA 2ZREA 3R7WB 1W0JA 121PA 4JLDA 1ZINA 5H68A 5IK2A 1GK6A 2IK8A 3MGNA 4PHTA 2A5JA 3IGFA 4S2EA 2FZLA 2JDIA 4PHFA 5AUQA 1RYFA 3CH5A 3RWMB 3VX4A 4R7ZA 3U7FB 2PH1A 1BMFA 1AS3A 2O8CB 4H1UA 2ANCA 1LB1B 4QGHA 1YZGA 5CM9C 3QSYA 5J40A 3Q7PA 1DVRA 1XNJA 4ZDWA 4D0LB 5IRCD 4JAUA 4JLPA 2FSFA 1AQYA 4U02A 1KI2A 2VRWA 1NVUQ 3LX5A 3VKWA 2XZLA 2X77A 2YINC 2W0MA 2AK3A 1TF2A 2QE7A 3KDSE 2ZXEB 2DHRA 2YZ2A 2BJVA 5F9FA 1F2TA 2HDNB 4W5HA 3QEJA 1RW4A 3WY9A 1S9KD 2OLJA 3VYIA 4CRWB 5AUNB 3T1TA 3W5JA 3DZDA 1N6NA 1X3SA 5EE9A 5FUVA 1RC8A 1VYTA 3E1SA 2F6RA 1ZIPA 1DO0A 1W0KA 4G5SA 5CYPA 3N2IA 1VYUA 5FOVA 4AQRD 4I2LC 2ERYA 2W27A 1OXUA 2W6JA 3N2EA 1DAMA 3BGWA 4Q9HA 3PUWA 1EFRD 3GLHA 4EPTA 5H1YA 2CDNA 2CK3D 3PUZA 1CKEA 3H84A 3TW8B 4LJYA 2OHFA 5M04A 3SDZA 2A5FA 2G1KA 2WPQA 2J0UA 4OI1A 1NBMD 3T97A 2V8OA 3FHOA 3FOZA 2OBNA 3QXSA 2XXAB 4AYTA 1Q20A 3GJXC 2YOFA 3CF0A 5BN5A 1E9SA 1A4RA 1CZQA 1KI1A 5CLLA 3JVUA 2WBLC 1E1RA 4MKFA 2JLYA 2KJQA 2VQSA 2WWYA 1C4OA 4BEBA 4YMWA 4AUWA 1DAKA 1JR3E 4NYMQ 4ZIRA 4D4JA 2DFKB 4U7OA 1CJTC 1WA5A 2FGJA 3K70B 1R0ZA 2R6GA 4DT1A 5JZVA 3Q5EA 3W8RA 3E5HA 2XEXA 4PSAA 4RD4A 5FPYA 3L8YA 4QM6A 3LH5A 1G17A 5D3MB 4XD7D 3WNBA 1ZM9A 3AGQA 1IJFA 1KI8A 2JIZA 4KO8A 2P0EA 2A5GA 3D36A 2D4HA 2C04A 1JB1A 421PA 2XB4A 3SJAA 3BOSA 4DSOA 2UVQA 2FU5C 2IC5A 1NVVQ 1T3SA 1X1RA 3PUYA 1VCOA 4HZUB 3EW9A 1Z6AA 1K5DA 5G53C 3THYA 4PZLA 2WICA 2YYZA 1XTIA 1SZPA 2MSDB 4Q9IA 2J7PA 2ODBA 5TB5A 4Q66C 2OILA 4RD3A 2PBRA 4JYCA 1J70A 1UADA 3O8RA 4A2WA 1FTNA 4H1VA 4W9MC 4B75A 5F98A 3PEVA 5CB6A 521PA 2R6AA 1G5RA 3QPWA 1RRCA 1MV5A 1HT2E 1NMYA 2G1JA 2D2EA 4QBGB 3VMZA 2D3WA 2ZRFA 2WJGA 5GVRA 2D2FA 1JAHA 1YQTA 2D62A 4LGMA 1E2NA 3EA0A 4C7NB 4M9QA 3RWOA 1UAAA 3MAAC 2P65A 4WXPA 1GM5A 4AWXA 4NHOA 3QBVA 3NBXX 3T1QA 1Z3IX 2OXRA 3RSOA 2IEYA 2ZRCA 2KWIA 4ARZA 2MMGA 4HB0A 5DH9A 3NKVA 4QPJA 1MT0A 4HEJA 3CWQA 1DE0A 1UF9A 2GXUA 3CW2A 2WAYA 5TDHA 4D4LA 2CLDX 2V7QA 2IYTA 3RS7A 2HLDA 1P60A 3A1WA 3AVPA 2QY9A 3J81k 5B30A 3FKSD 3EZ7A 1G8FA 1YRBA 1E1QA 4WA7A 1W46A 3C4JA 3WRXC 2IYZA 4RCZA 5AJXA 5J4LA 3P8MC 3MSXA 2K5UA 3VR1A 1CU1A 2Z5IA 4RCYA 3A4LA 3SJCA 4UJ5A 1E3MA 4LJ8A 1N5JA 2W6IA 3SYKA 4CF7A 3PQCA 1QF9A 3L43A 4XTCS 4Q4LA 2ZVPX 3M0DA 4JVMA 3TUZC 1GWNA 2Q3HA 1H8ED 4A92A 1E2FA 1XTRA 2PMDA 1CI6A 3HR7A 5APYA 1OIVA 4X8LA 3B2EA 1FP7A 3FGNA 5C2JB 4ZI3A 2EVWX 3B9PA 2I1QA 2KP8A 3LXXA 4C0LA 1ZBDA 2FV8A 1DH3A 2JJ8A 4Q4HB 2J0SA 1YU9A 2ODNA 1OH5A 5AW0B 3C16C 3P4YA 3DM9B 4PQFA 4OBEA 3WBJA 5F9HA 1GU5A 2ZSAA 4W7SA 4OK3A 1AQUA 1GVNB 2R6CA 4RVCA 1IONA 4P4SA 3UWKA 1G6OA 5HE8A 2F1RA 3NBZC 1M7GA 3MWLA 3THWB 3ZD7A 2FEMA 1ZM4A 2WJJA 3CR7A 4DEXA 2XSZA 2C96A 3IIKA 5KTYA 1CJUC 2ZJ2A 3H1TA 2WJYA 4B48A 4BFUA 2BMJA 4QGGA 1Z63A 3PFIA 3O8CA 3VTPC 1NN5A 1AGRA 4Q47A 4DLZA 1ETUA 4NYJR 1P62B 3SE0A 1VG9B 4LHWA 5CMZA 1E98A 1NN3A 5HZHA 4IOLA 3VHXA 3U3OA 1EFCA 2QRZA 4B86A 2BBSA 2F1JA 4Q01A 3U61B 3B1WA 3BH6A 2P6NA 1JNYA 3ZRXA 1DARA 1G5TA 4TSFD 5EE3A 3RYTC 3VQTA 4GDFA 1V43A 2ZI6A 2ZYVX 1KDOA 2NO9A 4DVGA 4TMZA 3TQFA 4CDGA 1E2EA 1DAHA 3GMTA 4A9AA 4DB2A 2OCPA 1GZLA 5DISB 2VO1A 4DUGA 4M2LA 1T3HA 4DKXA 5DI9A 2IT1A 1W0JD 5IK2D 3MD0A 1EFTA 2DY1A 3A4MA 2ERXA 2OAP1 1G4UR 4PZYA 4V0OA 3V5BA 2ZRLA 5TARA 3VMFA 1RKBA 4PHGA 4N0DA 1TNDA 3I73A 3QXCA 4RD2A 4J0QA 2MSEB 3JZMA 4AG5A 3PJRA 5CIWA 1O3YA 1CXZA 4Q48A 2XB2A 4ASUA 1HYQA 3E70C 3LXRA 1BMFD 2QPTA 2ZITA 2UKDA 1S2MA 2EWVA 3OESA 3P27A 2CL0X 4HAZA 3P7KA 1ESMA 1W47A 3PITA 4QBHA 3SI7A 3MG9A 4F4JA 4JSTA 4L4UA 1LF0A 1LTQA 5FL7A 2VIIA 5JEEA 1OB2A 2JATA 2VP6A 3SYLA 4RKEA 1PLJA 1T8UA 3I4LA 1OW3B 3IPXA 2OLKA 2PX3A 3FPAA 4NYIQ 5FBQB 4R71A 2IEZA 4ON9A 3QUSA 1II0A 4C4PA 1KIMA 4Q7JB 2QE7D 3GFPA 2BBWA 1P5ZB 1OH6A 4ZCMA 4MYTA 1ESNA 4QPKA 4DXAA 2GDJA 1GTVA 3CUEF 4OQXA 2DCUA 4IDOA 3H0KA 1GSIA 1KK2A 3SFZA 1N0VC 5HR5A 1YZUA 3E2IA 4N0EA 1T6NA 1YYCA 4KP4A 1W0KD 3R7WA 4MA4A 5LBIA 4EPVA 1E6CA 3QKRA 4M9XA 1CULC 5CM8B 3HU2A 2W6JD 5FOTA 1NJFA 1OV4A 2OBLA 1P3JA 3D7MA 5J4KA 5FTLA 1QVAA 2VSOA 4PR0A 1ZU4A 3QIAA 4V0MA 1G8PA 3W6OA 2YJTD 1JR3D 1S3GA 3BXZA 4CEHB 1QRAA 4KYIB 1L7VC 3BH7A 4B44A 1QZXA 2C8VA 2QP9X 2YWFA 2QZ4A 3MLEA 4GBMA 4WBSA 4KITB 1P4SA 1PLKA 2QBYB 2GRJA 2R5BA 3TK1A 3VTKA 4PPFA 5HTKA 4HUQA 3T06B 5AVZB 1KO7A 4LYJA 1OFIA 1VHLA 4URZR 5BN4A 4CIDA 2QORA 2BMFA 3M9HA 4C2UA 2EFGA 1ZJ6A 5FTKA 4DLWA 3CPJB 1CRPA 4NBSA 4KV9A 5DLQC 2A9KA 1E1RD 2ZRBA 5AVSB 3QVUA 1FP6A 5H70A 4BEJA 4GZMA 1T3LA 3K0AB 1XRJA 2GJKA 4LHZA 2JJ2A 1JECA 3CONA 4LHYA 1AJEA 5APUA 1N0UA 2L0XA 2SHKA 4HDQB 1RPZA 3VAAA 3U4QA 4I1SA 4TMKA 2KB0A 1E2QA 1EWQA 3JZAA 4HDOB 4LPKA 5HPYB 2UZ3A 3L0OA 2WJHA 3LDAA 3VR5A 5DI3B 8OHMA 1HBWA 2PZEA 1QHHB 1OXZA 3A7OA 2JIZD 1KJZA 2G77B 3BB1A 5AK0A 4JYBA 2FSHA 5TMPA 2PJZA 1U2RA 1ZP6A 3NFQA 3CM0A 3Q3JB 5AW4B 2ZRNA 4IKEA 4M8NE 1XTKA 4BFSA 3NTUA 2R44A 1TUIA 3BAFA 3GFOA 4B33A 3ZIAD 2JLQA 3LFUA 2F43B 4DSNA 2XZRA 2X2FA 3ADDA 5J5CA 4YXWA 3CRRA 1G21E 3W8NA 1M1YE 3I72A 4ZKIA 4PQYA 4LBYA 1M6NA 3OF5A 2AD5A 3KQGA 1TQDA 1E2IA 2BOVA 2O52A 1G3IA 3RABA 1NSFA 1N6PA 2BWJA 2KI5A 3A1SA 2ZM5A 4F92B 1VYVA 4NKRA 1VG8A 4FIDA 1G3QA 1MO6A 2NQ2C 2WWHA 2H57A 2QMOA 4RD6A 2X19A 1QHSA 4B43A 1ZNZA 2Q3IA 1FMLA 4LPSA 4WW0A 1YZTA 2QMHA 1QG2A 3LRPA 5AJYA 4V0NA 3EG5A 1N6RA 1XDBA 3T35A 2HT1A 3SQXA 3AUXA 4JVLA 1W7AA 4OJQA 4DB4A 2JA1A 5SZJA 4MGIR 5JFGA 1X6VA 1FL9A 3N70A 4G5RA 3RLFA 2CNWA 4FCVA 2GCPA 1CF4A 4CW7A 5JBQA 2FN4A 1GUAA 2A3RA 2GK7A 4LC1A 3TJZA 4TYWA 3UMRA 1W49A 1J99A 1EFRA 1KSHA 1E9RA 1XF9A 4P33A 4A0GA 4DRZA 3CWZA 4G3XA 4QM7A 4OHXA 5HKKD 3IBYA 3WP1B 5AJZA 1S0UA 2V7QD 2FFHA 3BE4A 1US8A 4IFBA 4Q00A 4DZOA 4D80A 2HLDD 1H89A 4JASA 3GLGA 2PX0A 1E9BA 3AVXA 1Q12A 1GRRA 4DHEA 4EPXA 2IUTA 4NPHA 1E1QD 3BWDD 3X1WA 721PA 4M1YA 3AVWA 3REGA 1M7BA 2GZHA 4Q21A 2OUKA 3QENA 4MRVA 3DOEA 3M06A 1P72A 1NMXA 3QKSA 3TYYA 1T2KD 5EP4A 1D2EA 1Y63A 4JVSB 2W6ID 4OQFA 4LV6A 3ZVMA 5CDFE 2BASA 5AVYB 1CR4A 3PR1A 3OAKA 2OCAA 1JI0A 5AW3B 1GNQA 5K8TA 3WXMA 1IN8A 3ZYCA 5FUWA 5GJVC 4AI6A 4JBYA 2RGEA 1Q1EA 1Q1BA 3I5CA 2GK6A 1JQJC 2W0SA 1W48A 1RJ9B 3M4YA 4IW3B 2J46A 2P5SA 3AKDA 2ZANA 3K0CC 2FG5A 1GNPA 2IYSA 4UNSA 3EZ9A 4QJ4A 3U44B 1AZTA 2QAJA 4XD7A 3DMNA 1IO4A 1D2MA 1G291 1HE1C 4XIGS 3L0IB 1VECA 1XMJA 2O8CA 1Z2CA 4O25A 4TLBA 2C78A 2VEDA 3A4NA 4Q1BA 4O2LA 4Q19A 4I1OA 4DDUA 4PO8A 2WZQA 4AYCA 1CBUA 1XX6A 2XSZD 4FMBB 2AKYA 5AVWB 2WKPA 5L3SB 2Z5HA 3GJ5A 2CL6X 1MRSA 1TQ2A 2GJSA 1W1WA 3SC3A 2EQBA 2QTVB 4MRSA 4UNPA 1YR6A 2VP4A 1JJ7A 1JQLB 2IYYA 3CRVA 1Z0JA 2VLIA 1J90A 1UBCA 4JLBA 3OIVA 2QSYA 4OK6A 4Q1CA 4TL8A 4OHVA 5CB8A 5FI0B 5LDDC 5C18A 4LX0A 3C7KA 3K09A 3EC1A 4B3CA 4G1UC 1Z22A 4O2RA 1FQJA 1DO2A 4Y0AA 3PUXA 2B8WA 3ADKA 3KJEA 2ZVQX 1KNXA 3IO3A 4D82A 2YO2A 3SJBA 2IWHA 4NU0A 2CVHA 4HLUC 1SHKA 2N1BA 3RS3A 5C1BA 1LW7A 1E79A 1YR9A 3L2OB 5DYIA 1J2JB 3TSWA 2I4IA 4M1KA 5KO2A 3AF3A 4C7OB 1P2SA 4DUGD 3GJ8A 5J4HA 3LA6A 3NMDA 2JJ1D 1D9ZA 1WDTA 2IUUA 1QG4A 2P5TB 1HTWA 1K8RA 1ZD8A 2YWGA 4M4SA 1GG2A 1QHNA 1U99A 4V0KA 1QHGA 4IDNA 4RZXA 3IHWA 3OFND 1KQLA 1Z6GA 2ZE7A 1ZU5A 4AY2A 1GD2E 4OKSA 4ASUD 3VHLB 1XMIA 4L5BA 1YR8A 3H86A 2QP4A 4P4UA 3ASZA 1GDDA 1G4AE 3LVRE 4JS0A 1M74A 1TEVA 1FZQA 1EXMA 1HURA 1NF3A 3IIJA 1OJLA 3NG1A 1XEXB 3EPHA 3K9GA 1RRFA 1H8EA 3DOFA 1R8SA 4M1OA 1LF5A 3BERA 5CYOA 5AW9B 4MUAA 5E4FA 2H7VA 2OV2A 1ZIOA 1R7RA 2QP3A 2WWFA 4DSTA 1NN1A 2FDCA 1KGDA 2A5DA 2MSCB 3KTAB 3TAHA 4EQ6B 4CEJB 3EA5A 5D3MA 4YMTA 4MT8A 1N6HA 2HF9A 3OHMA 4B74A 1ZRHA 1WBDA 1P6XA 1UEJA 1X1SA 4R98A 4YONB 3IO5A 5CJ2A 1OPXA 3X1XA 4XWOA 2QENA 4EPRA 1NKSA 2F7SA 1VIAA 3GJ0A 4M9ZA 1Z83A 3B82A 4E03A 2ZJYA 3U60B 3FMPB 4BLTA 1L8QA 2CLCX 2ZPTX 4NONA 2JGNA 3PG5A 1N6OA 1FFHA 3RS0A 4PSKA 4PANA 3ONWA 1E0JA 2A5YB 1F2UB 3MFYA 1Z6XA 4B47A 2YNYA 1R10A 1VCMA 4XWKA 5KU1A 1TF5A 2QMUA 1E2JA 2YO3A 2J0QA 5JJLA 1TEXA 5AW6B 1XU4A 2P2UA 2ZSFA 1P9RA 3DEFA 2ZJZA 1TQ6A 3QF4A 4ZPXA 2IYQA 2GEUA 2CHGA 5EP3A 2MMCA 1BIFA 3RRZA 2PL3A 3KX2A 3TR0A 3SFVA 1Q21A 2IS4A 4Q7KA 3FTQA 3V4RA 2FF7A 1KJYA 4B3FX 4NCJA 4YMVA 1Z29A 4F91B 4TLAA 2NPFA 3KXKA 4LSGA 3U7EB 2VHUA 4TSFA 2IW3A 1I4TD 2OZEA 3A3YB 1S1CA 4C7NA 1W2HA 4HAXA 3P32A 2N46A 2JJ2D 2Q3MA 4LJ6A 2JJLA 4NCHA 1E9DA 4GP6A 3G82C 3MUFA 3WMGA 2CJWA 1SVIA 4AKHA 5JWOA 2FWRA 3ZVNA 2YKGA 1JBKA 2YWHA 2ZRPA 4OL0A 5JWRA 3VU9B 2V55B 3L0PA 4QGFA 2G88A 4KCGA 2HJVA 1ZVQA 3QOFA 2W2VA 1CIPA 2AX4A 5EQTA 1GZSA 4B3DA 5GJBA 2H7HA 4LZZA 5EXXA 5SZIA 3VR4A 4AURA 5TXGA 1NMZA 1T0HB 3ND9A 3TSOA 2FH5B 2NO7A 2WT7B 1ZNWA 4TZ0A 2W2TA 2OBMA 1W4AA 3AEZA 4YXWD 4M9SA 1HJBA 1NRJB 4URWR 2PZGA 1HT1E 1I2MA 1FOEB 1GL9B 2ZRJA 4QBIA 4WXRA 5E7JA 1E2GA 5JSZB 3UXMA 2JCSA 4OYHA 3IEUA 4LV8B 4QHSA 2O0HA 4JBXA 4KXFB 4UXHA 3ADBA 3BB4A 2C98A 4KODA 5JWHA 2WWGA 3FMFA 2BC9A 3H4MA 3BJIC 1YHNA 2RKOA 3FWYA 4HYYA 5KDDA 3O8ZA 5KSYA 5FBRB 1E0KA 2IYXA 3ZZ0A 4NE2A 3T1VA 4YMUA 3G0HA 4JLJA 4FMDB 4KLZA 1MR3F 2PEZA 5FOWA 1DOAA 3WP0A 5EE5B 2W2XA 1XP8A 5E7MA 1Z07A 2N9BA 4Z8YA 5G3ZA 4II7A 2CNWD 3K0FA 1G18A 1NVWQ 1IY0A 2YOGA 1NAFA 1G20E 4KVGA 4E5UA 2C5LA 3EPKA 3NIBA 3THWA 5K8IA 4JKYA 4TQ9A 4UNNA 1X86B 2I1VB 2ZSDA 4YC7A 1OWAA 1EFHA 1JR3A 2BKEA 4BFYA 1IHUA 5ANRB 1KDTA 5BYJA 1GKUB 2XZPA 3MMPA 1U90A 4F93B 1FAVA 1KSFX 4IXMA 4TMTA 2FFBA 4ERNA 1H88A 1E0AA 1E2MA 3AV0B 3TNUB 4WOPA 5TV2A 4QL3A 1ANKA 4EPYA 3R9WA 4M1WA 1KKMA 5KYKA 2GCOB 1Z0KA 5JJIA 4NZYA 4BUJA 2QI9C 1O87A 2PMKA 4QBFA 1ONBA 2C2AA 4P4TA 4DDWA 3DM5A 5CITA 2QTHA 3ZZTA 1GRNA 1A02F 4Q1FA 2CL7X 4IJMA 2WTYA 2WV9A 4C0AC 5FBVB 4IOJA 2VSFA 5AUOB 1WBBA 1WXQA 4OI4A 2ZS8A 2YC2C 4LV5B 1OYYA 2Z0MA 3B60A 3NC1C 3G5UA 4IVQA 5HE9A 1WP9A 4HB2A 5JEDA 4MUBA 4ESVA 3W3AA 4ZKEA 1VPLA 2AWNA 1KI7A 1KMQA 2CHVA 3HJNA 1F5NA 2DR3A 2PEYA 4NCKA 1M8PA 2AFIE 3THOA 2O8DB 4LOAA 3UATA 1WQ1R 2ZE8A 1N5KA 4XE5B 1R0YA 1SVLA 4H9GA 4TTRA 1CEEA 3ZIAA 1EX7A 3FMOB 1JEEA 4RD1A 3CPEA 2GILA 3FDIA 3NWJA 2XX3A 4KYUA 1NI3A 1P9NA 1S8FA 4JLNA 3RC3A 5LD2C 5APVA 1PUIA 3OAAD 1SXJE 4G01B 4LBWA 3N5CA 5G41A 3JVVA 3V4FA 4QKQA 1Q3HA 4DIEA 2G6BA 1CS4C 2ZU0C 3FVQA 2FMXA 4D6PA 3FHTA 1HQCA 4Q7LA 1T91A 3ZRWB 1XCMA 4I99A 4P32A 3ZQJA 3KQKA 1SXJC 5E95A 4G5QA 4I4LA 4US1R 2EWWA 3RRYA 4D0NA 3T34A 3K9HA 2RGAA 4KSBA 3L36A 3AUYA 4X8MA 4C0JA 2ZYTX 3FB4A 2TMKA 4FI3C 4CT4B 4MYHA 3VMYA 2FEOA 3T5DA 4B34A 3AP2A 2VF7A 1E79D 4LYAA 3A8TA 3WNDA 4DWJA 1FX0B 3IPYA 3I62A 1NNEA 3BK7A 2RGCA 4Z1MD 1PLLA 1UBGA 3GQBA 3K1JA 3ZQ6A 4EJSC 5JCPA 2ZRKA 3QEOA 2HXSA 4CEHA 2PT7A 4A6PA 2NPIA 3EIHA 3AP3A 1JOYA 3OE7D 3RS2A 1GAJA 2VA8A 3THXA 1A1VA 1WRBA 3U7HB 1OXSC 3LY5A 2B8TA 1EK0A 1H8HD 3QF7A 4P3YA 2BVNA 4HB4A 3D6TB 4NL4H 3QQ5A 2WKRA 2CBZA 1C1YA 2GVDC 4QGAA 4TMVA 2HYDA 1SQ5A 3DZ8A 2DWPA 5CK5A 4PO1A 2DWQA 1CRQA 1XD8A 1FQKA 4BIUA 1GFIA 2BKUA 3K0AA 1OH8A 4PAQA 3SOPA 4F7WA 4JKIA 3CR8A 3CNOA 1X8YA 1G3UA 1N0WA 1OIWA 4YDHB 5BN3A 3K70D 2EFCB 4JZKA 3M0EA 4I6MC 4LJ7A 4URXR 3WYAA 1PVOA 1Z0AA 2ZE5A 3AQ4A 3CZPA 2LWIA 3VN0A 4OJKA 4PC7A 4F4IA 3R20A 1QHHA 2XTNA 3QY0A 1KO1A 2BBOA 1WB9A 5KSOA 2G83A 3TIFA 3A0RA 4HAVA 1AKYA 1G7TA 5TY0A 2F43A 2VP2A 5C46F 2IS1A 1E9EA 4O3MA 2CVFA 2I3BA 2FPMA 2O8BA 1G8GA 3LLMA 2B6HA 5LB4A 1AKEA 1NG1A 1II8A 2RGNC 4C0SA 3LQRA 5AR1A 3MJRA 3MGCA 3SR0A 4IRUB 4BPBA 3AVTA 4MRPA 1AK2A 1XEWY 3R9IA 4A8JC 1SHZA 4LJ5A 3A37A 1OB5A 2A2ZA 3WNCA 2VL7A 3HE5B 1YVDA 2J7KA 1DTSA 1A2KC 3OIWA 4TTPA 4PXAA 2IPPA 3DKPA 4IHQA 4A0RA 4DDVA 2AN9A 5IDJA 2B7CA 1A2BA 4IEIA 1XD2A 3GLHB 5AUPB 5LD2B 1Q22A 4NH0A 5KNCA 4JVNA 2ZQ5A 4IVRA 3M9BA 3P20A 3KQNA 4PSVA 2LCFA 2OCBA 2J0UB 2JJ1A 3TQCA 4IEEA 1SXJB 2WJVA 2QM7A 1E9CA 3TUIC 3EARA 2DPXA 4HDCA 3FE2A 4TZ6A 2PZFA 4DSUA 4HAWA 2H18A 5AW8B 3OFNA 4PX9A 2ZRGA 2E1RA 3V4WA 5FPTA 3RRMA 2HXYA 2V3CC 1RFLA 2G0TA 1D2NA 2QROA 4QRHA 3VNUA 1GITA 3KKNA 2XZOA 1NSTA 5BWMA 5B2ZA 1YZKA 2AK2A 4EJSB 5AVUB 1UKYA 2X2EA 4TLEA 3AKCA 4QXAA 1MV8A 2GKSA 5HCNA 3VKHA 4KHZA 1DBSA 5EUQB 2XV5A 1AS0A 3KXLA 4D81A 2F9LA 2V6JA 1Z47A 2EYQA 2QEQA 2Z83A 3SEAA 4U7DA 4KHXA 4LK2A 3UG6A 5SZKB 3WHKA 4BFTA 1RJ9A 2CCJA 3TW4A 4HI0E 5D3QA 2Z5FA 3KKOA 3O47A 4LY6A 5IT5A 3U44A 1AA9A 2V4ZA 2LFSA 2WIBA 4UXJA 2ZXUA 3C14C 3CNNA 5F3WB 4A36A 3IKJA 4P31A 3SNHA 2IF2A 3B1ZA 3U6KA 1Z0FA 3ZS8A 1D8TA 2CEAA 3THYB 4HATA 1CJMA 4XVUA 3HYTA 3NHAA 4I1UA 1JALA 1Z08A 5FBWB 1E96A 2FJUA 2ORIA 3GD7A 4A0HA 4BLOA 3AVVA 2F9MA 4FD2A 5L3SA 4R2HA 5BYKA 1R5OA 3D31A 4AC9A 2R65A 3L0SA 3RAPR 4KI0A 1JEDA 2O0JA 1XXHE 2VSXA 1DAFA 4G5GA 1XPUA 2R62A 2JEOA 3QE0A 1XTQA 3ZRVA 2FSIA 4ITRC 1H8AA 3AP1A 5P21A 1FOSE 1XZQA 2QA5A 2E42A 3EASA 1TX4B 2CCGA 4XSGA 2ZR7A 4UNRA 1ZM2A 1Z0DA 1IXRC 3A2AA 4M1SA 2FFAA 1KO4A 5BQ5A 5FL3A 1II9A 1EWRA 2XTZA 4C0BA 1SVOA 3IR9A 4TTQA 1N5LA 2GBLA 2OXCA 3F5FA 4ARZB 4D0GA 2BM1A 5DHFA 1J2JA 1AIPA 4TN1A 5JS8A 4CEIB 4A82A 2REOA 4A8JB 3LIDA 4C7OA 1HUCA 1LNZA 1YZLA 5L3QB 4OHYA 5J47A 2CE2X 2VYFA 1MRNA 4RZUA 2AL7A 2Q6TA 2YWEA 5GJWC 2DYKA 1GL7A 1Q3TA 1LVGA 3OEHD 4Z54A 1COWA 2FOLA 2IBMA 4G5OA 4W5WA 4MGYR 3I8XA 2NMVA 4GMXA 2KBEA 4D2IA 3QG1A 2PCJA 1D6JA 4B2LA 2D7CA 3AVOA 3CRW1 1KAGA 1TU3A 3C15C 1CI6B 4B3BA 1QHIA 4MGZR 3P4XA 3SWFA 1BKDR 2BEKA 3I92A 2ZJ5A 4RKFA 3NBYC 3NH6A 1OYWA 4TQUS 1DS6A 3AM1A 2WWIA 3AKYA 1U81A 5AW2B 4DBLC 2H16A 4QJ3A 1SKYE 4QFMA 3A1VA 5HKKA 4EAQA 1G64A 3NXSA 1RRGA 4YQFA 4CEJA 1CLUA 1U8AA 3KTAA 1JR6A 1OXTA 4L8GA 1R0XA 2QAGC 2Z43A 4ZDKA 1R0WA 3C5CA 1GKYA 1LFDB 5E7IA 4HUTA 2OAQ1 3BFKA 3BD9A 4RFSB 1PV4A 2XOKA 5FPKA 3FKQA 3TNFA 1UBFA 1U9IC 1X8LA 4JL5A 5E3HA 5C93A 1Z5ZA 3NH9A 2VTKA 3C8UA 2C95A 4L9WA 5CDFA 3M1IA 5AJVB 3A6PC 3B1VA 3CBQA 5L3VA 821PA 1IXSB 1G8HA 2F1IA 1VCIA 4BFXA 1KAOA 1KJWA 3BB3A 1OE0A 1TQ4A 1DADA 1ZMXA 2BBTA 1E9AA 1E2KA 3SQWA 3FFAA 1S9DA 3CF2A 3U2QA 3U7GA 2ZFCA 1XWIA 5IDVA 2WPRA 4ACAA 2C2HA 3LAWA 3QI2A 3T61A 4FWTA 1SVSA 4Q4JA 3GEIA 4BLPA 1YE8A 1BH2A 1HQYE 1GP2A 4AKEA 1E4VA 4KVAA 5FBLB 1P2VA 4P0TA 2IL1A 4TYQA 5APXA 1L4UA 4IDQA 1SP4A 2RAPA 5AWFC 5HCIA 1G6HA 1HA3A 1ZC4A 4LYFA 1E32A 1S9KE 1E2HA 2QTFA 2WMOB 4GI7A 4FMDF 4IDHA 5AW7B 4XSHA 3QJYA 1XXHB 3KZ1E 4EOTA 1R6BX 2R32A 3LX8A 4KBGA 2RGXA 2DFNA 3A36A 5B57C 3EZFA 4GSYA 5JCZA 3VU9A 2ORWA 3B78A 4A6XA 1N6IA 1U0LA 2ZRAA 4HLUA 4PO9A 3W3ZB 2BJWA 1DAIA 5DN6D 5EUMA 2F3TA 2IF0A 5DSZA 2R2AA 3WMFA 2V9PA 1HV8A 3OZXA 5KSZA 1UM8A 1X8KA 3HU1A 1QDEA 4OHZA 3I5XA 3IIMA 2XJ4A 1IY1A 4OI0A 2O8FB 2WT7A 4DCUA 1G5PA 1UKZA 4NYMR 5JI3E 3CIOA 3BBPA 2AKAB 2ZU6A 2WSMA 2NOAA 5APSA 1NBME 2ANBA 3AF0A 2HF8A 3OAAA 4NYJQ 1JPNA 5JSZA 1E9FA 1ZCBA 2OEPA 2Z6VA 2NO6A 4CVNA 4L15A 3UIEA 2NO0A 1N2CE 3GPLA 2WPDD 3B8HA 1G7RA 1ZM7A 4BLQA 1I4LD 4TL6A 4XTRA 4AIIA 3H2YA 5L8VA 3DDCA 2JAQA 2ZAOA 3KQLA 4FWIB 3X1DA 1XPRA 3VMXA 3KJGA 5AVQB 4Q9LA 3BS4A 1OFUX 1NVVR 3IUYA 3TMKA 3A5TA 5BW8A 3GLFE 4C9BA 1QHXA 4TWZA 4EDHA 2CLSA 4Z1MA 2C9NY 1W5SA 1VHTA 2X8AA 3EZ2A 2WKQA 2WM9B 3V4QA 2A78A 3GCGA 5IF9A 4G0NA 3VFDA 2QAGB 2NTYC 1SKQA 4BE7B 1SKYB 1OKKD 5KNDA 3OE7A 3GLIE 3B5JA 2J41A 2R9VA 3LBHA 2OG2A 3CRMA 2B21A 2GA8A 5HZKA 1H8HA 2LKCA 2RGBA 4TYPA 2XXAA 2JASA 3KJIA 1KDRA 4EIWA 4D25A 2GJ8A 1BS1A 2ZI4A 3KFVA 2YV5A 3QPUA 1TUEA 2ZRDA 1N5IA 3X2SA 4PC1A 2YVUA 3NEJA 4FW9A 4B35A 3U4QB 2FNAA 2A30A 3B1YA 4U00A 3P26A 1J8MF 1R8QA 2ZYUX 3DKVA 1SVKA 2GXAA 2RH5A 1EFUA 4WIAA 3EAQA 2CHQA 3AVYA 1IJEA 2OM2A 4CYMA 4FN5A 3ZS9A 2C9LY 4LHXA 2QG6A 3K09C 5G40A 1OXXK 2IS2A 4V02A 1IBRA 4FMCB 2GNOA 2FPLA 4PZZA 2GEDA 3VR3A 2ZJAA 3TBKA 1HE8B 2P6RA 2ATVA 1UEIA 1A02J 3R8CA 1IN7A 4AYXA 4C0QC 3RC8A 1GNRA 1X8JA 3C5HA 4NP6A 2DFLA 3OIYA 4LC0A 2QGZA 3KDPB 2ZUDA 5FUXA 2VBCA 4QJ5A 1UKVY 4RSGA 3U5ZB 4LJ4A 3U3KA 4Y0VA 2HCBA 3CB4A 2HV8A 1FPMA 2Q3FA 3DL0A 4WZAE 2GJAA 3NC0C 5J4VA 1SLQA 2ECKA 1RVDA 4HZUA 2BCGY 1W4RA 3KUCA 1CTQA 2X1VA 5CK4A 2EFHB 3R8FA 2D7DA 4E22A 2YNMA 4DLSA 4BRUA 1XTJA 1PUJA 3W90A 3EIQA 3HYRA 1XJ0A 1S3SA 3ZRWA 4OQNA 1WCV1 3ZJYA 3ZD6A 1XTSA 1NN0A 1OSNA 3IEVA 1E99A 1Q1ZA 1IOZA 4QNRA 2AR7A 3MRSA 1ZUNB 2QT0A 2EFEB 2IWRA 4LBVA 2QL6A 3NTNA 1UDXA 1AZSC 4B2IA 2YOHA 1GILA 3AF4A 4XWAA 4N3NA 5FI1B 2FZ4A 5FUYA 2J5XA 1GOTA 4GZLA 3X1ZA 6Q21A 2FSGA 3AF1A 3GJ3A 1XEWX 4POAA 1E2PA 4LDJA 1G16A 2WSSA 1GKIA 2FX3A 3Q8XB 3AKEA 1MFZA 2QU8A 3UPUA 3OEEA 4UQOA 3CX8A 3QKSB 4HLQB 3ZLJA 3HTKA 5JJKA 4ABYA 1CR1A 1COWD 1TL7C 2HCJB 2IX3A 2ZROA 1T5IA 4TYYA 1F3OA 4C0HA 2ZRIA 4JT4A 4KSCA 2YC4C 1XCGB 4M1MA 2IXEA 1PJRA 4B2PA 1I2DA 2DBYA 3IHLA 3Q72A 5FTNA 5KPJA 4AKIA 3UIAA 4OI2A 1KMHB 1EX6A 2ZAMA 2ZI3A 3GLFB 2VP9A 3BFXA 3GJ6A 1FTSA 4DJTA 2HJGA 3UWOA 1T0JB 5EXSA 1GL6A 3WBKA 4CZ2A 2DWOA 4IFEA 5EZ6B 4JLKA 4ESHA 1HWTC 5AW5B 4U5XA 3SZRA 4DC9A 5JLJA 3SHFA 4EFNA 3B85A 4PQRA 4Q4HA 1GIAA 4FCWA 3GLIB 4BZXA 3CX7A 3P1JA 3CNLA 1AS2A 2Q9AA 4V03A 4PC2A 3RVBA 4HSEA 4D26A 2XOKD 3AF2A 1FW6A 1W4CA 2J45A 1T8TA 4NTZA 3QXXA 4XVRA 1JXMA 1CJKC 2OFWA 2WHXA 4PHHA 4K8OA 3TR5A 3CPHA 4BZPA 1S9HA 3GFTA 2ZTSA 1XMVA 2GESA 1WF3A 2IYUA 4NYIR 1DEKA 4Q9KA 3RNLA 4WZ6A 4MITA 3I3SR 2NIPA 1Q0UA 4DLUA 1C9KA 3A1UA 2W6AA 1KOFA 3S1AB 1LS1A 1Z8FA 2F55A 4BQSA 5KPDA 3GP8A 2H5EA 4TYNA 1HUQA 1ZAKA 5CLQA 3CF6R 3PENA 1E4YA 4XH9B 4HLCA 4DLTA 3HE5A 4MDFA 3SU8A 1RE0A 3U3JA 2R6FA 1ZUIA 3I1FA 3LVQE 4JLMA 3KXIA 4PPNA 1FNNA 3GEHA 2IYWA 5APTA 4KBFA 1OFTA 3OIUA 2Y8EA 4A2QA 1R5NA 4CT5A 1QVRA 2REBA 3O8BA 4DIDA 4Q4AB 1NLYA 4DCVA 4YDSA 3I32A 1SXJA 3EIEA 2Q7CA 4GOJA 2H8KA 3Q5DA 1P2UA 2Q5UA 3QKTA 1NIJA 3WYGA 3B1XA 3OEHA 1E69A 1HEIA 2WOOA 5JRJA 2ZJBA 1ZC3A 3SYNA 4JLAA 4URUR 4BWYA 4JJKA 2GETA 3ZVLA 3PV0A 5EXPA 2J59A 5J4YA 2IUSA 4GOXA 4MKIA 3W6PA 2ZR0A 3DVLA 4JL6A 4TT3A 2E43A 2VHTA 4GFDA 4LRWA 1G2CB 2Q21A 3GLHE 2ONKA 4A2PA 4EJSA 2JLUA 4RZ3A 3O8DA 1I4DD 1YR7A 2AD1A 1P75A 1E94E 3K53A 5JHGB 3WMEA 4FCTA 1VKJA 2D06A 4EUNA 5JECA 5DNYB 3SS8A 1KSGA 4LBZA 5DIFA 2Q9CA 4TL9A 3Q9LA 4QHYA 2RB4A 3HE4B 5K8UA 2VP0A 1G7CA 1MABB 5KDOA 4AKGA 4Q18A 1ZM3A 3KL4A 3WHLA 2XNSA 3AB3A 3RSLA 3ZH9B 2QPOA 4QC2A 4HB3A 3EWAA 3KQHA 1E2LA 3VKGA 4M53A 4YLGA 2NZJA 2GWHA 4LYHA 1IN6A 5C4GB 3NDBB 4JLVA 1UDWA 3BIFA 3BFVA 1FMJA 2N42A 3EX7C 4Q1AA 1G8YA 5H8WA 2QSZA 3W9YA 3QBTA 1VIYA 1KI6B 2AFHE 3AVQA 3QF4B 4ACBA 1KO5A 2XNDA 1IN4A 2PJRA 2LKDA 3IQXA 3CO5A 5B1NA 1ZD1A 3PEWA 2AHOA 3U3MA 1TMKA 1KK1A 4KLNA 2VHJA 2QBYA 2O8EB 1DELA 1NIPA 3TKLA 4KJZA 3X1YA 3BC1A 1FUUA 5KUTA 1B23P 4IOMA 2XJ9A 1SVMA 2ONJA 1ZW6A 4ZCIA 4IOKA 5EXTA 2HYIC 2OSBA 2NG1A 1GU4A 4MKGA 2C03A 4C0KA 1P7CA 4WAUA 1DAGA 1ZUHA 1G9XA 1NJGA 2GAAA 2ZS7A 4PPQA 1LY1A 2RGNA 5JMTA 1NLFA 2CJWB 2NGRA 4Q03A 1AN0A 3ECCA 1CP2A 4HAUA 1KK3A 4PAMA 4WVFA 5AVVB 3ND8A 4CEIA 1W36D 1LS6A 4A8JA 2OE2A 1G41A 5L3QA 4AG6A 3W34A 4RD0A 2BM0A 4HAYA 5LPNA 2BHRA 4MRNA 4B71A 2ZEJA 3LQQA 3DPUA 5TVKA 1HY3A 1BO6A 1IY2A 2BDTA 4K46A 5DI3A 5AVRB 4JT2A 4N1AA 2R3CA 4ZCLA 1CR2A 2W58A 5DN6A 2BMDA 1R5BA 2OCYC 1KK0A 4KFSA 3EPLA 1MO4A 5FOUA 4DZZA 3DMDA 4M22A 3ETLA 2UZIR 3BRWD 4ZKDA 3L82B 3RS5A 3UG7A 1U0HC 2WPSA 1TTTA 1E2DA 2WAXA 1ZCAA 1DG1G 4NMMA 1F2TB 1UBEA 4BFWA 2ZS9A 3M91A 5B1OA 4PTLA 2Z4RA 2WWWA 4RESB 4Q20A 3TUJC 1HH4A 3LWNA 1TADA 3RS4A 3TRFA 1KSJA 2V6IA 1KO8A 5DE3A 1JAIA 1M7HA 1MO5A 2J87A 3PCRB 2WPDA 1IXMA 2IYRA 2ZI5A 2P2LA 4UJ3A 3WYFA 4URVR 5C4MA 3K0FB 3NVAA 2E87A 4TLDA 2G9NA 2LFRA 4JJZA 2IXGA 2WMNB 2DB3A 1JNMA 2JLWA 1T2KC 2H17A 3KB2A 4RFSA 3PXGA 1TF7A 1VCNA 1KI3A 2QQEA 1NWQA 2QM8A 4BFZA 4BECA 3LW8A 3EWSA 5FR2A 5A0FA 1T5LA 1BOFA 3B8EB 1ZNYA 4LJ9A 3SHWA 2FFQA 1FOSF 2GHIA 2RGDA 3LLUA 1PZNA 4OQMA 2B92A 1IQPA 3CZQA 3CLVA 4BLSA 2V1XA 3MWKA 2JLZA 1QHYA 2EYUA 1MOZA 1XZPA 2WSSD 4MH0R 1OKKA 1W2GA 2H1LA 2C9YA 3TVTA 1CSBA 2WJIA 4QHTA 2IS6A 1KHTA 3OEED 3ZGXA 1DG3A 4R9UC 2GXQA 4TMWA 2P6UA 3CRQA 1OIXA 2IHBA 4Q1DA 3SN6A 1XJQA 2BCJQ 3A1TA 1N3BA 4HYTB 1QBKC 4O0MA 1M34E 4L16A 4ZIRB 3D8BA 4RJLA 2P67A 2GF0A 4DT1B 3C41J 2IYLD 3CX6A 2WWXA 3HPQA 5AVTB 1KI9A 2QUZA 3Q7QA 3GEEA 5A5GA 2J9RA 3ASYA 4Z8XA 1IN5A 3B13B 2JDID 4MRRA 1S96A 4WZBE 2FE4A 1CR0A 1OF1A 1SVWA 621PA 4XJXA 1KYIA 1G7SA 3DHWC 4GOKA 3TVDA 1W36C 1XXHA 2GZAA 3F0TA 1Q1QA 1N6KA 1RRPA 3NEYA 5DYGA 2CE7A 1TPZA 3L8ZA 4NCIA 4X8HA 1VTKA 3EZ6A 4LUCA 4MYUA 4B76A 2IXFA 4D4KA 1VG1A 1T4GA 1NY5A 1U98A 1XPOA 2WOJA 5FOSA 1A7JA 4BASA 2DFTA 1EESA 3MCAA 1XJCA 4JSYA 3MWYW 1P61B 2JLVA 4S35A 4A1FA 2O8FA 5DGXA 2REXB 1LV7A 2R6DA 2ZETA 4MTXA 4KU4A 1BYUA 1ZYUA 2FGKA 2KBFA 4F4CA 2QT1A 1S4QA 4JLOA 4QOSA 4JMPA 3AVUA 1Z0IA 3LD9A 1KZGB 5L3RA 3TLXA 1KY2A 4AYWA 3K8YA 2GJ9A 2O5VA 1G19A 4R2IA 2JLSA 4M1TA 2C77A 4FMTA 1EGAA 1T9HA 2VRSA 1DAEA 2R5DA 3Q85A 2GTPA 4PC6A 3TSZA 2ASEA 1UFQA 2E9SA 2R8RA 1MH1A 3KJHA 2ZIAA 4KFRA 4A0FA 3DO6A 1Q44A 2EFDB 2FTKA 1JXOA 2QGNA 2KE5A 3LV8A 2IHYA 3KQUA 2IYVA 3VX3A 4DCSA 3UKDA 3NDPA 3I61A 5FPHA 4FMCF 3V00A 3M0AA 3KKPA 4HLDA 5FFMA 1OH7A 4V0LA 1L2TA 4AD8A 3LBIA 3THXB 3IBGA 2ZSEA 1SXJD 2QAGA 2VF8A 3BORA 1XB2A 3KKMA 1OLOA 1Z6YA 2ODWA 1U8YA 4E09A 2QNRA 2VPPA 4OQLA 1VG0B 4B73A 1JJVA 3AGPA 3EC2A 1OHHA 4Q5IA 5FR1A 2RCNA 3UK6A 4TLCA 1U9IA 3K9LA 5DO9A 1JPJA 2OESA 1XFAA 4V0ME 5B58C 2J0VA 3ADCA 5B64A 1NKTA 2AXPA 4MGKR 4TT3D 2ZYWX 2G0NA 3ICQB 2VHCA 1XEXA 5AW1B 5GADl 2GCNA 2NZ8A 1RYHA 3W5IA 4BGDA 4B3GA 4BZQA 1ODFA 1KDPA 2RGGA 4NCNA 3ICEA 2WTUA 3ZCCA 4ILEA 4BRWA 3U3RA 1SULA 4Q7MB 5FTMA 1Q57A 2ATXA 4D4MA 1FUKA 3D3QA 4EQ6A 1KY3A 4GPTA 1D5CA 4P4SB 3HR8A 1KTVA 5FOXA 4GMDA 5FH9A 4JIMA 2O0KA 4IVPA 1YJ5A 1XBTA 3LIEA 4GNKA 5GJCA 2O8BB 1YZQA 1XMSA 5APQA 1AM4D 2IA5A 4DLYA 1II8B 4KFUA 1DPFA 4JL8A 1WE2A 2GBLC 3TGPA 5AVXB 3VR6A 1Z6TA 2J7PD 4M0LA 4AK9A 4GL2A 4BIZA 2QMEA 2ODEA 1F60A 1F2UA 1W36B 3K0CA 4FXPA 2XNDD 5FPSA 4I5SA 3LNCA 2V1UA 3IDQA 4K81B 1SGWA 4OK5A 4B6FA 4FINA 2OT3B 4LCBA 2Q0HA 1XD9A 4M21A 5BXQC 2GZDA 3PEYA 1MO3A 1RIFA 1A82A 1AGPA 3CH4B 1XD2B 2BIFA 1BYIA 3IQWA 5KNBA 1F51A 3VNVA 1IAQA 3QXHA 3UANA 2AXNA 3K0EA 1OT3A 4XOIA 4KFTA 5F2EA 4KAXA 1MUUA 4ZDJA 4GP7A 1Y3AA 3PVSA 5G3YA 4GKGA 4TMXA 3PUVA 1W44A 5JHHB 2CK3A 1E0SA 1G3RA 4LI0A 3BH0A 4LJAA 3QNUA 3REFA 1NP6A 3HU3A 1G1MA 3TH5A 3WRYC 1ZNXA 1EG7A 2JLRA 221PA 1NBMA 3PIRA 2H92A 2BMEA 4A15A 3L35A 5KSPA 4BFVA 4JAVA 1V5WA 4I1VA 4PC3A 2ZRHA 3RDPA 3KUDA 4CGZA 2BV3A 2GEVA 4UNQA 4A4DA
chains in the Genus database with same CATH superfamily
5IX8A 1LZLA 5KLVD 2A9VA 5EJEA 4UKDA 3EPRA 1GNTA 1JVBA 2MR5A 1S72V 4BB9A 2XZDA 3QXJA 3RF6A 4IYIA 2AZ2A 3W6NA 1O6FA 3ZDBA 1L8AA 2PPLA 4BNXA 2ZJFA 4YMSA 1VMAA 1CCWA 1JIXA 4DL9A 4OMFG 2Q0OC 4L9SA 1QQBA 3MWJA 1FF9A 4RZ2A 2PBZA 1YHZA 4CLEA 3I9V1 1T2EA 2WU1A 2H0RA 3EIFA 1SHUX 3U6BA 3TLZA 1OQAA 3K79A 5JQGF 2XTMA 4Q15A 1UFVA 5EIOA 4IDDA 3PQ4A 2BOCC 4QO7A 1AK9A 2V54A 2WSSG 2CMKA 3AQIA 1D2DA 1I24A 3FKSA 4YIKA 3S70A 2B3DA 2JEEA 1RF1B 2JHGA 4FE3A 2O8DA 5FF9A 2AGVA 4O2AA 2VDLB 2CTRA 5E9JA 5HKOA 3VQXA 1RQNA 1A8SA 3I1IA 1V6SA 2FKNA 2HT6A 2FK8A 4MR9A 4CF6A 3CBGA 3HJGA 3NHJA 2ID4A 5AI4A 2I7VA 1U5AA 1U31A 2SPZA 3EXG2 1W76A 4XVQA 2FA9A 3PNLA 1LVUA 2XAHA 1FEZA 2XGJA 4AMYA 3L7BA 1IXZA 2OO5C 4B32A 1YRAA 1Z4QA 4ZMBA 2DP4E 2QJRA 4N4AA 1OCRC 3H16A 3KUUA 1ZIXA 4JLDA 1ZINA 4BPRA 1K9MW 1W88A 1GPUA 2C3OA 3BHJA 2FRVA 1AS3A 2ANCA 3Q7PA 4JAUA 4TT3G 3ZY6A 3CCSP 3IULA 1AQYA 2V0NA 4BNJA 10MHA 3OC0A 5A4FS 3L71G 3ZCQA 2J3KA 4UU1A 3PTAA 5I5EA 1QK3A 1E4OA 1UDRA 3D1JA 1ST3A 4Y6OA 4GXTA 3CLTC 3GMSA 1YNSA 4GI1A 5H9VA 3P2KA 3TE7A 1QLEC 1ZXBA 1LTHR 3H2GA 1KFJB 4YALA 2YJ5A 3SDZA 5LMUO 2G1KA 4KWEA 4MVSA 2QIWA 3EGOA 3O8OB 2JRIA 4NARA 1SKUA 1TYAE 5I7RA 1DAKA 5T8KC 3LDFA 3VQVA 4WUVA 3UUWA 4KR7A 2IH5A 1I6MA 1J21A 2EILC 1G17A 5K4HA 1FBMA 3EAFA 1SCUB 1W52X 1C3OB 1P18A 3EH2A 2CXSA 1T3SA 2ZIXA 1VJ1A 1LPMA 1KB9D 4IHJA 2X6CA 4RD3A 2JFBA 3NNSA 1M8FA 1E6EA 3EF3A 2W43A 3IAM6 3JYQA 5CB6A 2NPSA 4D41A 1XZMA 5BU5A 1UMBB 4F9GA 2PD3A 4P0PB 5BNFA 4EY7A 2P65A 4BGEA 2OXRA 1Y81A 4GXNA 3I56V 4OJMX 1U2DA 2ONCA 3IELA 4TQGA 1WZEA 4CH6A 1QGKB 4LJ8A 3SYKA 4YAEA 4K2HA 2OTLV 4AJLA 2Q3HA 1CI6A 3SR3A 3DEIA 2IXDA 5HG0A 3OZFA 3AEKB 3LXXA 3B77A 3SWWA 1UBRS 3FTPA 3C16C 2OFFA 3UJPA 1ZGCA 1G8KA 1RPRA 4E5SA 3JSAA 1EIZA 3IIKA 1H9BA 1S4XA 3KLMX 2EILB 4BFUA 2AMVA 2BFBB 3BRSA 4E4RA 1TVEA 3SE0A 1VG9B 3PQ3A 4UDYX 2ZG6A 4FJCC 3ZHXA 1X7XB 2BFAA 3OZUA 3KWMA 1AOXA 1DIGA 2QTSA 1Z6QA 4DB2A 3UJDA 2VO1A 4M2LA 2ES4A 5LKAA 1XR3A 1SCAA 2Z3ZA 2HPZA 1V96A 1M1JC 3ZE7A 3MBIA 1JSRA 5CT6A 3KD3A 3LCJA 4XDZA 1LH0A 3RC1A 4TSRA 3MG9A 3EFBA 2VF2A 3K0HA 2OLKA 1BOOA 3MAJA 1II0A 5BQPA 3ANYB 2A4KA 2ZDIC 1GTVA 4Z99A 5AQ1A 5K0JA 2FF5A 2YS8A 5HR5A 1YQXA 3VSAA 4X94A 3BDAA 1ZXGA 5LMUB 4J1NA 3L02A 7GPBA 5DJTB 1KR5A 4B7KA 5GV8A 1JXAA 1GT91 1V1JA 4J3NA 4REOA 5LQRA 1OFIA 1RJWA 2QORA 4X85A 2BMFA 2ODTX 4PJ0Z 4IF6A 1CRPA 1UANA 3F8WA 4Y9RA 2A9KA 2MYTA 1ZD4A 1FP6A 1PPJG 3U4DA 4HZ3A 3CONA 1VQOP 4HDQB 1BA3A 3SEQA 2UZ3A 3CRAA 4K35A 1QHHB 4LBEC 1DRJA 4OHRA 4DF3A 1TD1A 3PNYA 1EFPB 1UEXC 1M1JB 3LPCA 3USZA 8LDHA 4C01A 2AD5A 1F06A 1WUTA 4UCUA 4GX1A 1E1MA 1MO6A 3MJDA 3CNQS 1ZNZA 5BW4A 1QG2A 5CW1A 1N6RA 4ABMA 4DLAA 3CMAV 4B7UA 5A4AA 1OZGA 1V9PA 3N70A 1P1HA 2CNWA 3C3TA 5JBQA 3HBJA 2CVOA 4FUTA 4EVSA 1VQ7P 4OOEA 3H9JA 4DRZA 4EKNB 4J7JA 2ADFA 1TMOA 3OCCA 5M34A 3GVIA 4NXMO 3BMXA 2JS3A 4OTZA 2QJPC 1PX2A 2XADA 4MRVA 1TB4A 4UMVA 5K05A 2FWNA 3AR5A 5AVYB 1N73C 1N34O 1DZ3A 3SLGA 4KZPA 1Z4OA 2ATCA 2GFIA 1R9MA 2W0SA 2Q5LA 4M86A 2OKCA 1IBCA 3U4GA 4DADA 3R6LA 1HDEA 3UXYA 2AEMA 1W4ZA 1H4QA 1BFDA 3DDSA 2ZUWA 3EGWA 3D54D 5D1NA 3QLVC 4LGCA 3V8MA 5B1DA 1CBUA 4ZU3A 4YAFA 2FSVC 1XGKA 2PFXA 1OW8A 2YKOA 4OK6A 3KT6A 4MV7A 1Z22A 1L1FA 1IIBA 5JPCA 1MABG 3OCJA 3EQ7A 2WSCH 2FR0A 3AZQA 1MMMA 1ZAYA 4HLUC 3RS3A 2ZQYA 1SS1A 3MUEA 2P9JA 5AD1A 2JJ1D 4CS4A 1LI5A 4OH8B 3TW6A 2ZE7A 3V9AA 1IHDA 3DEKA 1M1KQ 3E9ZA 4L5BA 4QOJA 3B2QA 1PF7E 2PKRA 1ULZA 5C7IO 4XJVA 3H1KH 2QW1A 3M4JA 4PR3A 1RHJA 2R97A 3OBBA 2Q0AA 2QJPB 1NN1A 2PV0A 2A67A 4J7UA 3R3WA 3QH4A 4ZC8A 1RXEA 4QATA 2ADMA 4KK3A 1JCHA 2PQ2A 4UAGA 3BJRA 1W5FA 2AF4C 1N73B 2YCBA 1LBTA 5KYWB 3B82A 2J85A 3U60B 4MVZA 2W7TA 3I64A 4UHKA 1TF5A 2O1JA 5IYZA 2Z04A 1E2BA 1Q21A 2P9EA 1Z29A 2VYND 2N1TD 2P8JA 4RV4A 1CY8A 3H7IA 3STZC 5LNK6 5K0FA 1PNQA 5K03A 2JJLA 1GQOA 1MA1A 3HV2A 1TA0A 1U3DA 4PU0A 3C3AA 4PG5A 1ADCA 3GGGA 5EQTA 4X65O 3V8EA 4LWQA 2OBMA 3AEZA 4UUAA 5GTHE 4YT2A 1NRJB 3ROFA 4EO9A 2FPXA 2JCSA 2P6MA 1PYDA 2A1UB 2WYVA 2JDIH 1PQYA 1G6UA 1YMQA 4YAIA 4XM2A 5KX5F 2XDJA 1MEOA 2W2XA 1PK9A 3QU5A 1NOHA 4NXMB 2WJPA 1L8LA 1KDTA 1CB7A 2XKBA 1FNSA 3K5WA 3QPAA 1E0AA 1AFOA 3AV0B 4MW5A 1YAHA 1N34B 1W96A 1P3DA 4IJQA 1MZFA 5BO5A 1WW3A 5EWLA 4XGQA 4IUCS 3FPSA 3R4VA 4NBKA 5ITZB 4BRSA 4YCAA 5KJ7A 3RU7A 3UH0A 3TJMA 3T1NA 4E3WA 2OUIA 3KXPA 1DT5A 1MJHA 3I1JA 3T95A 2VKTA 3RFUA 4J4HA 1U65A 4HUJA 5G41A 3JVVA 4H1TA 4Q7LA 3I9LA 3KQKA 3M1YA 5KTBA 4J94A 4I4LA 4IRXA 1KFNA 2EDCA 1L9KA 2RGAA 5K09A 2RFLA 1Q0ZA 4J80A 3FB4A 1E3WA 1FYEA 3FIUA 3O8NA 1W19A 5F2NA 1GQYA 3J81N 3K1JA 2PT7A 1AZLA 2FW9A 3U4IA 2NPIA 5LQSA 4H33A 3LKDA 5CBFA 1EVIA 4YN3A 1VF7A 4XJTA 4X8AA 2RG1A 2R8XA 3PFFA 3DVAA 1T5DX 5KAIH 1G20B 5CB4A 5HRAA 1YXMA 1OYOA 1VEWA 1G3UA 1P4AA 4TYMA 3K6KA 3K70D 4JZKA 2RGRA 4KGXA 3CZPA 1QQTA 5K3SA 1IB6A 1LUWA 2XTNA 4MWBA 3RUDA 1QIJA 3P2MA 2VJAA 2Q6OA 1ZJ5A 3TGUJ 2VP2A 4KQMA 1J2RA 2QU7A 1G8GA 4BXOA 2B6HA 3ODGA 5C34B 5A9GA 1SB9A 1XZKA 4DYHA 1FXWF 2OSVA 2H6EA 3WB2A 5IYDO 1VJRA 1EBBA 1M7LA 3LLVA 1B3QA 3P4UA 1OB5A 3N74A 4C6RA 1RYDA 5SYNA 3W5AA 1YU6A 2IPPA 2UXCO 1SQQG 3P20A 4PSVA 1X22A 1WXDA 4X65B 3L9XA 4RA6A 3U11A 3FE2A 2HSDA 1ZFNA 3AEXA 4KNWA 3VJLA 5BXZA 2G0TA 1TFUA 2W6ZA 2ZM6O 2XZOA 4IIXA 3UXHA 4E6PA 5JCOC 13PKA 4RNDB 4JEUA 3JAMA 3FB5C 1EBFA 4NK4A 1RJ9A 2CCJA 1MC8A 4XR4A 2LFSA 4ND3A 5CFRA 1NU6A 3ZS8A 4HATA 2FQ1A 4B3IA 2AQHA 2F9MA 3V4LA 5BYKA 2R65A 3W7AA 1PGQA 5K1ZA 3QOXA 5BMVF 2Q6QA 2B0CA 2L35A 3JARA 2V98A 1KO4A 4Q12A 5BQ5A 1RSOB 5AOCA 7MHTA 3ID6C 3BHPA 4V0QA 1JFVA 1QQ6A 4FDMA 2FWAA 4I3FA 5EZSA 1V45E 4HDMB 1JQAA 3HBFA 3SX2A 3AVOA 3ZWQA 2B37A 3G71V 1HE2A 4IJKA 2BEKA 3QEMB 3TLYA 4ZVPA 3AM1A 3F4KA 1FBTA 3KQQA 4YQFA 2AXTZ 4FHCA 4RFSB 1PV4A 3HB9A 4PW0A 4FHGA 1T4CA 4JL5A 1SBZA 1F9EA 4L9WA 5CDFA 3CBQA 4CKXA 4R8KA 2GB4A 1G8HA 3NXKA 1KBHA 1FFWA 1USVA 2PRJA 2IDKA 4LIPD 4MWTA 1U2TA 3QVSA 3T61A 1K8YB 4HXYA 1E79G 2A6PA 3QFFA 2D6FA 1ISMA 4QUKA 1SP4A 1HA3A 1YQDA 1GL2A 2VJNA 1X7ZB 4EOTA 2DFNA 3T3DA 1GZ5A 3TTSA 2I62A 4FKZA 5LIRA 1B6RA 4NNOA 1XU7A 3RVYA 4OHZA 1H8EG 2C1XA 2WSMA 2O14A 4PRYA 2CZCA 4BB0A 5LBQA 3GAAA 3LQ1A 2EJUA 1ZCBA 4EM6A 2UXCB 1FQOA 3D3WB 1OVVA 3ANMA 1W35A 3KFLA 1ZM7A 1RCUA 4DV7O 3TLGB 2CXPA 4A73A 3LT2A 2ZAOA 2B1GA 4L85A 4Z9YA 3VMXA 4G0MA 2G9VA 2OPBA 3UICA 3HZOA 5EHGA 5HBRA 1NJ5A 1SKQA 5SY6A 2P4VA 5KNDA 5ISMA 1M72A 5J9FA 3LBHA 3CRMA 4ZYWA 3B9RA 3WNZA 4S1NA 1VBFA 2JEXA 3LBYA 2DJIA 3LPNA 4AZ3B 4L5JA 3N2YA 4WIAA 3PPIA 3F71A 4MVQA 1EGVB 2YTZA 4FJ0A 4F6LA 2BFCB 1FIUA 1T9GS 4HG2A 3JU3A 4KJXA 1AMOA 1KQOA 1UEIA 3P9KA 1A02J 3R8CA 4CH3A 4AYXA 3RREA 4JJFA 3NJ8A 4EFKA 2Y1DA 2AZ4A 3U3KA 5CFPA 1SIOA 3I04M 5K0SA 5HJ7A 4IQ0A 4AN4A 3R8FA 3NEAA 5I7UA 1OVUA 1S3SA 5HZMA 1N77A 1IOZA 1NVKA 4WFKA 3UHPA 1FB5A 1FZTA 3X1ZA 2FSGA 3GJ3A 1FKAO 2QXUA 4Z7QB 5GY7A 3NATA 4WT7A 3LDHA 2UZ1A 2ZK7A 1BS3A 1TKBA 4D56A 2HSGA 2PS9A 4DMGA 5J9PC 2JWDA 1QYIA 5D7BA 3ZOZA 4JYYA 1CSEE 2WFZA 2A94A 4I1LA 4CZ2A 1ZOOA 4GYJA 4DC9A 4D9BA 3NHFA 3TKYA 1C4WA 3KVNA 3CX7A 2Z09A 2POCA 5ALHA 3I0MA 2WHXA 3GFTA 1XMVA 3FWLA 2IYUA 1Q82W 3I3SR 1RFGE 2HFEC 3CLUC 1EWVA 1OMOA 1CRZA 1ZAKA 2Q5HA 4PFJA 4HLCA 1IDSA 3H05A 2OYHC 5HFJA 2AFIA 3GEHA 2HFJA 2I91A 2FDXA 4NU8X 2Q69A 2QTOA 4N5HX 1PBTA 4I4TB 1P2UA 4KK4A 4KWHA 2AVDA 4D6TH 1CS0B 4Y9DA 1ZC3A 1NVMB 2QX6A 2J59A 3D4LA 1OLXB 1NLMA 5H7XA 4GVXA 2OZLA 4EUNA 1IZ0A 4DV7B 1V9LA 1E5WA 5DIFA 5JQGB 1NTZJ 3EFOA 4DDMA 2PH7A 3M82A 3A0HZ 1Q2XA 1IN6A 4GMKA 4BJHB 3F3SA 1HYEA 3BL6A 3QF4B 2WQ7A 1E77A 3COJA 2HA4A 2AX3A 5D5PA 1KK1A 1YB4A 4KLNA 1R6VA 3LMKA 2GUZB 3DO5A 1G9XA 5A05A 1SRRA 1THZA 1P0IA 3BN3A 2HPHA 5LR6A 1SBNE 3T3HA 3FCCA 2OYHB 3LQQA 4GX5A 3KZMA 5GONF 1N2BA 3D5TA 3HHPA 4FOOA 4N1AA 1R5LA 4RDCA 2YXHA 1NVPD 2AYZA 1V41E 1A9XA 2Z4RA 3FUVA 4WFHA 2CZQA 3EEQA 3ZX6A 1HH4A 5JTUA 5AP9A 3ZCXA 3ZWOA 2F4NA 3LW8A 2Y4OA 2BSQA 1TEHA 5FR2A 3ITKA 1QAMA 5B55A 3UWPA 2FFQA 3KEOA 5B1AC 3CE6A 4CLHA 1SQQK 3EQ8A 1G5HA 1LZKA 3JQAA 3RLIA 2P6UA 1D2RA 1OIXA 1N78A 1YS9A 3PFKA 4W4LA 3JWIA 3N0TA 4G1MB 4ZIRB 4WINA 4LOIA 3IL2A 3R0QA 3IKLA 1EFVB 3IODA 2D5IA 3GEEA 1D5AA 5CX4A 3L5KA 1GKFA 4RHUA 1KYIA 5C5IA 1HDJA 3NBAA 2IW1A 5KB3A 3BWMA 4C0WA 3KOXA 2Z5LA 2REXB 3HSYA 2GDZA 4IKOA 4KU4A 2ZT9D 4QOSA 3CCJP 2YS6A 1KZGB 1YJ8A 4QOIA 1HLDA 3V7YA 3CZ5A 3KHUA 1AHIA 4CNQA 2E9SA 1JMYA 4PLPA 3HADA 2YX1A 2IYVA 3I61A 5A3RA 4JOQA 4EIJA 1LP1A 4WOKA 3THXB 2XUFA 3KKZA 3BORA 5KHHA 1Z6YA 4QLAA 5LQAA 3UK6A 3O2JA 5BV8A 1U9IA 4X92A 3ADCA 4V0ME 2J0VA 3HKCB 1ZH6A 5B1AB 4C5AA 1Q6HA 1TRHA 2Q8NA 3BGVA 3T1YO 5BOSB 2IUYA 4M9UA 1NULA 3ZDZB 4QOEA 2RGGA 4NCNA 3EK2A 5FBZA 2YIBA 4Q9DA 1X1BA 3DEJA 3OQJA 5JDCC 2B61A 3PWZA 4KFUA 5AVXB 5I9TA 2M8RA 1UPGA 1RWMA 1JNXX 1F2UA 5FPSA 4I5SA 3BABA 4G8CA 3UB4A 2JGIA 4BP9A 4ZKPA 4LVUA 5GTIH 1CFZA 3WL3A 2G9QA 2QMZA 3VNVA 1IAQA 1LFAA 4CKBA 5GAJA 3RK3D 2Q7OE 3KR1A 2BE7A 1EFLA 5DGIA 3WGGA 2IX7C 2PT6A 1EG7A 2PZKA 1C1XA 2JKVA 3HCAA 4DQUA 1KFMA 1ENZA 1JHMA 3R65A 4Q1EA 2OVBA 4AJNA 1DQNA 1EXNA 3AH8A 3SGIA 2NZVG 2RHJA 1NG9A 4M60A 2J3EA 1U0GA 3G8DA 3NHLA 1NUPA 1K89A 3ZLBA 2H2DA 3AJEA 3WTBA 1GRQA 5CIQA 5BR7A 3K16A 2WYHA 1CUFA 3MS7A 2DE0X 2CCKA 2FXVA 3VR0A 5BN4B 1UZNA 3A0BH 3Q4GA 2WHEA 1DC7A 3NBFA 1Q81Q 5GVSA 2HRDA 4C4TA 5TQ2A 2M32A 5EP2A 3TZKA 3AEYA 4P7JA 2ZUVA 1EQ7A 2B82A 3RVQA 3P9SA 3FI9A 1OXVA 3IHTA 1JCCA 1PFVA 3WS7A 2GQ0A 3HK2A 1JIVA 4X63A 1Y3CE 1YJCA 1HNWO 3I5YA 1PHRA 2EU8A 5EE0A 1M6VA 1L0LE 2K88A 4PSDA 3TLAA 4Z4CA 1P73A 2YY7A 2FX5A 4ZOAA 5B3JC 4TLFA 1U0EA 4I1YA 3SJZA 3UT6A 5CLJA 2IGBA 2DBRA 1Y66A 3BXEA 2F1MA 1ZMOA 4UXIA 7ABPA 5ELXA 3GJRA 1BC5A 4IEFB 4DNQA 1MDFA 4PN7A 4Y6QA 4DUZO 2PT5A 2HA5A 1YJAA 3DZIA 4HH4A 3CCCA 4Q4JB 2WFLA 1JYSA 2PLFA 2A7WA 4J0FA 3T1YB 3NANA 3PT5A 4E2WA 3FNFA 4C2TA 4YGYA 5A03A 3VDQA 1VF6C 4DXHA 4LKRA 1U7PA 1DAPA 2TYSB 4F2GA 1NYHA 4G4JA 4MB0A 1YASA 3CX5E 3G2NA 1F2TA 2OHXA 1JMMA 1EVJA 1JQEA 1R6UA 4RESA 4N7JA 2D0DA 3MCTA 2HCFA 3WX0A 5FUVA 1VYTA 4LMRA 1DO0A 1VYUA 3GHGA 3PFCA 3QTLA 1V48A 1KVSA 3BEDA 3TG2A 3H1LH 2CK3D 1CKEA 3CCRP 4RYDA 2FP4A 4YP7A 4GPIB 4E5PA 4AY5A 2OBFA 1XBLA 4N9QA 1X80B 3OT1A 5BN5A 1PT9A 1ACJA 5F4BA 5CLLA 3BD7A 2H89C 4W4TA 3U13A 4FFBB 3PJDA 4N5LA 3L74J 4ZYZA 5IC4A 1A8HA 4MJXA 1Z18A 4PYRA 1TIKA 3UMBA 3Q5EA 3WGZA 3LH5A 2Q67A 3WIVA 3OJEA 2P1ZA 4NSNA 4GOOD 3I1YA 1NF9A 4B4DA 3DNMA 4J0IA 1J6UA 4EFDA 1VCOA 1SZPA 5E79E 4BO5A 3CLRD 3CJHB 3P9YA 5B1IA 3VTAA 1NR5A 5I7VA 3AILA 2ZXFA 4U0JA 5JCJD 4XBFA 4XB6B 3HSSA 1E2NA 3EA0A 3RWOA 4ILKA 3MAAC 2H3OA 2G25A 4C2AA 1Q6UA 4BUZA 1AQ6A 4JQZA 2EX1A 1P60A 3K5HA 1BDJA 3GOHA 1HNWB 1IEXA 2Y1WA 5CVDA 5BWOA 4GS5A 4UULA 5CA0F 1LCIA 3ROTA 1QLNA 1YS4A 1XTRA 2FPIA 5CN0A 2C7PA 3FAZA 5T6BA 3IVMA 2OTKE 4XGIA 3B2EA 3UGTA 3DZBA 3L1VA 4RIEA 2A0WA 3RVJA 3FB7C 4N3CA 4L8VA 2J58A 3OMWA 1EUCB 3MDSA 2ECQA 3NBZC 3THWB 5D00A 4DUZB 2C96A 3AWIA 4RMIA 1FE6A 3RTAA 4F46A 4EB3A 4NYJR 4OGGA 3KVRA 5I45A 3VHXA 2X6RA 3DFUA 1EFCA 2QRZA 1JNYA 1DARA 4JENA 3ZBPA 5JSUA 2ZI6A 1NFFA 4CDGA 4WLEA 4L22A 1H4SA 5KX5B 1LEHA 3IQGX 2Q3CA 4Z2YA 2QPTA 4BHTA 1H42A 3TCNA 1DRKA 3TL6A 4F60A 3PXCX 3BHIA 1T0IA 3DTUB 3AEUB 3FPAA 1NJ8A 1PL5A 1O4WA 1RXWA 2GYWA 4MYTA 4LSZA 4HDRA 3BA1A 2HRZA 2J3HA 1KH1A 2B8EA 5FO0A 3L5OA 1GSIA 1G63A 1N0VC 2DLDA 1YYCA 2I1KA 1FMTA 5DW3A 3E8BA 4FFPA 3HU2A 1P3JA 1Q43A 5FTLA 1ZU4A 1PEYA 3GLUA 1S3GA 1QE3A 2HZBA 3MBOA 1QRAA 1L7VC 1DTOA 2QP9X 5IDYA 1N2ZA 3RROA 1QM5A 1OZFA 3E7FA 2CSXA 2VRBA 2YYYA 3EIUA 4HUQA 1DC8A 4KL8S 3KIPA 5CBPB 1ZJ6A 4XRGA 3G0DA 1UPXA 5AHOA 3QY9A 5IT0A 4UM5A 1JECA 1E6KA 3SIRA 4TMKA 4MW3A 3JZAA 4CCSA 3ZMVA 3ULKA 5DI3B 2A06H 4JYBA 2OBYA 3BAFA 4B33A 2QVZX 4M38A 5AKKA 1M6NA 5AJTA 5L6LB 2O52A 3A1SA 5L3CA 2H57A 2YV4A 3ESDA 2W2LD 4K3UA 2RGUA 1EM8B 2GTHA 4G0WA 3C3MA 5L3ZA 1W49A 1J99A 1KTIA 1TZKA 2NV2B 4DR2O 1BGYG 2FFHA 1WHSB 4RTNA 1H89A 4JASA 1DJNA 3DAOA 1KUQA 1G2PA 1GRRA 3F5SA 2WE8A 1M2OA 1M7BA 4Q21A 3WWPA 3UY4A 2HSJA 1Y63A 3O9VA 3VMAA 4CR7A 3FFWA 3A04A 1MOFA 2ZCUA 3FGOA 5I7SA 1Q1EA 1Q1BA 4C08A 1OXKB 2EGGA 1A5AB 2WG0A 3S2SA 1AZTA 3DMNA 3H0CA 1UJNA 1PNRA 3V1LA 3T7RA 4MVJH 4G0XA 4GWKA 3QEKA 3OPQA 2OXEA 3WMRA 4JPRA 4X1IA 1XX6A 5L3SB 4NJMA 2ZWPA 1PFUA 3WKCA 4UNPA 1JQLB 3CRVA 5AT1A 2QUKA 3KDAA 4JLBA 4Q1CA 1A69A 1P9OA 4HXGA 2YRXA 3BQ9A 5JJBA 3UJ8A 4B9EA 1RCTE 3TPFA 3EA4A 4WCDA 5HYVA 2N1BA 1V2GA 5DK4A 3I45A 3WA7A 3HCCA 1JWAB 1R73A 3WGYA 1QTQA 4OUDB 4CU5A 2M3BA 4FM0A 3Q12A 1Y1LA 3AG4C 3OFND 3V46A 4HX2A 1OV9A 4IX9A 1SWVA 3LECA 4NPEA 3H86A 3MGAA 1G4AE 4KAFA 3L4BA 4UD6A 3UK7A 1NF3A 5BMVB 3T99A 3X2FA 1JMKC 1G4YB 3ITDA 2X9QA 1M56C 1LF5A 2AG0A 3BERA 2DTXA 1OGYA 1NVEA 5KWIA 2JFVA 4DSTA 3KTAB 3EA5A 4PFQA 4JEIA 4YMIA 2Z56A 1P6XA 3CX5F 4DG5A 3AERB 4EPRA 4FNMA 1KOJA 2QUAA 3KVYA 1ZWKA 3WYEA 4FFNA 3FMPB 5EI5A 1L8QA 3OTHA 3VOAA 1CVIA 2PUTA 1VCMA 2BM8A 2WYOA 3QW4B 2YO3A 4MDHA 1MTZA 3MJCA 1BIFA 5LL6P 1T3GA 3LPAA 1FFAA 2VRCA 1GCOA 1LSSA 2OCDA 2BCCE 1I4TD 3I01M 4G4SP 1Q5PA 2R6R1 3UEOA 4CC6A 3E7PA 5FCDA 2Q5CA 1Y48E 8ADHA 1E3JA 2V55B 2IPNA 3N5KA 3MTAA 4TVSA 3VR4A 3D4NA 2KB1A 1IL0A 2KYRA 3R0XA 1RRMA 5J2UA 5CCHA 1QIGA 4M9SA 4QNHB 1M4UA 3AG4B 3H1BA 3C8MA 3VZCA 2UVPB 3BB4A 2X5KO 4KODA 4KR0A 4Y67A 5KSYA 1TGVA 3G0HA 1YQ9A 3GPIA 3M6UA 1M56B 4DR2B 2QSAA 3ZE6A 1E62A 4ZI7A 2I1VB 1QWOA 5EA2A 2QUJA 3L72H 1H88A 1TECE 3U81A 5DYNA 1QS0B 4OBWA 5A3JA 3H17A 3FH0A 3MCWA 2C2KA 5AI6A 5EMLA 2YZNA 4EA9A 1GRNA 4DYDA 4Q1FA 2PRIA 1PFKA 6REQA 1VQNV 2VSFA 3UMCA 2DOSA 5LXTF 2RB5A 3DDHA 5JEDA 2DU8A 2CHVA 3THOA 5BR4A 2W6IG 2WMYA 1R0YA 3INGA 4NBTA 3T7SA 3WUVA 5DEIA 3RU3A 4IFFA 3VPAA 1SQQJ 4LBWA 4QKQA 4Y2YA 5CJ4A 5H9CA 1X7YB 1XCMA 4P32A 4IV0A 3U5TA 5E95A 4ZCQA 3T34A 3VZRA 5JD5A 2AQ8A 1CB0A 4GM1A 3VMYA 4PZAA 1NH4A 3I62A 1RWWA 3SVZA 1S5LZ 2NUAA 3HE3A 4DREA 5MFPA 3IAYA 3OE7D 4K9SA 4UEJA 3B8NA 2Q7GA 4QGAA 1RY3A 2K6GA 3ELDA 5EHQA 1GFIA 3L01A 3KZIH 3NFYA 2HLHA 3PHBE 2AC4A 1L4AD 4MPTA 3R20A 3C8DA 1JLLA 3LQFA 3H25A 4GC9A 5ALMA 4LDRA 5FL7G 5TY0A 2F43A 4IIBA 5BRJA 1JJIA 5JG7A 3UMMA 1HDGO 1RQLA 4JJEA 2A2ZA 2G9RA 2H2AA 5KLVE 3HE5B 2HQSA 1VQ5P 3DKPA 4DDVA 2QVLA 1XD2A 4FDLA 4IVRA 2E49A 3ASNC 4X9QA 2IEGA 3R75A 3BA9A 2WMMA 4P53A 1HC7A 1JKIA 2B1RA 2H18A 4YLYA 3V4WA 5IXJA 2I65A 3M7IA 4LXQA 3AK1A 3ROXA 1DHTA 1K6IA 1UKYA 3HB0A 3O73A 4RVFA 2QLJA 2KS6A 4D81A 3S9OA 3LNMB 3WLMA 3MBKA 2XXBA 2ZYGA 1HEYA 1RBYA 5HMLA 4D4GA 3WC4A 3OPYA 2DUJA 4D6XA 3MIIA 3LHKA 5K3BA 1LUAA 4P08A 2FEXA 3AUFA 4BLOA 1SQBD 1AJNA 4JMLA 1PDOA 1SC9A 5EBLC 1NONA 1C30B 4KI0A 4X24A 1XXHE 4FDVA 2R1TB 1PT5A 4YXFA 2QA5A 5IMBA 5ENDA 1L7BA 4BN0A 1HM5A 2P2YA 5JJCA 5FTWA 3KB8A 3REQB 4JOCA 4ER5A 3N05A 4C7OA 1YZLA 2FYUD 4OHYA 2CE2X 4G1FA 4UBMA 4J3FA 3S2GA 3OETA 1GL7A 1WCIA 4X45A 2UYQA 2NMVA 1UBHS 3ASNB 2YIMA 1ZAUA 4Z0HO 4Y99C 4OV6B 2WUEA 1QP8A 2R8EA 3A1VA 4BYMA 1JDJA 1G64A 3WJAA 2Z43A 1P44A 2PS3A 4HDSB 1XMQO 4AJIA 3E61A 5GONB 3EVTA 1VCIA 1Q7YQ 5AM2A 1Y42X 4K1LA 1E7MA 4M0EA 1H85A 1BAPA 1MXHA 3VO8A 1V1MB 3AHFA 3IDFA 3U1CA 5APXA 2XNJA 4GI7A 1JHPA 3T54A 3A36A 4D9GA 3BVOA 2GO1A 1DLBA 2AN5A 3AKZA 2ID7A 1N6IA 3RVKA 3WIOA 3NHWA 1VQ7V 1QLJA 5JI3E 5BNTA 2QVBA 3IFSA 3UYKA 2ANBA 1L4LA 2NO6A 1E89A 1N2CE 2WPDD 2QYTA 3BZUA 4NY1A 1T36A 3UHFA 4I4TF 1ABFA 3E3MA 4DNOA 3A5TA 1POXA 3DC7A 4C9BA 1Z7BA 1X19A 1RI4A 4F1JA 1Y9AA 1AROP 2RI0A 2ZATA 3G1WA 3FOFC 2R6JA 3GLIE 3ZRSA 2Q3LA 3HJCA 5C8YF 1TMGE 4EIWA 1KB9E 2ZI4A 4RULA 3NEJA 5E8JA 2NT3A 4RK5A 3FLMA 2G9UA 3NUGA 5B6JA 2K2WA 1HG1A 4LF6O 3G0BA 5DDIP 3FW1A 2RH5A 4IJWA 4BFLA 4DO2A 4CYMA 4O4LB 5AXDA 4N18A 8GPBA 3HN2A 1HE8B 4QUAA 3V8RA 2EARA 1S2IA 2PGNA 1SQVG 2ZUDA 3JCUZ 4PN3A 2W4MA 4YO8A 5EIBD 4GVPA 3RYIB 3CB4A 2C3PA 5J4VA 2XHEA 4N7BA 1C9DB 1QIFA 1UQTA 2H31A 4E22A 2GZMA 1S2DA 2KKWA 1XJ0A 5JMOA 2GLTA 2EIJC 3MRSA 4CETA 1CUDA 2EFEB 2IWRA 1NS1A 2YOHA 1GOTA 4KUMA 2C3YA 3CUWA 3VVBA 1G16A 1KYQA 2GHQA 4KUGA 2QU8A 2ISCA 1QOZA 4HLQB 1F3OA 4C0HA 3ZCVA 3U1AA 1CHDA 1SBTA 4O0LA 4L73A 4PO3X 2OCHA 2EP8A 1T0JB 3G85A 3NRBA 3DZHA 1DTEA 1XMQB 3F4BA 3B85A 3ADPA 3SD7A 4HSEA 2Y9YA 1SC3A 5DGCA 1KYWA 3AF2A 4GLBA 3KTFA 3I0ZA 1JXMA 3MRXA 4ZV9A 1ZOSA 4LYGA 4U8HA 3B6IA 3RS9A 1ZVJA 3P9QA 4MV6A 3C1UA 3QTCA 5A06A 3R8XA 4GSKA 3GPDG 2QWQB 4PAGA 5CCGC 1IIRA 1MIOA 2RI6A 2WP0A 5EJ9A 3OJLA 1ZZGA 1CUHA 2PTGA 4N8SA 4LE1A 3FI0A 4K6HA 2ZT9C 1QU7A 2O1EA 4HBZA 2PH3A 1XI2A 2EIJB 1HEIA 1ZICA 4JDPA 1ZMRA 2QE6A 3T1TA 1D6SA 2Q21A 4EJSA 2DF8A 3QX7A 5G1NA 3R0JA 4B87A 3I2FA 2G0AA 1Z5GA 3Q9LA 1ZM3A 2FJPA 3WHLA 3ZH9B 3EISA 4QC2A 3CLSC 1OCRB 4PI0A 3HDJA 2RAVA 1UDWA 3BIFA 2AFVA 3TSCA 5AI8A 4ACBA 4X1YA 3S8MA 3RFXA 1PIXA 2Q4EA 2QD1A 1AA0A 1BDHA 1YBAA 4MP3A 3SC6A 1M57D 1BJTA 1UIMA 1YI2V