4LC1A

Meab, a bacterial homolog of mmaa, bound to gdp and crystallized in the presence of gdp and [alf4]-
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
326
structure length
315
Chain Sequence
TLPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylmalonyl-CoA mutase accessory protein
publication title Autoinhibition and Signaling by the Switch II Motif in the G-protein Chaperone of a Radical B12 Enzyme.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
total genus 122
structure length 315
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4lc1A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4lc1A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lc1A02
3Q5DA 4DB4A 2O0KA 3UK6A 1L2TA 1QHGA 2BMDA 2QY9A 4L15A 3LVQE 1XJ0A 4OQXA 5CM8B 1Z5ZA 2VHJA 1HT2E 1VYVA 4HLCA 3SE0A 4Q4LA 1U9IC 3PXGA 3HYTA 1XEFA 2ZUDA 3VTPC 3T97A 2X2EA 3F5FA 4A6XA 4LDJA 1R5NA 3K9GA 3SU8A 3EWSA 3LV8A 1ZM4A 4CYMA 2JLZA 4ACBA 2DFTA 3MG9A 1GDDA 3QF4B 4GMDA 2C99A 1ZNXA 2FE4A 2KSQA 2PX3A 3BERA 1MR3F 3V4RA 3AVWA 2N1BA 4RVCA 1W36D 5EXPA 1KSJA 2WICA 3NHBA 4B6FA 2JLXA 1E9FA 3ZRWB 2ZI6A 4M22A 4ZIRB 1KI8A 2W6ID 4RZ3A 2ZJZA 3ICQB 5JMTA 3W34A 2I1QA 1XXHE 1GILA 3KJEA 3CNOA 1YR6A 4W5HA 2G0TA 3IR9A 3L0PA 5ANRB 3LD9A 1OFUX 1WRBA 5E4FA 3GLHB 1Z3IX 4OBEA 4EAQA 2Q0HA 2BDTA 2IUTA 2V6IA 1GWNA 2BMFA 1CTQA 2CXXA 4DLUA 5FPSA 3NBFA 4KSBA 1HT1E 2ZVQX 5FBQB 1CP2A 4BIZA 4JAUA 1X8KA 2RGXA 3VR4A 2X19A 3BE4A 3EIQA 3HU1A 5JLJA 3J81k 3P27A 2GA8A 4AYWA 5CIQA 1W2HA 3VYIA 1CJKC 1M1YE 2PT7A 3CWQA 2R6GA 4DVGA 1MO6A 2C2AA 1XP8A 3RSLA 4QM6A 2CK3A 4BEBA 1IXZA 2J0UB 3AKEA 3B13B 4PXAA 4ESVA 2HYIC 4Q21A 3LXRA 2WTUA 3AEZA 4NZYA 3AP3A 4LSGA 3OAKA 5APQA 3I92A 5K8UA 5DO9A 3THXA 1M74A 2JDIA 4Q1DA 5KNBA 1XMIA 3PIRA 4NYMR 3SHFA 3TRFA 2B8WA 1U8AA 4TT3D 4UNSA 2F3TA 4XVRA 4DLTA 1Z0IA 1P9WA 2VTKA 5AW9B 4D81A 1LV7A 2IW3A 1SXJC 2P2LA 2W2VA 4YMVA 1VHTA 1G3MA 5AR1A 3TQFA 3VAAA 5KDOA 1HY3A 4C9BA 5L8VA 2EWVA 1FMLA 2SHKA 3A1VA 4BLTA 4NYJQ 3B2EA 3B9QA 4M1WA 3VFDA 3D7MA 3SFZA 121PA 4XWOA 3IBGA 4B3XA 3PITA 3EXAA 3RYTC 3AVQA 3RS0A 3QG1A 1S8FA 2HXSA 1EESA 2O8FA 2Q9AA 2ZSBA 4A8JC 4US2R 4WW0A 5JSZA 4D82A 2CLSA 4RCZA 5J4YA 1C4OA 3RHFA 4M2LA 4C4PA 1UDWA 2QA5A 3EASA 4DDVA 1J90A 3TK1A 3FMOB 1N6HA 2ZR7A 3V9PA 1UFQA 1UEIA 1UEJA 2J9RA 4HYYA 2J3EA 2GEVA 2ECKA 2NO7A 1Z0JA 2AWNA 2IHBA 1ZNWA 4DLYA 2YNMA 2D2FA 2OHFA 1DVRA 2ZRPA 4HAWA 4G5SA 3VNVA 5BYJA 2ZAOA 1KJYA 2YV5A 4DLWA 2ZE5A 1ZMXA 3R9XA 4P3YA 1F60A 2Z6VA 4P4SB 1C1YA 1II8A 4RESB 1Q44A 1ELOA 3CF2A 2RGCA 3HYRA 3PQCA 4LV6A 2ZUCA 4NMMA 2HUPA 3WY9A 3QG5A 1BS1A 1CR1A 1P2VA 2XSZA 2Z4RA 3ZH9B 4KHXA 1ZIOA 4DDWA 4C30A 5EXTA 5AW5B 1K6MA 2J59A 2WPRA 2W2TA 4C2UA 3NH9A 3C7KA 4XIGS 2DHRA 4MRRA 4NBSA 2ZUBA 3OF5A 3T15A 1U8ZA 4MKGA 3AUXA 5GVRA 5B57C 4GP7A 4QOSA 1XEXB 1NLFA 1PJRA 4B34A 1FNMA 1SHKA 1SVSA 1UJ2A 2O0JA 1YHNA 2GEUA 4Z54A 2HDNB 5CDFE 1U0JA 3SDZA 3VKGA 1TQ4A 1YJ5A 2Z43A 3ZQ6A 4PPNA 2CLDX 4PQRA 3TAUA 2ZI5A 2GBLC 5J4KA 2WT7A 5AVUB 2OM2A 2IWRA 1D9ZA 2E42A 2R2AA 4HB3A 1T5LA 2QORA 2AD5A 2IXFA 2RGAA 1C9KA 4Q4AB 1G5PA 2IYVA 1Q3HA 1UBFA 3IHLA 3BB3A 1KAOA 1ZNZA 4BASA 1G3UA 2OXCA 2ZROA 3QENA 1G18A 3IPYA 4KCGA 3WRYC 4AG5A 2P0EA 1NMZA 3K9LA 1L4YA 2NZ8A 3A4LA 4B6EA 2JCSA 2D06A 1UKYA 3UPUA 1NNEA 3C8UA 2LFRA 4OK6A 2XNDA 3PUWA 4EDHA 2ZYWX 2CL7X 4IXMA 1RRCA 2PLFA 3WMGA 2BEJA 2R32A 2RGNC 1XCPA 1ZCAA 1XTQA 1QHSA 1PLKA 4M0LA 3KXIA 2W2XA 5FBRB 4C0JA 3S1AA 5FTMA 3TUJC 2CDNA 1SLQA 1NKSA 3BGWA 2X8AA 1CS4C 2XEXA 3N5CA 5FOWA 721PA 1ZC3A 1MV5A 2C9YA 4QJ4A 5DHFA 4GRAA 1G6HA 5B2ZA 4B33A 1P4SA 1WB9A 3W3AA 3I3SR 4S35A 1GFIA 5AVXB 4F4JA 1W46A 1SULA 1T2KC 5AVZB 3FHCB 3K0CA 5APUA 3WNDA 1DAKA 2D74A 3HE5B 4WZ6A 2IYZA 3HE4B 3C5HA 3A5TA 3A36A 1KY2A 2RMKA 1OIXA 1FX0B 2H8KA 4TQ9A 2QAGA 2ZI9A 4H1VA 1NSFA 3DM5A 1G64A 3M0AA 3CO5A 1P3JA 2ATVA 2HV8A 1P9NA 5CJ2A 4Q9LA 5APSA 4V02A 4B32A 1NVVQ 3LBIA 1AA9A 3DZDA 1KNQA 3QI2A 3D8BA 4L8GA 4RKFA 4KITB 1JQJC 2PJZA 1IBRA 2IYLD 5E95A 3RAPR 2P67A 1GTWA 3EZ9A 2GWHA 5FUXA 1GP2A 3EA0A 2HEIA 4TZ0A 5FUWA 2RHDA 1E0KA 2CLCX 4V0MA 3BB1A 1MRSA 1DPFA 1ODFA 4PZLA 2IEYA 1NVWQ 1S0UA 3CZPA 5JEEA 3KQKA 2RKOA 3K0FB 3MGCA 3LWNA 1MV8A 3FKSA 2JDID 1IN7A 4FMCF 3W5JA 3K70D 1E9RA 1E9BA 3BS4A 4LK2A 1MFZA 4RY2A 1F3OA 3CZQA 3B8HA 2CEAA 4M3LA 4AG6A 2ODNA 2B8TA 4KFSA 2ZYUX 1NJGA 3PVSA 2IK8A 4PAOA 4GSYA 2HLDA 1AS0A 2QNRA 4WZAE 2QL6A 1P2UA 2DYKA 2ZSDA 3E5HA 4QNRA 1CSBA 5GJWC 4BPBA 4EFLA 2BWJA 2Y8EA 3QF7A 4RD3A 2NG1A 2J0VA 4B35A 3WBJA 3LH5A 3U6KA 4MUBA 5JECA 1Y63A 5KO2A 3NC1C 3NFQA 2VSXA 2W6JA 2WJVA 4M9XA 4PHTA 1VYTA 5HE8A 1KDRA 2R8RA 2D7DA 4D6PA 4DDUA 2ZRKA 3I62A 2O8DB 3RWOA 1TUEA 3X1WA 1PZNA 3FOZA 4HLUC 2BVNA 1SXJB 1TL7C 4GOKA 3CX7A 1KSFX 1S4QA 1Q22A 4LPSA 4NYJR 1HQYE 4CZ2A 4FMBB 4IDOA 3CRQA 3N70A 5CLQA 1XD2B 4IJMA 4NU0A 1FFHA 2OO7A 2PH1A 5APYA 3TMKA 1SVIA 1TAGA 3MJRA 4Q01A 2RB4A 1CBUA 1IHUA 1NRJB 2H5EA 3D6TB 3BFVA 4B86A 2VP2A 1S1CA 4LZZA 4US1R 3NTUA 3ZS8A 4RZ2A 3HR8A 5J47A 1E0AA 3A0RA 1IO4A 3NH6A 1JECA 4TL9A 4HAXA 1N5KA 4UQOA 4A8JB 4EQ6A 3KKPA 2XZPA 1VG0B 2AXNA 3ICEA 4D4JA 3OEHD 1DARA 2WIBA 3K09A 3NBXX 1KOFA 4A6PA 1KDPA 3CBQA 2XZOA 3Q3JB 4W5WA 4URZR 1Z28A 2AFHE 4M9QA 4LBYA 4PZZA 2IS1A 2XSZD 1KDOA 4Z8YA 1CJUC 1R7RA 3KUDA 4QBGB 2QZ4A 4A0GA 5B1NA 4F93B 1G4UR 1OWAA 2JLWA 1T5IA 4BLPA 1OFTA 4MYCA 4JJZA 1COWD 3BJIC 4PO1A 3OE7A 3ZVRA 4V0OA 1G3QA 2QEQA 5FUYA 3GLFA 2QPOA 5JHGB 5TDHA 2QTHA 3N2EA 4FD2A 4IFBA 1JJVA 3A2AA 4ASUA 4BLOA 3KXLA 4Q7MB 4MDEA 3HP1A 1OT3A 4G3XA 1DAIA 2W83A 1CJVC 4PFSA 1Z63A 3NDBB 4BGDA 2WVJA 4JYBA 3P26A 4UXJA 4PAQA 2ZFCA 3B9PA 4QGGA 1W49A 2C5LA 1Q57A 4HZIA 2NGRA 4UNRA 5IK2A 3V4WA 2P6NA 2FV8A 1SZPA 4RZXA 3U3JA 1JI0A 2FSGA 1U98A 3P7KA 4M9SA 1E2IA 3BH6A 3SYNA 4AK9A 1N6IA 2GZAA 4Q9HA 2FEOA 2P65A 4A4DA 2ODEA 3TW4A 1N5IA 1XXHA 1T8TA 3HPQA 1UBCA 4L5BA 4OI1A 3VU9A 3ZQJA 3ZJYA 1VCOA 2C96A 1U90A 2AK2A 4ZDWA 4B3CA 2ZRNA 3AKYA 1VG1A 4JIMA 3QJYA 1GRNA 2QTFA 5AVWB 4URWR 4TTRA 1FPMA 4ACAA 1BO6A 2ANCA 2GJ8A 2IS6A 3QIAA 1A02J 2IS2A 3A1SA 4NTZA 4ARZA 3OIVA 2HCJB 4QPKA 1XJQA 3TKLA 5JWOA 2B7CA 4KXFB 4P33A 1GTVA 2QROA 2QBYA 3GJ6A 3CKLA 4BFUA 2F43A 4D2IA 8OHMA 3SBEA 3MSXA 2B92A 2DR3A 4RFSA 2ZI3A 4DSOA 1OYWA 1XTJA 4KBFA 4DIEA 5BN5A 5IT5A 2ZRBA 4TL8A 1X8JA 4E5UA 4L9SA 1J2JB 2A5DA 5FR2A 5AW0B 3WBKA 3KB1A 5EUQB 1TPZA 1CI6A 3MMPA 1KK2A 3BFKA 3IIMA 1TF7A 3LQQA 2RGGA 1SHZA 3VMZA 1AKYA 5H70A 4R71A 2RH5A 4MRVA 1MABA 4IRUB 3C15C 3H4MA 2PZFA 5TMPA 4C7OB 2ZJ5A 2ZSFA 4MRPA 3UWOA 2J46A 2WJJA 4UJ5A 1AGPA 2IYUA 4TSFA 1DH3A 3SYKA 4EPTA 1DE0A 5JCPA 4V0NA 4XH9B 5LB2A 4PHHA 4DKXA 3AVXA 2J41A 4P31A 1ZD1A 2YINC 2YVUA 3BBPA 2WJIA 3DMNA 4MGZR 4YDHB 3UATA 3VQTA 2C78A 4NCKA 4PC2A 3RS3A 1R0WA 4EJSA 3THOA 3SJBA 4D4MA 4E22A 1J7KA 3QF4A 5EP1A 4B48A 1JEEA 2QT0A 4CRWB 1QZXA 1YR9A 1G7CA 2UVQA 3RS5A 3GLIB 2GXAA 4TT3A 4BIUA 1S3GA 1LB1B 2QPTA 4JVMA 2OEPA 1DAFA 3DPUA 1A4RA 2FH5B 1T8UA 1GU4A 4HYTB 3B6EA 4DCNA 4JMPA 2ZSEA 4M1SA 2WSSD 4MT8A 3VR5A 3CF6R 3O8CA 3HPRA 4M53A 1SGWA 4JKIA 2UZIR 3QKSA 2DCUA 4UXHA 4V0ME 3VX4A 1FOSE 3GLHA 1F5NA 3HDTA 3FHOA 3QBVA 4FW9A 3AB3A 1XDBA 5FI0B 5H8WA 4I5SA 5AUQA 2A3RA 2H17A 1Q12A 4POAA 2G1JA 1OYYA 3THYB 1UAAA 3W8RA 1EFHA 3IO3A 2VH5R 4Q20A 4GBMA 3Q85A 4XTRA 4I6MC 2JLRA 1AIPA 4FINA 3B78A 4NHOA 3QVUA 4NPHA 1NP6A 2QAJA 2QGNA 4PC6A 3LRPA 4Q1BA 5L3VA 3DEFA 1NG1A 5KHOC 3ZRXA 2WJYA 3C41J 1GNRA 3ETLA 3KTAB 3PENA 4OQLA 4IVQA 3ADCA 4URVR 2F55A 4JASA 4XE5B 2VHQA 1KAGA 2OESA 2JA1A 1AS3A 1N2CE 1Z0FA 4PANA 2GF0A 3QKTA 3TE6A 2ANBA 4G0NA 5AVQB 1GRRA 3NBZC 3UG7A 2MMCA 4QFMA 1TMKA 2OG2A 1CR0A 1RZ3A 1XEWY 3QXXA 3GD7A 2FF7A 4LYJA 5K8TA 3MWYW 1OV4A 3T1QA 2GILA 2PBRA 4BUJA 3UKDA 3UIEA 1G9XA 3EWAA 3FTQA 5AW4B 3GJ4A 3QXCA 4M8NE 3SR0A 4JSTA 1VTKA 4BFVA 5GADl 3KJIA 3NG1A 1J99A 3NHAA 1LF5A 4F91B 2IC5A 2Q3HA 2ZJ2A 1OE0A 1P2TA 3CX6A 4RCYA 2BMJA 2ZTSA 4E07A 3A6PC 1SVOA 1LNZA 2WV9A 3KDSE 1WF3A 4QHTA 5JWRA 3EPJA 2QU8A 4G5RA 3GEHA 3NMDA 3LBNA 2R6FA 3LXXA 1FTSA 4JVSB 4KHZA 5DYGA 5AW3B 4HLDA 2GCOB 3EIHA 5EUMA 5E7MA 3OE7D 1EFUA 5J4LA 5DLQC 4LPKA 2KI5A 2Z5HA 2W6AA 1LVGA 3RRZA 3WP0A 4EPWA 4X8MA 2OCAA 2ZU6A 4JT4A 4Q18A 1P72A 3QOFA 1N5JA 3L35A 2J87A 3CIOA 3ZVLA 3GQBA 4JKYA 4AKIA 3ZGXA 2F7SA 2IPPA 1G7RA 4I1OA 4DWJA 2R44A 1Z0KA 3T1TA 3ADDA 2QRNA 3IKJA 5C2JB 3P32A 3QEOA 3FGNA 1XTRA 1LS6A 2WWYA 5TB5A 1HV8A 2XGJA 2Z5IA 1W4CA 2GEDA 2IYRA 1JQLB 4OK3A 1CR2A 1SVLA 4IDPA 4KBGA 2REXB 2JLUA 5AVSB 1PUJA 2VHUA 2OSBA 4EOTA 4QG7A 4O2RA 4YQFA 1TEVA 4TMTA 1VKJA 4NP6A 1IN5A 3GLFE 3L8YA 4OJQA 1UKVY 2XNSA 2CE7A 4P4SA 2UZ3A 3AF4A 2FWRA 4B44A 5AW6B 2FPMA 3BRWD 3KJHA 5CIWA 4JBYA 3NWJA 2IS4A 1JXOA 2AL7A 3G82C 4FMCB 4OI0A 2OLJA 2I4IA 4P32A 5HZHA 2VSOA 4EFNA 1E0SA 1JJ7A 1E2FA 4Q4JB 4B2IA 1OKKD 2BM1A 5APVA 1D2EA 3E70C 4HLQB 4L9WA 5L3QB 1DAHA 1ZYUA 4EIWA 3EC1A 5EXSA 4ABYA 1DBSA 1H8AA 5FOSA 1KMHB 1E2KA 3UANA 5JS7A 4N0DA 2EW1A 1IAQA 1U2RA 1KI6B 3H0KA 3OESA 4DC9A 1Z2CA 2GDJA 1E3MA 1GKUB 5HPYB 2CCKA 4YMUA 3M9HA 5HTKA 1Z06A 2EVWX 4AKHA 1L7VC 4Q19A 1LF0A 4GOJA 4X8HA 3SQXA 5EE5B 3H1TA 4U5XA 3LLMA 2IHYA 4IDNA 5H68A 2ZJAA 3SYLA 1QHNA 1WBDA 4JBWA 3PUYA 3KKMA 1M7GA 2EFGA 1N6KA 4BZPA 1IY0A 1VECA 3BH7A 4LYHA 4AKEA 3T06B 3LAWA 1G6OA 1ZRHA 3LLUA 3LW8A 2WKPA 3SZRA 3SJAA 3ZDQA 4CEIB 1FAVA 1R8QA 4HSEA 4R9UC 1W5TA 4HUQB 3BFXA 4D80A 5DN6A 1N0WA 4RJLA 1SKYE 1GKYA 1A2BA 4B43A 3R8FA 2WMNB 1FUKA 1JR3D 3I73A 4HAUA 4TSFD 1E9CA 4H1UA 1MRNA 1U0HC 4ZCLA 3O47A 4CVNA 1NAFA 5FOTA 1CJTC 2AXPA 4NCJA 3ADBA 4K8OA 4B2PA 3O8ZA 4AY2A 3HU2A 3VKHA 4KV9A 3JVUA 1Z2AA 2BJWA 1P62B 4AKGA 4Q47A 1XZPA 1TQ2A 4FI3C 4F92B 4AI6A 2P2UA 1G16A 4WZBE 4ZV4A 3TH5A 1U99A 1GK6A 4M1YA 2XXAB 1ZU4A 2VSFA 5EE9A 1GAJA 4C0QC 3T1OA 2EFDB 5D3MB 4XTCS 1JAHA 1SQ5A 3HE5A 2DFKB 2ONKA 5DH9A 2YOFA 4FMDF 2OAQ1 1FX0A 2VPPA 1U9IA 4MRNA 3U4QB 1SVMA 1A5TA 5FR1A 1OH5A 1KO5A 1GU5A 2W0MA 2ZJOA 3ZZTA 2BBSA 4JBXA 5TXGA 2ZITA 1FOSF 3GJXC 3TNUB 1E99A 2A5YB 3BXZA 1QBKC 1XPOA 3T1VA 3KQGA 1KI2A 5AVYB 2GESA 3A4MA 1P60A 4Q4HB 2AHOA 4BZQA 3SS8A 3KB2A 4LYAA 3UMRA 3DHWC 5JJLA 1NY5A 2LFSA 1ZD8A 3LW7A 2H57A 3W3ZB 4JSYA 1I4LD 1OB2A 1H8HD 4KVGA 5CK4A 2ZS7A 3CM0A 1FP7A 2G3YA 4BFWA 5KYKA 1W7AA 4IOJA 4I1UA 1S9DA 5CYPA 3HWSA 1UKZA 3AQ4A 3FB4A 3GEEA 3K0FA 2FSFA 1KI4A 2GVZC 3GLHE 5LB4A 4TYWA 4HEJA 2ZJBA 2Q9BA 2KBFA 5DIFA 5JRZA 2CHQA 3SI7A 2GJSA 4AYXA 4J0QA 3A3YB 3GP8A 1Z6XA 2PMKA 3OEHA 4P4UA 3WHLA 1BYUA 1TADA 4LGMA 3I32A 3SHWA 3VTKA 3CF0A 3R20A 4AYCA 4DBLC 1P75A 3MRSA 1HE8B 2Z4SA 2MSCB 4X8LA 4RKEA 3TW8B 3U7EB 1KK1A 2F3RA 4F4IA 1YZLA 1HJBA 2XTZA 1DS6A 3ND8A 4MKFA 2IYTA 3SNHA 3K0CC 4HAVA 1JAIA 1AZSC 1LY1A 3GMTA 1COWA 1US8B 5CB8A 4CEHB 4GDFA 1HURA 2OFXA 2JASA 2QAGC 3TSWA 1OSNA 3MUFA 1W48A 4JLDA 2VP0A 3QXJA 4B3FX 621PA 1HBWA 1KJWA 3NDPA 1KGDA 3QNUA 1Z0AA 4OL0A 4UNNA 5CM9C 1F2UB 3IBYA 1K5GA 3CNLA 3T5GA 4DLVA 1YZKA 3EARA 4BRUA 3UIAA 2OBNA 1SXJA 4H9GA 2JIZA 2ZRMA 5B1OA 2F1JA 4LHXA 1JPNA 1Z22A 3KDPB 3M0DA 3Q8XB 421PA 1XD2A 4A9AA 2F9MA 2BIFA 3Q72A 4RD2A 2FGKA 5DNYB 2D62A 2O8CB 1NMYA 3EPKA 2GJKA 3QKRA 1II0A 2NO9A 3A4NA 2W27A 2PCJA 2ERYA 4TN1A 5C4MA 2O8EB 1IY2A 1VHLA 1NJFA 2VP5A 2QQEA 4JLOA 2ZJ8A 1VIAA 4YXWD 5G3ZA 3TIFA 5CB6A 3U44A 3AM1A 1E98A 1GVNB 2VEDA 2BKEA 2ZVPX 3LDAA 2C95A 5CK5A 4MGYR 1XBTA 4A8JA 2VHTA 2GHIA 3REFA 4HB4A 2H92A 5G40A 3QXHA 1E0JA 3TUZC 1MO5A 1E9AA 1OW3B 1BYIA 2ZRAA 3MGNA 2ORIA 2PL3A 3PJRA 2QUZA 4ZCIA 3Q5EA 5AJWA 2NPFA 2Q5UA 2GXSA 4UNQA 4TYNA 1D9XA 4MYUA 3EPHA 1N25A 4MKHA 4WIAA 3WRXC 2V9PA 3B1VA 1EFRA 4JL6A 2G88A 3IQWA 5GJVC 5DI3A 3AVTA 1AKEA 1E96A 2D7CA 3AVPA 3ZD6A 3AUYA 3BC1A 4ZKDA 1XTKA 3FDIA 2C04A 4YMSA 1JEDA 1ZM3A 3OAAA 4LC0A 2WM9B 4I1SA 3RRMA 2WWGA 4HZUA 2NPIA 2GXUA 4JS0A 1OIWA 3QPUA 1NKTA 1OH6A 5KOYA 2YOHA 3ZIAD 3MJHA 3PUZA 2WAXA 4DCSA 5L3SB 1NN3A 4JYCA 1IXSB 2BHRA 4OK5A 2C9NY 1U8YA 1S9HA 4C2TA 3AVVA 3CRW1 1IJFA 1NN1A 4GZMA 4AQRD 221PA 4GMXA 1Q1QA 1W47A 3TR5A 3OEED 2ZR0A 5EP2A 2IUSA 2R65A 4TLEA 3KQHA 4Q5IA 4HDOB 2FTKA 2C9CA 4LWZA 3VR3A 4DB2A 5JCZA 1ZUNB 5DN6D 521PA 6Q21A 3A1WA 5FOVA 3UMFA 3PUVA 4II7A 1FZQA 2IX3A 2W00A 2EFCB 1RJ9B 2IYXA 2LCFA 4PQYA 5BXQC 5GJBA 3KQNA 1VCNA 2R6DA 1K8RA 3L37A 1VCIA 3L0IB 4IEEA 4TMZA 3WYAA 2GBLA 1GKIA 2QP4A 2RHMA 3VHLB 1D2MA 2ZRJA 1T3HA 4CT5A 2O8BB 3PR1A 3NEYA 2BOVA 4B76A 2CHGA 4G5OA 3W9YA 1O87A 5SZJA 3L2OB 1W4RA 3ZRVA 3R8CA 2GNOA 2VA8A 3ZZUA 2C9OA 1GM5A 2WHXA 5AVRB 1W4BA 4LJ9A 2BC9A 1NF3A 1GSIA 2WSSA 1X1RA 1VYUA 5J40A 4DLSA 2NTYC 4PHFA 1DOAA 3KQUA 2WWWA 3I72A 3DOFA 3VMFA 2J7KA 1TEXA 2RGNA 1J2JA 3GLGB 1YZTA 1CU1A 1ZINA 3LA6A 4PSKA 4BFTA 1LFDB 2Z0MA 1IJEA 4LUCA 4KYIB 4TL6A 4MYTA 2YJTD 3X1YA 3TYYA 1MKYA 1X1SA 1EFTA 1XTIA 1IQPA 1GG2A 3VN0A 1NLYA 1P61B 2FZ4A 2GK6A 4CW7A 4C7OA 1KHTA 1II8B 4JT2A 4C46A 4DEXA 2YOGA 1N5LA 1ZC4A 4DSNA 1WE2A 1XFAA 1Q1ZA 4LJ8A 4JLVA 4ZKEA 1I4TD 2O0HA 3FMFA 2HT1A 1R0XA 1XF9A 4W5JA 1RRFA 5EQTA 2LKCA 1WMSA 3K0EA 4U00A 5AUNB 4Q1EA 4Q1CA 4WOPA 3NVAA 1X8LA 1CULC 4B75A 2WPSA 3C14C 2Q6TA 5GVSA 3FE2A 2P5TB 1ETUA 3M0EA 4GKGA 4HATA 3VX3A 3I8XA 4QBFA 1FQJA 1Z6AA 2OBLA 3EG5A 2FA9A 5HKKA 3I4LA 2ZRDA 4I1VA 1JUNA 3GLIA 4G1UC 1EWRA 2GAOA 2E1RA 5AJZA 5C93A 1P2SA 2GZDA 1G1MA 3ASZA 2QM8A 2G6BA 3K9HA 4LHZA 2CL6X 4LJ5A 3W6NA 2WKRA 1F2TB 2JJLA 2R6CA 4LV5B 2WPDA 4ZPXA 4D4LA 2R5DA 2HF9A 4IVPA 1E2DA 1G17A 1QRAA 2VRSA 1W36C 1XJCA 5TY0A 2DPXA 4LJ4A 3WNBA 3MWKA 3CPHA 2R62A 4MGIR 1E69A 3FMIA 2G77B 2ZRLA 2FJUA 4QRHA 3RRNA 4PTLA 2KBEA 3RSOA 3PG5A 2AX4A 1MUUA 3FWYA 4EPVA 4KLZA 4KI0A 3THYA 1A1VA 1U0LA 3TJZA 4DT1B 3P4YA 4OQMA 1AJEA 2FNAA 1TF5A 3GJ3A 1D5CA 4MUAA 4Q66C 1KSHA 2C2HA 1GL6A 1Z08A 1ZNYA 2GJAA 2QI9C 4RD4A 1QVAA 1U81A 3S1AB 3AKDA 2RCNA 1R8SA 2Q9CA 4O2LA 3PEWA 1SXJD 4A0FA 2JIZD 1Q3TA 4ON9A 3KTAA 1H8EA 1KKMA 2I3BA 4OYHA 3B7GA 4ZDIA 1HEIA 2AK3A 3IPXA 1X86B 1E2MA 5SZKB 1E2LA 1AQYA 2QQ0A 4OHVA 1E4VA 3GPLA 4CEJA 3BORA 4M1TA 2FX3A 3I5YA 2AKYA 3AGPA 2XJ4A 1R0YA 2BKUA 4YDSA 2B7BA 3RDPA 1XX6A 4ERNA 1OXVA 2BBOA 1I4DD 2PEZA 3C4JA 4TTPA 3U7HB 3PFIA 2ZRIA 4M1OA 5FI1B 5AW8B 1E1RD 4EJSC 2QAGB 4S2EA 2YC4C 2ZE7A 4NYIQ 3NEJA 5BWMA 4I99A 4XWAA 4XVQA 3V00A 1SP4A 5JS8A 2IXEA 4M1KA 4P4TA 5JI3E 4HLUA 4BLSA 4EKDA 1SXJE 4Q7KA 4M21A 5M04A 2IYYA 1SVWA 4OI4A 1OKKA 3X1XA 4MGKR 3U3MA 3LY5A 4QXAA 3K1JA 3A1TA 2VLIA 1EFRD 4DJTA 4FMDB 3TSZA 5UKDA 1HQCA 4WXRA 5DHAA 2P6RA 1PLJA 1G19A 2BASA 2HYDA 3R7WB 1CKEA 1CIPA 1XEWX 3OAAD 4BFXA 5KSZA 3ZS9A 5FPYA 1M7HA 3AGQA 5P21A 4BWYA 2PCLA 4B47A 4DSUA 4U7NA 2CJWB 2VO1A 4DDTA 5CJPA 3P4XA 4QL3A 3T34A 1N0VC 1NBMA 2P5SA 1E2EA 1E79D 1S3SA 3JZAA 5KPDA 2R3CA 2IUUA 2ZS9A 2B6HA 2R9VA 4HAYA 3ZYCA 4TZ6A 1DTSA 5C4GB 3WHKA 1E32A 4N1AA 1FMJA 1X6VA 1YRBA 2AKAB 5KSOA 4LC1A 4GP6A 5TVKA 2X2FA 1JR3A 4TQUS 3WP1B 5G3YA 1XCGB 3KFXA 3DDCA 3B8EB 1DAMA 2ODWA 4G01B 1E9DA 3NC0C 1GD2E 3FKQA 5JBQA 1S9KD 3KJGA 5TARA 4JZKA 2BCJQ 4WBSA 1E1QA 2GRJA 1KY3A 4PC1A 4QNMA 4BLRA 3VMXA 1T0JB 3REGA 5KDDA 5F9FA 4NYMQ 1G8PA 1KTVA 4L16A 1UF9A 4JLKA 1H89A 1N6NA 3SJZA 4Q4JA 1OPXA 4A0RA 1KMQA 1ESMA 2YHSA 1HYQA 1CXZA 1NVVR 2V6JA 4MKIA 5FTKA 3TVTA 2IWHA 4BE7B 4FMTA 1RFLA 3X1DA 3ZRWA 2WWHA 1OIVA 1T3SA 4AURA 1KI6A 3H86A 4Y0VA 2IEZA 5AUOB 4XSHA 1FP6A 3GFTA 1RE0A 2BM0A 3FYHA 4MQBA 4N0EA 4KO8A 1MH1A 2EYQA 2C77A 4GCZA 2NOAA 2Z83A 1G4AE 1P6XA 1Z07A 3B1ZA 4QGHA 5DSZA 4KVAA 3ONWA 3QQ5A 1NN5A 2W58A 3KKQA 1CR4A 2GETA 3LVRE 1LS1A 1FW6A 2WIAA 2ZE8A 3CB4A 5DE3A 4A1FA 3B85A 2ODBA 4TMVA 3RS2A 3RWMB 4XOIA 3GCGA 1SVKA 1UBEA 2GCNA 3EZ6A 3FFAA 3H84A 3Q9LA 2H7HA 4CEIA 2V3CC 1OXTA 2OILA 4XD7A 2WPQA 1XMJA 1H8HA 5KTYA 3IEVA 2ZEJA 2PZEA 5HCIA 3QPVA 1DAEA 3L0OA 4IEIA 1T2KD 1RYHA 2BBWA 5EE1A 2XJ9A 4DZOA 4OHXA 2J0UA 4MITA 4MYHA 1G5TA 1A2KC 1E2NA 5HE9A 1JNYA 3VR2A 3PV0A 2FN4A 4W9MC 1E4YA 3TVDA 3DGEA 3GLFB 1TU4A 4G5QA 1NN0A 1CLUA 3CH5A 5HKKD 3K0SA 2JLSA 2CVFA 2XXAA 3F0TA 1TNDA 1N6LA 5IRCD 1V43A 2QM7A 4LBZA 4PAMA 1YQTA 4CF7A 4DLXA 5D3MA 2WPDD 3DO6A 4Q1AA 2XX3A 4BFSA 4DUGA 3LIEA 2QT1A 1T0HB 3DKPA 2PJRA 1EWQA 3L43A 2R6AA 5KUTA 3U4QA 4JLMA 3B1XA 5F2EA 1P73A 3G0HA 3QY0A 4JLPA 4ZKIA 5CMZA 1WDTA 4AYTA 2OT3B 4C0KA 2XB2A 1S2MA 1YE8A 1GZLA 1LW7A 1DADA 3F3YA 1XXHB 4Q1FA 4TTQA 3P8MC 1DG1G 3BAFA 4RFVA 4PR0A 3U60B 2ZQ5A 4HDQB 4O0MA 4Q4HA 5EP3A 1IXRC 1FNNA 2YZ2A 2ONJA 1G7TA 3GLIE 4IOLA 3CPJB 1P7CA 4TQAA 1XPRA 1Z6GA 2H1LA 1QG2A 2V1XA 3KZ1E 4NL4H 2VF7A 4XSGA 4C3ZA 1R10A 1ZBDA 2WBLC 4JVNA 3TQCA 2ZRFA 3D3QA 3RNLA 1G3RA 1UBGA 2E9SA 2J7PD 4IDQA 1A7JA 5SZHB 3W6PA 2A5GA 3IGFA 1H8ED 1W36B 2K5UA 3VR6A 3I5CA 1OXSC 5FL7A 2GKSA 4QKQA 1ZCBA 2QBYB 1G2CB 1IN6A 2FFBA 4R2HA 3U7GA 1TQ6A 2Q21A 4NONA 3I61A 1HUCA 3VMYA 1QDEA 2WWXA 3LX8A 4YXWA 1CRPA 2Q3FA 3AKCA 4KJZA 1HTWA 1KO4A 3V5BA 4R2IA 1H65A 2A7QA 1OFIA 2OV2A 3KXKA 3ZVNA 2D3WA 4D25A 1TF2A 2ZREA 3D31A 1E2JA 1QHHB 1W0KD 4KYUA 3NBYC 3K70C 5AUPB 3ZVMA 4WA7A 2P6UA 2ASEA 3W8NA 1MABB 5E7JA 1WQ1R 1Q20A 1ZP6A 4U7OA 4NCIA 3QBTA 1KKLA 4M1MA 4E09A 4A15A 1GIAA 3KFVA 5FOUA 5K8LA 3FFBA 5F3WB 5GJCA 1US8A 2QE7D 1J8MF 4Q02A 4CEHA 3LX5A 1HWTC 1XEXA 2JGNA 3DVLA 3SEAA 3K8YA 2E43A 2ERXA 2O52A 3AV0B 3K0AB 2PZGA 4BFZA 4AUWA 5AW7B 1F2UA 5C18A 2OBMA 5B64A 2MSDB 4FIDA 2DWOA 4NYIR 4EJSB 2FSHA 2NO6A 3BH0A 3PEVA 3ZIAA 2VQSA 5LDDC 1V5WA 1YKSA 4N3NA 2YWFA 4DRZA 2A5FA 4LJYA 4Q4AA 2P7JA 3CH4B 3VHXA 2ORVA 4OHYA 3RANA 1ZM7A 1NBMD 2IF2A 2O8CA 1E6CA 1ANKA 5AW2B 4PC7A 3K53A 4KLNA 5EE3A 2O8EA 3OEEA 1KDTA 5J4HA 1JR6A 1DO0A 4IOMA 4B73A 2EFHB 4PSAA 1D8TA 4R98A 4EPXA 1QF9A 2NIPA 2VRWA 2FFQA 3CRVA 4GPTA 3GJ5A 4RD0A 1CEEA 1ZM2A 1JPJA 3QKSB 1G8GA 2V7QA 4LOAA 4F38A 1E1QD 1HH4A 2JJ1A 3B82A 1E2GA 3M1IA 5AJYA 2YWEA 3P20A 4B3GA 2QMUA 2XITA 2CBZA 3NKVA 4HAZA 1DO2A 2I1VB 4I81A 3WYGA 4QGFA 1A02F 4YONB 3QPWA 3T5DA 3MWJA 2MMGA 1IY1A 5LD2C 2JJ2A 2RGBA 2P3SA 1NBME 2DWPA 1DELA 4LY6A 1IN4A 3I1FA 4IW3B 3A1UA 4A82A 1N6OA 2XZRA 2GK7A 3QE0A 3JZMA 5E3HA 3O8DA 1X8YA 4Q03A 3THWB 2VIIA 1XPUA 2OLKA 4G5GA 3HE4A 1JR3E 4C0BA 4OHWA 1TQDA 4LX0A 2JAQA 2YYZA 1GL7A 4QGAA 3RS7A 2N42A 5FTNA 1OHHD 2QP3A 3IEUA 2GAAA 3OFNA 2ZIAA 2ZJYA 4OHZA 3NTNA 4D0NA 1NMXA 3EAQA 5BW8A 3RC3A 4B3BA 5L3SA 3A8TA 4TYYA 3CPEA 1RRGA 2F1RA 5BN3A 4ZDKA 2AWOA 5H1YA 4D26A 5C46F 3N2IA 3OZXA 2V54A 4U02A 4BFYA 4B74A 2YWHA 1JALA 1GZSA 1M6NA 2C03A 2EYUA 2ZAMA 1OFHA 2QTVB 2NMVA 4EUNA 4IVRA 5B58C 3U3KA 1R5OA 5G53C 2F1HA 1WBBA 1WA5A 2YNYA 1KZ7B 1XMSA 4XD7D 4KP4A 2QRZA 1KO1A 5HZKA 1VG8A 2G1KA 2AR7A 3KL4A 1RJ9A 5FBLB 1OJLA 4CT4B 3AVYA 1WP9A 1EFCA 2ZYVX 2G0NA 3OIYA 1OH8A 4E03A 3M9BA 3DOEA 3TAHA 1O3YA 1ZM9A 4GNKA 1BIFA 1KI1A 3BIFA 4C7NB 3DMDA 3U61B 1XB2A 3QXSA 2O8BA 3AH8A 1BOFA 4QBHA 4R7ZA 1W44A 3CW2A 4JLJA 4PPQA 3LNCA 1IN8A 2DB3A 2YO2A 3GJ0A 2BMEA 2H7VA 1BMFD 2F9LA 3SN6A 2WWIA 3B5JA 4Y0AA 1MT0A 4DXAA 4DIDA 2CE2X 3EPLA 1VPLA 3B60A 4JL5A 4DUGD 3FHTA 2IL1A 4F4CA 1AZTA 4BQSA 4CDGA 4NE2A 5K8IA 3HU3A 3QUSA 3R9IA 4A0HA 3GLGA 1E9EA 2GXQA 4FWTA 5F98A 1RW4A 1E9SA 1NIJA 1JB1A 5D3QA 2Q3IA 4ITRC 1A82A 1S96A 5AJVB 1M34E 4FXPA 2C9LY 3M06A 1G21E 2ZETA 2O8DA 1D6JA 1N0UA 3T35A 5FL3A 3FPAA 4D0LB 2DBYA 5B30A 3IIKA 5FTJA 3KX2A 1GNQA 5AJXA 3GJ7A 2VF8A 4V03A 2DY1A 2CHVA 2L0XA 5A0FA 2FPKA 4LYFA 2ZPTX 4PZYA 3L8ZA 1I2MA 3GJ8A 2Q7CA 3WXMA 2OE2A 5HR5A 3CR8A 1CRQA 4LHWA 5FL7D 3SFVA 4HB0A 2G83A 5FH9A 1LTQA 1XNJA 1NY6A 1TU3A 3L0SA 3UWKA 3I5XA 4URUR 3TUIC 2HT6A 3PEUA 3OIWA 4TMKA 4D4KA 1E1RA 4TL7A 1EX7A 1ZVQA 1F2TA 1W5SA 3K9NA 1E2PA 2ZSAA 4LBVA 2RGDA 4YMWA 1Z8FA 4OQNA 3AF0A 3EZ2A 4UXIA 4A2WA 4ZI2A 2ZI7A 5FPTA 3ND9A 2YKGA 1E94E 4TMWA 3U7FB 4QBIA 3ASYA 2H18A 2QMOA 4KSCA 4L4UA 4DHEA 3O8RA 2OCBA 3PCRB 1E2HA 4DT1A 3AP1A 1OB5A 1ESNA 3TNFA 4OJKA 4CIDA 3MD0A 3SOPA 3CLVA 2ZRCA 1OXZA 4I2LC 1GRQA 4B2LA 2V55B 2VHCA 3RS4A 2OZEA 3DL0A 1RIFA 4TWZA 3UXMA 1GK4A 3RABA 3W90A 5L3RA 3THXB 3VNUA 3IO5A 1F6BA 4DEYA 2OCPA 1RKBA 2PEYA 3ADKA 1F51A 2CL0X 1E79A 3K70B 4UKDA 3SQWA 1XU4A 3RRYA 1RVDA 1YZUA 1W4AA 2OAP1 2CCJA 3M4YA 4FCWA 3RLFA 2IYSA 2EQBA 2JLQA 2AD1A 2LWIA 4JAVA 3BOSA 4GZLA 2IF0A 2GCPA 4Q7LA 3X2SA 1SKQA 4FCVA 1YZQA 2ZS8A 2ZYTX 1AQUA 2QMEA 4LCBA 4P0TA 4KODA 1NLZA 1QG4A 3E2IA 1UADA 1GUAA 1T91A 4EFMA 2GJ9A 2V7QD 3TBKA 1L4UA 5LPNA 4EPYA 2WOJA 1R0ZA 2JJ1D 3B1WA 4DCVA 1FOEB 2E87A 3PUXA 5CLLA 5BN4A 5KU1A 2O8FB 4PPGA 5IHPA 3OHMA 2FMXA 2KE5A 2YC2C 1Q21A 3IILA 3ZZ0A 4HDCA 4C0SA 3WMFA 2WJHA 5JSZB 2JJ2D 3DM9B 4OI2A 3VR1A 3FMPB 3K09C 1MO3A 3C16C 1G8YA 4W7SA 2WMOB 1N3BA 1DEKA 4UJ3A 1W0JA 1EX6A 2PLRA 1YYCA 4HI0E 1Z47A 1XTSA 1N6PA 5CITA 3IHWA 3R7WA 4NH0A 3W5IA 4Z1MA 4NCHA 2N9BA 2CK3D 5JEDA 4DZZA 4V0LA 4ZDJA 2IYQA 3A7OA 1XMVA 2CNWA 3SWFA 2PX0A 2CJWA 3OFND 1G5RA 3I8SA 3QVVA 4MH0R 5AK0A 3EZ7A 3AF3A 5EZ6B 1YZGA 1JXMA 2XU6A 5DYIA 4WAUA 2J45A 2WJGA 3TSOA 2QENA 2OFOA 2VP6A 2VP4A 3W6OA 3WYFA 3Q7PA 1YZNA 4AWXA 1FQKA 1ONBA 4LJ6A 2AFIE 1WXQA 3EW9A 5LD2B 4OQFA 1PUIA 4HUTA 1ZD9A 1ZJ6A 4YC7A 4LHYA 5FTLA 4MTXA 1Q0UA 2DFNA 4JLNA 3WMEA 2JLVA 3TR0A 1KNXA 3IIJA 3LQRA 5LBIA 4C0AC 2F1IA 2WZQA 4B71A 4NDZA 2FOLA 2ZE6A 2XTNA 3U3RA 1EXMA 1OF1A 1NSTA 3A58B 4HB2A 1NVUQ 4DSTA 5KNDA 4BECA 2DWQA 2VBCA 4QHYA 4RZUA 3H2YA 2O5VA 1HUQA 1EGAA 3HJNA 2HF8A 1AK2A 3EC2A 4XJXA 3T12A 1KK0A 1BKDR 1J8YF 3ECCA 5FBWB 3TGPA 1EK0A 1GL9B 1R5BA 2C98A 1J70A 2IXGA 2WT7B 1R2QA 2FEMA 2FSIA 4IDHA 4AD8A 5HCNA 5J5CA 2JEOA 1PV4A 5JZVA 3UMSA 3M91A 1T3LA 3OIUA 4MA4A 3QKRB 5KNCA 1IOZA 4IOKA 3LFUA 2XV5A 3PEYA 5E7IA 4DLRA 4Z51A 2HCBA 3U44B 2XB4A 5C1BA 3U5ZB 3CNNA 1XD8A 2PT5A 1RC8A 3AVUA 2XOKA 1JBKA 2G9NA 4KFTA 1KIMA 4BRWA 4WVFA 1Q1EA 5EXXA 1IXMA 1NL3A 2N46A 2QGZA 3GFPA 1FL9A 1KZGB 2J0SA 3GFOA 3CX8A 3F8TA 4QHSA 4U7DA 3LBHA 4LRWA 4GFDA 1OXXK 5J4VA 2J7PA 2EWWA 4LI0A 2EFEB 5APXA 3MCAA 1NG9A 2NO0A 2WAYA 4GI7A 1ZUIA 4URYR 4LJAA 4KAXA 2A30A 4BEJA 2QP9X 2X1VA 1QHIA 5DI3B 5FOXA 4F7WA 3GLGE 2MSEB 5IDJA 3MLEA 1VCMA 4KFUA 3B1YA 2FGJA 2WOOA 3SJCA 4XWKA 5KPJA 3ZD7A 1P9RA 4K81B 1XWIA 2NO1A 2IBMA 1UM8A 4Q9IA 4HZUB 2D4HA 4I4LA 2R5BA 4FWIB 4TYPA 4YMTA 4US0R 3U6BA 3QSYA 5AVVB 4FCTA 5JJIA 2FDCA 4RD1A 3BD9A 2OXRA 2D2EA 4JLBA 1FUUA 1W0KA 1B23P 3L36A 1G8FA 1KK3A 1U94A 2X77A 4OKSA 2GF9A 2JJ8A 1B0UA 4GL2A 1NI3A 1UDXA 3U2QA 2V8OA 3CR7A 1R4AA 4KU4A 1QVRA 2QE7A 5FFMA 1KJZA 2J1LA 5CYOA 2BV3A 2FFHA 2A78A 4PHGA 5G41A 1Z6YA 3D36A 4PPFA 2GCOA 2XNDD 4Q7JB 3CONA 1HA3A 1AGRA 5DISB 1T6NA 2V4ZA 3LO5A 3Q7QA 2QMHA 4ESHA 5KSYA 2HJGA 4GT1A 1G291 1KSGA 2WKQA 2KP8A 3IUYA 1XCMA 1RYFA 1Z29A 3SC3A 2VYFA 2QSZA 3O8BA 2AN9A 1G8HA 1AN0A 1CJMA 4QC2A 1E2QA 5F9HA 2JLYA 4PC3A 1ZUHA 4IFEA 3KQLA 4PX9A 2ZXUA 2VP9A 2W6IA 1MO4A 2HJVA 5APTA 3R9WA 3AF1A 1S1MA 2OCYC 1GOTA 1G20E 1ZAKA 2Q3MA 3MAAC 5EP4A 4UNPA 1L8QA 5JFGA 2QSYA 4TYQA 3U3OA 2BBTA 3ZCCA 2FU5C 1NVXQ 4QJ3A 3KKNA 2IT1A 2FG5A 1ZU5A 3BK7A 2GZHA 1KI9A 5ELXA 2PMDA 3CUEF 1FTNA 1QHHA 4O25A 3AVOA 5FPHA 1N6RA 4BZXA 5FPKA 3KKOA 3CRRA 1Y3AA 5KSPA 4ZIRA 4A36A 4Q00A 5FUVA 1TTTA 5KDLA 2VL7A 1XD9A 3EIEA 5L3QA 1VMAA 4TMXA 1G3IA 4PO8A 4FN5A 4MRSA 1T9HA 1KMHA 5JJKA 5JI2E 2XTMA 1W0JD 3K0AA 2FPLA 3CWZA 4QJ5A 4XVUA 5IF9A 3V4FA 2A9KA 3G5UA 3QEJA 2REBA 4A2PA 1GITA 4Z1MD 4LJ7A 2KB0A 1OHHA 1YU9A 2ORWA 1S9KE 2REOA 1NWQA 2ZM5A 2WWFA 4IHQA 2GTPA 2CNWD 1AS2A 3V4QA 2HXYA 3AF2A 3E1SA 3FKSD 4URXR 1YRAA 1TX4B 4PO9A 3IQXA 4QPJA 4IXNA 3KUCA 4Q9KA 1Z6TA 1XZQA 4M4SA 4NCNA 1YR8A 4O3MA 1M7BA 2DFLA 4EQ6B 1QHXA 4HUQA 4PQFA 1KI7A 3IDQA 5IDVA 5AVTB 2HLDD 2ZRHA 2ZRGA 1BH2A 3A37A 4YLGA 2C8VA 2CCGA 3EZFA 1Q1BA 3EX7C 1IONA 1P5ZB 4TLDA 2FZLA 1TUIA 1YVDA 4V0KA 3BB4A 5AW1B 4M9ZA 1X3SA 1G41A 4TLBA 4Q9JA 1R6BX 3GEIA 4Z8XA 4IKEA 2W0SA 2W6JD 3MWLA 1OLOA 1KO8A 2ATXA 1VIYA 4NKRA 3RC8A 1CF4A 2NZJA 2XAUA 5BQ5A 4RD6A 3TLXA 1JNMA 4DLZA 4ZI3A 2J0QA 2OFWA 5BYKA 1BMFA 1VDZA 1EG7A 4TLAA 4DCUA 3DKVA 2ZR9A 3THWA 5AWFC 2RGEA 2TMKA 4ZCMA 5JHHB 4CGZA 1PVOA 3NIBA 4B3DA 5DGXA 1UKEA 4WXPA 5EZ5A 5EE0A 4A2QA 4CEJB 5SZIA 2JATA 4EPRA 4QM7A 1H88A 3AP2A 3WNCA 4AC9A 1W1WA 4DCTA 2A2ZA 3TNUA 4JVLA 1UPTA 2KJQA 5CDFA 3MFYA 5FBVB 1JOYA 4C0HA 2EU8A 3BWDD 4TLCA 3VU9B 1KO7A 4C0LA 2OUKA 2Z5FA 2YWGA 5DI9A 4GOXA 1AM4D 2XOKD 2CVHA 2H16A 3UG6A 1K5DA 3C5CA 2BCGY 1HE1C 4ILEA 3SBDA 1CZQA 1DG3A 4JJKA 1ZW6A 2GVDC 4JLAA 1DAGA 1ZIPA 3EA5A 1OH7A 1OXUA 1VG9B 2QN6A 4LBWA 1RRPA 2ZI4A 4RSGA 1QHYA 1KI3A 3LIDA 1D2NA 5APWA 1M8PA 1NIPA 4LV8B 4ARZB 5A5GA 4ZO4A 1F48A 5TV2A 821PA 2IYWA 1GNPA 2J5XA 3HR7A 3P1JA 3CRMA 1SKYB 2WTYA 2RAPA 4C7NA 2KWIA 1Z0DA 2BEKA 3RVBA 1YR7A 1PLLA 3VKWA 2F6RA 3DZ8A 2UKDA 2ZXEB 1T4GA 5A4JA 1II9A 3HTKA 2F43B 5EJEA 4BLQA 4X8OA 1KQLA 1RPZA 4PSVA 4Q48A 4ASUD 4K46A 2FFAA 2LKDA 4RFSB 1XRJA 5JWHA 2CMKA 4FPPA 2A5JA 1I2DA 1MOZA 2BJVA 2IA5A 5JRJA 4LHVA 2V1UA 2WSMA 1KYIA 2QPAA 2YO3A 3QKUA 4KFRA 4AIIA 3ZLJA 4MDFA 2QG6A 1CI6B 1WCV1 3T61A 2B21A 3L82B 4JL8A 1G7SA 1Z83A 3X1ZA 5IK2D 1IM2A 2ZU0C 3NXSA 3FVQA 4D0GA 2NQ2C 1W2GA 3JVVA 2XZLA 1M2OB 3M6AA 2ZANA 4A92A
chains in the Genus database with same CATH superfamily
3Q5DA 1L2TA 4DR5O 2BMDA 3PQDA 4LSZA 4HLCA 1U2SA 1UDAA 3CNHA 2AYZA 2JHFA 5AKLA 2ZAIA 1HDIA 2X6QA 2H4JA 1T6ZA 3SG0A 1DXYA 1UWKA 1TJNA 3GGOA 4Z7QB 3NHBA 4EENA 1XXHE 1YIDA 5FUMA 2N1TC 1WRBA 4GXQA 2N04A 2XCLA 2Q0HA 2IUTA 2YCLA 3HB7A 1R6NA 4BIZA 2WZBA 3TMAA 1AD2A 3JWEA 2OYIA 1EUDA 2E76B 4RMJA 2YWCA 2IRWA 5IT4A 4BB6A 4Q21A 1IE3A 3OAKA 5KNBA 3F6PA 1PNVA 1A9PA 1XMIA 1CUEA 2OHVA 1U8AA 1PJ3A 4D81A 5HF5A 2NYAA 3A1VA 1KPIA 4PONA 1AURA 4TV8F 4O4LB 5K20A 121PA 3TL3A 4ZRNA 1IPEA 3EXAA 3QG1A 6ADHA 2JGUA 1VZ3A 2ZJ4A 2E3CA 1T3UA 4D82A 1I08A 3H16A 4AP6A 4N5NA 3AEQA 1J90A 4QUKA 1UFQA 4ZZIA 3RNOA 3V97A 3U5TA 1JY2N 4RDHA 4G5SA 1M0WA 4UUMA 1CDDA 3F1KA 4WT7A 4P4SB 1V9CA 5CCHD 3AC0A 4EHFA 1TEZA 2VPIA 4DDWA 3VYUB 4D3XA 1PFIA 2J0EA 4EVRA 1NLFA 1SVSA 2GUWA 1R4MA 1RBZA 1Y6RA 4J1QA 2VUIB 3AL0C 1TQ4A 4FLXA 4GI3A 1WAZA 2C3PA 1XROA 1DLJA 1YFZA 4PG6A 5ALSA 5DBFA 2P10A 1K3FA 1R5JA 3C0KA 3L72J 4JP1A 3VV3A 3VSBA 2XNDA 1RVV1 5JAPA 2R68A 3WMGA 3ZWQA 2VTVA 3AW8A 3GAFA 1ZCAA 2ICAA 4CQLA 4PA4A 1YS2X 3JYHA 2FXPA 3OF2A 4X6XA 5L7WA 1C7QA 1N8SA 1M33A 2XWPA 3HP4A 3MCTA 4F72A 2QAGA 2C61A 1HFJA 1P3JA 4OB7A 5BSMA 1GRJA 2EIXA 2BSXA 2QXYA 1PVDA 3H3XA 3D8BA 3RRFA 3EZNA 1Z4JA 1TK3A 3I04M 3EA0A 4N47A 2DTDA 2TECE 2PMBA 4L8YA 5JY6A 5C8DA 4BO2A 1M83A 2HR1A 4BR6A 2Z9CA 3DW3X 2QJWA 2B8TA 4OLAA 2GERA 3G6KA 2QNRA 4K9MA 2ROQA 1RWKA 3ANMA 3PIIA 4EFLA 3WGVA 1K3EA 2J0VA 4N7JA 3FUTA 1XZ8A 4EP1A 2VZEA 2PH7A 1VQLP 2L5GB 3W7VA 4QNHB 3I62A 3EOBI 5TVGA 1FBMA 2V5UA 1PZNA 2XE6A 4AXBA 1XKLA 2JFBA 1S4QA 4CZ2A 3SAJA 3RGUA 1XD2B 1HNWB 1RF0C 3MJRA 4DUPA 3DB1A 4I2NA 3QVLA 3CLSC 1VMGA 3O0TA 1DWPA 4OH7A 3B4SA 1UBKS 3SYQA 4Y9TA 1JDBB 2WUVA 1FUEA 5AVTA 5A3RA 1KDPA 3L8MA 3O4FA 4M9QA 1CJUC 4IGKA 1IVYA 4YT8A 2QTHA 3UA4A 4GLFA 2W83A 3SPJA 3T2MA 1L7BA 3E9EA 2PVSA 4GM0A 2NGRA 3P7KA 5FT9A 4ISBA 3TW4A 4B3CA 3AKYA 4OAQA 2IH2A 2WHRA 4YJHB 2IY9A 3KL2A 4ACAA 5REQB 2HMAA 4IT5A 1LBTA 2QD2A 1NONA 2JLAA 3S44A 4ZBMA 4MA0A 4RF3A 1BXGB 2R9AA 1SQBJ 2PAFA 4RFSA 4RDXA 2QJPB 5JH7F 4TL8A 2A5DA 5AW0B 3MMPA 3JYOA 2IVFA 5JY1A 3KYCB 2RH5A 4MRVA 4IRUB 3C15C 4C7OB 2ZJ5A 3TQSA 3F3MA 1NU1K 1GPUA 3P9KA 3DMNA 4MGZR 1NTMG 4PC2A 2J9FA 3NFYA 2QT0A 2UVQA 1LLDA 2QPTA 1ZH8A 3C7AA 2QVXX 3TQTA 2OWOA 4YRDA 2ZBVA 2B4AA 1E20A 2V59A 4J9YB 2Q5QA 2WA4A 2EBFX 3RFTA 3SIWA 2UZ0A 4URFA 3VPDA 1PW7A 3W8RA 3R7LA 1AZLA 1I36A 3Q85A 4I6MC 2GUZB 5H3HA 4UOEA 1B93A 3JWIA 1T8SA 3SY8A 2HO5A 4YQEA 3NBZC 2ACVA 2N74A 2Y0DA 2Z57A 1M56C 1RPNA 1HNWO 3HKEB 4UFOA 5BRNA 3PDCA 1JHPA 4I6GA 3MXOA 1VTKA 1Y42X 1JJOA 3FB5C 3K35A 2Q3HA 4LVOA 1F4LA 2B78A 3GEHA 5EKXA 2VDPB 4KHZA 3GPBA 5CURA 5E7QA 1UH5A 4OFXA 1FXKB 2O2YA 2ZU6A 1P72A 4GWGA 4CS4A 5DNVA 1E92A 2BFPA 2C83A 3UWDA 3VYWA 3L73G 3QA3E 2W6NA 2REXB 3TDMA 2Q3EA 3L8YA 4YAOA 3TTVA 5LNK1 2QMZA 3NEAA 2I4IA 4HG2A 4FGSA 5C8ZA 3FTFA 3E70C 3F8SA 3FPKA 1TT5B 2WILA 2EW1A 4DC9A 4OUKX 1D2DA 3IBFA 4M0FA 3IP3A 1DJOA 3BH7A 4F3YA 3F6SA 4WNAA 1J1DC 1W5TA 2K2QB 4MTLA 1BNCA 4FJ1A 3URMA 2AG8A 4FZ5A 3PRYA 1SQXD 2I6SA 1JAZA 1U0HC 3IJPA 1CJTC 1SZJG 4F2DA 2K3RA 1YQ3C 1Z2AA 4R5MA 1TQ2A 2J5QA 3M6WA 4PLYA 5KHGA 5DCLA 4O2BB 1HWYA 1Q95A 4JTAB 3AXSA 2Z5UA 4BFCA 5DH9A 3OUTA 5FXMA 5CLHA 3U4QB 4DAOA 4JBXA 5IKPA 2QB5A 3N39C 1Q14A 2ZFUA 1RWPA 1P60A 1JY3N 4BZQA 2C9MA 1Y8QB 2WUDA 2JIQA 2E76D 5CK4A 5LGTA 3C3WA 2D1FA 3AHCA 3EDYA 5CDTA 3U31A 3IQIX 4A27A 3AQ4A 2NN4A 2ZJBA 3CUVA 3CCLV 1FDOA 2KBFA 1I01A 2RG1A 4U2KA 2RCYA 4MZXA 3WO0A 1A88A 2NVWA 1WIWA 3SHWA 2QWOB 4F4IA 4WFJA 1DS6A 4OHPA 2AX3A 4HAVA 2E49A 4PIVA 1ID1A 1Q6UA 2DH6A 3EARA 3WWEA 3BMNB 4AZWA 1AR5A 4TKVA 3IQFA 1JPNA 2I91A 4C7MA 1MQ8B 3VR6D 5EJFA 3LUAA 4TN1A 4UCOA 1RAAA 3JAWA 3L7JA 5G3ZA 3AM1A 3ZG6A 2HREA 3OQJA 3UT6A 2Y6UA 4A8JA 4E70A 1R8XA 5G40A 2G9VA 3TRJA 1MO5A 1XALA 1VPTA 2OBXA 1XYYA 4TGLA 3UBMA 4S1PA 3V3KA 3ZD6A 2KSEA 4YHHB 3ZVKA 1OHHG 4FNAA 4O4JF 2QDOA 5JLAA 1ZL8A 1N77A 4JENA 2WAXA 3H9QA 1M67A 1QG0A 4UVAA 3DAHA 1G9SA 3W2TA 4W9NC 1RXYA 3V7NA 1C4KA 3D0KA 4MTGA 4DB2A 5ITVA 3HD7C 3A1WA 2W00A 2KHZA 4DNQA 1S0VA 4ND6A 2GBLA 4NMWA 2XQVA 4CT5A 1JH8A 1BX1A 2A1UA 4S1TA 4EF4A 3B8MA 1FDRA 3OUFA 4KXRA 1QAMA 4R9VA 1CF2O 3AHDA 4WF9V 4ICIA 5K4AA 1J2JA 4FPXA 3NOXA 1YZTA 1JLSA 4MS3B 5FNZA 3HUUA 4MYTA 1PPJG 1YHQV 1N5LA 5IWCA 3K6RA 4P58A 4JLVA 5IH3A 5CFOA 4P83A 2UAGA 5M2QA 2HB6A 2XYVA 4Q1CA 4BN0A 3OFVA 2O8NA 4HQ6A 5I7AA 1UIIA 3K7EA 3VSAA 3ZQ6A 2GZDA 2B1QA 2G6BA 1KMIY 2J3IA 2JJLA 2VOJA 3GUCA 4HYTA 1ZGAA 5EL0A 1YVPA 1PWEA 3ZMTA 1TO2E 1Y7TA 3C70A 2C5GA 3GFQA 3PG5A 3GHGC 3ICCA 1EYZA 5JXIA 4DT1B 2I1LA 1TF5A 1QRTA 1I33A 2QI9C 4RD4A 2OR3A 2A06H 2YMYA 3ZHVA 4YV1A 2CUTA 4MQMA 2P77A 1EE2A 4OYHA 3RODA 1EWTA 3KSAC 1E2MA 3FHLA 5JXJA 2BGMA 3BORA 4KSYA 3NP9A 2ECPA 1E1RD 2X5NA 2JJ1G 2Q2QA 1DC8A 4U3FJ 3NRJA 4K3AA 3L72H 1QR8A 5FP0A 4QXAA 5AW3A 3TIVA 4EKWA 3PHLA 2YJ3A 2RAVA 4M0KA 1QIFA 4R1NA 3KD3A 3A6JA 5B7PA 4YHHO 3M3HA 2R3CA 2HU5A 2IUUA 1WV1A 3DDCA 4OXRA 4WKCA 1MFPA 2AHZA 5KNBH 3KT8A 5KDDA 2IE0A 1XRPA 1H89A 3Q0EA 4Z5XA 3HYSA 1ZGZA 3AWIA 3GA7A 2EULA 3TO5A 3CWBG 1WNTA 1Z7BA 5FTKA 2GJ4A 4FMTA 3EFFK 3HDVA 4Y0VA 1KB9H 3E9RA 3GFTA 2NQ8A 2EIMB 4N0EA 2QV7A 5H59A 4UPVA 4QGHA 4WN9B 3INRA 3G23A 2AGAA 2B8NA 2V6FA 3PXXA 4KFCA 4J1SA 1L4AA 1CD5A 3V6LA 1HR0O 4HXEB 3GLMA 4DR4B 4JQ0D 4BO5A 2O2SA 3L06A 2HVKC 1R6KA 2HHHB 4YYEA 3VDXA 3MQFA 1NKVA 1GNLA 2E6UX 2XJ9A 4OHXA 3J81N 1GSHA 4EY3A 1JHAA 3UN1A 1CEQA 3CJHA 3DGEA 1FZAA 1EK1A 2PT6A 2D2IA 4DLXA 4DUGA 2D0DA 2R96A 4TKUB 5ALRA 5CT6A 4LF9O 2UZ1A 3IKTA 1G6KA 1XXHB 2GFIA 3BAFA 4WLFA 2FX2A 2ONJA 2YZ2A 1LPBB 4TQAA 4XEUA 1QG2A 3VVCA 2KUBA 1YV9A 2K5UA 4PGMA 2QBYB 4L5IA 2EDCA 2PTGA 1XVTA 1H0RA 2WWXA 3LX8A 1U57A 1E2BA 2A7QA 3NGXA 1OFIA 1DFGA 3NBYC 3VM6A 3G71P 5AUPB 3PKZA 1YBHA 2JGJA 3D64A 4EG4A 1KYTA 2QR5A 4RHTA 2H52A 1GUDA 2CVPA 1IK7A 4WFIA 1Y6QA 1F2UA 1WHSA 1GFZA 2D1SA 3PEVA 1MAAA 3OX1A 5HP4A 3KDPA 5KWIA 3CH4B 1SQBH 3GRRA 4ZVVA 2W6BA 5DT2A 1Q8IA 1D8TA 1MSDA 1LW6E 1SD1A 2PZLA 2NIPA 4RD0A 1FXHA 2FEXA 3EOAI 3RK3E 3BRQA 5AJYA 3UGJA 4Z2WA 3FJYA 1W8DA 1QTQA 3ZDZB 2H00A 1IY1A 2RGBA 1WMEA 1M73E 5KQPA 5U9CA 5E3HA 3THWB 2OLKA 5TPWB 5L8RJ 3KKEA 3FB1A 3BRCA 3CPEA 2XOKG 4U02A 2WLLA 4GBJA 4DCGA 1R27A 5AMXA 1WBBA 2YNYA 4ES6A 1KO1A 4D97A 1YR3A 2D00A 1OJLA 4ONEA 2G0NA 5CW2A 4DR4O 2WNHA 1FDMA 1ZM9A 4Q9DA 5KKZB 1TVKA 4ASUG 3VR2D 1RRKA 2FXMA 2HHHO 4R7ZA 1RLJA 4OHOA 4OM8A 2W90A 2F9LA 1WZUA 3EPLA 1H6AA 1O0BA 5T4EA 4XQEA 1NRIA 1NIJA 4WRRA 1QFSA 3ZJUA 2NXWA 1U4NA 4JODA 2D2XA 5EHZA 5EHXA 4DCMA 1S4MA 2C2BA 5BSHA 4B3JA 2FMUA 2VJBA 4PD4E 4IEFB 4Q4DA 2Q4TA 3GJ8A 5LYJF 3NBAA 4FKZA 2GFQA 2BFCA 3ISVA 5CCDA 1FDTA 3GAZA 4TL7A 2YDYA 1E2PA 3S81A 1JPVA 2HPHA 2KLVA 3Q2YA 2J3LA 2BTOA 4NH4A 1BVUA 3ASOC 2A88A 5D8DA 4YUYA 1VQPV 1N0HA 1S3FA 3IT0A 1KILC 1E6UA 1PRYA 4J2OA 2Z6AA 4ZK2A 4BNGA 1SQPD 3T5PA 2DW4A 3VI3B 5AP9A 2VHCA 1NTKE 4OXYA 4EVIA 1LBEA 4TWJA 1ZJZA 4J90A 2DUNA 3V48A 3IPCA 1ORQC 2C2KA 2NUTB 1SQQD 4XA4A 4KNYA 4QIHA 4LCBA 4M83A 5ICGA 5DOVA 2V7QD 3H11B 1GYQA 1F38A 2C7RA 3PUXA 2O5EA 2WF6A 2PUHA 5ESRA 1GFWA 4JB0A 2YC2C 1SUEA 1BDDA 3FMPB 4F12A 3K31A 1RXCA 2I6FA 5TR9A 1W0JA 3ILHA 4NH0A 3MDSA 3LKZA 1L5KA 5JEDA 1X9VA 1UDBA 2PX0A 1ZAUA 2O59A 2WJGA 1VCHA 1NJ5A 3TTWA 3KT6A 3AXTA 4OQFA 1MZEA 3RF6A 3K0KA 4AX8A 1RC0A 2FOLA 3N6XA 2ZWVA 3OKCA 1OF1A 3LCCA 5FYQA 5K3OA 3QOXA 2O2ZA 1YS6A 5K0FA 3KEMA 4YX9A 1I32A 1JILA 4AN0A 1JEAA 2IYFA 2WIGA 3ZWAA 2FEMA 2FCAA 5HCNA 1V9SA 2OCLA 1GTOA 1RRMA 4YALA 2NUPA 2RH9B 2JFWA 1YCIA 1XD8A 1WPGA 4GMFA 2I4NA 2UUCB 2FYUK 3GFPA 1WQ3A 3SKXA 2JBAA 1BXKA 2YC0A 4EA9A 2RK4A 4GI7A 1ZUIA 4ZT2A 1XZHA 5FV7A 3NVKI 2HBQA 3IV9A 3GLGE 3CH7A 3BMOA 1W2EA 5HBRA 3MRTA 4KV7A 4UASA 5F33A 3D6HA 2WLNA 1QSGA 3E7FA 4OKSA 2CEKA 4GL2A 3U2QA 3VPHA 1NVAA 5J59A 3QMMA 4KWIA 3JQFA 3A26A 5DISB 4RK7A 3VBEA 4CMGA 4EYYQ 1K6XA 3I9MA 5KSYA 2HMVA 1V1MB 1X14A 1I14A 3HB0A 2B2XA 2FZEA 4PS0A 1E2QA 1E4OA 4UZFA 3N3AC 2E76C 4MKXA 2OCYC 5EXEA 1OXMA 1XQ1A 2QSYA 1NVXQ 4OHBA 1ZD2P 3NM4A 4F6RB 4AS3A 5JC8A 3T9BA 5LQJA 2YXNA 4CM4A 1DKPA 2WU0A 3O6VA 1IHDA 3G5UA 3GFVA 2RC5A 4EUHA 2ORWA 2CNWD 2R1TA 4Y0NA 5A9GA 1AGXA 4GU5A 4UC0A 1EP1B 4MULA 1EGHA 3GLKA 4Q3KA 3OEYA 2ZDIC 1V8BA 4G8JA 1WSBA 4XDZA 3SSOA 3KXPA 4LIPD 1QJCA 1QV9A 10MHA 2WE8A 3U81A 3TQQA 2H9AA 4DVJA 3RC8A 3R7SA 1QIMA 3JYQA 5DCWA 4UCVA 4F8YA 3SX2A 2LP7A 3QUTA 1LUAA 3FTNA 4JYYA 5IABA 2GUVA 3GUYA 5JSFA 4C0LA 3OCZA 2Z5FA 2A0UA 3ZQ4A 2BCGY 3FB6C 1GY8A 5LA6F 2B9ZA 2HDWA 821PA 3HR7A 5A6SB 1T5DX 2UUCO 4HX2A 5AJTA 2LKDA 1DQNA 3BFJA 3UJ8A 1IUPA 3KPUA 3D3NA 1MOZA 1FJGO 2V0GA 1WCV1 5AM0A 4RGBA 4D0GA 5EUBA 3TW8A 3IOCA 1H69A 4HT3B 3EPRA 3DO5A 2HR3A 1X59A 4RHCA 2JI9A 4U3FH 3I2YX 3DAYA 1VYVA 3AEUA 4QLOA 4JI8B 2LDBA 4K05A 3F5FA 3IL2A 1PNMA 1J0CA 1HDRA 1J2RA 1OBFO 1YXMA 3LV8A 4RKYA 4ACBA 3MG9A 1ZNXA 4H3VA 2FOXA 4TSKA 1ZVMA 3S40A 3CCJV 3KAPA 1E9FA 3IVMA 4Y9RA 2GBIA 3RRXA 3JR3A 4YS6A 3LUBA 3MWDB 2MOKA 1RQXA 4MR8A 5LZ8A 2B98A 3MA0A 4OBEA 4J1TC 3ROZA 1ZLXA 4B7AA 5FPSA 4QLAA 1UBNA 1HT1E 3QYFA 4AYWA 3DTVB 1MO6A 4KXVA 5DNAA 1TZCA 5LMZA 1CK4A 1VM6A 1UMKA 2DQ3A 3L8DA 4QULA 5DO9A 1N0IA 2DQYA 1A9QA 3ZJ5A 2CMHA 5K99A 3RW0A 2Q7XA 1MX1A 2PL5A 3VAAA 2DBZA 5L8VA 3M0DC 4EHDA 1EMDA 3C3CA 2IHVA 2WTXA 3PNOA 4U2CA 4DIBA 3HU5A 3PITA 5L3GA 3AVQA 1S8FA 1R0RE 2XYHA 1AVMA 3BE6A 1JDBC 3W06A 1GL2B 2NAFA 3VJRA 1S2LA 2XQJA 2ECKA 3GYGA 1KAEA 1AP6A 1Q82W 1EP9A 4P3YA 1ELOA 1J06A 1M0SA 5TQVA 4MJLA 1KH3A 1XU7A 2ZUBA 3DOOA 1VHJA 4QOSA 4TVKA 1NPTO 4FEAA 1UJ5A 2B8EA 2JEUA 2GEUA 1BFKA 4D44A 4HJXA 3PQ7A 3FSGD 3ANTA 2OPHA 4RTSA 3VHXB 1DIOB 3RBAA 4BASA 3BB3A 4D7SA 1QGED 1L4YA 2NZ8A 1SQXG 1PT8A 1V8OA 3S7ZA 5I9IA 3WMWA 4EDHA 2QJPC 4R1QA 2ZWMA 5JMWA 4QD3A 3UH1A 1XRSB 2CLEB 1TYEB 4JI8O 4B33A 1MJFA 5EHQA 1WB9A 4ZHQA 4JCOA 1OGYA 3LTNC 2ZJ3A 3A5TA 2QLNA 4XPIA 1OIXA 3L5OA 4UM7A 2WUGA 4R1MA 4JLSA 4HWRA 2QRVB 3ZWXA 1XZLA 4PXYA 1ADYA 3LBIA 4HN4B 5EJ6A 5FQNA 2Z5GA 5TS3A 4KITB 2D8MA 5E95A 5BT8A 1KEKA 1GTWA 4L0QA 5AOCA 1W5BA 3QZUA 2H63A 3PXAA 2YXHA 1L0NE 4LK2A 3UXYA 2HWYA 4CMJA 2JFQA 1J1DB 2IFTA 3ETQA 5J2TB 5E79E 4EY5A 1C8VB 1I4WA 3SPHA 4BPBA 2FMFA 2O2XA 1XELA 5HM8A 5H9WA 4B35A 2E5TA 3SJCC 3GBPA 1URQA 2DJVA 3NTOA 3NFQA 1XOUA 3HCOA 1CY1A 2W6JA 2Y1GA 3GAMA 3R7FA 1JSXA 5E0KB 1TUEA 4JF3A 4AZVA 3COJA 4GOKA 4LPSA 3ZV5A 1Q22A 4DZRA 1MO2A 2DRIA 5SYMA 3RLIA 2R47A 4IS2A 1PQWA 4B0OA 3E7XA 3CO0S 1CBUA 1IU9A 1IHUA 4B86A 1FXKC 3ACCA 1KV4A 1G5FA 5EMNA 3WKBA 2C8LA 2C94A 2XZPA 5DW0A 2IX9A 8GPBA 3ZDMA 3FIJA 5CBFA 1Y5MA 3R23A 3KUDA 1L4HA 1OFTA 2E4UA 4BNDA 5J9PC 4AN4A 5JHGB 3H1KE 4DV4O 1ILWA 4Q34A 2DOSA 1DAIA 4RA6B 1GQRA 2EXXA 4XB2A 1H6BA 4COKA 1AHHA 3K15A 3SBXA 2WQZA 4HZIA 2FV8A 2V7GA 2EILB 4TTIA 2X0KA 1RTTA 2I29A 5A4AA 2Q0OC 1T8TA 4QUIA 3WJ1A 4QBTA 4KIGA 4ZDWA 2H1VA 3R6TA 3ZMZA 4HF7A 1N34B 5LP6A 3OU7A 5TMDA 1BO6A 1Z16A 2IW1A 3O38A 3EXFA 1LXCA 2YMQA 3GMSA 4DNXA 3CKLA 1TB4A 4ZO9A 4JP8A 3WLIA 1VKRA 4BAYA 2YFKA 2FRXA 2B92A 3IMEA 1PBNA 2AKEA 4EGAA 4KBFA 3CMAP 4IIEA 3D3EA 1T9AA 2WK1A 1GU7A 5IAGA 3FFXA 1Y3IA 1CI6A 1WKVA 3ZMSA 1KK2A 1AKYA 1SRQA 3KV1A 3PXEA 4LHEA 5CFQA 2JK0A 1CQJB 3FYUA 1DP4A 4M6WA 5JYEA 2WJJA 4X7MA 4BL5A 5JCPA 1QH0A 2DOKA 3WISA 2RGYA 5EERA 4ID3A 4G5FA 2P8SA 1RM0A 5EP1A 4PLGA 3U17A 1XA4A 4CRWB 3AFGA 3ZBUA 1QIEA 2Z3WA 3FYDA 4FT4A 1KJNA 2HL6A 3HPRA 4UXHA 2XMPA 4RY0A 3VX4A 3WMRA 3HDTA 1V3TA 1QNMA 2B3DA 4X90A 4OMCA 4NHOA 4ZCRA 3DUFA 2CLMB 1HF9A 1GNRA 3ADCA 5EEHA 4FEEA 4K3UA 2XKKA 1KR2A 3ICVA 2OG2A 3IUNA 1E1RG 3B9BA 3QXXA 3H1EA 1OFVA 3GVCA 4PGAA 1G9XA 2XUGA 3GJ4A 1Z73A 4BFVA 5GADl 2PVPA 2AC7A 1LF5A 4F91B 4GOMD 4KVZA 4H7HA 3S8EA 5JWRA 2PZBA 4KEAA 3GOQA 3KKLA 4JVSB 3LY7A 4XA8A 1BFUA 4MR7A 1EFUA 3OTOB 3QGMA 4M87A 4Q0MA 4E1BA 3RK3B 4ZMSA 4FZ0A 5K0EA 2L42A 3ZGXA 3T3NA 5C2JB 3AK2A 3EAGA 3EAFA 2JLUA 2NU7A 2VHUA 1OTXA 2OSBA 4TMTA 3FTCA 3B1JA 3IEPA 2Z2JA 3UJHA 4F86A 1GT91 2XDYA 4IYJA 1E2FA 5ALZA 3EC1A 1N34O 1H8AA 2XMQA 4FFKA 2O1WA 3C6KA 1IAQA 2OB2A 2WJ6A 1C0PA 3PHIA 4UM5A 4YMUA 1CG6A 4ETWA 4DWWA 3DF7A 1EXNA 2O8VA 1HBJA 3P2KA 1LI7A 4MW1A 1N6KA 2YR0A 1R74A 3RCBA 3B3GA 1JLLA 1G6OA 3KYIB 3PF8A 1KBQA 4YAJA 1E9CA 2R1VA 4MWSA 1PZGA 2VCYA 1TRHA 1H2FA 4X7BA 1ZKDA 1PSZA 1XLTC 3DA8A 4MMZB 4HGRA 3F73A 4IZIA 1CX9B 2XXAB 2VSFA 4D99A 3CNQS 3ZCRA 3H32A 4R4LA 3TG2A 4FMDF 4TX1A 3ZOZA 1SQ6A 2PU7A 4BKUA 1RKXA 3C7CB 3TNUB 3O9MA 1AQJA 2A5YB 5FWXA 3ANXA 2H1HA 4IOIH 2VJMA 2AGVA 5JMOA 4PLCA 2A57A 2XRMA 3RSFA 3DNPA 3VOBA 3DTVD 4ZZ3A 2BFBA 1W7AA 1BCSA 4ZAGA 1JHXA 4MN4C 3ITKA 5CB4B 2QW1A 1J2TA 1TOAA 2B35A 2PMKA 3D6FA 2YUIA 4DBLC 3R20A 2DQ4A 2FWBA 1ORTA 1VQ6P 2F3RA 4S1WA 3CZ9A 5CP8A 2R60A 2QJFA 2PI5A 4LMPA 1W48A 3A0BH 2OKGA 1GL2D 1YZKA 1G38A 3D4LA 2ZRMA 4DMGA 3R74A 3OTOO 4FYHA 1USKA 1DC6A 1II0A 3A4NA 3U9TA 2VUSA 2VDWA 1YMVA 3G2MA 3U44A 2F8TA 2NT3A 5IKOA 3BFRA 5JNRA 2C95A 2GHIA 4IL6Z 5F1OA 3FNHA 3MGNA 2NUAB 1WXDA 2QUZA 1JVBA 3LCJA 3LT2A 1PJLA 1YMUA 4WIAA 1EXDA 1C7RA 4JL6A 2G88A 1SZCA 3B77A 2YY7A 4YR9A 4YMSA 1SHUX 4JS0A 1NKTA 5L3SB 5LP6F 1YXBA 4C76A 4DOJA 1JSLA 4I1PA 3ELUA 4Q5IA 2ZSHA 3GRFA 5JCZA 2GPAA 2EIMC 4IWYA 3TD2A 2HDHA 1PR6A 5DHUA 1EFDN 3GCWA 5TS2A 1K8RA 4IEEA 4TMZA 2VWHA 4KK3A 2EBHX 4TV8A 3BKWA 3UW1A 1T3GA 4KWHA 4ENWA 3GGJA 2J67A 3NZEA 1DOAA 3UF0A 3MP7B 3GLGB 2OCGA 1Y76A 2WF9A 1VI6A 2XWSA 4KYIB 1MB2A 1WTCA 3DOHA 3GVXA 2BGKA 4LZPA 4DSNA 5H6RA 3GT0A 4ZKEA 3NTLA 5EQTA 4BO0A 3K0EA 1DKQA 4CM8B 3NVAA 3STWA 2HTFA 2P5TB 2PNFA 1TJYA 5EQFA 1ZR4A 1PWZA 1FQJA 1U0EA 3EG5A 4G0OA 1SC5B 1IFPA 4GX0A 4BV8A 5F5NA 2IU0A 3NHSA 1J1EB 5L3FA 1NJIQ 3E9YA 2PKRA 2HF9A 4KWEA 2A0WA 1EUYA 4QWWA 1C9MA 2CTPA 4ARUA 3LIIA 3WNBA 2VTEA 3IAYA 2PKQO 3TI9A 2PIDA 4WESB 1SQPG 4HAOA 4C0XA 4Q66C 4DJEC 2C1ZA 3FCYA 1JFFB 1VPDA 3QEMB 4KR6A 3IPXA 4CEJA 1SQQG 2VKTA 4OHMA 1YR1A 3C4JA 2PEZA 3UAXA 2PY5A 4CIYA 2V7QG 5AW8B 4WOCA 1HORA 2DUMA 3KS9A 3MINB 3QU5A 2RKBA 2Z95A 1UWVA 3PR2B 4DIKA 1YBMA 1EFRD 1L7OA 3WTCA 2GCGA 3AE2C 2J8ZA 4IGAA 1PLJA 4KXLA 4JI1B 3Q0TA 4AMVA 4MJ7A 4R50A 3T34A 2RJNA 3O94A 2QK4A 4LDPA 4IUDS 5C4GB 2AKAB 5FBZA 1KILB 5G3YA 2C84A 1RHKA 3BDIA 1FFCA 1OCEA 2JPDA 1N2JA 4QNMA 4AUKA 1PS0A 3AEFC 2EW2A 4D8UA 3QHPA 4F2PA 1EVKA 2G8YA 4CLOA 5JTUA 2WHEA 2XUHA 2IWHA 3TVTA 5CA0B 5I9NA 2O48X 2D13A 4ER5A 1PJBA 5KKZC 3KKKA 2VJNA 1CR4A 5AQEA 3QUAA 4WQMA 3RS2A 1BMQA 3EZ6A 2A45I 3VBBA 1V41E 3OTIA 3CWCA 3OSZA 2DW3A 4BX9A 2I2AA 4B4DA 4B1FA 2OFPA 5EE1A 4MITA 1U8FO 3RSQA 1O0CA 3A2FA 2G5CA 3M9QA 2B34A 1KP9A 1UXGA 5JNLA 1PJSA 1V43A 3OR6C 2AF4C 4CF5A 1C9DB 3L1KA 3NTXA 2FJ0A 4JLMA 2UZAA 1MMMA 4FUTA 4JLPA 4FLZA 2HZ7A 1LW7A 1L5GB 5CVDA 3L9WA 4YCCA 1KYOF 3BN3A 1NF8A 2NTNA 3NS7A 1SCIA 1RHUA 5A5FA 1YS1X 4PEVA 2BKXA 1NW3A 1GV1A 1H2GA 3VNAA 4J3JA 4R2HA 2SKDA 4HDSB 4Y18A 5HMMA 4BOYA 1KBZA 1GCOA 1PJ2A 4XDGA 4HRXA 4G24A 2CDRA 1NU1E 3ND6A 2XRFA 4E09A 4PNHA 2QX8A 4YLYA 4Q02A 4BXLA 5HK9A 2R9IA 2R6HA 3SEAA 5JH7A 1U1IA 2YIDA 2OBMA 3RK3D 3PE4A 1LQTA 3CXCU 1F4NA 4DGQA 4KQGA 2G17A 4OHYA 2R48A 4FYXA 5BUSA 4JI1O 4ENTA 4YT5A 3TIGA 1RJWA 5ES3A 4EPXA 4EELA 1ZM2A 3K4QA 4WVLA 2MKVA 2I7DA 3C8MA 3CISA 3NKVA 2XITA 2CBZA 2Q3JA 5JNVA 2RBKA 4FFNA 3CXHI 1DBIA 3SQOA 1XPUA 1W96A 4ETNA 1HKHA 4LX0A 5A0TA 3IEUA 4OHZA 4AVYA 4CR8A 2WE7A 2F1RA 3ONVA 2CVQA 1GZSA 1PQ4A 4BCBA 1OFHA 4EG3A 1WA5A 4TQFA 2JFPA 3ZK9A 1U0RA 1ETHA 1KR5A 3W5CA 4DIOA 5KVSA 5FCDA 1QL1A 4A91A 1ZI9A 4PD4D 4KAAA 3WYEA 4CDGA 2XA1A 1HZZA 4LVUA 2FEPA 2OCIA 1WSWA 1NXVA 3M06A 3VYSB 4V38A 2J30A 5G4KA 1I2MA 2G83A 1R88A 2M6SA 1XNJA 1DK1A 1E6WA 3CRNA 4X3OA 3GDFA 1F2TA 2NVUB 5CGZA 4WE3A 1YKFA 5IC4A 5JRDS 4YMWA 4L4YA 3PWZA 2BSKB 1Z18A 4KSCA 1CUBA 1W88A 1O95D 3K08A 3OW2O 5K6RA 3FLBA 2K9JA 2OZEA 2A8YA 4J0GA 2CLOB 2PGXA 1E79A 3AHEA 1DRVA 1EQUA 4R2KA 1TI7A 1QBZA 1EZVH 4ALJA 2PD4A 4PV1B 3X2SA 4ANFA 2AQHA 1QGAA 1Q16A 4E0BA 3TZCA 3LUFA 5LQSA 4Z1VA 4I66A 3OEWA 1FFDA 3FW1A 2CLHB 5CA1B 2X8LA 5KU1A 5KEIA 1RBMA 2FMXA 3AHGA 5BYAA 1WU7A 3O2SB 3DM9B 3IAM6 2WMOB 4LR3A 4BMYA 4HI0E 2HC9A 2F64A 4RHUA 1RAFA 3KG2A 1VL0A 5KCMA 3TCKA 4LRSB 1FLVA 4TMYA 5EZ6B 1XNRB 5B5EZ 2HBYA 1V54B 1UP6A 3LDDA 2R8YA 4WBNF 4OMDA 4BQPA 1J95A 1E5VA 3TB4A 1Y98A 4B71A 1G98A 2XTNA 1V16A 4J76A 4F3KA 4F3NA 2B9EA 1AU9A 4LQ4A 2WDZA 3ICPA 4R3UC 1E64A 1Z7GA 1E8MA 1VC2A 4PNZA 3HJCA 4MB6A 5FBWB 3GJTA 2XYQA 4C5CA 3AE3C 5ALHA 5F7ZA 4MSUA 4HQ0A 5EZQA 4IQFA 4ZI7B 2XB4A 3I37X 3JRWA 2X6CA 1Z36A 3AVUA 3DDUA 1KIMA 3CC2V 5DOZA 4TYMA 3F89A 4N8DA 4NFLA 2PF4E 2JIBA 2PJUA 5FOXA 1N1DA 3H9UA 4XWKA 1P1KA 1UM8A 1OAKA 2Y27A 1ZJ5A 1F6DA 5HZMA 1W0KA 5A3JA 3O2NA 3L36A 4BO9A 1VSQA 3SFDC 1B0UA 5BO5A 1L7XA 2D2CB 1QVRA 4O4JA 3R8XA 1UZMA 4HNVA 4EHNA 1T6NA 1SCJA 2A4MA 3IAS6