4LC1A

Meab, a bacterial homolog of mmaa, bound to gdp and crystallized in the presence of gdp and [alf4]-
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
326
structure length
315
Chain Sequence
TLPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Methylmalonyl-CoA mutase accessory protein
publication title Autoinhibition and Signaling by the Switch II Motif in the G-protein Chaperone of a Radical B12 Enzyme.
pubmed doi rcsb
source organism Methylobacterium extorquens
total genus 122
structure length 315
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4lc1A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4lc1A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lc1A02
1XEXB 4IDOA 4KHZA 1A2BA 3I92A 2VHCA 5CYPA 1AIPA 2WHXA 5CM9C 5DI3A 4L9WA 3A1TA 3A36A 2CJWA 2ODWA 3ZVRA 4XWOA 5KUTA 3UPUA 1YQTA 4CEHA 5AJXA 2CK3A 2ZI7A 1GU5A 2XJ4A 2GNOA 5AVRB 1UBFA 2ZSBA 5HCIA 3IHWA 1HT1E 5JI3E 1S8FA 2IXEA 5UKDA 1RYHA 4M22A 2V55B 2G1KA 4W5HA 3UKDA 1DH3A 2DYKA 2PCJA 4E07A 3KKMA 4NL4H 5KDLA 4NCIA 3KB1A 2ZVPX 1Z06A 4A15A 3H4MA 1OV4A 4H1VA 3RAPR 1KI7A 3U3JA 4MRPA 4JAUA 3RWOA 1AS0A 3CX6A 2WJGA 2O8EB 3TH5A 2GEDA 5DI9A 1YR7A 5FBQB 3CRW1 2RHDA 5G41A 4B2PA 1FFHA 4OK6A 1NBMA 4GL2A 1OKKA 2C9CA 5K8TA 1P9NA 3TNUA 1EFRA 4DSOA 1E0JA 3UMSA 5APSA 3MRSA 4QL3A 1UADA 2FEOA 1IONA 2EYUA 4KXFB 4JLAA 1M7HA 2QBYA 3KKNA 5B1OA 2ORVA 2RH5A 2ZYVX 1AKEA 2GAAA 2REOA 1CLUA 2Z5IA 2YOGA 4DT1B 4NTZA 4XVUA 4DLRA 2ZR7A 1FMLA 2A5GA 3RNLA 4DWJA 2YJTD 2J7PA 4KODA 3PUWA 1G5TA 2X2FA 1LVGA 5FBLB 1E9SA 1MT0A 1II8A 4WXPA 1ODFA 4G5OA 3GLHE 1E98A 4NCJA 1XJQA 4HDQB 1FNMA 5BXQC 4GMXA 2KBFA 3HU2A 4AIIA 2ZREA 4RFSB 4BQSA 3GJ7A 4C4PA 2HT1A 1Z6XA 3SDZA 1B23P 2WM9B 2ORWA 4B48A 3KQHA 2ATXA 1E96A 1M2OB 3A7OA 1QHIA 1VKJA 4KO8A 2OCAA 1KI2A 3OAKA 4ITRC 1J90A 4LHZA 3SFVA 4EQ6B 4UNPA 3KB2A 4IDNA 4EFNA 2ZVQX 2N46A 4M9ZA 4Q1FA 1ZD1A 3GLFA 3KJHA 5TV2A 2RCNA 1GILA 4Q03A 2OAP1 5AW6B 4JBXA 3LXXA 1XEFA 2J45A 3P4XA 5JWRA 5KDDA 1Z6YA 1XMSA 2ZXUA 4LJ6A 3DMDA 3ZVLA 3LLMA 4TYPA 1HBWA 4EJSA 3VKHA 1D2NA 2RB4A 4JYCA 3OIUA 1IY0A 2WSSD 1KDOA 3V4WA 3HYTA 1T3SA 4EPYA 5JS8A 1JAIA 2OILA 3THWB 2JJ2D 1F2UB 1W7AA 1G3RA 1W4BA 1KI6B 1OH8A 2FNAA 1S96A 3ZVMA 2F43A 2OBMA 1LY1A 3D31A 3AB3A 4ILEA 1D9XA 3X1YA 4R71A 4PHHA 1U2RA 2GRJA 4WVFA 1T5IA 4Q4LA 2O0KA 1XD2B 3FHTA 2DB3A 4P31A 4KFSA 4LHVA 4M9XA 4ZDKA 5BN3A 3W5IA 1PUJA 3ECCA 4C0KA 3X1WA 3UIAA 4KSBA 3PV0A 4JT2A 4DDUA 1MV8A 4NPHA 3OE7D 3HE5A 1GVNB 4WW0A 3R8FA 2ZRGA 4US1R 1F2TA 4TMKA 1UDWA 3B60A 4WZBE 1ZM4A 5SZKB 1FP7A 3UG6A 1G3UA 1G8YA 4C30A 1N6LA 4A2QA 4B6EA 1J2JA 3H0KA 5M04A 4MRVA 4GRAA 3W3AA 5IT5A 3ADCA 3U44A 1M34E 2NO0A 5JEEA 3K70D 1UKZA 1E9EA 2XTMA 2QGZA 3D36A 1E32A 1LV7A 2C78A 4JKYA 2WWFA 2WBLC 2VBCA 1CTQA 1P2VA 3THYB 3K9NA 1SVMA 3DKVA 1U0JA 4ACAA 2SHKA 4W5WA 1JUNA 2ZE7A 3REGA 3PUXA 2BCGY 1W1WA 4BGDA 4HATA 3HWSA 1DAHA 1U8ZA 3LW7A 3W34A 2UVQA 3A1SA 1US8A 3O47A 2BKEA 2WZQA 4JLDA 221PA 3M0DA 4D80A 3ND9A 3NH6A 3EPKA 2XOKD 2GTPA 2HXSA 1SXJD 1J8YF 1ZNWA 3ASYA 4I2LC 4KV9A 4I6MC 1IJFA 1E2EA 3ZRWB 5J5CA 1FTSA 3KQUA 1AZSC 1PZNA 4HB0A 4I1VA 1XXHB 3CNNA 3M1IA 4ZO4A 1KJZA 3CWQA 4K46A 5K8IA 2V6JA 2DWPA 4C7OA 4EPVA 4ABYA 5DGXA 2JEOA 2BEKA 3LXRA 3SI7A 4Q02A 4MDFA 3G0HA 1T8UA 1XCGB 3E2IA 2W6JA 3IO5A 3THXA 4IDPA 4L8GA 5APVA 3BFVA 2WOJA 3KZ1E 421PA 4ESHA 2ZJ5A 3QF7A 4HLDA 5FI0B 1F60A 3HE4A 1NBME 1Z29A 2AXNA 4XE5B 2AN9A 1RFLA 2FGKA 1OXXK 1NLZA 2MSEB 1KNXA 1DAMA 2FG5A 4M1MA 3SJCA 1P9RA 3EIHA 2XV5A 1WBDA 3UMRA 3EZ7A 3PG5A 4RCZA 4WZ6A 1MO6A 5AW4B 3QXJA 4XSHA 2VP5A 2I1VB 1T6NA 4UNNA 5GVSA 3QPUA 4IVRA 821PA 3QNUA 4XVRA 4O3MA 1DELA 2ECKA 1FNNA 1ZM2A 2C9YA 5F2EA 1J7KA 3SYLA 4LJ9A 2LWIA 2W83A 2D2EA 1EG7A 2HDNB 2P5SA 3L43A 1KSGA 2AKAB 1FW6A 4M4SA 5J47A 1H65A 2OV2A 3TR5A 4KU4A 1RVDA 1RRGA 4IDHA 4TTRA 1XCPA 2XU6A 2J9RA 3A4NA 3W3ZB 1JI0A 1F6BA 4MYTA 4EAQA 4ZV4A 1H88A 2ZEJA 1GK4A 1YHNA 5EXTA 2WAYA 4TL8A 2BJWA 5JS7A 1G19A 1JB1A 2YYZA 4FMCB 3QOFA 2UZIR 1N6OA 4Q4JB 5C1BA 1DG3A 3TE6A 4IFBA 3SE0A 1DBSA 3A4MA 3GLFE 1E6CA 2FFAA 3IIJA 4HI0E 1MO4A 2N1BA 2PCLA 4D4JA 5FL3A 2G3YA 1DPFA 1GAJA 3VR5A 4URVR 4PZLA 3WHKA 2IPPA 5AW9B 3AGPA 1ZD8A 5HTKA 4HUTA 3D7MA 2ZRCA 3QBTA 3QI2A 5JMTA 1HA3A 4FI3C 3BIFA 3BAFA 3M0AA 4DDWA 1CBUA 2QI9C 3PEUA 2C2AA 1Z2AA 1E1QD 2CDNA 3NXSA 1GG2A 2KSQA 1AGPA 2Q7CA 1MO5A 5EQTA 5L8VA 3QG5A 3A1WA 1S9KD 5DO9A 4AI6A 1P5ZB 5DE3A 3QKRA 3OEHA 1DTSA 3CW2A 1ZYUA 4Q9JA 3UANA 4AKHA 5KNBA 4ZI3A 1ZMXA 5FR2A 2XNSA 3BRWD 4AYWA 2J0VA 4B2IA 2WT7B 3NBFA 1QVRA 4LV8B 3T12A 4BLQA 2IYXA 2WWGA 3AF2A 3TNFA 2VHQA 2ODBA 4EJSB 1EWRA 5EXPA 3QVUA 2ZRIA 3A1VA 3ADDA 4G5RA 4U02A 1Y3AA 4F7WA 2E1RA 2V7QA 4PQRA 2PJZA 1J99A 4P32A 4C0BA 1JAHA 2JJ1A 1KKLA 1UKEA 3X1XA 4E09A 4S2EA 1VTKA 2QMOA 1RJ9B 4YLGA 1G41A 5H8WA 2Q3FA 1YZQA 2VRWA 1QHXA 1BYUA 1X3SA 2ZTSA 3N2EA 4LZZA 1HQYE 2ODNA 4PQFA 2EU8A 4TSFA 1E1RD 2V8OA 1HYQA 4JLBA 2ZJYA 4C0JA 4RVCA 3VYIA 1U9IA 3TAHA 1E0SA 1OIWA 1KO5A 3ONWA 2H7VA 5HCNA 2PT7A 2ZJAA 3FFBA 3W8RA 2A2ZA 1II9A 4ZCMA 4DJTA 1Q20A 2GAOA 3FB4A 2MSCB 3K8YA 4OQXA 3WYGA 5J4HA 5L3VA 5DSZA 3U3KA 1G5PA 1QRAA 2Z83A 5FTMA 1G8GA 1T8TA 3RYTC 5TY0A 2HLDA 3I1FA 4I99A 2OO7A 4QJ5A 1M7GA 3NFQA 3X2SA 2GJAA 4KLZA 5DNYB 2KE5A 3CX8A 2NPIA 4DHEA 1IOZA 2GHIA 2WPSA 1TEXA 4TL6A 4ZDWA 1YR8A 3U7HB 3F8TA 4NE2A 1T91A 2GXUA 4DEXA 5F9FA 4Q7JB 3PFIA 2CBZA 4RZ3A 1NVXQ 3FMFA 3KQLA 4Z8XA 1Z07A 4FCTA 4ARZA 2AFIE 1OIVA 2AR7A 5IDVA 3SOPA 4IOJA 4JJKA 2BMDA 1GP2A 3SWFA 3CUEF 3DVLA 1GZLA 1KDRA 1ZM7A 2XJ9A 5GJCA 3I8XA 1D8TA 3SYNA 1OB5A 4D25A 4DUGD 3QKSB 1KO1A 4TL9A 4LJYA 4PC7A 4PSKA 4BFUA 2LCFA 4M1YA 1TUEA 4XIGS 3IBGA 1G3QA 4BFVA 2JLVA 3V4QA 5AJYA 3TW4A 5J40A 1CRPA 3ZH9B 2YWEA 3KXLA 1U0LA 4A2PA 1PV4A 4BEBA 4YMSA 2QM8A 5E4FA 1GTWA 1Z08A 4D6PA 4V0NA 2GCOB 2OEPA 3QXSA 5G3YA 3AM1A 2WIBA 1MV5A 2ERXA 4QGGA 1DEKA 3LX5A 1HY3A 2ZUDA 1RPZA 2GCPA 4GI7A 4F91B 1FOSE 1QHHB 1W0JA 3K1JA 4JLJA 1TUIA 2R44A 5GVRA 2FJUA 3LBNA 5DHFA 4LJ8A 4A92A 2QP3A 1SKYE 1XD9A 2JGNA 1XFAA 2WKPA 5JJLA 1A02F 1HE8B 1XTJA 2NO6A 5FUYA 5L3QB 2RGAA 1CSBA 2QQ0A 5FOUA 3RANA 2B8TA 3ZD6A 2VP6A 4O0MA 3UMFA 1BMFD 1RKBA 1JXOA 4PHTA 4C3ZA 4JASA 2V3CC 4PC1A 4AC9A 4A0HA 2WICA 4HZUB 5J4LA 1SGWA 1E0AA 4DCSA 2BEJA 4FW9A 1M6NA 5DH9A 4Z1MA 5JHHB 1VCOA 3HDTA 4ZKEA 2PEYA 3I73A 2QA5A 5A0FA 1Q21A 2GZAA 1CF4A 2Q9CA 5TMPA 3OAAA 1CZQA 3Q7PA 2GBLC 4ERNA 3EASA 2OUKA 3NMDA 1RE0A 1Q1EA 4JMPA 2GXSA 1ESNA 3EZ2A 2IUSA 1P6XA 1U94A 3N5CA 4PPNA 1R8SA 2KI5A 5J4KA 1Q57A 3R9XA 1Q1QA 1XPUA 1Z47A 3DDCA 1E99A 1OFTA 5CJ2A 3GFTA 3R7WB 4LWZA 4CT5A 2H17A 2QL6A 4RD6A 1XTIA 1KI3A 2P67A 3VR1A 1OHHA 2XXAA 1RYFA 1OH6A 1OH5A 4JLNA 1FL9A 1Z6GA 1EX7A 4OI1A 5LPNA 1Z63A 1WA5A 2BM0A 4D81A 4M9SA 1EFCA 5AW2B 3EPHA 3IPYA 1XX6A 3UXMA 2Z4RA 2XGJA 2EW1A 1CU1A 3VNUA 1BYIA 2A3RA 2CLDX 3BS4A 2QU8A 3BERA 3K9GA 2GK7A 3F3YA 1HQCA 1XMVA 1GZSA 2NO1A 1OWAA 1N0UA 4JVSB 2W27A 4B74A 2XSZA 2CLCX 4PPQA 3O8CA 1NY6A 2G0NA 4KHXA 2HYDA 4OK3A 4MH0R 1F51A 1HV8A 4HLUA 5AJWA 5C93A 4TZ6A 2WIAA 4XWAA 2GXAA 4DLXA 5IF9A 2YC4C 5AR1A 1E94E 5HPYB 2IS6A 3KTAB 4A82A 4FMDF 4MRNA 2WWHA 4CW7A 3ZZUA 3RRYA 2ZRBA 2AXPA 1Z0KA 2FFQA 1OKKD 2O0HA 3HPRA 4UKDA 3A1UA 2O5VA 1VCIA 1CJUC 4Y0VA 3WYAA 1FUUA 5E95A 4HB3A 3AUXA 3NDBB 2ZITA 3GLGB 5CIWA 3NBZC 3IEVA 3P20A 4LBYA 2G0TA 3MJHA 1VMAA 4PFSA 2JLSA 4MGZR 4MKGA 3E1SA 1A5TA 3AVYA 2O8DB 5KU1A 2WJIA 3GCGA 4IHQA 4AURA 4G0NA 2R9VA 8OHMA 5FOXA 3VMYA 2YOHA 1A02J 1E2FA 3KXKA 2BWJA 3MMPA 1NKTA 2O0JA 1YE8A 1X86B 2A30A 4PO8A 1P60A 4JSTA 5AVXB 4J0QA 4Q7LA 1SXJE 2IYRA 4JLPA 1KI8A 5E7MA 1TQDA 1JEDA 1GRQA 4IOKA 2WJHA 3DHWC 5AJZA 4CDGA 4Z51A 2RGXA 4WZAE 1AS2A 1KJWA 2C96A 3CONA 3FVQA 3AVUA 4KSCA 4A6PA 3WNCA 3NWJA 1G6OA 3NEJA 1P75A 4WA7A 1EK0A 3NBYC 1T0JB 3X1DA 2ZE5A 4FIDA 1S3SA 4LPKA 1OIXA 1VG1A 1SLQA 1RW4A 2ZSAA 2O8CB 1FAVA 5KO2A 4QPJA 3OZXA 4EFMA 3DGEA 3WP0A 4PHFA 1Z0AA 3WMEA 5JJKA 3HJNA 1RRFA 4YDHB 3QKUA 4RSGA 2W6IA 2RKOA 4XTCS 4ASUD 4CVNA 3RC8A 1GKUB 2X77A 2IUUA 5JWOA 3TK1A 2D06A 1W46A 3EZFA 3A6PC 3EWSA 1H8HA 3B8EB 1CP2A 3BC1A 4HSEA 1NMZA 1NF3A 3GJXC 2VP0A 3P8MC 1G7CA 2ZI5A 4NCKA 4PC6A 4RZUA 1YZUA 4C0LA 5JSZB 4R2IA 3TUIC 2LFSA 4MGKR 4BFXA 5FTKA 2D62A 3UWOA 3AVWA 2JCSA 2NGRA 5P21A 2WTUA 4X8OA 5FR1A 1LB1B 2QE7A 2C5LA 2RMKA 3NTNA 2HJGA 3T1VA 2NO9A 4A8JB 2QMHA 4ZDJA 4I1OA 2WWIA 3A58B 1I2MA 4I81A 2I1QA 4X8HA 5C18A 2BKUA 2JLYA 3SU8A 1IN4A 5E7JA 5KNDA 1GNPA 1S3GA 4YMWA 4UJ3A 1H8EA 3W6NA 2YO3A 2Z6VA 2ZSDA 3AP2A 3H86A 3JVUA 2IS1A 3MD0A 4IKEA 5KPJA 2OBNA 3CRRA 4IFEA 4LSGA 5AW3B 5LB2A 4LPSA 1LF0A 4Q00A 3GP8A 2C9LY 5D3MA 1G3MA 3QXHA 1R8QA 2QN6A 5EZ5A 1ZU5A 2AK2A 2IL1A 3C5CA 2X1VA 5FTJA 2KJQA 1G16A 2BOVA 4JSYA 2WPDA 2H8KA 2O52A 2XTNA 3B9PA 3BFKA 2VP9A 3MJRA 4AYTA 4FD2A 3FKSD 5FPTA 2ZJ2A 3AF4A 2CCKA 4N1AA 3T06B 2BM1A 4F4JA 4LI0A 4A9AA 1Q22A 3JZMA 4JLVA 1OPXA 4TQUS 1G7RA 1EWQA 3QF4B 3ZQJA 5HZHA 3LWNA 2OXCA 4RESB 2R5DA 1XJCA 4O2RA 4RKFA 4TMZA 1UPTA 4B32A 4U5XA 4RKEA 4W9MC 4PTLA 3PJRA 3NDPA 4R98A 5LDDC 1H8AA 3RABA 4Q66C 2ZS9A 4HAVA 2ATVA 1XB2A 3IQXA 2VH5R 1M74A 1YZLA 1MH1A 1TF7A 3WMGA 4QG7A 2NO7A 4JVNA 3K0AB 2BMJA 1UM8A 3RC3A 3RRNA 3GFPA 4V0KA 5APXA 3RHFA 2H57A 2ZANA 3QXCA 3R8CA 2IWHA 5IK2D 3FHCB 1VCNA 2ZIAA 3K9HA 3LLUA 4Q48A 2IS2A 2QNRA 1BH2A 3VX4A 4HAZA 4DRZA 3PUYA 1G18A 3CR8A 3RS3A 2R6DA 3OESA 2ZUBA 2FA9A 4F4IA 3VU9B 1S4QA 3V4RA 2ORIA 3EARA 3EG5A 3CBQA 3M9HA 5FBRB 3KFVA 4TLEA 3WBKA 5FUVA 3BFXA 4OQMA 2OSBA 1DOAA 1X8KA 4LCBA 3VKGA 2FPMA 3EC1A 4LBWA 1C4OA 3U7FB 2IEYA 5AW7B 5DYGA 1IXMA 4GFDA 3ZRXA 1NMXA 2CXXA 2IYQA 4D2IA 1XDBA 2V4ZA 1WRBA 3REFA 4NYIQ 5KSZA 1TU3A 2E87A 2J87A 1E79A 3GEEA 4AD8A 4HEJA 4GOJA 4CF7A 4C0AC 5KYKA 1MRNA 3AVOA 4O25A 4US0R 4DLTA 3FMIA 4EPTA 2FE4A 3GLHB 2XB2A 3QIAA 3TGPA 2GKSA 2IHYA 2F1RA 3B82A 1HEIA 1ZBDA 1G1MA 1SULA 4B6FA 3H1TA 5DYIA 5J4VA 3E5HA 1YRBA 5LD2C 1HURA 4LGMA 1I4LD 4MUAA 5G40A 3VMXA 2NZ8A 4JLOA 5AUOB 2JDIA 3NBXX 2ZYTX 2AWOA 1TQ2A 3PR1A 1NKSA 1P62B 4AKIA 2RGEA 1ZNZA 2IW3A 4UNRA 3CF6R 1NG9A 4KP4A 1W2HA 5BW8A 1NN3A 1QBKC 3MGCA 1VIYA 2XNDD 4QHSA 2FF7A 4JL6A 4QM6A 4EOTA 1ELOA 4PX9A 2C03A 2H7HA 2XTZA 2YWGA 1XEWY 4V03A 1XEWX 4ZIRA 1OH7A 1VG0B 2IWRA 2JIZD 4YMVA 2WPQA 1D5CA 5C4MA 2J59A 2YV5A 1UEIA 1N6NA 2GZHA 4XD7A 1N5LA 1E9RA 4HZIA 1FX0A 4DC9A 1G4AE 4OHWA 4E22A 3O8DA 1NJGA 3OFND 3ZIAA 1D9ZA 3T97A 2VP4A 1X8JA 4DZOA 1COWA 4B47A 5CDFA 2E43A 3GQBA 1U8AA 4MRSA 3T1QA 2C9OA 5AUPB 3AKCA 721PA 1OXUA 1EFHA 2CLSA 5TVKA 4RY2A 1I4DD 4CRWB 4TMXA 1EX6A 3M6AA 4RZXA 4TTQA 3IIMA 621PA 2XEXA 1K6MA 2YINC 4QM7A 3KKQA 1GWNA 3ZQ6A 1Z22A 5CB6A 2RGDA 2WVJA 2WWYA 2ZS7A 1U90A 1LS1A 2PEZA 2BV3A 4M1OA 4Q9KA 2D3WA 5L3SB 1AQUA 1N5KA 2JJ1D 2WJVA 2ZRNA 1W36B 2IXFA 2EWWA 2QP4A 3T1OA 2XZOA 4PC2A 3EPLA 1XBTA 3C4JA 3I8SA 4UXIA 3UK6A 5K8UA 4YXWA 1G9XA 1EFUA 1XJ0A 1NLFA 4LYJA 4IOLA 5C4GB 4NONA 1U9IC 4QHTA 5FUWA 1Z5ZA 2ZPTX 2BBWA 4LC0A 1OFHA 4GNKA 4U00A 3WYFA 1VIAA 2ZETA 2EFCB 1UKYA 4M8NE 1YZTA 2O8FB 2V9PA 3K70C 2FN4A 3DOEA 4HLCA 2J0UA 4Q4AA 2ZRJA 4MUBA 2QAGB 1R2QA 5DN6A 5GJBA 3FKQA 1Q12A 5HE8A 1P3JA 3CB4A 2REXB 4D4KA 5LB4A 4Q01A 3BH6A 2VO1A 1UAAA 3S1AA 1DAKA 4TT3D 1S2MA 3KQNA 1KK2A 1W2GA 2HEIA 4UXJA 4FMTA 1ZM3A 5JCPA 1XMIA 1G7TA 1I4TD 1T4GA 2P5TB 3L82B 4TL7A 4CT4B 1XD8A 3NC1C 2FSFA 1E69A 2OG2A 2JLZA 1SXJC 4LV5B 2IC5A 3B8HA 2IYLD 4NP6A 5DI3B 3TJZA 1OSNA 1GM5A 2CJWB 2BVNA 4CEHB 2WJJA 3KKOA 4JVLA 1JEEA 4NHOA 4K8OA 4HUQA 1FP6A 1KSHA 1QG2A 4DCNA 3DZ8A 4NZYA 3L36A 3CF2A 4V0LA 3PXGA 2A5FA 2VRSA 2G88A 4LX0A 1Q44A 5FPSA 3NG1A 3ASZA 4QC2A 4C7NA 1CRQA 1FQJA 1CJKC 3RRZA 1J70A 3CM0A 3DOFA 3A8TA 1N5JA 3TW8B 5EE0A 2JJLA 3VR4A 1XCMA 1VDZA 3SFZA 1P2TA 3ZGXA 2VF8A 2JAQA 1IN8A 4Q9IA 2L0XA 2ZE6A 2ZRDA 3B9QA 3SJZA 2LKCA 3TNUB 2J0SA 1FZQA 4MGIR 4JAVA 3VAAA 3KJGA 4XTRA 1T3HA 2J41A 4GOKA 2D4HA 2KWIA 3GMTA 4BIZA 3Q7QA 3U7EB 2QBYB 4QKQA 1ZJ6A 5AW0B 1G20E 1R7RA 3M4YA 2PL3A 4WBSA 3NH9A 3LA6A 1AQYA 4HDOB 2O8BA 1G8FA 2RHMA 1CS4C 4P4TA 3IIKA 4NMMA 1YRAA 1IN7A 1G4UR 2XZPA 2ZRKA 2WKQA 4G5SA 1ZP6A 2QUZA 521PA 5EP4A 1JR3D 2VLIA 3B85A 3FYHA 1VECA 4GPTA 1II8B 1MOZA 2ZRHA 1GKIA 5FL7D 1OFUX 5A5GA 3QXXA 4L9SA 4I1UA 2NPFA 4EDHA 1K5GA 2HV8A 2E42A 1E2KA 4XWKA 1UJ2A 3KUDA 2GVDC 2CCJA 1DARA 1R5NA 1N25A 2CNWD 2J1LA 3U6KA 1WB9A 1YR9A 3KJEA 2DFNA 2ZRLA 3MSXA 1G64A 1QDEA 4C0HA 2NTYC 1CJVC 4RD1A 3TIFA 2WSSA 4TYWA 3W6OA 4DSUA 4R7ZA 2OLKA 2VTKA 4ZDIA 2WAXA 3GLFB 3EZ6A 4URXR 4L15A 3SZRA 4UJ5A 1CJMA 2BJVA 3P32A 1NVVR 3MAAC 2Q21A 5SZJA 2J46A 4M1SA 4URZR 2GESA 4NU0A 4FPPA 1W4CA 1ZNXA 4NKRA 4LYAA 2Q0HA 3I61A 4BWYA 3AKYA 3P4YA 5JJIA 2WWWA 3I32A 2PT5A 4LDJA 2BCJQ 3T5DA 3L2OB 4CEJA 1W0KD 2XAUA 4HDCA 2DFLA 1OE0A 1T2KD 4C0SA 3GD7A 5EXXA 4BE7B 1OW3B 1DAEA 1NSTA 1TQ4A 4AWXA 5CDFE 2CVFA 1E4YA 4NCNA 2F3TA 3TKLA 3OE7A 2E9SA 2FSIA 5L3RA 1OXVA 2F43B 1FOSF 2C04A 3OHMA 4OKSA 4URYR 4S35A 3DMNA 3LVRE 1U0HC 4AKEA 1TMKA 3GPLA 3UATA 1XZQA 2B6HA 5SZIA 2JASA 2F9LA 2B8WA 1YVDA 3KXIA 3LRPA 4BLRA 4D26A 3K0CA 3ND8A 3IKJA 1XRJA 2VA8A 1YR6A 4A6XA 4B3CA 5HKKD 1KI9A 1E2HA 4HLUC 4M1KA 3HE5B 1W47A 2OLJA 2Q3MA 1JJ7A 1QHYA 1Z6AA 3OIVA 1XPOA 1LW7A 1F2TB 4RD0A 3TMKA 1Q3HA 1MABA 4IXMA 5KNCA 4DLUA 2I4IA 2I3BA 3K09C 1KAGA 5AWFC 3LDAA 3VR6A 2BIFA 3KUCA 3B78A 4NYMQ 2NMVA 2BHRA 1BS1A 3B1XA 1P61B 1J2JB 1XF9A 2BC9A 2Z4SA 1AA9A 1UBEA 2MMCA 1OLOA 3U44B 4LJ7A 4BFZA 2H5EA 3KL4A 3QSYA 1SVLA 1JECA 1X6VA 1VYTA 1CI6A 2A9KA 2IF2A 4JLMA 2KB0A 5CJPA 1DS6A 1KY2A 1TQ6A 2XOKA 3KKPA 1SXJA 2PX3A 4LRWA 4OHVA 2GA8A 2R65A 3C8UA 4D4MA 3I62A 2YWHA 4OHXA 1OJLA 3CNLA 4A4DA 1P4SA 1FUKA 2GJ9A 4MYHA 2YKGA 3B6EA 2Y8EA 3TQCA 4IEEA 4BASA 1G17A 1E4VA 1US8B 2Q3HA 4N3NA 3C41J 3DL0A 1VYUA 2FZLA 3MWJA 4PQYA 1FTNA 1UDXA 2GF9A 4D4LA 5FBWB 5APTA 4AG6A 1KDTA 1KSFX 4I5SA 4C2UA 1ZCBA 2QPOA 3OEED 5FH9A 2QTFA 5FFMA 5IRCD 1FPMA 2FOLA 2GVZC 4MRRA 2IHBA 3LQQA 4X8LA 1N6RA 4MGYR 1ZD9A 3ADKA 2EVWX 4Q4HA 4HAYA 2ZXEB 3TVTA 2F3RA 4C7OB 4P3YA 2PZEA 1OFIA 3K0FA 2J5XA 2RGBA 2NG1A 3N2IA 5EP3A 1TL7C 1XTKA 3THXB 4QJ3A 1AKYA 1SVIA 3OIWA 3Q9LA 5TARA 5AW8B 3B13B 1N6HA 3RRMA 3BH7A 3HE4B 1KK1A 2AD5A 1P7CA 2W0SA 2R6CA 1WF3A 1SVOA 2DFTA 3QBVA 1L7VC 3TLXA 4RFVA 2VF7A 2ZRFA 1WMSA 2RAPA 3T34A 3CKLA 4QNMA 5EE9A 4F38A 1JJVA 1N6IA 5LBIA 1JNMA 2PBRA 4XVQA 1W36D 1Z83A 4JL8A 4P4UA 4GZMA 2FTKA 1L4UA 3LY5A 2HT6A 4XJXA 1Z0DA 3H84A 5FTLA 2O8EA 5H70A 1YKSA 4POAA 3AF0A 4P4SA 1PLJA 3ZRVA 3AVVA 4BRUA 2PLFA 1CR2A 2NZJA 2YZ2A 3RS4A 2VEDA 4OBEA 1MKYA 3GLIA 1P72A 4TLAA 4D0LB 2EFHB 3ZYCA 4YMUA 1C1YA 1DAGA 2P6NA 4GP6A 5B30A 3FHOA 3CO5A 3EIQA 4F4CA 5LD2B 4W7SA 1G21E 4L5BA 5HZKA 1XEXA 3K0EA 1X1RA 1W48A 2ZR0A 3PUVA 4B35A 4DCVA 5DLQC 2HJVA 2R6FA 1E1QA 4ESVA 3CH5A 1NVUQ 3EA0A 2XZRA 1KO8A 1ZC3A 2ONKA 3Q72A 4V02A 4FWTA 4AY2A 4TZ0A 4N0DA 4D0GA 4M2LA 2P7JA 1IY1A 4DB2A 3M9BA 3GJ0A 3FMPB 3WBJA 2R2AA 3RS5A 2ZJZA 1JQJC 1G5RA 4ZCLA 3I4LA 2QAJA 4TTPA 5KTYA 1IAQA 1EFTA 1Z0FA 2P2LA 3IO3A 1IJEA 3IPXA 3B7GA 1DO2A 2QROA 3BJIC 3NVAA 2TMKA 4BLSA 3IR9A 1WE2A 1E2JA 2BBOA 2CK3D 3AKDA 1ZUIA 5CMZA 3KFXA 3QKRB 4MT8A 1E0KA 5B2ZA 1SQ5A 5CIQA 3T35A 3V9PA 4M9QA 3U61B 2AHOA 1VPLA 2OCYC 4V0MA 1VHTA 1JBKA 3HR8A 4JT4A 2W2VA 3BE4A 3DPUA 4BECA 2PJRA 1GL9B 2A5JA 3SEAA 2PH1A 5BN5A 3V5BA 1IXSB 3FGNA 1IBRA 2GCNA 2IK8A 4QOSA 1E9FA 2C98A 3IHLA 4WIAA 5IHPA 2J0QA 1E1RA 3I5YA 2DY1A 3K09A 1DE0A 2DWOA 4KCGA 4DT1A 1SKQA 4BUJA 1KZ7B 2C99A 3U7GA 3EXAA 1F48A 1NBMD 3HP1A 1WP9A 1E2NA 4EPWA 1EFRD 3AF3A 3B1YA 4TLCA 2WMOB 3QUSA 3BB3A 5EZ6B 3RSLA 3KDPB 1UKVY 2FMXA 1KK0A 1TPZA 1Z0IA 3KQKA 3Q8XB 4I1SA 4FXPA 1E9DA 3AGQA 2YWFA 4RFSA 3DEFA 3R9IA 3NHBA 4A0FA 2FZ4A 1NY5A 4HYYA 5F9HA 1DVRA 2FDCA 4QRHA 1KYIA 1LFDB 3U6BA 3HPQA 3MCAA 2J7PD 1ZUHA 2C95A 3WMFA 5KOYA 2VSXA 2ZRAA 4EQ6A 5AK0A 1UF9A 1OXSC 4ZKIA 4Q1DA 1GIAA 4GMDA 1ZW6A 2ANCA 4JL5A 4OQNA 3FPAA 1W5TA 3LNCA 4YC7A 1IHUA 1O87A 2YNYA 4DB4A 4DLYA 1S1MA 4Z8YA 4DVGA 1GD2E 1NIPA 4QBHA 3U60B 2IYUA 1JPNA 4QPKA 4L16A 1NRJB 5AVTB 2JJ8A 4FN5A 2CE2X 4KITB 1VG8A 5HE9A 2H92A 4DUGA 2WTYA 3PCRB 3ICEA 2V6IA 3THWA 4ARZB 4Q7MB 4L4UA 1F2UA 1GFIA 1KI6A 3LV8A 4MA4A 3A5TA 1M1YE 4LJ5A 2ERYA 2REBA 3LD9A 2OCBA 3B5JA 3C15C 1Z0JA 2OM2A 4PPGA 1XP8A 3QPVA 3TYYA 2F7SA 4AG5A 3PEYA 4V0OA 1DG1G 1NN5A 5EP1A 3PVSA 4Q18A 1XD2A 2YO2A 2GF0A 4EUNA 4DCTA 3GJ3A 2B7BA 3NIBA 4NDZA 3ZVNA 1KI1A 1HUQA 2VHJA 3QVVA 3J81k 4OJKA 3CWZA 4FCWA 4NBSA 4TYYA 5KHOC 1NN1A 3LBIA 1KGDA 2IX3A 3VTKA 4KBFA 2RGNA 1BMFA 4OYHA 3SN6A 3QEJA 4PSVA 1GKYA 2GJ8A 2R6GA 1GNQA 4AQRD 4PR0A 1KO7A 4RD4A 1QF9A 2DR3A 2IYYA 2P6UA 4BFTA 4CGZA 2F1IA 4YMTA 3CPHA 3FDIA 4PHGA 4TQ9A 2W2XA 3VNVA 2QQEA 3M91A 5AUQA 3B2EA 4FMDB 3Q5EA 1NIJA 2OXRA 1P9WA 3G5UA 4B2LA 5CLQA 1A7JA 4QGHA 4KYUA 3WRXC 3THYA 2G6BA 1E2DA 2ZYUX 2DWQA 1AGRA 2WKRA 3GLIE 5APWA 5FOSA 3BB4A 3KX2A 1Y63A 3SBEA 3W90A 3GJ8A 1HWTC 3EIEA 1U98A 2WPRA 2FPKA 3L35A 1XTRA 1TEVA 2FX3A 2A7QA 3K0SA 4KFTA 2ZFCA 4LHWA 4B76A 5J4YA 2G77B 4TMVA 3ZDQA 5GJVC 1D6JA 1Z3IX 4JZKA 3D6TB 2ONJA 4DDVA 1S9KE 2IXGA 1GRRA 1TAGA 2PLRA 4R2HA 1E2QA 2FPLA 4QBGB 1N2CE 5AVWB 3ZZ0A 1VHLA 4B71A 1XNJA 1XXHA 1Z8FA 4KVGA 3SYKA 1PJRA 2IS4A 1CIPA 2VP2A 2ZE8A 2Z43A 3JZAA 4DLWA 3AP3A 3ZCCA 1A82A 2R62A 3AEZA 2ZSFA 3LFUA 2ZI3A 3SC3A 4RJLA 1RZ3A 1QHSA 2CL6X 4PO9A 2WOOA 3CF0A 2XXAB 3IEUA 4EKDA 3RVBA 1T3LA 3KDSE 1ZC4A 1ZINA 5APQA 2FV8A 2CHQA 2ZRMA 4M1WA 1QZXA 1BO6A 1IM2A 4V0ME 2GZDA 2VL7A 4EIWA 3V00A 1WXQA 4ON9A 1IY2A 3SJAA 3WNDA 1KMHA 3CH4B 3W6PA 2PMKA 5CM8B 2DPXA 1YU9A 1PLLA 1AJEA 3Q3JB 2FFBA 3WP1B 5AW1B 2W6JD 1KIMA 2X8AA 3AKEA 3TSOA 2HCJB 3IUYA 1Q1ZA 1M7BA 4GZLA 1SP4A 1GTVA 3HU1A 4M0LA 4B3FX 1YZGA 1KDPA 2BMFA 2LFRA 1LF5A 3PITA 3HYRA 4AYXA 3BXZA 4QFMA 1Z28A 2F1HA 1KOFA 1P2UA 4URWR 5FBVB 4H1UA 3SNHA 3BWDD 5TXGA 5EE3A 3PEWA 3HTKA 4JLKA 4A1FA 4CIDA 4U7NA 3B1WA 2MMGA 1T5LA 1ZRHA 2NIPA 5ANRB 1G3IA 1E9BA 3M06A 2ODEA 3L8YA 4OI4A 1KMQA 1AM4D 3KJIA 1UEJA 4Q4JA 1P2SA 4RCYA 3IBYA 5KPDA 2WJYA 2GEVA 1XPRA 3X1ZA 4PAQA 4WAUA 3VR2A 4A0GA 3CNOA 4E03A 1N3BA 2CE7A 5H1YA 1R0XA 3M0EA 5ELXA 5KSOA 1ZAKA 3RS0A 2HUPA 3D3QA 1KY3A 2QP9X 2QEQA 2UZ3A 1TF2A 1A2KC 2OAQ1 3QG1A 4MKIA 3I3SR 4FINA 3IDQA 1A4RA 3C14C 4B3BA 2J3EA 3G82C 2ZM5A 2EWVA 4PO1A 1PVOA 4Q19A 2YNMA 1MR3F 4NYMR 4MYUA 1W4AA 1YZKA 2VQSA 2RGCA 3AF1A 4BFWA 2GJKA 1XZPA 2WT7A 2XX3A 3WRYC 1KZGB 2OFWA 4HB4A 3LH5A 1CJTC 3LQRA 4B3GA 1EXMA 2IBMA 3CRVA 3WY9A 3BOSA 1EGAA 4BLOA 4BFYA 2FSHA 1D2EA 1NL3A 4ASUA 2VSOA 4TMTA 1HJBA 1BKDR 2HXYA 3OEHD 4MYCA 3MG9A 2C77A 4P33A 2HYIC 4TLDA 3IILA 5DIFA 4OHZA 3EAQA 4Z54A 3L0PA 1RJ9A 3UG7A 5AVQB 1B0UA 4JS0A 4JYBA 3EW9A 2IYZA 4XOIA 4TN1A 1OYYA 3DO6A 3VN0A 1UBGA 1IXRC 2R6AA 4IDQA 3ETLA 2WWXA 5APUA 2AKYA 2X19A 2V7QD 5DHAA 3R9WA 1V43A 2QPTA 2X2EA 3MWYW 4CEIA 5AJVB 1GOTA 1WQ1R 4QXAA 3TBKA 3IQWA 3NKVA 2FWRA 4BEJA 1CR1A 1ZU4A 3K0CC 3TUJC 3T15A 4QHYA 3I5XA 3T1TA 3U5ZB 3AV0B 2D2FA 1N0VC 1S1CA 4TSFD 2FEMA 2IT1A 1QHGA 5AUNB 6Q21A 4QGFA 3VHLB 2OHFA 1I2DA 5H68A 4GSYA 2OT3B 1JALA 4FMCF 1IO4A 2KP8A 4C46A 121PA 1E2LA 1L8QA 2DHRA 4PPFA 3CX7A 1OB2A 3L0SA 5F98A 3U3RA 4OK5A 2RGGA 1K5DA 5DISB 3E70C 4DLSA 2HLDD 3FKSA 3W8NA 1GITA 2KBEA 2ZAMA 4PANA 1G291 4JBYA 2Z5FA 4X8MA 5APYA 4W5JA 1XU4A 5D3MB 1E3MA 2V1XA 1XXHE 4DLZA 3NTUA 4IOMA 3I72A 2AX4A 4ACBA 1E2IA 2CCGA 3QKSA 4MKFA 2F1JA 2D7DA 1TU4A 2D7CA 3H2YA 4UQOA 4IEIA 4GKGA 1BOFA 2AK3A 4AUWA 1F5NA 1R0YA 1JOYA 4A2WA 3WXMA 2ZQ5A 5CITA 2Q9AA 1OXZA 4ZI2A 4B86A 2H16A 2J7KA 4HB2A 5G3ZA 3FE2A 3GFOA 1R6BX 3TQFA 2GCOA 2JA1A 4Q9HA 2CL0X 4KI0A 1BIFA 4NYJQ 3IGFA 4C0QC 3DZDA 5IK2A 3D8BA 3ZD7A 2YC2C 3A4LA 2QT0A 3NHAA 1QHHA 2A5YB 4WOPA 3LW8A 1NAFA 5JFGA 2QSZA 1RRPA 2VHTA 1E2PA 1R0WA 1GUAA 5SZHB 5CK4A 2Q6TA 4DLVA 5L3QA 5AVVB 4PAMA 4CZ2A 1KMHB 2OBLA 2PZGA 4OHYA 1WCV1 3FMOB 3U4QA 1KO4A 1MFZA 3THOA 3PUZA 2QORA 3LIEA 4U7DA 3A0RA 1R0ZA 4YONB 1TTTA 1OF1A 1W0JD 3PENA 4HZUA 4G1UC 4LK2A 1ZIOA 2LKDA 2IYSA 4B33A 4JIMA 1II0A 4HAUA 1JXMA 4G3XA 5A4JA 1SVSA 2ZJOA 2YOFA 1Z2CA 4B73A 1E2GA 2ZAOA 4UNQA 5AVYB 4Q21A 3CRMA 3QE0A 3VHXA 4EFLA 1WBBA 2P0EA 2C2HA 5EUMA 2ZI4A 4BPBA 5BYJA 2C8VA 4RD2A 4A8JC 1GU4A 3RWMB 5JECA 4PXAA 3CLVA 3P7KA 3EPJA 1T0HB 1NNEA 1DAFA 2ZSEA 1KTVA 2BBSA 2QMEA 2NQ2C 3EZ9A 2QY9A 4LY6A 4Z1MD 1M8PA 4OL0A 4PZZA 2R3CA 3R7WA 3LVQE 3QY0A 2GWHA 1NP6A 2JJ2A 4B34A 1RC8A 5JRZA 2ZI6A 2XNDA 3CZPA 2GJSA 2V54A 3OAAD 4MKHA 3MFYA 2GDJA 1OT3A 5TB5A 2JIZA 3DM5A 3TVDA 4BZXA 1GDDA 1O3YA 1KK3A 1QVAA 2HCBA 4Q1BA 5GJWC 4HAWA 1U81A 4ZCIA 2AL7A 1YYCA 2FH5B 1YJ5A 4CYMA 1NWQA 2DFKB 3PQCA 3OFNA 4KLNA 2P2UA 1N5IA 1N0WA 3Q5DA 2QTHA 1OHHD 4OQFA 4JVMA 1XWIA 1GL7A 1R10A 3BORA 5JCZA 1HE1C 4ZIRB 1GSIA 3P27A 3L0IB 4Y0AA 1S0UA 4G5GA 2IEZA 1Z6TA 4GDFA 5EE1A 4M21A 1NG1A 2R8RA 3F0TA 4KBGA 4O2LA 1T2KC 4UNSA 3VTPC 1FX0B 1FOEB 2IYWA 5JWHA 2WSMA 3SQXA 4XH9B 4KFUA 5BN4A 3KTAA 2BMEA 4GCZA 2F6RA 4GOXA 4BIUA 3AH8A 5FTNA 4XSGA 4E5UA 2XSZD 5EE5B 4U7OA 1ANKA 2A78A 2G9NA 2BBTA 4OJQA 1A1VA 1X1SA 4EPRA 5HR5A 5JLJA 1P73A 5CLLA 1LS6A 4LUCA 2W00A 3GLGA 1Q0UA 3TUZC 3C16C 5AW5B 4Q7KA 4A36A 2AWNA 3QPWA 4TYNA 2Z0MA 5G53C 1N6PA 1G6HA 4CEIB 3T5GA 5B1NA 2O8DA 2W58A 5CYOA 2CEAA 4IXNA 5JEDA 1DADA 4GP7A 2QRNA 4PAOA 1U99A 1JQLB 4TT3A 1CKEA 3RS2A 1L2TA 2B21A 4WXRA 4ZPXA 2GETA 2J0UB 4Q4AB 4II7A 4A0RA 3ZLJA 2OFXA 2AD1A 3NEYA 2ZR9A 4JKIA 3LAWA 1DO0A 4GBMA 4Q1EA 3VMFA 4LYHA 1R5OA 1LTQA 3SBDA 1TX4B 2MSDB 3SR0A 3S1AB 1KQLA 2B7CA 1XTSA 2G1JA 3AUYA 5EXSA 4DIEA 3TRFA 3HR7A 2Z5HA 1X8YA 2K5UA 4Q20A 2H1LA 2VSFA 3TR0A 3AP1A 5FI1B 1MUUA 3VQTA 3MWLA 2OESA 2FGJA 4C2TA 4TYQA 1V5WA 2JLQA 2O8CA 3T61A 1D2MA 4KYIB 1JPJA 3U2QA 4DSTA 1QHNA 4H9GA 2ZRPA 3KQGA 5FOWA 3A3YB 4HAXA 1MRSA 1R5BA 2VIIA 1ZUNB 5KSYA 1VCMA 1AZTA 2IUTA 2WMNB 4MDEA 1S9DA 3AVPA 4M53A 3CZQA 3LX8A 2BDTA 4YDSA 1YZNA 4AKGA 4HUQB 5FOTA 4TQAA 4F92B 4OI0A 3B1VA 5TDHA 2VPPA 3NC0C 3QEOA 4JBWA 4G01B 5D3QA 1W44A 1RIFA 2CHGA 4C7NB 2F9MA 2B92A 5EP2A 5JSZA 1TNDA 1NMYA 1DAIA 4QNRA 3B1ZA 2OE2A 1KKMA 4BLPA 4Q1CA 2W6ID 2CHVA 2P65A 1SKYB 2QGNA 1TF5A 1NSFA 2EFGA 2IA5A 3L8ZA 4A8JA 1GRNA 1HH4A 4B3XA 5E3HA 2RGNC 3FWYA 2ZJ8A 1H8HD 5FUXA 2EFDB 1JR3A 1FQKA 2H18A 5FOVA 1IN6A 2DBYA 5CK5A 3JVVA 1C9KA 3TAUA 4QGAA 1ZNYA 1R4AA 3BD9A 2QTVB 5FL7A 4DIDA 3U4QB 5F3WB 4ZKDA 5KDOA 4UXHA 2Q5UA 4I4LA 3ZS8A 2PX0A 1W36C 3VMZA 2QE7D 3K9LA 5KSPA 4F93B 2O8BB 1QG4A 2DCUA 2Q9BA 2OCPA 1SHZA 1CEEA 4B44A 2FSGA 3O8ZA 2CNWA 2ZU6A 3P26A 5BYKA 3MGNA 1NJFA 1OYWA 2F55A 4Q47A 2GXQA 5GADl 1H8ED 4PC3A 4RZ2A 4LBVA 1Q3TA 2GK6A 1ONBA 4Q5IA 3ADBA 1Q1BA 4KFRA 3QJYA 4N0EA 3FTQA 4B43A 3PEVA 5IDJA 5JBQA 2QAGC 1F3OA 3BB1A 1G2CB 3C7KA 4AK9A 3VKWA 4FWIB 3TSZA 5E7IA 2ANBA 1ZCAA 3QF4A 4NYIR 1KHTA 2XB4A 4BZPA 2R32A 2WPDD 1CR4A 1W0KA 3UIEA 3ICQB 3RS7A 3CPJB 4Q1AA 5B64A 1X8LA 1OXTA 1NVWQ 3WNBA 3RLFA 5C46F 3UWKA 5AVSB 1G8HA 4B75A 1CULC 3QQ5A 4B3DA 4M3LA 2A5DA 3L0OA 1NI3A 2QENA 4FCVA 3K0AA 4YQFA 2EQBA 5FPKA 4CEJB 3U3MA 1W4RA 3GEIA 4LV6A 4PSAA 2QRZA 3L37A 1WDTA 4IVQA 3SS8A 1IN5A 5HKKA 4NH0A 3Q85A 4KVAA 5JHGB 2JATA 4QBIA 3VU9A 4LYFA 4DEYA 1W5SA 2IYVA 4LJAA 1AK2A 2W2TA 1VG9B 4BLTA 4LHYA 1KAOA 4MITA 2QMUA 4Q9LA 4US2R 3DKPA 5FPHA 2ZU0C 4LC1A 3SQWA 4DKXA 1G7SA 2P3SA 4RD3A 3MUFA 1HUCA 2ZJBA 3PIRA 3VFDA 2JLXA 4LJ4A 3GLGE 4IRUB 2W6AA 1HT2E 3C5HA 1MO3A 1KNQA 1TADA 3MLEA 3QENA 3N70A 3SHFA 3K70B 3AVTA 3O8BA 2V1UA 2QZ4A 5AVZB 1MABB 3U3OA 3LIDA 2ZYWX 3BK7A 3A37A 3GLHA 4KAXA 1ETUA 4BRWA 2CMKA 1PUIA 2GILA 3BBPA 2YVUA 1L4YA 4TMWA 5AVUB 1J8MF 1CXZA 1NVVQ 2QG6A 4FMBB 1HTWA 1VYVA 3DM9B 4DZZA 1KSJA 2EYQA 5BQ5A 2FU5C 1PLKA 1E79D 1AN0A 3CR7A 1UBCA 3FFAA 1JR6A 4LBZA 1NLYA 3EC2A 1T9HA 5CB8A 1CI6B 1JNYA 3AVXA 4BFSA 2YHSA 3OF5A 3AQ4A 4D82A 3TSWA 2QM7A 4DDTA 2IYTA 1GL6A 5EUQB 3FOZA 1SVWA 1SXJB 2UKDA 3ZS9A 5BWMA 1EESA 3W9YA 2C9NY 2WV9A 3OEEA 1XTQA 4QBFA 4R9UC 1GNRA 4PZYA 2BASA 3A2AA 3BH0A 1N6KA 1H89A 2FFHA 2JDID 3SHWA 2P6RA 2VHUA 4MQBA 1UFQA 4TLBA 2ZUCA 2AFHE 1K8RA 4HYTB 4HLQB 1FMJA 2PZFA 2W0MA 3P1JA 2XITA 3VR3A 3GJ6A 4OI2A 2EFEB 3K53A 4IW3B 3RDPA 5B57C 1S9HA 2D74A 4EJSC 2HF9A 3RSOA 3ZZTA 3O8RA 3F5FA 3EX7C 3EA5A 3AVQA 4P0TA 1RRCA 5B58C 4IJMA 4Q4HB 1GK6A 3GJ5A 3K0FB 4C9BA 4XD7D 5C2JB 4QJ4A 2OZEA 2Q3IA 1NN0A 4AYCA 2QT1A 3ZIAD 1IQPA 1ZVQA 1G8PA 1U8YA 4DCUA 1IXZA 1COWD 3QKTA 5L3SA 2ASEA 3GEHA 1W49A 3CRQA 2VYFA 2HF8A 3LBHA 1ZM9A 4OQLA 5JZVA 4LHXA 3SJBA 4NCHA 1ESMA 1JR3E 3VX3A 5K8LA 2ZS8A 3BGWA 3GJ4A 2G83A 3OIYA 2QPAA 5FPYA 4LOAA 3CPEA 2NOAA 3W5JA 3R20A 3HU3A 4URUR 2JLWA 2N9BA 4BZQA 3CIOA 4EPXA 2OFOA 2PMDA 4NYJR 1KJYA 2XZLA 2O8FA 2JLUA 5JI2E 1E9CA 2ZI9A 1SZPA 4IVPA 4M1TA 5JRJA 2QAGA 2GBLA 5EJEA 4G5QA 4YXWD 1CR0A 3I5CA 1XMJA 1LNZA 2IF0A 4P4SB 1E2MA 2GEUA 4GT1A 2CL7X 3LO5A 3EWAA 3WHLA 4DSNA 4DXAA 1SHKA 3GLIB 2JLRA 2R5BA 3V4FA 4MTXA 4KJZA 3ZRWA 2ZROA 1AS3A 1SVKA 4JJZA 4TWZA 4D0NA 2QSYA 4K81B 4DBLC 1E9AA 1ZIPA 2CVHA 1KI4A 2N42A 3MWKA 3ZJYA 5DN6D
chains in the Genus database with same CATH superfamily
1MAVA 3E3NA 1A2BA 2AE2A 4ZYLA 1NC3A 4U9IS 4CEHA 5AJXA 3TJTA 1N2CB 2O2DA 3UJBA 3HBLA 3F9IA 3DH0A 1OV4A 4GBGA 3FD8A 1QFYA 1OU4A 3CRW1 2GDSA 1EDZA 2GSMB 5APSA 3ZCRA 1ICEA 3FTNA 1YZ3A 3G4SP 4AY3A 3U59A 1R5SA 1T4DA 1AKEA 2I7CA 4U39A 5KNDH 1ZIXA 2CTPA 4BBAA 5JCOA 2KBFA 1BU8A 3S2SA 2RHTA 3MUOA 3FKJA 3VZSA 4G4IA 1ZGHA 2VCHA 4MV5A 3TGUJ 3E1RA 2QYSA 5AJHA 2BL4A 3CKMA 3CX5I 4Y1EA 3GLFA 2RCNA 3V1UA 3WK6A 4NK4A 4LJ6A 2VJOA 1GJRA 4BKUA 3OIGA 1GU1A 2W90A 3OM8A 3HCFA 3DFUA 1KI6B 1OH8A 1S96A 2YXEA 4UVDA 3JQFC 3X1YA 4G89A 2L2QA 1XD2B 4D9CA 1S7GA 4KSBA 4DDUA 4QGSA 3Q3HA 1GAXA 4UTXA 1GPWB 4KAFA 4BNFA 1D7AA 5KYGA 1OVMA 3RW0A 2C4HA 1SQQG 1HGVA 4KJXA 4ROTA 4EUHA 2HHAA 4MW0A 2PZJA 1ZXLA 3TGWA 3DKVA 4LWQA 3LHIA 5C81A 5JOQA 2YRXA 2JDIH 2F62A 2ZKLA 1KJ8A 5E2AA 2WSCH 2ADFA 5I47A 4FJ2A 1J8YF 3FETA 1PK9A 3ON5A 1GXSA 2ACVA 3ASOB 1ZOOA 5HJ2A 4E3WA 5K8IA 1HTBA 5KVVA 3W2GA 1DP4A 5B1DA 3KR9A 1BEZA 1FFXA 5CA1B 2ZIFA 4L8GA 1H94A 2QXYA 1SOMA 2Y1DA 1Z56A 1NVFA 2O4CA 2V0CA 1YTFD 3K15A 2UYGA 2XV5A 4BNLA 1T6NA 4UNNA 4V2IA 1YEWA 3Q7IA 3DOIA 1G9TA 2I1JA 1ZM2A 3Q9SA 5DWVA 4EW1A 5J47A 2XLCA 4RX1A 4KU4A 1RRGA 3IP5A 1NM5A 4E4TA 4MYTA 3U80A 2G80A 8MHTA 5EXTA 1RF1C 3JAMA 1NS1A 2RI6A 5C1BA 3SICE 2JA2A 1ZSNA 4IG4A 3MT8A 1HX7A 3AGPA 5I6DA 4E15A 3BIFA 1NGSA 3MTJA 5DO9A 3UANA 2GH1A 3NBFA 1QVRA 3NS7A 3OUFA 3T12A 4Y7DA 2OZKA 5EXPA 3CMAP 3ZNPA 4G5RA 1Q0SA 3HDJA 1MZ9A 4PQRA 2JVKA 1LTIC 3BD8A 2VRWA 4OQEA 1SKBA 1QHXA 1HQYE 2ODNA 1YGPA 4JLBA 1NW3A 1EUDA 1US6A 4PDLA 3HBFA 3W8RA 3K8YA 3BA6A 4PG5A 3B5IA 1WQ3A 4G25A 1GDTA 1UJ5A 3IAM1 5JU6A 2OO7A 2KE5A 1IOZA 2GHIA 2WPSA 2H4JA 5AVTA 3JQ6A 4DEXA 5JS2A 2FYZA 4D1YA 4UOQA 2FWPA 4D57A 4BE9A 4X45A 7ABPA 2BTEA 1UBNA 1X2EA 3JALB 4AJJA 2C0WA 2FQ1A 3AE4C 3I8XA 2Q3LA 3KHKA 4IIEA 4LY9A 2H1WA 3R3VA 5JAPA 2JKZA 1CRPA 4YMSA 3ZDBA 1DRUA 1M1JB 5JADA 4GI1A 3W7SA 3ZV3A 3MTAA 4J1QA 3K3WA 4ID3A 5ADWA 1D2AA 3JTEA 4CLOA 2C00A 1A02F 3I04A 2BGLA 3PKIA 2XQKA 3H1JG 3EQ9A 3G2IA 5I7HA 4Q05A 4JASA 2GFQA 5LM3A 4Y2SA 3PVZA 2KHZA 3ETJA 3WNVA 3K5PA 2GBLC 4ZO7A 3ENKA 4QUJA 1U94A 2W6OA 5ENDA 1Q1QA 3KYDA 1F2VA 1W4LA 1NTMK 5IY5C 1EWTA 3LC7O 2GDZA 3TLZA 3O2SB 4HNAB 1DFHA 1S5LZ 3BS4A 2QU8A 3BERA 3L9XA 1GZSA 1PPJD 2RG7A 2O05A 2X8LA 3WNQA 4RETA 5F5LA 2YC4C 4J6FA 5BV0A 3Q2KA 1JDPA 3V2PA 1ZCZA 3ZY2A 3ZZUA 3GT3A 2B9ZA 1Z0KA 3I0ZA 3MHPA 2R00A 1C5KA 2GEFA 2W70A 1TB4A 2CFCA 1RAIA 4G97A 3DC7A 3UO8B 3QPCA 2P0YA 3SIXA 1Q1AA 1K92A 1OGIA 4JSTA 3W5HA 3N2LA 1NQXA 3LDEA 1GT91 3QMWA 4UAGA 2BFCB 2R1VA 1XZBA 3TZKA 3FVQA 4GLFA 3CZ5A 4RVNA 3X1DA 5G2OA 1OIXA 1SG9A 1A7UA 2QQ5A 3T4EA 4GG1A 2VXBA 5A9SA 3QKUA 1ZI8A 2BH9A 4HGQA 3R66A 2FPIA 3PE3A 3ZU6A 1UWKA 4QEKA 3NO4A 3D3WA 3OMWA 1NF3A 3VSAA 3ZWBA 3N2ZB 2PH7A 3MHSC 2D0IA 1J9EA 3HB0A 3A4IA 4I81A 3KCYA 3FFQA 3WGIA 5B2EA 1VJ0A 2NN4A 4DGSA 5KPJA 3K9WA 5LB2A 4LPSA 5D3MA 3ML1A 3EVTA 3D2CA 3EIUA 3SM9A 1MD9A 3S2FA 2A1UB 3B3JA 3BFKA 3FKSD 1PGQA 3W2TA 2CCKA 1N4AA 1P7ZA 5J1TB 1QCZA 1KEZA 4OX9O 2GSWA 1M83A 5TC4A 2C1EA 1P3Y1 3IUJA 4JI7B 1FYXA 4QFCA 1Z8HA 3PJRA 1XC7A 3FLEA 1CHNA 4UVAA 5EL0A 4E1BA 3WR5A 2YEVB 4HN4B 3OA7A 1L4FA 1E58A 1G18A 2FA9A 3VU9B 3HJGA 3EG5A 2PHZA 3SEZA 4J1TC 1BA2A 1W2WB 5AVYA 1DOAA 4G5XA 5LXTB 2H51A 3VKGA 4GXRA 4NY1A 1UBUS 4JSRA 4KIJA 1E79A 1IFJA 1G2PA 3ROZA 1PR6A 3PYLA 4W63A 2XB2A 4D4IA 1QX4A 3TGPA 1C8BA 1M2WA 2EULA 4OJTA 1H6DA 3H1TA 3OTGA 4RE6A 3HUUA 4W4TA 1TT7A 4JZYA 3N7AA 4R2WA 3AILA 4KKXB 5CX4A 1XZAA 1N0IA 4M7PA 4MWBA 1PPJH 1FTYA 1D6MA 4Z4HA 1YJWV 1X8JA 4L0QA 3Q5RA 4YCNA 3EWKA 3MQ2A 3L6EA 2PDAA 3R3HA 1EM6A 4YEDA 1RQLA 2VOJA 3DFKA 3D0RA 2B88A 2H4WA 1LPPA 3EPLA 3BFPA 4CI9A 1EFUA 1SQBG 5EFZA 2WJ3A 2NUTA 3HBMA 1LWUC 2Y4TA 4O4HA 4YY3B 4R5MA 2AQ8A 1FAFA 2J0UA 4Q4AA 5DVZA 1HH0A 1RH5B 1HDZA 4UE3S 2CJFA 2BHLA 1CC1S 1S72P 2QN2A 4L8YA 3ZQKA 2P3QA 4TL7A 2ATIA 2A45I 5IUNC 4KDEA 1SXJC 1JIQA 3HZOA 5T4BA 4R81A 1JDNA 1C1XB 3U26A 3O75A 3E81A 2YKQA 4JUCA 2YC0A 1KSHA 1QG2A 4P08A 2VFAA 3LPDA 3T7TA 4X66B 1Q44A 1SU7A 5IT9A 3URKA 4MMZB 7REQA 3VZBA 2FZCA 3B9QA 1SK8A 4YXWH 2J0SA 4MVMA 4GOKA 3RVQA 5KQGA 1L5ZA 5CFOA 4WBSA 1Z7GA 1SQVD 1IN7A 5A6SB 2JK0A 1II8B 4DV5B 1MOZA 3V8PA 4W1RA 2DTDA 3PC2A 1ZUWA 4I1UA 1WR8A 4XQCA 2GVDC 2CCJA 4WLUA 3U6KA 2QRVB 3MGAA 4R8CA 4I4NA 4LDPA 1O6ZA 4R7ZA 2R4QA 4ZDIA 4URXR 4KPYA 5SZJA 5JFTA 1PIWA 2JFPA 1NH2D 4CCYB 4BWYA 3P4YA 5DJ5A 1Q81W 4LXHA 4C0SA 3GD7A 4XWTA 4NCNA 4ER0A 2G38A 2Y1LA 5BUZA 1GQQA 3H2BA 3WSVA 5HQ3A 3SYOA 1MG1A 3H83A 4JI3B 1LW7A 1M1ZA 1Q3HA 4FR2A 2M6KA 1MABA 4DLUA 2W0XA 3VR6A 3EULA 1F8GA 2BIFA 1SRYA 3L72G 4MEAA 1OJHA 2B2NA 2I2XB 3AFGA 2H5EA 1OX4B 4PGHA 2ATCA 3SYTA 3GCDA 4JQOA 1ZA1A 1OAKA 1ZXBA 3VH1A 2X0LA 3G2LA 4YJHB 5B6JA 5LWQA 2PIDA 2GD1O 2DWEC 1H05A 1KDTA 4GX5A 4LYDA 3P9NA 1Q43A 5HX7A 5IRCD 2JFOA 3LQQA 1KMCA 3DJFA 3KVOA 4NU6A 2J5XA 3BJMA 5AXCA 4KAJA 2HPCB 3LT4A 2POQX 1K73Q 5E6SB 1P80A 4KMRA 4OHUA 3BD7A 1FRZA 1AJYA 1PRYA 3WL4A 1CY1A 2PBRA 3V3KA 5EIXA 2AB0A 3IELA 1E7RA 2RGRA 4OG2A 4FLYA 3PI6A 1GPJA 1OLUA 5LD2B 1OX5A 2M6LA 3F98A 1LV8A 2G17A 3UAYA 2XKJE 4R68A 2I71A 2F43G 5A0TA 3EVCA 3LK7A 3HZHA 1MQ9A 1L7QA 2B2XA 2XE8A 1IAQA 3U4IA 4PGFA 4BLSA 4X6UA 5CMZA 4IDEA 2P79A 4GZ6A 2QIOA 1GL9B 5EZYB 2A5JA 4F3RA 1JKFA 3I5YA 2ESRA 2EJVA 1MGOA 3HP1A 2MSNA 1E2NA 1PJCA 1RY3A 2Q46A 1FZCC 3R9IA 1Q0RA 3WLQA 2OCDA 2QD3A 2J7PD 3OA0A 3NT5A 1ZW6A 3GFBA 4EVIA 4PWYA 1L5KA 1JQ0A 3TTTA 4P2BA 5HE9A 2HHJA 4LS3A 1KFBB 4ZJPA 1IG3A 1UKBA 1NT2B 3A1EA 1WXDA 1WV1A 4X6LA 1J23A 3WQQA 3OQ6A 4QDXA 1TUEB 5DT2A 2OY0A 3QFCA 4XWGA 3CWZA 1KGDA 3A1NA 4KBFA 2JFZA 4OYHA 1E3EA 4DV6B 1QR2A 2NXCA 1GKYA 3ROMA 4EHDA 2DR3A 4CGZA 4YP7A 2XUQA 4PHGA 2C61A 3B2EA 3GMDA 2P9QA 3OQVA 3Q5EA 3PS9A 4BTLA 3TTXA 1QWSA 3THYA 3ZWDA 4WESB 1AKNA 1J1DB 2WT4A 3O1JC 1IVNA 3EDCA 3ZY5A 2EIXA 4H4EA 3H1HJ 2QN7A 1GPBA 4TMVA 4OB8A 5JPDA 2YV2A 5BR4A 2PLRA 4H1WA 5AVWB 4KVGA 2P78A 3G2MA 4AS2A 1Q11A 2ZSFA 5EVJA 4RJLA 3TSIA 1UMBB 1HFEL 4PO9A 1VLMA 2XXAB 2YV4A 4LKOA 4XGKA 1PZFA 1WPRA 3MSCA 1BO6A 1IY2A 4FYMA 1M67A 2JKYA 3RK3B 2GJ4A 4NXNB 2NU8B 3RGBA 3VSBA 3FOWA 3N53A 2BM8A 2LFRA 3BXZA 3PR3A 1P2UA 4KXWA 2YFKA 4BQOA 2G07A 1BCSB 3CI9A 2FLKA 3M83A 3HUTA 4V3BA 4GOFA 4HGOA 5IU6A 1MKMA 4ZHSA 1JO5A 4W9RA 3H5WA 3VR2A 4DRXA 1P0QA 1SG6A 2QL5A 3EOAI 1L8LA 5KSOA 1O08A 5DHPA 3PNQA 1BMQA 3KE9A 2Y99A 3FPLA 1QH1A 3L70E 1U2DC 2AQHA 4NYMR 1PT9A 2VQSA 3GWZA 2GJKA 2O2IA 3OQNA 4RAIA 3KOXA 1J97A 5A5DA 1B73A 1HSOA 4MDYA 3V2GA 3BRQA 5IJ9B 3FOBA 4ZEOA 4G2NA 3V1YA 4JYBA 2IYZA 3DLIA 3EVKA 1W9HA 2V7QD 4JI6O 4YWHA 4AX8A 3R9WA 5KHIA 4RJTA 1P2FA 3TBKA 4BEJA 2N1TD 1ZU4A 1SH7A 3MELA 5HMMA 1K8AW 1KZ4A 4DCCA 3S7ZA 4GSYA 1L8QA 3DB2A 3QVGB 1OYOA 1OA0A 5EWJB 4KQ6A 1JFFB 4YJ2B 2WU8A 4YK7A 4MQFB 1Y76A 1G55A 3U81A 2BEWA 4ZOLB 1R6BX 1UPGA 4L8VA 4Y1GA 5IYCO 4KI0A 4HWTA 4FZ3A 3OZGA 4C0QC 3DZDA 4I2VA 1Q0PA 2QT0A 1NXSA 2A5YB 4ZO9A 1K75A 3N0WA 3CINA 5CK4A 2GK4A 3THOA 3ZXSA 4HDAA 2Q6VA 3PENA 2C5FA 5DGIA 4FE7A 3IP1A 3I2YX 4B09A 1PJ8A 3BMQB 2GNAA 1XN1A 3OCJA 1OILA 2E6UX 1L7PA 4QPPA 3Q7EA 2KS1B 3P9KA 4GRDA 4LNHA 3QY0A 1RC8A 2PIAA 3RL0C 1ZH6A 1K86A 3OAAD 1S2GA 4BDTA 3FUVA 3OEYA 3PGLA 1N8TA 2ADQB 3TL2A 2ABWA 1NKVA 1X74A 1GSIA 3L0IB 4DWOA 1FZTA 2IEZA 3DXFA 2GA9A 5BN4A 3F47A 3VVBA 5EIBD 1H0TB 1FDMA 5A4DA 4FZ0A 2JO1A 3ZQUA 4QT4A 5FAXA 4TPKA 3FB7C 1PJLA 1JWLA 2IHVA 1DKRA 3RU9A 3TUZC 3AF6A 2I6SA 3EF3A 1C0IA 2HWKA 1EX9A 2EBOA 4TYNA 4KQHA 2H94A 4H0LD 4HPXB 5EYPB 4D9EA 1VIBA 1PM9A 4GP7A 3B3GA 1U99A 1JQLB 1PJ2A 3L8CA 1GGJA 1J25A 4P92A 1DO0A 4PLCA 3AUYA 5ALSA 3VPGA 4Q20A 4MJ7A 4TN5A 4PYLA 4X89A 3ROFA 3I30X 5LMCA 1Y37A 3CYOA 1I1OA 2C29D 4H9GA 3SXUB 2V7QH 5IUKC 5DU2A 5E38A 3ESCA 4KPGA 1AUVA 4TKLA 2HGSA 1Q7YW 2QDOA 3EZGA 4DW1A 3ER9A 3IBTA 4B4UA 2COEA 2OD2A 3T1YB 4J0KA 1DUIA 1ENVA 5LUBA 5E3HA 2E48A 4E5YA 2Q3BA 4UEKA 4R8RA 3V1NA 4I4LA 3VPCA 2B87A 3SQLA 5KSPA 5AW3A 2JBAA 1CEEA 1PW7A 1LLUA 4I50A 3P26A 5BYKA 4FYIA 3ZV4A 4Q47A 4DR2B 4EZBA 5D5HA 1VQ4P 1RACA 2C5GA 4N0EA 2VJLA 4FWIB 4BZPA 3ZIAG 2ZCUA 4RIGA 2WVAA 1AU9A 3CPJB 4MLDA 4CM5A 4ARAA 1GZ6A 4UD2A 2ZBFA 4MV1A 1QZTA 5DB4A 4IWYA 3SNKA 4C03A 3LW5H 4JI0O 5BORA 1TYZA 5HDBB 2TRSB 4PV1B 2JL1A 1QPZA 3DF9A 1Z9BA 4BLTA 1J42A 4MITA 1EJBA 5LYJF 5GWXA 4JFAA 5K5EA 3WB0A 4HRXA 1L6IA 3T9DA 3LI2A 2V1UA 4JBLA 4J4HA 3UJ7A 4M8SA 2JFUA 4J29A 5EMNA 4QLAA 2EYQA 1AN0A 1EZ4A 2Y6UA 2ZR3A 5L7WA 4DM4A 1JH8A 1U2GC 3W9YA 4BNZA 3CC4V 4E2WA 4HH2A 2E74C 1LJ8A 4U2EA 3L41A 2LCQA 2HIMA 3OZVA 2C20A 2NU9B 4E13A 4M1EA 2IE0A 2O7SA 2NYRA 3GCWA 1INLA 3U5TA 2XNXA 1SIBE 3K0FB 4EVRA 3ZG6A 2EZ4A 1JQAA 1CUGA 2XLBA 1YT5A 5IJ0A 2CXHA 1NU1J 1JBQA 3QKTA 4Q24A 5JZVA 3SJBA 1IBMO 2QKYA 3FA2A 4YJGA 1SQXJ 3HL4A 2R0QC 1TUBA 3PKJA 1HDYA 5IJAA 2GEUA 3OWOA 1KFCB 5FJIA 3LY7A 4MR8A 1ZMTA 1AHNA 1E9AA 4IXTA 1IBCA 3C85A 1AIPA 3FOEC 2XF2A 1WXIA 2AZ2A 5ITWA 2VXOA 2BSXA 1T6YA 1N9GB 4YCBA 5B3AA 4W5HA 1YASA 2HADA 1F14A 1LTJC 1VP3A 4JZGA 2PO5A 2PUCA 1H2HA 1Y6FA 4HWRA 2GEDA 1P9NA 3TNUA 1NQVA 3DULA 1Q15A 2WUDA 3UYKA 4GQIA 4GSKA 2R96A 3OX1A 2JFNA 2IKSA 4DMCA 1G5TA 3AWDA 3W5UA 3BVHA 5K4HA 2IZ1A 1FNMA 1RJFA 4GMXA 4HXFB 3IDFA 3A05A 4KOEC 1WLEA 1M2OB 1BNCA 3WK7A 5HJEA 2F8TA 2Y1FA 2DERA 3OU6A 3K05A 1PQWA 2OAP1 5D00A 3DXRB 4DUZO 1XVIA 1OMOA 4I7ZC 2A45G 5JS8A 2I9PA 4O4JA 3B1JA 5LL6Y 4FXOA 1WB6A 3L7YA 1E8MA 3L0YA 2BKVA 2JFYA 3PEFA 4O2BB 2PKQO 2W8BB 3EXIA 1DOHA 2CSXA 3E7WA 4DYHA 2QKCA 1TK3A 3IAEA 2FRDA 2ZRGA 2ZIVB 4Y7CA 1YUMA 1F2TA 4HNTA 3ZDCA 3G0DA 2H8PC 2QTZA 3B60A 1ZM4A 1MFPA 2QJPB 1Z4MA 3LK6A 3KSZO 1UCFA 1UKZA 1TK9A 1ID1A 1BGYJ 2P27A 2Y6VA 1SVMA 2IJKA 1NJSA 5BSUA 3PUXA 1W1WA 4B87A 4HATA 1U8ZA 1UM9B 4GEKA 3A2MA 4UVEA 2VRCD 3RYCB 1LPMA 1JA8A 2VZ0A 1EGHA 221PA 1ZMRA 3NVDA 4KV9A 4I6MC 1SVNA 1FTSA 1PZNA 2OWDA 1ENOA 1XXHB 2C2BA 4RACA 1N57A 4DXHA 1L5OA 4GDMA 3MRTA 3RAJA 1QIEA 1V1MB 2WOJA 421PA 3IE1A 5CFRA 4PG6A 1F60A 1NBME 2XYQA 2PSDA 2HYNA 1SQFA 4RCZA 3QXJA 4PZAA 2VP5A 3LGAA 2QKSA 1X7XA 4RK1A 3QNUA 4XVRA 4DJEC 3N9IA 4EF6A 2IHZA 4HXGA 2PYDA 1VQ8V 2XU6A 1F6BA 2D13A 1YHNA 2NXEA 1G19A 4GI2A 2JVIA 4POOA 1N6OA 3BDAA 3DBVO 2JNWA 1PJZA 1LTAC 5HTKA 1KJIA 4HUTA 1AQTA 3C6XA 2QI9C 1WUHS 1GG2A 1RTTA 3VOUA 3BXPA 1AO3A 4PA6A 5L7YA 1P5RA 3VC2A 3TNFA 5KLIB 3NHSA 2Z9DA 2B4RO 1NVBA 4UV8A 1KTIA 3HV0A 2EJRA 4BVLA 2L6LA 4ZC8A 3G9UA 3SDBA 5REQB 1F17A 5HK8A 5HCNA 1AVTA 5DOVA 3WYGA 5J4HA 3PQ6A 3X2FA 1YHQP 2G1AA 1USWA 4ZDWA 5D6OA 2XADA 1FYFA 3GVXA 5KYUA 1OIVA 4GNRA 4IOJA 3L7MA 3CCEP 2CGOA 4EYEA 1H2SB 1JKXA 4D25A 1OAOC 2RG1A 4UZEA 4DUGD 5I4KA 3K06A 1I1QB 4KQ1A 4DMGA 4NOJA 1SQGA 3VAZA 4R1OA 3CUSA 4TQFA 1U3WA 1EZVH 4BEBA 1S2OA 4MPRA 5G4LA 4RTNA 1FLNA 1JA1A 3L1VA 3R41A 2PZMA 3K1JA 5GVRA 2QP3A 4AO8A 1XFAA 4R6ZA 3PX2A 4DAEA 3BRTB 4AXBA 1NTKJ 1KBQA 1C9NA 1RKBA 4FR0A 3BT7A 1ZI9A 2GAJA 5C4IA 1QAMA 3EVBA 4AUNA 2EJCA 4X84A 1I9GA 5DH9A 1KS2A 2HMSA 3UFXA 2FW6A 2W11A 1A95A 1SUBA 5A0FA 1KJJA 1VKOA 1XZKA 2PWPA 4QODA 3UB4A 4JUBA 1Q1EA 3QO7A 4BGUA 3PDWA 1YF2A 2IUSA 1P6XA 1F7UA 5KAIZ 3R9XA 2GBPA 4Q6BA 5JMWA 2J09A 4MVJH 2PH5A 1OBFO 3VTZA 1LD3A 2G5CA 2AE1A 2BM0A 4M9SA 2XCQA 1F23A 4D9BA 1C7ZA 1ISMA 4EG1A 3A10A 3K9GA 5K3FA 1V5FA 1VA4A 4NFLA 1A72A 3NFYA 4B74A 5EKTA 2B9VA 3PNSA 1HV8A 1EZVE 2G72A 3DEHA 1E94E 3OCXA 2X3FA 2AMFA 3ZW8A 2YZNA 2XUFA 2R8EA 3JASA 3RODA 3EBOA 1IWBB 4CL3A 3TSYA 3MJHA 3E82A 1S01A 2QX4A 2R9VA 3PEEA 4DIUA 1C81A 1JZQA 4EA9A 3E3MA 4PO8A 3I12A 1Q7EA 1TQDA 2BE9A 4Q3KA 1AT1A 2MINA 4AO6A 4V39A 1WUYA 2BZ1A 1G6OA 1GQ2A 4MVJE 1DZ3A 1RW4A 1Z0AA 3STWA 1RRFA 5ECWA 4RSGA 3JYOA 3GHGC 3N5KA 2LFSA 4P82A 1A97A 2QLMA 1LB1B 3HYNA 3F90A 2GLUA 1QHTA 4PVCA 1XYGA 3R75A 3AETA 2YO3A 2Z6VA 3IUMA 4FT4A 1SD1A 5LZ2A 2HIGA 1XZCA 2QSUA 4B7AA 2OXIA 2KJQA 1K33A 5K6TA 4JP1A 1ISHA 1QEXA 1N92A 3EGCA 4N76A 4YALA 4NH4A 4CF6A 3SY8A 4CMIA 5TX7A 1N7SD 1J5XA 3BUSA 3U11A 3D9QX 5LDDC 1V8ZA 1F0NA 4UHDA 1P2DA 1UOPA 1YFJA 2NO7A 2N9UA 4QLBA 1ZN2A 5J59A 3T6KA 3VVCA 3R8CA 5F7JA 1QIKA 2BCEA 4LOIA 2IY9A 4DRZA 1QK5A 4D96A 1DUVG 4J91A 3ULKA 1G8JA 2WJ6A 3DAHA 4TT3G 2B5OA 4E6PA 1KEEB 4H7FA 2VHEA 5E3JA 1FXVA 2IYQA 4OHBA 4LZAA 5CW2A 4PBSA 4CF7A 5KYKA 3QLVC 1RTKA 3ETQA 3LDGA 3BTUA 4GECA 3TZHA 1GCGA 1K7EB 1R1BA 2GN6A 1YMQA 1I4EB 3MGCA 1N0HA 4O1MA 2H63A 1RZUA 2QUIA 4FLTA 3KIPA 4AMBA 4XD2A 1D5CA 3B8MA 2J59A 4HZ3A 4MKRA 4J11A 4P5EA 1L4KA 3BMCB 4CM7A 1S8OA 4L73A 3AKCA 1V35A 4GX1A 2Y0BA 3IIMA 1Z22A 4P9NA 3O8OA 1LS1A 1A04A 4HQRA 1CZRA 2JC3A 3TLBA 2QF7A 2AN3A 4HEHA 5J2TF 1Y1KE 2VATA 4MWCA 1L8OA 2EFCB 2AC7A 2RJOA 3WFZA 1AD2A 1P3JA 2REXB 4PZPA 2A06E 4ATNA 4E5NA 2IPOA 2XUJA 2QRUA 3OR6C 3O4GA 1ZTEA 1MC5A 2CHFA 2Q5QA 3NHKA 5EJ9A 1AV1A 1WVIA 1IRIA 2IITA 1GM5A 4MLZA 4FT2A 1SBIA 1RE1A 1AX9A 1N32O 4YWJA 4QASA 1JEQB 2VRSA 4LX0A 5FLXN 3FWLA 3M89A 5EE0A 3BIOA 3DS8A 2VF8A 2D54A 4YJFB 3KJGA 1G20E 3H1LH 3JSVC 1SQPD 1KOJA 4YHHO 4RVUA 2X58A 1FVFA 3FFTA 1P8AA 2WSBA 3HD7C 4UOZA 5FL7D 4LOJA 3QXXA 4U6SA 1DD3A 5TPZD 4Y6QA 3W5BA 1ZKMA 1Y6JA 4H1HA 2RCVA 1H66A 1AVMA 4KQEA 2JS7A 5IX8A 5F7ZA 1PR4A 4M0DA 2FI1A 3RD5A 3DEIA 5TF0A 2DYSC 4OCZA 4DS3A 4RDIA 1HNXO 5TEWA 2XAUA 2DFLA 2D2XA 3QTLA 4IIYA 1IFDA 1AE1A 4G6ZA 3M4JA 4C4TA 1U0HC 1TMKA 1BDJA 1XZQA 5EIBC 1F7VA 2HL6A 2R70A 3PDCA 4QEZA 2CYCA 3G2QA 3HNRA 3FB1A 4GXNA 3COZA 4I55A 4H0LC 4BP9A 2NNUA 3H1LE 1XF9A 5BURA 2OPBA 1ISFA 2OO3A 1J06A 2PQ6A 4BFZA 1TYCA 1VYTA 1E18A 4RF2A 4PGMA 1DXOA 4A4DA 2GJ9A 1G17A 4N3NA 3OZRA 2CH7A 4I5SA 2NO5A 2RHBA 1RI1A 2C94A 5DWQA 3ADKA 4LOKA 4IFDK 3CBGA 5ICGA 3GYBA 5I5GA 1TL7C 3H9EO 1WZCA 4QPJC 1MW8X 3BH7A 2M0BA 5ARDA 3AEUB 1P7CA 2A1TR 1RHUA 1ESEA 3LO8A 1WMSA 1COZA 5C1IA 3GJRA 3OW2U 2Z5GA 3PXAA 4L3WA 4L08A 2BCCJ 1D0SA 4POAA 4JAAA 4HH3C 3GLIA 4M0MA 3KFLA 3ZYCA 5CVTA 5FHQA 3L4EA 1XEXA 3O4FA 1Z4JA 3UK2A 3Q2OA 1XTPA 4OGFA 5JJNB 1X94A 2P7JA 3BRWA 2R2AA 4K2AA 4G1CA 2JP3A 4X3PA 2P2LA 4MVJF 1LJ2A 1P3DA 2FUG1 1SVFA 3ZBUA 2HMTA 4LCUC 3T35A 2H6EA 4JBIA 1S4XA 1U11A 1UPFA 1BDMA 1ONSA 3UOAB 1Z6QA 4UMDA 1Y9JA 3K09A 2HNKA 5B58T 1SKQA 1GN3A 3BABA 1NNSA 3IB3A 2AEFA 4DV7O 1TVMA 1UIMA 4CM4B 1XQYA 1EP1B 3AJEA 4HYEA 2Q28A 1K0FA 3MF4A 2H2HA 2JJ8A 1X19A 1BWQA 4ETNA 1VG8A 3CZAA 3BTVA 3CWBJ 4UARA 3ICEA 1CZOA 2Y1XA 4TTIA 4F72A 2FEPA 2YXDA 1CY4A 4PINA 2ERYA 3D3JA 3NYIA 2CLEB 2DPYA 3GZNB 1PP9E 3BGDA 5LL6P 1GH6A 2G40A 4ANFA 4PLGA 1IULA 4GO1A 3AL2A 1JY2N 1JTVA 4PSVA 2R6GA 3HB9A 1ZJZA 2H1CA 5I5EA 3O9MA 1PD3A 2IW1A 2QJKC 1OOEA 2ZYDA 2W2XA 1PP9J 3KDAA 4B3MB 3AI2A 4BMSA 1RF1B 2YSUB 4KN8A 3AO0B 1UBKS 2H65A 1IOLA 2K37A 3VMAA 3BB4A 2GPSA 4XRGA 3UWDA 2OYIA 1XTRA 3K0SA 4KFTA 4LHWA 1N7IA 3P9IA 5CA3A 4E2YA 4QBGB 4U7FA 5KTOA 1S5JA 2YWCA 3R0XA 2VP2A 4BMPB 2R62A 4F3TA 1JTFA 1VHQA 1L0NJ 1JG7A 3KDSE 1ZC4A 2C7GA 1QZXA 1V39A 3IV7A 3PPVA 4EIWA 4Y2TA 4YDRA 4ON9A 4KLAA 2E5LB 4LWSA 4B3TB 3HB1A 2JJQA 1GZ7A 1XKTA 3AKEA 4GPEA 1BT8A 1FFGA 3F5QA 1JIJA 4DNOA 5E1DA 2YIBA 4URWR 3TGUE 5FBVB 2MW2B 4QXPA 2PANA 2EL7A 5HHTA 5ALKA 1I3LA 2XAQA 5B66H 1Q0HA 3IC5A 4A0GA 4AZTA 2PT9A 4KXQA 1RLOA 3LFTA 3T7IA 3HYSA 5DW3A 1K8XB 2W43A 3G8BA 5T6MA 1NJ5A 3UWSA 5CFNA 1OTYA 3I4FA 3G82C 3ILSA 4H17A 2KSJA 4PY2A 1ONPA 4JI8B 2WWRA 4BFYA 2ZAEB 4N0MA 1F8XA 3S99A 3OEHD 2X5KO 4XEHA 3WKAA 3Q3CA 4OHZA 4JS0A 2F1MA 1U31A 2VDLB 3CSDA 2KNCB 5LZ8A 2JAUA 4KHPO 4ZI5A 2LIPA 4HQKA 5I7SA 3KAPA 1OYVA 4YUVA 3QV1A 3WK8A 4XYLA 1A9YA 1QE5A 1Z38A 5A1TA 4R50A 3U5ZB 2POHA 5A2QA 5LA6B 1VRCA 1HL3A 5F33A 1IO4A 2VTVA 2DHRA 3V7UA 4ZFNA 2IZZA 2DULA 4OK5A 2RGGA 5K09A 2WSYB 1ZRTD 1IEXA 1JLLA 1A9XA 2FDXA 3ESAA 1XVTA 1U8TA 2AI2A 4PANA 2IEIA 5B66E 5IY5B 5APYA 1XU4A 1BQ4A 2A57A 3BXEA 3ZX6A 2CUTA 4ACBA 2CFSA 5GINE 2EXXA 2QTMA 1BOFA 1N8SA 1GMJA 4A2WA 1CUFA 1Q7BA 1T4MA 2P9FA 5AM1A 4PG7A 2EW8A 3A27A 2CMDA 4C7RA 1R0WA 4K8ZA 3VISA 3T9BA 1YE5A 1L4AA 2Q73A 3FSGA 3KEOA 3F5SA 2WT8A 4YV2A 3MAQA 2LKDA 4E12A 4B33A 1UBHS 4B4VA 1UWVA 3CRMA 1H6CA 3J7AC 1FK8A 1DEAA 4X54A 2W98A 3KNZA 1T0HB 3ZVKA 4RSMA 5U4QA 3UJDA 1C9DB 2R3CA 1WXFA 2ZJ0A 1RQGA 3JRXA 5IKMA 4JJIA 1NRWA 4DLPA 3S70A 4NAHA 5TISH 1AKVA 1GDDA 1KK3A 3TOZA 1T4BA 5DP1A 5AW2A 2UUPA 2G7ZA 1NXWA 2QTHA 3BF7A 3FYUA 4WXMA 4X1YA 4EABA 1IUOA 1UZNA 4GDFA 4O2LA 1RHQA 2PKRA 4MB2A 1FX0B 4UNSA 3V6MA 4GYCB 4M76B 4XSGA 4E5UA 1YD7A 3AJ8A 2A78A 4FM2A 1WLSA 4EPRA 1DIGA 5AKYA 2KKWA 3QQPA 3PC8A 3NAMA 4UCQA 3GLGA 4ZYTA 1VF7A 1RWWA 3BPZA 5JJJB 4O8CA 1NTZJ 2R87A 4JR0A 4MEBA 1DADA 4PAOA 5KYYB 5H9CA 5C8YB 2DQSA 4ZPXA 1VDMA 5SYAA 1HLGA 3ZI4A 2GA1A 2OFXA 2HZBA 4RH3A 3S27A 3E7KA 3A9SA 4Y6OA 5PGMA 1I5OA 3Q0TA 1AB5A 3T61A 5TISE 3U2QA 4TM8A 2BZGA 4JGSA 2WKSA 2M1XA 3LU1A 1YVPA 5TQJA 1S9DA 1B3BA 1O57A 5FOTA 2I54A 4BFLA 2QJOA 4O63O 1H85A 1KL7A 3GP3A 2XY4A 5FULA 2F1KA