1QL2A

Inovirus (filamentous bacteriophage) strain pf1 major coat protein assembly
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Structure and Structural Transition of the Alpha-Helical Capsid in Filamentous Bacteriophage Pf1
pubmed doi rcsb
source organism Pseudomonas phage pf1
molecule tags Virus
molecule keywords PF1 BACTERIOPHAGE COAT PROTEIN B
total genus 15
structure length 46
sequence length 46
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ql2A00
2IFMA 1IFNA 2XKMA 3IFMA 2KSJA 1QL2A 2IFNA 1QL1A 4IFMA 1PFIA 2KLVA 1ZN5A 1IFMA
chains in the Genus database with same CATH superfamily
1BE3G 2AEFA 2JWDA 3TNUB 2Z4EA 1AJYA 1CW5A 4AUWA 2H43A 2OYHA 1CSBA 1NTZE 3L74J 1DD4A 2WT7B 3FWLA 4ASWA 1HTLC 5KAFH 3CMAP 2Q3EA 2IDBA 3G9RA 1YI2P 2HODA 2E75D 2OGUA 4GIFA 1JY2O 1NU1E 2JWAA 3KYQA 3F89A 2FYUK 5AW4B 3QH9A 3L75E 3V2QA 2WSSH 4UB8E 3VMYA 3WUUA 3L71D 3U1CA 2O3JA 1HF9A 2ZFCA 1QVGO 3HD7C 2K88A 2UWJE 3CCQP 1J1EC 1PP9D 1J1EB 1GK6A 3H1KG 3L36A 5AW6B 2YIUB 3Q5PA 2QM8A 2C9NY 1OVVA 2M0BA 3A2AA 1GD2E 3CCLP 1L0NE 5APQA 1SQPG 1EZVG 2OTKE 1BSNA 1MV8A 1USEA 5AW9B 1GMJA 2IPPA 1WT6A 1NTMK 4WBAA 3S4RA 1SP4A 3V2NA 1VQ7P 2FYUJ 3TF5A 2H88C 4I2LC 1KFMA 1NTKE 2GUSA 1YQ4C 3CX5E 3GF7A 3JCUH 3M9BA 4IL6X 3KPEA 4WY4B 1KC8Q 1FZAA 2IBZD 2L5GB 3CWBJ 4JQ0D 1W5CE 1VQLP 3KQGA 2K9JA 3WUVA 1N2DC 4U3FJ 2O01N 2HYNA 1KQFB 1KN7A 3AEGC 2QJPC 2OQQA 3CWBG 5DJUB 1ZR4A 2I1KA 1VPCA 3L37A 1HGZA 4HB1A 1LP1B 3L70D 3RL0D 3IFMA 1LTJB 2K9JB 3H1JE 1FZCB 2IFNA 4XE5B 1L0ND 3H1HG 3RK3D 2WSEJ 4WVZA 2D2CC 1FU1A 4OGQD 3TYYA 2H8PD 3CXHH 2XKMA 1LWUC 1NTKK 2ZVOB 2ZJSE 1NWQA 1NTKG 1X8YA 4GDOA 2WT7A 2OYHC 1H0TA 2VRSA 1XTGB 1KFNA 1RY3A 4ZKPA 3HTKB 3ITKA 1LJ2A 5H2FE 3CMEP 2JR8A 4UB6E 1H0TB 1N7SB 2QJKC 5AW8B 1CI6B 2CPBA 4UB8H 2N9BA 3D70A 2MJZA 2PFXA 3H1LE 4U3FD 2ZT9B 2N9YB 1SVFA 2A06G 3RBZA 1LT1A 2HG5D 3H1HE 2FFDC 3V6IA 1KB9I 1CI6A 4LGDE 3L73J 4YTPC 1S9KE 1DEBA 3PH0A 1K73Q 4OH8B 2Q9IA 1L0NJ 1SQVJ 2IYPA 2W27A 3VMAA 4QMAA 1JCCA 3HUSB 1SQPE 2YO2A 1JOCA 2ZYAA 1MUUA 1VQ6P 5KLIC 2QEXP 3IF4A 1G1JA 3AEAC 3AECC 4MN4C 3Q3DA 1VQKP 5AVZB 2H7HA 1NU1G 1FDIA 3WU2E 3Q5SA 1NTZD 2Y0CA 4IOIH 1FZCC 1GL2D 3PJSK 5TISE 4KHXA 2ZXEB 2KK7A 2KS1A 1OMIA 2YMKA 1VF5D 3H1LG 3A5TA 1FJKA 1KV4A 1KB9D 2IZ1A 3PP5A 1KYOD 5CCGD 1YITP 1EZVE 1GW4A 2RH0A 3NFQA 4R4MA 4C46A 1LTJA 3OW2O 1LGHB 3JSVC 3L71J 1BGYG 1RQVA 2XNXA 3L72D 4N3YB 3KHUA 1Q7YQ 1Y9BA 1OFCX 2AXTH 2WPVB 2XV5A 1PFIA 1PP9J 3A3YB 2ZT9C 3Q2YA 2D2CD 2PP6A 3KZIH 1SQQE 1JY3O 1FBMA 1YTZT 3UIAA 2M3BA 2W6AA 1T2KD 1SQXE 3P8CD 2OTJP 1SQBJ 1IO4A 1RF0A 1S9KD 3CL3D 4H13C 5AVSB 1OVUA 1OZHA 2OARA 4Y99B 5CBNA 4YPCA 3AEDC 1SLQA 3M06A 2NRGA 3RK3E 2WSCH 2KP8A 2P10A 3CWBD 3CXHD 5APYA 2SPZA 1LWUB 3HE5A 1BDCA 4L76A 1Q86Q 2A06E 3N7NA 4BWNA 1JTHB 1VF5C 1IFJA 4D6TG 1VQ4P 5AVRB 2ZXXA 4DZOA 3H25A 1IJDB 1QX8A 2FKWB 3G3ZA 4DCKA 2FY8A 4L74A 1DH3A 3A0BH 1KYOE 3HUSA 1FZFA 3ABVC 2P1JA 1S5LE 1J2JB 3I5CA 3AE9C 5DJTB 1AFOA 2WSCJ 2BCCJ 4N78E 4OGQB 5GTIH 3OAKA 5TISH 4TLFA 1PL5A 2YO3A 3H1IG 1KB9H 2W83C 5C39A 3SSUA 5H2FH 2KS1B 2W6JH 4W7ZA 2KOGA 1S2EA 1NOHA 1HUCA 3ZDMA 1LTGC 1NU1J 3H32B 3N4XA 3F5HA 2V7QJ 1SQPD 4Y28J 5CCHD 2KZJA 4TT3H 1U7MA 1DIPA 1EZVI 1PP9G 1L0LJ 2YMYA 3H1KD 1BGYE 1L0NK 5KKZC 5E79E 3H1ID 1BGYJ 1T6AA 2ZYDA 3L71G 4GT1A 4K3AA 3FXEA 3V4WA 1YYCA 3RK2B 4I7ZC 1MZ9A 1KQGB 1SQVD 1OX3A 1FZEA 2AXCA 2FYZA 2LXBA 3HE4A 2C9LY 2JKVA 1BCCJ 1SQQG 3CCUP 1LT9B 3CC7P 3IAOA 2CPSA 1VQOP 1RF1C 1ZMEC 2BCCD 1IFMA 3H1LJ 2DW3A 1S5LX 3WUTA 1NTZJ 4ZKUA 3HD7D 2LXCB 2QIWA 1OVRA 2RMZA 1NO4A 1URQC 3WMM0 1VQ5P 3RL0C 2B89A 2PRRA 2XZRA 2A45I 1IFDA 1VF5B 2IBZI 4EI2A 1NU1D 2Q1KA 4NPDA 2WSEH 4LC1A 1EDLA 3HE5B 3TGUD 1JO5A 1FZBA 3MGNA 4M3LA 1OW6A 4GOEA 1M7LA 2WSFH 3P8MC 2FBWC 4D6TE 3B5NB 3H1HJ 1L4AC 2YKOA 1P84E 4H13B 4WB4A 1FDOA 1BGYD 1LTIC 3MZWB 5APUA 2O1KA 5KJ7C 2FFDB 2HLOA 3RBXA 1AQTA 1EC5A 1BCCE 1RE3C 1TU3F 1ZN5A 1JY2N 1NVOA 1S3JA 2BCCE 2PGDA 3SFDC 4PD4D 2IBZE 3U1AA 2Y9ZA 5GTHH 5APXA 1Q81Q 1HJBA 1YIJP 2Y0DA 1RE4C 1ZW0A 2GM4A 2KLVA 1SFCB 2POHA 3MHVA 1SQBD 2N1TD 1SQVE 2J58A 1KILB 2NPSA 1KMIZ 2A06D 4HYTB 2OYHB 3D6ZA 5KLVK 2J5UA 3G71P 4H44B 4NPFX 3A0HH 2P58A 3TGUJ 4Z1MH 1GL2B 1AVOA 3G6EP 1KD1Q 1GL2C 4CPGA 2C0WA 4H44C 3CCMP 1HJ0A 1SQPK 2QG4A 3L71E 1Y47A 1GL2A 2Q6QA 3Q5RA 1P84H 4JYCA 5GTHE 4L73A 1NAFA 1GU4A 2B87B 1G2CA 2GUVA 2E75B 1X22A 1QEXA 1LT9A 4O9BA 4WWIA 5KLVD 1JUNA 1NGMB 2XDJA 2M5AA 3QWOC 3IN6A 3RL0B 4HH2A 3LW5J 1E5WA 1NH4A 3PHLA 3L70G 2E43A 1QLED 1N73B 3L74D 1OW7A 2R5DA 1Q2NA 4PD4H 2WPSA 3CPWO 1N8RQ 1FE6A 2E42A 4PV1B 2CK3H 4K35A 1H88A 4I7ZB 3AEBC 2FXMA 2ZT9D 4AYCA 1RF1A 2KXPB 4ASVA 3GHGC 1Y8AA 3L75J 3BASA 2HPCA 1QVFO 2OYIB 2O01J 1JY3N 3H1IJ 3VP8A 2A45H 3CX5I 1FAVA 3NMDA 2BCCG 1SQXK 2LR2A 2IX7C 3TNUA 5CCGC 1FZGA 1OXZA 2XU6A 3AEFC 5KLVJ 2OYIA 1LT9C 3V4QA 2IZ0A 1QL1A 3E1IA 3BRVB 2BEZF 1UIXA 3JCUE 2FYUD 4W7YA 1GDTA 1URQB 3B8EB 5AVTB 2WTYA 2Y9YA 1NYHA 2ITAA 4ZMDA 4GKGA 1IFNA 3AE8C 3RL0g 3FX0A 2FXOA 5EFWB 3VOPA 4D6TD 2N1TC 5CJ4A 5KLVE 3L72E 1RE3A 1N7SA 2OTLP 1BCCG 1SQQJ 2IBZG 2WZ7A 2E76D 2KSJA 1DX7A 3H6PA 1T2KC 1FDMA 4IFMA 1M8OB 1PPJE 2FYUG 1T3JA 2JJLA 2I8DA 4WY4C 2PAJA 3USSA 3WU2H 3MTUE 4C7NA 5GTIE 1FOSE 2WPRA 3OA7A 2W6BA 5APTA 2W90A 1DEEG 4WY4A 2V7QH 1YJ9P 1JB0J 1IZNB 2YXRB 2HR3A 3D71A 1A02F 1JMMA 1EQ7A 1X79B 2OYIC 3MUDC 1BDDA 2OYOA 1XTCC 2FYNB 3L70E 3GHGB 1H8AA 3BCCJ 5AW7B 1Q82Q 5BVZA 3HD7B 1GW3A 1IK7A 1N73A 2FFDA 1SQQK 2N1TA 3PTZA 4PJ0E 2K3RA 5KAIE 3SWKA 3E1RA 1IFIA 2MKVA 1KORA 3GHGA 3LIEA 1FZCA 1ZXGA 4RKUJ 1NKNA 2O01H 1EDJA 1WRGA 3L74G 5L8RJ 2C0XA 2N1TB 3PLNA 3S9OA 3W68A 3OJAB 1P84D 2QVAA 3L73D 3T97A 3G4SP 1W2EA 3V5BA 2RKLA 1L0LG 3VTPC 2E76C 2V4HA 2QE7H 2JDIH 4JBZA 3VYIA 4KT0J 1PP9E 3BRTB 1LP1A 4PD4E 1VDFA 3HTKA 1MKMA 1L4AD 3GG2A 1HWTC 2L91A 3H1JJ 1AVYA 5AW0B 3AE5C 4Y99C 3AE4C 3GF3A 1N73C 3AE7C 5AW5B 2JEEA 3CC2P 1N86A 1CZQA 3FGAD 3KDPB 4RJTA 4IFDK 1YJNP 1SQBE 2QJYC 2HODB 2QJYB 2AEMA 1VL2A 1YTZI 1Q90D 1IFPA 1RF0C 3MP7B 4IL6E 1KILC 3M0DA 4PV1C 1RH5B 3CCEP 3A7OA 4I1LA 1LTAC 5CHXA 4B86A 3B5ND 5B66E 1X0TA 2YNYA 3L72J 4C7NB 1M56D 1JNMA 4RO0A 1SS1A 2IFMA 5AW3B 2KUBA 2NPSC 4ZNCA 1U57A 4I6MC 1R5SA 2QJKB 2KI7B 1N7SC 5KLVG 4IL6H 4GOFA 2I1JA 2WMMA 3VMXA 1OIPA 5AVQB 3H1LD 4DOJA 3R2PA 3RK3C 1PGJA 2E5YA 1QL2A 1SQBK 2Y0EA 5AW2B 3RGUA 3HD7A 1SQBG 3FWNA 4GODA 2ZAEB 1PV3A 2QJPB 3O8ZA 3RK3B 4NPEA 4U3FG 1JM0A 1K9MQ 3I56P 4UB6H 1SQQD 1PZQA 2R3CA 3AEEC 2R32A 3L74E 4PJ0H 4DJGA 5KLIB 1SQVG 1YHQP 2KB7P 3RK2C 3LW5H 1M90Q 3FXDA 2J59M 4XFJA 3L73G 3T97B 1EXIA 3CI9A 3EQ2A 3SWFA 1L0LE 2WVRA 2WSFJ 1SFCC 3GW6A 1LTBC 1ZP0C 3EFFK 3TK1A 1KTMA 1J1DB 4H0LC 4JYBA 4OVNF 4N78D 2Q7CA 3C1LA 1BSHA 5APWA 2KLUA 1D7MA 1KZUB 1ZLLA 2E74B 2R5BA 4PD4I 4DT0A 4H44D 3C9IA 2NPSD 3NXSA 4XA4A 4C7RA 3M9QA 5B5EE 1URQD 1R8EA 1YJWP 1X9VA 4YXWH 1EDKA 1ZRTE 3P32A 4U3FE 4A7PA 1JTHA 1JY2P 2JO1A 3B4SA 1IC2A 3KZIE 4N6JA 1NTKD 2FXPA 3PRJA 1NJIQ 1FS0E 2QRXA 3I55P 2M3EA 2QSIA 5AVVB 2YIUC 3L73E 2IYOA 3TGUG 4EOTA 3CC4P 1SQVK 2KZIA 1NTZK 2P67A 1L0NG 1L0LD 3AE3C 1Z56A 3IR9A 5AW1B 3VP9A 3L70J 4LLHA 1BE3J 3GMAA 1MFTA 3VN0A 1PIXA 3CCRP 2QM7A 1JCDA 5CJ0A 1NKZB 1PPJD 5APSA 5B66H 5KKZB 2R44A 1ZR2A 1BCCD 1FC2C 1HGVA 3O6QA 1W2BO 3MD0A 2G8YA 4AQRD 5KJ7A 3AE1C 4L75A 1R5LA 5M1BA 1U7JA 1KYOH 2A45G 3H1JD 5APVA 1ZV8A 1NTMD 3O6QB 3TGUE 2FYNC 2M8RA 1RHZB 2RN0A 2BEQD 3M9HA 3SFEC 1NTKJ 1AA0A 2E74C 1K8AQ 3L4FA 1EZVD 5BU8B 1K05A 1M1JC 1J1DC 4H0LB 3CD6P 3L75D 3K5BA 3M0AA 3H32A 1JEKA 1L4AA 3TSIA 3L72G 5AVUB 1KILE 1LNQA 1BE3D 1OW8A 2WPQA 3TDKA 1WMKA 3CCSP 1PGOA 5CBOA 5CMZA 1ZOYC 3U59A 1GTWA 3Q1MA 2B87A 2E75C 2P7JA 2ZYGA 1PPJG 2H89C 2FYUE 1LTSC 1KILD 2M5AB 2K9YA 5AVWB 2WWWA 5AVXB 3BATA 1HBWA 2AXTE 1KYOI 1NTMJ 2B9BA 1M57D 2K1AA 3CX5D 5K5GB 1AQ5A 1AV1A 3B5NA 1KQLA 1T8ZA 1RQUA 2KNCA 2WQYC 3C8VA 3M91A 1EXJA 1VQ9P 1LWUA 3KXDA 2GA1A 1N7SD 1PGQA 1LTTC 1SQPJ 3V2RA 2YKPA 2G3AA 3HUSC 4R4LA 4HJGH 1NAYA 3HRNA 1NTME 3H1KJ 1BE3E 2E74D 3V2PA 4EYYQ 2Z5HA 2HPCB 1GZLA 2P2UA 1NTZG 3VMZA 2ZVNB 3CCVP 1KB9E 5KAIH 1RE4A 3JC22 5TJHA 1VQMP 3L35A 1N7LA 1KILA 2NPSB 3M0DC 3MIWA 1VQNP 4EDFA 3EFGA 1OWAA 1K04A 2YXQB 5AVYB 1E79H 2BASA 2W8ZA 3RK2D 3BCCD 4PV1D 5KAFE 4YXDC 2Q3IA 1JMBA 3A0BE 1KQSO 1URQA 4HKZH 4EIJA 1QGKB 4OWFA 2Z5IA 3S1KA 3B5NC 3D6YA 2NZ2A 2O1JA 4JF7A 2KIKA 2QA4P 3BCCE 1SFCA 2E5TA 2Q5UA 1SQXD 2LKMA 2K37A 4WY4D 4W80A 1FOSF 3H1HD 1L4AB 1PGPA 2WITA 3NTNA 2KSEA 1UIIA 1YBKA 3P7KA 4BRYA 1HH0A 1JY3P 1S4XA 1SQXG 2KYVA 3W67A 3HE4B 1S5LH 5CCGA 5B5EH 1USDA 1G1IA 2D2CB 3CWBE 3CXHE 5CCHA 2JP3A 4BRYB 1P84I 1M1JA 5KJ7D 1LTJC 1GK4A 1G2CB 1MFZA 1ZRTD 4H0LD 3B71A 3LIDA 4RESB 1S72P 3BCCG 3R4YA 1RF1B 4IFFA 4D6TJ 2KNCB 3AE6C 5KTBA 1M1JB 1DD3A 1VQ8P 1SFCD 1GU5A 3MUDA 1H89A 1L0LK 3SWYA 1NHLA 2XNDH 1SQXJ 1VQPP 3CCJP 1IK9A 1HVVA 1M1KQ 3CXHI 5BU5A 3EWKA 1NU1K 1YQ3C 3L75G 4JPZB 4OGQC 2R3SA 3H1JG 4KJMA 5E79H 1A02J 1FJPA 3H1IE 4H13D 4BXLA 3E7KA 1S1CX 3GLMA 2B88A 3AE2C 3H1KE 3II6A 3P8CE 4U7JA 2AEJA 5CCHC 1L2PA 3BVHA 2HFED 3A0HE 2E76B 2YKQA 3CX5H 1NTMG 3CLQA 1T3UA 1EDIA
chains in the Genus database with same CATH topology
3TNUB 2Z4EA 1CW5A 4AUWA 2H43A 2OYHA 1CSBA 2WT7B 1HTLC 1HWTC 2HODA 4GIFA 1JY2O 3KYQA 5AW4B 3V2QA 3VMYA 2FYUK 3U1CA 2ZFCA 3HD7C 1J1EC 1J1EB 1GK6A 3L36A 5AW6B 2C9NY 2QM8A 1GD2E 3A2AA 5APQA 1MV8A 5AW9B 2IPPA 1WT6A 1NTMK 4WBAA 1SP4A 3V2NA 4I2LC 1KFMA 2GUSA 4WY4B 3M9BA 3KPEA 1FZAA 2L5GB 3KQGA 1N2DC 2HYNA 1ZR4A 2I1KA 1VPCA 3L37A 1HGZA 3RL0D 3IFMA 1LTJB 1FZCB 2IFNA 4XE5B 3RK3D 3TYYA 1FU1A 2H8PD 2XKMA 1LWUC 1NTKK 1NWQA 1X8YA 2WT7A 2OYHC 2VRSA 1XTGB 1KFNA 1RY3A 4ZKPA 3HTKB 1N7SB 5AW8B 1CI6B 2CPBA 2N9BA 2MJZA 1SVFA 2HG5D 2FFDC 4LGDE 1CI6A 1S9KE 1DEBA 4OH8B 2Q9IA 2W27A 1JCCA 3HUSB 2YO2A 1JOCA 1MUUA 1G1JA 2H7HA 5AVZB 1FZCC 1GL2D 4KHXA 2ZXEB 3A5TA 1FJKA 3PP5A 5CCGD 1GW4A 3NFQA 4C46A 1LTJA 1LGHB 4N3YB 2XNXA 2XV5A 1PFIA 3A3YB 2PP6A 3UIAA 1JY3O 1FBMA 1YTZT 2M3BA 2W6AA 1T2KD 3P8CD 1IO4A 1RF0A 3CL3D 5AVSB 4Y99B 2OARA 1SLQA 3M06A 2WSCH 2KP8A 5APYA 1LWUB 3HE5A 3N7NA 1JTHB 1IFJA 5AVRB 4DZOA 1IJDB 2FKWB 3G3ZA 1DH3A 3HUSA 1FZFA 2P1JA 1J2JB 3I5CA 1AFOA 4N78E 3OAKA 2YO3A 4W7ZA 2KOGA 1NOHA 1HUCA 1LTGC 3H32B 3N4XA 5CCHD 2YMYA 1L0NK 3V4WA 4GT1A 1YYCA 3RK2B 1MZ9A 1FZEA 3HE4A 2FYZA 2C9LY 1LT9B 2CPSA 1RF1C 1IFMA 4ZKUA 3HD7D 1NO4A 1URQC 3WMM0 3RL0C 2XZRA 2A45I 1IFDA 2WSEH 4LC1A 3HE5B 1JO5A 1FZBA 3MGNA 4M3LA 1M7LA 2WSFH 3P8MC 3B5NB 1L4AC 2YKOA 4WB4A 1LTIC 5APUA 2O1KA 5KJ7C 2FFDB 2HLOA 1RE3C 1ZN5A 1S9KD 1JY2N 3U1AA 5APXA 1HJBA 1RE4C 2GM4A 2KLVA 1SFCB 2POHA 2N1TD 2J58A 1KILB 2NPSA 4HYTB 2OYHB 5KLVK 1GL2B 1GL2C 2C0WA 1SQPK 1GL2A 4JYCA 1NAFA 1GU4A 1G2CA 2GUVA 1LT9A 4O9BA 1JUNA 2XDJA 3RL0B 4HH2A 1E5WA 1NH4A 2E43A 1N73B 2R5DA 2WPSA 1H88A 2FXMA 4AYCA 1RF1A 3GHGC 3BASA 2HPCA 2OYIB 1JY3N 3VP8A 2A45H 1FAVA 3NMDA 1SQXK 3TNUA 2IX7C 1FZGA 5CCGC 1OXZA 2XU6A 2OYIA 1LT9C 3V4QA 1QL1A 3E1IA 3BRVB 1GDTA 4W7YA 3B8EB 1URQB 5AVTB 2WTYA 4GKGA 1IFNA 3VOPA 2N1TC 5CJ4A 1RE3A 1N7SA 2WZ7A 2KSJA 1DX7A 3H6PA 1T2KC 1FDMA 4IFMA 2JJLA 4WY4C 1T3JA 1A02J 1FOSE 2PAJA 4C7NA 3MTUE 2WPRA 3OA7A 2W6BA 5APTA 4WY4A 1A02F 1JMMA 1EQ7A 1X79B 2OYIC 1XTCC 3GHGB 1H8AA 5AW7B 5BVZA 3HD7B 1GW3A 1N73A 1SQQK 2N1TA 1IFIA 3LIEA 3GHGA 1FZCA 1NKNA 2O01H 1WRGA 2C0XA 2N1TB 3OJAB 3T97A 1W2EA 3V5BA 3VTPC 3VYIA 3BRTB 1VDFA 3HTKA 1L4AD 5AW0B 4Y99C 1N73C 5AW5B 2JEEA 1N86A 1CZQA 3KDPB 4IFDK 2HODB 1YTZI 1RF0C 1KILC 3M0DA 3A7OA 4I1LA 1LTAC 5CHXA 4B86A 3B5ND 2YNYA 4C7NB 1JNMA 5AW3B 2IFMA 2NPSC 4I6MC 1N7SC 2I1JA 4DOJA 3VMXA 5AVQB 3R2PA 3RK3C 1QL2A 1SQBK 5AW2B 3HD7A 3O8ZA 3RK3B 2R3CA 2R32A 2KB7P 3RK2C 3LW5H 2J59M 3CI9A 3EQ2A 3SWFA 1SFCC 1LTBC 3TK1A 1J1DB 4JYBA 4N78D 2Q7CA 5APWA 1KZUB 1ZLLA 2R5BA 3C9IA 2NPSD 3NXSA 4XA4A 4C7RA 3M9QA 1URQD 1X9VA 3P32A 1JTHA 1JY2P 1IC2A 4N6JA 5AVVB 4EOTA 1SQVK 1NTZK 2P67A 1Z56A 3IR9A 5AW1B 3VP9A 4LLHA 3VN0A 2QM7A 1JCDA 5APSA 1NKZB 1ZR2A 1HGVA 3MD0A 5KJ7A 4AQRD 2A45G 5APVA 1ZV8A 3M9HA 2M8RA 3L4FA 5BU8B 1M1JC 1J1DC 3M0AA 3H32A 1L4AA 3TSIA 5AVUB 2WPQA 1GTWA 5CMZA 3U59A 2P7JA 1LTSC 1KILD 5AVWB 2WWWA 5AVXB 3BATA 1HBWA 1AQ5A 3B5NA 1KQLA 1T8ZA 3M91A 2E42A 1LWUA 3V2RA 1N7SD 1LTTC 2YKPA 3HUSC 3HRNA 3V2PA 2Z5HA 2HPCB 1GZLA 2P2UA 3VMZA 1RE4A 3L35A 1N7LA 1KILA 2NPSB 3M0DC 3MIWA 3EFGA 1OWAA 5AVYB 2FFDA 2BASA 3RK2D 2Q3IA 1URQA 4EIJA 2Z5IA 3B5NC 2O1JA 4JF7A 1SFCA 2Q5UA 2LKMA 4WY4D 4W80A 1FOSF 1L4AB 2WITA 3NTNA 3P7KA 1HH0A 1JY3P 2KYVA 3HE4B 5CCGA 1G1IA 5CCHA 5KJ7D 1M1JA 1LTJC 1GK4A 1G2CB 1MFZA 4RESB 3LIDA 1RF1B 4IFFA 5KTBA 1M1JB 1SFCD 1GU5A 3MUDA 1H89A 1L0LK 3SWYA 1NHLA 1IK9A 1HVVA 5BU5A 1NU1K 1FJPA 3II6A 3P8CE 5CCHC 3BVHA 2HFED 2YKQA 5CJ0A 3CLQA 1T3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFM A;  1IFN A;  2XKM A;  3IFM A;  2KSJ A;  1QL2 A;  2IFN A;  1QL1 A;  4IFM A;  1PFI A;  2KLV A;  1ZN5 A;  1IFM A; 
#chains in the Genus database with same CATH topology
 1BE3 G;  2AEF A;  2JWD A;  3TNU B;  2Z4E A;  1AJY A;  1CW5 A;  4AUW A;  2H43 A;  2OYH A;  1CSB A;  1NTZ E;  3L74 J;  1DD4 A;  2WT7 B;  3FWL A;  4ASW A;  1HTL C;  5KAF H;  3CMA P;  2Q3E A;  2IDB A;  3G9R A;  1YI2 P;  2HOD A;  2E75 D;  2OGU A;  4GIF A;  1JY2 O;  1NU1 E;  2JWA A;  3KYQ A;  3F89 A;  2FYU K;  5AW4 B;  3QH9 A;  3L75 E;  3V2Q A;  2WSS H;  4UB8 E;  3VMY A;  3WUU A;  3L71 D;  3U1C A;  2O3J A;  1HF9 A;  2ZFC A;  1QVG O;  3HD7 C;  2K88 A;  2UWJ E;  3CCQ P;  1J1E C;  1PP9 D;  1J1E B;  1GK6 A;  3H1K G;  3L36 A;  5AW6 B;  2YIU B;  3Q5P A;  2QM8 A;  2C9N Y;  1OVV A;  2M0B A;  3A2A A;  1GD2 E;  3CCL P;  1L0N E;  5APQ A;  1SQP G;  1EZV G;  2OTK E;  1BSN A;  1MV8 A;  1USE A;  5AW9 B;  1GMJ A;  2IPP A;  1WT6 A;  1NTM K;  4WBA A;  3S4R A;  1SP4 A;  3V2N A;  1VQ7 P;  2FYU J;  3TF5 A;  2H88 C;  4I2L C;  1KFM A;  1NTK E;  2GUS A;  1YQ4 C;  3CX5 E;  3GF7 A;  3JCU H;  3M9B A;  4IL6 X;  3KPE A;  4WY4 B;  1KC8 Q;  1FZA A;  2IBZ D;  2L5G B;  3CWB J;  4JQ0 D;  1W5C E;  1VQL P;  3KQG A;  2K9J A;  3WUV A;  1N2D C;  4U3F J;  2O01 N;  2HYN A;  1KQF B;  1KN7 A;  3AEG C;  2QJP C;  2OQQ A;  3CWB G;  5DJU B;  1ZR4 A;  2I1K A;  1VPC A;  3L37 A;  1HGZ A;  4HB1 A;  1LP1 B;  3L70 D;  3RL0 D;  3IFM A;  1LTJ B;  2K9J B;  3H1J E;  1FZC B;  2IFN A;  4XE5 B;  1L0N D;  3H1H G;  3RK3 D;  2WSE J;  4WVZ A;  2D2C C;  1FU1 A;  4OGQ D;  3TYY A;  2H8P D;  3CXH H;  2XKM A;  1LWU C;  1NTK K;  2ZVO B;  2ZJS E;  1NWQ A;  1NTK G;  1X8Y A;  4GDO A;  2WT7 A;  2OYH C;  1H0T A;  2VRS A;  1XTG B;  1KFN A;  1RY3 A;  4ZKP A;  3HTK B;  3ITK A;  1LJ2 A;  5H2F E;  3CME P;  2JR8 A;  4UB6 E;  1H0T B;  1N7S B;  2QJK C;  5AW8 B;  1CI6 B;  2CPB A;  4UB8 H;  2N9B A;  3D70 A;  2MJZ A;  2PFX A;  3H1L E;  4U3F D;  2ZT9 B;  2N9Y B;  1SVF A;  2A06 G;  3RBZ A;  1LT1 A;  2HG5 D;  3H1H E;  2FFD C;  3V6I A;  1KB9 I;  1CI6 A;  4LGD E;  3L73 J;  4YTP C;  1S9K E;  1DEB A;  3PH0 A;  1K73 Q;  4OH8 B;  2Q9I A;  1L0N J;  1SQV J;  2IYP A;  2W27 A;  3VMA A;  4QMA A;  1JCC A;  3HUS B;  1SQP E;  2YO2 A;  1JOC A;  2ZYA A;  1MUU A;  1VQ6 P;  5KLI C;  2QEX P;  3IF4 A;  1G1J A;  3AEA C;  3AEC C;  4MN4 C;  3Q3D A;  1VQK P;  5AVZ B;  2H7H A;  1NU1 G;  1FDI A;  3WU2 E;  3Q5S A;  1NTZ D;  2Y0C A;  4IOI H;  1FZC C;  1GL2 D;  3PJS K;  5TIS E;  4KHX A;  2ZXE B;  2KK7 A;  2KS1 A;  1OMI A;  2YMK A;  1VF5 D;  3H1L G;  3A5T A;  1FJK A;  1KV4 A;  1KB9 D;  2IZ1 A;  3PP5 A;  1KYO D;  5CCG D;  1YIT P;  1EZV E;  1GW4 A;  2RH0 A;  3NFQ A;  4R4M A;  4C46 A;  1LTJ A;  3OW2 O;  1LGH B;  3JSV C;  3L71 J;  1BGY G;  1RQV A;  2XNX A;  3L72 D;  4N3Y B;  3KHU A;  1Q7Y Q;  1Y9B A;  1OFC X;  2AXT H;  2WPV B;  2XV5 A;  1PFI A;  1PP9 J;  3A3Y B;  2ZT9 C;  3Q2Y A;  2D2C D;  2PP6 A;  3KZI H;  1SQQ E;  1JY3 O;  1FBM A;  1YTZ T;  3UIA A;  2M3B A;  2W6A A;  1T2K D;  1SQX E;  3P8C D;  2OTJ P;  1SQB J;  1IO4 A;  1RF0 A;  1S9K D;  3CL3 D;  4H13 C;  5AVS B;  1OVU A;  1OZH A;  2OAR A;  4Y99 B;  5CBN A;  4YPC A;  3AED C;  1SLQ A;  3M06 A;  2NRG A;  3RK3 E;  2WSC H;  2KP8 A;  2P10 A;  3CWB D;  3CXH D;  5APY A;  2SPZ A;  1LWU B;  3HE5 A;  1BDC A;  4L76 A;  1Q86 Q;  2A06 E;  3N7N A;  4BWN A;  1JTH B;  1VF5 C;  1IFJ A;  4D6T G;  1VQ4 P;  5AVR B;  2ZXX A;  4DZO A;  3H25 A;  1IJD B;  1QX8 A;  2FKW B;  3G3Z A;  4DCK A;  2FY8 A;  4L74 A;  1DH3 A;  3A0B H;  1KYO E;  3HUS A;  1FZF A;  3ABV C;  2P1J A;  1S5L E;  1J2J B;  3I5C A;  3AE9 C;  5DJT B;  1AFO A;  2WSC J;  2BCC J;  4N78 E;  4OGQ B;  5GTI H;  3OAK A;  5TIS H;  4TLF A;  1PL5 A;  2YO3 A;  3H1I G;  1KB9 H;  2W83 C;  5C39 A;  3SSU A;  5H2F H;  2KS1 B;  2W6J H;  4W7Z A;  2KOG A;  1S2E A;  1NOH A;  1HUC A;  3ZDM A;  1LTG C;  1NU1 J;  3H32 B;  3N4X A;  3F5H A;  2V7Q J;  1SQP D;  4Y28 J;  5CCH D;  2KZJ A;  4TT3 H;  1U7M A;  1DIP A;  1EZV I;  1PP9 G;  1L0L J;  2YMY A;  3H1K D;  1BGY E;  1L0N K;  5KKZ C;  5E79 E;  3H1I D;  1BGY J;  1T6A A;  2ZYD A;  3L71 G;  4GT1 A;  4K3A A;  3FXE A;  3V4W A;  1YYC A;  3RK2 B;  4I7Z C;  1MZ9 A;  1KQG B;  1SQV D;  1OX3 A;  1FZE A;  2AXC A;  2FYZ A;  2LXB A;  3HE4 A;  2C9L Y;  2JKV A;  1BCC J;  1SQQ G;  3CCU P;  1LT9 B;  3CC7 P;  3IAO A;  2CPS A;  1VQO P;  1RF1 C;  1ZME C;  2BCC D;  1IFM A;  3H1L J;  2DW3 A;  1S5L X;  3WUT A;  1NTZ J;  4ZKU A;  3HD7 D;  2LXC B;  2QIW A;  1OVR A;  2RMZ A;  1NO4 A;  1URQ C;  3WMM 0;  1VQ5 P;  3RL0 C;  2B89 A;  2PRR A;  2XZR A;  2A45 I;  1IFD A;  1VF5 B;  2IBZ I;  4EI2 A;  1NU1 D;  2Q1K A;  4NPD A;  2WSE H;  4LC1 A;  1EDL A;  3HE5 B;  3TGU D;  1JO5 A;  1FZB A;  3MGN A;  4M3L A;  1OW6 A;  4GOE A;  1M7L A;  2WSF H;  3P8M C;  2FBW C;  4D6T E;  3B5N B;  3H1H J;  1L4A C;  2YKO A;  1P84 E;  4H13 B;  4WB4 A;  1FDO A;  1BGY D;  1LTI C;  3MZW B;  5APU A;  2O1K A;  5KJ7 C;  2FFD B;  2HLO A;  3RBX A;  1AQT A;  1EC5 A;  1BCC E;  1RE3 C;  1TU3 F;  1ZN5 A;  1JY2 N;  1NVO A;  1S3J A;  2BCC E;  2PGD A;  3SFD C;  4PD4 D;  2IBZ E;  3U1A A;  2Y9Z A;  5GTH H;  5APX A;  1Q81 Q;  1HJB A;  1YIJ P;  2Y0D A;  1RE4 C;  1ZW0 A;  2GM4 A;  2KLV A;  1SFC B;  2POH A;  3MHV A;  1SQB D;  2N1T D;  1SQV E;  2J58 A;  1KIL B;  2NPS A;  1KMI Z;  2A06 D;  4HYT B;  2OYH B;  3D6Z A;  5KLV K;  2J5U A;  3G71 P;  4H44 B;  4NPF X;  3A0H H;  2P58 A;  3TGU J;  4Z1M H;  1GL2 B;  1AVO A;  3G6E P;  1KD1 Q;  1GL2 C;  4CPG A;  2C0W A;  4H44 C;  3CCM P;  1HJ0 A;  1SQP K;  2QG4 A;  3L71 E;  1Y47 A;  1GL2 A;  2Q6Q A;  3Q5R A;  1P84 H;  4JYC A;  5GTH E;  4L73 A;  1NAF A;  1GU4 A;  2B87 B;  1G2C A;  2GUV A;  2E75 B;  1X22 A;  1QEX A;  1LT9 A;  4O9B A;  4WWI A;  5KLV D;  1JUN A;  1NGM B;  2XDJ A;  2M5A A;  3QWO C;  3IN6 A;  3RL0 B;  4HH2 A;  3LW5 J;  1E5W A;  1NH4 A;  3PHL A;  3L70 G;  2E43 A;  1QLE D;  1N73 B;  3L74 D;  1OW7 A;  2R5D A;  1Q2N A;  4PD4 H;  2WPS A;  3CPW O;  1N8R Q;  1FE6 A;  2E42 A;  4PV1 B;  2CK3 H;  4K35 A;  1H88 A;  4I7Z B;  3AEB C;  2FXM A;  2ZT9 D;  4AYC A;  1RF1 A;  2KXP B;  4ASV A;  3GHG C;  1Y8A A;  3L75 J;  3BAS A;  2HPC A;  1QVF O;  2OYI B;  2O01 J;  1JY3 N;  3H1I J;  3VP8 A;  2A45 H;  3CX5 I;  1FAV A;  3NMD A;  2BCC G;  1SQX K;  2LR2 A;  2IX7 C;  3TNU A;  5CCG C;  1FZG A;  1OXZ A;  2XU6 A;  3AEF C;  5KLV J;  2OYI A;  1LT9 C;  3V4Q A;  2IZ0 A;  1QL1 A;  3E1I A;  3BRV B;  2BEZ F;  1UIX A;  3JCU E;  2FYU D;  4W7Y A;  1GDT A;  1URQ B;  3B8E B;  5AVT B;  2WTY A;  2Y9Y A;  1NYH A;  2ITA A;  4ZMD A;  4GKG A;  1IFN A;  3AE8 C;  3RL0 g;  3FX0 A;  2FXO A;  5EFW B;  3VOP A;  4D6T D;  2N1T C;  5CJ4 A;  5KLV E;  3L72 E;  1RE3 A;  1N7S A;  2OTL P;  1BCC G;  1SQQ J;  2IBZ G;  2WZ7 A;  2E76 D;  2KSJ A;  1DX7 A;  3H6P A;  1T2K C;  1FDM A;  4IFM A;  1M8O B;  1PPJ E;  2FYU G;  1T3J A;  2JJL A;  2I8D A;  4WY4 C;  2PAJ A;  3USS A;  3WU2 H;  3MTU E;  4C7N A;  5GTI E;  1FOS E;  2WPR A;  3OA7 A;  2W6B A;  5APT A;  2W90 A;  1DEE G;  4WY4 A;  2V7Q H;  1YJ9 P;  1JB0 J;  1IZN B;  2YXR B;  2HR3 A;  3D71 A;  1A02 F;  1JMM A;  1EQ7 A;  1X79 B;  2OYI C;  3MUD C;  1BDD A;  2OYO A;  1XTC C;  2FYN B;  3L70 E;  3GHG B;  1H8A A;  3BCC J;  5AW7 B;  1Q82 Q;  5BVZ A;  3HD7 B;  1GW3 A;  1IK7 A;  1N73 A;  2FFD A;  1SQQ K;  2N1T A;  3PTZ A;  4PJ0 E;  2K3R A;  5KAI E;  3SWK A;  3E1R A;  1IFI A;  2MKV A;  1KOR A;  3GHG A;  3LIE A;  1FZC A;  1ZXG A;  4RKU J;  1NKN A;  2O01 H;  1EDJ A;  1WRG A;  3L74 G;  5L8R J;  2C0X A;  2N1T B;  3PLN A;  3S9O A;  3W68 A;  3OJA B;  1P84 D;  2QVA A;  3L73 D;  3T97 A;  3G4S P;  1W2E A;  3V5B A;  2RKL A;  1L0L G;  3VTP C;  2E76 C;  2V4H A;  2QE7 H;  2JDI H;  4JBZ A;  3VYI A;  4KT0 J;  1PP9 E;  3BRT B;  1LP1 A;  4PD4 E;  1VDF A;  3HTK A;  1MKM A;  1L4A D;  3GG2 A;  1HWT C;  2L91 A;  3H1J J;  1AVY A;  5AW0 B;  3AE5 C;  4Y99 C;  3AE4 C;  3GF3 A;  1N73 C;  3AE7 C;  5AW5 B;  2JEE A;  3CC2 P;  1N86 A;  1CZQ A;  3FGA D;  3KDP B;  4RJT A;  4IFD K;  1YJN P;  1SQB E;  2QJY C;  2HOD B;  2QJY B;  2AEM A;  1VL2 A;  1YTZ I;  1Q90 D;  1IFP A;  1RF0 C;  3MP7 B;  4IL6 E;  1KIL C;  3M0D A;  4PV1 C;  1RH5 B;  3CCE P;  3A7O A;  4I1L A;  1LTA C;  5CHX A;  4B86 A;  3B5N D;  5B66 E;  1X0T A;  2YNY A;  3L72 J;  4C7N B;  1M56 D;  1JNM A;  4RO0 A;  1SS1 A;  2IFM A;  5AW3 B;  2KUB A;  2NPS C;  4ZNC A;  1U57 A;  4I6M C;  1R5S A;  2QJK B;  2KI7 B;  1N7S C;  5KLV G;  4IL6 H;  4GOF A;  2I1J A;  2WMM A;  3VMX A;  1OIP A;  5AVQ B;  3H1L D;  4DOJ A;  3R2P A;  3RK3 C;  1PGJ A;  2E5Y A;  1QL2 A;  1SQB K;  2Y0E A;  5AW2 B;  3RGU A;  3HD7 A;  1SQB G;  3FWN A;  4GOD A;  2ZAE B;  1PV3 A;  2QJP B;  3O8Z A;  3RK3 B;  4NPE A;  4U3F G;  1JM0 A;  1K9M Q;  3I56 P;  4UB6 H;  1SQQ D;  1PZQ A;  2R3C A;  3AEE C;  2R32 A;  3L74 E;  4PJ0 H;  4DJG A;  5KLI B;  1SQV G;  1YHQ P;  2KB7 P;  3RK2 C;  3LW5 H;  1M90 Q;  3FXD A;  2J59 M;  4XFJ A;  3L73 G;  3T97 B;  1EXI A;  3CI9 A;  3EQ2 A;  3SWF A;  1L0L E;  2WVR A;  2WSF J;  1SFC C;  3GW6 A;  1LTB C;  1ZP0 C;  3EFF K;  3TK1 A;  1KTM A;  1J1D B;  4H0L C;  4JYB A;  4OVN F;  4N78 D;  2Q7C A;  3C1L A;  1BSH A;  5APW A;  2KLU A;  1D7M A;  1KZU B;  1ZLL A;  2E74 B;  2R5B A;  4PD4 I;  4DT0 A;  4H44 D;  3C9I A;  2NPS D;  3NXS A;  4XA4 A;  4C7R A;  3M9Q A;  5B5E E;  1URQ D;  1R8E A;  1YJW P;  1X9V A;  4YXW H;  1EDK A;  1ZRT E;  3P32 A;  4U3F E;  4A7P A;  1JTH A;  1JY2 P;  2JO1 A;  3B4S A;  1IC2 A;  3KZI E;  4N6J A;  1NTK D;  2FXP A;  3PRJ A;  1NJI Q;  1FS0 E;  2QRX A;  3I55 P;  2M3E A;  2QSI A;  5AVV B;  2YIU C;  3L73 E;  2IYO A;  3TGU G;  4EOT A;  3CC4 P;  1SQV K;  2KZI A;  1NTZ K;  2P67 A;  1L0N G;  1L0L D;  3AE3 C;  1Z56 A;  3IR9 A;  5AW1 B;  3VP9 A;  3L70 J;  4LLH A;  1BE3 J;  3GMA A;  1MFT A;  3VN0 A;  1PIX A;  3CCR P;  2QM7 A;  1JCD A;  5CJ0 A;  1NKZ B;  1PPJ D;  5APS A;  5B66 H;  5KKZ B;  2R44 A;  1ZR2 A;  1BCC D;  1FC2 C;  1HGV A;  3O6Q A;  1W2B O;  3MD0 A;  2G8Y A;  4AQR D;  5KJ7 A;  3AE1 C;  4L75 A;  1R5L A;  5M1B A;  1U7J A;  1KYO H;  2A45 G;  3H1J D;  5APV A;  1ZV8 A;  1NTM D;  3O6Q B;  3TGU E;  2FYN C;  2M8R A;  1RHZ B;  2RN0 A;  2BEQ D;  3M9H A;  3SFE C;  1NTK J;  1AA0 A;  2E74 C;  1K8A Q;  3L4F A;  1EZV D;  5BU8 B;  1K05 A;  1M1J C;  1J1D C;  4H0L B;  3CD6 P;  3L75 D;  3K5B A;  3M0A A;  3H32 A;  1JEK A;  1L4A A;  3TSI A;  3L72 G;  5AVU B;  1KIL E;  1LNQ A;  1BE3 D;  1OW8 A;  2WPQ A;  3TDK A;  1WMK A;  3CCS P;  1PGO A;  5CBO A;  5CMZ A;  1ZOY C;  3U59 A;  1GTW A;  3Q1M A;  2B87 A;  2E75 C;  2P7J A;  2ZYG A;  1PPJ G;  2H89 C;  2FYU E;  1LTS C;  1KIL D;  2M5A B;  2K9Y A;  5AVW B;  2WWW A;  5AVX B;  3BAT A;  1HBW A;  2AXT E;  1KYO I;  1NTM J;  2B9B A;  1M57 D;  2K1A A;  3CX5 D;  5K5G B;  1AQ5 A;  1AV1 A;  3B5N A;  1KQL A;  1T8Z A;  1RQU A;  2KNC A;  2WQY C;  3C8V A;  3M91 A;  1EXJ A;  1VQ9 P;  1LWU A;  3KXD A;  2GA1 A;  1N7S D;  1PGQ A;  1LTT C;  1SQP J;  3V2R A;  2YKP A;  2G3A A;  3HUS C;  4R4L A;  4HJG H;  1NAY A;  3HRN A;  1NTM E;  3H1K J;  1BE3 E;  2E74 D;  3V2P A;  4EYY Q;  2Z5H A;  2HPC B;  1GZL A;  2P2U A;  1NTZ G;  3VMZ A;  2ZVN B;  3CCV P;  1KB9 E;  5KAI H;  1RE4 A;  3JC2 2;  5TJH A;  1VQM P;  3L35 A;  1N7L A;  1KIL A;  2NPS B;  3M0D C;  3MIW A;  1VQN P;  4EDF A;  3EFG A;  1OWA A;  1K04 A;  2YXQ B;  5AVY B;  1E79 H;  2BAS A;  2W8Z A;  3RK2 D;  3BCC D;  4PV1 D;  5KAF E;  4YXD C;  2Q3I A;  1JMB A;  3A0B E;  1KQS O;  1URQ A;  4HKZ H;  4EIJ A;  1QGK B;  4OWF A;  2Z5I A;  3S1K A;  3B5N C;  3D6Y A;  2NZ2 A;  2O1J A;  4JF7 A;  2KIK A;  2QA4 P;  3BCC E;  1SFC A;  2E5T A;  2Q5U A;  1SQX D;  2LKM A;  2K37 A;  4WY4 D;  4W80 A;  1FOS F;  3H1H D;  1L4A B;  1PGP A;  2WIT A;  3NTN A;  2KSE A;  1UII A;  1YBK A;  3P7K A;  4BRY A;  1HH0 A;  1JY3 P;  1S4X A;  1SQX G;  2KYV A;  3W67 A;  3HE4 B;  1S5L H;  5CCG A;  5B5E H;  1USD A;  1G1I A;  2D2C B;  3CWB E;  3CXH E;  5CCH A;  2JP3 A;  4BRY B;  1P84 I;  1M1J A;  5KJ7 D;  1LTJ C;  1GK4 A;  1G2C B;  1MFZ A;  1ZRT D;  4H0L D;  3B71 A;  3LID A;  4RES B;  1S72 P;  3BCC G;  3R4Y A;  1RF1 B;  4IFF A;  4D6T J;  2KNC B;  3AE6 C;  5KTB A;  1M1J B;  1DD3 A;  1VQ8 P;  1SFC D;  1GU5 A;  3MUD A;  1H89 A;  1L0L K;  3SWY A;  1NHL A;  2XND H;  1SQX J;  1VQP P;  3CCJ P;  1IK9 A;  1HVV A;  1M1K Q;  3CXH I;  5BU5 A;  3EWK A;  1NU1 K;  1YQ3 C;  3L75 G;  4JPZ B;  4OGQ C;  2R3S A;  3H1J G;  4KJM A;  5E79 H;  1A02 J;  1FJP A;  3H1I E;  4H13 D;  4BXL A;  3E7K A;  1S1C X;  3GLM A;  2B88 A;  3AE2 C;  3H1K E;  3II6 A;  3P8C E;  4U7J A;  2AEJ A;  5CCH C;  1L2P A;  3BVH A;  2HFE D;  3A0H E;  2E76 B;  2YKQ A;  3CX5 H;  1NTM G;  3CLQ A;  1T3U A;  1EDI A; 
#chains in the Genus database with same CATH homology
 3TNU B;  2Z4E A;  1CW5 A;  4AUW A;  2H43 A;  2OYH A;  1CSB A;  2WT7 B;  1HTL C;  1HWT C;  2HOD A;  4GIF A;  1JY2 O;  3KYQ A;  5AW4 B;  3V2Q A;  3VMY A;  2FYU K;  3U1C A;  2ZFC A;  3HD7 C;  1J1E C;  1J1E B;  1GK6 A;  3L36 A;  5AW6 B;  2C9N Y;  2QM8 A;  1GD2 E;  3A2A A;  5APQ A;  1MV8 A;  5AW9 B;  2IPP A;  1WT6 A;  1NTM K;  4WBA A;  1SP4 A;  3V2N A;  4I2L C;  1KFM A;  2GUS A;  4WY4 B;  3M9B A;  3KPE A;  1FZA A;  2L5G B;  3KQG A;  1N2D C;  2HYN A;  1ZR4 A;  2I1K A;  1VPC A;  3L37 A;  1HGZ A;  3RL0 D;  3IFM A;  1LTJ B;  1FZC B;  2IFN A;  4XE5 B;  3RK3 D;  3TYY A;  1FU1 A;  2H8P D;  2XKM A;  1LWU C;  1NTK K;  1NWQ A;  1X8Y A;  2WT7 A;  2OYH C;  2VRS A;  1XTG B;  1KFN A;  1RY3 A;  4ZKP A;  3HTK B;  1N7S B;  5AW8 B;  1CI6 B;  2CPB A;  2N9B A;  2MJZ A;  1SVF A;  2HG5 D;  2FFD C;  4LGD E;  1CI6 A;  1S9K E;  1DEB A;  4OH8 B;  2Q9I A;  2W27 A;  1JCC A;  3HUS B;  2YO2 A;  1JOC A;  1MUU A;  1G1J A;  2H7H A;  5AVZ B;  1FZC C;  1GL2 D;  4KHX A;  2ZXE B;  3A5T A;  1FJK A;  3PP5 A;  5CCG D;  1GW4 A;  3NFQ A;  4C46 A;  1LTJ A;  1LGH B;  4N3Y B;  2XNX A;  2XV5 A;  1PFI A;  3A3Y B;  2PP6 A;  3UIA A;  1JY3 O;  1FBM A;  1YTZ T;  2M3B A;  2W6A A;  1T2K D;  3P8C D;  1IO4 A;  1RF0 A;  3CL3 D;  5AVS B;  4Y99 B;  2OAR A;  1SLQ A;  3M06 A;  2WSC H;  2KP8 A;  5APY A;  1LWU B;  3HE5 A;  3N7N A;  1JTH B;  1IFJ A;  5AVR B;  4DZO A;  1IJD B;  2FKW B;  3G3Z A;  1DH3 A;  3HUS A;  1FZF A;  2P1J A;  1J2J B;  3I5C A;  1AFO A;  4N78 E;  3OAK A;  2YO3 A;  4W7Z A;  2KOG A;  1NOH A;  1HUC A;  1LTG C;  3H32 B;  3N4X A;  5CCH D;  2YMY A;  1L0N K;  3V4W A;  4GT1 A;  1YYC A;  3RK2 B;  1MZ9 A;  1FZE A;  3HE4 A;  2FYZ A;  2C9L Y;  1LT9 B;  2CPS A;  1RF1 C;  1IFM A;  4ZKU A;  3HD7 D;  1NO4 A;  1URQ C;  3WMM 0;  3RL0 C;  2XZR A;  2A45 I;  1IFD A;  2WSE H;  4LC1 A;  3HE5 B;  1JO5 A;  1FZB A;  3MGN A;  4M3L A;  1M7L A;  2WSF H;  3P8M C;  3B5N B;  1L4A C;  2YKO A;  4WB4 A;  1LTI C;  5APU A;  2O1K A;  5KJ7 C;  2FFD B;  2HLO A;  1RE3 C;  1ZN5 A;  1S9K D;  1JY2 N;  3U1A A;  5APX A;  1HJB A;  1RE4 C;  2GM4 A;  2KLV A;  1SFC B;  2POH A;  2N1T D;  2J58 A;  1KIL B;  2NPS A;  4HYT B;  2OYH B;  5KLV K;  1GL2 B;  1GL2 C;  2C0W A;  1SQP K;  1GL2 A;  4JYC A;  1NAF A;  1GU4 A;  1G2C A;  2GUV A;  1LT9 A;  4O9B A;  1JUN A;  2XDJ A;  3RL0 B;  4HH2 A;  1E5W A;  1NH4 A;  2E43 A;  1N73 B;  2R5D A;  2WPS A;  1H88 A;  2FXM A;  4AYC A;  1RF1 A;  3GHG C;  3BAS A;  2HPC A;  2OYI B;  1JY3 N;  3VP8 A;  2A45 H;  1FAV A;  3NMD A;  1SQX K;  3TNU A;  2IX7 C;  1FZG A;  5CCG C;  1OXZ A;  2XU6 A;  2OYI A;  1LT9 C;  3V4Q A;  1QL1 A;  3E1I A;  3BRV B;  1GDT A;  4W7Y A;  3B8E B;  1URQ B;  5AVT B;  2WTY A;  4GKG A;  1IFN A;  3VOP A;  2N1T C;  5CJ4 A;  1RE3 A;  1N7S A;  2WZ7 A;  2KSJ A;  1DX7 A;  3H6P A;  1T2K C;  1FDM A;  4IFM A;  2JJL A;  4WY4 C;  1T3J A;  1A02 J;  1FOS E;  2PAJ A;  4C7N A;  3MTU E;  2WPR A;  3OA7 A;  2W6B A;  5APT A;  4WY4 A;  1A02 F;  1JMM A;  1EQ7 A;  1X79 B;  2OYI C;  1XTC C;  3GHG B;  1H8A A;  5AW7 B;  5BVZ A;  3HD7 B;  1GW3 A;  1N73 A;  1SQQ K;  2N1T A;  1IFI A;  3LIE A;  3GHG A;  1FZC A;  1NKN A;  2O01 H;  1WRG A;  2C0X A;  2N1T B;  3OJA B;  3T97 A;  1W2E A;  3V5B A;  3VTP C;  3VYI A;  3BRT B;  1VDF A;  3HTK A;  1L4A D;  5AW0 B;  4Y99 C;  1N73 C;  5AW5 B;  2JEE A;  1N86 A;  1CZQ A;  3KDP B;  4IFD K;  2HOD B;  1YTZ I;  1RF0 C;  1KIL C;  3M0D A;  3A7O A;  4I1L A;  1LTA C;  5CHX A;  4B86 A;  3B5N D;  2YNY A;  4C7N B;  1JNM A;  5AW3 B;  2IFM A;  2NPS C;  4I6M C;  1N7S C;  2I1J A;  4DOJ A;  3VMX A;  5AVQ B;  3R2P A;  3RK3 C;  1QL2 A;  1SQB K;  5AW2 B;  3HD7 A;  3O8Z A;  3RK3 B;  2R3C A;  2R32 A;  2KB7 P;  3RK2 C;  3LW5 H;  2J59 M;  3CI9 A;  3EQ2 A;  3SWF A;  1SFC C;  1LTB C;  3TK1 A;  1J1D B;  4JYB A;  4N78 D;  2Q7C A;  5APW A;  1KZU B;  1ZLL A;  2R5B A;  3C9I A;  2NPS D;  3NXS A;  4XA4 A;  4C7R A;  3M9Q A;  1URQ D;  1X9V A;  3P32 A;  1JTH A;  1JY2 P;  1IC2 A;  4N6J A;  5AVV B;  4EOT A;  1SQV K;  1NTZ K;  2P67 A;  1Z56 A;  3IR9 A;  5AW1 B;  3VP9 A;  4LLH A;  3VN0 A;  2QM7 A;  1JCD A;  5APS A;  1NKZ B;  1ZR2 A;  1HGV A;  3MD0 A;  5KJ7 A;  4AQR D;  2A45 G;  5APV A;  1ZV8 A;  3M9H A;  2M8R A;  3L4F A;  5BU8 B;  1M1J C;  1J1D C;  3M0A A;  3H32 A;  1L4A A;  3TSI A;  5AVU B;  2WPQ A;  1GTW A;  5CMZ A;  3U59 A;  2P7J A;  1LTS C;  1KIL D;  5AVW B;  2WWW A;  5AVX B;  3BAT A;  1HBW A;  1AQ5 A;  3B5N A;  1KQL A;  1T8Z A;  3M91 A;  2E42 A;  1LWU A;  3V2R A;  1N7S D;  1LTT C;  2YKP A;  3HUS C;  3HRN A;  3V2P A;  2Z5H A;  2HPC B;  1GZL A;  2P2U A;  3VMZ A;  1RE4 A;  3L35 A;  1N7L A;  1KIL A;  2NPS B;  3M0D C;  3MIW A;  3EFG A;  1OWA A;  5AVY B;  2FFD A;  2BAS A;  3RK2 D;  2Q3I A;  1URQ A;  4EIJ A;  2Z5I A;  3B5N C;  2O1J A;  4JF7 A;  1SFC A;  2Q5U A;  2LKM A;  4WY4 D;  4W80 A;  1FOS F;  1L4A B;  2WIT A;  3NTN A;  3P7K A;  1HH0 A;  1JY3 P;  2KYV A;  3HE4 B;  5CCG A;  1G1I A;  5CCH A;  5KJ7 D;  1M1J A;  1LTJ C;  1GK4 A;  1G2C B;  1MFZ A;  4RES B;  3LID A;  1RF1 B;  4IFF A;  5KTB A;  1M1J B;  1SFC D;  1GU5 A;  3MUD A;  1H89 A;  1L0L K;  3SWY A;  1NHL A;  1IK9 A;  1HVV A;  5BU5 A;  1NU1 K;  1FJP A;  3II6 A;  3P8C E;  5CCH C;  3BVH A;  2HFE D;  2YKQ A;  5CJ0 A;  3CLQ A;  1T3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...