1QL2A

Inovirus (filamentous bacteriophage) strain pf1 major coat protein assembly
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PF1 BACTERIOPHAGE COAT PROTEIN B
publication title The Molecular Structure and Structural Transition of the Alpha-Helical Capsid in Filamentous Bacteriophage Pf1
pubmed doi rcsb
source organism Pseudomonas phage pf1
total genus 15
structure length 46
sequence length 46
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ql2A00
3IFMA 1QL1A 1IFNA 2IFMA 4IFMA 2KLVA 1QL2A 1IFMA 1ZN5A 2IFNA 1PFIA 2XKMA 2KSJA
chains in the Genus database with same CATH superfamily
2N1TC 1M56D 2A45G 2KK7A 2RKLA 1SQXJ 1SQQJ 2Z5HA 1FBMA 4PV1B 3BCCD 2W90A 3Q5PA 1Q7YQ 1FZCA 5APXA 3B5NC 2FXMA 1EXIA 4U7JA 3W68A 2LXCB 3H1JG 3AE4C 2JWAA 1CW5A 1WT6A 3M9BA 1JY3N 1LP1B 3G6EP 1PPJG 2AEJA 2YIUC 3KZIE 1NU1E 1TU3F 2R44A 4K3AA 5DJTB 2WPQA 3JCUE 2HPCA 4U3FG 4D6TJ 2NZ2A 1N7SB 3RBZA 2FKWB 2PRRA 2WWWA 3BATA 2B87B 1SQBJ 1EXJA 1S4XA 1H88A 4PD4I 1UIXA 2UWJE 3WMM0 3PJSK 1JNMA 2O01H 3MGNA 2QG4A 1VQ9P 1P84E 1FJPA 3V2RA 5B5EE 1KQFB 1FJKA 3S1KA 3C9IA 2XV5A 1SQVE 5KKZC 2KB7P 1K8AQ 2LKMA 4H0LC 3AEDC 1LWUA 3CCJP 1RQUA 2KOGA 1OW7A 1H8AA 2B89A 2IDBA 5AVYB 1PGPA 4C7NB 2K3RA 2MJZA 4B86A 2OTLP 3TNUB 1OX3A 1KQSO 2V7QH 1FZCC 5AVTB 3NFQA 3CX5D 3RK2B 1N7LA 3O8ZA 1GD2E 3L74J 2CK3H 2KS1A 4IOIH 3T97B 1ZV8A 3Q2YA 2YKQA 3M9HA 2ZT9C 3RGUA 3A2AA 3OW2O 3EWKA 2AXTH 5CBOA 3SSUA 2QJPB 1JMBA 2M5AB 4DJGA 1ZXGA 5CJ0A 3H1KE 1FE6A 1KYOI 3LIEA 2ZAEB 3L71J 4JYBA 4JQ0D 3L35A 2QJYB 1IFIA 3CWBG 3FX0A 5AW7B 2IX7C 1RE3A 1GL2B 4JF7A 1FZGA 3H1IE 1YITP 3SWKA 1SQPG 2YMYA 1N73B 3RBXA 2KI7B 1ZW0A 4WB4A 1T3JA 1LTJA 3CD6P 1L4AA 3IAOA 2XZRA 2P2UA 4JYCA 3S4RA 3RK3B 2OYHB 2FYUD 3O6QA 4Y28J 1URQA 2K9YA 4U3FJ 3L72G 2C9LY 3EFFK 5AW9B 4C7RA 4IL6X 2IBZD 1NTKE 1K73Q 2E75B 2E74D 3EFGA 3HE4B 1USEA 1DEBA 3CCSP 1KQGB 1Q81Q 2KUBA 4AQRD 5CCHA 4ZKPA 2JO1A 2YKOA 1PP9E 1LWUC 3MUDA 2WSEH 4RESB 4AUWA 2GA1A 1LT1A 1KC8Q 2Y9ZA 4BXLA 2W8ZA 1J2JB 4C46A 4OWFA 1ZOYC 5H2FH 2FYNC 1L4AD 4BRYA 1JB0J 1JTHB 2QEXP 1NH4A 3E1IA 4I7ZB 4M3LA 2QM8A 2E42A 1DX7A 2IFMA 3B71A 1ZRTD 1ZN5A 5AW2B 4MN4C 1M57D 1S5LH 2YKPA 2E74C 4YPCA 3P8CD 5APYA 3G9RA 1VF5B 3G3ZA 3P7KA 2OYIA 1NJIQ 2W83C 1SFCB 1ZR2A 1HJBA 1RE3C 1R5SA 2NRGA 1KYOH 1L4AC 1S3JA 4Z1MH 1YHQP 2DW3A 3HRNA 1KB9D 3CWBJ 2E5TA 1URQC 2GUSA 1NO4A 3RL0B 1RH5B 1RF0A 2W27A 3EQ2A 1SQPJ 1KILA 3H1LJ 2Q7CA 3II6A 5CCHC 3HD7B 3MUDC 1SQVG 1OVUA 1SQXD 1SQQD 4DCKA 3AEBC 4OGQB 1LP1A 3L72J 2FFDB 1PGJA 1MZ9A 3A5TA 1FZFA 3TGUD 1ZP0C 4WY4B 3VTPC 2P67A 1S72P 1OXZA 4W7ZA 1N7SA 5AW3B 4EYYQ 2FYUK 3PTZA 1BE3J 1GDTA 1KILD 2B87A 2QE7H 4CPGA 2QJKC 4A7PA 3MD0A 2H8PD 3H1KG 2MKVA 3L73E 3FXEA 4D6TD 2OYIC 3L36A 1AJYA 4HH2A 3CMAP 1ZLLA 1AVYA 1SQBD 1DD3A 3H1IG 3RK3E 3M9QA 3MP7B 1L0LG 1EDLA 4H13B 2AEFA 4C7NA 2QVAA 2E76D 3LIDA 1IFPA 1PFIA 1NTZD 4NPEA 3AE7C 2E5YA 1RF0C 5APTA 3S9OA 1KB9H 1KILC 2WSSH 3L70D 1NTKG 3E1RA 1OIPA 1VQ4P 1M1JB 1XTGB 3T97A 1LTIC 1QGKB 2ZXXA 1PP9G 2J59M 1A02F 2AXTE 2WITA 3IN6A 1BSHA 1RE4A 1IFDA 2Q1KA 3WU2H 3L74D 1YBKA 3AEGC 3I56P 1X8YA 1EZVG 1XTCC 1N8RQ 1YYCA 1SQVJ 3V2NA 3W67A 2FBWC 1GL2A 2J58A 3GHGB 2L91A 1N73A 1MFTA 4BWNA 3H1JD 4Y99B 1VQNP 4NPFX 1JY3P 3MTUE 1OVRA 3F5HA 1JEKA 1SQQK 3MIWA 1L0NE 1PPJD 2LR2A 1X9VA 4L75A 2BCCE 4I6MC 3L37A 1U57A 2XNXA 3CXHD 1VQ7P 3H1KJ 1IFNA 2Z5IA 4GIFA 5KLVE 1YIJP 4U3FD 5KAIE 3CCUP 1H0TB 5BU8B 1DEEG 1S5LX 2WMMA 2XKMA 2HODB 3QWOC 5H2FE 1KORA 1VQOP 1JTHA 3RK2C 3H1IJ 1YQ3C 2WSCJ 4RJTA 1L0LJ 2R32A 1JY3O 3C1LA 1PGQA 3U1CA 2R3CA 1SQBK 3AECC 1RE4C 2WTYA 1AA0A 1NTMD 3L71G 1OVVA 3IF4A 3HUSB 1S5LE 1NTKJ 2RH0A 2WZ7A 2O01N 5AVWB 2QJYC 1QEXA 3R2PA 1PP9J 2O1KA 1SFCA 1AQ5A 2O3JA 2IZ1A 1N73C 3HTKB 4DOJA 1NTZK 4H0LD 3Q1MA 1QVGO 1VPCA 1IK7A 3P32A 1KYOE 1LGHB 2PGDA 1NWQA 5AVQB 1X79B 1G2CB 1ZMEC 3L73G 1NKZB 2C0XA 3CLQA 4TLFA 4JPZB 2QA4P 2M0BA 5AW8B 3SWYA 1CI6A 2KNCB 2FYUE 2E75C 3H25A 3PRJA 1GZLA 1EDIA 3ZDMA 2ZT9D 2IBZE 3HD7A 1SLQA 1LTTC 3OAKA 3CWBD 3N4XA 5TISE 1BGYE 3OA7A 2HYNA 3CXHH 3HE5B 1ZR4A 1SQPD 2FFDA 1JY2N 3TSIA 2D2CD 1FOSF 1J1DC 1YJNP 1NAFA 4UB6H 3CI9A 2RN0A 3CX5I 2ZVOB 5CCGA 2HG5D 1G1IA 5CHXA 3L72D 1U7JA 1T2KC 2FY8A 2PP6A 3BRVB 5KTBA 4RO0A 1K05A 5AW6B 1OWAA 4UB8H 4GOEA 1AV1A 5DJUB 3MHVA 1IC2A 3CC7P 1VF5C 3JSVC 5APVA 4OVNF 1QVFO 2IYPA 1YTZT 1KMIZ 2I1KA 2PAJA 2NPSB 3JC22 1PIXA 3KYQA 2N1TB 2VRSA 3RL0g 1KTMA 2D2CC 1VDFA 2H89C 3B5NB 4YXWH 2ITAA 3RL0C 1YI2P 3BVHA 1L0NG 3H1LG 1FZBA 2KXPB 1JUNA 1JCCA 2ZYDA 3N7NA 1KB9E 3D6ZA 2IBZI 1NTMK 2BCCG 3AE5C 3HD7C 3VMYA 1RF1B 3L73J 2YIUB 4WVZA 5APQA 5KLVG 4OGQC 2OGUA 2IPPA 5AVVB 3L75E 1HGZA 3Q5RA 3CCEP 2K37A 2E43A 5E79H 1DD4A 4H44D 5CCGC 2KZIA 4HYTB 1BE3G 2BEQD 3M0DA 1P84D 3TGUE 1HBWA 4GDOA 2OQQA 3A0HH 2YXRB 1PL5A 1LJ2A 2V7QJ 1T6AA 3AE8C 1IK9A 1S9KE 2WT7A 3V2QA 1URQD 2LXBA 3CX5H 1SQVD 4LC1A 3TDKA 1W5CE 5KKZB 1OW6A 5CCHD 1N2DC 1SQPK 3BRTB 2Q3EA 1J1EC 1JM0A 1NU1G 2KLUA 4GT1A 3I5CA 4GKGA 1FZCB 5GTHE 4H44C 2HODA 5C39A 1KB9I 1LTJC 1NKNA 2IZ0A 2YO2A 3H1KD 1UIIA 2Y0EA 1E5WA 1NTZE 1KV4A 3A7OA 2GUVA 2G8YA 2ZFCA 3H1HE 3L70E 1HVVA 1PZQA 1BGYG 4IFFA 1HH0A 1NOHA 4WWIA 1L0NJ 2WPSA 3H1ID 1FU1A 2WSFH 3TYYA 1LTGC 2JWDA 1L0LD 1VQ5P 2BCCJ 2P1JA 4OH8B 3G71P 4N78E 2Q9IA 2WSEJ 2P10A 3M0DC 5KLVJ 3HTKA 1GU4A 3ABVC 5KLIC 1NTKD 5APWA 4Y99C 4PV1D 5APSA 2PFXA 1G2CA 4XFJA 3USSA 1PP9D 3KHUA 1LTAC 1N86A 3H1JE 1SP4A 4N6JA 1SS1A 1LWUB 5AVUB 1EZVD 1MFZA 4TT3H 1LNQA 1RY3A 2W6AA 1VQPP 2J5UA 3GLMA 4L76A 2FYNB 3LW5H 2XDJA 3HE5A 1PGOA 2ZJSE 1KN7A 2KS1B 4I2LC 3FWNA 2M3BA 2ZYGA 1NU1J 1N7SD 1BCCE 4UB6E 1X22A 1R8EA 2Q3IA 4PV1C 1SQVK 4XA4A 2A06D 1U7MA 3TNUA 3L4FA 2IYOA 4EDFA 1FZAA 2E74B 3BCCE 5AVZB 3L75G 1FS0E 1LT9B 4UB8E 2FYUJ 1QL2A 1LTBC 2K9JB 4N3YB 3PP5A 1RQVA 1NTME 2JJLA 1CSBA 2XU6A 3M91A 2M5AA 3AE9C 4R4MA 3KQGA 1BGYJ 1L4AB 3TGUG 2A45I 2K1AA 3U1AA 2YMKA 2NPSA 3E7KA 4I1LA 1CZQA 1FAVA 2CPSA 2QSIA 4ZKUA 1JOCA 3VN0A 1T8ZA 3B5NA 1N7SC 2Y9YA 4YTPC 1Y8AA 2I8DA 1IFMA 3CL3D 3RK2D 3WUUA 4KT0J 1IZNB 3A0BH 1BDCA 1FDMA 1FOSE 3L71D 4QMAA 2KZJA 2RMZA 4GOFA 1L0LK 2OYHA 2KYVA 5KAFH 1KQLA 1SQXK 1RF1A 1Q2NA 4PJ0H 1S1CX 3A3YB 3CPWO 3CXHI 4IL6H 3HE4A 1NTKK 2KSJA 1EDKA 1HUCA 5E79E 2FYZA 1GL2D 3L73D 2SPZA 5M1BA 3U59A 3H1HG 2WQYC 3A0HE 4EOTA 3RK3D 2OYIB 3VMZA 3CX5E 2QM7A 1GU5A 1JY2P 2R3SA 3K5BA 4L74A 1NYHA 3ITKA 2E75D 2QJPC 1KFNA 3M0AA 3KXDA 1FDIA 2YNYA 1GW3A 2NPSC 3L75J 1AFOA 2R5DA 4DZOA 3D6YA 1YTZI 3AE1C 2YO3A 1GL2C 1KILB 5KJ7A 2HLOA 1E79H 3IFMA 2A45H 3PH0A 5B66H 3AEAC 3TGUJ 3M06A 2C9NY 2AEMA 2IFNA 2G3AA 3VMXA 3TF5A 3MZWB 3RK3C 2OYHC 3FXDA 3FWLA 1T2KD 1RF1C 3WUTA 1JY2O 1WRGA 1QLED 2WVRA 1GMJA 1HGVA 1VF5D 3SFDC 1SFCD 1X0TA 1BSNA 1BCCG 2E76B 2K88A 5KJ7D 2L5GB 1H89A 1L0ND 3H1LD 1RHZB 1A02J 3BCCG 4I7ZC 2BCCD 4ASVA 1QL1A 1S2EA 4WY4A 4PD4D 3RL0D 2OYOA 1G1JA 1OW8A 1VQ8P 1NTZJ 5KLVD 1NTMG 2N9YB 3H1HJ 3L70J 3HD7D 2WPRA 5BVZA 2JKVA 1JMMA 1ZRTE 2JR8A 4OGQD 2AXCA 3H32B 3GF7A 1BE3D 1IO4A 1SFCC 3P8CE 1HF9A 1W2EA 5KJ7C 5AW1B 3V4QA 3B4SA 4KJMA 4WY4D 1MUUA 5CCGD 3KPEA 4R4LA 1K9MQ 2I1JA 1VL2A 2Q6QA 1KD1Q 1FC2C 4WBAA 2B9BA 2ZVNB 4GODA 3B8EB 5AVRB 3WUVA 3H1JJ 1GW4A 1LT9A 1EC5A 4RKUJ 2FXPA 1M1JA 1NU1D 3V5BA 3PLNA 2YXQB 3GF3A 5AW5B 3GMAA 1KYOD 2BEZF 2K9JA 3VP9A 2M8RA 4K35A 1NAYA 1GK4A 2O01J 1L0LE 2GM4A 1SQXE 1SQQE 2M3EA 2FFDC 1DIPA 3WU2E 4H13D 1P84I 5AW0B 1DH3A 1EQ7A 4WY4C 2QIWA 1EDJA 1BCCJ 2HFED 3Q5SA 3GHGA 1BGYD 4AYCA 3AE3C 4PD4H 3NXSA 3F89A 3Q3DA 2R5BA 1M8OB 3A0BE 4ZNCA 5TJHA 1Q86Q 3V4WA 5KAIH 1KILE 3BCCJ 5KAFE 5BU5A 4PJ0E 1KFMA 2Y0CA 5GTIH 1EZVE 5CBNA 2HR3A 2ZXEB 2H88C 4LLHA 1J1DB 4H0LB 1NTMJ 4IL6E 4D6TE 3P8MC 1L0NK 2JP3A 1SQBE 4H13C 3GG2A 4ZMDA 2Z4EA 1H0TA 4O9BA 1LTSC 2N9BA 5KLVK 1OMIA 2Y0DA 5APUA 4EIJA 2A06E 2ZT9B 1LT9C 2FYUG 1KZUB 1M1JC 2IBZG 2BASA 2JDIH 3KZIH 3FGAD 1SVFA 3CCLP 2P58A 2KSEA 3JCUH 2D2CB 3HUSA 3VMAA 2HPCB 5K5GB 1M1KQ 1L2PA 4EI2A 3TK1A 2QRXA 5EFWB 4JBZA 1CI6B 3L74E 5L8RJ 2B88A 4IFMA 3GHGC 2W6JH 1HWTC 1VQLP 3CCQP 4IFDK 5B66E 5AW4B 3L75D 1P84H 2O1JA 5TISH 1NVOA 5AVSB 1NU1K 4ASWA 3SWFA 3KDPB 5B5EH 1EZVI 3AEFC 3L71E 2OTJP 1USDA 1JO5A 4W7YA 2KNCA 1VQMP 1OZHA 1M7LA 3CC4P 3NTNA 1Q90D 1HTLC 2Q5UA 3R4YA 1PPJE 1GK6A 1MV8A 1S9KD 4XE5B 1YJWP 4KHXA 1W2BO 1D7MA 2H7HA 3CXHE 3AEEC 2W6BA 3QH9A 4U3FE 4DT0A 1FZEA 2FXOA 2OTKE 5CJ4A 2C0WA 2KP8A 3VOPA 4HKZH 3BASA 3V2PA 1J1EB 1JCDA 1K04A 2P7JA 1YJ9P 3PHLA 3VP8A 4W80A 1SQXG 1SQQG 1FDOA 3CC2P 3HUSC 4LGDE 1VQ6P 1IJDB 4H44B 3H32A 2WSFJ 2KLVA 3D71A 2WSCH 3H6PA 1LTJB 3H1HD 2OARA 3OJAB 3G4SP 3NMDA 1Z56A 2CPBA 2N1TA 4L73A 3AE2C 3O6QB 1URQB 1YQ4C 3CCMP 4HJGH 2ZYAA 1QX8A 5CMZA 3UIAA 2V4HA 4N78D 1GTWA 1T3UA 3V6IA 3SFEC 3CCVP 4D6TG 1M90Q 2WPVB 1MKMA 4YXDC 4NPDA 1AQTA 1PV3A 1SQBG 2E76C 1Q82Q 4BRYB 1R5LA 5KLIB 2NPSD 1Y9BA 2N1TD 3CWBE 3VYIA 3LW5J 1VQKP 2WT7B 2XNDH 4HB1A 2A06G 3AE6C 3B5ND 1SQPE 3H1LE 1NTZG 1NGMB 1BDDA 2QJKB 3L70G 4PD4E 3IR9A 3D70A 3CMEP 3CCRP 1HJ0A 3L72E 3I55P 3C8VA 1IFJA 5GTHH 1OFCX 5AVXB 1NHLA 2POHA 1AVOA 1BCCD 2H43A 1WMKA 3GW6A 3L74G 5GTIE 2JEEA 2KIKA 1Y47A 1BE3E
chains in the Genus database with same CATH topology
2HODA 2N1TC 2A45G 3LIDA 5AW1B 2Z5HA 1FBMA 3V4QA 1PFIA 4WY4D 1MUUA 5CCGD 3KPEA 1LTJC 1RF0C 5APTA 1NKNA 2I1JA 1FZCA 5APXA 2YO2A 3B5NC 2FXMA 1KILC 1E5WA 4WBAA 3A7OA 1M1JB 1XTGB 2GUVA 3T97A 1LTIC 2ZFCA 2J59M 1HVVA 3B8EB 5AVRB 4IFFA 1GW4A 1CW5A 1HH0A 1LT9A 1NOHA 1A02F 1WT6A 2WPSA 1FU1A 3M9BA 1M1JA 2WITA 1JY3N 3V5BA 2WSFH 3TYYA 1LTGC 1RE4A 1IFDA 5AW5B 3VP9A 1X8YA 2P1JA 2M8RA 4OH8B 1XTCC 4N78E 1GK4A 1YYCA 2GM4A 2WPQA 2Q9IA 3V2NA 3M0DC 2FFDC 2HPCA 3HTKA 1GL2A 2J58A 1N7SB 1GU4A 3GHGB 5AW0B 1N73A 1DH3A 2FKWB 1EQ7A 2WWWA 3BATA 5APWA 4WY4C 4Y99C 5APSA 4Y99B 1G2CA 1H88A 2HFED 1JY3P 3MTUE 3GHGA 4AYCA 1LTAC 3WMM0 1N86A 3NXSA 1SQQK 3MIWA 1JNMA 1SP4A 2R5BA 2O01H 3MGNA 4N6JA 1FJPA 1LWUB 3V4WA 1X9VA 5AVUB 4I6MC 3V2RA 1MFZA 1FJKA 3C9IA 5BU5A 3L37A 2XNXA 1RY3A 2XV5A 2W6AA 1KFMA 2KB7P 2LKMA 1IFNA 1LWUA 2ZXEB 4LLHA 2Z5IA 4GIFA 3LW5H 1J1DB 2KOGA 2XDJA 1H8AA 3HE5A 5AVYB 3P8MC 1L0NK 5BU8B 4C7NB 2MJZA 2XKMA 2HODB 4B86A 3TNUB 4I2LC 1FZCC 1JTHA 5AVTB 3NFQA 3RK2C 2M3BA 1N7SD 2Z4EA 3RK2B 1N7LA 3O8ZA 2Q3IA 4O9BA 1LTSC 1GD2E 1SQVK 4XA4A 2R32A 2N9BA 1JY3O 5KLVK 1ZV8A 3TNUA 2YKQA 3M9HA 5APUA 3L4FA 4EIJA 1FZAA 1LT9C 3A2AA 1KZUB 3U1CA 2R3CA 5AVZB 1M1JC 1LT9B 1SQBK 1RE4C 2WTYA 2BASA 5CJ0A 1QL2A 3HUSB 1LTBC 4N3YB 2WZ7A 3LIEA 1SVFA 3PP5A 5AVWB 2JJLA 1CSBA 2XU6A 4JYBA 3M91A 3R2PA 3L35A 2O1KA 1IFIA 1SFCA 1AQ5A 3KQGA 1L4AB 2A45I 3HUSA 5AW7B 3U1AA 2NPSA 2HPCB 4I1LA 2IX7C 1CZQA 1FAVA 1N73C 1RE3A 2CPSA 1GL2B 3HTKB 1NTZK 4JF7A 4DOJA 1FZGA 2YMYA 1N73B 1VPCA 3TK1A 3P32A 4ZKUA 4WB4A 1LGHB 1CI6B 1LTJA 1T3JA 1NWQA 1JOCA 5AVQB 1L4AA 3VN0A 1T8ZA 3B5NA 1N7SC 1X79B 2XZRA 1G2CB 3GHGC 4IFMA 2P2UA 1NKZB 2C0XA 3CLQA 4JYCA 1IFMA 3CL3D 1HWTC 3RK2D 3RK3B 2OYHB 4IFDK 5AW8B 3SWYA 5AW4B 1URQA 1CI6A 2O1JA 2C9LY 5AW9B 4C7RA 1FDMA 1FOSE 5AVSB 1NU1K 3SWFA 1GZLA 3KDPB 3EFGA 3HE4B 1DEBA 1L0LK 2OYHA 2KYVA 3HD7A 1SLQA 4AQRD 1KQLA 1SQXK 1RF1A 1LTTC 5CCHA 3A3YB 3OAKA 4ZKPA 3MUDA 2YKOA 1JO5A 1LWUC 4W7YA 3N4XA 2WSEH 4RESB 4AUWA 3OA7A 2HYNA 3HE5B 3HE4A 1M7LA 1ZR4A 3NTNA 1J2JB 1HTLC 2FFDA 2Q5UA 1JY2N 3TSIA 4C46A 1NTKK 1FOSF 2KSJA 1GK6A 1J1DC 1L4AD 1MV8A 1S9KD 1HUCA 4XE5B 4KHXA 1JTHB 1NAFA 2FYZA 3CI9A 1GL2D 1NH4A 3E1IA 2H7HA 5CCGA 2HG5D 4M3LA 1G1IA 2QM8A 3U59A 5CHXA 2W6BA 2E42A 1DX7A 1FZEA 1T2KC 2PP6A 2IFMA 5CJ4A 4EOTA 3BRVB 1ZN5A 5KTBA 2C0WA 5AW2B 3RK3D 2OYIB 5AW6B 3VMZA 1OWAA 2KP8A 3VOPA 1IC2A 3BASA 2YKPA 2QM7A 1GU5A 1JY2P 3P8CD 5APYA 3V2PA 1J1EB 1JCDA 5APVA 3G3ZA 1KFNA 2P7JA 3P7KA 3M0AA 2OYIA 3VP8A 4W80A 2YNYA 1SFCB 1YTZT 1ZR2A 3HUSC 1GW3A 2NPSC 4LGDE 2I1KA 2PAJA 1HJBA 1RE3C 1IJDB 2NPSB 3H32A 2KLVA 3KYQA 1AFOA 2N1TB 2WSCH 2VRSA 3H6PA 2R5DA 4DZOA 1L4AC 1LTJB 1YTZI 2OARA 2YO3A 1VDFA 1GL2C 3OJAB 3B5NB 1KILB 3NMDA 1Z56A 5KJ7A 3HRNA 2HLOA 3RL0C 3IFMA 2CPBA 2N1TA 2A45H 1URQC 3BVHA 2GUSA 1NO4A 3M06A 3RL0B 2C9NY 1URQB 1FZBA 1JUNA 1RF0A 1JCCA 3N7NA 2W27A 3EQ2A 2IFNA 3VMXA 1KILA 1NTMK 3RK3C 2OYHC 2Q7CA 3HD7C 5CMZA 3UIAA 1T2KD 1GTWA 4N78D 1RF1C 1T3UA 3II6A 3VMYA 5CCHC 3HD7B 1JY2O 1WRGA 1RF1B 5APQA 2IPPA 5AVVB 1HGVA 1HGZA 2FFDB 1SFCD 2E43A 1MZ9A 3A5TA 1FZFA 2NPSD 5CCGC 5KJ7D 4HYTB 2L5GB 2N1TD 4WY4B 3VTPC 2P67A 3VYIA 1OXZA 1H89A 3M0DA 1N7SA 4W7ZA 5AW3B 2WT7B 1HBWA 2FYUK 1A02J 1GDTA 3B5ND 1KILD 1QL1A 4WY4A 3MD0A 1IK9A 2H8PD 3RL0D 1S9KE 2WT7A 3V2QA 1G1JA 1URQD 4LC1A 3IR9A 2OYIC 3L36A 4HH2A 1ZLLA 1IFJA 3HD7D 2WPRA 5AVXB 5BVZA 1N2DC 1SQPK 5CCHD 1NHLA 1JMMA 3BRTB 2POHA 1J1EC 3M9QA 2H43A 3H32B 4GT1A 1IO4A 2JEEA 1SFCC 3I5CA 4GKGA 1FZCB 3P8CE 1W2EA 5KJ7C 4C7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFM A;  1QL1 A;  1IFN A;  2IFM A;  4IFM A;  2KLV A;  1QL2 A;  1IFM A;  1ZN5 A;  2IFN A;  1PFI A;  2XKM A;  2KSJ A; 
#chains in the Genus database with same CATH topology
 2N1T C;  1M56 D;  2A45 G;  2KK7 A;  2RKL A;  1SQX J;  1SQQ J;  2Z5H A;  1FBM A;  4PV1 B;  3BCC D;  2W90 A;  3Q5P A;  1Q7Y Q;  1FZC A;  5APX A;  3B5N C;  2FXM A;  1EXI A;  4U7J A;  3W68 A;  2LXC B;  3H1J G;  3AE4 C;  2JWA A;  1CW5 A;  1WT6 A;  3M9B A;  1JY3 N;  1LP1 B;  3G6E P;  1PPJ G;  2AEJ A;  2YIU C;  3KZI E;  1NU1 E;  1TU3 F;  2R44 A;  4K3A A;  5DJT B;  2WPQ A;  3JCU E;  2HPC A;  4U3F G;  4D6T J;  2NZ2 A;  1N7S B;  3RBZ A;  2FKW B;  2PRR A;  2WWW A;  3BAT A;  2B87 B;  1SQB J;  1EXJ A;  1S4X A;  1H88 A;  4PD4 I;  1UIX A;  2UWJ E;  3WMM 0;  3PJS K;  1JNM A;  2O01 H;  3MGN A;  2QG4 A;  1VQ9 P;  1P84 E;  1FJP A;  3V2R A;  5B5E E;  1KQF B;  1FJK A;  3S1K A;  3C9I A;  2XV5 A;  1SQV E;  5KKZ C;  2KB7 P;  1K8A Q;  2LKM A;  4H0L C;  3AED C;  1LWU A;  3CCJ P;  1RQU A;  2KOG A;  1OW7 A;  1H8A A;  2B89 A;  2IDB A;  5AVY B;  1PGP A;  4C7N B;  2K3R A;  2MJZ A;  4B86 A;  2OTL P;  3TNU B;  1OX3 A;  1KQS O;  2V7Q H;  1FZC C;  5AVT B;  3NFQ A;  3CX5 D;  3RK2 B;  1N7L A;  3O8Z A;  1GD2 E;  3L74 J;  2CK3 H;  2KS1 A;  4IOI H;  3T97 B;  1ZV8 A;  3Q2Y A;  2YKQ A;  3M9H A;  2ZT9 C;  3RGU A;  3A2A A;  3OW2 O;  3EWK A;  2AXT H;  5CBO A;  3SSU A;  2QJP B;  1JMB A;  2M5A B;  4DJG A;  1ZXG A;  5CJ0 A;  3H1K E;  1FE6 A;  1KYO I;  3LIE A;  2ZAE B;  3L71 J;  4JYB A;  4JQ0 D;  3L35 A;  2QJY B;  1IFI A;  3CWB G;  3FX0 A;  5AW7 B;  2IX7 C;  1RE3 A;  1GL2 B;  4JF7 A;  1FZG A;  3H1I E;  1YIT P;  3SWK A;  1SQP G;  2YMY A;  1N73 B;  3RBX A;  2KI7 B;  1ZW0 A;  4WB4 A;  1T3J A;  1LTJ A;  3CD6 P;  1L4A A;  3IAO A;  2XZR A;  2P2U A;  4JYC A;  3S4R A;  3RK3 B;  2OYH B;  2FYU D;  3O6Q A;  4Y28 J;  1URQ A;  2K9Y A;  4U3F J;  3L72 G;  2C9L Y;  3EFF K;  5AW9 B;  4C7R A;  4IL6 X;  2IBZ D;  1NTK E;  1K73 Q;  2E75 B;  2E74 D;  3EFG A;  3HE4 B;  1USE A;  1DEB A;  3CCS P;  1KQG B;  1Q81 Q;  2KUB A;  4AQR D;  5CCH A;  4ZKP A;  2JO1 A;  2YKO A;  1PP9 E;  1LWU C;  3MUD A;  2WSE H;  4RES B;  4AUW A;  2GA1 A;  1LT1 A;  1KC8 Q;  2Y9Z A;  4BXL A;  2W8Z A;  1J2J B;  4C46 A;  4OWF A;  1ZOY C;  5H2F H;  2FYN C;  1L4A D;  4BRY A;  1JB0 J;  1JTH B;  2QEX P;  1NH4 A;  3E1I A;  4I7Z B;  4M3L A;  2QM8 A;  2E42 A;  1DX7 A;  2IFM A;  3B71 A;  1ZRT D;  1ZN5 A;  5AW2 B;  4MN4 C;  1M57 D;  1S5L H;  2YKP A;  2E74 C;  4YPC A;  3P8C D;  5APY A;  3G9R A;  1VF5 B;  3G3Z A;  3P7K A;  2OYI A;  1NJI Q;  2W83 C;  1SFC B;  1ZR2 A;  1HJB A;  1RE3 C;  1R5S A;  2NRG A;  1KYO H;  1L4A C;  1S3J A;  4Z1M H;  1YHQ P;  2DW3 A;  3HRN A;  1KB9 D;  3CWB J;  2E5T A;  1URQ C;  2GUS A;  1NO4 A;  3RL0 B;  1RH5 B;  1RF0 A;  2W27 A;  3EQ2 A;  1SQP J;  1KIL A;  3H1L J;  2Q7C A;  3II6 A;  5CCH C;  3HD7 B;  3MUD C;  1SQV G;  1OVU A;  1SQX D;  1SQQ D;  4DCK A;  3AEB C;  4OGQ B;  1LP1 A;  3L72 J;  2FFD B;  1PGJ A;  1MZ9 A;  3A5T A;  1FZF A;  3TGU D;  1ZP0 C;  4WY4 B;  3VTP C;  2P67 A;  1S72 P;  1OXZ A;  4W7Z A;  1N7S A;  5AW3 B;  4EYY Q;  2FYU K;  3PTZ A;  1BE3 J;  1GDT A;  1KIL D;  2B87 A;  2QE7 H;  4CPG A;  2QJK C;  4A7P A;  3MD0 A;  2H8P D;  3H1K G;  2MKV A;  3L73 E;  3FXE A;  4D6T D;  2OYI C;  3L36 A;  1AJY A;  4HH2 A;  3CMA P;  1ZLL A;  1AVY A;  1SQB D;  1DD3 A;  3H1I G;  3RK3 E;  3M9Q A;  3MP7 B;  1L0L G;  1EDL A;  4H13 B;  2AEF A;  4C7N A;  2QVA A;  2E76 D;  3LID A;  1IFP A;  1PFI A;  1NTZ D;  4NPE A;  3AE7 C;  2E5Y A;  1RF0 C;  5APT A;  3S9O A;  1KB9 H;  1KIL C;  2WSS H;  3L70 D;  1NTK G;  3E1R A;  1OIP A;  1VQ4 P;  1M1J B;  1XTG B;  3T97 A;  1LTI C;  1QGK B;  2ZXX A;  1PP9 G;  2J59 M;  1A02 F;  2AXT E;  2WIT A;  3IN6 A;  1BSH A;  1RE4 A;  1IFD A;  2Q1K A;  3WU2 H;  3L74 D;  1YBK A;  3AEG C;  3I56 P;  1X8Y A;  1EZV G;  1XTC C;  1N8R Q;  1YYC A;  1SQV J;  3V2N A;  3W67 A;  2FBW C;  1GL2 A;  2J58 A;  3GHG B;  2L91 A;  1N73 A;  1MFT A;  4BWN A;  3H1J D;  4Y99 B;  1VQN P;  4NPF X;  1JY3 P;  3MTU E;  1OVR A;  3F5H A;  1JEK A;  1SQQ K;  3MIW A;  1L0N E;  1PPJ D;  2LR2 A;  1X9V A;  4L75 A;  2BCC E;  4I6M C;  3L37 A;  1U57 A;  2XNX A;  3CXH D;  1VQ7 P;  3H1K J;  1IFN A;  2Z5I A;  4GIF A;  5KLV E;  1YIJ P;  4U3F D;  5KAI E;  3CCU P;  1H0T B;  5BU8 B;  1DEE G;  1S5L X;  2WMM A;  2XKM A;  2HOD B;  3QWO C;  5H2F E;  1KOR A;  1VQO P;  1JTH A;  3RK2 C;  3H1I J;  1YQ3 C;  2WSC J;  4RJT A;  1L0L J;  2R32 A;  1JY3 O;  3C1L A;  1PGQ A;  3U1C A;  2R3C A;  1SQB K;  3AEC C;  1RE4 C;  2WTY A;  1AA0 A;  1NTM D;  3L71 G;  1OVV A;  3IF4 A;  3HUS B;  1S5L E;  1NTK J;  2RH0 A;  2WZ7 A;  2O01 N;  5AVW B;  2QJY C;  1QEX A;  3R2P A;  1PP9 J;  2O1K A;  1SFC A;  1AQ5 A;  2O3J A;  2IZ1 A;  1N73 C;  3HTK B;  4DOJ A;  1NTZ K;  4H0L D;  3Q1M A;  1QVG O;  1VPC A;  1IK7 A;  3P32 A;  1KYO E;  1LGH B;  2PGD A;  1NWQ A;  5AVQ B;  1X79 B;  1G2C B;  1ZME C;  3L73 G;  1NKZ B;  2C0X A;  3CLQ A;  4TLF A;  4JPZ B;  2QA4 P;  2M0B A;  5AW8 B;  3SWY A;  1CI6 A;  2KNC B;  2FYU E;  2E75 C;  3H25 A;  3PRJ A;  1GZL A;  1EDI A;  3ZDM A;  2ZT9 D;  2IBZ E;  3HD7 A;  1SLQ A;  1LTT C;  3OAK A;  3CWB D;  3N4X A;  5TIS E;  1BGY E;  3OA7 A;  2HYN A;  3CXH H;  3HE5 B;  1ZR4 A;  1SQP D;  2FFD A;  1JY2 N;  3TSI A;  2D2C D;  1FOS F;  1J1D C;  1YJN P;  1NAF A;  4UB6 H;  3CI9 A;  2RN0 A;  3CX5 I;  2ZVO B;  5CCG A;  2HG5 D;  1G1I A;  5CHX A;  3L72 D;  1U7J A;  1T2K C;  2FY8 A;  2PP6 A;  3BRV B;  5KTB A;  4RO0 A;  1K05 A;  5AW6 B;  1OWA A;  4UB8 H;  4GOE A;  1AV1 A;  5DJU B;  3MHV A;  1IC2 A;  3CC7 P;  1VF5 C;  3JSV C;  5APV A;  4OVN F;  1QVF O;  2IYP A;  1YTZ T;  1KMI Z;  2I1K A;  2PAJ A;  2NPS B;  3JC2 2;  1PIX A;  3KYQ A;  2N1T B;  2VRS A;  3RL0 g;  1KTM A;  2D2C C;  1VDF A;  2H89 C;  3B5N B;  4YXW H;  2ITA A;  3RL0 C;  1YI2 P;  3BVH A;  1L0N G;  3H1L G;  1FZB A;  2KXP B;  1JUN A;  1JCC A;  2ZYD A;  3N7N A;  1KB9 E;  3D6Z A;  2IBZ I;  1NTM K;  2BCC G;  3AE5 C;  3HD7 C;  3VMY A;  1RF1 B;  3L73 J;  2YIU B;  4WVZ A;  5APQ A;  5KLV G;  4OGQ C;  2OGU A;  2IPP A;  5AVV B;  3L75 E;  1HGZ A;  3Q5R A;  3CCE P;  2K37 A;  2E43 A;  5E79 H;  1DD4 A;  4H44 D;  5CCG C;  2KZI A;  4HYT B;  1BE3 G;  2BEQ D;  3M0D A;  1P84 D;  3TGU E;  1HBW A;  4GDO A;  2OQQ A;  3A0H H;  2YXR B;  1PL5 A;  1LJ2 A;  2V7Q J;  1T6A A;  3AE8 C;  1IK9 A;  1S9K E;  2WT7 A;  3V2Q A;  1URQ D;  2LXB A;  3CX5 H;  1SQV D;  4LC1 A;  3TDK A;  1W5C E;  5KKZ B;  1OW6 A;  5CCH D;  1N2D C;  1SQP K;  3BRT B;  2Q3E A;  1J1E C;  1JM0 A;  1NU1 G;  2KLU A;  4GT1 A;  3I5C A;  4GKG A;  1FZC B;  5GTH E;  4H44 C;  2HOD A;  5C39 A;  1KB9 I;  1LTJ C;  1NKN A;  2IZ0 A;  2YO2 A;  3H1K D;  1UII A;  2Y0E A;  1E5W A;  1NTZ E;  1KV4 A;  3A7O A;  2GUV A;  2G8Y A;  2ZFC A;  3H1H E;  3L70 E;  1HVV A;  1PZQ A;  1BGY G;  4IFF A;  1HH0 A;  1NOH A;  4WWI A;  1L0N J;  2WPS A;  3H1I D;  1FU1 A;  2WSF H;  3TYY A;  1LTG C;  2JWD A;  1L0L D;  1VQ5 P;  2BCC J;  2P1J A;  4OH8 B;  3G71 P;  4N78 E;  2Q9I A;  2WSE J;  2P10 A;  3M0D C;  5KLV J;  3HTK A;  1GU4 A;  3ABV C;  5KLI C;  1NTK D;  5APW A;  4Y99 C;  4PV1 D;  5APS A;  2PFX A;  1G2C A;  4XFJ A;  3USS A;  1PP9 D;  3KHU A;  1LTA C;  1N86 A;  3H1J E;  1SP4 A;  4N6J A;  1SS1 A;  1LWU B;  5AVU B;  1EZV D;  1MFZ A;  4TT3 H;  1LNQ A;  1RY3 A;  2W6A A;  1VQP P;  2J5U A;  3GLM A;  4L76 A;  2FYN B;  3LW5 H;  2XDJ A;  3HE5 A;  1PGO A;  2ZJS E;  1KN7 A;  2KS1 B;  4I2L C;  3FWN A;  2M3B A;  2ZYG A;  1NU1 J;  1N7S D;  1BCC E;  4UB6 E;  1X22 A;  1R8E A;  2Q3I A;  4PV1 C;  1SQV K;  4XA4 A;  2A06 D;  1U7M A;  3TNU A;  3L4F A;  2IYO A;  4EDF A;  1FZA A;  2E74 B;  3BCC E;  5AVZ B;  3L75 G;  1FS0 E;  1LT9 B;  4UB8 E;  2FYU J;  1QL2 A;  1LTB C;  2K9J B;  4N3Y B;  3PP5 A;  1RQV A;  1NTM E;  2JJL A;  1CSB A;  2XU6 A;  3M91 A;  2M5A A;  3AE9 C;  4R4M A;  3KQG A;  1BGY J;  1L4A B;  3TGU G;  2A45 I;  2K1A A;  3U1A A;  2YMK A;  2NPS A;  3E7K A;  4I1L A;  1CZQ A;  1FAV A;  2CPS A;  2QSI A;  4ZKU A;  1JOC A;  3VN0 A;  1T8Z A;  3B5N A;  1N7S C;  2Y9Y A;  4YTP C;  1Y8A A;  2I8D A;  1IFM A;  3CL3 D;  3RK2 D;  3WUU A;  4KT0 J;  1IZN B;  3A0B H;  1BDC A;  1FDM A;  1FOS E;  3L71 D;  4QMA A;  2KZJ A;  2RMZ A;  4GOF A;  1L0L K;  2OYH A;  2KYV A;  5KAF H;  1KQL A;  1SQX K;  1RF1 A;  1Q2N A;  4PJ0 H;  1S1C X;  3A3Y B;  3CPW O;  3CXH I;  4IL6 H;  3HE4 A;  1NTK K;  2KSJ A;  1EDK A;  1HUC A;  5E79 E;  2FYZ A;  1GL2 D;  3L73 D;  2SPZ A;  5M1B A;  3U59 A;  3H1H G;  2WQY C;  3A0H E;  4EOT A;  3RK3 D;  2OYI B;  3VMZ A;  3CX5 E;  2QM7 A;  1GU5 A;  1JY2 P;  2R3S A;  3K5B A;  4L74 A;  1NYH A;  3ITK A;  2E75 D;  2QJP C;  1KFN A;  3M0A A;  3KXD A;  1FDI A;  2YNY A;  1GW3 A;  2NPS C;  3L75 J;  1AFO A;  2R5D A;  4DZO A;  3D6Y A;  1YTZ I;  3AE1 C;  2YO3 A;  1GL2 C;  1KIL B;  5KJ7 A;  2HLO A;  1E79 H;  3IFM A;  2A45 H;  3PH0 A;  5B66 H;  3AEA C;  3TGU J;  3M06 A;  2C9N Y;  2AEM A;  2IFN A;  2G3A A;  3VMX A;  3TF5 A;  3MZW B;  3RK3 C;  2OYH C;  3FXD A;  3FWL A;  1T2K D;  1RF1 C;  3WUT A;  1JY2 O;  1WRG A;  1QLE D;  2WVR A;  1GMJ A;  1HGV A;  1VF5 D;  3SFD C;  1SFC D;  1X0T A;  1BSN A;  1BCC G;  2E76 B;  2K88 A;  5KJ7 D;  2L5G B;  1H89 A;  1L0N D;  3H1L D;  1RHZ B;  1A02 J;  3BCC G;  4I7Z C;  2BCC D;  4ASV A;  1QL1 A;  1S2E A;  4WY4 A;  4PD4 D;  3RL0 D;  2OYO A;  1G1J A;  1OW8 A;  1VQ8 P;  1NTZ J;  5KLV D;  1NTM G;  2N9Y B;  3H1H J;  3L70 J;  3HD7 D;  2WPR A;  5BVZ A;  2JKV A;  1JMM A;  1ZRT E;  2JR8 A;  4OGQ D;  2AXC A;  3H32 B;  3GF7 A;  1BE3 D;  1IO4 A;  1SFC C;  3P8C E;  1HF9 A;  1W2E A;  5KJ7 C;  5AW1 B;  3V4Q A;  3B4S A;  4KJM A;  4WY4 D;  1MUU A;  5CCG D;  3KPE A;  4R4L A;  1K9M Q;  2I1J A;  1VL2 A;  2Q6Q A;  1KD1 Q;  1FC2 C;  4WBA A;  2B9B A;  2ZVN B;  4GOD A;  3B8E B;  5AVR B;  3WUV A;  3H1J J;  1GW4 A;  1LT9 A;  1EC5 A;  4RKU J;  2FXP A;  1M1J A;  1NU1 D;  3V5B A;  3PLN A;  2YXQ B;  3GF3 A;  5AW5 B;  3GMA A;  1KYO D;  2BEZ F;  2K9J A;  3VP9 A;  2M8R A;  4K35 A;  1NAY A;  1GK4 A;  2O01 J;  1L0L E;  2GM4 A;  1SQX E;  1SQQ E;  2M3E A;  2FFD C;  1DIP A;  3WU2 E;  4H13 D;  1P84 I;  5AW0 B;  1DH3 A;  1EQ7 A;  4WY4 C;  2QIW A;  1EDJ A;  1BCC J;  2HFE D;  3Q5S A;  3GHG A;  1BGY D;  4AYC A;  3AE3 C;  4PD4 H;  3NXS A;  3F89 A;  3Q3D A;  2R5B A;  1M8O B;  3A0B E;  4ZNC A;  5TJH A;  1Q86 Q;  3V4W A;  5KAI H;  1KIL E;  3BCC J;  5KAF E;  5BU5 A;  4PJ0 E;  1KFM A;  2Y0C A;  5GTI H;  1EZV E;  5CBN A;  2HR3 A;  2ZXE B;  2H88 C;  4LLH A;  1J1D B;  4H0L B;  1NTM J;  4IL6 E;  4D6T E;  3P8M C;  1L0N K;  2JP3 A;  1SQB E;  4H13 C;  3GG2 A;  4ZMD A;  2Z4E A;  1H0T A;  4O9B A;  1LTS C;  2N9B A;  5KLV K;  1OMI A;  2Y0D A;  5APU A;  4EIJ A;  2A06 E;  2ZT9 B;  1LT9 C;  2FYU G;  1KZU B;  1M1J C;  2IBZ G;  2BAS A;  2JDI H;  3KZI H;  3FGA D;  1SVF A;  3CCL P;  2P58 A;  2KSE A;  3JCU H;  2D2C B;  3HUS A;  3VMA A;  2HPC B;  5K5G B;  1M1K Q;  1L2P A;  4EI2 A;  3TK1 A;  2QRX A;  5EFW B;  4JBZ A;  1CI6 B;  3L74 E;  5L8R J;  2B88 A;  4IFM A;  3GHG C;  2W6J H;  1HWT C;  1VQL P;  3CCQ P;  4IFD K;  5B66 E;  5AW4 B;  3L75 D;  1P84 H;  2O1J A;  5TIS H;  1NVO A;  5AVS B;  1NU1 K;  4ASW A;  3SWF A;  3KDP B;  5B5E H;  1EZV I;  3AEF C;  3L71 E;  2OTJ P;  1USD A;  1JO5 A;  4W7Y A;  2KNC A;  1VQM P;  1OZH A;  1M7L A;  3CC4 P;  3NTN A;  1Q90 D;  1HTL C;  2Q5U A;  3R4Y A;  1PPJ E;  1GK6 A;  1MV8 A;  1S9K D;  4XE5 B;  1YJW P;  4KHX A;  1W2B O;  1D7M A;  2H7H A;  3CXH E;  3AEE C;  2W6B A;  3QH9 A;  4U3F E;  4DT0 A;  1FZE A;  2FXO A;  2OTK E;  5CJ4 A;  2C0W A;  2KP8 A;  3VOP A;  4HKZ H;  3BAS A;  3V2P A;  1J1E B;  1JCD A;  1K04 A;  2P7J A;  1YJ9 P;  3PHL A;  3VP8 A;  4W80 A;  1SQX G;  1SQQ G;  1FDO A;  3CC2 P;  3HUS C;  4LGD E;  1VQ6 P;  1IJD B;  4H44 B;  3H32 A;  2WSF J;  2KLV A;  3D71 A;  2WSC H;  3H6P A;  1LTJ B;  3H1H D;  2OAR A;  3OJA B;  3G4S P;  3NMD A;  1Z56 A;  2CPB A;  2N1T A;  4L73 A;  3AE2 C;  3O6Q B;  1URQ B;  1YQ4 C;  3CCM P;  4HJG H;  2ZYA A;  1QX8 A;  5CMZ A;  3UIA A;  2V4H A;  4N78 D;  1GTW A;  1T3U A;  3V6I A;  3SFE C;  3CCV P;  4D6T G;  1M90 Q;  2WPV B;  1MKM A;  4YXD C;  4NPD A;  1AQT A;  1PV3 A;  1SQB G;  2E76 C;  1Q82 Q;  4BRY B;  1R5L A;  5KLI B;  2NPS D;  1Y9B A;  2N1T D;  3CWB E;  3VYI A;  3LW5 J;  1VQK P;  2WT7 B;  2XND H;  4HB1 A;  2A06 G;  3AE6 C;  3B5N D;  1SQP E;  3H1L E;  1NTZ G;  1NGM B;  1BDD A;  2QJK B;  3L70 G;  4PD4 E;  3IR9 A;  3D70 A;  3CME P;  3CCR P;  1HJ0 A;  3L72 E;  3I55 P;  3C8V A;  1IFJ A;  5GTH H;  1OFC X;  5AVX B;  1NHL A;  2POH A;  1AVO A;  1BCC D;  2H43 A;  1WMK A;  3GW6 A;  3L74 G;  5GTI E;  2JEE A;  2KIK A;  1Y47 A;  1BE3 E; 
#chains in the Genus database with same CATH homology
 2HOD A;  2N1T C;  2A45 G;  3LID A;  5AW1 B;  2Z5H A;  1FBM A;  3V4Q A;  1PFI A;  4WY4 D;  1MUU A;  5CCG D;  3KPE A;  1LTJ C;  1RF0 C;  5APT A;  1NKN A;  2I1J A;  1FZC A;  5APX A;  2YO2 A;  3B5N C;  2FXM A;  1KIL C;  1E5W A;  4WBA A;  3A7O A;  1M1J B;  1XTG B;  2GUV A;  3T97 A;  1LTI C;  2ZFC A;  2J59 M;  1HVV A;  3B8E B;  5AVR B;  4IFF A;  1GW4 A;  1CW5 A;  1HH0 A;  1LT9 A;  1NOH A;  1A02 F;  1WT6 A;  2WPS A;  1FU1 A;  3M9B A;  1M1J A;  2WIT A;  1JY3 N;  3V5B A;  2WSF H;  3TYY A;  1LTG C;  1RE4 A;  1IFD A;  5AW5 B;  3VP9 A;  1X8Y A;  2P1J A;  2M8R A;  4OH8 B;  1XTC C;  4N78 E;  1GK4 A;  1YYC A;  2GM4 A;  2WPQ A;  2Q9I A;  3V2N A;  3M0D C;  2FFD C;  2HPC A;  3HTK A;  1GL2 A;  2J58 A;  1N7S B;  1GU4 A;  3GHG B;  5AW0 B;  1N73 A;  1DH3 A;  2FKW B;  1EQ7 A;  2WWW A;  3BAT A;  5APW A;  4WY4 C;  4Y99 C;  5APS A;  4Y99 B;  1G2C A;  1H88 A;  2HFE D;  1JY3 P;  3MTU E;  3GHG A;  4AYC A;  1LTA C;  3WMM 0;  1N86 A;  3NXS A;  1SQQ K;  3MIW A;  1JNM A;  1SP4 A;  2R5B A;  2O01 H;  3MGN A;  4N6J A;  1FJP A;  1LWU B;  3V4W A;  1X9V A;  5AVU B;  4I6M C;  3V2R A;  1MFZ A;  1FJK A;  3C9I A;  5BU5 A;  3L37 A;  2XNX A;  1RY3 A;  2XV5 A;  2W6A A;  1KFM A;  2KB7 P;  2LKM A;  1IFN A;  1LWU A;  2ZXE B;  4LLH A;  2Z5I A;  4GIF A;  3LW5 H;  1J1D B;  2KOG A;  2XDJ A;  1H8A A;  3HE5 A;  5AVY B;  3P8M C;  1L0N K;  5BU8 B;  4C7N B;  2MJZ A;  2XKM A;  2HOD B;  4B86 A;  3TNU B;  4I2L C;  1FZC C;  1JTH A;  5AVT B;  3NFQ A;  3RK2 C;  2M3B A;  1N7S D;  2Z4E A;  3RK2 B;  1N7L A;  3O8Z A;  2Q3I A;  4O9B A;  1LTS C;  1GD2 E;  1SQV K;  4XA4 A;  2R32 A;  2N9B A;  1JY3 O;  5KLV K;  1ZV8 A;  3TNU A;  2YKQ A;  3M9H A;  5APU A;  3L4F A;  4EIJ A;  1FZA A;  1LT9 C;  3A2A A;  1KZU B;  3U1C A;  2R3C A;  5AVZ B;  1M1J C;  1LT9 B;  1SQB K;  1RE4 C;  2WTY A;  2BAS A;  5CJ0 A;  1QL2 A;  3HUS B;  1LTB C;  4N3Y B;  2WZ7 A;  3LIE A;  1SVF A;  3PP5 A;  5AVW B;  2JJL A;  1CSB A;  2XU6 A;  4JYB A;  3M91 A;  3R2P A;  3L35 A;  2O1K A;  1IFI A;  1SFC A;  1AQ5 A;  3KQG A;  1L4A B;  2A45 I;  3HUS A;  5AW7 B;  3U1A A;  2NPS A;  2HPC B;  4I1L A;  2IX7 C;  1CZQ A;  1FAV A;  1N73 C;  1RE3 A;  2CPS A;  1GL2 B;  3HTK B;  1NTZ K;  4JF7 A;  4DOJ A;  1FZG A;  2YMY A;  1N73 B;  1VPC A;  3TK1 A;  3P32 A;  4ZKU A;  4WB4 A;  1LGH B;  1CI6 B;  1LTJ A;  1T3J A;  1NWQ A;  1JOC A;  5AVQ B;  1L4A A;  3VN0 A;  1T8Z A;  3B5N A;  1N7S C;  1X79 B;  2XZR A;  1G2C B;  3GHG C;  4IFM A;  2P2U A;  1NKZ B;  2C0X A;  3CLQ A;  4JYC A;  1IFM A;  3CL3 D;  1HWT C;  3RK2 D;  3RK3 B;  2OYH B;  4IFD K;  5AW8 B;  3SWY A;  5AW4 B;  1URQ A;  1CI6 A;  2O1J A;  2C9L Y;  5AW9 B;  4C7R A;  1FDM A;  1FOS E;  5AVS B;  1NU1 K;  3SWF A;  1GZL A;  3KDP B;  3EFG A;  3HE4 B;  1DEB A;  1L0L K;  2OYH A;  2KYV A;  3HD7 A;  1SLQ A;  4AQR D;  1KQL A;  1SQX K;  1RF1 A;  1LTT C;  5CCH A;  3A3Y B;  3OAK A;  4ZKP A;  3MUD A;  2YKO A;  1JO5 A;  1LWU C;  4W7Y A;  3N4X A;  2WSE H;  4RES B;  4AUW A;  3OA7 A;  2HYN A;  3HE5 B;  3HE4 A;  1M7L A;  1ZR4 A;  3NTN A;  1J2J B;  1HTL C;  2FFD A;  2Q5U A;  1JY2 N;  3TSI A;  4C46 A;  1NTK K;  1FOS F;  2KSJ A;  1GK6 A;  1J1D C;  1L4A D;  1MV8 A;  1S9K D;  1HUC A;  4XE5 B;  4KHX A;  1JTH B;  1NAF A;  2FYZ A;  3CI9 A;  1GL2 D;  1NH4 A;  3E1I A;  2H7H A;  5CCG A;  2HG5 D;  4M3L A;  1G1I A;  2QM8 A;  3U59 A;  5CHX A;  2W6B A;  2E42 A;  1DX7 A;  1FZE A;  1T2K C;  2PP6 A;  2IFM A;  5CJ4 A;  4EOT A;  3BRV B;  1ZN5 A;  5KTB A;  2C0W A;  5AW2 B;  3RK3 D;  2OYI B;  5AW6 B;  3VMZ A;  1OWA A;  2KP8 A;  3VOP A;  1IC2 A;  3BAS A;  2YKP A;  2QM7 A;  1GU5 A;  1JY2 P;  3P8C D;  5APY A;  3V2P A;  1J1E B;  1JCD A;  5APV A;  3G3Z A;  1KFN A;  2P7J A;  3P7K A;  3M0A A;  2OYI A;  3VP8 A;  4W80 A;  2YNY A;  1SFC B;  1YTZ T;  1ZR2 A;  3HUS C;  1GW3 A;  2NPS C;  4LGD E;  2I1K A;  2PAJ A;  1HJB A;  1RE3 C;  1IJD B;  2NPS B;  3H32 A;  2KLV A;  3KYQ A;  1AFO A;  2N1T B;  2WSC H;  2VRS A;  3H6P A;  2R5D A;  4DZO A;  1L4A C;  1LTJ B;  1YTZ I;  2OAR A;  2YO3 A;  1VDF A;  1GL2 C;  3OJA B;  3B5N B;  1KIL B;  3NMD A;  1Z56 A;  5KJ7 A;  3HRN A;  2HLO A;  3RL0 C;  3IFM A;  2CPB A;  2N1T A;  2A45 H;  1URQ C;  3BVH A;  2GUS A;  1NO4 A;  3M06 A;  3RL0 B;  2C9N Y;  1URQ B;  1FZB A;  1JUN A;  1RF0 A;  1JCC A;  3N7N A;  2W27 A;  3EQ2 A;  2IFN A;  3VMX A;  1KIL A;  1NTM K;  3RK3 C;  2OYH C;  2Q7C A;  3HD7 C;  5CMZ A;  3UIA A;  1T2K D;  1GTW A;  4N78 D;  1RF1 C;  1T3U A;  3II6 A;  3VMY A;  5CCH C;  3HD7 B;  1JY2 O;  1WRG A;  1RF1 B;  5APQ A;  2IPP A;  5AVV B;  1HGV A;  1HGZ A;  2FFD B;  1SFC D;  2E43 A;  1MZ9 A;  3A5T A;  1FZF A;  2NPS D;  5CCG C;  5KJ7 D;  4HYT B;  2L5G B;  2N1T D;  4WY4 B;  3VTP C;  2P67 A;  3VYI A;  1OXZ A;  1H89 A;  3M0D A;  1N7S A;  4W7Z A;  5AW3 B;  2WT7 B;  1HBW A;  2FYU K;  1A02 J;  1GDT A;  3B5N D;  1KIL D;  1QL1 A;  4WY4 A;  3MD0 A;  1IK9 A;  2H8P D;  3RL0 D;  1S9K E;  2WT7 A;  3V2Q A;  1G1J A;  1URQ D;  4LC1 A;  3IR9 A;  2OYI C;  3L36 A;  4HH2 A;  1ZLL A;  1IFJ A;  3HD7 D;  2WPR A;  5AVX B;  5BVZ A;  1N2D C;  1SQP K;  5CCH D;  1NHL A;  1JMM A;  3BRT B;  2POH A;  1J1E C;  3M9Q A;  2H43 A;  3H32 B;  4GT1 A;  1IO4 A;  2JEE A;  1SFC C;  3I5C A;  4GKG A;  1FZC B;  3P8C E;  1W2E A;  5KJ7 C;  4C7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...