1QL2A

Inovirus (filamentous bacteriophage) strain pf1 major coat protein assembly
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF1 BACTERIOPHAGE COAT PROTEIN B
publication title The Molecular Structure and Structural Transition of the Alpha-Helical Capsid in Filamentous Bacteriophage Pf1
pubmed doi rcsb
source organism Pseudomonas phage pf1
molecule tags Virus
total genus 15
structure length 46
sequence length 46
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ql2A00
1ZN5A 1QL1A 2KSJA 3IFMA 2IFNA 2IFMA 1PFIA 4IFMA 1QL2A 1IFNA 1IFMA 2KLVA 2XKMA
chains in the Genus database with same CATH superfamily
5AW6B 2OTLP 2C0XA 3L72D 2WSFJ 1GU5A 2KOGA 2LXBA 1J2JB 1UIIA 4GODA 2IYPA 4RO0A 1IK7A 1XTCC 2E74B 2A45H 1FE6A 1KD1Q 3EFFK 4BRYB 1S5LX 2E74D 2Y0DA 3H1HE 2J5UA 3G4SP 3IF4A 1BSHA 3CX5E 2P10A 4N3YB 3LW5H 4GOEA 1HBWA 3G9RA 3CMAP 2Q6QA 3E7KA 1J1DC 4KT0J 2C9LY 5AVRB 1NHLA 4CPGA 2HFED 1MZ9A 3CXHH 4W7ZA 1URQC 2WQYC 2AXTE 3IFMA 1W2EA 3Q5SA 2FFDA 1SQQD 3L75G 1X9VA 1EC5A 3KHUA 2A06E 2HPCA 2RN0A 2ZT9C 2YIUB 1AFOA 2OGUA 5CBNA 2W27A 2K37A 1HGVA 2K9JA 3B5NA 2JO1A 5AW0B 2HLOA 3MHVA 1OZHA 4DZOA 2W83C 2Y0CA 5AW5B 1DX7A 1LTJC 5KTBA 2FFDB 2HODA 2H89C 1EDKA 3KZIE 2HPCB 1LT9B 3RK3E 1SLQA 1GZLA 1NO4A 3CL3D 5BU5A 3TSIA 2K9JB 4DT0A 1SQVG 3B5NB 3F89A 1CZQA 2WT7A 3CCEP 1EDJA 3MUDC 1KILE 4WY4A 2HODB 2JDIH 5KLVG 2FYUG 1NU1G 2GUSA 2NPSA 1EXIA 1S9KE 2VRSA 2WSCJ 2M8RA 3EWKA 1UIXA 2IBZE 2C0WA 1NTKG 3HD7A 1KN7A 1LP1A 5H2FH 1AA0A 4IL6E 1SQXJ 2ZJSE 1SQXK 2QJYC 3UIAA 2AXTH 4PD4I 1SP4A 1NTZE 3A0BH 5APTA 2OYIA 3M0DA 3H1LG 1A02F 1KQLA 4WY4B 2KZJA 1ZV8A 1ZLLA 2NPSB 2IYOA 4PD4D 3CC2P 4ASVA 1EQ7A 1P84E 1MFTA 2QM8A 1JTHA 2NZ2A 4H13C 2NPSD 4JQ0D 4JYBA 3HD7B 3WU2E 1LTSC 1LP1B 3N4XA 3HD7D 1QL2A 3H1JD 2OYIB 1WMKA 2WPQA 1AQ5A 3H1HG 3B8EB 1DD3A 2WPRA 4EDFA 1N7SC 1N8RQ 1GL2C 3NXSA 2QRXA 1JMBA 3WMM0 1VQ5P 4OGQC 1SQVJ 1SQVK 1NOHA 2B87A 3A3YB 1EXJA 2Q9IA 4LC1A 1JTHB 3U59A 4XE5B 3ITKA 1M7LA 2KXPB 2YO2A 2D2CC 3VTPC 1LGHB 1NTMD 1L0LJ 4EI2A 1L0LK 3Q5PA 2JWAA 1KFNA 1RQUA 2HG5D 3JSVC 2LR2A 5KLVJ 1EZVD 5KLVK 2FYUK 3P32A 1G2CA 2BCCJ 5APUA 1USDA 2O1KA 1LTTC 1YJ9P 1OIPA 1KORA 2V4HA 1SFCB 2JR8A 1N86A 4C46A 1W2BO 2WVRA 4IL6H 2IFNA 4H44B 1SFCD 1RF1C 2OYHA 3L72J 3HTKB 1NYHA 1QLED 3VP8A 3TF5A 1JOCA 4H44D 1G2CB 4AQRD 3V4QA 2QJKC 3NFQA 4U7JA 1DH3A 1M57D 3KQGA 1ZRTE 2POHA 1P84H 1SQPD 2QG4A 3AEAC 5KAFH 3H1IG 1PL5A 3WU2H 5EFWB 1MFZA 3L74E 2AEJA 3G71P 2B9BA 3M0AA 2OYHB 3FWNA 1JMMA 1VQPP 5AW4B 1BE3D 2FXPA 4W7YA 3TK1A 3G6EP 4GKGA 2R32A 2CPSA 4N78D 3RK3C 4EOTA 1PIXA 1Q2NA 5CCHC 1SQQJ 4U3FJ 1SQQK 3AE1C 3HUSA 1U7JA 1QL1A 2R3SA 1KMIZ 5APVA 2WMMA 2XZRA 3MGNA 4YXDC 4GT1A 2Q3EA 2IZ1A 1PV3A 1KILC 2PGDA 1ZXGA 3EFGA 1VF5C 3Q3DA 3USSA 1R8EA 1KYOE 2OTKE 4R4LA 3HUSB 2KLVA 5APYA 1BGYE 3CC7P 5AVTB 2N9BA 1RQVA 3RK2B 4GOFA 2QIWA 1VQLP 1BCCE 1E5WA 3H1KG 3V4WA 3B4SA 2RKLA 3H1IJ 3RK2D 1BDCA 4PV1B 3PH0A 1H88A 5AVXB 2JJLA 3MUDA 4PV1D 1SQBG 3V5BA 1VQ8P 2O01N 5KJ7D 4WB4A 2HR3A 1HGZA 3RL0C 2KS1A 4JBZA 1LNQA 1IFIA 4TT3H 1OFCX 3W67A 1PP9E 3AE9C 5CMZA 2AEFA 1L0NE 4D6TE 3G3ZA 3KDPB 3E1IA 2FKWB 2FY8A 3P8CD 2QJPB 3TGUJ 3OA7A 2IX7C 3M9HA 3AEGC 2KS1B 3CXHE 2WTYA 1RF0C 1SQVD 3L71J 3H25A 3VMXA 1OW8A 3AEEC 3H6PA 3H1JJ 2K9YA 2E42A 1YQ3C 4L73A 1LJ2A 3M91A 5GTIH 1L0LD 1YTZI 3AE4C 3Q2YA 4UB8E 2JEEA 5AVYB 5KLVD 2FYUD 3H1KJ 2QSIA 2BCCD 3O8ZA 1OVUA 3MTUE 1CI6A 1YJWP 4QMAA 1SQBJ 3GHGC 1DIPA 1SQBK 2WSCH 4PJ0E 2B88A 3CWBG 2N1TA 1M1KQ 1J1EB 3L73J 4GIFA 2I1KA 1PPJG 3L72E 2Z5HA 3PLNA 2ZVNB 2PP6A 2Y9YA 2W6JH 3A0HE 1CI6B 4DJGA 3A2AA 4IFDK 1A02J 3CX5I 3BCCG 2N1TB 2C9NY 5AVQB 2SPZA 2E43A 2N1TD 2ZFCA 3U1CA 1IFPA 1SQPJ 1SQPK 1AVYA 2CPBA 2O01J 5H2FE 1L4AC 3I56P 3TNUA 1BCCG 2IZ0A 3A0BE 4U3FD 4Y28J 4B86A 1YBKA 3FX0A 4NPDA 1BE3J 2M3BA 2J59M 1R5LA 5APSA 2E75B 4UB8H 1OXZA 3GW6A 4GDOA 3EQ2A 1OVVA 1VPCA 2LKMA 3SWYA 1IFDA 2E75D 2YKOA 3R4YA 3CWBJ 4K3AA 1YTZT 3C8VA 5KLIC 2A45G 4PJ0H 1KZUB 2FYZA 2Y9ZA 2KYVA 1KV4A 2BASA 1NWQA 1RE3C 3AECC 1OW7A 3B71A 1YI2P 3CCRP 2KK7A 1VQ9P 3FGAD 3A0HH 3BCCJ 3H1ID 1T2KD 1HUCA 3TYYA 3SFEC 4DCKA 3B5ND 1Z56A 2WITA 3I5CA 1QGKB 1S2EA 2KB7P 3PRJA 3RGUA 3BRTB 3CC4P 3KXDA 4UB6H 4Y99C 1T6AA 4I7ZC 2G8YA 2KNCA 2IBZI 1EDLA 5KKZB 2P2UA 2E5TA 2WT7B 3L75J 1S5LE 4ZKUA 3L70G 2ZYDA 4LLHA 1S1CX 1U57A 2PFXA 3AE6C 3RBXA 2KUBA 4WY4D 3O6QA 4PD4E 5CCGC 2KNCB 3TGUD 3AEBC 5KAFE 1IFJA 1FDOA 3S4RA 1JO5A 3L71D 4IFFA 2BEZF 4WWIA 3H1JE 3SWFA 1NKZB 3OW2O 3ZDMA 1K04A 3MP7B 2W6AA 1FC2C 3M9BA 3Q5RA 2FYNC 1RF0A 1L2PA 3HE5A 1GK4A 3H1KD 3O6QB 1QVGO 3HE4A 2JKVA 1CSBA 3M06A 1SQBD 1NTME 4JYCA 2DW3A 5APWA 1FBMA 3CI9A 2FYUJ 2E74C 1NU1J 2CK3H 1NU1K 2YNYA 1EZVE 1RE4C 2W6BA 5AW9B 3JCUH 3L73D 1X0TA 1LT1A 1MUUA 1NTKJ 1NTKK 3HE5B 2A06G 3GHGA 2B87B 5B66E 3PTZA 4C7RA 3C9IA 3HE4B 1NAFA 1FU1A 2WSSH 2OQQA 3R2PA 1PFIA 3AEFC 5DJTB 3L70J 3KYQA 2L91A 3H1LJ 3LIDA 2QE7H 4H0LB 1S5LH 1VQMP 2XKMA 2E76B 2I1JA 4H0LD 5K5GB 3H32A 2KLUA 3NTNA 1OVRA 5E79E 2E76D 1ZR2A 1T3UA 4PD4H 3GHGB 1SQPE 3TDKA 5TJHA 5AW1B 2Q7CA 1QEXA 1JCDA 3H1HJ 5L8RJ 2YIUC 3VOPA 2J58A 3T97A 1KQFB 1FS0E 2HYNA 1BE3E 3H32B 4L74A 1GW3A 1URQA 4N78E 2FFDC 1YHQP 2KSJA 1ZOYC 1PGJA 1KB9I 4LGDE 2ZVOB 3CWBD 1LT9C 2BEQD 2IBZG 1FZEA 1IFMA 3T97B 1J1DB 1PPJD 3V2NA 3BASA 1HF9A 1KB9D 1NTZG 1VQNP 4A7PA 2WSFH 1URQB 1JY2P 1LWUC 5B66H 4O9BA 1S72P 5BU8B 1LTJA 1URQD 2IFMA 3BCCD 3VMAA 5GTIE 2ZT9B 1RE3A 2YKQA 3AE7C 2XNDH 1YQ4C 2ZT9D 4EIJA 1N73C 1OX3A 1Y9BA 5E79H 3IR9A 4W80A 1HWTC 2ZXEB 5KLIB 2G3AA 3PHLA 1USEA 3CCMP 3P7KA 1LTJB 1OW6A 5KAIH 1SQXE 1Q86Q 2NPSC 1LTIC 3L75D 4JF7A 5APXA 5DJUB 2MKVA 2IDBA 4KJMA 1FDMA 2A45I 1FZCC 3HD7C 4WVZA 1NTMG 2YXRB 5AW7B 5AVUB 1HVVA 1EZVG 5AW8B 1MKMA 1D7MA 3SSUA 2OYIC 5TISH 3I55P 2OTJP 1JCCA 1NJIQ 2KI7B 2ZXXA 2L5GB 1RH5B 1Q7YQ 4C7NA 2O1JA 1DEEG 5GTHH 5CCGA 2QVAA 3P8CE 4M3LA 4Z1MH 2R5BA 1KB9H 2QJYB 1PGOA 1SQVE 1S3JA 3HRNA 3GG2A 3VP9A 4TLFA 1GDTA 2QM7A 4RJTA 3V2QA 2PAJA 1N7SA 1GL2A 1R5SA 2GUVA 1L0LE 5AW2B 1T8ZA 1NU1D 5KLVE 3F5HA 2FYUE 1SFCC 3L74G 1M1JC 2BCCE 4H13B 3FXDA 2V7QJ 3S1KA 2I8DA 3D6ZA 1NTKD 1PGQA 1HJBA 4H13D 2Z5IA 4YTPC 3NMDA 1H0TA 4HH2A 1N7SB 3L70D 1GL2B 4BRYA 5C39A 3H1LD 1AJYA 3PJSK 4OGQB 1KTMA 1E79H 1IK9A 1N7SD 1GL2D 2R5DA 2YXQB 3CCSP 3GF7A 3AE8C 3GF3A 4OGQD 1FOSE 1NH4A 3AE2C 2D2CB 2OYHC 1W5CE 1RF1A 4HYTB 2RMZA 1JY2O 1YYCA 2H8PD 3L36A 4IL6X 2D2CD 1H0TB 4WBAA 1X79B 1Y47A 3BRVB 4UB6E 3H1HD 4XA4A 3L4FA 3RL0g 3CX5D 1QX8A 1BGYG 2R3CA 1YJNP 4RESB 4OH8B 1SVFA 1GK6A 4L75A 1RF1B 3WUVA 2UWJE 4I1LA 3VMZA 2GM4A 1IFNA 1M56D 3D70A 4KHXA 5AVWB 1SQQE 4ZNCA 1YITP 4U3FE 2YMYA 2QJKB 5AVVB 3IAOA 3L74J 2H88C 2FXMA 1SQXG 3VYIA 3OAKA 1GTWA 3SFDC 2A06D 5CCHA 3HUSC 3TNUB 1LT9A 2Z4EA 5AVSB 2MJZA 1PGPA 3RK2C 2WZ7A 3IN6A 2P7JA 1KILA 4PV1C 3CPWO 5APQA 1PP9G 1DD4A 1LWUA 3RK3B 1L0NG 4D6TG 2W90A 5B5EE 5KJ7C 1IZNB 4EYYQ 3RK3D 4JPZB 1TU3F 3AEDC 1AV1A 3H1IE 1GD2E 2RH0A 1MV8A 5CCHD 1OWAA 1KQGB 2OYOA 4IOIH 3JCUE 1N73A 3II6A 2QEXP 4AUWA 2N9YB 2WSEJ 1IO4A 1KILB 1BGYJ 1JY2N 1NVOA 1DEBA 1RY3A 3V2RA 1VF5B 1LWUB 3CX5H 1KILD 1L0LG 2P58A 1KQSO 4I2LC 1BCCJ 1M8OB 1VF5D 4NPFX 1S9KD 2BCCG 1JY3P 2QJPC 2IBZD 1FZBA 3SWKA 1FZCA 2KIKA 2LXCB 1N73B 4BXLA 3K5BA 2P67A 1HH0A 1P84I 1NTZD 2B89A 1FZFA 4I6MC 3L35A 1VQ6P 2GA1A 1G1JA 3TGUE 3CCVP 3D71A 3L72G 3QH9A 1RHZB 3A7OA 4MN4C 2YO3A 3L71E 3C1LA 3MZWB 1P84D 1LTAC 3VN0A 2XV5A 2WWWA 4IFMA 3RL0B 1FZCB 3LW5J 1Q82Q 1PP9J 1L0NJ 4ZMDA 1L0NK 4D6TJ 2ZYGA 4HKZH 1ZP0C 1JM0A 2FXOA 3RL0D 1Q81Q 3H1KE 2OARA 3CLQA 1J1EC 5B5EH 3FWLA 2PRRA 3KZIH 2KZIA 1SQBE 1H8AA 1WT6A 2K1AA 2XNXA 1EZVI 1H89A 3WUTA 1SFCA 1M1JA 2AXCA 2M5AA 2KSEA 2ZYAA 1JUNA 2NRGA 3L73E 3KPEA 2XDJA 1SQQG 3HTKA 4U3FG 2N1TC 1PZQA 3MD0A 1VQOP 1WRGA 3JC22 3CMEP 3CCLP 3OJAB 2FBWC 1IJDB 2Q1KA 1M1JB 2M5AB 2WPSA 1G1IA 2W8ZA 2K3RA 1AQTA 3BATA 3V2PA 3A5TA 3CD6P 3QWOC 1FDIA 4DOJA 1HTLC 5KAIE 1X8YA 2P1JA 2H43A 1XTGB 3ABVC 1ZRTD 1ZN5A 2E75C 3L37A 1JEKA 5M1BA 3CCQP 2Y0EA 1FJKA 1GW4A 3E1RA 3GLMA 1L4AA 3LIEA 3L74D 4R4MA 5CJ0A 3GMAA 1OMIA 5CHXA 1T3JA 1K05A 1VL2A 3AE5C 1HJ0A 1VDFA 5TISE 1NGMB 2V7QH 4L76A 3CWBE 1JY3O 5GTHE 1T2KC 1FZGA 2O3JA 3V6IA 3B5NC 3RBZA 1PPJE 5BVZA 1FAVA 2JWDA 1CW5A 4OVNF 1KB9E 1L4AB 4ASWA 5AW3B 4YPCA 1IC2A 1L4AD 1KYOI 1LTBC 2ZAEB 2Q5UA 2AEMA 3BCCE 3TGUG 5CJ4A 3U1AA 2M3EA 1VQKP 1N7LA 1KYOD 3BVHA 3L71G 5KJ7A 5KKZC 1BGYD 3H1JG 3D6YA 2O01H 4WY4C 1BCCD 1AVOA 1LTGC 1X22A 1VQ4P 1ZW0A 3L75E 1Q90D 1QVFO 4XFJA 1K9MQ 4RKUJ 1YIJP 1M90Q 1EDIA 3CCJP 2QA4P 3AE3C 1VQ7P 1K8AQ 1SQXD 1NKNA 1NAYA 3L73G 3M0DC 1JB0J 4HB1A 4YXWH 4ZKPA 1BSNA 2XU6A 2YKPA 3WUUA 2WPVB 3MIWA 4Y99B 4I7ZB 1NTZJ 5AVZB 1FOSF 1NTZK 2Q3IA 3VMYA 4AYCA 1PP9D 3CXHI 1L0ND 4BWNA 4D6TD 4OWFA 1Y8AA 1JY3N 3FXEA 2YMKA 1S4XA 1JNMA 2KP8A 3CXHD 4HJGH 1N2DC 1SQPG 4NPEA 1K73Q 3W68A 4C7NB 5CBOA 3CCUP 4K35A 3M9QA 1NU1E 1KFMA 3PP5A 1KYOH 4H44C 2WSEH 5CCGD 1KC8Q 1ZR4A 1GMJA 1NTKE 3N7NA 4H0LC 1BE3G 2E76C 1RE4A 2R44A 3P8MC 3Q1MA 2K88A 2H7HA 2E5YA 3L70E 1SS1A 3H1LE 2IPPA 1U7MA 2FYNB 1NTMJ 1FJPA 1NTMK 1FZAA 1BDDA 2JP3A 3S9OA 2M0BA 4N6JA 2ITAA 1GU4A 1ZMEC
chains in the Genus database with same CATH topology
5AW6B 1KILB 3RK2D 2C0XA 1JY2N 3LIDA 1GU5A 2KOGA 1J2JB 1DEBA 2XKMA 1H88A 1RY3A 3V2RA 1XTCC 1LWUB 5AVXB 2JJLA 2I1JA 3MUDA 1KILD 2A45H 4I2LC 3V5BA 3H32A 3NTNA 1S9KD 1ZR2A 1JY3P 1T3UA 5KJ7D 4WB4A 3GHGB 1HGZA 1FZBA 3RL0C 1FZCA 4N3YB 5AW1B 3LW5H 1IFIA 2Q7CA 1N73B 2P67A 1JCDA 1HBWA 1HH0A 3VOPA 1FZFA 4I6MC 2J58A 3L35A 1J1DC 3T97A 1G1JA 2C9LY 5AVRB 1NHLA 2HFED 1MZ9A 5CMZA 2HYNA 3H32B 3A7OA 4W7ZA 1GW3A 3G3ZA 1URQC 1URQA 2YO3A 3KDPB 3E1IA 3IFMA 1W2EA 2FKWB 1LTAC 4N78E 3P8CD 3VN0A 2FFDC 3OA7A 2FFDA 2KSJA 2IX7C 2XV5A 3M9HA 1X9VA 2WWWA 4LGDE 4IFMA 3RL0B 1FZCB 2HPCA 1LT9C 2WTYA 1L0NK 1RF0C 1FZEA 3RL0D 1AFOA 2W27A 3VMXA 1IFMA 1J1DB 3H6PA 2OARA 3CLQA 1HGVA 2E42A 1J1EC 3V2NA 3B5NA 3BASA 5AW0B 2HLOA 3M91A 4DZOA 2WSFH 1YTZI 1URQB 1JY2P 1H8AA 5AVYB 1LWUC 1WT6A 2JEEA 4O9BA 5AW5B 1DX7A 2XNXA 1H89A 5BU8B 1SFCA 3O8ZA 1LTJC 5KTBA 2FFDB 1LTJA 1M1JA 1URQD 2HODA 2IFMA 1JUNA 3MTUE 2HPCB 1LT9B 3KPEA 1CI6A 1SLQA 2XDJA 1GZLA 1RE3A 1NO4A 3GHGC 3CL3D 3HTKA 1SQBK 2WSCH 5BU5A 2YKQA 2N1TC 2N1TA 3TSIA 4EIJA 1N73C 3MD0A 1J1EB 3B5NB 1WRGA 3IR9A 1CZQA 4W80A 2WT7A 4GIFA 2I1KA 1HWTC 2ZXEB 2Z5HA 3OJAB 2PP6A 1IJDB 3P7KA 1LTJB 1M1JB 4WY4A 2HODB 2WPSA 1G1IA 2NPSC 1LTIC 2GUSA 2NPSA 4JF7A 1CI6B 1S9KE 3BATA 3V2PA 3A5TA 5APXA 4IFDK 2VRSA 3A2AA 1A02J 2M8RA 2N1TB 1FDMA 2A45I 1FZCC 2C0WA 3HD7C 4DOJA 1HTLC 3HD7A 2C9NY 1X8YA 2P1JA 5AVQB 5AW7B 2H43A 5AVUB 1XTGB 1SQXK 3UIAA 2E43A 2N1TD 1ZN5A 2ZFCA 3U1CA 1HVVA 5AW8B 1SP4A 3L37A 5APTA 1SQPK 2OYIC 2OYIA 1FJKA 2CPBA 1GW4A 3M0DA 1JCCA 1A02F 1KQLA 4WY4B 1L4AC 2L5GB 1L4AA 3LIEA 1ZV8A 3TNUA 1ZLLA 5CJ0A 2NPSB 5CHXA 1T3JA 4C7NA 2O1JA 1EQ7A 1VDFA 2QM8A 5CCGA 3P8CE 1JTHA 2NPSD 4B86A 4JYBA 4M3LA 3HD7B 2R5BA 1LTSC 2M3BA 2J59M 5APSA 3N4XA 3HRNA 3VP9A 3HD7D 1OXZA 1QL2A 1JY3O 3EQ2A 1GDTA 2QM7A 1T2KC 1FZGA 1VPCA 2LKMA 3V2QA 2OYIB 3B5NC 2WPQA 3SWYA 1AQ5A 3B8EB 1IFDA 1FAVA 2WPRA 5BVZA 1N7SC 2PAJA 1CW5A 1GL2C 1N7SA 2YKOA 3NXSA 1GL2A 1L4AB 2GUVA 1YTZT 3WMM0 5AW2B 1T8ZA 5AW3B 1SQVK 2A45G 1NOHA 1IC2A 1KZUB 1L4AD 1SFCC 3A3YB 2FYZA 2Q9IA 4LC1A 1JTHB 3U59A 1LTBC 1M1JC 4XE5B 2KYVA 1M7LA 2Q5UA 2YO2A 2BASA 3VTPC 1LGHB 1RE3C 1NWQA 1HJBA 2Z5IA 5CJ4A 3U1AA 1L0LK 3NMDA 1KFNA 2HG5D 1N7LA 5KLVK 2FYUK 3P32A 1G2CA 4HH2A 3BVHA 5APUA 5KJ7A 1N7SB 1GL2B 2O1KA 1T2KD 1HUCA 3TYYA 1LTTC 3B5ND 1N7SD 1IK9A 1Z56A 1GL2D 2R5DA 2WITA 3I5CA 2O01H 1SFCB 2KB7P 1N86A 4WY4C 4C46A 1FOSE 1LTGC 3BRTB 1NH4A 2IFNA 2OYHC 1RF1C 1SFCD 2OYHA 1RF1A 4Y99C 4HYTB 3HTKB 1JY2O 1YYCA 2H8PD 3L36A 3VP8A 1JOCA 4WBAA 1G2CB 4AQRD 1X79B 3V4QA 3NFQA 3BRVB 1DH3A 1NKNA 2P2UA 4XA4A 3L4FA 2WT7B 3KQGA 2POHA 4ZKUA 3M0DC 2R3CA 4LLHA 4RESB 4ZKPA 4OH8B 1SVFA 1MFZA 2XU6A 1GK6A 3M0AA 2YKPA 1RF1B 2OYHB 3MIWA 4Y99B 4WY4D 5AVZB 1FOSF 1NTZK 1JMMA 5CCGC 5AW4B 4I1LA 3VMZA 2GM4A 1IFNA 4KHXA 1IFJA 5AVWB 2Q3IA 3VMYA 4AYCA 2YMYA 4W7YA 5AVVB 1JO5A 3TK1A 4IFFA 2FXMA 1JY3N 2R32A 4GKGA 2CPSA 4N78D 3RK3C 4EOTA 1JNMA 3VYIA 2KP8A 3OAKA 3SWFA 5CCHC 1GTWA 1NKZB 5CCHA 1SQQK 1N2DC 2W6AA 3HUSC 3HUSA 3TNUB 1LT9A 3M9BA 2Z4EA 1QL1A 5AVSB 1RF0A 5APVA 4C7NB 3HE5A 2MJZA 1GK4A 3M9QA 2XZRA 3MGNA 3RK2C 4GT1A 1KFMA 2WZ7A 3HE4A 3PP5A 1CSBA 2P7JA 1KILC 2WSEH 3M06A 5CCGD 1KILA 1ZR4A 5APQA 3N7NA 4JYCA 5APWA 1FBMA 3EFGA 3CI9A 1LWUA 3RK3B 1NU1K 2YNYA 1RE4C 2W6BA 1RE4A 5KJ7C 5AW9B 3P8MC 2H7HA 3RK3D 1MUUA 3HUSB 2KLVA 5APYA 2IPPA 1GD2E 1NTKK 1FJPA 1MV8A 1NTMK 3HE5B 5CCHD 3GHGA 1FZAA 5AVTB 1OWAA 2N9BA 4C7RA 3RK2B 3C9IA 3HE4B 1NAFA 1FU1A 4N6JA 3R2PA 1N73A 3II6A 1PFIA 1E5WA 4AUWA 3V4WA 1GU4A 1IO4A 3KYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZN5 A;  1QL1 A;  2KSJ A;  3IFM A;  2IFN A;  2IFM A;  1PFI A;  4IFM A;  1QL2 A;  1IFN A;  1IFM A;  2KLV A;  2XKM A; 
#chains in the Genus database with same CATH topology
 5AW6 B;  2OTL P;  2C0X A;  3L72 D;  2WSF J;  1GU5 A;  2KOG A;  2LXB A;  1J2J B;  1UII A;  4GOD A;  2IYP A;  4RO0 A;  1IK7 A;  1XTC C;  2E74 B;  2A45 H;  1FE6 A;  1KD1 Q;  3EFF K;  4BRY B;  1S5L X;  2E74 D;  2Y0D A;  3H1H E;  2J5U A;  3G4S P;  3IF4 A;  1BSH A;  3CX5 E;  2P10 A;  4N3Y B;  3LW5 H;  4GOE A;  1HBW A;  3G9R A;  3CMA P;  2Q6Q A;  3E7K A;  1J1D C;  4KT0 J;  2C9L Y;  5AVR B;  1NHL A;  4CPG A;  2HFE D;  1MZ9 A;  3CXH H;  4W7Z A;  1URQ C;  2WQY C;  2AXT E;  3IFM A;  1W2E A;  3Q5S A;  2FFD A;  1SQQ D;  3L75 G;  1X9V A;  1EC5 A;  3KHU A;  2A06 E;  2HPC A;  2RN0 A;  2ZT9 C;  2YIU B;  1AFO A;  2OGU A;  5CBN A;  2W27 A;  2K37 A;  1HGV A;  2K9J A;  3B5N A;  2JO1 A;  5AW0 B;  2HLO A;  3MHV A;  1OZH A;  4DZO A;  2W83 C;  2Y0C A;  5AW5 B;  1DX7 A;  1LTJ C;  5KTB A;  2FFD B;  2HOD A;  2H89 C;  1EDK A;  3KZI E;  2HPC B;  1LT9 B;  3RK3 E;  1SLQ A;  1GZL A;  1NO4 A;  3CL3 D;  5BU5 A;  3TSI A;  2K9J B;  4DT0 A;  1SQV G;  3B5N B;  3F89 A;  1CZQ A;  2WT7 A;  3CCE P;  1EDJ A;  3MUD C;  1KIL E;  4WY4 A;  2HOD B;  2JDI H;  5KLV G;  2FYU G;  1NU1 G;  2GUS A;  2NPS A;  1EXI A;  1S9K E;  2VRS A;  2WSC J;  2M8R A;  3EWK A;  1UIX A;  2IBZ E;  2C0W A;  1NTK G;  3HD7 A;  1KN7 A;  1LP1 A;  5H2F H;  1AA0 A;  4IL6 E;  1SQX J;  2ZJS E;  1SQX K;  2QJY C;  3UIA A;  2AXT H;  4PD4 I;  1SP4 A;  1NTZ E;  3A0B H;  5APT A;  2OYI A;  3M0D A;  3H1L G;  1A02 F;  1KQL A;  4WY4 B;  2KZJ A;  1ZV8 A;  1ZLL A;  2NPS B;  2IYO A;  4PD4 D;  3CC2 P;  4ASV A;  1EQ7 A;  1P84 E;  1MFT A;  2QM8 A;  1JTH A;  2NZ2 A;  4H13 C;  2NPS D;  4JQ0 D;  4JYB A;  3HD7 B;  3WU2 E;  1LTS C;  1LP1 B;  3N4X A;  3HD7 D;  1QL2 A;  3H1J D;  2OYI B;  1WMK A;  2WPQ A;  1AQ5 A;  3H1H G;  3B8E B;  1DD3 A;  2WPR A;  4EDF A;  1N7S C;  1N8R Q;  1GL2 C;  3NXS A;  2QRX A;  1JMB A;  3WMM 0;  1VQ5 P;  4OGQ C;  1SQV J;  1SQV K;  1NOH A;  2B87 A;  3A3Y B;  1EXJ A;  2Q9I A;  4LC1 A;  1JTH B;  3U59 A;  4XE5 B;  3ITK A;  1M7L A;  2KXP B;  2YO2 A;  2D2C C;  3VTP C;  1LGH B;  1NTM D;  1L0L J;  4EI2 A;  1L0L K;  3Q5P A;  2JWA A;  1KFN A;  1RQU A;  2HG5 D;  3JSV C;  2LR2 A;  5KLV J;  1EZV D;  5KLV K;  2FYU K;  3P32 A;  1G2C A;  2BCC J;  5APU A;  1USD A;  2O1K A;  1LTT C;  1YJ9 P;  1OIP A;  1KOR A;  2V4H A;  1SFC B;  2JR8 A;  1N86 A;  4C46 A;  1W2B O;  2WVR A;  4IL6 H;  2IFN A;  4H44 B;  1SFC D;  1RF1 C;  2OYH A;  3L72 J;  3HTK B;  1NYH A;  1QLE D;  3VP8 A;  3TF5 A;  1JOC A;  4H44 D;  1G2C B;  4AQR D;  3V4Q A;  2QJK C;  3NFQ A;  4U7J A;  1DH3 A;  1M57 D;  3KQG A;  1ZRT E;  2POH A;  1P84 H;  1SQP D;  2QG4 A;  3AEA C;  5KAF H;  3H1I G;  1PL5 A;  3WU2 H;  5EFW B;  1MFZ A;  3L74 E;  2AEJ A;  3G71 P;  2B9B A;  3M0A A;  2OYH B;  3FWN A;  1JMM A;  1VQP P;  5AW4 B;  1BE3 D;  2FXP A;  4W7Y A;  3TK1 A;  3G6E P;  4GKG A;  2R32 A;  2CPS A;  4N78 D;  3RK3 C;  4EOT A;  1PIX A;  1Q2N A;  5CCH C;  1SQQ J;  4U3F J;  1SQQ K;  3AE1 C;  3HUS A;  1U7J A;  1QL1 A;  2R3S A;  1KMI Z;  5APV A;  2WMM A;  2XZR A;  3MGN A;  4YXD C;  4GT1 A;  2Q3E A;  2IZ1 A;  1PV3 A;  1KIL C;  2PGD A;  1ZXG A;  3EFG A;  1VF5 C;  3Q3D A;  3USS A;  1R8E A;  1KYO E;  2OTK E;  4R4L A;  3HUS B;  2KLV A;  5APY A;  1BGY E;  3CC7 P;  5AVT B;  2N9B A;  1RQV A;  3RK2 B;  4GOF A;  2QIW A;  1VQL P;  1BCC E;  1E5W A;  3H1K G;  3V4W A;  3B4S A;  2RKL A;  3H1I J;  3RK2 D;  1BDC A;  4PV1 B;  3PH0 A;  1H88 A;  5AVX B;  2JJL A;  3MUD A;  4PV1 D;  1SQB G;  3V5B A;  1VQ8 P;  2O01 N;  5KJ7 D;  4WB4 A;  2HR3 A;  1HGZ A;  3RL0 C;  2KS1 A;  4JBZ A;  1LNQ A;  1IFI A;  4TT3 H;  1OFC X;  3W67 A;  1PP9 E;  3AE9 C;  5CMZ A;  2AEF A;  1L0N E;  4D6T E;  3G3Z A;  3KDP B;  3E1I A;  2FKW B;  2FY8 A;  3P8C D;  2QJP B;  3TGU J;  3OA7 A;  2IX7 C;  3M9H A;  3AEG C;  2KS1 B;  3CXH E;  2WTY A;  1RF0 C;  1SQV D;  3L71 J;  3H25 A;  3VMX A;  1OW8 A;  3AEE C;  3H6P A;  3H1J J;  2K9Y A;  2E42 A;  1YQ3 C;  4L73 A;  1LJ2 A;  3M91 A;  5GTI H;  1L0L D;  1YTZ I;  3AE4 C;  3Q2Y A;  4UB8 E;  2JEE A;  5AVY B;  5KLV D;  2FYU D;  3H1K J;  2QSI A;  2BCC D;  3O8Z A;  1OVU A;  3MTU E;  1CI6 A;  1YJW P;  4QMA A;  1SQB J;  3GHG C;  1DIP A;  1SQB K;  2WSC H;  4PJ0 E;  2B88 A;  3CWB G;  2N1T A;  1M1K Q;  1J1E B;  3L73 J;  4GIF A;  2I1K A;  1PPJ G;  3L72 E;  2Z5H A;  3PLN A;  2ZVN B;  2PP6 A;  2Y9Y A;  2W6J H;  3A0H E;  1CI6 B;  4DJG A;  3A2A A;  4IFD K;  1A02 J;  3CX5 I;  3BCC G;  2N1T B;  2C9N Y;  5AVQ B;  2SPZ A;  2E43 A;  2N1T D;  2ZFC A;  3U1C A;  1IFP A;  1SQP J;  1SQP K;  1AVY A;  2CPB A;  2O01 J;  5H2F E;  1L4A C;  3I56 P;  3TNU A;  1BCC G;  2IZ0 A;  3A0B E;  4U3F D;  4Y28 J;  4B86 A;  1YBK A;  3FX0 A;  4NPD A;  1BE3 J;  2M3B A;  2J59 M;  1R5L A;  5APS A;  2E75 B;  4UB8 H;  1OXZ A;  3GW6 A;  4GDO A;  3EQ2 A;  1OVV A;  1VPC A;  2LKM A;  3SWY A;  1IFD A;  2E75 D;  2YKO A;  3R4Y A;  3CWB J;  4K3A A;  1YTZ T;  3C8V A;  5KLI C;  2A45 G;  4PJ0 H;  1KZU B;  2FYZ A;  2Y9Z A;  2KYV A;  1KV4 A;  2BAS A;  1NWQ A;  1RE3 C;  3AEC C;  1OW7 A;  3B71 A;  1YI2 P;  3CCR P;  2KK7 A;  1VQ9 P;  3FGA D;  3A0H H;  3BCC J;  3H1I D;  1T2K D;  1HUC A;  3TYY A;  3SFE C;  4DCK A;  3B5N D;  1Z56 A;  2WIT A;  3I5C A;  1QGK B;  1S2E A;  2KB7 P;  3PRJ A;  3RGU A;  3BRT B;  3CC4 P;  3KXD A;  4UB6 H;  4Y99 C;  1T6A A;  4I7Z C;  2G8Y A;  2KNC A;  2IBZ I;  1EDL A;  5KKZ B;  2P2U A;  2E5T A;  2WT7 B;  3L75 J;  1S5L E;  4ZKU A;  3L70 G;  2ZYD A;  4LLH A;  1S1C X;  1U57 A;  2PFX A;  3AE6 C;  3RBX A;  2KUB A;  4WY4 D;  3O6Q A;  4PD4 E;  5CCG C;  2KNC B;  3TGU D;  3AEB C;  5KAF E;  1IFJ A;  1FDO A;  3S4R A;  1JO5 A;  3L71 D;  4IFF A;  2BEZ F;  4WWI A;  3H1J E;  3SWF A;  1NKZ B;  3OW2 O;  3ZDM A;  1K04 A;  3MP7 B;  2W6A A;  1FC2 C;  3M9B A;  3Q5R A;  2FYN C;  1RF0 A;  1L2P A;  3HE5 A;  1GK4 A;  3H1K D;  3O6Q B;  1QVG O;  3HE4 A;  2JKV A;  1CSB A;  3M06 A;  1SQB D;  1NTM E;  4JYC A;  2DW3 A;  5APW A;  1FBM A;  3CI9 A;  2FYU J;  2E74 C;  1NU1 J;  2CK3 H;  1NU1 K;  2YNY A;  1EZV E;  1RE4 C;  2W6B A;  5AW9 B;  3JCU H;  3L73 D;  1X0T A;  1LT1 A;  1MUU A;  1NTK J;  1NTK K;  3HE5 B;  2A06 G;  3GHG A;  2B87 B;  5B66 E;  3PTZ A;  4C7R A;  3C9I A;  3HE4 B;  1NAF A;  1FU1 A;  2WSS H;  2OQQ A;  3R2P A;  1PFI A;  3AEF C;  5DJT B;  3L70 J;  3KYQ A;  2L91 A;  3H1L J;  3LID A;  2QE7 H;  4H0L B;  1S5L H;  1VQM P;  2XKM A;  2E76 B;  2I1J A;  4H0L D;  5K5G B;  3H32 A;  2KLU A;  3NTN A;  1OVR A;  5E79 E;  2E76 D;  1ZR2 A;  1T3U A;  4PD4 H;  3GHG B;  1SQP E;  3TDK A;  5TJH A;  5AW1 B;  2Q7C A;  1QEX A;  1JCD A;  3H1H J;  5L8R J;  2YIU C;  3VOP A;  2J58 A;  3T97 A;  1KQF B;  1FS0 E;  2HYN A;  1BE3 E;  3H32 B;  4L74 A;  1GW3 A;  1URQ A;  4N78 E;  2FFD C;  1YHQ P;  2KSJ A;  1ZOY C;  1PGJ A;  1KB9 I;  4LGD E;  2ZVO B;  3CWB D;  1LT9 C;  2BEQ D;  2IBZ G;  1FZE A;  1IFM A;  3T97 B;  1J1D B;  1PPJ D;  3V2N A;  3BAS A;  1HF9 A;  1KB9 D;  1NTZ G;  1VQN P;  4A7P A;  2WSF H;  1URQ B;  1JY2 P;  1LWU C;  5B66 H;  4O9B A;  1S72 P;  5BU8 B;  1LTJ A;  1URQ D;  2IFM A;  3BCC D;  3VMA A;  5GTI E;  2ZT9 B;  1RE3 A;  2YKQ A;  3AE7 C;  2XND H;  1YQ4 C;  2ZT9 D;  4EIJ A;  1N73 C;  1OX3 A;  1Y9B A;  5E79 H;  3IR9 A;  4W80 A;  1HWT C;  2ZXE B;  5KLI B;  2G3A A;  3PHL A;  1USE A;  3CCM P;  3P7K A;  1LTJ B;  1OW6 A;  5KAI H;  1SQX E;  1Q86 Q;  2NPS C;  1LTI C;  3L75 D;  4JF7 A;  5APX A;  5DJU B;  2MKV A;  2IDB A;  4KJM A;  1FDM A;  2A45 I;  1FZC C;  3HD7 C;  4WVZ A;  1NTM G;  2YXR B;  5AW7 B;  5AVU B;  1HVV A;  1EZV G;  5AW8 B;  1MKM A;  1D7M A;  3SSU A;  2OYI C;  5TIS H;  3I55 P;  2OTJ P;  1JCC A;  1NJI Q;  2KI7 B;  2ZXX A;  2L5G B;  1RH5 B;  1Q7Y Q;  4C7N A;  2O1J A;  1DEE G;  5GTH H;  5CCG A;  2QVA A;  3P8C E;  4M3L A;  4Z1M H;  2R5B A;  1KB9 H;  2QJY B;  1PGO A;  1SQV E;  1S3J A;  3HRN A;  3GG2 A;  3VP9 A;  4TLF A;  1GDT A;  2QM7 A;  4RJT A;  3V2Q A;  2PAJ A;  1N7S A;  1GL2 A;  1R5S A;  2GUV A;  1L0L E;  5AW2 B;  1T8Z A;  1NU1 D;  5KLV E;  3F5H A;  2FYU E;  1SFC C;  3L74 G;  1M1J C;  2BCC E;  4H13 B;  3FXD A;  2V7Q J;  3S1K A;  2I8D A;  3D6Z A;  1NTK D;  1PGQ A;  1HJB A;  4H13 D;  2Z5I A;  4YTP C;  3NMD A;  1H0T A;  4HH2 A;  1N7S B;  3L70 D;  1GL2 B;  4BRY A;  5C39 A;  3H1L D;  1AJY A;  3PJS K;  4OGQ B;  1KTM A;  1E79 H;  1IK9 A;  1N7S D;  1GL2 D;  2R5D A;  2YXQ B;  3CCS P;  3GF7 A;  3AE8 C;  3GF3 A;  4OGQ D;  1FOS E;  1NH4 A;  3AE2 C;  2D2C B;  2OYH C;  1W5C E;  1RF1 A;  4HYT B;  2RMZ A;  1JY2 O;  1YYC A;  2H8P D;  3L36 A;  4IL6 X;  2D2C D;  1H0T B;  4WBA A;  1X79 B;  1Y47 A;  3BRV B;  4UB6 E;  3H1H D;  4XA4 A;  3L4F A;  3RL0 g;  3CX5 D;  1QX8 A;  1BGY G;  2R3C A;  1YJN P;  4RES B;  4OH8 B;  1SVF A;  1GK6 A;  4L75 A;  1RF1 B;  3WUV A;  2UWJ E;  4I1L A;  3VMZ A;  2GM4 A;  1IFN A;  1M56 D;  3D70 A;  4KHX A;  5AVW B;  1SQQ E;  4ZNC A;  1YIT P;  4U3F E;  2YMY A;  2QJK B;  5AVV B;  3IAO A;  3L74 J;  2H88 C;  2FXM A;  1SQX G;  3VYI A;  3OAK A;  1GTW A;  3SFD C;  2A06 D;  5CCH A;  3HUS C;  3TNU B;  1LT9 A;  2Z4E A;  5AVS B;  2MJZ A;  1PGP A;  3RK2 C;  2WZ7 A;  3IN6 A;  2P7J A;  1KIL A;  4PV1 C;  3CPW O;  5APQ A;  1PP9 G;  1DD4 A;  1LWU A;  3RK3 B;  1L0N G;  4D6T G;  2W90 A;  5B5E E;  5KJ7 C;  1IZN B;  4EYY Q;  3RK3 D;  4JPZ B;  1TU3 F;  3AED C;  1AV1 A;  3H1I E;  1GD2 E;  2RH0 A;  1MV8 A;  5CCH D;  1OWA A;  1KQG B;  2OYO A;  4IOI H;  3JCU E;  1N73 A;  3II6 A;  2QEX P;  4AUW A;  2N9Y B;  2WSE J;  1IO4 A;  1KIL B;  1BGY J;  1JY2 N;  1NVO A;  1DEB A;  1RY3 A;  3V2R A;  1VF5 B;  1LWU B;  3CX5 H;  1KIL D;  1L0L G;  2P58 A;  1KQS O;  4I2L C;  1BCC J;  1M8O B;  1VF5 D;  4NPF X;  1S9K D;  2BCC G;  1JY3 P;  2QJP C;  2IBZ D;  1FZB A;  3SWK A;  1FZC A;  2KIK A;  2LXC B;  1N73 B;  4BXL A;  3K5B A;  2P67 A;  1HH0 A;  1P84 I;  1NTZ D;  2B89 A;  1FZF A;  4I6M C;  3L35 A;  1VQ6 P;  2GA1 A;  1G1J A;  3TGU E;  3CCV P;  3D71 A;  3L72 G;  3QH9 A;  1RHZ B;  3A7O A;  4MN4 C;  2YO3 A;  3L71 E;  3C1L A;  3MZW B;  1P84 D;  1LTA C;  3VN0 A;  2XV5 A;  2WWW A;  4IFM A;  3RL0 B;  1FZC B;  3LW5 J;  1Q82 Q;  1PP9 J;  1L0N J;  4ZMD A;  1L0N K;  4D6T J;  2ZYG A;  4HKZ H;  1ZP0 C;  1JM0 A;  2FXO A;  3RL0 D;  1Q81 Q;  3H1K E;  2OAR A;  3CLQ A;  1J1E C;  5B5E H;  3FWL A;  2PRR A;  3KZI H;  2KZI A;  1SQB E;  1H8A A;  1WT6 A;  2K1A A;  2XNX A;  1EZV I;  1H89 A;  3WUT A;  1SFC A;  1M1J A;  2AXC A;  2M5A A;  2KSE A;  2ZYA A;  1JUN A;  2NRG A;  3L73 E;  3KPE A;  2XDJ A;  1SQQ G;  3HTK A;  4U3F G;  2N1T C;  1PZQ A;  3MD0 A;  1VQO P;  1WRG A;  3JC2 2;  3CME P;  3CCL P;  3OJA B;  2FBW C;  1IJD B;  2Q1K A;  1M1J B;  2M5A B;  2WPS A;  1G1I A;  2W8Z A;  2K3R A;  1AQT A;  3BAT A;  3V2P A;  3A5T A;  3CD6 P;  3QWO C;  1FDI A;  4DOJ A;  1HTL C;  5KAI E;  1X8Y A;  2P1J A;  2H43 A;  1XTG B;  3ABV C;  1ZRT D;  1ZN5 A;  2E75 C;  3L37 A;  1JEK A;  5M1B A;  3CCQ P;  2Y0E A;  1FJK A;  1GW4 A;  3E1R A;  3GLM A;  1L4A A;  3LIE A;  3L74 D;  4R4M A;  5CJ0 A;  3GMA A;  1OMI A;  5CHX A;  1T3J A;  1K05 A;  1VL2 A;  3AE5 C;  1HJ0 A;  1VDF A;  5TIS E;  1NGM B;  2V7Q H;  4L76 A;  3CWB E;  1JY3 O;  5GTH E;  1T2K C;  1FZG A;  2O3J A;  3V6I A;  3B5N C;  3RBZ A;  1PPJ E;  5BVZ A;  1FAV A;  2JWD A;  1CW5 A;  4OVN F;  1KB9 E;  1L4A B;  4ASW A;  5AW3 B;  4YPC A;  1IC2 A;  1L4A D;  1KYO I;  1LTB C;  2ZAE B;  2Q5U A;  2AEM A;  3BCC E;  3TGU G;  5CJ4 A;  3U1A A;  2M3E A;  1VQK P;  1N7L A;  1KYO D;  3BVH A;  3L71 G;  5KJ7 A;  5KKZ C;  1BGY D;  3H1J G;  3D6Y A;  2O01 H;  4WY4 C;  1BCC D;  1AVO A;  1LTG C;  1X22 A;  1VQ4 P;  1ZW0 A;  3L75 E;  1Q90 D;  1QVF O;  4XFJ A;  1K9M Q;  4RKU J;  1YIJ P;  1M90 Q;  1EDI A;  3CCJ P;  2QA4 P;  3AE3 C;  1VQ7 P;  1K8A Q;  1SQX D;  1NKN A;  1NAY A;  3L73 G;  3M0D C;  1JB0 J;  4HB1 A;  4YXW H;  4ZKP A;  1BSN A;  2XU6 A;  2YKP A;  3WUU A;  2WPV B;  3MIW A;  4Y99 B;  4I7Z B;  1NTZ J;  5AVZ B;  1FOS F;  1NTZ K;  2Q3I A;  3VMY A;  4AYC A;  1PP9 D;  3CXH I;  1L0N D;  4BWN A;  4D6T D;  4OWF A;  1Y8A A;  1JY3 N;  3FXE A;  2YMK A;  1S4X A;  1JNM A;  2KP8 A;  3CXH D;  4HJG H;  1N2D C;  1SQP G;  4NPE A;  1K73 Q;  3W68 A;  4C7N B;  5CBO A;  3CCU P;  4K35 A;  3M9Q A;  1NU1 E;  1KFM A;  3PP5 A;  1KYO H;  4H44 C;  2WSE H;  5CCG D;  1KC8 Q;  1ZR4 A;  1GMJ A;  1NTK E;  3N7N A;  4H0L C;  1BE3 G;  2E76 C;  1RE4 A;  2R44 A;  3P8M C;  3Q1M A;  2K88 A;  2H7H A;  2E5Y A;  3L70 E;  1SS1 A;  3H1L E;  2IPP A;  1U7M A;  2FYN B;  1NTM J;  1FJP A;  1NTM K;  1FZA A;  1BDD A;  2JP3 A;  3S9O A;  2M0B A;  4N6J A;  2ITA A;  1GU4 A;  1ZME C; 
#chains in the Genus database with same CATH homology
 5AW6 B;  1KIL B;  3RK2 D;  2C0X A;  1JY2 N;  3LID A;  1GU5 A;  2KOG A;  1J2J B;  1DEB A;  2XKM A;  1H88 A;  1RY3 A;  3V2R A;  1XTC C;  1LWU B;  5AVX B;  2JJL A;  2I1J A;  3MUD A;  1KIL D;  2A45 H;  4I2L C;  3V5B A;  3H32 A;  3NTN A;  1S9K D;  1ZR2 A;  1JY3 P;  1T3U A;  5KJ7 D;  4WB4 A;  3GHG B;  1HGZ A;  1FZB A;  3RL0 C;  1FZC A;  4N3Y B;  5AW1 B;  3LW5 H;  1IFI A;  2Q7C A;  1N73 B;  2P67 A;  1JCD A;  1HBW A;  1HH0 A;  3VOP A;  1FZF A;  4I6M C;  2J58 A;  3L35 A;  1J1D C;  3T97 A;  1G1J A;  2C9L Y;  5AVR B;  1NHL A;  2HFE D;  1MZ9 A;  5CMZ A;  2HYN A;  3H32 B;  3A7O A;  4W7Z A;  1GW3 A;  3G3Z A;  1URQ C;  1URQ A;  2YO3 A;  3KDP B;  3E1I A;  3IFM A;  1W2E A;  2FKW B;  1LTA C;  4N78 E;  3P8C D;  3VN0 A;  2FFD C;  3OA7 A;  2FFD A;  2KSJ A;  2IX7 C;  2XV5 A;  3M9H A;  1X9V A;  2WWW A;  4LGD E;  4IFM A;  3RL0 B;  1FZC B;  2HPC A;  1LT9 C;  2WTY A;  1L0N K;  1RF0 C;  1FZE A;  3RL0 D;  1AFO A;  2W27 A;  3VMX A;  1IFM A;  1J1D B;  3H6P A;  2OAR A;  3CLQ A;  1HGV A;  2E42 A;  1J1E C;  3V2N A;  3B5N A;  3BAS A;  5AW0 B;  2HLO A;  3M91 A;  4DZO A;  2WSF H;  1YTZ I;  1URQ B;  1JY2 P;  1H8A A;  5AVY B;  1LWU C;  1WT6 A;  2JEE A;  4O9B A;  5AW5 B;  1DX7 A;  2XNX A;  1H89 A;  5BU8 B;  1SFC A;  3O8Z A;  1LTJ C;  5KTB A;  2FFD B;  1LTJ A;  1M1J A;  1URQ D;  2HOD A;  2IFM A;  1JUN A;  3MTU E;  2HPC B;  1LT9 B;  3KPE A;  1CI6 A;  1SLQ A;  2XDJ A;  1GZL A;  1RE3 A;  1NO4 A;  3GHG C;  3CL3 D;  3HTK A;  1SQB K;  2WSC H;  5BU5 A;  2YKQ A;  2N1T C;  2N1T A;  3TSI A;  4EIJ A;  1N73 C;  3MD0 A;  1J1E B;  3B5N B;  1WRG A;  3IR9 A;  1CZQ A;  4W80 A;  2WT7 A;  4GIF A;  2I1K A;  1HWT C;  2ZXE B;  2Z5H A;  3OJA B;  2PP6 A;  1IJD B;  3P7K A;  1LTJ B;  1M1J B;  4WY4 A;  2HOD B;  2WPS A;  1G1I A;  2NPS C;  1LTI C;  2GUS A;  2NPS A;  4JF7 A;  1CI6 B;  1S9K E;  3BAT A;  3V2P A;  3A5T A;  5APX A;  4IFD K;  2VRS A;  3A2A A;  1A02 J;  2M8R A;  2N1T B;  1FDM A;  2A45 I;  1FZC C;  2C0W A;  3HD7 C;  4DOJ A;  1HTL C;  3HD7 A;  2C9N Y;  1X8Y A;  2P1J A;  5AVQ B;  5AW7 B;  2H43 A;  5AVU B;  1XTG B;  1SQX K;  3UIA A;  2E43 A;  2N1T D;  1ZN5 A;  2ZFC A;  3U1C A;  1HVV A;  5AW8 B;  1SP4 A;  3L37 A;  5APT A;  1SQP K;  2OYI C;  2OYI A;  1FJK A;  2CPB A;  1GW4 A;  3M0D A;  1JCC A;  1A02 F;  1KQL A;  4WY4 B;  1L4A C;  2L5G B;  1L4A A;  3LIE A;  1ZV8 A;  3TNU A;  1ZLL A;  5CJ0 A;  2NPS B;  5CHX A;  1T3J A;  4C7N A;  2O1J A;  1EQ7 A;  1VDF A;  2QM8 A;  5CCG A;  3P8C E;  1JTH A;  2NPS D;  4B86 A;  4JYB A;  4M3L A;  3HD7 B;  2R5B A;  1LTS C;  2M3B A;  2J59 M;  5APS A;  3N4X A;  3HRN A;  3VP9 A;  3HD7 D;  1OXZ A;  1QL2 A;  1JY3 O;  3EQ2 A;  1GDT A;  2QM7 A;  1T2K C;  1FZG A;  1VPC A;  2LKM A;  3V2Q A;  2OYI B;  3B5N C;  2WPQ A;  3SWY A;  1AQ5 A;  3B8E B;  1IFD A;  1FAV A;  2WPR A;  5BVZ A;  1N7S C;  2PAJ A;  1CW5 A;  1GL2 C;  1N7S A;  2YKO A;  3NXS A;  1GL2 A;  1L4A B;  2GUV A;  1YTZ T;  3WMM 0;  5AW2 B;  1T8Z A;  5AW3 B;  1SQV K;  2A45 G;  1NOH A;  1IC2 A;  1KZU B;  1L4A D;  1SFC C;  3A3Y B;  2FYZ A;  2Q9I A;  4LC1 A;  1JTH B;  3U59 A;  1LTB C;  1M1J C;  4XE5 B;  2KYV A;  1M7L A;  2Q5U A;  2YO2 A;  2BAS A;  3VTP C;  1LGH B;  1RE3 C;  1NWQ A;  1HJB A;  2Z5I A;  5CJ4 A;  3U1A A;  1L0L K;  3NMD A;  1KFN A;  2HG5 D;  1N7L A;  5KLV K;  2FYU K;  3P32 A;  1G2C A;  4HH2 A;  3BVH A;  5APU A;  5KJ7 A;  1N7S B;  1GL2 B;  2O1K A;  1T2K D;  1HUC A;  3TYY A;  1LTT C;  3B5N D;  1N7S D;  1IK9 A;  1Z56 A;  1GL2 D;  2R5D A;  2WIT A;  3I5C A;  2O01 H;  1SFC B;  2KB7 P;  1N86 A;  4WY4 C;  4C46 A;  1FOS E;  1LTG C;  3BRT B;  1NH4 A;  2IFN A;  2OYH C;  1RF1 C;  1SFC D;  2OYH A;  1RF1 A;  4Y99 C;  4HYT B;  3HTK B;  1JY2 O;  1YYC A;  2H8P D;  3L36 A;  3VP8 A;  1JOC A;  4WBA A;  1G2C B;  4AQR D;  1X79 B;  3V4Q A;  3NFQ A;  3BRV B;  1DH3 A;  1NKN A;  2P2U A;  4XA4 A;  3L4F A;  2WT7 B;  3KQG A;  2POH A;  4ZKU A;  3M0D C;  2R3C A;  4LLH A;  4RES B;  4ZKP A;  4OH8 B;  1SVF A;  1MFZ A;  2XU6 A;  1GK6 A;  3M0A A;  2YKP A;  1RF1 B;  2OYH B;  3MIW A;  4Y99 B;  4WY4 D;  5AVZ B;  1FOS F;  1NTZ K;  1JMM A;  5CCG C;  5AW4 B;  4I1L A;  3VMZ A;  2GM4 A;  1IFN A;  4KHX A;  1IFJ A;  5AVW B;  2Q3I A;  3VMY A;  4AYC A;  2YMY A;  4W7Y A;  5AVV B;  1JO5 A;  3TK1 A;  4IFF A;  2FXM A;  1JY3 N;  2R32 A;  4GKG A;  2CPS A;  4N78 D;  3RK3 C;  4EOT A;  1JNM A;  3VYI A;  2KP8 A;  3OAK A;  3SWF A;  5CCH C;  1GTW A;  1NKZ B;  5CCH A;  1SQQ K;  1N2D C;  2W6A A;  3HUS C;  3HUS A;  3TNU B;  1LT9 A;  3M9B A;  2Z4E A;  1QL1 A;  5AVS B;  1RF0 A;  5APV A;  4C7N B;  3HE5 A;  2MJZ A;  1GK4 A;  3M9Q A;  2XZR A;  3MGN A;  3RK2 C;  4GT1 A;  1KFM A;  2WZ7 A;  3HE4 A;  3PP5 A;  1CSB A;  2P7J A;  1KIL C;  2WSE H;  3M06 A;  5CCG D;  1KIL A;  1ZR4 A;  5APQ A;  3N7N A;  4JYC A;  5APW A;  1FBM A;  3EFG A;  3CI9 A;  1LWU A;  3RK3 B;  1NU1 K;  2YNY A;  1RE4 C;  2W6B A;  1RE4 A;  5KJ7 C;  5AW9 B;  3P8M C;  2H7H A;  3RK3 D;  1MUU A;  3HUS B;  2KLV A;  5APY A;  2IPP A;  1GD2 E;  1NTK K;  1FJP A;  1MV8 A;  1NTM K;  3HE5 B;  5CCH D;  3GHG A;  1FZA A;  5AVT B;  1OWA A;  2N9B A;  4C7R A;  3RK2 B;  3C9I A;  3HE4 B;  1NAF A;  1FU1 A;  4N6J A;  3R2P A;  1N73 A;  3II6 A;  1PFI A;  1E5W A;  4AUW A;  3V4W A;  1GU4 A;  1IO4 A;  3KYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...