1QL2A

Inovirus (filamentous bacteriophage) strain pf1 major coat protein assembly
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Structure and Structural Transition of the Alpha-Helical Capsid in Filamentous Bacteriophage Pf1
pubmed doi rcsb
source organism Pseudomonas phage pf1
molecule tags Virus
molecule keywords PF1 BACTERIOPHAGE COAT PROTEIN B
total genus 15
structure length 46
sequence length 46
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ql2A00
1IFNA 1QL2A 3IFMA 2IFMA 2IFNA 4IFMA 1PFIA 2KLVA 2XKMA 1IFMA 2KSJA 1QL1A 1ZN5A
chains in the Genus database with same CATH superfamily
3KYQA 5KLVD 3L75D 3HD7C 1EDIA 1HVVA 5AVSB 5BU5A 1GL2B 1X9VA 2KLVA 1YQ4C 2YKPA 1N7SA 2ZT9D 3ABVC 2AEMA 2B87B 4H0LC 3AECC 2NRGA 1LJ2A 5AW6B 1KFMA 2E74B 1SQVD 1OZHA 1M1JA 2WSCH 4TT3H 1HBWA 1VQ7P 1KN7A 2PP6A 5E79H 1NU1G 2P7JA 3VYIA 2FXPA 1KC8Q 1BE3J 1BE3E 1KILA 1L0NK 2C0XA 3KDPB 1VL2A 1U57A 5KAFH 5TISH 1VQPP 2AXTH 4EOTA 1M7LA 5CBNA 1JCDA 1RE3A 1SQQD 2YXRB 5KAIE 2W90A 3H1KG 3FGAD 1N73B 1BSNA 5B66H 1JM0A 1HUCA 1PGOA 1LTTC 2ZYAA 3IN6A 4WBAA 1PIXA 3KZIE 2AXCA 3A2AA 3FX0A 1SVFA 4BXLA 2WPSA 3F5HA 3H32B 2AXTE 2NPSC 4K35A 3HTKA 4KT0J 2LXCB 3NMDA 4WVZA 1T6AA 3SFDC 1RE4C 1N7LA 1X79B 3L71D 2W27A 1VQNP 3L4FA 4N6JA 3WUUA 4U3FD 4B86A 1SQQE 2POHA 3GF7A 2YO3A 1PP9E 3HUSA 2CPSA 2KOGA 3AE2C 3V4WA 1GL2D 4C7RA 3RK3D 1U7MA 2E76B 2L5GB 4GOFA 1LT9B 3RK2C 4D6TD 2QEXP 3BCCJ 4MN4C 1RY3A 2IYPA 5KLVK 1DEBA 5AW9B 3ZDMA 1JTHB 2M8RA 1RQVA 3TK1A 2K9JB 5AVTB 4C7NB 3EFFK 1SQBE 1LTGC 2K9JA 2JR8A 5M1BA 1MUUA 4C7NA 3B5NA 1WRGA 2UWJE 3AEGC 3JCUE 3TDKA 4BRYB 2LXBA 3L37A 1R5SA 3CWBD 3H1LE 1IFMA 1CI6A 1GMJA 1JY2N 4D6TJ 4IL6X 1KB9E 2V7QJ 4D6TE 1H0TA 2YXQB 4EDFA 1OXZA 1URQC 1L0ND 3M0DA 4KHXA 1LTSC 1NTKK 1SQBD 4H13D 2KS1B 2WSCJ 2R32A 3TSIA 5GTIH 3L72J 3GHGB 2H8PD 1LNQA 3AE4C 4GKGA 5CJ0A 3CI9A 3SSUA 5KJ7A 2E75C 3L70D 2P67A 1NJIQ 1EDJA 1ZR2A 3E1IA 3SWYA 1FZCB 2Q3IA 2GM4A 3GF3A 3L73E 5APSA 4JBZA 2PGDA 1LTJC 4PD4E 1DD4A 3D6ZA 3CX5I 1Q7YQ 4ZMDA 2JWAA 2Q5UA 2ZT9C 4IL6E 5BU8B 1BCCD 4JPZB 3MTUE 4WWIA 3JCUH 3M9QA 1UIXA 3TGUG 4A7PA 5KLVJ 1KYOD 5CBOA 3L35A 4YXWH 1JCCA 1SQXJ 3MGNA 2O01H 2H89C 1IFIA 2AEFA 1SQVJ 1M57D 2O1KA 1AJYA 3BCCD 1MKMA 2WPQA 3RGUA 1LTIC 5AW4B 1KB9H 3VOPA 5KJ7D 1PP9D 3CMEP 4L73A 4OGQC 1LTJB 3PJSK 3O6QB 4H44C 1HTLC 2AEJA 1AV1A 2XNDH 1H88A 1N8RQ 1IO4A 1S9KD 5CCGA 1RF1C 2FYUG 4KJMA 2KI7B 1PZQA 5AW2B 1N73C 3L72G 3MZWB 3C9IA 4H13C 1SQXE 1GD2E 4PJ0E 1KTMA 2BASA 2BCCE 2ZXXA 2OARA 3E7KA 5GTHE 1JY3O 3IAOA 2K1AA 1LP1A 2NPSB 1SFCC 4OGQD 3V2PA 3BVHA 1KZUB 2JP3A 3H1LG 1EDLA 2JO1A 1FBMA 1IFNA 3RK2D 3VP9A 3AEBC 1N7SD 3P7KA 1S72P 2IZ1A 1NTZJ 1NTZE 2Q1KA 1NTMJ 3CXHH 3P8CD 4HB1A 1PGPA 2QJKB 5KLVG 1YJWP 2OYHA 1J1DB 3H1JJ 2YKOA 5CMZA 2YNYA 3PH0A 4BWNA 2R3SA 5BVZA 5APQA 1HJ0A 2SPZA 1SQVG 3L75J 1GL2A 1P84E 1ZLLA 4AQRD 1G1JA 1NU1D 1Q90D 1NAYA 4WY4C 2R5DA 2G8YA 2E76D 3OJAB 4L74A 2HG5D 1H0TB 3KXDA 2OYIB 2ITAA 1DH3A 5APUA 1SQQG 4C46A 2CPBA 2P1JA 3CX5H 2LR2A 4I7ZB 5AVXB 1GU4A 3G6EP 3U59A 3BRTB 2N9YB 3H1JE 1URQD 5KLVE 3H25A 1QEXA 2E5YA 1YTZT 3AE6C 5TISE 2BEZF 3TF5A 1PL5A 5AW1B 1FZCC 4JQ0D 3RK3B 2YIUC 3L75E 3ITKA 1R8EA 1AQ5A 4R4LA 5APTA 1FE6A 2IBZE 2O01J 3R2PA 2WSFJ 2XDJA 2JKVA 2H43A 2YMKA 3L74E 5APYA 1NGMB 4IFDK 5B66E 4IL6H 2OYIC 1GDTA 4XA4A 2V7QH 1OWAA 1Q2NA 4I6MC 4DOJA 1PV3A 3V2QA 4D6TG 5AVUB 2N9BA 3M91A 3IFMA 3NFQA 4W7YA 1S3JA 1FDOA 3H1IJ 3NXSA 3VMAA 3M06A 1NU1K 2KSJA 4R4MA 1LWUB 2M3EA 3CCRP 2RKLA 1G2CB 2P58A 3M9BA 2K9YA 3FXEA 3TNUB 4ZKPA 1SQPD 2R44A 5H2FH 3WUVA 3HD7D 1SQBG 3AEFC 4JYBA 4GODA 5AW3B 1ZRTE 2IX7C 2M5AB 3A3YB 2HLOA 1GK6A 1M1JB 1EDKA 1KQGB 5AVRB 5APXA 1LT1A 1L4AD 1KILD 1OW8A 3LW5J 1BDDA 2KZIA 1VPCA 2KS1A 2E43A 2RMZA 2I1JA 4UB8H 1VQ6P 1FJPA 5H2FE 1HGVA 4IFMA 4O9BA 5C39A 1M56D 1N86A 4AYCA 3RBZA 3A0BE 3VMZA 3H1HE 5B5EE 2FYZA 1CSBA 2P10A 1BCCG 1JY2O 4N3YB 4RESB 1PGJA 2OTJP 2QM7A 1WMKA 3H1ID 1K73Q 1GW4A 1JTHA 1IFJA 3L72E 2OYHC 1BSHA 3P8MC 4NPDA 3CPWO 2KXPB 3RL0D 2QRXA 2WSEJ 1MZ9A 3L71E 1BGYJ 3Q3DA 2JEEA 2QJPC 1J2JB 1JEKA 1KYOH 3A7OA 2WSFH 4YTPC 1P84I 1SFCA 1S5LX 2KZJA 5DJUB 3W68A 1JNMA 2H7HA 1JO5A 1SQPK 2OYIA 1QL1A 3B5ND 3B4SA 1NWQA 1NTKJ 2FYUD 1G2CA 3L72D 5KKZC 1OVVA 2R5BA 1N73A 1VF5D 3SFEC 2NZ2A 1HJBA 5CCGC 1FZFA 1FZCA 1GK4A 2C9LY 1L0LJ 3K5BA 4EYYQ 4PD4I 3AE3C 3CWBE 3CWBJ 3H1LD 1DIPA 1KB9D 2A45H 5CHXA 3CCMP 3KQGA 1QVFO 3VMXA 1MV8A 1L0NE 1USDA 1GZLA 1S5LE 1PP9J 1SQPJ 1FOSE 4N78E 2B87A 1EC5A 2KSEA 4WY4A 3HD7B 4CPGA 3AE7C 1GL2C 3C1LA 3L70E 1SQXK 4H0LB 4LGDE 5AVQB 2QJYB 4BRYA 3A5TA 2Y0DA 1NTMD 4U3FJ 3CCEP 2RN0A 3CXHE 1LTJA 1KB9I 2QM8A 3HE5A 3L71J 2K3RA 2MKVA 2WPVB 3U1AA 1J1EB 1CW5A 3C8VA 2WT7A 4IOIH 3B5NB 1EZVD 1L0LG 3L36A 3EQ2A 3VP8A 1NTZK 3P8CE 4RKUJ 1FDIA 3Q5SA 5APVA 3Q2YA 2PFXA 3M0AA 1NTKG 1RH5B 3A0HH 3HRNA 3L70J 4HKZH 3G9RA 4TLFA 5AVVB 3B8EB 1URQA 2VRSA 3FWLA 3M0DC 2Q7CA 1GTWA 1GU5A 2K37A 4HYTB 1E5WA 2WZ7A 4U7JA 2Z4EA 1MFTA 1A02J 2M3BA 4PV1D 2XU6A 1L0NJ 2XV5A 1IZNB 1K9MQ 3B5NC 1T3JA 2L91A 3GMAA 3WUTA 4EIJA 4UB6E 3VMYA 1QX8A 2IFNA 3I55P 2Z5IA 1QVGO 1RF1B 1HWTC 4DJGA 1SQXD 2OTKE 1NYHA 3MP7B 1OFCX 1RF1A 2B88A 4W80A 4RO0A 3WU2E 1YJNP 1XTCC 2E74C 2I8DA 2Y0CA 3LW5H 1YTZI 1NAFA 1TU3F 2XKMA 2ZVOB 1RHZB 2KYVA 2C0WA 3H1HG 4LLHA 5AVZB 3BATA 1D7MA 1VQ5P 1SQPG 1YIJP 3F89A 3AE5C 3OW2O 3Q5PA 2B9BA 4OWFA 4QMAA 1NTZD 1FDMA 4AUWA 3NTNA 5KKZB 4H44D 1KFNA 1NTME 2OQQA 3CCLP 1T8ZA 2WT7B 1MFZA 2E5TA 2WITA 3S1KA 3M9HA 3AE1C 3LIEA 2QIWA 2W6AA 3TGUE 1W2BO 3BRVB 1SQBJ 2FYUK 3PHLA 5KLIC 5KJ7C 2DW3A 3TYYA 1VQOP 1T2KC 1EZVE 1VDFA 1VQLP 3N4XA 4OH8B 1YI2P 2WQYC 1Y9BA 5AW8B 2P2UA 1KQLA 3HUSB 2W8ZA 1OX3A 2I1KA 3H1IG 3CCQP 2N1TD 3V5BA 3CC2P 1IFDA 1YQ3C 4DT0A 3D71A 1N7SC 2E76C 3RK2B 2KNCB 1BGYG 3Q1MA 1M90Q 2Y9YA 1SQPE 1S4XA 3A0BH 2QJYC 1Y47A 3Q5RA 2QG4A 1KORA 1XTGB 2GUSA 2C9NY 3SWKA 3P32A 1JY2P 1N2DC 2YMYA 5B5EH 3MUDC 1VQMP 3D6YA 1J1EC 3H6PA 1HH0A 1Y8AA 2FXMA 2YIUB 3KHUA 2KNCA 1X8YA 3V2NA 1NHLA 3L73G 4IFFA 2IZ0A 3AEEC 3U1CA 2WTYA 3HUSC 2NPSD 4XFJA 3D70A 5AVYB 1YYCA 4Z1MH 2D2CD 3S4RA 1KILB 1CI6B 2V4HA 1X0TA 1RE4A 1A02F 1VQ4P 1FZGA 1LP1B 2NPSA 4DZOA 2A45I 4U3FE 2ZVNB 1EXJA 1IK7A 1SQVE 2A06G 2E75B 3VTPC 3H1IE 1M8OB 2QA4P 2W83C 1PPJG 4GOEA 2QE7H 2RH0A 3OA7A 5E79E 1Q81Q 1BE3D 1LTBC 2W6JH 3II6A 2FY8A 3L73J 4I1LA 1RE3C 2CK3H 1YHQP 1VQ9P 2J5UA 2Y0EA 3L74J 4GIFA 2WPRA 3AEDC 1QLED 3BASA 4RJTA 1KILC 1QL2A 3H1JG 3G4SP 1ZOYC 1M1JC 1ZRTD 4GT1A 1KQSO 3HE5B 2HYNA 1NTMG 1QGKB 1T2KD 2BCCJ 2BCCG 5AW7B 1DX7A 2OTLP 1RF0A 2IBZG 1IFPA 3HD7A 4PD4H 2ZJSE 3H1LJ 1W2EA 1SQQK 2HR3A 1H89A 2FYNB 2FFDA 3PP5A 1EZVG 1L0LD 3JSVC 4JF7A 1YITP 5DJTB 2LKMA 3JC22 3L74G 2Q6QA 3FXDA 1LT9C 2YKQA 4I7ZC 3CXHI 4PV1B 5AVWB 3TNUA 3V6IA 1FU1A 1NTKD 1SQBK 2D2CC 1U7JA 2FYUJ 2ZAEB 1NH4A 2XZRA 4H13B 4UB8E 5AW5B 2G3AA 2A45G 1DD3A 4L75A 2W6BA 3WMM0 2Z5HA 2IBZI 2HFED 2N1TA 2YO2A 1S1CX 3CL3D 1NKNA 1S2EA 1OVUA 2FYNC 1L4AA 5CCHA 2O01N 2QJPB 1SQQJ 2FKWB 3H1HJ 1URQB 3KPEA 1K8AQ 1N7SB 2WSSH 5EFWB 1DEEG 1SQXG 1JOCA 1NTKE 2QJKC 3RL0g 3GHGC 1J1DC 1NO4A 5GTIE 3AE9C 1HF9A 1ZW0A 2FYUE 5APWA 3TGUJ 1Q86Q 3L75G 1KV4A 1KYOI 4GDOA 1Q82Q 1JY3N 2WSEH 4UB6H 1IK9A 3G71P 1VF5B 2BEQD 2ZYGA 3H1HD 3V4QA 3CCJP 1LGHB 1Z56A 1RQUA 2O1JA 3O6QA 5CCGD 2JJLA 1LWUC 4WY4B 2HPCA 1L0LK 1AQTA 2E75D 2FBWC 2KUBA 3H1KE 4WB4A 3MHVA 1NTZG 4ZNCA 2ZT9B 3GG2A 1OVRA 3T97B 3I5CA 2IYOA 3KZIH 3PLNA 3RK3E 1EQ7A 1EXIA 3HE4B 1IC2A 1SLQA 1YBKA 2QSIA 3H32A 2ZYDA 3R4YA 5KAFE 3V2RA 3RL0C 2M5AA 4N78D 3GW6A 3H1KD 3VN0A 2PRRA 5CCHD 2N1TB 3CMAP 1JB0J 1VF5C 5KAIH 1ZMEC 4ZKUA 3CCUP 1L0LE 1LTAC 2GUVA 2OGUA 3LIDA 2KP8A 1OW7A 2MJZA 1UIIA 4XE5B 2JWDA 4H44B 1S5LH 3CLQA 3L71G 1FS0E 4WY4D 2Q3EA 2ZFCA 1OMIA 3AE8C 1BGYD 4U3FG 1H8AA 1USEA 5AW0B 1FOSF 1SQVK 1SFCD 2ZXEB 3O8ZA 1OW6A 4NPFX 1M1KQ 5GTHH 1VQ8P 1YJ9P 2A06E 4PJ0H 1SFCB 4Y99C 3CCSP 1OIPA 1HGZA 3L73D 1BCCE 3B71A 2JDIH 2KLUA 3IF4A 1NKZB 2WVRA 4H0LD 5CCHC 2HPCB 5KTBA 4PD4D 5L8RJ 2HODA 2OYOA 3CWBG 3CCVP 2IDBA 3PTZA 1KMIZ 1JMMA 2HODB 1KD1Q 1NOHA 4PV1C 3W67A 1L0NG 1KYOE 1X22A 2D2CB 1AVOA 2WMMA 3CXHD 3OAKA 3AEAC 1ZV8A 2Y9ZA 1L2PA 1JMBA 3CX5E 4YPCA 4ASWA 1FAVA 2A06D 2Q9IA 4K3AA 1FZBA 3BCCE 1FJKA 1PPJD 4Y99B 3PRJA 4NPEA 5CJ4A 1FZEA 3GLMA 1AFOA 3L70G 1BE3G 4JYCA 1NU1J 2FFDC 3MD0A 4OGQB 2XNXA 1P84D 1ZXGA 4HJGH 3S9OA 3UIAA 2PAJA 1RF0C 3HTKB 3EFGA 2IPPA 3USSA 2B89A 1PPJE 1S9KE 1IJDB 3H1JD 3G3ZA 2O3JA 1BDCA 2H88C 3CX5D 3QWOC 1LWUA 1SS1A 1PFIA 1SP4A 4ASVA 3TGUD 2KB7P 1W5CE 2OYHB 4Y28J 4YXDC 2BCCD 1PGQA 2J59M 1JUNA 1KQFB 4OVNF 3RK3C 1FC2C 4HH2A 2IBZD 3A0HE 1BCCJ 5KLIB 2IFMA 2KIKA 1K04A 3BCCG 2FFDB 1FZAA 1AA0A 1AVYA 1CZQA 1KILE 1R5LA 1BGYE 1T3UA 1WT6A 2E74D 2FXOA 2KK7A 2WWWA 3GHGA 1PP9G 1G1IA 3FWNA 4M3LA 5TJHA 3RBXA 1JY3P 3L74D 3T97A 2K88A 1L4AC 3SWFA 4L76A 3CD6P 3HE4A 3RL0B 1E79H 1NVOA 3N7NA 2N1TC 1ZR4A 3CC7P 2GA1A 5K5GB 1K05A 1GW3A 2E42A 2QVAA 2J58A 1NU1E 3E1RA 1VQKP 3I56P 3H1KJ 4DCKA 3CC4P 4W7ZA 1ZN5A 3MIWA 4EI2A 2M0BA 3EWKA 1LT9A 1EZVI 4I2LC 2R3CA 3MUDA 3QH9A 3WU2H 4LC1A 3IR9A 1ZP0C 1L4AB 1NTMK 1P84H
chains in the Genus database with same CATH topology
3KYQA 3HD7C 1HVVA 5AVSB 5BU5A 1GL2B 1X9VA 2KLVA 2YKPA 5CCHD 1N7SA 3V2NA 5AW6B 1KFMA 1M1JA 2WSCH 1HBWA 2PP6A 3VYIA 2P7JA 1KILA 1L0NK 2C0XA 3KDPB 4EOTA 1M7LA 1JCDA 1RE3A 1N73B 4WBAA 1HUCA 1LTTC 3A2AA 1SVFA 2WPSA 3H32B 2NPSC 3HTKA 3NMDA 1RE4C 1N7LA 1X79B 2W27A 3L4FA 4N6JA 4B86A 2POHA 2YO3A 4C7RA 3HUSA 2CPSA 2KOGA 3V4WA 1RF1C 1GL2D 3RK3D 3RK2C 2L5GB 1LT9B 1RY3A 5KLVK 1DEBA 5AW9B 4C7NB 1JTHB 2M8RA 3TK1A 1ZR2A 5AVTB 1LTGC 1MUUA 4C7NA 3B5NA 1WRGA 3L37A 1IFMA 1CI6A 1JY2N 1OXZA 1URQC 3M0DA 4KHXA 1LTSC 1NTKK 3TSIA 2R32A 3GHGB 2H8PD 4GKGA 5CJ0A 3CI9A 5KJ7A 2P67A 3E1IA 3SWYA 1FZCB 2Q3IA 2GM4A 5APSA 1LTJC 2Q5UA 5BU8B 3MTUE 3M9QA 3L35A 1JCCA 3MGNA 2O01H 1IFIA 2O1KA 2WPQA 1LTIC 5AW4B 3VOPA 5KJ7D 1LTJB 1HTLC 1IO4A 1S9KD 5CCGA 5AW2B 1N73C 3C9IA 1GD2E 2BASA 2OARA 1JY3O 2NPSB 3V2PA 1SFCC 3BVHA 1KZUB 1FBMA 1IFNA 3RK2D 3VP9A 1N7SD 3P7KA 3P8CD 2OYHA 1J1DB 2YKOA 5CMZA 2YNYA 5BVZA 5APQA 1ZLLA 1GL2A 4AQRD 1G1JA 4WY4C 2R5DA 3OJAB 2HG5D 2OYIB 1DH3A 5APUA 4C46A 2CPBA 2P1JA 5AVXB 1GU4A 3U59A 3BRTB 1URQD 1YTZT 5AW1B 1FZCC 3RK3B 1AQ5A 5APTA 3R2PA 2XDJA 5APYA 1GDTA 2OYIC 4XA4A 1OWAA 4DOJA 4I6MC 3V2QA 5AVUB 2N9BA 3M91A 3IFMA 3NFQA 4W7YA 3NXSA 3M06A 1NU1K 2KSJA 1LWUB 1G2CB 3M9BA 3TNUB 4ZKPA 3HD7D 4JYBA 5AW3B 2IX7C 5AVRB 3A3YB 2HLOA 1GK6A 1M1JB 5APXA 1L4AD 1KILD 1VPCA 2E43A 2I1JA 1FJPA 1HGVA 4IFMA 4O9BA 1N86A 4AYCA 3VMZA 2FYZA 1CSBA 1JY2O 4N3YB 4RESB 2QM7A 1GW4A 1JTHA 1IFJA 2OYHC 3P8MC 3RL0D 1MZ9A 2JEEA 3A7OA 1J2JB 2WSFH 1JNMA 1SFCA 1JO5A 2H7HA 1SQPK 2OYIA 1QL1A 3B5ND 1NWQA 1G2CA 2R5BA 1N73A 1HJBA 5CCGC 1FZFA 1FZCA 1GK4A 2C9LY 5CHXA 2A45H 3KQGA 3VMXA 1MV8A 1GZLA 1FOSE 4N78E 4WY4A 3HD7B 1GL2C 4LGDE 2H43A 1SQXK 5AVQB 3A5TA 1LTJA 2QM8A 3HE5A 3U1AA 1J1EB 1CW5A 2WT7A 3B5NB 3L36A 3EQ2A 3VP8A 1NTZK 3P8CE 5APVA 3M0AA 3HRNA 5AVVB 3B8EB 1URQA 2VRSA 3M0DC 2Q7CA 1GU5A 1GTWA 2Z4EA 4HYTB 1E5WA 2WZ7A 1A02J 2M3BA 2XU6A 2XV5A 3B5NC 1T3JA 4EIJA 3VMYA 2IFNA 2Z5IA 1RF1B 1HWTC 1RF1A 4W80A 1XTCC 3LW5H 1YTZI 1NAFA 2XKMA 4LLHA 2KYVA 2C0WA 5AVZB 3BATA 1FDMA 4AUWA 3NTNA 1KFNA 1T8ZA 2WT7B 1MFZA 2WITA 3M9HA 3LIEA 2W6AA 3BRVB 2FYUK 5KJ7C 3TYYA 1T2KC 1VDFA 3N4XA 4OH8B 5AW8B 2P2UA 1KQLA 3HUSB 2I1KA 2N1TD 3V5BA 1IFDA 1N7SC 3RK2B 1XTGB 2GUSA 2C9NY 3P32A 1JY2P 1N2DC 2YMYA 1J1EC 3H6PA 1HH0A 2FXMA 1FOSF 2WTYA 1X8YA 1NHLA 3U1CA 4IFFA 3HUSC 2NPSD 5AVYB 1YYCA 1KILB 1CI6B 1RE4A 1A02F 1FZGA 2NPSA 4DZOA 2A45I 3VTPC 3OA7A 1LTBC 3II6A 4I1LA 1RE3C 4GIFA 2WPRA 3BASA 1KILC 1QL2A 1M1JC 4GT1A 3HE5B 2HYNA 1T2KD 5AW7B 1DX7A 1RF0A 3HD7A 1H89A 1W2EA 1SQQK 2FFDA 3PP5A 4JF7A 2LKMA 1LT9C 2YKQA 5AVWB 3TNUA 1H88A 1FU1A 1SQBK 4IFDK 1NH4A 2XZRA 5AW5B 3WMM0 2A45G 2W6BA 2Z5HA 2N1TA 2HFED 2YO2A 3CL3D 1NKNA 1L4AA 5CCHA 2FKWB 3KPEA 1URQB 1N7SB 1JOCA 3GHGC 1J1DC 1NO4A 5APWA 1JY3N 2WSEH 1IK9A 3V4QA 1LGHB 1Z56A 2O1JA 5CCGD 2JJLA 1LWUC 4WY4B 2HPCA 1L0LK 4WB4A 3I5CA 1EQ7A 3HE4B 1IC2A 1SLQA 3H32A 3V2RA 3RL0C 4N78D 3VN0A 2N1TB 4ZKUA 1LTAC 2GUVA 3LIDA 2KP8A 2MJZA 4XE5B 3CLQA 4WY4D 2ZFCA 1H8AA 5AW0B 1SQVK 3O8ZA 1SFCD 2ZXEB 4Y99C 1SFCB 1HGZA 5CCHC 1NKZB 2HPCB 5KTBA 2HODA 1JMMA 2HODB 1NOHA 3OAKA 1ZV8A 1FAVA 2Q9IA 1FZBA 1FJKA 4Y99B 5CJ4A 1AFOA 1FZEA 4JYCA 2FFDC 3MD0A 2XNXA 3UIAA 2PAJA 1RF0C 3HTKB 3EFGA 2IPPA 1S9KE 1IJDB 3G3ZA 1PFIA 1LWUA 1SP4A 2KB7P 1JUNA 2OYHB 2J59M 3RK3C 4HH2A 2IFMA 2FFDB 1FZAA 1T3UA 1CZQA 1WT6A 3GHGA 4M3LA 2WWWA 1G1IA 1JY3P 3T97A 1L4AC 3SWFA 3HE4A 3RL0B 3N7NA 2N1TC 1ZR4A 1GW3A 2E42A 2J58A 4W7ZA 1ZN5A 3MIWA 1LT9A 4I2LC 2R3CA 3MUDA 4LC1A 3IR9A 1L4AB 1NTMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFN A;  1QL2 A;  3IFM A;  2IFM A;  2IFN A;  4IFM A;  1PFI A;  2KLV A;  2XKM A;  1IFM A;  2KSJ A;  1QL1 A;  1ZN5 A; 
#chains in the Genus database with same CATH topology
 3KYQ A;  5KLV D;  3L75 D;  3HD7 C;  1EDI A;  1HVV A;  5AVS B;  5BU5 A;  1GL2 B;  1X9V A;  2KLV A;  1YQ4 C;  2YKP A;  1N7S A;  2ZT9 D;  3ABV C;  2AEM A;  2B87 B;  4H0L C;  3AEC C;  2NRG A;  1LJ2 A;  5AW6 B;  1KFM A;  2E74 B;  1SQV D;  1OZH A;  1M1J A;  2WSC H;  4TT3 H;  1HBW A;  1VQ7 P;  1KN7 A;  2PP6 A;  5E79 H;  1NU1 G;  2P7J A;  3VYI A;  2FXP A;  1KC8 Q;  1BE3 J;  1BE3 E;  1KIL A;  1L0N K;  2C0X A;  3KDP B;  1VL2 A;  1U57 A;  5KAF H;  5TIS H;  1VQP P;  2AXT H;  4EOT A;  1M7L A;  5CBN A;  1JCD A;  1RE3 A;  1SQQ D;  2YXR B;  5KAI E;  2W90 A;  3H1K G;  3FGA D;  1N73 B;  1BSN A;  5B66 H;  1JM0 A;  1HUC A;  1PGO A;  1LTT C;  2ZYA A;  3IN6 A;  4WBA A;  1PIX A;  3KZI E;  2AXC A;  3A2A A;  3FX0 A;  1SVF A;  4BXL A;  2WPS A;  3F5H A;  3H32 B;  2AXT E;  2NPS C;  4K35 A;  3HTK A;  4KT0 J;  2LXC B;  3NMD A;  4WVZ A;  1T6A A;  3SFD C;  1RE4 C;  1N7L A;  1X79 B;  3L71 D;  2W27 A;  1VQN P;  3L4F A;  4N6J A;  3WUU A;  4U3F D;  4B86 A;  1SQQ E;  2POH A;  3GF7 A;  2YO3 A;  1PP9 E;  3HUS A;  2CPS A;  2KOG A;  3AE2 C;  3V4W A;  1GL2 D;  4C7R A;  3RK3 D;  1U7M A;  2E76 B;  2L5G B;  4GOF A;  1LT9 B;  3RK2 C;  4D6T D;  2QEX P;  3BCC J;  4MN4 C;  1RY3 A;  2IYP A;  5KLV K;  1DEB A;  5AW9 B;  3ZDM A;  1JTH B;  2M8R A;  1RQV A;  3TK1 A;  2K9J B;  5AVT B;  4C7N B;  3EFF K;  1SQB E;  1LTG C;  2K9J A;  2JR8 A;  5M1B A;  1MUU A;  4C7N A;  3B5N A;  1WRG A;  2UWJ E;  3AEG C;  3JCU E;  3TDK A;  4BRY B;  2LXB A;  3L37 A;  1R5S A;  3CWB D;  3H1L E;  1IFM A;  1CI6 A;  1GMJ A;  1JY2 N;  4D6T J;  4IL6 X;  1KB9 E;  2V7Q J;  4D6T E;  1H0T A;  2YXQ B;  4EDF A;  1OXZ A;  1URQ C;  1L0N D;  3M0D A;  4KHX A;  1LTS C;  1NTK K;  1SQB D;  4H13 D;  2KS1 B;  2WSC J;  2R32 A;  3TSI A;  5GTI H;  3L72 J;  3GHG B;  2H8P D;  1LNQ A;  3AE4 C;  4GKG A;  5CJ0 A;  3CI9 A;  3SSU A;  5KJ7 A;  2E75 C;  3L70 D;  2P67 A;  1NJI Q;  1EDJ A;  1ZR2 A;  3E1I A;  3SWY A;  1FZC B;  2Q3I A;  2GM4 A;  3GF3 A;  3L73 E;  5APS A;  4JBZ A;  2PGD A;  1LTJ C;  4PD4 E;  1DD4 A;  3D6Z A;  3CX5 I;  1Q7Y Q;  4ZMD A;  2JWA A;  2Q5U A;  2ZT9 C;  4IL6 E;  5BU8 B;  1BCC D;  4JPZ B;  3MTU E;  4WWI A;  3JCU H;  3M9Q A;  1UIX A;  3TGU G;  4A7P A;  5KLV J;  1KYO D;  5CBO A;  3L35 A;  4YXW H;  1JCC A;  1SQX J;  3MGN A;  2O01 H;  2H89 C;  1IFI A;  2AEF A;  1SQV J;  1M57 D;  2O1K A;  1AJY A;  3BCC D;  1MKM A;  2WPQ A;  3RGU A;  1LTI C;  5AW4 B;  1KB9 H;  3VOP A;  5KJ7 D;  1PP9 D;  3CME P;  4L73 A;  4OGQ C;  1LTJ B;  3PJS K;  3O6Q B;  4H44 C;  1HTL C;  2AEJ A;  1AV1 A;  2XND H;  1H88 A;  1N8R Q;  1IO4 A;  1S9K D;  5CCG A;  1RF1 C;  2FYU G;  4KJM A;  2KI7 B;  1PZQ A;  5AW2 B;  1N73 C;  3L72 G;  3MZW B;  3C9I A;  4H13 C;  1SQX E;  1GD2 E;  4PJ0 E;  1KTM A;  2BAS A;  2BCC E;  2ZXX A;  2OAR A;  3E7K A;  5GTH E;  1JY3 O;  3IAO A;  2K1A A;  1LP1 A;  2NPS B;  1SFC C;  4OGQ D;  3V2P A;  3BVH A;  1KZU B;  2JP3 A;  3H1L G;  1EDL A;  2JO1 A;  1FBM A;  1IFN A;  3RK2 D;  3VP9 A;  3AEB C;  1N7S D;  3P7K A;  1S72 P;  2IZ1 A;  1NTZ J;  1NTZ E;  2Q1K A;  1NTM J;  3CXH H;  3P8C D;  4HB1 A;  1PGP A;  2QJK B;  5KLV G;  1YJW P;  2OYH A;  1J1D B;  3H1J J;  2YKO A;  5CMZ A;  2YNY A;  3PH0 A;  4BWN A;  2R3S A;  5BVZ A;  5APQ A;  1HJ0 A;  2SPZ A;  1SQV G;  3L75 J;  1GL2 A;  1P84 E;  1ZLL A;  4AQR D;  1G1J A;  1NU1 D;  1Q90 D;  1NAY A;  4WY4 C;  2R5D A;  2G8Y A;  2E76 D;  3OJA B;  4L74 A;  2HG5 D;  1H0T B;  3KXD A;  2OYI B;  2ITA A;  1DH3 A;  5APU A;  1SQQ G;  4C46 A;  2CPB A;  2P1J A;  3CX5 H;  2LR2 A;  4I7Z B;  5AVX B;  1GU4 A;  3G6E P;  3U59 A;  3BRT B;  2N9Y B;  3H1J E;  1URQ D;  5KLV E;  3H25 A;  1QEX A;  2E5Y A;  1YTZ T;  3AE6 C;  5TIS E;  2BEZ F;  3TF5 A;  1PL5 A;  5AW1 B;  1FZC C;  4JQ0 D;  3RK3 B;  2YIU C;  3L75 E;  3ITK A;  1R8E A;  1AQ5 A;  4R4L A;  5APT A;  1FE6 A;  2IBZ E;  2O01 J;  3R2P A;  2WSF J;  2XDJ A;  2JKV A;  2H43 A;  2YMK A;  3L74 E;  5APY A;  1NGM B;  4IFD K;  5B66 E;  4IL6 H;  2OYI C;  1GDT A;  4XA4 A;  2V7Q H;  1OWA A;  1Q2N A;  4I6M C;  4DOJ A;  1PV3 A;  3V2Q A;  4D6T G;  5AVU B;  2N9B A;  3M91 A;  3IFM A;  3NFQ A;  4W7Y A;  1S3J A;  1FDO A;  3H1I J;  3NXS A;  3VMA A;  3M06 A;  1NU1 K;  2KSJ A;  4R4M A;  1LWU B;  2M3E A;  3CCR P;  2RKL A;  1G2C B;  2P58 A;  3M9B A;  2K9Y A;  3FXE A;  3TNU B;  4ZKP A;  1SQP D;  2R44 A;  5H2F H;  3WUV A;  3HD7 D;  1SQB G;  3AEF C;  4JYB A;  4GOD A;  5AW3 B;  1ZRT E;  2IX7 C;  2M5A B;  3A3Y B;  2HLO A;  1GK6 A;  1M1J B;  1EDK A;  1KQG B;  5AVR B;  5APX A;  1LT1 A;  1L4A D;  1KIL D;  1OW8 A;  3LW5 J;  1BDD A;  2KZI A;  1VPC A;  2KS1 A;  2E43 A;  2RMZ A;  2I1J A;  4UB8 H;  1VQ6 P;  1FJP A;  5H2F E;  1HGV A;  4IFM A;  4O9B A;  5C39 A;  1M56 D;  1N86 A;  4AYC A;  3RBZ A;  3A0B E;  3VMZ A;  3H1H E;  5B5E E;  2FYZ A;  1CSB A;  2P10 A;  1BCC G;  1JY2 O;  4N3Y B;  4RES B;  1PGJ A;  2OTJ P;  2QM7 A;  1WMK A;  3H1I D;  1K73 Q;  1GW4 A;  1JTH A;  1IFJ A;  3L72 E;  2OYH C;  1BSH A;  3P8M C;  4NPD A;  3CPW O;  2KXP B;  3RL0 D;  2QRX A;  2WSE J;  1MZ9 A;  3L71 E;  1BGY J;  3Q3D A;  2JEE A;  2QJP C;  1J2J B;  1JEK A;  1KYO H;  3A7O A;  2WSF H;  4YTP C;  1P84 I;  1SFC A;  1S5L X;  2KZJ A;  5DJU B;  3W68 A;  1JNM A;  2H7H A;  1JO5 A;  1SQP K;  2OYI A;  1QL1 A;  3B5N D;  3B4S A;  1NWQ A;  1NTK J;  2FYU D;  1G2C A;  3L72 D;  5KKZ C;  1OVV A;  2R5B A;  1N73 A;  1VF5 D;  3SFE C;  2NZ2 A;  1HJB A;  5CCG C;  1FZF A;  1FZC A;  1GK4 A;  2C9L Y;  1L0L J;  3K5B A;  4EYY Q;  4PD4 I;  3AE3 C;  3CWB E;  3CWB J;  3H1L D;  1DIP A;  1KB9 D;  2A45 H;  5CHX A;  3CCM P;  3KQG A;  1QVF O;  3VMX A;  1MV8 A;  1L0N E;  1USD A;  1GZL A;  1S5L E;  1PP9 J;  1SQP J;  1FOS E;  4N78 E;  2B87 A;  1EC5 A;  2KSE A;  4WY4 A;  3HD7 B;  4CPG A;  3AE7 C;  1GL2 C;  3C1L A;  3L70 E;  1SQX K;  4H0L B;  4LGD E;  5AVQ B;  2QJY B;  4BRY A;  3A5T A;  2Y0D A;  1NTM D;  4U3F J;  3CCE P;  2RN0 A;  3CXH E;  1LTJ A;  1KB9 I;  2QM8 A;  3HE5 A;  3L71 J;  2K3R A;  2MKV A;  2WPV B;  3U1A A;  1J1E B;  1CW5 A;  3C8V A;  2WT7 A;  4IOI H;  3B5N B;  1EZV D;  1L0L G;  3L36 A;  3EQ2 A;  3VP8 A;  1NTZ K;  3P8C E;  4RKU J;  1FDI A;  3Q5S A;  5APV A;  3Q2Y A;  2PFX A;  3M0A A;  1NTK G;  1RH5 B;  3A0H H;  3HRN A;  3L70 J;  4HKZ H;  3G9R A;  4TLF A;  5AVV B;  3B8E B;  1URQ A;  2VRS A;  3FWL A;  3M0D C;  2Q7C A;  1GTW A;  1GU5 A;  2K37 A;  4HYT B;  1E5W A;  2WZ7 A;  4U7J A;  2Z4E A;  1MFT A;  1A02 J;  2M3B A;  4PV1 D;  2XU6 A;  1L0N J;  2XV5 A;  1IZN B;  1K9M Q;  3B5N C;  1T3J A;  2L91 A;  3GMA A;  3WUT A;  4EIJ A;  4UB6 E;  3VMY A;  1QX8 A;  2IFN A;  3I55 P;  2Z5I A;  1QVG O;  1RF1 B;  1HWT C;  4DJG A;  1SQX D;  2OTK E;  1NYH A;  3MP7 B;  1OFC X;  1RF1 A;  2B88 A;  4W80 A;  4RO0 A;  3WU2 E;  1YJN P;  1XTC C;  2E74 C;  2I8D A;  2Y0C A;  3LW5 H;  1YTZ I;  1NAF A;  1TU3 F;  2XKM A;  2ZVO B;  1RHZ B;  2KYV A;  2C0W A;  3H1H G;  4LLH A;  5AVZ B;  3BAT A;  1D7M A;  1VQ5 P;  1SQP G;  1YIJ P;  3F89 A;  3AE5 C;  3OW2 O;  3Q5P A;  2B9B A;  4OWF A;  4QMA A;  1NTZ D;  1FDM A;  4AUW A;  3NTN A;  5KKZ B;  4H44 D;  1KFN A;  1NTM E;  2OQQ A;  3CCL P;  1T8Z A;  2WT7 B;  1MFZ A;  2E5T A;  2WIT A;  3S1K A;  3M9H A;  3AE1 C;  3LIE A;  2QIW A;  2W6A A;  3TGU E;  1W2B O;  3BRV B;  1SQB J;  2FYU K;  3PHL A;  5KLI C;  5KJ7 C;  2DW3 A;  3TYY A;  1VQO P;  1T2K C;  1EZV E;  1VDF A;  1VQL P;  3N4X A;  4OH8 B;  1YI2 P;  2WQY C;  1Y9B A;  5AW8 B;  2P2U A;  1KQL A;  3HUS B;  2W8Z A;  1OX3 A;  2I1K A;  3H1I G;  3CCQ P;  2N1T D;  3V5B A;  3CC2 P;  1IFD A;  1YQ3 C;  4DT0 A;  3D71 A;  1N7S C;  2E76 C;  3RK2 B;  2KNC B;  1BGY G;  3Q1M A;  1M90 Q;  2Y9Y A;  1SQP E;  1S4X A;  3A0B H;  2QJY C;  1Y47 A;  3Q5R A;  2QG4 A;  1KOR A;  1XTG B;  2GUS A;  2C9N Y;  3SWK A;  3P32 A;  1JY2 P;  1N2D C;  2YMY A;  5B5E H;  3MUD C;  1VQM P;  3D6Y A;  1J1E C;  3H6P A;  1HH0 A;  1Y8A A;  2FXM A;  2YIU B;  3KHU A;  2KNC A;  1X8Y A;  3V2N A;  1NHL A;  3L73 G;  4IFF A;  2IZ0 A;  3AEE C;  3U1C A;  2WTY A;  3HUS C;  2NPS D;  4XFJ A;  3D70 A;  5AVY B;  1YYC A;  4Z1M H;  2D2C D;  3S4R A;  1KIL B;  1CI6 B;  2V4H A;  1X0T A;  1RE4 A;  1A02 F;  1VQ4 P;  1FZG A;  1LP1 B;  2NPS A;  4DZO A;  2A45 I;  4U3F E;  2ZVN B;  1EXJ A;  1IK7 A;  1SQV E;  2A06 G;  2E75 B;  3VTP C;  3H1I E;  1M8O B;  2QA4 P;  2W83 C;  1PPJ G;  4GOE A;  2QE7 H;  2RH0 A;  3OA7 A;  5E79 E;  1Q81 Q;  1BE3 D;  1LTB C;  2W6J H;  3II6 A;  2FY8 A;  3L73 J;  4I1L A;  1RE3 C;  2CK3 H;  1YHQ P;  1VQ9 P;  2J5U A;  2Y0E A;  3L74 J;  4GIF A;  2WPR A;  3AED C;  1QLE D;  3BAS A;  4RJT A;  1KIL C;  1QL2 A;  3H1J G;  3G4S P;  1ZOY C;  1M1J C;  1ZRT D;  4GT1 A;  1KQS O;  3HE5 B;  2HYN A;  1NTM G;  1QGK B;  1T2K D;  2BCC J;  2BCC G;  5AW7 B;  1DX7 A;  2OTL P;  1RF0 A;  2IBZ G;  1IFP A;  3HD7 A;  4PD4 H;  2ZJS E;  3H1L J;  1W2E A;  1SQQ K;  2HR3 A;  1H89 A;  2FYN B;  2FFD A;  3PP5 A;  1EZV G;  1L0L D;  3JSV C;  4JF7 A;  1YIT P;  5DJT B;  2LKM A;  3JC2 2;  3L74 G;  2Q6Q A;  3FXD A;  1LT9 C;  2YKQ A;  4I7Z C;  3CXH I;  4PV1 B;  5AVW B;  3TNU A;  3V6I A;  1FU1 A;  1NTK D;  1SQB K;  2D2C C;  1U7J A;  2FYU J;  2ZAE B;  1NH4 A;  2XZR A;  4H13 B;  4UB8 E;  5AW5 B;  2G3A A;  2A45 G;  1DD3 A;  4L75 A;  2W6B A;  3WMM 0;  2Z5H A;  2IBZ I;  2HFE D;  2N1T A;  2YO2 A;  1S1C X;  3CL3 D;  1NKN A;  1S2E A;  1OVU A;  2FYN C;  1L4A A;  5CCH A;  2O01 N;  2QJP B;  1SQQ J;  2FKW B;  3H1H J;  1URQ B;  3KPE A;  1K8A Q;  1N7S B;  2WSS H;  5EFW B;  1DEE G;  1SQX G;  1JOC A;  1NTK E;  2QJK C;  3RL0 g;  3GHG C;  1J1D C;  1NO4 A;  5GTI E;  3AE9 C;  1HF9 A;  1ZW0 A;  2FYU E;  5APW A;  3TGU J;  1Q86 Q;  3L75 G;  1KV4 A;  1KYO I;  4GDO A;  1Q82 Q;  1JY3 N;  2WSE H;  4UB6 H;  1IK9 A;  3G71 P;  1VF5 B;  2BEQ D;  2ZYG A;  3H1H D;  3V4Q A;  3CCJ P;  1LGH B;  1Z56 A;  1RQU A;  2O1J A;  3O6Q A;  5CCG D;  2JJL A;  1LWU C;  4WY4 B;  2HPC A;  1L0L K;  1AQT A;  2E75 D;  2FBW C;  2KUB A;  3H1K E;  4WB4 A;  3MHV A;  1NTZ G;  4ZNC A;  2ZT9 B;  3GG2 A;  1OVR A;  3T97 B;  3I5C A;  2IYO A;  3KZI H;  3PLN A;  3RK3 E;  1EQ7 A;  1EXI A;  3HE4 B;  1IC2 A;  1SLQ A;  1YBK A;  2QSI A;  3H32 A;  2ZYD A;  3R4Y A;  5KAF E;  3V2R A;  3RL0 C;  2M5A A;  4N78 D;  3GW6 A;  3H1K D;  3VN0 A;  2PRR A;  5CCH D;  2N1T B;  3CMA P;  1JB0 J;  1VF5 C;  5KAI H;  1ZME C;  4ZKU A;  3CCU P;  1L0L E;  1LTA C;  2GUV A;  2OGU A;  3LID A;  2KP8 A;  1OW7 A;  2MJZ A;  1UII A;  4XE5 B;  2JWD A;  4H44 B;  1S5L H;  3CLQ A;  3L71 G;  1FS0 E;  4WY4 D;  2Q3E A;  2ZFC A;  1OMI A;  3AE8 C;  1BGY D;  4U3F G;  1H8A A;  1USE A;  5AW0 B;  1FOS F;  1SQV K;  1SFC D;  2ZXE B;  3O8Z A;  1OW6 A;  4NPF X;  1M1K Q;  5GTH H;  1VQ8 P;  1YJ9 P;  2A06 E;  4PJ0 H;  1SFC B;  4Y99 C;  3CCS P;  1OIP A;  1HGZ A;  3L73 D;  1BCC E;  3B71 A;  2JDI H;  2KLU A;  3IF4 A;  1NKZ B;  2WVR A;  4H0L D;  5CCH C;  2HPC B;  5KTB A;  4PD4 D;  5L8R J;  2HOD A;  2OYO A;  3CWB G;  3CCV P;  2IDB A;  3PTZ A;  1KMI Z;  1JMM A;  2HOD B;  1KD1 Q;  1NOH A;  4PV1 C;  3W67 A;  1L0N G;  1KYO E;  1X22 A;  2D2C B;  1AVO A;  2WMM A;  3CXH D;  3OAK A;  3AEA C;  1ZV8 A;  2Y9Z A;  1L2P A;  1JMB A;  3CX5 E;  4YPC A;  4ASW A;  1FAV A;  2A06 D;  2Q9I A;  4K3A A;  1FZB A;  3BCC E;  1FJK A;  1PPJ D;  4Y99 B;  3PRJ A;  4NPE A;  5CJ4 A;  1FZE A;  3GLM A;  1AFO A;  3L70 G;  1BE3 G;  4JYC A;  1NU1 J;  2FFD C;  3MD0 A;  4OGQ B;  2XNX A;  1P84 D;  1ZXG A;  4HJG H;  3S9O A;  3UIA A;  2PAJ A;  1RF0 C;  3HTK B;  3EFG A;  2IPP A;  3USS A;  2B89 A;  1PPJ E;  1S9K E;  1IJD B;  3H1J D;  3G3Z A;  2O3J A;  1BDC A;  2H88 C;  3CX5 D;  3QWO C;  1LWU A;  1SS1 A;  1PFI A;  1SP4 A;  4ASV A;  3TGU D;  2KB7 P;  1W5C E;  2OYH B;  4Y28 J;  4YXD C;  2BCC D;  1PGQ A;  2J59 M;  1JUN A;  1KQF B;  4OVN F;  3RK3 C;  1FC2 C;  4HH2 A;  2IBZ D;  3A0H E;  1BCC J;  5KLI B;  2IFM A;  2KIK A;  1K04 A;  3BCC G;  2FFD B;  1FZA A;  1AA0 A;  1AVY A;  1CZQ A;  1KIL E;  1R5L A;  1BGY E;  1T3U A;  1WT6 A;  2E74 D;  2FXO A;  2KK7 A;  2WWW A;  3GHG A;  1PP9 G;  1G1I A;  3FWN A;  4M3L A;  5TJH A;  3RBX A;  1JY3 P;  3L74 D;  3T97 A;  2K88 A;  1L4A C;  3SWF A;  4L76 A;  3CD6 P;  3HE4 A;  3RL0 B;  1E79 H;  1NVO A;  3N7N A;  2N1T C;  1ZR4 A;  3CC7 P;  2GA1 A;  5K5G B;  1K05 A;  1GW3 A;  2E42 A;  2QVA A;  2J58 A;  1NU1 E;  3E1R A;  1VQK P;  3I56 P;  3H1K J;  4DCK A;  3CC4 P;  4W7Z A;  1ZN5 A;  3MIW A;  4EI2 A;  2M0B A;  3EWK A;  1LT9 A;  1EZV I;  4I2L C;  2R3C A;  3MUD A;  3QH9 A;  3WU2 H;  4LC1 A;  3IR9 A;  1ZP0 C;  1L4A B;  1NTM K;  1P84 H; 
#chains in the Genus database with same CATH homology
 3KYQ A;  3HD7 C;  1HVV A;  5AVS B;  5BU5 A;  1GL2 B;  1X9V A;  2KLV A;  2YKP A;  5CCH D;  1N7S A;  3V2N A;  5AW6 B;  1KFM A;  1M1J A;  2WSC H;  1HBW A;  2PP6 A;  3VYI A;  2P7J A;  1KIL A;  1L0N K;  2C0X A;  3KDP B;  4EOT A;  1M7L A;  1JCD A;  1RE3 A;  1N73 B;  4WBA A;  1HUC A;  1LTT C;  3A2A A;  1SVF A;  2WPS A;  3H32 B;  2NPS C;  3HTK A;  3NMD A;  1RE4 C;  1N7L A;  1X79 B;  2W27 A;  3L4F A;  4N6J A;  4B86 A;  2POH A;  2YO3 A;  4C7R A;  3HUS A;  2CPS A;  2KOG A;  3V4W A;  1RF1 C;  1GL2 D;  3RK3 D;  3RK2 C;  2L5G B;  1LT9 B;  1RY3 A;  5KLV K;  1DEB A;  5AW9 B;  4C7N B;  1JTH B;  2M8R A;  3TK1 A;  1ZR2 A;  5AVT B;  1LTG C;  1MUU A;  4C7N A;  3B5N A;  1WRG A;  3L37 A;  1IFM A;  1CI6 A;  1JY2 N;  1OXZ A;  1URQ C;  3M0D A;  4KHX A;  1LTS C;  1NTK K;  3TSI A;  2R32 A;  3GHG B;  2H8P D;  4GKG A;  5CJ0 A;  3CI9 A;  5KJ7 A;  2P67 A;  3E1I A;  3SWY A;  1FZC B;  2Q3I A;  2GM4 A;  5APS A;  1LTJ C;  2Q5U A;  5BU8 B;  3MTU E;  3M9Q A;  3L35 A;  1JCC A;  3MGN A;  2O01 H;  1IFI A;  2O1K A;  2WPQ A;  1LTI C;  5AW4 B;  3VOP A;  5KJ7 D;  1LTJ B;  1HTL C;  1IO4 A;  1S9K D;  5CCG A;  5AW2 B;  1N73 C;  3C9I A;  1GD2 E;  2BAS A;  2OAR A;  1JY3 O;  2NPS B;  3V2P A;  1SFC C;  3BVH A;  1KZU B;  1FBM A;  1IFN A;  3RK2 D;  3VP9 A;  1N7S D;  3P7K A;  3P8C D;  2OYH A;  1J1D B;  2YKO A;  5CMZ A;  2YNY A;  5BVZ A;  5APQ A;  1ZLL A;  1GL2 A;  4AQR D;  1G1J A;  4WY4 C;  2R5D A;  3OJA B;  2HG5 D;  2OYI B;  1DH3 A;  5APU A;  4C46 A;  2CPB A;  2P1J A;  5AVX B;  1GU4 A;  3U59 A;  3BRT B;  1URQ D;  1YTZ T;  5AW1 B;  1FZC C;  3RK3 B;  1AQ5 A;  5APT A;  3R2P A;  2XDJ A;  5APY A;  1GDT A;  2OYI C;  4XA4 A;  1OWA A;  4DOJ A;  4I6M C;  3V2Q A;  5AVU B;  2N9B A;  3M91 A;  3IFM A;  3NFQ A;  4W7Y A;  3NXS A;  3M06 A;  1NU1 K;  2KSJ A;  1LWU B;  1G2C B;  3M9B A;  3TNU B;  4ZKP A;  3HD7 D;  4JYB A;  5AW3 B;  2IX7 C;  5AVR B;  3A3Y B;  2HLO A;  1GK6 A;  1M1J B;  5APX A;  1L4A D;  1KIL D;  1VPC A;  2E43 A;  2I1J A;  1FJP A;  1HGV A;  4IFM A;  4O9B A;  1N86 A;  4AYC A;  3VMZ A;  2FYZ A;  1CSB A;  1JY2 O;  4N3Y B;  4RES B;  2QM7 A;  1GW4 A;  1JTH A;  1IFJ A;  2OYH C;  3P8M C;  3RL0 D;  1MZ9 A;  2JEE A;  3A7O A;  1J2J B;  2WSF H;  1JNM A;  1SFC A;  1JO5 A;  2H7H A;  1SQP K;  2OYI A;  1QL1 A;  3B5N D;  1NWQ A;  1G2C A;  2R5B A;  1N73 A;  1HJB A;  5CCG C;  1FZF A;  1FZC A;  1GK4 A;  2C9L Y;  5CHX A;  2A45 H;  3KQG A;  3VMX A;  1MV8 A;  1GZL A;  1FOS E;  4N78 E;  4WY4 A;  3HD7 B;  1GL2 C;  4LGD E;  2H43 A;  1SQX K;  5AVQ B;  3A5T A;  1LTJ A;  2QM8 A;  3HE5 A;  3U1A A;  1J1E B;  1CW5 A;  2WT7 A;  3B5N B;  3L36 A;  3EQ2 A;  3VP8 A;  1NTZ K;  3P8C E;  5APV A;  3M0A A;  3HRN A;  5AVV B;  3B8E B;  1URQ A;  2VRS A;  3M0D C;  2Q7C A;  1GU5 A;  1GTW A;  2Z4E A;  4HYT B;  1E5W A;  2WZ7 A;  1A02 J;  2M3B A;  2XU6 A;  2XV5 A;  3B5N C;  1T3J A;  4EIJ A;  3VMY A;  2IFN A;  2Z5I A;  1RF1 B;  1HWT C;  1RF1 A;  4W80 A;  1XTC C;  3LW5 H;  1YTZ I;  1NAF A;  2XKM A;  4LLH A;  2KYV A;  2C0W A;  5AVZ B;  3BAT A;  1FDM A;  4AUW A;  3NTN A;  1KFN A;  1T8Z A;  2WT7 B;  1MFZ A;  2WIT A;  3M9H A;  3LIE A;  2W6A A;  3BRV B;  2FYU K;  5KJ7 C;  3TYY A;  1T2K C;  1VDF A;  3N4X A;  4OH8 B;  5AW8 B;  2P2U A;  1KQL A;  3HUS B;  2I1K A;  2N1T D;  3V5B A;  1IFD A;  1N7S C;  3RK2 B;  1XTG B;  2GUS A;  2C9N Y;  3P32 A;  1JY2 P;  1N2D C;  2YMY A;  1J1E C;  3H6P A;  1HH0 A;  2FXM A;  1FOS F;  2WTY A;  1X8Y A;  1NHL A;  3U1C A;  4IFF A;  3HUS C;  2NPS D;  5AVY B;  1YYC A;  1KIL B;  1CI6 B;  1RE4 A;  1A02 F;  1FZG A;  2NPS A;  4DZO A;  2A45 I;  3VTP C;  3OA7 A;  1LTB C;  3II6 A;  4I1L A;  1RE3 C;  4GIF A;  2WPR A;  3BAS A;  1KIL C;  1QL2 A;  1M1J C;  4GT1 A;  3HE5 B;  2HYN A;  1T2K D;  5AW7 B;  1DX7 A;  1RF0 A;  3HD7 A;  1H89 A;  1W2E A;  1SQQ K;  2FFD A;  3PP5 A;  4JF7 A;  2LKM A;  1LT9 C;  2YKQ A;  5AVW B;  3TNU A;  1H88 A;  1FU1 A;  1SQB K;  4IFD K;  1NH4 A;  2XZR A;  5AW5 B;  3WMM 0;  2A45 G;  2W6B A;  2Z5H A;  2N1T A;  2HFE D;  2YO2 A;  3CL3 D;  1NKN A;  1L4A A;  5CCH A;  2FKW B;  3KPE A;  1URQ B;  1N7S B;  1JOC A;  3GHG C;  1J1D C;  1NO4 A;  5APW A;  1JY3 N;  2WSE H;  1IK9 A;  3V4Q A;  1LGH B;  1Z56 A;  2O1J A;  5CCG D;  2JJL A;  1LWU C;  4WY4 B;  2HPC A;  1L0L K;  4WB4 A;  3I5C A;  1EQ7 A;  3HE4 B;  1IC2 A;  1SLQ A;  3H32 A;  3V2R A;  3RL0 C;  4N78 D;  3VN0 A;  2N1T B;  4ZKU A;  1LTA C;  2GUV A;  3LID A;  2KP8 A;  2MJZ A;  4XE5 B;  3CLQ A;  4WY4 D;  2ZFC A;  1H8A A;  5AW0 B;  1SQV K;  3O8Z A;  1SFC D;  2ZXE B;  4Y99 C;  1SFC B;  1HGZ A;  5CCH C;  1NKZ B;  2HPC B;  5KTB A;  2HOD A;  1JMM A;  2HOD B;  1NOH A;  3OAK A;  1ZV8 A;  1FAV A;  2Q9I A;  1FZB A;  1FJK A;  4Y99 B;  5CJ4 A;  1AFO A;  1FZE A;  4JYC A;  2FFD C;  3MD0 A;  2XNX A;  3UIA A;  2PAJ A;  1RF0 C;  3HTK B;  3EFG A;  2IPP A;  1S9K E;  1IJD B;  3G3Z A;  1PFI A;  1LWU A;  1SP4 A;  2KB7 P;  1JUN A;  2OYH B;  2J59 M;  3RK3 C;  4HH2 A;  2IFM A;  2FFD B;  1FZA A;  1T3U A;  1CZQ A;  1WT6 A;  3GHG A;  4M3L A;  2WWW A;  1G1I A;  1JY3 P;  3T97 A;  1L4A C;  3SWF A;  3HE4 A;  3RL0 B;  3N7N A;  2N1T C;  1ZR4 A;  1GW3 A;  2E42 A;  2J58 A;  4W7Z A;  1ZN5 A;  3MIW A;  1LT9 A;  4I2L C;  2R3C A;  3MUD A;  4LC1 A;  3IR9 A;  1L4A B;  1NTM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...