2WT7B

Crystal structure of the bzip heterodimeric complex mafb:cfos bound to dna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
90
structure length
90
Chain Sequence
DQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKSEKLAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords PROTO-ONCOGENE PROTEIN C-FOS
publication title Design of a bZIP Transcription Factor with Homo/Heterodimer-Induced DNA-Binding Preference.
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wt7B00
1YYCA 1S9KD 4JYCA 5AW9B 3L36A 1GK4A 2P2UA 1MUUA 4KHXA 3VMZA 1T2KC 3O8ZA 1SP4A 2R5BA 1G2CB 2BASA 5AVXB 2P7JA 3HE5A 2QM7A 3P32A 1HWTC 2P67A 1H8AA 2WTYA 1H89A 2IPPA 1GU5A 1NAFA 2KP8A 3V4QA 1CI6B 3VN0A 4I6MC 3HE4B 3T97A 2WPRA 1DH3A 5AW1B 1MV8A 3V4WA 2R3CA 1GK6A 2R32A 4JYBA 2E42A 2XZRA 5AW5B 5AW7B 4RESB 1GD2E 3M0DA 1A02F 3TNUA 3P8MC 3TNUB 2N9BA 5AVTB 5APTA 4C46A 1HUCA 1MFZA 2YNYA 5AVSB 3TYYA 1J2JB 3P7KA 3MD0A 2ZFCA 4GT1A 5AVVB 5AW3B 5AW6B 3VMYA 5AVYB 1CSBA 3MGNA 3M0AA 5AVWB 4GKGA 4AUWA 4HYTB 3A5TA 4LC1A 1CI6A 2QM8A 2W6AA 5CMZA 1KQLA 3HE4A 1SLQA 5APVA 2YO3A 5AVRB 2Q7CA 3I5CA 3M9BA 3L35A 3UIAA 4AYCA 1GZLA 5AVZB 4AQRD 5APQA 2VRSA 2ZXEB 3A2AA 2C9LY 5APUA 5AVQB 2E43A 2W27A 3LIEA 1NWQA 1FOSE 2Q3IA 5APXA 2Q5UA 2WPQA 2XV5A 4C7NB 3OAKA 1IO4A 2C9NY 5AW4B 2Z5HA 3M91A 3SWFA 3KQGA 3KDPB 2WPSA 3NMDA 1GTWA 2Z5IA 1H88A 4DZOA 1HJBA 3TK1A 4EOTA 1X8YA 3A7OA 3M06A 1OWAA 3NFQA 2JJLA 1JUNA 3V5BA 5APSA 3HTKA 5AW8B 5AVUB 2WWWA 2H7HA 1GU4A 1HBWA 1CZQA 1OXZA 3B8EB 3HE5B 4I2LC 4M3LA 3NTNA 1T2KD 2WT7A 3A3YB 2WT7B 1FAVA 2XU6A 1JNMA 3LIDA 5AW2B 4C7NA 5AW0B 5APYA 3VTPC 3VYIA 3VMXA 3IR9A 3NXSA 3L37A 1A02J 2R5DA 4XE5B 2YO2A 4B86A 1S9KE 1FOSF 3M9HA 5APWA
chains in the Genus database with same CATH superfamily
4Z1MH 1KILA 3D6ZA 1L0NJ 2WMMA 1EZVI 1VQPP 1VQ7P 3CXHH 3O8ZA 2R3SA 4H13B 1SQPJ 3A0HE 2ZAEB 1CW5A 1XTCC 1ZRTD 2AXTE 2JR8A 3HRNA 3V4QA 2OARA 3T97A 3L73J 2BCCG 2E42A 1X9VA 1Y8AA 5KLVJ 3W68A 2IYPA 2KSEA 1Q86Q 1BGYG 3RK3B 1VQ5P 3HUSA 1VQOP 1YBKA 3MTUE 2HODB 3MP7B 4N78D 1VQMP 2WSCH 1URQC 2HFED 4UB6H 3HD7D 5APVA 5AVRB 4IFMA 1NTZK 1K9MQ 1GZLA 1SQQJ 5AVZB 3V2NA 3A2AA 1NJIQ 3CCSP 1JCDA 2AEMA 1GL2B 2KNCA 1KN7A 2Q3IA 1M1JB 3RL0B 3TSIA 2M5AB 1VQ6P 4H0LD 1IO4A 4LLHA 3CX5D 2A45I 2E5YA 2QJKC 1KQGB 1SFCB 3PJSK 3BRTB 2PAJA 3CCJP 3Q1MA 3HTKA 1QGKB 4PD4H 2A45H 5AW0B 4WY4D 3H32B 1LTAC 3I56P 1E5WA 4TT3H 1IFDA 1RF0A 3SFDC 1FBMA 1PPJG 3WU2E 1SP4A 2KB7P 2KS1B 1NTKJ 1L0LE 5B5EH 1HWTC 1KFNA 3VOPA 1QX8A 2OTLP 3Q2YA 2LXCB 5CBOA 3AE4C 3N7NA 3IF4A 3L71E 3BASA 3TGUG 5AW6B 1BE3J 1ZXGA 4A7PA 1VQNP 2KLUA 3PP5A 5B66E 4OGQB 2YKQA 3JSVC 1SQBK 2JKVA 2BEQD 1EXJA 1M8OB 2DW3A 1UIIA 3OJAB 1AJYA 1KZUB 3GHGC 1LWUC 3GF7A 4U3FD 2OYIC 2Q9IA 4C7NA 1KB9E 3H1JG 3U59A 5APYA 1RE4A 1HGZA 3VMAA 1SQXJ 1L4AD 1J1DB 2FFDC 3MHVA 3B71A 1AQ5A 2FYUD 1DD4A 2GUVA 4BXLA 2QM7A 2N1TB 1S2EA 3CC7P 1H8AA 1NU1J 1U7JA 1NTMG 1KILC 3H1HE 1NAFA 2KP8A 3GMAA 1S1CX 1PP9J 1MV8A 3RK3E 1YQ3C 2M3BA 3L75J 3TNUB 5AVTB 2PFXA 1EZVD 3RL0g 2M0BA 1P84I 3CXHE 5KLVK 3AEFC 3L72E 2Y0DA 3FX0A 3CWBE 3HUSC 2ZYAA 4YTPC 2QSIA 1FC2C 5AVQB 3TF5A 5CHXA 2CPSA 3S1KA 3V2QA 1R8EA 3AE7C 3OAKA 4GODA 1TU3F 3TK1A 1WRGA 1JMMA 1BGYD 3CI9A 2HR3A 4Y99B 4YXWH 2A06G 5GTIH 3Q5PA 3NTNA 2WT7B 2XU6A 2FBWC 1GW3A 3G3ZA 1GDTA 1HTLC 3VTPC 2R5DA 3R2PA 3II6A 1RF1A 2YO2A 3AE2C 3A0HH 4JQ0D 3I55P 1RH5B 4D6TJ 2W8ZA 3CCEP 1RF0C 1USEA 1Z56A 2IPPA 3E1IA 4R4LA 5H2FH 4PD4E 2NZ2A 4N3YB 3FXEA 1MZ9A 3LW5H 1L0NE 2D2CC 3L71J 1HJ0A 1N2DC 3E7KA 5AVSB 1VF5D 4QMAA 1SQPE 1MFTA 1HF9A 3RK2C 1IZNB 3AEGC 1FS0E 3KYQA 5B5EE 4LC1A 2W6AA 3FWLA 1KQLA 3BCCD 3MUDA 1UIXA 1SQVJ 2Q7CA 3M9BA 2ITAA 5KLVE 2ZXEB 1S3JA 2W27A 3ITKA 3LIEA 2WPVB 1NTZJ 4GDOA 2Q5UA 1KMIZ 1D7MA 1ZN5A 1L0LG 4BWNA 3NMDA 2Z5IA 3HD7A 1EQ7A 5APSA 3L70D 1SQQE 1M56D 3B5NA 3AECC 3CCVP 4DJGA 2J59M 1LTJA 1A02J 5EFWB 1KC8Q 4B86A 1S9KE 3WU2H 1MKMA 3IFMA 1OZHA 1URQB 3L36A 1YJ9P 1VDFA 3WUTA 4ZKUA 1NHLA 3HE5A 3P32A 1SQXK 2L91A 1M7LA 2YXQB 1WT6A 2K88A 1RHZB 3P8CD 1YQ4C 4WY4A 1JB0J 5AW1B 1DH3A 3V4WA 4JYBA 3CMAP 1DX7A 1IK7A 1IK9A 1LJ2A 2QJKB 4UB8H 5APTA 2GUSA 2YNYA 4H44C 1KYOE 1NTKE 3D70A 3L74D 2KYVA 1QVGO 1YJNP 3KZIE 3CWBJ 1LP1A 1SLQA 3VP9A 2KSJA 2K3RA 3H1IG 2OTJP 5B66H 1EXIA 5DJTB 1WMKA 1Q90D 4DCKA 1LT9A 3H1KJ 4L73A 2V7QJ 1NTMD 2PRRA 3AE8C 1KB9I 2C9NY 2M3EA 1IFMA 3M91A 3SSUA 2NPSC 1P84D 1SQBJ 2ZVOB 1NAYA 1ZR4A 3AE1C 1BE3E 3H1HG 1HGVA 3NFQA 5CJ0A 2JJLA 1PZQA 2Y0CA 1KB9H 2P10A 3F89A 1OXZA 2QIWA 3JC22 3PRJA 2FYUG 2GA1A 4NPEA 1ZMEC 2ZT9D 1FDOA 3H1LD 1JTHB 1RY3A 2BEZF 3VP8A 3L72G 4ZNCA 4ASVA 3ABVC 1G2CB 2BASA 1RF1C 1H0TB 3CXHI 2BCCJ 3S9OA 1LT1A 2LXBA 4LGDE 1VL2A 1H89A 5GTIE 2ZT9C 1BGYJ 1CI6B 2WSEJ 3U1CA 1SQXE 4ZKPA 2XZRA 2A06D 4RESB 1L4AA 3CPWO 2L5GB 5KKZC 4K3AA 1YJWP 4GT1A 5AVVB 3GHGB 3RGUA 1LWUB 2QRXA 1NU1E 2KUBA 3C8VA 5CMZA 2OYIB 2OYHA 2WSFH 1PP9E 5H2FE 2G3AA 4CPGA 4AQRD 4K35A 2E43A 3L75E 3MUDC 1GL2A 2FFDB 1SQVK 2M5AA 2Z5HA 4JPZB 1SS1A 2JEEA 2ZJSE 1Q81Q 2E76D 2FXPA 1KILB 1IFPA 1SFCA 2QE7H 4WVZA 3B5ND 1JUNA 1NKZB 2A45G 2LKMA 2OGUA 1L0NG 1M90Q 1AV1A 3HD7C 4PD4I 3L37A 1SQPG 4XE5B 3T97B 1LNQA 1FZGA 3B5NC 1FZAA 4NPDA 2IX7C 3WUVA 1T3JA 2KS1A 1LTJC 3HUSB 3TDKA 3L73G 4H0LC 4EI2A 1OMIA 1LGHB 1N7SA 4EYYQ 1L0LD 1AA0A 2WSEH 2H8PD 2WSSH 2O01H 4KJMA 5KAFH 2B89A 1T3UA 4HH2A 3TGUJ 3BCCG 2C0WA 1AFOA 1GD2E 2I1JA 1X0TA 3KXDA 1HUCA 1BSHA 2KNCB 4WY4C 1AVYA 1ZV8A 4D6TE 2FY8A 1T6AA 1RE3A 4BRYA 4AUWA 2IBZE 1Y47A 1HVVA 3HE4A 3H25A 1OW7A 2W90A 5KJ7A 1J1EC 3QH9A 2YIUC 2K37A 3O6QA 1PGPA 1YTZI 3CMEP 3L70G 1EDIA 4UB8E 1LT9C 4W7ZA 1JY2P 4RJTA 2O3JA 1QLED 2V4HA 4EOTA 1SQVE 1OWAA 3MIWA 3H1JJ 3FWNA 1BCCJ 2O01N 5AW8B 5AVUB 1HBWA 2OTKE 2E75D 1N73A 3LIDA 1NTZE 2D2CB 4RO0A 4YXDC 3SWKA 3H1ID 1KB9D 2ZYGA 2FXOA 3RK2B 1QL2A 4H13D 1NTMJ 2E75C 2Q1KA 1KYOI 1OVVA 2P67A 4RKUJ 4JBZA 3L74G 4H13C 3H1HD 3A0BH 3SWYA 1GK6A 1VQKP 1KYOH 1JY3O 3TNUA 4IFDK 3TYYA 1ZLLA 3KZIH 1OW8A 2B87A 4IL6E 3W67A 1PIXA 1L4AC 2J58A 3CXHD 1EC5A 1E79H 3L72D 5L8RJ 2IZ1A 2JP3A 1GL2D 3E1RA 5APQA 3V2PA 3C9IA 2FKWB 2QA4P 3RL0D 3USSA 2KOGA 3Q3DA 1YIJP 2K9JA 4W80A 2OYHC 4C7NB 1KILE 2CPBA 5AW4B 2HPCA 1SFCD 1KV4A 4HB1A 2H88C 1N7LA 3RL0C 4GOFA 3H1LG 3H1KE 4MN4C 3IN6A 4M3LA 2WT7A 1JMBA 2N9YB 3D71A 3G9RA 2IDBA 4H44B 1FOSF 1SQBE 3M9HA 3CD6P 1YYCA 1NU1G 1ZR2A 2KK7A 1N7SD 5AVXB 4PV1D 2FXMA 2MKVA 3D6YA 2JDIH 1DEBA 3VN0A 1IC2A 4PD4D 2R32A 3FGAD 1N7SC 1JY2N 2NPSB 3H6PA 4PV1C 2LR2A 3M0DA 3CCQP 1L0ND 2KXPB 4C7RA 3P7KA 2ZFCA 1X22A 1SQPD 2BCCE 4WBAA 3MGNA 5AVWB 3A5TA 5KJ7D 4XA4A 1BGYE 3UIAA 1T8ZA 5BVZA 3M9QA 5KAFE 4OWFA 3CCUP 3L73D 4GIFA 5KLVD 1M1KQ 2P1JA 3EFFK 5APXA 5KJ7C 2JWAA 1RF1B 3KDPB 2Q6QA 1AVOA 5KLIC 1K05A 3A7OA 3BRVB 2ZT9B 3V6IA 1ZP0C 2P58A 4DT0A 1VF5C 2B9BA 5K5GB 1G1IA 2QG4A 1CZQA 2CK3H 1SQQD 3Q5SA 1W2EA 1JNMA 3GW6A 5KKZB 5BU8B 1YITP 3PLNA 4D6TG 3EFGA 1PGJA 2Y9YA 1S9KD 1N73C 3RBXA 4IOIH 3VMZA 1K73Q 4L76A 1X79B 1JY3P 2PGDA 4EDFA 2IBZI 5BU5A 3RBZA 1PPJE 1NTMK 2RKLA 5CCGA 3L71G 2R3CA 2IYOA 1QL1A 3PH0A 1GMJA 2N9BA 1RE4C 1DD3A 3H1IJ 4WWIA 2UWJE 4PJ0E 3MD0A 2GM4A 3MZWB 5AW3B 1KYOD 5E79H 1NTKD 4U7JA 5AVYB 1N86A 1Q7YQ 2JO1A 4Y28J 4XFJA 1IFNA 1K04A 1NTZG 2E74D 4U3FJ 3HD7B 3TGUE 3A0BE 3B5NB 1NWQA 1USDA 1PGOA 4W7YA 1LTJB 3KQGA 3AEBC 2E74C 4H0LB 3GF3A 3G6EP 2FYUJ 4IL6X 3CC2P 1NGMB 1KD1Q 2H7HA 2J5UA 3HE5B 3AE5C 3IAOA 4YPCA 2HYNA 4WY4B 1NYHA 1FZEA 1BDDA 5AW9B 1FZCA 1GK4A 3SFEC 1DIPA 1KORA 2Q3EA 3H1JE 1NOHA 1IFJA 1BCCE 1J1EB 3QWOC 4I7ZC 1YHQP 2YIUB 1JY2O 1LP1B 2WPRA 3GG2A 1SQXD 1LT9B 1NTME 2QVAA 3CC4P 1FZFA 4IL6H 3CWBG 1S4XA 2WVRA 1LWUA 3AE3C 2YXRB 3M0DC 4HJGH 1NU1D 2FYNC 3L35A 1BSNA 1IFIA 1PP9D 1SQBG 2FFDA 2WPQA 2HODA 3AEEC 2QJYC 2E75B 2YMKA 1JY3N 4ZMDA 1L0LK 2WPSA 2KIKA 1JM0A 3Q5RA 2E5TA 2V7QH 5GTHE 3A3YB 1M1JA 3AEDC 1VPCA 1URQD 2A06E 3S4RA 1DEEG 3F5HA 4JYCA 4I1LA 4WB4A 3K5BA 1L4AB 1FE6A 1N8RQ 2G8YA 2R5BA 1OX3A 1ZRTE 2P7JA 1R5SA 1JCCA 5CCGD 3BCCJ 1GU5A 2W6JH 3B4SA 3H32A 1S5LE 3FXDA 2E76C 1XTGB 3CLQA 2OYHB 4N6JA 2AXCA 2QJPC 5AW5B 5AW7B 1YTZT 5CCGC 4N78E 5M1BA 3OA7A 5KLVG 3M0AA 4D6TD 4HYTB 2QM8A 1OFCX 2IBZD 3L70J 2YKOA 2ZXXA 2VRSA 2JWDA 3CCRP 1PFIA 1FOSE 3AE6C 3CX5E 3L71D 1Y9BA 2K1AA 1SQQG 1OW6A 5KTBA 5CCHA 1H88A 1NH4A 4DZOA 5E79E 3JCUE 2XNXA 2I8DA 1SQVD 1QVFO 2Y9ZA 3HTKB 1ZOYC 3B8EB 1N7SB 4PV1B 2FYUK 3VYIA 4ASWA 1NTZD 2OQQA 1R5LA 2HLOA 3KHUA 3GLMA 1PGQA 1MUUA 3L74J 1EDJA 2O1JA 2W83C 2RH0A 1BDCA 5KAIH 1LTIC 4BRYB 1FZCC 4DOJA 4I6MC 3HE4B 1NTKG 2AEFA 2WZ7A 2POHA 1OIPA 1VQLP 3N4XA 4PJ0H 4TLFA 3O6QB 3P8MC 5KLIB 3EQ2A 3PTZA 4C46A 1J2JB 3G71P 2N1TA 1VF5B 3CCMP 1SVFA 4R4MA 1GW4A 2MJZA 2R44A 3RK3D 1S72P 2C9LY 1YI2P 1BE3G 1FJPA 1N73B 3H1IE 4EIJA 5CJ4A 3H1LJ 1FDMA 1BCCG 1KILD 1KFMA 1GTWA 3RK3C 3CWBD 2YKPA 4U3FE 1RQVA 2M8RA 1OVUA 3H1KD 2OYOA 1L0NK 3VMXA 3IR9A 1SQPK 1GL2C 2I1KA 1SQBD 1M1JC 2FYUE 3LW5J 1SQXG 2B87B 2K9YA 1KQSO 2SPZA 1SFCC 1FDIA 2H43A 3AE9C 1ZW0A 2KI7B 2IFMA 5TJHA 2NPSA 2QEXP 1EZVE 2E74B 1VQ4P 1P84H 1PP9G 2K9JB 2O1KA 3EWKA 2HG5D 2RN0A 5TISH 1SQQK 3L75G 2IZ0A 2BCCD 2HPCB 4JF7A 2YO3A 3I5CA 2FYZA 4UB6E 1S5LX 5APUA 1VQ8P 2NRGA 1NO4A 5CCHD 3WMM0 3CCLP 1X8YA 4I7ZB 4OGQD 5GTHH 3V5BA 1L0LJ 2W6BA 1RE3C 2AXTH 2WQYC 2D2CD 4I2LC 5CCHC 1U7MA 1Q82Q 1EDKA 3NXSA 3RK2D 1PL5A 4GOEA 3KPEA 4OGQC 1NTKK 5C39A 2WITA 2P2UA 3CL3D 3C1LA 2FYNB 1W5CE 1S5LH 3PHLA 3BATA 1PPJD 2XDJA 2QJYB 3L73E 2IBZG 1URQA 1QEXA 1A02F 1U57A 2N1TD 2XKMA 1MFZA 3V2RA 2YMYA 3CX5I 1J1DC 1NVOA 3ZDMA 3BCCE 4GKGA 5KAIE 1HH0A 3R4YA 1IJDB 2N1TC 1JOCA 4IFFA 3CX5H 3OW2O 3TGUD 3U1AA 1LTSC 1SQVG 1OVRA 1KQFB 3SWFA 3JCUH 1M57D 2ZVNB 1HJBA 2KZIA 3M06A 3L70E 2E76B 2Z4EA 1EDLA 2QJPB 1T2KD 1W2BO 2AEJA 1JEKA 3H1HJ 4H44D 1L2PA 1KTMA 1RQUA 1PV3A 1FJKA 5APWA 1JO5A 2B88A 1FU1A 1NU1K 1BE3D 4KHXA 1T2KC 1VQ9P 4L74A 1G1JA 2PP6A 3H1JD 4OVNF 1BCCD 2WTYA 2KZJA 1FZBA 3L72J 3P8CE 1NKNA 4Y99C 4L75A 3BVHA 2NPSD 4OH8B 1JTHA 4KT0J 2WSFJ 4HKZH 1G2CA 3WUUA 3L74E 4NPFX 3L4FA 1H0TA 4U3FG 3G4SP 3VMYA 1CSBA 1CI6A 2WSCJ 1Q2NA 1LTGC 2ZYDA 4AYCA 1K8AQ 2H89C 2XV5A 3GHGA 2IFNA 1AQTA 1P84E 3H1KG 5CBNA 4O9BA 2OYIA 2RMZA 5TISE 1FZCB 1LTTC 2WWWA 1GU4A 5DJUB 2Y0EA 2C0XA 1FAVA 3L75D 1EZVG 5AW2B 3AEAC 1LTBC 2XNDH 2KLVA 3H1LE 2O01J
chains in the Genus database with same CATH topology
1YYCA 3IFMA 1KILA 1URQB 3L36A 1ZR2A 1MUUA 1VDFA 3O8ZA 1N7SD 4ZKUA 1NHLA 2O1JA 5AVXB 3HE5A 3P32A 1SQXK 1CW5A 1XTCC 1M7LA 1LTIC 2FXMA 1WT6A 1FZCC 3HRNA 4DOJA 3V4QA 1DEBA 3VN0A 4I6MC 1IC2A 3HE4B 3P8CD 2OARA 3T97A 4WY4A 1DH3A 2WZ7A 5AW1B 3V4WA 2R32A 4JYBA 2POHA 2E42A 1N7SC 1X9VA 1JY2N 3N4XA 1DX7A 2NPSB 3H6PA 1IK9A 3M0DA 3P8MC 5APTA 2GUSA 3RK3B 3EQ2A 4C46A 2YNYA 3HUSA 4C7RA 1J2JB 3MTUE 3P7KA 2N1TA 2ZFCA 2HODB 2KYVA 4N78D 2WSCH 4WBAA 1URQC 3MGNA 5AVWB 3A5TA 2HFED 5KJ7D 4XA4A 3VP9A 1SLQA 3HD7D 2KSJA 5APVA 5AVRB 1SVFA 4IFMA 3UIAA 1GW4A 2MJZA 1NTZK 1T8ZA 5BVZA 3M9QA 1GZLA 5AVZB 1LT9A 3RK3D 3V2NA 2C9LY 3A2AA 4GIFA 1JCDA 1FJPA 1GL2B 2P1JA 2Q3IA 5APXA 1N73B 5KJ7C 1M1JB 3RL0B 3TSIA 4EIJA 5CJ4A 1IO4A 2C9NY 4LLHA 1IFMA 3M91A 1FDMA 2NPSC 1RF1B 2A45I 1KILD 1KFMA 3KDPB 1GTWA 1ZR4A 3RK3C 1HGVA 3A7OA 3BRVB 3NFQA 5CJ0A 1SFCB 2JJLA 3BRTB 2PAJA 2YKPA 3HTKA 1G1IA 2M8RA 1CZQA 1OXZA 1W2EA 2A45H 1JNMA 5AW0B 4WY4D 1L0NK 3VMXA 3H32B 3IR9A 5BU8B 1LTAC 1SQPK 1E5WA 3EFGA 1IFDA 1JTHB 1RF0A 1GL2C 1RY3A 1S9KD 2I1KA 1FBMA 3VP8A 1N73C 1M1JC 3VMZA 1SP4A 2KB7P 1G2CB 2BASA 1RF1C 1X79B 1JY3P 1HWTC 4LGDE 1KFNA 3VOPA 5BU5A 1H89A 1SFCC 1NTMK 5CCGA 1CI6B 2H43A 3U1CA 2R3CA 4ZKPA 2XZRA 2IFMA 4RESB 2NPSA 1L4AA 2L5GB 1QL1A 3N7NA 2N9BA 1RE4C 3BASA 2O1KA 3MD0A 4GT1A 2HG5D 5AVVB 2GM4A 3GHGB 1LWUB 5AW3B 5AW6B 5AVYB 1N86A 1SQQK 2HPCB 5CMZA 1IFNA 2OYIB 4JF7A 2OYHA 2YO3A 2WSFH 3I5CA 2FYZA 3PP5A 3HD7B 4AQRD 5APUA 2YKQA 2E43A 3B5NB 1SQBK 1NWQA 1GL2A 2FFDB 1SQVK 1NO4A 4W7YA 5CCHD 2Z5HA 3WMM0 1LTJB 3KQGA 2JEEA 3OJAB 1X8YA 1KILB 1KZUB 1SFCA 3GHGC 3B5ND 1JUNA 1LWUC 3V5BA 1NKZB 2W6BA 2A45G 1RE3C 2H7HA 2LKMA 3HE5B 4I2LC 5CCHC 2OYIC 2Q9IA 4C7NA 3U59A 5APYA 3HD7C 3NXSA 3RK2D 3L37A 1RE4A 1HGZA 4XE5B 2HYNA 3KPEA 4WY4B 1L4AD 1FZGA 3B5NC 1NTKK 1FZAA 1J1DB 1FZEA 2WITA 2FFDC 5AW9B 1FZCA 2IX7C 1GK4A 2P2UA 3CL3D 1T3JA 1AQ5A 1LTJC 1NOHA 1IFJA 2GUVA 3HUSB 2QM7A 2N1TB 1LGHB 1N7SA 1H8AA 1J1EB 2WSEH 2H8PD 1KILC 1NAFA 1JY2O 2KP8A 2O01H 3BATA 2WPRA 2XDJA 1T3UA 1MV8A 4HH2A 2M3BA 1URQA 1LT9B 2C0WA 1AFOA 1GD2E 1A02F 2N1TD 1FZFA 2XKMA 3TNUB 5AVTB 2I1JA 1HUCA 1MFZA 3V2RA 2YMYA 4WY4C 1ZV8A 1LWUA 1J1DC 1RE3A 4AUWA 4GKGA 5KLVK 1HH0A 3M0DC 1HVVA 1IJDB 3HE4A 3L35A 5KJ7A 3HUSC 1IFIA 2N1TC 1JOCA 4IFFA 1J1EC 5AVQB 3U1AA 1LTSC 5CHXA 2FFDA 1YTZI 2CPSA 2WPQA 3V2QA 2HODA 3OAKA 1LT9C 1JY3N 4W7ZA 3SWFA 1JY2P 1L0LK 2WPSA 1HJBA 3TK1A 4EOTA 1WRGA 1JMMA 3M06A 1OWAA 3MIWA 3CI9A 4Y99B 2Z4EA 5AW8B 5AVUB 1HBWA 3NTNA 1T2KD 3A3YB 2WT7B 2XU6A 1N73A 1GW3A 3LIDA 1M1JA 1VPCA 3G3ZA 1GDTA 1HTLC 3VTPC 2R5DA 3R2PA 3II6A 1RF1A 1URQD 2YO2A 1FJKA 5APWA 1JO5A 3RK2B 1QL2A 4JYCA 4I1LA 4WB4A 1FU1A 1L4AB 1NU1K 4KHXA 1T2KC 2R5BA 1G1JA 2P7JA 2PP6A 1JCCA 5CCGD 2P67A 1RF0C 2WTYA 1Z56A 2IPPA 3E1IA 1GU5A 1FZBA 3P8CE 1NKNA 3H32A 4Y99C 1XTGB 3CLQA 2OYHB 4N3YB 3BVHA 2NPSD 4OH8B 3SWYA 4N6JA 1GK6A 1JTHA 5AW5B 5AW7B 1YTZT 1MZ9A 3LW5H 1JY3O 5CCGC 3TNUA 1N2DC 1G2CA 4IFDK 5AVSB 3L4FA 3TYYA 4N78E 1ZLLA 3RK2C 3OA7A 3VMYA 1CSBA 3KYQA 3M0AA 1L4AC 2J58A 4HYTB 4LC1A 1CI6A 2QM8A 2W6AA 1KQLA 3MUDA 2Q7CA 3M9BA 2YKOA 1LTGC 4AYCA 1GL2D 5APQA 3V2PA 2VRSA 2ZXEB 3C9IA 2FKWB 3RL0D 2W27A 3LIEA 2KOGA 2OYHC 4W80A 1FOSE 1PFIA 2Q5UA 2XV5A 3GHGA 2IFNA 4C7NB 1ZN5A 2CPBA 5AW4B 4O9BA 5KTBA 2HPCA 3NMDA 1SFCD 5CCHA 2Z5IA 1H88A 2OYIA 1NH4A 4DZOA 1FZCB 1N7LA 3RL0C 1LTTC 3HD7A 2XNXA 1EQ7A 5APSA 3HTKB 2WWWA 1GU4A 3B5NA 3B8EB 4M3LA 1N7SB 2WT7A 2C0XA 1FAVA 5AW2B 2FYUK 2J59M 3VYIA 1LTJA 1LTBC 1A02J 2KLVA 4B86A 1S9KE 2HLOA 1FOSF 3M9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYC A;  1S9K D;  4JYC A;  5AW9 B;  3L36 A;  1GK4 A;  2P2U A;  1MUU A;  4KHX A;  3VMZ A;  1T2K C;  3O8Z A;  1SP4 A;  2R5B A;  1G2C B;  2BAS A;  5AVX B;  2P7J A;  3HE5 A;  2QM7 A;  3P32 A;  1HWT C;  2P67 A;  1H8A A;  2WTY A;  1H89 A;  2IPP A;  1GU5 A;  1NAF A;  2KP8 A;  3V4Q A;  1CI6 B;  3VN0 A;  4I6M C;  3HE4 B;  3T97 A;  2WPR A;  1DH3 A;  5AW1 B;  1MV8 A;  3V4W A;  2R3C A;  1GK6 A;  2R32 A;  4JYB A;  2E42 A;  2XZR A;  5AW5 B;  5AW7 B;  4RES B;  1GD2 E;  3M0D A;  1A02 F;  3TNU A;  3P8M C;  3TNU B;  2N9B A;  5AVT B;  5APT A;  4C46 A;  1HUC A;  1MFZ A;  2YNY A;  5AVS B;  3TYY A;  1J2J B;  3P7K A;  3MD0 A;  2ZFC A;  4GT1 A;  5AVV B;  5AW3 B;  5AW6 B;  3VMY A;  5AVY B;  1CSB A;  3MGN A;  3M0A A;  5AVW B;  4GKG A;  4AUW A;  4HYT B;  3A5T A;  4LC1 A;  1CI6 A;  2QM8 A;  2W6A A;  5CMZ A;  1KQL A;  3HE4 A;  1SLQ A;  5APV A;  2YO3 A;  5AVR B;  2Q7C A;  3I5C A;  3M9B A;  3L35 A;  3UIA A;  4AYC A;  1GZL A;  5AVZ B;  4AQR D;  5APQ A;  2VRS A;  2ZXE B;  3A2A A;  2C9L Y;  5APU A;  5AVQ B;  2E43 A;  2W27 A;  3LIE A;  1NWQ A;  1FOS E;  2Q3I A;  5APX A;  2Q5U A;  2WPQ A;  2XV5 A;  4C7N B;  3OAK A;  1IO4 A;  2C9N Y;  5AW4 B;  2Z5H A;  3M91 A;  3SWF A;  3KQG A;  3KDP B;  2WPS A;  3NMD A;  1GTW A;  2Z5I A;  1H88 A;  4DZO A;  1HJB A;  3TK1 A;  4EOT A;  1X8Y A;  3A7O A;  3M06 A;  1OWA A;  3NFQ A;  2JJL A;  1JUN A;  3V5B A;  5APS A;  3HTK A;  5AW8 B;  5AVU B;  2WWW A;  2H7H A;  1GU4 A;  1HBW A;  1CZQ A;  1OXZ A;  3B8E B;  3HE5 B;  4I2L C;  4M3L A;  3NTN A;  1T2K D;  2WT7 A;  3A3Y B;  2WT7 B;  1FAV A;  2XU6 A;  1JNM A;  3LID A;  5AW2 B;  4C7N A;  5AW0 B;  5APY A;  3VTP C;  3VYI A;  3VMX A;  3IR9 A;  3NXS A;  3L37 A;  1A02 J;  2R5D A;  4XE5 B;  2YO2 A;  4B86 A;  1S9K E;  1FOS F;  3M9H A;  5APW A; 
#chains in the Genus database with same CATH topology
 4Z1M H;  1KIL A;  3D6Z A;  1L0N J;  2WMM A;  1EZV I;  1VQP P;  1VQ7 P;  3CXH H;  3O8Z A;  2R3S A;  4H13 B;  1SQP J;  3A0H E;  2ZAE B;  1CW5 A;  1XTC C;  1ZRT D;  2AXT E;  2JR8 A;  3HRN A;  3V4Q A;  2OAR A;  3T97 A;  3L73 J;  2BCC G;  2E42 A;  1X9V A;  1Y8A A;  5KLV J;  3W68 A;  2IYP A;  2KSE A;  1Q86 Q;  1BGY G;  3RK3 B;  1VQ5 P;  3HUS A;  1VQO P;  1YBK A;  3MTU E;  2HOD B;  3MP7 B;  4N78 D;  1VQM P;  2WSC H;  1URQ C;  2HFE D;  4UB6 H;  3HD7 D;  5APV A;  5AVR B;  4IFM A;  1NTZ K;  1K9M Q;  1GZL A;  1SQQ J;  5AVZ B;  3V2N A;  3A2A A;  1NJI Q;  3CCS P;  1JCD A;  2AEM A;  1GL2 B;  2KNC A;  1KN7 A;  2Q3I A;  1M1J B;  3RL0 B;  3TSI A;  2M5A B;  1VQ6 P;  4H0L D;  1IO4 A;  4LLH A;  3CX5 D;  2A45 I;  2E5Y A;  2QJK C;  1KQG B;  1SFC B;  3PJS K;  3BRT B;  2PAJ A;  3CCJ P;  3Q1M A;  3HTK A;  1QGK B;  4PD4 H;  2A45 H;  5AW0 B;  4WY4 D;  3H32 B;  1LTA C;  3I56 P;  1E5W A;  4TT3 H;  1IFD A;  1RF0 A;  3SFD C;  1FBM A;  1PPJ G;  3WU2 E;  1SP4 A;  2KB7 P;  2KS1 B;  1NTK J;  1L0L E;  5B5E H;  1HWT C;  1KFN A;  3VOP A;  1QX8 A;  2OTL P;  3Q2Y A;  2LXC B;  5CBO A;  3AE4 C;  3N7N A;  3IF4 A;  3L71 E;  3BAS A;  3TGU G;  5AW6 B;  1BE3 J;  1ZXG A;  4A7P A;  1VQN P;  2KLU A;  3PP5 A;  5B66 E;  4OGQ B;  2YKQ A;  3JSV C;  1SQB K;  2JKV A;  2BEQ D;  1EXJ A;  1M8O B;  2DW3 A;  1UII A;  3OJA B;  1AJY A;  1KZU B;  3GHG C;  1LWU C;  3GF7 A;  4U3F D;  2OYI C;  2Q9I A;  4C7N A;  1KB9 E;  3H1J G;  3U59 A;  5APY A;  1RE4 A;  1HGZ A;  3VMA A;  1SQX J;  1L4A D;  1J1D B;  2FFD C;  3MHV A;  3B71 A;  1AQ5 A;  2FYU D;  1DD4 A;  2GUV A;  4BXL A;  2QM7 A;  2N1T B;  1S2E A;  3CC7 P;  1H8A A;  1NU1 J;  1U7J A;  1NTM G;  1KIL C;  3H1H E;  1NAF A;  2KP8 A;  3GMA A;  1S1C X;  1PP9 J;  1MV8 A;  3RK3 E;  1YQ3 C;  2M3B A;  3L75 J;  3TNU B;  5AVT B;  2PFX A;  1EZV D;  3RL0 g;  2M0B A;  1P84 I;  3CXH E;  5KLV K;  3AEF C;  3L72 E;  2Y0D A;  3FX0 A;  3CWB E;  3HUS C;  2ZYA A;  4YTP C;  2QSI A;  1FC2 C;  5AVQ B;  3TF5 A;  5CHX A;  2CPS A;  3S1K A;  3V2Q A;  1R8E A;  3AE7 C;  3OAK A;  4GOD A;  1TU3 F;  3TK1 A;  1WRG A;  1JMM A;  1BGY D;  3CI9 A;  2HR3 A;  4Y99 B;  4YXW H;  2A06 G;  5GTI H;  3Q5P A;  3NTN A;  2WT7 B;  2XU6 A;  2FBW C;  1GW3 A;  3G3Z A;  1GDT A;  1HTL C;  3VTP C;  2R5D A;  3R2P A;  3II6 A;  1RF1 A;  2YO2 A;  3AE2 C;  3A0H H;  4JQ0 D;  3I55 P;  1RH5 B;  4D6T J;  2W8Z A;  3CCE P;  1RF0 C;  1USE A;  1Z56 A;  2IPP A;  3E1I A;  4R4L A;  5H2F H;  4PD4 E;  2NZ2 A;  4N3Y B;  3FXE A;  1MZ9 A;  3LW5 H;  1L0N E;  2D2C C;  3L71 J;  1HJ0 A;  1N2D C;  3E7K A;  5AVS B;  1VF5 D;  4QMA A;  1SQP E;  1MFT A;  1HF9 A;  3RK2 C;  1IZN B;  3AEG C;  1FS0 E;  3KYQ A;  5B5E E;  4LC1 A;  2W6A A;  3FWL A;  1KQL A;  3BCC D;  3MUD A;  1UIX A;  1SQV J;  2Q7C A;  3M9B A;  2ITA A;  5KLV E;  2ZXE B;  1S3J A;  2W27 A;  3ITK A;  3LIE A;  2WPV B;  1NTZ J;  4GDO A;  2Q5U A;  1KMI Z;  1D7M A;  1ZN5 A;  1L0L G;  4BWN A;  3NMD A;  2Z5I A;  3HD7 A;  1EQ7 A;  5APS A;  3L70 D;  1SQQ E;  1M56 D;  3B5N A;  3AEC C;  3CCV P;  4DJG A;  2J59 M;  1LTJ A;  1A02 J;  5EFW B;  1KC8 Q;  4B86 A;  1S9K E;  3WU2 H;  1MKM A;  3IFM A;  1OZH A;  1URQ B;  3L36 A;  1YJ9 P;  1VDF A;  3WUT A;  4ZKU A;  1NHL A;  3HE5 A;  3P32 A;  1SQX K;  2L91 A;  1M7L A;  2YXQ B;  1WT6 A;  2K88 A;  1RHZ B;  3P8C D;  1YQ4 C;  4WY4 A;  1JB0 J;  5AW1 B;  1DH3 A;  3V4W A;  4JYB A;  3CMA P;  1DX7 A;  1IK7 A;  1IK9 A;  1LJ2 A;  2QJK B;  4UB8 H;  5APT A;  2GUS A;  2YNY A;  4H44 C;  1KYO E;  1NTK E;  3D70 A;  3L74 D;  2KYV A;  1QVG O;  1YJN P;  3KZI E;  3CWB J;  1LP1 A;  1SLQ A;  3VP9 A;  2KSJ A;  2K3R A;  3H1I G;  2OTJ P;  5B66 H;  1EXI A;  5DJT B;  1WMK A;  1Q90 D;  4DCK A;  1LT9 A;  3H1K J;  4L73 A;  2V7Q J;  1NTM D;  2PRR A;  3AE8 C;  1KB9 I;  2C9N Y;  2M3E A;  1IFM A;  3M91 A;  3SSU A;  2NPS C;  1P84 D;  1SQB J;  2ZVO B;  1NAY A;  1ZR4 A;  3AE1 C;  1BE3 E;  3H1H G;  1HGV A;  3NFQ A;  5CJ0 A;  2JJL A;  1PZQ A;  2Y0C A;  1KB9 H;  2P10 A;  3F89 A;  1OXZ A;  2QIW A;  3JC2 2;  3PRJ A;  2FYU G;  2GA1 A;  4NPE A;  1ZME C;  2ZT9 D;  1FDO A;  3H1L D;  1JTH B;  1RY3 A;  2BEZ F;  3VP8 A;  3L72 G;  4ZNC A;  4ASV A;  3ABV C;  1G2C B;  2BAS A;  1RF1 C;  1H0T B;  3CXH I;  2BCC J;  3S9O A;  1LT1 A;  2LXB A;  4LGD E;  1VL2 A;  1H89 A;  5GTI E;  2ZT9 C;  1BGY J;  1CI6 B;  2WSE J;  3U1C A;  1SQX E;  4ZKP A;  2XZR A;  2A06 D;  4RES B;  1L4A A;  3CPW O;  2L5G B;  5KKZ C;  4K3A A;  1YJW P;  4GT1 A;  5AVV B;  3GHG B;  3RGU A;  1LWU B;  2QRX A;  1NU1 E;  2KUB A;  3C8V A;  5CMZ A;  2OYI B;  2OYH A;  2WSF H;  1PP9 E;  5H2F E;  2G3A A;  4CPG A;  4AQR D;  4K35 A;  2E43 A;  3L75 E;  3MUD C;  1GL2 A;  2FFD B;  1SQV K;  2M5A A;  2Z5H A;  4JPZ B;  1SS1 A;  2JEE A;  2ZJS E;  1Q81 Q;  2E76 D;  2FXP A;  1KIL B;  1IFP A;  1SFC A;  2QE7 H;  4WVZ A;  3B5N D;  1JUN A;  1NKZ B;  2A45 G;  2LKM A;  2OGU A;  1L0N G;  1M90 Q;  1AV1 A;  3HD7 C;  4PD4 I;  3L37 A;  1SQP G;  4XE5 B;  3T97 B;  1LNQ A;  1FZG A;  3B5N C;  1FZA A;  4NPD A;  2IX7 C;  3WUV A;  1T3J A;  2KS1 A;  1LTJ C;  3HUS B;  3TDK A;  3L73 G;  4H0L C;  4EI2 A;  1OMI A;  1LGH B;  1N7S A;  4EYY Q;  1L0L D;  1AA0 A;  2WSE H;  2H8P D;  2WSS H;  2O01 H;  4KJM A;  5KAF H;  2B89 A;  1T3U A;  4HH2 A;  3TGU J;  3BCC G;  2C0W A;  1AFO A;  1GD2 E;  2I1J A;  1X0T A;  3KXD A;  1HUC A;  1BSH A;  2KNC B;  4WY4 C;  1AVY A;  1ZV8 A;  4D6T E;  2FY8 A;  1T6A A;  1RE3 A;  4BRY A;  4AUW A;  2IBZ E;  1Y47 A;  1HVV A;  3HE4 A;  3H25 A;  1OW7 A;  2W90 A;  5KJ7 A;  1J1E C;  3QH9 A;  2YIU C;  2K37 A;  3O6Q A;  1PGP A;  1YTZ I;  3CME P;  3L70 G;  1EDI A;  4UB8 E;  1LT9 C;  4W7Z A;  1JY2 P;  4RJT A;  2O3J A;  1QLE D;  2V4H A;  4EOT A;  1SQV E;  1OWA A;  3MIW A;  3H1J J;  3FWN A;  1BCC J;  2O01 N;  5AW8 B;  5AVU B;  1HBW A;  2OTK E;  2E75 D;  1N73 A;  3LID A;  1NTZ E;  2D2C B;  4RO0 A;  4YXD C;  3SWK A;  3H1I D;  1KB9 D;  2ZYG A;  2FXO A;  3RK2 B;  1QL2 A;  4H13 D;  1NTM J;  2E75 C;  2Q1K A;  1KYO I;  1OVV A;  2P67 A;  4RKU J;  4JBZ A;  3L74 G;  4H13 C;  3H1H D;  3A0B H;  3SWY A;  1GK6 A;  1VQK P;  1KYO H;  1JY3 O;  3TNU A;  4IFD K;  3TYY A;  1ZLL A;  3KZI H;  1OW8 A;  2B87 A;  4IL6 E;  3W67 A;  1PIX A;  1L4A C;  2J58 A;  3CXH D;  1EC5 A;  1E79 H;  3L72 D;  5L8R J;  2IZ1 A;  2JP3 A;  1GL2 D;  3E1R A;  5APQ A;  3V2P A;  3C9I A;  2FKW B;  2QA4 P;  3RL0 D;  3USS A;  2KOG A;  3Q3D A;  1YIJ P;  2K9J A;  4W80 A;  2OYH C;  4C7N B;  1KIL E;  2CPB A;  5AW4 B;  2HPC A;  1SFC D;  1KV4 A;  4HB1 A;  2H88 C;  1N7L A;  3RL0 C;  4GOF A;  3H1L G;  3H1K E;  4MN4 C;  3IN6 A;  4M3L A;  2WT7 A;  1JMB A;  2N9Y B;  3D71 A;  3G9R A;  2IDB A;  4H44 B;  1FOS F;  1SQB E;  3M9H A;  3CD6 P;  1YYC A;  1NU1 G;  1ZR2 A;  2KK7 A;  1N7S D;  5AVX B;  4PV1 D;  2FXM A;  2MKV A;  3D6Y A;  2JDI H;  1DEB A;  3VN0 A;  1IC2 A;  4PD4 D;  2R32 A;  3FGA D;  1N7S C;  1JY2 N;  2NPS B;  3H6P A;  4PV1 C;  2LR2 A;  3M0D A;  3CCQ P;  1L0N D;  2KXP B;  4C7R A;  3P7K A;  2ZFC A;  1X22 A;  1SQP D;  2BCC E;  4WBA A;  3MGN A;  5AVW B;  3A5T A;  5KJ7 D;  4XA4 A;  1BGY E;  3UIA A;  1T8Z A;  5BVZ A;  3M9Q A;  5KAF E;  4OWF A;  3CCU P;  3L73 D;  4GIF A;  5KLV D;  1M1K Q;  2P1J A;  3EFF K;  5APX A;  5KJ7 C;  2JWA A;  1RF1 B;  3KDP B;  2Q6Q A;  1AVO A;  5KLI C;  1K05 A;  3A7O A;  3BRV B;  2ZT9 B;  3V6I A;  1ZP0 C;  2P58 A;  4DT0 A;  1VF5 C;  2B9B A;  5K5G B;  1G1I A;  2QG4 A;  1CZQ A;  2CK3 H;  1SQQ D;  3Q5S A;  1W2E A;  1JNM A;  3GW6 A;  5KKZ B;  5BU8 B;  1YIT P;  3PLN A;  4D6T G;  3EFG A;  1PGJ A;  2Y9Y A;  1S9K D;  1N73 C;  3RBX A;  4IOI H;  3VMZ A;  1K73 Q;  4L76 A;  1X79 B;  1JY3 P;  2PGD A;  4EDF A;  2IBZ I;  5BU5 A;  3RBZ A;  1PPJ E;  1NTM K;  2RKL A;  5CCG A;  3L71 G;  2R3C A;  2IYO A;  1QL1 A;  3PH0 A;  1GMJ A;  2N9B A;  1RE4 C;  1DD3 A;  3H1I J;  4WWI A;  2UWJ E;  4PJ0 E;  3MD0 A;  2GM4 A;  3MZW B;  5AW3 B;  1KYO D;  5E79 H;  1NTK D;  4U7J A;  5AVY B;  1N86 A;  1Q7Y Q;  2JO1 A;  4Y28 J;  4XFJ A;  1IFN A;  1K04 A;  1NTZ G;  2E74 D;  4U3F J;  3HD7 B;  3TGU E;  3A0B E;  3B5N B;  1NWQ A;  1USD A;  1PGO A;  4W7Y A;  1LTJ B;  3KQG A;  3AEB C;  2E74 C;  4H0L B;  3GF3 A;  3G6E P;  2FYU J;  4IL6 X;  3CC2 P;  1NGM B;  1KD1 Q;  2H7H A;  2J5U A;  3HE5 B;  3AE5 C;  3IAO A;  4YPC A;  2HYN A;  4WY4 B;  1NYH A;  1FZE A;  1BDD A;  5AW9 B;  1FZC A;  1GK4 A;  3SFE C;  1DIP A;  1KOR A;  2Q3E A;  3H1J E;  1NOH A;  1IFJ A;  1BCC E;  1J1E B;  3QWO C;  4I7Z C;  1YHQ P;  2YIU B;  1JY2 O;  1LP1 B;  2WPR A;  3GG2 A;  1SQX D;  1LT9 B;  1NTM E;  2QVA A;  3CC4 P;  1FZF A;  4IL6 H;  3CWB G;  1S4X A;  2WVR A;  1LWU A;  3AE3 C;  2YXR B;  3M0D C;  4HJG H;  1NU1 D;  2FYN C;  3L35 A;  1BSN A;  1IFI A;  1PP9 D;  1SQB G;  2FFD A;  2WPQ A;  2HOD A;  3AEE C;  2QJY C;  2E75 B;  2YMK A;  1JY3 N;  4ZMD A;  1L0L K;  2WPS A;  2KIK A;  1JM0 A;  3Q5R A;  2E5T A;  2V7Q H;  5GTH E;  3A3Y B;  1M1J A;  3AED C;  1VPC A;  1URQ D;  2A06 E;  3S4R A;  1DEE G;  3F5H A;  4JYC A;  4I1L A;  4WB4 A;  3K5B A;  1L4A B;  1FE6 A;  1N8R Q;  2G8Y A;  2R5B A;  1OX3 A;  1ZRT E;  2P7J A;  1R5S A;  1JCC A;  5CCG D;  3BCC J;  1GU5 A;  2W6J H;  3B4S A;  3H32 A;  1S5L E;  3FXD A;  2E76 C;  1XTG B;  3CLQ A;  2OYH B;  4N6J A;  2AXC A;  2QJP C;  5AW5 B;  5AW7 B;  1YTZ T;  5CCG C;  4N78 E;  5M1B A;  3OA7 A;  5KLV G;  3M0A A;  4D6T D;  4HYT B;  2QM8 A;  1OFC X;  2IBZ D;  3L70 J;  2YKO A;  2ZXX A;  2VRS A;  2JWD A;  3CCR P;  1PFI A;  1FOS E;  3AE6 C;  3CX5 E;  3L71 D;  1Y9B A;  2K1A A;  1SQQ G;  1OW6 A;  5KTB A;  5CCH A;  1H88 A;  1NH4 A;  4DZO A;  5E79 E;  3JCU E;  2XNX A;  2I8D A;  1SQV D;  1QVF O;  2Y9Z A;  3HTK B;  1ZOY C;  3B8E B;  1N7S B;  4PV1 B;  2FYU K;  3VYI A;  4ASW A;  1NTZ D;  2OQQ A;  1R5L A;  2HLO A;  3KHU A;  3GLM A;  1PGQ A;  1MUU A;  3L74 J;  1EDJ A;  2O1J A;  2W83 C;  2RH0 A;  1BDC A;  5KAI H;  1LTI C;  4BRY B;  1FZC C;  4DOJ A;  4I6M C;  3HE4 B;  1NTK G;  2AEF A;  2WZ7 A;  2POH A;  1OIP A;  1VQL P;  3N4X A;  4PJ0 H;  4TLF A;  3O6Q B;  3P8M C;  5KLI B;  3EQ2 A;  3PTZ A;  4C46 A;  1J2J B;  3G71 P;  2N1T A;  1VF5 B;  3CCM P;  1SVF A;  4R4M A;  1GW4 A;  2MJZ A;  2R44 A;  3RK3 D;  1S72 P;  2C9L Y;  1YI2 P;  1BE3 G;  1FJP A;  1N73 B;  3H1I E;  4EIJ A;  5CJ4 A;  3H1L J;  1FDM A;  1BCC G;  1KIL D;  1KFM A;  1GTW A;  3RK3 C;  3CWB D;  2YKP A;  4U3F E;  1RQV A;  2M8R A;  1OVU A;  3H1K D;  2OYO A;  1L0N K;  3VMX A;  3IR9 A;  1SQP K;  1GL2 C;  2I1K A;  1SQB D;  1M1J C;  2FYU E;  3LW5 J;  1SQX G;  2B87 B;  2K9Y A;  1KQS O;  2SPZ A;  1SFC C;  1FDI A;  2H43 A;  3AE9 C;  1ZW0 A;  2KI7 B;  2IFM A;  5TJH A;  2NPS A;  2QEX P;  1EZV E;  2E74 B;  1VQ4 P;  1P84 H;  1PP9 G;  2K9J B;  2O1K A;  3EWK A;  2HG5 D;  2RN0 A;  5TIS H;  1SQQ K;  3L75 G;  2IZ0 A;  2BCC D;  2HPC B;  4JF7 A;  2YO3 A;  3I5C A;  2FYZ A;  4UB6 E;  1S5L X;  5APU A;  1VQ8 P;  2NRG A;  1NO4 A;  5CCH D;  3WMM 0;  3CCL P;  1X8Y A;  4I7Z B;  4OGQ D;  5GTH H;  3V5B A;  1L0L J;  2W6B A;  1RE3 C;  2AXT H;  2WQY C;  2D2C D;  4I2L C;  5CCH C;  1U7M A;  1Q82 Q;  1EDK A;  3NXS A;  3RK2 D;  1PL5 A;  4GOE A;  3KPE A;  4OGQ C;  1NTK K;  5C39 A;  2WIT A;  2P2U A;  3CL3 D;  3C1L A;  2FYN B;  1W5C E;  1S5L H;  3PHL A;  3BAT A;  1PPJ D;  2XDJ A;  2QJY B;  3L73 E;  2IBZ G;  1URQ A;  1QEX A;  1A02 F;  1U57 A;  2N1T D;  2XKM A;  1MFZ A;  3V2R A;  2YMY A;  3CX5 I;  1J1D C;  1NVO A;  3ZDM A;  3BCC E;  4GKG A;  5KAI E;  1HH0 A;  3R4Y A;  1IJD B;  2N1T C;  1JOC A;  4IFF A;  3CX5 H;  3OW2 O;  3TGU D;  3U1A A;  1LTS C;  1SQV G;  1OVR A;  1KQF B;  3SWF A;  3JCU H;  1M57 D;  2ZVN B;  1HJB A;  2KZI A;  3M06 A;  3L70 E;  2E76 B;  2Z4E A;  1EDL A;  2QJP B;  1T2K D;  1W2B O;  2AEJ A;  1JEK A;  3H1H J;  4H44 D;  1L2P A;  1KTM A;  1RQU A;  1PV3 A;  1FJK A;  5APW A;  1JO5 A;  2B88 A;  1FU1 A;  1NU1 K;  1BE3 D;  4KHX A;  1T2K C;  1VQ9 P;  4L74 A;  1G1J A;  2PP6 A;  3H1J D;  4OVN F;  1BCC D;  2WTY A;  2KZJ A;  1FZB A;  3L72 J;  3P8C E;  1NKN A;  4Y99 C;  4L75 A;  3BVH A;  2NPS D;  4OH8 B;  1JTH A;  4KT0 J;  2WSF J;  4HKZ H;  1G2C A;  3WUU A;  3L74 E;  4NPF X;  3L4F A;  1H0T A;  4U3F G;  3G4S P;  3VMY A;  1CSB A;  1CI6 A;  2WSC J;  1Q2N A;  1LTG C;  2ZYD A;  4AYC A;  1K8A Q;  2H89 C;  2XV5 A;  3GHG A;  2IFN A;  1AQT A;  1P84 E;  3H1K G;  5CBN A;  4O9B A;  2OYI A;  2RMZ A;  5TIS E;  1FZC B;  1LTT C;  2WWW A;  1GU4 A;  5DJU B;  2Y0E A;  2C0X A;  1FAV A;  3L75 D;  1EZV G;  5AW2 B;  3AEA C;  1LTB C;  2XND H;  2KLV A;  3H1L E;  2O01 J; 
#chains in the Genus database with same CATH homology
 1YYC A;  3IFM A;  1KIL A;  1URQ B;  3L36 A;  1ZR2 A;  1MUU A;  1VDF A;  3O8Z A;  1N7S D;  4ZKU A;  1NHL A;  2O1J A;  5AVX B;  3HE5 A;  3P32 A;  1SQX K;  1CW5 A;  1XTC C;  1M7L A;  1LTI C;  2FXM A;  1WT6 A;  1FZC C;  3HRN A;  4DOJ A;  3V4Q A;  1DEB A;  3VN0 A;  4I6M C;  1IC2 A;  3HE4 B;  3P8C D;  2OAR A;  3T97 A;  4WY4 A;  1DH3 A;  2WZ7 A;  5AW1 B;  3V4W A;  2R32 A;  4JYB A;  2POH A;  2E42 A;  1N7S C;  1X9V A;  1JY2 N;  3N4X A;  1DX7 A;  2NPS B;  3H6P A;  1IK9 A;  3M0D A;  3P8M C;  5APT A;  2GUS A;  3RK3 B;  3EQ2 A;  4C46 A;  2YNY A;  3HUS A;  4C7R A;  1J2J B;  3MTU E;  3P7K A;  2N1T A;  2ZFC A;  2HOD B;  2KYV A;  4N78 D;  2WSC H;  4WBA A;  1URQ C;  3MGN A;  5AVW B;  3A5T A;  2HFE D;  5KJ7 D;  4XA4 A;  3VP9 A;  1SLQ A;  3HD7 D;  2KSJ A;  5APV A;  5AVR B;  1SVF A;  4IFM A;  3UIA A;  1GW4 A;  2MJZ A;  1NTZ K;  1T8Z A;  5BVZ A;  3M9Q A;  1GZL A;  5AVZ B;  1LT9 A;  3RK3 D;  3V2N A;  2C9L Y;  3A2A A;  4GIF A;  1JCD A;  1FJP A;  1GL2 B;  2P1J A;  2Q3I A;  5APX A;  1N73 B;  5KJ7 C;  1M1J B;  3RL0 B;  3TSI A;  4EIJ A;  5CJ4 A;  1IO4 A;  2C9N Y;  4LLH A;  1IFM A;  3M91 A;  1FDM A;  2NPS C;  1RF1 B;  2A45 I;  1KIL D;  1KFM A;  3KDP B;  1GTW A;  1ZR4 A;  3RK3 C;  1HGV A;  3A7O A;  3BRV B;  3NFQ A;  5CJ0 A;  1SFC B;  2JJL A;  3BRT B;  2PAJ A;  2YKP A;  3HTK A;  1G1I A;  2M8R A;  1CZQ A;  1OXZ A;  1W2E A;  2A45 H;  1JNM A;  5AW0 B;  4WY4 D;  1L0N K;  3VMX A;  3H32 B;  3IR9 A;  5BU8 B;  1LTA C;  1SQP K;  1E5W A;  3EFG A;  1IFD A;  1JTH B;  1RF0 A;  1GL2 C;  1RY3 A;  1S9K D;  2I1K A;  1FBM A;  3VP8 A;  1N73 C;  1M1J C;  3VMZ A;  1SP4 A;  2KB7 P;  1G2C B;  2BAS A;  1RF1 C;  1X79 B;  1JY3 P;  1HWT C;  4LGD E;  1KFN A;  3VOP A;  5BU5 A;  1H89 A;  1SFC C;  1NTM K;  5CCG A;  1CI6 B;  2H43 A;  3U1C A;  2R3C A;  4ZKP A;  2XZR A;  2IFM A;  4RES B;  2NPS A;  1L4A A;  2L5G B;  1QL1 A;  3N7N A;  2N9B A;  1RE4 C;  3BAS A;  2O1K A;  3MD0 A;  4GT1 A;  2HG5 D;  5AVV B;  2GM4 A;  3GHG B;  1LWU B;  5AW3 B;  5AW6 B;  5AVY B;  1N86 A;  1SQQ K;  2HPC B;  5CMZ A;  1IFN A;  2OYI B;  4JF7 A;  2OYH A;  2YO3 A;  2WSF H;  3I5C A;  2FYZ A;  3PP5 A;  3HD7 B;  4AQR D;  5APU A;  2YKQ A;  2E43 A;  3B5N B;  1SQB K;  1NWQ A;  1GL2 A;  2FFD B;  1SQV K;  1NO4 A;  4W7Y A;  5CCH D;  2Z5H A;  3WMM 0;  1LTJ B;  3KQG A;  2JEE A;  3OJA B;  1X8Y A;  1KIL B;  1KZU B;  1SFC A;  3GHG C;  3B5N D;  1JUN A;  1LWU C;  3V5B A;  1NKZ B;  2W6B A;  2A45 G;  1RE3 C;  2H7H A;  2LKM A;  3HE5 B;  4I2L C;  5CCH C;  2OYI C;  2Q9I A;  4C7N A;  3U59 A;  5APY A;  3HD7 C;  3NXS A;  3RK2 D;  3L37 A;  1RE4 A;  1HGZ A;  4XE5 B;  2HYN A;  3KPE A;  4WY4 B;  1L4A D;  1FZG A;  3B5N C;  1NTK K;  1FZA A;  1J1D B;  1FZE A;  2WIT A;  2FFD C;  5AW9 B;  1FZC A;  2IX7 C;  1GK4 A;  2P2U A;  3CL3 D;  1T3J A;  1AQ5 A;  1LTJ C;  1NOH A;  1IFJ A;  2GUV A;  3HUS B;  2QM7 A;  2N1T B;  1LGH B;  1N7S A;  1H8A A;  1J1E B;  2WSE H;  2H8P D;  1KIL C;  1NAF A;  1JY2 O;  2KP8 A;  2O01 H;  3BAT A;  2WPR A;  2XDJ A;  1T3U A;  1MV8 A;  4HH2 A;  2M3B A;  1URQ A;  1LT9 B;  2C0W A;  1AFO A;  1GD2 E;  1A02 F;  2N1T D;  1FZF A;  2XKM A;  3TNU B;  5AVT B;  2I1J A;  1HUC A;  1MFZ A;  3V2R A;  2YMY A;  4WY4 C;  1ZV8 A;  1LWU A;  1J1D C;  1RE3 A;  4AUW A;  4GKG A;  5KLV K;  1HH0 A;  3M0D C;  1HVV A;  1IJD B;  3HE4 A;  3L35 A;  5KJ7 A;  3HUS C;  1IFI A;  2N1T C;  1JOC A;  4IFF A;  1J1E C;  5AVQ B;  3U1A A;  1LTS C;  5CHX A;  2FFD A;  1YTZ I;  2CPS A;  2WPQ A;  3V2Q A;  2HOD A;  3OAK A;  1LT9 C;  1JY3 N;  4W7Z A;  3SWF A;  1JY2 P;  1L0L K;  2WPS A;  1HJB A;  3TK1 A;  4EOT A;  1WRG A;  1JMM A;  3M06 A;  1OWA A;  3MIW A;  3CI9 A;  4Y99 B;  2Z4E A;  5AW8 B;  5AVU B;  1HBW A;  3NTN A;  1T2K D;  3A3Y B;  2WT7 B;  2XU6 A;  1N73 A;  1GW3 A;  3LID A;  1M1J A;  1VPC A;  3G3Z A;  1GDT A;  1HTL C;  3VTP C;  2R5D A;  3R2P A;  3II6 A;  1RF1 A;  1URQ D;  2YO2 A;  1FJK A;  5APW A;  1JO5 A;  3RK2 B;  1QL2 A;  4JYC A;  4I1L A;  4WB4 A;  1FU1 A;  1L4A B;  1NU1 K;  4KHX A;  1T2K C;  2R5B A;  1G1J A;  2P7J A;  2PP6 A;  1JCC A;  5CCG D;  2P67 A;  1RF0 C;  2WTY A;  1Z56 A;  2IPP A;  3E1I A;  1GU5 A;  1FZB A;  3P8C E;  1NKN A;  3H32 A;  4Y99 C;  1XTG B;  3CLQ A;  2OYH B;  4N3Y B;  3BVH A;  2NPS D;  4OH8 B;  3SWY A;  4N6J A;  1GK6 A;  1JTH A;  5AW5 B;  5AW7 B;  1YTZ T;  1MZ9 A;  3LW5 H;  1JY3 O;  5CCG C;  3TNU A;  1N2D C;  1G2C A;  4IFD K;  5AVS B;  3L4F A;  3TYY A;  4N78 E;  1ZLL A;  3RK2 C;  3OA7 A;  3VMY A;  1CSB A;  3KYQ A;  3M0A A;  1L4A C;  2J58 A;  4HYT B;  4LC1 A;  1CI6 A;  2QM8 A;  2W6A A;  1KQL A;  3MUD A;  2Q7C A;  3M9B A;  2YKO A;  1LTG C;  4AYC A;  1GL2 D;  5APQ A;  3V2P A;  2VRS A;  2ZXE B;  3C9I A;  2FKW B;  3RL0 D;  2W27 A;  3LIE A;  2KOG A;  2OYH C;  4W80 A;  1FOS E;  1PFI A;  2Q5U A;  2XV5 A;  3GHG A;  2IFN A;  4C7N B;  1ZN5 A;  2CPB A;  5AW4 B;  4O9B A;  5KTB A;  2HPC A;  3NMD A;  1SFC D;  5CCH A;  2Z5I A;  1H88 A;  2OYI A;  1NH4 A;  4DZO A;  1FZC B;  1N7L A;  3RL0 C;  1LTT C;  3HD7 A;  2XNX A;  1EQ7 A;  5APS A;  3HTK B;  2WWW A;  1GU4 A;  3B5N A;  3B8E B;  4M3L A;  1N7S B;  2WT7 A;  2C0X A;  1FAV A;  5AW2 B;  2FYU K;  2J59 M;  3VYI A;  1LTJ A;  1LTB C;  1A02 J;  2KLV A;  4B86 A;  1S9K E;  2HLO A;  1FOS F;  3M9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...