2QM8A

Meab, a bacterial homolog of mmaa, in the nucleotide free form
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
326
structure length
320
Chain Sequence
b'TLPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase/ATPase
publication title Crystal structure and mutagenesis of the metallochaperone MeaB: insight into the causes of methylmalonic aciduria.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
total genus 118
structure length 320
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qm8A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2qm8A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qm8A02
4D2IA 1D9XA 3SOPA 3BXZA 3I3SR 2HEIA 4UNNA 2QAGA 5AVTB 2YWEA 2J0VA 2V1UA 1V43A 2XZPA 3GCGA 4DLTA 2IYLD 2KBEA 1FX0B 4JSYA 1R0ZA 2CL7X 2WOJA 1FQJA 4D4MA 5FTLA 1Y3AA 2ZSDA 2D7DA 3G0HA 2QP4A 4Q9KA 1GU4A 3NHBA 2QAGB 2JDIA 3IHLA 2ZRMA 2XU6A 3QENA 3ZIAA 5JLJA 4LJ5A 3LXRA 2WAYA 4ZDIA 4LK2A 1BMFA 4EAQA 2DYKA 5AVXB 4QJ4A 2FE4A 3QPUA 1SKQA 3B8HA 2XZRA 5AW7B 3HE5A 1IOZA 4JKYA 1CRPA 2QI9C 1N5LA 2ZRFA 3PJRA 1NN5A 1WP9A 5FOSA 2IBMA 1E4YA 2WKPA 3F3YA 4Q19A 2ZR9A 2FFAA 2QEQA 3QF7A 1RRPA 3P32A 3VN0A 2QQ0A 1XD9A 3KJGA 5GVSA 1G8HA 1AQUA 3RS2A 4XJXA 4D0GA 2W0MA 3CH5A 2CLDX 1NVWQ 1G7SA 3HE5B 1OYWA 2Z83A 4M1OA 3SYLA 2JJ2D 3B78A 3OEED 4YMWA 2C9CA 1ZRHA 3TQCA 1ZBDA 4G3XA 2GEDA 2OO7A 4OKSA 5FUYA 3TUZC 3QVUA 4XVQA 1TF5A 4BQSA 2GZAA 4ASUD 3UG7A 1JAIA 4ZCMA 1WBBA 2Z43A 2QTHA 5B58C 4MRRA 1M74A 4TYQA 5HR5A 3VMZA 4IHQA 1T5LA 2GK6A 4JL6A 3DEFA 2ZS9A 4EDHA 4XIGS 1EFRD 1YZQA 2A2ZA 2HT6A 3J81k 2O8BA 5E7IA 4LGMA 4CW7A 3AVOA 4O2RA 4GP7A 1X1RA 1S9KD 1UM8A 4B3GA 1GOTA 5AUPB 4DWJA 4LBWA 2JJ8A 3X1DA 2WHXA 1Y63A 1OH8A 1KI3A 1RW4A 2K5UA 3K0EA 4NYIQ 3WMGA 4I6MC 2JLVA 3IILA 2O8BB 3CKLA 5AW6B 3U7HB 1T2KC 4QBIA 3KXKA 1LB1B 4C46A 3CH4B 1Q3HA 5DO9A 5EE1A 1QVRA 3NBXX 1KTVA 2ZM5A 2C99A 5KHOC 3LX8A 5CYOA 4C2UA 3IEVA 1Z6GA 1A02F 4JYBA 1W5SA 4E09A 4HB2A 1W4CA 1EXMA 2W58A 2G0NA 3U7EB 2QP3A 4HB0A 1QG2A 2QU8A 2B7CA 3RHFA 1PZNA 2NG1A 1MO6A 1PJRA 4URYR 3L36A 1OV4A 1ZUNB 2IA5A 3VMFA 2IXGA 1E2LA 4MDFA 1GFIA 2HJGA 3IR9A 5B1NA 2DFTA 2VIIA 4IDPA 4FD2A 1SXJA 3OIUA 1CLUA 2KJQA 5CYPA 5DYGA 1CU1A 1EG7A 1I4LD 2JDID 3EX7C 3ZIAD 1D9ZA 1VCNA 4PHHA 4QBGB 3HR7A 5JWHA 1XCPA 1XEXA 4IJMA 5DISB 2ZUCA 2IXEA 3TMKA 1GU5A 1DVRA 2ZU0C 1B23P 1FAVA 1Z0DA 1I4TD 4KHZA 1SXJB 4RFSA 4TLDA 4OQLA 1DOAA 2CXXA 4OYHA 3D36A 4Q66C 5F3WB 4GPTA 2WJGA 2AKYA 1XEXB 1YRBA 4LCBA 4L8GA 2C98A 2WKQA 1W0KA 4B86A 2VHJA 4BIZA 2R44A 1SHKA 5TY0A 5JWOA 4UQOA 1QBKC 4RFSB 2GJKA 1F3OA 2HLDA 3RSOA 4FMCF 5KO2A 5LD2C 2QTFA 2KB0A 3AVTA 1KIMA 1MABA 3PUXA 2WWFA 1CF4A 4DDTA 1OH5A 2EQBA 3W3ZB 2P65A 4QOSA 1IQPA 4KBGA 4DSOA 2REOA 3IGFA 4JT4A 4LRWA 4PPGA 4F38A 1OXVA 2CDNA 4JMPA 4Q9IA 3T15A 4F7WA 1QF9A 1ZCAA 4P4SA 1KO1A 2PZFA 4ZKEA 4TL8A 1MABB 1VCMA 3VR4A 4D6PA 1RRFA 2NZ8A 1DG1G 3KJEA 4F91B 1TEVA 4E22A 1ZJ6A 4ZKIA 4ZPXA 3NXSA 1UEIA 2CLSA 1HUQA 2ZANA 4TMWA 3SFZA 4Q4LA 1KY2A 2YOFA 4P4SB 2QBYB 1MRSA 3ICQB 4X8OA 2R62A 4JZKA 1KNXA 4B74A 4HDOB 3U61B 1KK2A 2GHIA 3TKLA 2BV3A 4V0ME 2A5DA 3QQ5A 4M1SA 4CT5A 3A1SA 2NPFA 3Q72A 1XNJA 2V9PA 4PQFA 1SP4A 2FPLA 2YC4C 3KKQA 2F9LA 3FB4A 1O87A 1G3RA 2R6FA 3QBTA 3NKVA 4ILEA 3EIQA 1Z8FA 3RLFA 3H4MA 2BKUA 3MG9A 4UXJA 1LS1A 3TH5A 2E1RA 4F4JA 2B92A 3HE4A 2VP9A 3VR1A 2ZFCA 4B47A 5EZ5A 1OKKA 4XOIA 3OFND 3T34A 1HEIA 1KMQA 1ZM3A 4FINA 2WPRA 2WJVA 5B30A 1CRQA 4AQRD 3ZZTA 1W1WA 2X1VA 2ZSEA 3EZ9A 1FQKA 3K1JA 1TUIA 2JLRA 3CLVA 4OI1A 1FL9A 1YZNA 3HE4B 3B1VA 2A30A 1VG8A 2QMHA 3KKPA 2BBTA 3CM0A 2WVJA 3I8XA 2Q21A 2GRJA 1L4UA 2GETA 2OLJA 2ZI5A 1W0KD 2PH1A 2VP0A 2QN6A 5KYKA 3FKSA 1P4SA 3PV0A 2ODWA 2HF9A 3QVVA 3JZMA 3VR3A 1Z6XA 1QG4A 3W5IA 3AKDA 3DGEA 2VHCA 1IXMA 5B64A 2GXAA 1EWQA 1OH6A 4PC3A 3PEWA 5EUMA 1ZNXA 2ZETA 5P21A 2XGJA 1KJWA 3W8NA 4A82A 3NH6A 2XNDA 4W9MC 3GLFE 1NLZA 5EE9A 4LOAA 4B73A 1L4YA 5AUOB 3KL4A 3NHAA 2I3BA 2I4IA 1NSTA 5APQA 3W5JA 4QGGA 2XSZD 3E5HA 2G1JA 3AF2A 4QPJA 3Q8XB 2E9SA 3I4LA 3MD0A 5D3QA 2QT1A 3U6BA 4P33A 2O0HA 4B71A 2IYWA 3GJ4A 5E3HA 5AJWA 1GNQA 4RZUA 5LBIA 4RD1A 4DCVA 3THYA 1S3SA 3PEUA 2ECKA 1ZINA 1Z47A 1UEJA 4GCZA 2WJYA 3CNLA 4KYUA 2YWGA 3B1YA 4M9ZA 3CUEF 5JZVA 4URZR 4A6XA 2ONKA 4C2TA 4PFSA 3KQKA 3IHWA 1W7AA 1W48A 1XEWX 3ZZUA 3LXXA 2PLFA 1IJEA 5JECA 3THYB 1Z6AA 4TL9A 3K70D 1NBMA 1HT2E 1A2BA 1ZD1A 2O5VA 4BZQA 4FMTA 2ZPTX 1F48A 1EESA 4RCZA 3LRPA 4LX0A 721PA 1N6LA 2BKEA 3CX6A 3NTNA 2ZJZA 3O8DA 1A5TA 4QHTA 2WOOA 1LFDB 1H65A 1E2JA 1JQJC 2ZI6A 4M3LA 3IIMA 4M1TA 5EE3A 3T12A 1GIAA 3SU8A 5FBVB 2EYQA 4BFVA 2J59A 4OHZA 3GLHE 2IS1A 4PZZA 3AVYA 3W9YA 1OKKD 4IRUB 4D81A 5DYIA 4I1SA 1CR0A 4UXHA 5APUA 4JLOA 1XTJA 2ATXA 5SZHB 4XTRA 4OJQA 3U3JA 1LF0A 3X1YA 2O52A 1TMKA 4PZYA 3KQGA 2GZDA 3NIBA 2IEYA 4LJ7A 4W5WA 4DDUA 4DCNA 3QPVA 4Q1BA 1IN5A 2DFLA 3AVUA 1KZ7B 1E1QA 1HY3A 5BYKA 1UKEA 2QL6A 4PSAA 5AW5B 3QNUA 4NCKA 2OBMA 2YINC 3QY0A 4E03A 2BM1A 3FKSD 2GXSA 2NQ2C 3WBJA 2H7HA 2XB2A 4L9SA 4XWAA 5BN4A 1R10A 4IDQA 4N0DA 2QY9A 2Z4SA 4J0QA 2AXPA 3SC3A 2AFHE 3QKRA 3AKYA 2VP6A 1KK0A 2XNDD 2QE7A 5KPJA 1CR2A 3TGPA 3JVVA 3NDBB 1YKSA 1OXZA 1Z08A 1RIFA 3F0TA 2ZRJA 3Q85A 4NCIA 4KSCA 5CITA 1HWTC 4F4CA 1QZXA 1S1CA 2JLSA 2LWIA 3TLXA 2ZVQX 1BS1A 3QKRB 1DPFA 2P7JA 1XX6A 5KNBA 2AN9A 1JXOA 1R5OA 3N2IA 1A02J 1SZPA 2ZRGA 3AM1A 4TTRA 4D82A 1NIPA 3QG1A 1H8HA 1II9A 3QKTA 5CDFA 1HURA 1ZM7A 4A8JC 1W36C 2WWWA 2QM8A 2OT3B 1W4AA 3R7WA 3CIOA 3FMIA 5AW0B 2BBOA 1WXQA 4QHSA 2RGNA 3RC3A 4LV5B 4LPKA 1Q1ZA 3U3KA 1W4BA 2IF2A 3A3YB 2CK3A 1U99A 2ZRHA 3K09A 3ADCA 4NPHA 2H17A 2OCYC 3BB4A 2RGEA 3PENA 4XSHA 1P5ZB 3HDTA 4AG6A 1NBMD 3R7WB 5M04A 3U4QB 4PTLA 4GT1A 2ZR7A 4DLVA 1E9RA 1N6OA 4LI0A 4Q18A 2IEZA 3RANA 3WYFA 3AV0B 2NO6A 2BCGY 3FDIA 5AVUB 1DH3A 1SKYE 4ZO4A 1SULA 2D7CA 2CBZA 4TYYA 1BIFA 1OJLA 3I92A 1X8KA 3V9PA 3BGWA 3GJXC 4O25A 4JJKA 3WNDA 4TQAA 1QVAA 4EIWA 1OXTA 3B1XA 4JKIA 1G6HA 2XAUA 2FJUA 2XX3A 4PXAA 1MO3A 3GPLA 4GOXA 2E42A 4WZAE 4B3XA 1IBRA 2HYIC 3RRMA 3DKVA 3T5DA 4A1FA 3B1ZA 5IK2A 2AK2A 5HCIA 4JAUA 3B13B 3TUIC 1E1QD 5L3SA 1RC8A 3UXMA 2ATVA 4QKQA 4S35A 1E0AA 1IY1A 2Q5UA 1HH4A 1KJYA 1YVDA 5E7JA 4C30A 3UKDA 2Q3IA 4RD2A 1NN1A 1TADA 2FU5C 1G41A 2QG6A 3RS7A 3GFTA 1H88A 1VG1A 2PEYA 4QHYA 4C0AC 3I73A 2R6DA 2IK8A 3THOA 5L3SB 4A6PA 2YOGA 3CRVA 4JLMA 1XCGB 5AVRB 4HAYA 4BEJA 2ZI3A 3MMPA 1IXSB 3CF2A 5F98A 1XD2B 3M0AA 1N25A 4LYFA 4LV6A 2XZLA 1N6HA 2N1BA 1G3IA 2F1JA 2OG2A 2PT7A 1ZYUA 1QHHA 4PPNA 3TE6A 4OI0A 4AY2A 1FOSF 1HBWA 1NLFA 3PQCA 5ELXA 3VNVA 3L8ZA 3EWAA 2IL1A 4YONB 2DPXA 5H68A 2W83A 3BFVA 3NEYA 2PMDA 2Z5IA 3F5FA 4KVAA 1G4UR 3TRFA 1OXXK 1G5RA 1XTRA 1P3JA 2X8AA 4JL5A 5CK4A 3AGQA 4FWTA 4EQ6B 1QHHB 4M9SA 4O3MA 3QEOA 4HLUA 1F6BA 4MKGA 3MJHA 4UNQA 4Q48A 2FFHA 4GMXA 2CK3D 2D3WA 1SVMA 4N0EA 2CLCX 3EZ7A 1NP6A 4TL7A 4KITB 2AL7A 5TMPA 4U7DA 4UNPA 3T35A 1GTVA 4TT3D 4PAMA 2CHVA 3V4WA 2FFQA 2WZQA 1AZTA 5AVVB 3AUYA 4YC7A 3EZ6A 1VYTA 2FEMA 3ZVMA 2GCOA 3FE2A 4LBZA 1NAFA 1Z83A 3A1VA 4N3NA 1U9IA 4OI4A 4BECA 4KXFB 2JLZA 4JSTA 4JBYA 4HB4A 2FG5A 2WJHA 4F93B 2P3SA 3N5CA 4TMTA 3RNLA 1GILA 2HUPA 4AK9A 3PG5A 1OIWA 1R0YA 2GCOB 2YV5A 1S0UA 4V0OA 4A0RA 1KYIA 2FMXA 4MUBA 3TQFA 5EXSA 3K8YA 1Z0IA 4ESVA 1FTSA 1Z0FA 4NYMR 3WHKA 4OK5A 3U3MA 3ZDQA 4JIMA 4JAVA 1VCOA 2WTYA 3KXIA 4CT4B 4MGKR 1N5IA 4TQ9A 1VG9B 3UANA 3KQNA 3P1JA 1Z5ZA 4OI2A 1R5NA 5J47A 3L82B 2YJTD 4Q1AA 1XBTA 4TWZA 3K0CA 4TTPA 3VHLB 3AF0A 3ZLJA 3VFDA 2F55A 4UNRA 3EG5A 4B2LA 4GL2A 2W6IA 4I2LC 2PEZA 4R7ZA 5G3YA 2DWPA 2FZLA 3X1WA 1F2TA 1ZU4A 4OHYA 3FVQA 1LVGA 4QNRA 3GJ8A 3SEAA 2V3CC 1E0KA 1NY6A 4HLDA 4DIEA 1FUUA 2YO3A 4FMCB 4KLZA 1SGWA 2QTVB 4BFXA 3ICEA 1Q1BA 4EKDA 3O47A 3OAAA 1A82A 2HV8A 2NTYC 1X1SA 5SZKB 4M21A 2Q9CA 5C93A 2N46A 3QEJA 3SJZA 1F2TB 4FMDB 1XEWY 4IOMA 1GK4A 2WJIA 4KV9A 5G3ZA 1GRRA 3RYTC 2QENA 2WWXA 2WJJA 4HAUA 2G9NA 1LW7A 3LIEA 4B76A 1F5NA 4AG5A 1X86B 2Q9BA 1R8SA 4K46A 4MTXA 3B82A 3CPJB 4A4DA 2C96A 2EU8A 1KI7A 4PQRA 5EXPA 5H70A 3X1ZA 2GJ9A 2IS2A 5CB8A 4RCYA 3GFOA 3CX8A 2XNSA 1E1RA 1TUEA 3FKQA 4MGIR 1K8RA 3RWOA 4BLQA 4HYTB 1N0UA 4HAVA 4HB3A 5K8UA 2AWNA 5FBQB 1U8YA 2RAPA 4M8NE 3IKJA 4DJTA 1U94A 2GCNA 1DE0A 2ZVPX 5JJKA 3OHMA 1KK3A 3L0IB 3QE0A 2FA9A 3KKMA 3P8MC 5AVZB 2J9RA 4XD7A 1J99A 1D2EA 3Q7QA 2R8RA 1HJBA 2ZRIA 4B33A 4Z1MA 2RGAA 4MITA 3REFA 1DG3A 2C8VA 2IYYA 1DAEA 3ETLA 4AC9A 1I2MA 2UZ3A 3THWA 1N6RA 1U90A 1EWRA 1HYQA 2Q9AA 4V0MA 2OXCA 2WM9B 2ZXUA 3L8YA 4P4TA 4TZ0A 4EJSA 3BFXA 3I8SA 1M7HA 2HJVA 4C0QC 3IIKA 3WHLA 5LB4A 2FSGA 1IN6A 2H18A 3VR6A 1G7TA 4A92A 3UWKA 3PUZA 3LIDA 3CRQA 1T5IA 2GILA 5DLQC 3U7GA 3THWB 1E2KA 4ZKDA 3KUCA 5J4LA 1KI6A 3OIWA 2JLYA 1OE0A 3R9WA 2ZE5A 5EP2A 4EJSB 2OE2A 2ZREA 3UMSA 4LYAA 2F1IA 4EFLA 2E43A 1UKZA 3LNCA 1JR3D 3KDPB 3AF1A 2W6ID 2H5EA 3NH9A 4Q1FA 3VU9A 4AYXA 5APXA 2RGXA 1NJFA 1KI6B 4YQFA 5HKKA 4CZ2A 5E4FA 3E1SA 2OV2A 2OAP1 3R8FA 1UBEA 2CHQA 2REXB 4V0LA 4M9QA 3OAAD 5BW8A 4G1UC 3BORA 4DCSA 5HZKA 2Q7CA 1XJQA 2VO1A 3VU9B 3REGA 2GESA 3CWQA 1T3HA 2AWOA 3IBGA 1FW6A 1RRGA 2R5BA 4FW9A 2AK3A 2J87A 3OE7D 4OQXA 5LDDC 3K9GA 3OEHA 4OQMA 4ZI3A 2GEVA 5BN5A 1XTKA 1JEEA 4DXAA 3S1AA 3RC8A 4WBSA 4R71A 3ECCA 3IPXA 3IO5A 3C16C 2V55B 5C2JB 4FCTA 3HR8A 2C03A 4LJ9A 2PX3A 2ZE8A 4B3BA 2R2AA 2ZSAA 4TMKA 1G8PA 3DVLA 1E1RD 1KO8A 3TYYA 1S9HA 4ITRC 3VKGA 4UKDA 3S1AB 5BN3A 3TBKA 4Q7LA 1VTKA 1KSGA 3D31A 3GD7A 5AVWB 1GAJA 421PA 3L37A 1GL9B 3VAAA 3LLMA 3T06B 1COWD 1XD8A 4XD7D 3WYGA 4LUCA 4B2PA 1QHNA 4Z1MD 4LHZA 4UJ3A 2GA8A 1ZMXA 1AS3A 1XPUA 4JASA 3AF3A 4DHEA 4FMBB 2OESA 2ZTSA 5CIQA 5FH9A 4W5HA 3EPLA 3VHXA 3GJ6A 1BKDR 5KTYA 4LHYA 4I99A 2GF9A 4Q21A 3M1IA 2J46A 1AGPA 1KK1A 3MWJA 4TYNA 4KFSA 4DIDA 4LSGA 1G8FA 1NKTA 3A5TA 3UK6A 1AA9A 3AVQA 2ZI7A 4CDGA 3K70C 3Q5DA 1EX6A 2X2FA 2JJLA 5APVA 5JFGA 5L8VA 3FOZA 4Q9JA 1R6BX 2P5TB 2V54A 4I81A 2O8FA 3SZRA 3ZRVA 3FMFA 4WAUA 5HE8A 1QHXA 1WE2A 2GTPA 3CRW1 1P62B 3GLHA 4G0NA 4AWXA 2VHUA 3A8TA 3HWSA 4BFWA 1OSNA 1Z0JA 4IEEA 1GD2E 2OAQ1 1MH1A 3FGNA 5HKKD 1G18A 4KAXA 2KSQA 4E5UA 2O8FB 3IQXA 3Q3JB 2BMFA 3G82C 2H8KA 2HXYA 1BMFD 3GLHB 3M0EA 4NE2A 4WVFA 1FPMA 3DKPA 1VHTA 3TAUA 4DT1A 4FXPA 4HDQB 4DBLC 2CEAA 2VHQA 3LQRA 3I32A 3C14C 1TQDA 1BOFA 3A1TA 4D25A 4NYJR 1P75A 3IDQA 1XTQA 2H1LA 4LYJA 4M4SA 2IYRA 1XXHE 5FBWB 3OEHD 3BD9A 1E2PA 1OF1A 3K0SA 4D0NA 3LO5A 4TLAA 2FX3A 4IXNA 4DT1B 2IYZA 3THXA 2R3CA 1KHTA 2Z0MA 3ZGXA 3WMEA 2ODBA 3BB3A 4QXAA 5FI0B 4OHVA 2C78A 3T1TA 1Q57A 4LJ4A 1UADA 1GWNA 2ZRBA 4LHXA 5JS7A 1DS6A 2X19A 2ZAOA 3CR8A 3GEIA 4V0KA 3V4FA 4CGZA 3ASZA 1E96A 2VH5R 2OFXA 3OESA 3A1UA 1JALA 1GRNA 1OFHA 5JEEA 1CS4C 5SZIA 4ZV4A 2ZJYA 3THXB 4LJ6A 1VIYA 1G21E 4JL8A 2KP8A 1G3MA 3IQWA 3EC2A 3C8UA 1ZM9A 3VNUA 1KOFA 521PA 4BFTA 2FH5B 4B3CA 1CJKC 2ZS8A 3KB1A 1QHGA 3NC0C 3IIJA 1E9CA 2D2FA 1U0HC 3I72A 3RRZA 1AS2A 4QM7A 5HCNA 1MV8A 2RCNA 4AKHA 2NO9A 1CR4A 3TSOA 4EQ6A 2RKOA 3CBQA 4JLNA 4IVPA 2QRZA 4OL0A 5E95A 1NN0A 4MKHA 1VPLA 4Q4HA 3FHTA 2GKSA 4GFDA 4LPSA 3CONA 1DO2A 1N6IA 1II0A 3LVQE 3MGCA 2ZYTX 4GRAA 2JATA 3EZFA 2ZXEB 4QJ5A 2KI5A 4JLAA 3SN6A 5K8IA 2DWOA 2R9VA 1VHLA 3WYAA 1T9HA 1E3MA 1Q1EA 4RZ2A 4Q4HB 3KDSE 3BE4A 3SI7A 4P0TA 3EPHA 1KDOA 3IPYA 1Z0AA 1LNZA 4US1R 2FTKA 3DL0A 4I1VA 2BEJA 3PFIA 3HP1A 2A5FA 4BFYA 1SKYB 4KP4A 2IYUA 3EIEA 3QOFA 1G17A 1SVOA 4BE7B 2AX4A 1Z6TA 1SXJD 1S9KE 4PSVA 4CF7A 3EARA 4NDZA 3ZVLA 5LB2A 2FPMA 3V5BA 4ARZA 2WIBA 2F3RA 1X8JA 4I1UA 3TR0A 3C41J 3LDAA 1AKEA 1PLLA 3L0SA 1C9KA 5TVKA 2G1KA 2WPSA 1ZW6A 3M4YA 5FFMA 3NFQA 5EP1A 1E9AA 5FL7A 1DAKA 1FFHA 4Q47A 3VR5A 1M6NA 1A4RA 2GDJA 3AP2A 5FPKA 2C77A 1HUCA 3MRSA 2QORA 4MRSA 1H89A 3WNBA 5AWFC 2DFKB 2VYFA 2VP5A 4ARZB 4IKEA 4PR0A 4MYCA 1OB2A 1R2QA 2WBLC 1H8AA 4M2LA 2R6AA 4MDEA 2IYSA 4ZDWA 2FSFA 1DO0A 3MWYW 2Q6TA 2P0EA 4X8LA 1VCIA 5L3QA 3BWDD 2BEKA 2HLDD 1X3SA 2Q3FA 2Z6VA 3GMTA 4FIDA 3VR2A 4AKEA 4B6EA 1D2NA 1E79A 1NL3A 1XEFA 2EFGA 4IFEA 1H8EA 1UF9A 2BJWA 2C95A 2V8OA 2EFCB 5L3QB 1P6XA 4PPQA 4LBVA 2XXAA 3MLEA 4UXIA 3WMFA 3FPAA 3AKCA 4JLBA 4M9XA 3K9NA 3PXGA 4B6FA 3L35A 1CP2A 3AVVA 3RRNA 2VRSA 3ZS9A 1XF9A 4KFRA 1T8TA 1BH2A 5FBLB 1UKYA 2XXAB 3CPEA 1Z3IX 3A2AA 5CLLA 3A4MA 1EFHA 2AR7A 5AVQB 2RHMA 1CJMA 3C4JA 1J8MF 1IJFA 2IXFA 3VMXA 5LD2B 4LJYA 4DEXA 1TQ6A 1NVVR 2DB3A 1GKUB 2BM0A 2PCLA 2JLUA 3T61A 2EFDB 5AVYB 2ZJOA 3F8TA 4DB4A 4PO8A 1KY3A 2E87A 4URXR 4JS0A 1NJGA 2JJ1A 2SHKA 2ZIAA 3ZVNA 1NG9A 4V03A 2H16A 2FF7A 3B60A 3HPQA 1XPRA 1T2KD 1MKYA 4IDOA 4U5XA 4PZLA 1EK0A 1JUNA 3HU2A 2YNMA 5AVSB 3FWYA 4PAQA 3C5CA 5JHHB 2DR3A 3GLGE 2LFRA 3IBYA 1S8FA 1MO4A 3GQBA 3B2EA 5HTKA 5DGXA 4M22A 3U6KA 1QDEA 4JT2A 1NSFA 2R5DA 3H2YA 3W34A 4A2QA 2J3EA 2FDCA 4BFSA 2QGNA 1JXMA 3AQ4A 1G8GA 5CJPA 4M1YA 1RYHA 4PHFA 1T3SA 1YRAA 2J7PA 2R6CA 2J41A 1LV7A 2ZS7A 3D8BA 3NC1C 3QBVA 3A6PC 4C7NA 1NVXQ 3GJ0A 2ORWA 5KSZA 2IS4A 2KBFA 4OBEA 3BS4A 4RD6A 3ZZ0A 3B9PA 3CX7A 2BWJA 2WKRA 3GFPA 5DHFA 2GCPA 5FOWA 1E2MA 4BRWA 1XPOA 4RD3A 1E0SA 1GSIA 1X8YA 4D26A 1E2NA 1AS0A 4C7NB 1YZGA 5FUXA 2IX3A 2P6RA 4GDFA 1RPZA 3T1QA 4YDHB 4KSBA 5BXQC 2VPPA 1E99A 1WA5A 2ZR0A 4HDCA 4Q9HA 3UMRA 1SVIA 1E79D 5IRCD 4DSTA 1H8ED 2ZI9A 1KKLA 1VIAA 5LPNA 1ZNWA 1ZIPA 2FZ4A 1GKYA 3D6TB 3WP0A 4BLSA 3CWZA 1A2KC 2J0QA 1DELA 2P6NA 3M0DA 4FN5A 1RYFA 3EAQA 4A0FA 2ZYWX 3R8CA 1TF7A 3A4NA 3TW4A 4PHGA 5AW8B 4U7NA 4QGHA 2J5XA 3NBZC 4PO9A 5APWA 2IWHA 3WY9A 2PT5A 1ZP6A 3BC1A 1N6NA 2YC2C 2G3YA 2YOHA 1JPNA 4TN1A 2WICA 3FFBA 4HZIA 4HATA 3CNNA 1E4VA 1AZSC 2EFHB 5KDDA 2WV9A 3LAWA 4JLDA 2C9OA 3D3QA 1D8TA 4BLPA 3T97A 1OXUA 1TTTA 2AHOA 5J4HA 3IUYA 5C4MA 3VKWA 3SJAA 1G5TA 3QPWA 3T1OA 1NIJA 2IW3A 4XVUA 2ZEJA 3LWNA 2C2HA 1G2CB 2GK7A 3QSYA 2OXRA 2JJ1D 2VP2A 6Q21A 4HEJA 3RS0A 1KZGB 4UNSA 3X2SA 1JEDA 3CR7A 4PC6A 3SQWA 1MUUA 2DCUA 3P4YA 1E9EA 3TAHA 4GP6A 4ESHA 4A0HA 4A0GA 4RESB 5JEDA 1F2UA 3B8EB 821PA 2CCKA 2J1LA 3ZQJA 4B44A 3LVRE 1PUJA 4G5RA 3ZS8A 1ZD9A 4BPBA 1Z06A 2OFOA 1W44A 2W0SA 5J4KA 4DLWA 2ASEA 4X8MA 1DAGA 2J0UA 1ZVQA 1FOSE 2IHYA 1FMJA 2A5YB 1T3LA 1F2UB 2J7PD 2Q3HA 5DN6A 2W2TA 4YXWA 1US8A 5TARA 4PC2A 2AD5A 1Z28A 4BUJA 3AB3A 5CK5A 1CKEA 1P9WA 2ZJ8A 3UIEA 2P2UA 3RS5A 4IOJA 4DSNA 1NI3A 1U98A 1YZKA 2H92A 2JLWA 5FOTA 1FUKA 2Z4RA 1L2TA 4LYHA 5BYJA 4LDJA 3LFUA 1KSJA 5TB5A 1US8B 3PVSA 1I4DD 2F1HA 3CF0A 1MR3F 3PITA 2OSBA 2QE7D 3AH8A 4NYMQ 5TXGA 4QJ3A 2XB4A 4RZ3A 5FPHA 4DZOA 1RZ3A 1W2HA 1W0JA 3RWMB 2BHRA 1XCMA 2ZJ2A 1II8A 1G6OA 2QT0A 4H1UA 1ZIOA 2QA5A 4B43A 3P7KA 3H84A 2IPPA 5DI3A 4B75A 5AW4B 3AVXA 2QSYA 4YMSA 1DADA 5J4VA 2W00A 3B7GA 4KLNA 4S2EA 5DE3A 1H8HD 1SVKA 3AUXA 5AJXA 4DDVA 4BLOA 2D62A 3GLIE 2NIPA 1II8B 1UBFA 5EP3A 5K8TA 5DI3B 1YR8A 2ANCA 5BWMA 2ZE7A 2CHGA 1TF2A 2GBLC 3DM9B 1P60A 3JVUA 2PJRA 3LH5A 2G77B 2ODNA 5B2ZA 2D06A 3KQHA 1Q1QA 2CCGA 1K6MA 4PAOA 4A8JA 4BIUA 4TTQA 2NPIA 5ANRB 2AFIE 1NKSA 2V6IA 2YO2A 3MFYA 1FP6A 4IW3B 4CIDA 4TL6A 3W90A 1G8YA 1MT0A 4GKGA 1AGRA 1J7KA 2W2XA 1G3UA 2OEPA 1PLKA 5EE0A 3E70C 1BYIA 2NO1A 4IOLA 1Z2CA 1KI1A 1HE1C 1LS6A 5G41A 4LJ8A 4A8JB 1GL6A 3UWOA 1W36B 1PUIA 5JBQA 1X8LA 1UDXA 2JIZA 4NCJA 1CJUC 1TPZA 2BJVA 2WWGA 3L0OA 4PC7A 4HUTA 4IXMA 4MRNA 2H7VA 4TQUS 1NLYA 3GEHA 1CI6A 1GNRA 5FUVA 3JZAA 2LKCA 3DOFA 4XH9B 3WP1B 5DN6D 5IK2D 1NBME 3RABA 1ZM2A 1NG1A 1Z29A 1KQLA 1IO4A 3B6EA 4ERNA 1R0XA 1E2DA 1MFZA 2R6GA 1QHIA 3SYKA 3MJRA 2GVZC 4CVNA 4N1AA 1CTQA 3A0RA 1CI6B 1NMXA 1WRBA 2ZI4A 3HYRA 4DLSA 5EJEA 4LJAA 2IF0A 2XEXA 2EVWX 1OW3B 2QAGC 3PUYA 5FL3A 4A15A 2ORIA 4P3YA 1CBUA 4WW0A 2V6JA 2WMOB 3TNUA 1E2HA 2PZEA 3KFVA 4DCUA 5AJVB 2V7QA 1YR9A 1D5CA 3B9QA 2IYVA 1EFCA 2QPTA 3WRXC 4A2PA 2EW1A 2OCPA 4YMUA 4W7SA 1G5PA 5G40A 2N9BA 2BBWA 2ZRLA 5CJ2A 1OXSC 4WOPA 4DLYA 4POAA 1EX7A 1GRQA 1R0WA 3TNUB 1XXHA 4I1OA 4WXRA 2OFWA 3RSLA 5C46F 1RKBA 5AW2B 5CIWA 3SS8A 2O0JA 3AVWA 4HUQA 1N6PA 1KNQA 2LFSA 3A37A 2VP4A 1XZPA 1KKMA 4MUAA 4II7A 2R32A 1CSBA 4XE5B 1XXHB 3SHFA 2F6RA 5JSZA 5JI3E 4DCTA 2JASA 4LHWA 3R9XA 2CCJA 3I62A 4HUQB 2O8CA 4AYTA 3WRYC 5K8LA 3CB4A 2DBYA 2FPKA 2RHDA 4QGAA 3HJNA 4L16A 3RDPA 2JEOA 2FGKA 3HPRA 5C1BA 2KE5A 1M7GA 2V4ZA 2VHTA 2ZJBA 2IWRA 1W36D 1A1VA 3AGPA 1CZQA 4NP6A 1EFTA 4U7OA 5JSZB 4O2LA 4PANA 1KGDA 3QXXA 3SWFA 2RGGA 1YE8A 1G19A 2O8CB 4Q00A 3A4LA 4A36A 4QBFA 2VF8A 3NDPA 4KODA 3BAFA 2ZRCA 5KSYA 2JJ2A 3M06A 1P72A 1KMHA 2P2LA 1AIPA 3DZ8A 3OEEA 1E9DA 2JIZD 2ZSBA 4RFVA 2OHFA 1CULC 5EZ6B 3ZD6A 1J2JA 2G88A 2ZJAA 2FEOA 3NBFA 4ASUA 1FOEB 4D0LB 3UPUA 4M1WA 4MA4A 4LBYA 3U60B 3M91A 4K81B 4YLGA 4EFNA 1U0LA 4KI0A 4QL3A 3BBPA 2J45A 4AD8A 1T6NA 3U2QA 1KMHB 3MGNA 2RGCA 1E2EA 1ZU5A 3AP1A 4TLCA 4B48A 1MRNA 5FBRB 4BLTA 3OIYA 1J2JB 4URWR 1XJ0A 2VBCA 1D6JA 3TR5A 2F7SA 1JQLB 4DSUA 5AW1B 1JI0A 1N2CE 2HYDA 5F9HA 1MO5A 2QRNA 4B2IA 2V1XA 4Z54A 3T1VA 1WB9A 3QG5A 2GAAA 2N42A 1KI8A 2DWQA 3C7KA 2WWHA 4MGZR 3KJIA 4B35A 4GI7A 1R4AA 2RGBA 4H9GA 1PV4A 5FTNA 2B7BA 5A5GA 3EA0A 4YDSA 4U00A 5KOYA 2VLIA 4IVRA 3TVDA 1SXJC 1P2TA 1XJCA 1YZLA 2OCBA 4PQYA 8OHMA 3A1WA 4WXPA 3QKUA 1Z0KA 2CL0X 4GBMA 1FMLA 1FNMA 2P5SA 2W2VA 5IHPA 1VKJA 3EIHA 1KO4A 1ESNA 4MYHA 1OH7A 1UPTA 4TMVA 4X8HA 1F60A 4QBHA 1MOZA 4RD4A 1Q44A 5FTKA 2G83A 5JI2E 3GLFA 5FOXA 4TSFA 2WMNB 5JJLA 4DRZA 2Q3MA 5FOUA 2ZRKA 3FMPB 1J90A 4R9UC 4AIIA 4Z51A 3LD9A 2CMKA 5DI9A 5B57C 1WBDA 4MH0R 3ND8A 3DO6A 3FTQA 2A5GA 5GVRA 1SHZA 3GLFB 3R9IA 4NYJQ 4W5JA 5CM8B 4BZXA 4D4JA 3VYIA 4KO8A 2D74A 1Z63A 2BDTA 4LC1A 5AJZA 1CR1A 4MKIA 3ZVRA 3BB1A 2BBSA 3KX2A 3CRMA 2XJ4A 5GJWC 2P67A 4WIAA 1CXZA 1YR7A 4QG7A 1XMJA 4JVSB 1VDZA 5FUWA 1OLOA 2LCFA 1ZC3A 5UKDA 4B3FX 2IS6A 3TSZA 3B85A 2NOAA 5TDHA 3SFVA 2QUZA 3O8RA 2CNWA 2HCBA 5KPDA 4HLQB 1P7CA 2FSIA 2AKAB 2IYXA 1XTSA 4JLVA 1N5KA 1OFUX 2CE7A 3KJHA 3N70A 5BQ5A 4YMTA 5AUNB 1YHNA 2L0XA 4GMDA 4Q1EA 4YMVA 5GADl 1Z22A 2A5JA 5FOVA 5DIFA 2Z5FA 1NRJB 3LA6A 3ZYCA 1FTNA 1DEKA 3L43A 2F43A 4Z8YA 3CRRA 1HT1E 3ADDA 1IN4A 4LHVA 4ACAA 3GLGA 4GNKA 1U81A 5AUQA 4BLRA 2OCAA 1FZQA 4ZI2A 1IONA 5KDOA 1GKIA 1MV5A 4MT8A 1W4RA 3NBYC 3UMFA 4IEIA 4CYMA 5JRZA 3EPJA 2HF8A 2F43B 1GL7A 4ZDKA 1GP2A 3EA5A 5JJIA 1QHSA 1E2IA 3T5GA 1ONBA 3GLGB 3QXSA 2PL3A 4FPPA 4JLPA 3EC1A 3B5JA 3EWSA 3W3AA 4TLBA 1YJ5A 5FR1A 3RVBA 4M53A 3SE0A 4BASA 4ACBA 3M9BA 2YWFA 5J4YA 4E07A 3KQLA 2F9MA 5GJCA 4V02A 1KI2A 5FI1B 3BRWD 1DBSA 4R2IA 2ORVA 1IXZA 5EXTA 1OWAA 1L8QA 1FNNA 4RKEA 2IUUA 3B1WA 3SHWA 3PCRB 2B8WA 3H1TA 4TSFD 1JR3E 3DM5A 4Q03A 2B6HA 2FSHA 3MSXA 3OFNA 1JNYA 1S96A 2H57A 3W6NA 1AJEA 5EP4A 2J0SA 1Q21A 2FOLA 4C4PA 1IHUA 4PC1A 2GZHA 3TSWA 1T8UA 1KI4A 3IEUA 4FI3C 4G5SA 3QJYA 5EXXA 4DEYA 2O8EA 4M1KA 3NWJA 4RZXA 5APSA 1YZTA 2PLRA 1TQ2A 1W46A 4C0HA 2PZGA 4Q9LA 4NMMA 3I5XA 3U3RA 2J7KA 1JPJA 5A0FA 1ZCBA 3A36A 2ZITA 3I5YA 1K5GA 2JA1A 1RFLA 5CLQA 4DB2A 2O8EB 4NYIR 1N5JA 4Q01A 4FMDF 2CNWD 3QXCA 3A7OA 4OK6A 4QM6A 4AKGA 3D7MA 4KHXA 2VSOA 4Q7MB 2BMEA 2VQSA 1DAFA 2XSZA 4FCVA 1TU4A 2XJ9A 3NTUA 5FPSA 1I2DA 4L5BA 1CJTC 3GJ7A 4Q5IA 4ZCLA 1TL7C 3OF5A 4OJKA 3KQUA 1O3YA 2QBYA 3TW8B 1P61B 4UJ5A 1G1MA 2ZU6A 1M7BA 3UG6A 1FP7A 5AJYA 2QMUA 1TX4B 1TU3A 1R5BA 3V4QA 2CL6X 3FYHA 2WIAA 2ZAMA 1DTSA 3Q9LA 2XOKA 1XMVA 1OFTA 2G0TA 2OLKA 3VTKA 3SBDA 4BZPA 4Q7KA 4AI6A 3HU1A 1SLQA 4Q7JB 1GTWA 4BWYA 1NVVQ 1WDTA 3DHWC 4DKXA 4GZLA 4BGDA 1G7RA 3HTKA 1P9RA 5A4JA 3DMDA 2ZYVX 1YQTA 3PR1A 3GJ5A 3I1FA 3N2EA 1U2RA 4B32A 4RVCA 4JVMA 5IF9A 2WAXA 3AKEA 5FR2A 1XMSA 1NN3A 1S1MA 2UVQA 4KU4A 3I5CA 1GZLA 1X6VA 3K70B 3WNCA 3V4RA 1E2QA 4TZ6A 3LY5A 1E69A 1G3QA 4WZBE 1OHHA 3MCAA 3AVPA 2IHBA 2XTNA 4CRWB 4CEHA 4NL4H 5F2EA 4NHOA 5F9FA 1ZNZA 2YNYA 1C1YA 3ONWA 3X1XA 2A7QA 2AD1A 2D4HA 5J40A 1UFQA 3A58B 2C9LY 2ZRAA 5HE9A 1VECA 1G16A 4IDNA 4JLKA 3Q5EA 4RKFA 3K53A 2WSSA 3EW9A 3ND9A 1IN8A 3PUVA 3GP8A 4CEHB 1L7VC 5AK0A 2YWHA 3ZRWA 4G5GA 1KO5A 3EZ2A 4MYTA 3ZQ6A 1Z07A 3GLIA 3K0FA 2ZUBA 4B3DA 1TAGA 3HU3A 2QAJA 5JCPA 4H1VA 3PIRA 5GJVC 4XWKA 1E6CA 2IYQA 4ZDJA 1GUAA 2Z5HA 1OYYA 1Q0UA 4WA7A 5B1OA 2YZ2A 3CZPA 2ERXA 4G5OA 1OPXA 3ZRWB 4KBFA 3GLIB 1E9SA 2EFEB 2W27A 1E0JA 1Z2AA 2CVHA 3K0FB 2JGNA 1R7RA 4P31A 4AYWA 1OIXA 3QUSA 2HT1A 2RGNC 3E2IA 5E7MA 3TVTA 3W6OA 4QC2A 2ZSFA 5CMZA 1DAHA 4EPVA 3QIAA 3UATA 1E2FA 1KJZA 3OZXA 4HAZA 5EQTA 1NF3A 1UKVY 3K09C 2I1QA 1YR6A 3FFAA 2F3TA 1N3BA 5AW3B 1HA3A 2BOVA 3QI2A 4M1MA 2BC9A 3CW2A 1P73A 4OQNA 1P2SA 1AM4D 1XTIA 3QF4A 1OFIA 2IUTA 3U3OA 1YYCA 1RVDA 4JYCA 2XOKD 1RE0A 2OUKA 4Q4AA 2ANBA 3DOEA 2HCJB 2BIFA 1M2OB 5EUQB 2JAQA 3M9HA 1JJVA 2GJSA 4HZUA 4XWOA 1NMYA 1G9XA 2VTKA 1HV8A 2BASA 5D3MA 3QF4B 2QMOA 2EYUA 2IC5A 1N0VC 3TIFA 1D2MA 1HQYE 3BH0A 4Q4AB 3RS4A 4US2R 2WWYA 1GM5A 3AP3A 1ELOA 3PUWA 3ZJYA 3LBHA 5FL7D 4HZUB 3PEVA 4IDHA 1KDRA 5D3MB 2CVFA 1N6KA 4KCGA 1U8AA 2GXUA 2RB4A 5C18A 2VL7A 2FV8A 2WWIA 1OT3A 4XSGA 1OHHD 3H86A 3LBNA 4LC0A 3QXHA 3KFXA 2MSEB 2XTMA 4G01B 2CJWA 3VMYA 3EASA 4JBWA 1SXJE 3TUJC 4KYIB 1P2UA 2BCJQ 1ANKA 4NH0A 4LZZA 2PBRA 3W6PA 2GAOA 1S2MA 5KU1A 2P6UA 1T91A 4PPFA 2WSSD 1LTQA 2PX0A 2CJWB 5KSPA 3KZ1E 2C9NY 1M1YE 3VQTA 3KTAA 1HQCA 1KSHA 5DHAA 3RRYA 4NCHA 1TQ4A 3MWLA 3QXJA 1GZSA 4OHXA 3VKHA 3P27A 4L15A 2O0KA 4Q1DA 1G64A 1KAGA 5L3RA 1S3GA 1JJ7A 3SR0A 1B0UA 3FHCB 4QNMA 2FN4A 4GSYA 3KTAB 4HLUC 3C15C 3VX4A 3WBKA 4URUR 1UBCA 1VYUA 3KUDA 4I5SA 3O8BA 2QM7A 1WCV1 1TEXA 1ZUIA 2Q0HA 4C3ZA 4AYCA 2ODEA 1KI9A 1SVLA 3RS3A 1U8ZA 1ZC4A 4AUWA 3GEEA 4MKFA 4HI0E 1XFAA 2VSXA 4PHTA 1BO6A 3CNOA 4F4IA 3BERA 4CEIA 3IO3A 1PVOA 5EE5B 3MWKA 4PO1A 5IDJA 3U4QA 3FHOA 4ON9A 2OILA 2RH5A 4DLUA 4FCWA 5KNCA 3P20A 4R98A 4MYUA 1AN0A 3ADKA 2XTZA 5JS8A 2UKDA 5IT5A 2ERYA 1HTWA 2C5LA 2IYTA 2ZRPA 4V0NA 1U9IC 5JHGB 2HXSA 1M34E 4CEIB 1ZD8A 5APYA 4RY2A 4LWZA 5CB6A 5JMTA 3LV8A 1T0HB 3AF4A 4IFBA 2OBLA 5KUTA 1PLJA 3P26A 2B21A 3MUFA 4EOTA 1R8QA 3TNFA 2PMKA 2MSCB 2MSDB 4TT3A 3MAAC 4NCNA 1YU9A 3UIAA 2LKDA 5SZJA 121PA 4NTZA 2MMCA 1NNEA 4C0SA 2DY1A 2IUSA 1HE8B 1F51A 4C7OA 1BYUA 3OIVA 3SYNA 2VA8A 1U0JA 1G20E 3LX5A 3VTPC 3BK7A 3P4XA 3H0KA 2J0UB 1LF5A 2PCJA 2ZRNA 4XTCS 1W2GA 3LQQA 1CEEA 1KSFX 3K0CC 4I4LA 4Q1CA 4URVR 5DSZA 2DHRA 4EPRA 3KKOA 4MGYR 3SBEA 1NVUQ 1S4QA 4BFUA 1AK2A 2DFNA 4C7OB 5C4GB 1GDDA 2GJAA 4EFMA 3BIFA 1M8PA 2GJ8A 3V00A 4C0BA 1GITA 3VX3A 2ZRDA 3ZCCA 3K9LA 2TMKA 1SVSA 4L9WA 3ADBA 2KWIA 4JLJA 1XD2A 4RD0A 3ZRXA 4RSGA 4DLRA 2OM2A 1E2GA 1W49A 1IN7A 3ZH9B 1JOYA 4NBSA 5FTMA 4DC9A 1UAAA 1XRJA 2WPQA 3U44A 3LLUA 4HYYA 4QFMA 5CM9C 2NO0A 4NU0A 4NZYA 4ZCIA 3BJIC 3KB2A 4IOKA 2QQEA 4Z8XA 3NG1A 2Y8EA 4DUGA 4P32A 4U02A 2AXNA 4BRUA 1RJ9A 1JECA 5L3VA 3U44B 2JLXA 2BMJA 4Q4JA 1SQ5A 1K5DA 1J70A 1YZUA 5HZHA 3TJZA 4AURA 3WXMA 2ZUDA 5GJBA 2EWVA 1NWQA 4XVRA 2C2AA 2PJZA 1RJ9B 1XB2A 4OK3A 1XWIA 1IM2A 2ZE6A 2QPOA 4TMZA 4Q4JB 3CPHA 3LBIA 5FPTA 3W8RA 3ASYA 4EUNA 1S9DA 4JBXA 1JR6A 4GZMA 2EWWA 1G4AE 4TMXA 3BOSA 3TK1A 1E9BA 1AQYA 2QZ4A 4NONA 5KDLA 4EPYA 4M0LA 1QHYA 4A9AA 1IY2A 221PA 4HAXA 1OIVA 2NO7A 3SJBA 4EJSC 4TYPA 4YXWD 1N0WA 3DPUA 3EPKA 4CEJA 3CO5A 1EFUA 4US0R 5APTA 1ESMA 2VEDA 2XV5A 2A3RA 5JWRA 2YKGA 1KAOA 5FTJA 4LY6A 3NVAA 1NMZA 2RMKA 1G291 1CIPA 1E98A 4KFTA 3NEJA 4FWIB 2FWRA 2GXQA 1V5WA 2W6JA 4GOKA 3SNHA 1VG0B 2XZOA 2WTUA 3Q7PA 4LV8B 1LY1A 2ZJ5A 1ODFA 4Q02A 4WZ6A 5IDVA 4C0KA 4CEJB 2QGZA 1GK6A 4HSEA 2A9KA 4BFZA 1XMIA 4Q20A 4ZIRA 5DNYB 4C0LA 5KNDA 2WPDA 1Z6YA 1ETUA 2WSMA 1W0JD 3DZDA 1JB1A 1G7CA 1Q22A 4DZZA 4OQFA 4QPKA 4KVGA 3KXLA 3R20A 4EPXA 1P9NA 5TV2A 2JLQA 1P2VA 4MRPA 4KJZA 1ZAKA 4TYWA 4ZIRB 4RJLA 2XITA 2C9YA 2A78A 1VYVA 3CZQA 3K9HA 4L4UA 4JVLA 2MMGA 4BEBA 2GEUA 2GWHA 2VF7A 3K0AA 1GG2A 1JR3A 3LW7A 4HAWA 2NZJA 1UBGA 2NMVA 1UJ2A 3KKNA 3LW8A 1DARA 1JNMA 1A7JA 1C4OA 1WF3A 2C04A 4K8OA 5J5CA 3ZD7A 3U7FB 3SJCA 1IXRC 4R2HA 4DVGA 4DUGD 1J8YF 4EPWA 1DAIA 4A2WA 4QGFA 2NGRA 1IY0A 4PSKA 3C5HA 3K0AB 4EPTA 4O0MA 4DLZA 4MQBA 1WMSA 2CE2X 3NMDA 2QMEA 3QKSA 4JVNA 4NKRA 3BFKA 1ZM4A 5JCZA 2ZYUX 2D2EA 2X2EA 3CF6R 2FGJA 1T4GA 2GF0A 2VRWA 4JJZA 3OE7A 5H1YA 3RAPR 3GJ3A 2ZQ5A 5FPYA 3U5ZB 3L0PA 2QROA 4G5QA 1Q20A 3SDZA 1Q12A 2YYZA 5CDFE 2GBLA 2R65A 3DDCA 3L2OB 2I1VB 2VSFA 2OBNA 1GVNB 2F1RA 2YVUA 3BH6A 3QKSB 2O8DA 3O8CA 5HPYB 4MRVA 5G53C 2QSZA 4AKIA 1W47A 1TNDA 3G5UA 2BVNA 1UDWA 1E94E 1KO7A 1E32A 1Q3TA 2GVDC 2HDNB 2QP9X 2REBA 4TLEA 2YHSA 5AR1A 3M6AA 2IT1A 2QNRA 4OHWA 2GNOA 1JBKA 2FFBA 2O8DB 4HLCA 1E9FA 5H8WA 3O8ZA 2X77A 4F92B 2OZEA 4KFUA 3I61A 3SQXA 4DLXA 4Y0AA 4D4KA 1NY5A 1QRAA 4D4LA 1XZQA 1GNPA 1COWA 3HYTA 2ONJA 3EXAA 4DDWA 2W6AA 2B8TA 1EFRA 1JAHA 2ZROA 4PX9A 4P4UA 4GOJA 1SVWA 1DAMA 4D80A 2FNAA 3BH7A 4C9BA 1RRCA 4QRHA 3FMOB 1ZUHA 2WT7A 2W6JD 4Y0VA 1KDPA 1IAQA 5DH9A 1XDBA 4B34A 4ABYA 5AW9B 1VMAA 1ZNYA 2BMDA 2UZIR 1W5TA 1KDTA 2G6BA 1XP8A 2V7QD 3DMNA 2QPAA 1EGAA 5KSOA 1OB5A 1XU4A 3AEZA 1AKYA 4C0JA 621PA 2WPDD 3OAKA 2RGDA 1CJVC 1FX0A 1T0JB 1WQ1R 2WT7B 3PEYA 5JRJA 2JCSA 4IVQA
chains in the Genus database with same CATH superfamily
1N4CA 3NGMA 3ROGA 1DQYA 4MS3B 4MUHA 1M57D 4Y8VA 1FQJA 3WRXA 3R2PA 4AT1A 5B3AA 3NHBA 1JX6A 2FMTA 4HVLA 3I9FA 2HWXA 4MCHA 1CRPA 5FOSA 4BGUA 3EIXA 5EFOA 3C3TA 3UK1A 2YJ4A 3U37A 5IP5A 1ZRHA 1KOLA 1TTHA 4J03A 3K1TA 1HLPA 2IHZA 1WBBA 2OCKA 5A4IS 4YQYA 2FZVA 4YYEA 3QE3A 5AW6A 1AF7A 2C88A 3FB6C 5C35A 2EW8A 2DSNA 3O94A 3PFNA 4V1CA 1MX5A 4FR2A 1JHPA 3Q8WA 4JQCA 2O8BB 2HODA 4JV5B 5DO9A 3NBXX 3LLSA 1DX7A 1VQ4P 1A02F 1I3LA 3U7EB 2QN2A 4URYR 4IGIA 4RSHA 1SXPA 3QPBA 2OVBA 4WUTA 4CQLB 3ISJA 2HPCB 3I4FA 4FT4A 1ZVMA 2UUBO 4AFNA 3AG4C 1D9ZA 3MCUA 2PSEA 4PYRA 3O9MA 4TLDA 1NW9B 3D36A 4F2DA 2QLJA 2SKEA 1YRBA 4NDAA 4RS4A 4L8GA 2WKQA 1U0GA 2XW6A 4P30A 4P82A 5LYJA 2C7GA 1VI6A 3X2QC 1Z37A 1VQMP 3AVTA 3JAWB 1B8PA 3L71D 1FZCC 4DY6A 4IMPA 1YUMA 4RTKA 5KA6A 1UIRA 4JT4A 5DM4A 4F38A 2YKQA 1JZSA 4MW0A 4ZKEA 5LP1A 3A7EA 2ZYGA 1M56B 4LWSA 4AJ1A 2BP7B 4P4SB 4MQ6A 5ALMA 2DQYA 2C3PA 1S3FA 2LXCB 1O87A 3V32A 4WDRA 3CNQS 4XYLA 2OTKE 3ELUA 1VDMA 4IHJF 3BWVA 4M55A 3U9SA 1D2RA 3HXOA 5K0NA 1JAYA 5M5BA 1KJIA 4BV3A 5CLJA 1Z8NA 1XKLA 1SESA 2P2NA 1EEHA 4YWHA 3HV0A 3HD7D 3QPAA 4HDMA 4OXSA 3FKSA 3PV0A 5ALRA 3OT5A 2GEBA 1HNXO 3OJEA 1A9OA 1I36A 3KB8A 3VOBA 4WJLA 2P6JA 1UMCB 5ADUS 4JGBA 4UQPA 3E9MA 2O0HA 2QSAA 4CKEA 2NX2A 4ZCSA 1BE3H 1PNKA 3WLRA 5TQ0B 3GFFA 4ISBA 4ZCQA 2FLVA 4M9ZA 3WGLA 3CX5H 3GEMA 5KJFA 5TNXA 2X86A 4OJMX 3WGUA 3G9RA 1Z6AA 5A2GA 1Q74A 2QD5A 1X7GA 1I94O 1ONPA 2IYFA 3AOEC 1VQ4V 5KWJA 2H1FA 5E1DA 2VUUA 3TZBA 1RABA 4G0VA 3HRNA 1CFJA 3GGSA 4MWGA 1P17A 4CIAA 3BCSA 1TMKA 4YYZA 4DDUA 3AERB 1R9JA 4W8GA 3T3NA 4G86A 1TIBA 3U80A 3FKSD 4ZMRA 3IQZA 1C29B 1Q16A 3PD7A 4XWAA 5C34B 3SC3A 1MC4A 1WD7A 3DNFA 2JGFA 2VJDA 2JHFA 1VQMV 3BCCE 4RF4A 3GHYA 3AM1A 4K1XA 5JZMA 3OUZA 1IBCA 2B6NA 2D1RA 4EWLA 3R7WA 1WXQA 3JQFC 3QLTA 3VQXA 1UJNA 1PZFA 3K09A 4IFFA 1ZFNA 3NZEA 1P33A 1N7IA 5M04A 2ZR7A 3PNSA 2QI9F 3I1IA 3N58A 3B8EA 2YQ5A 3GK3A 4BN4A 3LSTA 3H13A 2BCGY 2RHRA 1SULA 2D7CA 4PBRA 1OJLA 4OGGA 3SMVA 2Q5CA 4UDNA 4JKIA 2GPAA 2Q4EA 4RHCA 3ENZA 4YAIA 3KQVA 2AK2A 1I0IA 1A95A 2VDWB 3IH5A 3AR3A 1KBHA 4JCOA 4DOMA 4N78D 4TM7A 4E5SA 5BVHB 1BS3A 1JLLA 3CLKA 4YO8A 1SXIA 4BPRA 5CCDA 3L49A 4TTAA 3BFVA 2CUTA 1JU4A 1KZYC 3PNQA 5CK4A 1BA2A 2DECA 3LXUX 2Y05A 3CI9A 4TZKA 2FFHA 1VRWA 1XRNA 1UK9A 2JGKA 4Y2VA 5IAAA 2HI0A 2YIBA 1AZTA 5AVVB 3EZ6A 2XVXA 2LW7A 3H1AA 2EXXA 2LXNA 5FAXA 3HYLA 3G1UA 3CLRC 3FCUB 3L4SO 1Y8QB 3K20A 2R84A 5COAA 4RJ2A 4BQFA 4OK5A 3BEHA 4U2CA 4FSXA 3ZCPA 4OI2A 5J47A 4K26A 1EIZA 1FDOA 1YJBA 1NM5C 1AO3A 1HFWA 4DJGA 1WKBA 1LVGA 2YO3A 4M3NA 2BOCC 2ID9A 2QTVB 3Q3EA 1R5SA 2RBEA 3QO7A 2HV8A 3QEJA 3CF4A 5KYWB 4D3SA 1GAEO 3NAZA 3LIEA 2C59A 5BV0A 4IBOA 2VTBA 3ZHCA 5IKXA 1VP9A 1PR2A 1B2RA 3CPJB 2EU8A 4DGSA 3HN7A 5T4FA 1A0OA 1F8UA 4MV5A 4XKJA 3GFOA 5HVNA 1R6AA 4AY6A 1VPEA 2YIBD 4HB3A 1MRZA 1EK5A 3R5SA 5A62A 5I9SA 1UWKA 1TI7A 1J99A 3EVBA 3BCUA 2AXEA 5K3BA 2YRFA 1W0JG 1JS1X 1I2MA 3GWKC 4A2CA 5A9GA 4F6RA 1OBOA 4X3CA 5LKRA 3PPXA 3CCEP 3I8SA 4MNTA 4BNGA 2G7MC 4Z1MH 3N76A 2WVRA 2XPCA 2H18A 3C45A 2GYWA 1E2KA 4EGSA 3V1NA 4W8OA 1RYMA 1NGSA 1VQ6P 4CHGA 3E1GA 4JXZA 1FFDA 4LYAA 1VBMA 2H5EA 3NH9A 4EAAA 3KJFA 2JAHA 4P7GA 1ZIXA 4CZ2A 4H3SA 4KSYA 1SQSA 1WEKA 3KYDB 3KL2A 3VU9B 3DE3X 1J8VA 1I7PA 1YJNP 1SA0A 1RRGA 2EKLA 3WQRA 4ZI3A 4FYYA 5A3RA 3RC8A 4WBSA 4R71A 4AUKA 3PICA 3ILYA 5DNCA 1GW4A 4B3BA 1G8PA 4EVIA 2ZB3A 4UKDA 1C1XA 1EQAA 1POWA 3GD7A 1C14A 3SVZA 1P84F 2ZXWC 4LHZA 5BN3B 1YTZI 3OUUA 2BFBA 1SIUA 1EXDA 5IULC 3I0NA 4BKMA 1EHYA 2V54A 3L1UA 3NUGA 4FVMA 1PD1A 1BSVA 1EBOA 4E31A 4KLRA 3ZE9A 4AHCA 4A23A 1MH1A 4CQMB 4FYHA 2Q1KA 4Q12A 1SBYA 1RQ7A 3DKPA 3TWOA 2OO5C 2FP3A 5DLEA 1U0NA 4H77A 1AHIA 1A9XA 5GZ1A 1NQUA 4AUEA 2R3CA 3HCOA 2BELA 3WMEA 1EKXA 2ODBA 4M49A 3CR8A 4TQGA 2P9YA 4BCBA 1VIYA 2PQMA 4Y1RA 3UBTA 4PV1D 5CT9A 4DCKA 5LYJB 4CMIB 2IP2A 1E5WA 2NSDA 4CDRA 2ACVA 3NJRA 4Z7OB 3V6MA 4LRSB 3MLBA 3L74J 1N1MA 2V4HA 3EQ9A 3L6UA 2R9VA 2FSSA 3CCEV 1UMBA 4C7MA 3LT2A 3G2JA 1BQ3A 3C9IA 1VQ6V 4BNUA 1KMNA 1JQ5A 3QWAA 4I1UA 5JSUA 1XMXA 3O9OA 3F7TA 1Z2PX 4ZO9A 1U3GA 3FVRA 1NQWA 5U4XA 1YJNV 1I2AA 2IJJA 2RI1A 4IMJB 1XLTC 2BEKA 4IO1A 1D2HA 2XCUA 3BCCD 2JJQA 3RFVA 1DX4A 1E79A 2WU0A 4EL5A 3BE5A 2DYSB 4QVGA 4AF6A 4INPA 4B6FA 3LF2A 4MW2A 1T8TA 2HTEA 5EUBA 5F7ZA 3VJKA 1DB3A 1EFHA 3T7SA 1JQDA 2R60A 1ID8A 1I7SB 2PGIA 5AVSA 3D54D 3CEIA 4I4NA 4DB4A 5HG0A 2E87A 2H16A 1U6JA 1T2KD 3AY7A 1K4MA 3FWYA 1CERA 2EIJB 1QU2A 2LFRA 3NHKA 3HB1A 2KW5A 4JT2A 2UVDA 2W43A 2WLJA 1QCZA 3QBVA 4LF6B 4DLPA 1CZUA 3NC1C 3M8AA 1NVTA 4C7NA 4MPPA 1E2MA 4BRWA 1E0SA 1BRMA 1NYRA 2H0QA 2JIPA 2VPPA 1GAWA 4OXQA 1E79D 1CK4A 1D2DA 1ZH6A 4EA7A 1B0AA 2LW1A 4O29A 3HCRA 4FN5A 5FFNA 1I10A 3ZH2A 3OZSA 2C4WA 5EZYF 5HFLA 4GD3Q 2GD1O 5TT1A 4XX0A 1BDCA 1SQBK 3J7TA 2Q5IA 1I32A 1NTMG 1SIOA 2HNAA 5B6IA 3G2IA 4ZIBA 5ALFA 3BA6A 3LWNA 4MHSA 3CG4A 3SJBC 2DCUA 3S68A 4MZXA 4A0GA 1EZVE 3B8EB 1GUDA 2XADA 3IUNA 2D59A 3WGYA 3QVNA 5IYZF 3G7NA 3H1IG 2OFOA 2W0SA 1V1RA 4UOQA 1NURA 1XKQA 2H31A 1FMJA 3STVA 3T3MB 2JFXA 3SAJA 1QB7A 3RS5A 3U81A 2X0JA 3HFJA 2JLWA 4D44A 4LYHA 3LWDA 3VPXA 4G84A 3D6NB 4P3PA 4HV4A 2XB4A 4RZ3A 4WKGA 2C1ZA 2F3SA 1C3OB 5BT8A 1H8HD 2GBIA 2WMDA 4ECEA 2YL2A 1YR8A 1AHHA 1YRQA 5BW6B 3P30A 1UAYA 1S72P 1Y9BA 1LTGC 1L7PA 4DA7A 4DV3B 1FS4A 4IDCA 5JDIA 1LGHB 2RK3A 4RHTA 5G41A 4HB1A 1X8LA 3COYA 1NLYA 3JZAA 4RKRA 2JH3A 1Z29A 3AUFA 1MG5A 2ZWAA 2VCYA 3WWYA 1YZHA 2IF0A 2EKQA 3D1VA 3MTJA 3PCXA 3WLIA 5FL3A 1ZJWA 2V6JA 1DGSA 4LVOA 4A2PA 4L6CA 2X13A 2NO4A 2KK7A 5CJ2A 2B61A 3RSLA 5CIWA 1KMIZ 1JKIA 3B3AA 2VP4A 5LYYA 5KTKA 1NMSA 4ID3A 3ZU4A 1Z4IA 1Z56C 1U65A 2R7AA 2F6RA 3QZUA 1Y7IA 4L85A 4JGGA 1H3FA 4J3NA 1O54A 3QVJA 3AGPA 3ZI7A 3P0FA 4IQ4A 4WOJA 2YCLA 1S5LZ 2M6KA 3DXRB 3SLGA 2VF8A 1RIIA 2CXRA 4CIYA 5KQLA 1J2JA 3NBFA 4Z1OA 3U60B 3M91A 4DMKA 3C70A 3SXJA 3DFUA 1TGYA 2WWRA 5JVDA 1D6JA 4F6RB 2DOKA 1OBFO 2BEVA 2QRNA 4FYXA 4I6JA 5I47A 1K3EA 1E64A 2VJKA 4ZVUA 3GVCA 3BWBA 5L95A 4H13D 4PQYA 2SKCA 3EVZA 3VPHA 4G1CA 1NYHA 1TDJA 2W2OA 2P5SA 4GOMD 1JQEA 3VXKA 2E85A 4YP5A 4UOEA 3PDJA 4MV1A 3I3OA 2GUWA 2AOXA 5HDBB 4CS2A 2YEVB 2Q3MA 5EHIA 3Q1MA 3OPYI 1NOIA 2ETXA 3FX7A 2Z5LA 3R9IA 3VYIA 3PLAE 1S72V 1I8TA 2OV6A 4LZAA 4HR7A 5FCDA 3MDSA 1ZN7A 2JIQA 1K4KA 1RYEA 2XLCA 4RUEA 3A6ZA 1P84I 1O6GA 2HMVA 5KPDA 5TR9A 3OSZA 1OFUX 2CE7A 1YHNA 4BJ5A 2A5JA 5BUCA 3EQZA 4IQ0A 2C4HA 1HT1E 2BFBB 3SBOA 4HPWA 3UPTA 2BZ1A 3T4PA 4ZI2A 5BMOA 2PX4A 1JA0A 1GZ5A 3PFHA 1OMOA 1Z12A 3K2EA 1X77A 1XDSA 2ZSJA 4ACBA 1DBSA 4U7TB 2YXDA 1GPNA 1LRKA 1PK9A 1SS3A 2W2QA 2HH9A 4IIYA 5CCBA 3DGEC 5EP4A 4KXWA 1U3DA 4IFTA 5JZBA 1A9XB 1UIMA 2ZVDA 1BJRE 4HBZA 3OD4A 2O8EA 4B83A 2F62A 4XUEA 3TOZA 1JG3A 4MSWC 5B3JC 4IJUA 1N73C 5A0FA 5B1BC 4Y1RB 3TW8A 4XDLA 3QUBA 4OK6A 3D7MA 2HWUA 3N87A 3JQBA 4ZCLA 2WG2A 4WNCA 4GU5A 1BA3A 4LGCA 4RVNA 3P2MA 3E1RA 1M7BA 3KPEA 3LOQA 4ZKPA 3BAZA 1YHYA 4IZOA 3ZW9A 4QTUB 1SLQA 4YCAA 1WDTA 4UQLA 2E75B 3DHWC 2HU8A 3HTKA 4JVMA 3F73A 1DC6A 3IC5A 3L8DA 3L71G 1G3QA 1OHHA 2ZIEA 4F9TA 1H93A 1KC3A 3RCBA 1L1QA 1SU6A 2HJRA 2LP4Y 3TJRA 3GP8A 2GN4A 2DTXA 1KVSA 1IBKO 3IP7A 5KC9A 1LQTA 2EAUA 3NETA 1Z6ZA 1E6CA 3LNTA 4OHUA 1YIDA 2Z5HA 2ERXA 1Y9DA 5LN1A 1Y6ZA 2B9BA 1JFVA 2NU6B 2WUVA 1KJZA 1VFPA 1KL7A 1CJCA 3L8FA 5AM1A 3JASB 2PFXA 4R31A 2BOVA 4OQNA 1LSJA 3JZDA 4Q93A 2AFIB 3TNLA 4MQEA 3ELWA 2QTGA 4HDSA 1SQPD 2BLLA 3UH0A 1NMYA 1PG0A 2GLXA 5JS2A 1LLQA 1Q43A 5D1HA 1WY5A 3DL2A 2I1KA 3IMFA 5FL7D 2GN9A 2I8AA 1N6KA 2OTJV 4KCGA 5C8YA 3IOEA 3QBEA 4JEUA 2RKLA 2FV8A 1OHHD 2RHLA 3QXHA 3OUSA 3N0TA 1I2CA 4S2UA 5LGTA 3FH0A 3BDIA 4KN6A 1DDGA 3G9ZA 5CLHA 4JYAB 3AHFA 1IFPA 3EH1A 2BFFB 3W0LB 1K3UB 1WDKA 1XVVA 4QNMA 4EB3A 4NE9A 2O8NA 4LTNA 3TNDA 4P6VF 4RGQA 1BE1A 1SU4A 3BCHA 1NJ6A 3MWKA 2K7ZA 4E5DA 3N1UA 4B0PA 3PGLA 4PS0A 3F6YA 3IRUA 1U9IC 4CT0A 3WL6A 3LV8A 1PLJA 4JYZA 4YR7A 1A04A 2MSDB 1T5OA 1E3QA 3FKSG 2FF5A 2G17A 2DY1A 1P1BA 4RPGA 1KD1Q 5EEHA 4F46A 1LTJB 4Q1CA 4D02A 2VAXA 1AK2A 3FFXA 1NYQA 3BIFA 3GVHA 2ZDHA 2FMIA 5F7JA 4QATA 3MSCA 4DLRA 2OM2A 3K15A 1W49A 1KQSU 5KS2A 2P75A 1GKKA 2V65A 4RO0A 3O2SB 1FZFA 3BJIC 2QQEA 3ZDMA 3OPNA 1U2DC 3FSEA 1BGVA 2HA3A 5BURA 1SQ5A 5G0WA 4PD4D 3L7MA 4F4HA 3FZEA 2Q6IA 2EILC 3RC2A 1GR1A 3FCCA 5E8RA 5K4GA 4TKVA 4RTQA 4YGYA 4G4GA 4WLUA 2R72A 4B85A 2CXNA 4R2XA 4WY2A 4LC9A 3OZIA 1L0NE 1H2SB 2YZKA 4RADA 2OTCA 1MJGM 4Q02A 4CEJB 2YXNA 4BFZA 4Q20A 3VDXA 4R0MA 3WIVA 1NT4A 5EGSA 1MXHA 4WFIA 4OHCA 5TV2A 5ITZB 2JLQA 1P2VA 1SPBS 3GT7A 4F5WA 4ZIRB 1Y8RB 1PIWA 3K0AA 2VF7A 2HRCA 4POOA 3OJOA 4JGSA 4ZYZA 4FFVA 4QGFA 3WLEA 5ALWA 1E5VA 2GBFA 4AICA 2VRWA 1YCDA 2ZQ5A 1Y6XA 5FPYA 1QYDA 4KPYA 2I1VB 2NWQA 1GVNB 3BH6A 3GRYA 3LDFA 1W47A 3LT5A 2OHXA 4FNGA 4HWGA 3GP5A 5I4CA 1A5SB 1H2RS 4LW8A 4OHWA 1PJCA 2DFDA 1QRAA 3QX8A 4O02B 1JV2B 4FOOA 5HUQA 1O94C 4JBHA 1GGJA 3DCNA 2NT4A 3MXOA 4WXMA 1M72A 3EN0A 4ZAWA 3D8RA 1HGXA 1DHTA 3ZE0B 1U7JA 1KJNA 4HVTA 2IH4A 1H2KA 1OB5A 1NH4A 4DR1O 1B00A 2RGDA 1U0OC 4G2KA 4FHZA 3JSLA 3I12A 4L27A 2VI5A 3CC4P 1IU9A 1U6IA 1EM1A 5GONA 3QJ5A 1FZAA 1ENYA 3CH7A 2J0VA 4F60A 1P0PA 2WOJA 5EIBD 3PGKA 1CHDA 4TWKA 1GU4A 3ZDZB 3N28A 2ILMA 2AMVA 4QU9A 2C9BA 4LF7O 3K32A 4BYGA 2PTHA 1P44A 1E4YA 3QEBZ 3JCUE 2CJYA 1BZYA 4KNVA 1G8HA 4QXMA 1XU9A 3JQ9A 3OEED 1M54A 3OCUA 3QVUA 1TF5A 4MS1A 3OZRA 2PFKA 1EVQA 3R7LA 4Y2XA 2HA0A 4OTZA 4CM4A 3C6ZA 1LPPA 1NFRA 1DAOA 2ZYDA 2OMKA 4C7BA 2A06E 4RS3A 4LFBB 4DC1A 3CF4G 2ZBEA 4C46A 3WO0A 1Q3HA 3SJ7A 1G8JA 3FCEA 1RMQA 2WD9A 5JNLA 1UP7A 4F4DA 4DR2O 1QOQB 2ZR3A 3FBGA 4GI3A 2OP0A 2VIIA 3KELA 5LGNA 4M36A 4Y6OA 4RUKA 2Y9MB 1JEYA 1YKGA 2IXEA 2ZU0C 2HYNA 4GKKB 4JI6O 1A69A 4OQLA 2FUKA 1UEXC 4ZTBA 4GPTA 3RVJA 3GA0A 1R37A 2G08A 4OATA 1JQ0A 4I0WB 1SQBH 1QPBA 1GNSA 4Z9YA 2HLDA 1J1UA 2FSVA 4X91A 3IJ4A 1VE5A 4GW3A 3M6IA 1MABA 5LIPA 4DSOA 4P7FA 4JIGA 2B5VA 4Q9IA 1JAXA 3HJCA 2UXBB 1MMFB 1JTEA 3HXQA 4IDAA 2KLUA 2HHHO 3AZQA 3RLIA 1PNVA 3FYIB 4K7JA 3ICQB 1CUYA 4NTWA 4JZKA 4UATA 1VIVA 2ZDQA 2RHBA 3FX2A 3AO0B 2NU7A 3A1SA 1XNJA 2KSEA 3HKDA 3HH8A 1G3RA 1IZ0A 3R3XA 3QBTA 3TO5A 2A86A 2C5FA 1JHXA 3H4MA 3CC4V 4UXJA 1AI7A 1W93A 2X9NA 2GN2A 1KMQA 1PVDA 1SFCA 3ZZTA 4BQOA 1FQKA 3K1JA 3WQHA 5EWJA 1AKVA 4H0FA 1OH6A 1T0IA 1KJWA 2XNDA 4X65B 5BR8O 1QORA 4B73A 4BB6A 5CYGA 4PF1A 2VJAA 3P2IA 2I4IA 4LZOA 5APQA 3UJ3X 3CMEP 1P9OA 4RZUA 2DBZA 2BFEA 4LIPD 3EEIA 3IT3A 3LRTA 2WJYA 3CUEF 1UC8A 1ZA2A 3IEMA 3K70D 4MW9A 2FETA 2EG9A 1Q91A 3RJ5A 3KYJB 5J59A 4L1KA 2QZ9A 3SU8A 3BCCG 4HN9A 2EYQA 1AV6A 4OHZA 4HF7A 1SFCD 3EA4A 4OJQA 1LF0A 1DXQA 4JI0B 3NIBA 3ONDA 5EIAA 2C82A 3PX7A 3G4SP 4E03A 3FTDA 4N8EA 1JG6A 4BJ1A 2VAWA 2AXPA 1VOTA 1VIDA 1R8YA 1KK0A 2XNDD 3F4LA 4FN4A 4W1RA 4YEDA 2K9YA 3EULA 3F0TA 2DWDC 3QKRB 2QE7H 1SZPA 3EHBB 2BN4A 4R6ZA 1W4AA 3FMIA 5AW0B 5EYPB 1D4ZA 3AG3C 1W4BA 4FXOA 1LUWA 2ZRHA 4JC0A 1DNPA 3OCYA 1Y8ZA 3BB4A 4PTLA 3GI1A 1PF7E 1UDAA 2IEZA 1JGTA 1K68A 1WW8A 4TYYA 1XU7A 2XNKA 3QRWA 1JLRA 1E79G 4QO7A 1WUJS 5D5QA 1ZP0C 2XX3A 3GPLA 4PRKA 5FYDA 5P8WA 4KOEC 5DCYA 2OL4A 3E48A 1UZNA 4MPJA 2Q5UA 1VGVA 1EXWA 1H88A 2EV9A 4QU0A 5AW4A 3LL7A 5BQFA 3A0HH 2N1TD 4O6VA 3VH1A 5JS1A 5F98A 1PE0A 5CT4A 3HGTA 4Y2TA 1W9MA 1HT3A 1OXXK 3CMEV 4MKGA 2RGWA 3ICWA 4ER6A 1HGVA 2HNKA 4TL7A 4AIRA 2BUAA 1EWYA 4JENA 4QPPA 4J1QA 1C4KA 2H29A 4HFRA 5EQFA 1Z83A 4TUYA 1LWUB 3H5WA 1QIMA 4N8DA 3QV1A 4A0RA 2C20A 3CVYA 5KHJA 4TTJA 3L40A 4CKCA 3KYBA 1EK1A 2WTYA 2FDRA 2NV6A 1E9VA 2OZPA 1QK4A 3UNXA 3OLWA 2Q9UA 3LHSA 2QVLA 3G4SV 2UUAB 5BYBA 5BORA 2DWPA 4NPFX 1ZU4A 5LU9A 4L4ZA 3SEAA 2ZVOB 3I8OA 4ZCTA 4RWEA 1FUUA 4P36A 3KSZO 3BWCA 1E20A 1SVNA 1Y48E 5GZ3A 2NTYC 1F2TB 1U63A 1GRRA 2OV1A 1X86B 3B82A 3KVYA 3U19A 2BEWB 1EDIA 2AKEA 3X1ZA 2VKQA 3VI3B 5DN9A 1GZ6A 1SFRA 4AZSA 3ND6A 4OIFA 2HZ7A 2Z30A 3L0IB 4MVJE 3WGGA 3AW8A 2A06D 3RIEA 3L8YA 4MRMA 4QX6A 3LFTA 3H2HA 1IN6A 1T4CB 1YVUA 2C07A 5JCXA 4GGPA 4Z9BA 3T3EA 1DLBA 3A31A 3BE8A 3ROFA 3RAFC 1NHWA 2CHQA 4PDVA 2Q7CA 3H8JA 2VO1A 3MA0A 4AJ2A 4LWPA 4RV4A 1M83A 4G8DA 3HACA 1Y6RA 3HQ4O 3OEHA 3JSNA 4UW9A 4ENWA 3S1AA 2NVUA 3C16C 1U97A 1VPVA 4FCTA 3FOBA 1X87A 3E05A 2C03A 2ZSAA 2WT4A 4E5NA 4IGFA 1L4MA 5I6DA 3RFRA 3DBOB 5IARA 3LLMA 3T06B 1Q7BA 4PZPA 5K6RA 2J48A 2A1TR 1U7MA 1AS3A 4DHEA 5E79H 4X24A 1DBPA 4CMCA 2AN3A 3ZGVA 2R7KA 2ZTLA 3RC1A 5IJZA 1XPJA 5K6AA 2Y1WA 3AVQA 3A0BH 4FHDA 2QWPB 2DKOA 1PVVA 4I81A 3UICA 1P62B 1YZBA 1GXSA 3AXTA 5K0FA 2RH9B 2AHYA 3CBGA 5AKLA 2ICAA 2IZ5A 2XCIA 3G82C 4WADA 5IZCA 3ZE6A 4D9NA 4CQNA 3QGMA 2W5UA 1SD5A 2FUG6 3HUFA 4IX9A 4YUYA 4K6FA 3OEHD 2WZDA 2K37A 5C3MA 2DPYA 1AVMA 3I6IA 4UUAA 2IYZA 1BDBA 1KHTA 1IL0A 4JU9A 5JS7A 5D5HA 1P8AA 2VH5R 3INGA 1JALA 2RMZA 3FN4A 1P1JA 1ZM9A 4LXQA 3NAQA 2C31A 3IIJA 3NC0C 4V24A 2D2FA 4AKHA 2CVQA 4GMHA 1YJXA 4R7TA 2A59A 1NN0A 4AXXA 4GUAA 5K5EA 1ZL0A 2WJ4A 4RDXA 3X43A 1ZISA 1Q1EA 1OVUA 2ISCA 2BEJA 2FFJA 3ZD8A 1UOEA 3FTCA 1O0BA 1SXJD 2GJ4A 4AY4A 3BUSA 3CKMA 5IAOA 2X0NA 4AJ4A 2WPSA 4XPIA 3Q4GA 4WZAB 3VR5A 4M9CA 1GLVA 2Q1XA 4DYVA 2QJWA 2DFKB 4ARZB 3NORA 3IAEA 4ZDWA 3ZTYA 2PX5A 3GMTA 3AE2C 4H33A 1WP4A 5JJEB 1L8LA 3GXOA 2I6UA 2BJWA 4Q1VA 4Y2UA 4LBVA 4INOA 2H1IA 4BMCA 3GIWA 4D42A 1I6KA 4KH1A 4EGFA 1V35A 3IDSA 5KKAA 1BH2A 5D84A 3ZWKA 1AN9A 2RHMA 4KR6A 3MILA 4EHAA 5TVGA 1TQ6A 3L71E 2PCLA 3B3QA 3K2IA 2OECA 1QIIA 2P1ZA 4QWWA 4FYMA 4JI1B 1BFUA 3RTDA 1NG9A 4P22A 2JGIA 3C5CA 4QVKA 3GLGE 2XVMA 3IBYA 2R5DA 2FDCA 1RYHA 3A32A 3DNPA 1GQSA 1YRAA 2G9RA 1IH8A 3VR5D 1NVXQ 4D6TH 1XZIA 3GJ0A 2OGUA 5JZOA 3EXFA 5KJ7A 1XPOA 4OQEA 2V96A 1U2GC 4IL5A 1AS0A 1M6YA 3JXEA 4GDFA 1T9AA 1EUDA 4KMMA 1QGDA 2WSCJ 2ZR0A 1BE3D 2ZI9A 5CU7A 4OREX 1AUXA 1EZVG 3KD3A 2XODA 1R0SA 3V1UA 4ZPJA 3TW4A 1ETHA 5APWA 2YV1A 3E7PA 2ACEA 1ZJZA 3O90A 3PXBA 3CNNA 4LDRA 3ZVKA 1G2CA 2VDOB 1V55B 4MVJA 3T1OA 1OHHG 3ELYA 3S3TA 3S2SA 2Q6AA 4NCBA 1F2UA 3DAHA 4NX2A 3CCQP 1DAGA 2QK4A 2KZJA 1YGYA 2O3SA 3SFDC 4IJWA 5KJ7D 4DSNA 4BNKA 5FOTA 5F51A 4JF3A 2P7HA 4YXWH 5TISZ 1KSJA 2J9FA 5TB5A 3T5CA 4MLCA 5GTIZ 1D0VA 1USKA 3SJCC 3LUDA 5KTRA 3P7KA 2FFDA 3H84A 2C2GA 2C5HA 5AW4B 3HSYA 4NB5A 5E4YA 4J1NA 4FQ5A 5J4VA 2W00A 3MYRA 2PWZA 3I9V6 1I33A 3ZDDA 2AOVA 2ZRQA 2DOSA 4OM8A 3SWYA 1FP4B 1BHSA 3ICVA 4FGUA 3DAPA 2DCMA 3D3WA 4MVJD 3L6CA 3RB8A 3V48A 1AGRA 1RSZA 3AESB 2H5JA 2NO1A 1BDIA 1HE1C 2V97A 3V2HA 3AFMA 3MINB 3T38A 3NR7A 1ULSA 5KTOA 1GNRA 1RWVA 3DOFA 1LC0A 2CSXA 1FMFA 1NG1A 2HNBA 4U2GA 1R0XA 1QHIA 1V7CA 4HH3C 2GVZC 3OETA 3A3NA 4DLSA 2V6GA 4BUZA 2X8LA 3O1JC 2WMYA 2WPVB 3TXAA 1RZVA 1G6KA 2HLNA 5G40A 3AM3A 1W8DA 1XALA 4WXRA 3JS5A 3SS8A 1N3LA 1R6VA 1GDTA 1LDMA 3NB0A 4YCCA 3L4JA 4NG5A 4DCTA 4N78E 2JASA 2HN9A 4FIZA 3D4IA 1HPLA 3CB4A 3PQ4A 5I8WA 3D3EA 2Q4DA 2V59A 2RGGA 5TPWA 1G19A 2O8CB 2V03A 3UUFA 4I7EA 1TE2A 4BX3A 3W06A 4WXHA 3HSKA 2P11A 1P49A 4ZVRA 1CJSA 3HB0A 5JAZA 1OCRB 4WCFC 3CCQV 5FBRB 1YQXA 4U9UA 3AL3A 5F3RA 1LTAC 1IEXA 4XLLA 2H0RA 2E5FA 4AKSA 5HQ3B 2EKDA 3LBYA 4DFDA 8OHMA 1X0TA 2UZ1B 2GVNA 3PJFA 5IHPA 3RK3D 5H02A 4HNTA 1QS0B 3FA2A 5BR4A 1YBMA 4KUHA 4NJEB 4KQCA 1KB9I 1XGKA 2GOYA 4YJGB 2WF7A 3IE1A 1FXUA 3JD0A 3VC7A 1G6Q1 1ONOA 4BZXA 1DXHA 4LC1A 1MOPA 1T13A 3ZVRA 3HWWA 3HABA 4K9OA 3WL4A 3T7TA 3E89A 1BXKA 2NN3C 1P1CA 2M0BA 2EX3A 1E5QA 4A5SA 3UB2A 2R68A 1E1LA 1N5KA 3N2LA 4YMTA 1CXZB 1L5HB 9ABPA 1DEKA 1MOFA 3WUTA 4ZT7A 3GLGA 1U81A 4KJMA 1SO8A 1U8EA 4K05A 4NPCA 3N8GA 3U31A 4AP6A 2WJ6A 3AEUB 3DMTC 2ORVA 3R3VA 3RIGA 4DRXB 2VT3A 4EELA 3FFTA 2FN9A 2QW8A 4G27B 2J0SA 2PO7A 2O1SA 2FKNA 3P9XA 4EG6A 3HD7A 2ERCA 1W1UA 3RASA 5H3HA 2YV4A 1VF5B 3X2EA 4X5OA 3TLYA 1WOMA 4ZJUA 4U5QA 1T8PA 2WUDA 3I9V1 5BSKA 1M1JC 5JMWA 5ARBA 2WP8J 1N33B 1IFJA 2XUIA 3BMCB 2Y99A 1NUUA 4PV7A 2UUOA 4S12A 3K92A 2QIWA 2VUSA 4D43A 3NXKA 1JPXA 3NWOA 1XMVA 2C00A 1K8AW 5KAPA 4RJKA 4AI6A 3AK1A 1FS5A 3BHMA 3UAZA 3ER9A 2Q0XA 4TN5A 3DLAA 3MF4A 1KFEB 1CLEA 4BGDA 2FPIA 5FR2A 2VTVA 3W4KA 3AFNA 1P4HA 2ZBQA 4YAUA 2GZ1A 4I6GA 3G0GA 1VDFA 4NFSA 1C9MA 5F2EA 5G1PA 1C1YA 1QCCA 2VF5X 4UCSA 3WKAA 4AVYA 3EW9A 3KOUA 5BU8B 1IHYA 3UCFA 1TPYA 4H1VA 1ORQC 1FJPA 3TQHA 4L8YA 1CETA 4CLRA 4FQ8A 4RA6A 5E3JA 3K0FB 1XOUA 1I0HA 3O93A 4HNHA 5J2UB 2H1WA 2I1QA 1LBEA 1MX3A 5I4BA 1W0CA 1H23A 1JYSA 1QF6A 1D5AA 4DO2A 4HXEB 4YCJA 4OLBA 2ZFUA 1CNEA 3O03A 4W7YA 2AQKA 1V37A 2CF5A 3JZIA 4I50B 1X79B 1NJ8A 4EW6A 2HLDG 2CY0A 4BV8A 5BY2A 2HJSA 1U8AA 2CXTA 3B5EA 1ZTEA 1MABG 4XSGA 1RLMA 1A32A 4JBWA 1BCRA 5L7TA 1V9PA 2AYZA 3W6PA 1PQPA 1JR4A 2C97A 2VK1A 1KEEB 3NATA 4J94A 3ZMVA 3RRYA 3MWLA 5K0GA 5AVOA 5EERA 2KS6A 1MD9A 3CZCA 1GTZA 1TEXA 1ZUIA 3NOVA 3PUIA 3L5OA 1H5NA 4PHTA 1XFAA 1GUBA 2C2OA 2ZCJA 1P45A 4YY3B 3BERA 5EE5B 3T1HO 3UCEA