2QM8A

Meab, a bacterial homolog of mmaa, in the nucleotide free form
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
326
structure length
320
Chain Sequence
TLPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords GTPase/ATPase
publication title Crystal structure and mutagenesis of the metallochaperone MeaB: insight into the causes of methylmalonic aciduria.
pubmed doi rcsb
source organism Methylobacterium extorquens
total genus 118
structure length 320
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qm8A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2qm8A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qm8A02
5KSYA 2IUTA 4AKIA 5DYIA 3KKQA 3TMKA 2XSZA 1W4RA 1DEKA 1TU3A 2AFHE 2NZ8A 1UM8A 1EXMA 4B6EA 3J81k 2Q3MA 4PC7A 1Q22A 2FFQA 4DLZA 2AD5A 2YO2A 1Q3TA 4TSFA 3QENA 2J0UA 4IVPA 3U3KA 2PEZA 3DEFA 3K70C 4AKHA 3K0SA 1GNQA 1MT0A 1CJUC 2GCOA 1KYIA 2FZLA 2ODBA 2ZRPA 1OE0A 4JLKA 4B44A 2ZE7A 4GNKA 4Q4AB 5C18A 1N6HA 4XWKA 3SBDA 4RFSA 5CMZA 5DHFA 3T15A 4LUCA 1T0HB 1N6PA 3BH6A 2JLUA 3A3YB 4EJSB 2VPPA 3BRWD 3Q8XB 3ZCCA 3T1TA 3L8ZA 4Q4LA 1T9HA 4S35A 1R0YA 5EZ5A 4B74A 4B73A 4DSUA 1Q21A 1R5OA 3MD0A 1I4LD 1KDRA 3VU9A 4R7ZA 3LBHA 3BB4A 4WBSA 4BFSA 5CJPA 5FH9A 1BYUA 4IDPA 4POAA 3PCRB 3QG5A 1KIMA 4DC9A 1H8HA 1H8EA 4BPBA 1F48A 4QBFA 2Z4SA 2IHYA 5EP2A 1P75A 2UZ3A 3QI2A 2IUUA 1NG9A 1IJFA 1KI8A 4Z51A 2O8FB 1FTSA 3FMOB 3CX7A 3HYTA 1YRAA 1E79D 2BKUA 4YQFA 1IM2A 5BXQC 1P2TA 3GLGA 2ZJ8A 5APUA 2C9OA 3ZDQA 1T3LA 2DPXA 5B64A 1Z6AA 2R9VA 5KDOA 4WA7A 2Q3IA 3L82B 1X8KA 4IRUB 4UXIA 4B33A 2QSYA 4NPHA 2RKOA 2X2FA 3L43A 2WVJA 3RAPR 2HEIA 4EFNA 2XGJA 1T2KD 2IS4A 4X8LA 1Q44A 3VKWA 2WJYA 2ZPTX 4IOLA 2OCAA 2WJHA 1EWRA 3LW8A 1P60A 2C77A 2WJGA 2EWWA 4AURA 1HQCA 3ZLJA 1UBEA 4OI1A 4EAQA 1HUCA 1D9XA 5AUOB 1UDWA 2W6AA 2GRJA 2ZRFA 4GOJA 4NU0A 1XB2A 2NOAA 1FMJA 1Z83A 3B60A 2XZPA 4TYPA 5EP3A 2ZIAA 4M1OA 4PXAA 4LHVA 4LYAA 3AV0B 4I1SA 4UNNA 4DSOA 4YMTA 1W49A 2CHVA 2OE2A 4KI0A 5EE3A 2C9CA 1XDBA 1RE0A 1Z2CA 1KO1A 4C2UA 1IQPA 1KMHB 3OIUA 4URYR 1PUJA 3PUZA 1IAQA 1W36B 5FUXA 1A02F 3TVTA 2G9NA 4ZCIA 4DCUA 4MRRA 4TQAA 1VCNA 5GJWC 4E09A 1JPJA 1G3UA 2G88A 4OQNA 3EZ2A 4A2WA 4LYFA 1QHHB 2NO1A 4NYMQ 4DZOA 4TLEA 1U81A 5JWHA 2B7CA 2VF8A 2JLVA 1KJZA 4CEHB 2RGGA 3KZ1E 3OIVA 4R71A 2R5BA 3THYB 3KQNA 3O8RA 4BQSA 3AVXA 1EFCA 4ZDWA 1MABB 1S1MA 4ZIRB 3NBYC 2P2LA 2FPMA 3K0FA 3U44A 1FX0B 2IEYA 4PPQA 2FX3A 2IBMA 2GDJA 2Q5UA 2WPSA 1R6BX 2FH5B 3DOEA 3VQTA 5AVYB 4NTZA 4JT2A 4MKFA 3TNUA 3X1WA 5AW2B 1AA9A 1ZBDA 3CB4A 2PJZA 4YMUA 1U0JA 2WAXA 3CH4B 1YJ5A 3BERA 4C7NB 1Z2AA 3MLEA 4M9ZA 3V4FA 3W3ZB 4TYWA 1TU4A 2PCLA 1BYIA 4CEIA 1Z0AA 2XZLA 1G7RA 1MKYA 5HZHA 4HDOB 3M1IA 4BLTA 4CGZA 4NDZA 4OYHA 2AFIE 3ZRXA 4QBHA 3D31A 3OEEA 3IIKA 5TY0A 1AK2A 3ND8A 3O8CA 2N9BA 2ZJOA 4IJMA 4TT3D 2AN9A 8OHMA 1G6OA 3C8UA 4PO8A 2XNSA 4RD3A 3AH8A 2GAOA 4HUQB 3C7KA 4HYYA 3R7WA 5F3WB 1XBTA 4FINA 3ICEA 2FNAA 1P2SA 2PMDA 3W6NA 2D06A 1G8HA 3SHWA 3HE4B 4DIDA 3E5HA 1ETUA 3ZD6A 4MYCA 1KY3A 2CK3D 3V9PA 3TSWA 3KQHA 1WP9A 4M0LA 2CBZA 2XXAA 1KI2A 1SKYE 3K8YA 1L4UA 3C16C 3SS8A 3M06A 4FW9A 3AVQA 2C9NY 2MSEB 2PZEA 4PC1A 4HLUA 2XAUA 1U98A 1JQLB 4E5UA 4Y0AA 1QZXA 3BOSA 5AW7B 3RDPA 5K8TA 1SXJB 2R6AA 2WWIA 2J3EA 4GOKA 4ZKIA 4KU4A 5APQA 4TTQA 2WJVA 3HR8A 3A5TA 3LBIA 2HT1A 4DVGA 1IO4A 5TXGA 4IXNA 1CR1A 1FMLA 2RGXA 4PX9A 4WIAA 4AWXA 3ZYCA 1KJYA 2R44A 2FDCA 3NFQA 2XZOA 1Z0KA 3I3SR 4FWIB 2GZAA 1JECA 3EAQA 1IY0A 4D4MA 4CVNA 4W5JA 3OIYA 1YZGA 3LQRA 1N5LA 3HR7A 4KLZA 2EWVA 3AP3A 4JLNA 1S1CA 2ERYA 3IIJA 1ZU5A 2P5TB 5HE8A 1R0ZA 3WMEA 5KSZA 3I72A 5JBQA 1XCPA 2QAGB 2HUPA 1R2QA 2ZSAA 1ZD8A 3GEHA 3CM0A 3EZ6A 3KXKA 1U99A 3LDAA 3PUWA 4MA4A 2C78A 1FQJA 1U90A 2BBTA 2R32A 1GNPA 3FFAA 1Z07A 1F3OA 1RVDA 1G41A 3PR1A 2QA5A 1Z22A 4Q1DA 3A2AA 3NH6A 4QC2A 4EQ6A 4BE7B 4DDVA 1KJWA 2W0MA 2F3TA 3FTQA 1ZW6A 3NDBB 5GJBA 5E95A 3X1YA 1P62B 3N2EA 4G3XA 4RD1A 5AWFC 3LY5A 3WYAA 3FHOA 1Y63A 1ZC3A 5AW8B 2HXYA 4QOSA 4OL0A 3FWYA 3NC0C 4KLNA 1FOEB 1RJ9B 2J5XA 2OBLA 4J0QA 5JSZA 2PCJA 3BFVA 4HB4A 3EW9A 4UNRA 1DAHA 4NONA 2CLSA 1XZPA 2WKPA 3VMFA 2QQ0A 2RGEA 1ZNWA 1U9IA 5KUTA 1E2KA 2VP2A 3U5ZB 2EYQA 1D8TA 1M7GA 2YNYA 1KO7A 1TQ4A 1OXXK 2FF7A 4BLQA 3QPVA 3NMDA 2XOKA 4UQOA 2R8RA 5E7JA 1G4AE 1NJGA 1GTWA 1Z08A 2D7CA 4IKEA 4IOKA 1NBMD 2PJRA 4BRWA 1CRPA 1YZTA 4V0MA 5CLQA 1UF9A 2RGNA 4LZZA 2P6UA 1G3IA 2ZJZA 4C3ZA 4HLQB 3NBZC 1GTVA 1RFLA 3QBVA 2FFHA 2ZRJA 2GXUA 5DLQC 3TR5A 3QSYA 4C7OB 1ZUNB 5KSPA 2GA8A 2JATA 4CW7A 1EK0A 3QIAA 2G6BA 1J90A 4MT8A 3C14C 4QPKA 3G82C 4AD8A 1SHKA 2KWIA 4N1AA 1TF5A 1GKYA 2QUZA 5TVKA 2XJ9A 5HKKA 2EFEB 3LXRA 4RZUA 4Q47A 1I4DD 5JECA 2YWFA 3LH5A 2WPDA 4MH0R 4PZYA 2QEQA 4GDFA 421PA 4QGFA 4RKFA 2YWEA 3CF2A 1SVSA 3THXB 1T0JB 2HJGA 3QKRA 1TF2A 1Q1QA 1NN1A 3SC3A 5AJVB 1HT1E 2F6RA 2VHTA 5H70A 1C4OA 3DM9B 2LKDA 1CULC 3MG9A 3QF4B 3GLIB 4JLBA 4UXJA 2GZDA 4OHVA 1SHZA 1E9FA 3ZRVA 1NG1A 2AR7A 1UFQA 1NY5A 2Z0MA 3A4LA 3AEZA 3ZRWA 1DAGA 2WKRA 1G9XA 1KK2A 5CB6A 3HU1A 2GEDA 1P9WA 1TQ2A 4A0FA 2NIPA 4B32A 5FR2A 2BHRA 2P67A 1DAFA 5DI3B 2VYFA 5FOTA 1XEXB 3FPAA 5DGXA 1GK4A 2PLRA 1YHNA 2BBOA 1FW6A 3CZPA 3QF7A 3QNUA 3GLFA 3U4QB 4PPNA 5BQ5A 1JUNA 1FZQA 2Q7CA 2PT7A 1Z6TA 4A0RA 1CF4A 4M1TA 3AVVA 1E2LA 5TARA 4XTRA 3QKSB 5L3SB 1T8TA 1ODFA 2VP9A 2GXQA 5FPKA 5JHHB 5KSOA 1VG8A 1XMIA 2A30A 4G5OA 4LHYA 5BW8A 2NMVA 2ATXA 4TYNA 1FOSF 3L35A 3U7GA 3VKGA 5JJIA 3CZQA 3GJ5A 1KK3A 2AKAB 1ZRHA 3QEOA 2JLSA 4P0TA 3BWDD 2V9PA 1X1SA 3K0CA 1L7VC 3MAAC 4HB2A 3NDPA 3TR0A 3VKHA 3RSOA 3DKVA 1I2DA 1S9KD 1Q57A 2C9LY 5H68A 4DCSA 2CXXA 1P9RA 2NO0A 1P73A 3ETLA 3NWJA 2P3SA 4HZUA 5AJZA 3WNBA 1VCIA 3M9BA 1W46A 1GRRA 4YONB 3L0OA 1W5TA 3EA0A 1F2TA 3FKQA 2CCKA 4JLAA 4LPKA 4PAMA 3TUIC 1KI7A 1SQ5A 2P2UA 4LC0A 2GJSA 4NCHA 2QMHA 1G8YA 4M2LA 4XJXA 1MO4A 1G3QA 1LW7A 3WNDA 1NY6A 1XTIA 2ASEA 1M1YE 3AGQA 5K8UA 4IFEA 2KI5A 2VSOA 3I5XA 2JAQA 2OXCA 2QMUA 4TWZA 3QEJA 3THWA 1XEFA 3TBKA 2ZM5A 2VBCA 4OHXA 2BM1A 4I1OA 2JEOA 2JGNA 4GP6A 1KSJA 1WB9A 4Q4HA 1RYHA 2QMEA 2WJJA 2QRNA 3K70B 2WM9B 5FTLA 4HLDA 1UPTA 1SVWA 4AG5A 1II0A 2D74A 3QJYA 3UG7A 2ZFCA 2QE7D 3B8EB 4DSTA 3B78A 1UEIA 2VTKA 3SR0A 4QM7A 4H9GA 3VMZA 2WWYA 1K8RA 3CX8A 2WMOB 2C95A 5DE3A 2WSSD 5BN5A 3H84A 2BMDA 2FG5A 2IC5A 4US0R 1E3MA 1S8FA 2F7SA 1NIPA 2A5GA 4AYWA 2ORVA 4IOJA 3RC8A 2LFRA 5KDLA 3PV0A 4URUR 3T12A 3DVLA 2ZAMA 5M04A 4JVMA 1W1WA 4B6FA 4K81B 4LJ8A 3TK1A 1WA5A 3VTPC 4B3DA 2J59A 4MQBA 3SBEA 1N6LA 1XZQA 4RD6A 2W6IA 2DB3A 4XD7A 1W2GA 2E42A 2Z5IA 3BK7A 3PG5A 4LX0A 4TYQA 4Q9LA 2K5UA 1T2KC 3KTAB 5FTMA 3W8RA 6Q21A 1TQ6A 2BEJA 4ZI3A 1US8A 2QM7A 1JOYA 2QE7A 1KI3A 2OLKA 4AKEA 2OAP1 4PFSA 3QKUA 2QQEA 2C8VA 5BN3A 2BWJA 3D7MA 1WRBA 1G2CB 2ZE6A 3E2IA 3HJNA 4OI2A 5BN4A 1KNQA 2WSSA 3QPUA 2CE2X 4G5GA 5E7MA 4ZI2A 2EQBA 3JZMA 2QROA 2FPKA 1OJLA 4WVFA 4BECA 4P4SB 3QXJA 5DI9A 5D3MA 5CIWA 4Q48A 4B76A 1CJTC 1XF9A 1WQ1R 1SULA 1TUIA 2HJVA 4WZAE 2H16A 3RABA 2FOLA 4PZZA 4O0MA 3D8BA 2FV8A 1IXSB 1ZAKA 1RRPA 3SU8A 1E9RA 2V55B 4DB2A 2V3CC 1GL9B 1KI1A 2I1VB 2W0SA 5AVTB 5C46F 5KO2A 4D80A 2RAPA 1XXHA 2ZJYA 3NKVA 2QM8A 2HCBA 5DN6A 3T1VA 2IF0A 2WMNB 1UBCA 2ODNA 3SI7A 3I5CA 3BIFA 1ZIPA 3C41J 3K09C 1M74A 1VG0B 4UXHA 4JLOA 3I8SA 2CCGA 2YYZA 3T34A 3I62A 4M1WA 2QU8A 1RPZA 2HF9A 1OIVA 2P5SA 5IF9A 4M9QA 1T8UA 2QT1A 3OEHD 5HZKA 4BLRA 4LYHA 4EPXA 1B23P 1S0UA 3SQWA 2YNMA 4Z8XA 1YVDA 1UKZA 3K9LA 3LXXA 4B3XA 1UBGA 3T97A 1Z3IX 4OI0A 3HPRA 2P0EA 4IEEA 1X8YA 5JJLA 5AVRB 2V7QA 4BIZA 3WBKA 5DSZA 1GRNA 3B2EA 5L8VA 3PEWA 5SZHB 4JVNA 3UXMA 1W7AA 1DO2A 1ZUIA 1Q12A 2ECKA 1F6BA 4MUBA 4RFVA 1QVRA 3ZVNA 2N42A 4U02A 2F1JA 2YWGA 1V43A 1E2FA 1NSTA 1KKMA 2BCJQ 4FMCB 2NO6A 3PEUA 4H1UA 4Q01A 2OLJA 3CWZA 5AW4B 4A2PA 1PVOA 2A5YB 4ESVA 3EG5A 2JLZA 3LD9A 4OBEA 1HURA 3DO6A 1SZPA 2YWHA 4PAOA 4C0JA 4B75A 5A4JA 3FKSD 4M3LA 1SVIA 3VX3A 4Q4AA 1GSIA 2BVNA 1PJRA 3Q85A 1YYCA 2W58A 4HAYA 4U7OA 1NLZA 5GADl 4BLOA 3MGCA 4EJSA 2VO1A 3RS0A 2ZI7A 1LS1A 1WBDA 2ZR7A 4MITA 1U8YA 4PC3A 3VHLB 4NMMA 1IOZA 1NMZA 3RS5A 3BE4A 1E6CA 4KFSA 2FN4A 4QL3A 2XSZD 5FI1B 3SYKA 2GBLA 2GJKA 1NBME 2AXPA 3X2SA 5HPYB 4YMSA 4FWTA 4I5SA 2R3CA 4HZIA 1FUUA 2OBNA 4LBWA 3RRNA 2W2TA 5EE9A 2ONJA 3K9HA 4M1YA 4PHHA 4TSFD 4JLJA 1Z0FA 3EPHA 2O8FA 1A82A 1XJQA 2DY1A 2JLYA 2CCJA 2W27A 2ORWA 3ND9A 4PAQA 1ZCAA 2CNWA 3V4RA 1XTQA 4HAXA 4ZPXA 3B8HA 1KKLA 3FHCB 1P72A 4JJKA 4HUTA 4DWJA 5KNDA 1OFHA 1JJVA 2OILA 4A8JC 1L2TA 5JEDA 2QTFA 3NEJA 1YQTA 3AF1A 2W6JA 2FWRA 1G8GA 2IYQA 3IBYA 1IN7A 2PZGA 4C0QC 5EE0A 2GJAA 2RMKA 4QKQA 1KQLA 4C2TA 5E4FA 3R8FA 5KU1A 3ZVMA 1Z0JA 2ZI9A 5JS8A 4O3MA 2E43A 3O8ZA 4DB4A 2H7HA 2OFOA 2ZYUX 3EZ9A 1M8PA 1N0VC 1AZSC 3TUJC 4MKHA 3TKLA 1OB5A 2YC4C 1W44A 4DKXA 3I32A 1H8HD 1KI6B 2WHXA 4F7WA 1JB1A 1H8ED 1OXZA 3B85A 1EESA 2Y8EA 2VRWA 4EPYA 2F1HA 1GILA 1HWTC 1KMHA 3CNLA 1SKYB 1WBBA 4X8OA 3EWSA 1XCMA 2WKQA 2OV2A 1OYYA 4FMCF 4JT4A 1FTNA 2G1KA 1QHHA 3FGNA 4II7A 1T6NA 1VCOA 1TAGA 4RZ2A 1Z8FA 2E1RA 2GK7A 1AKEA 3A37A 4CEHA 2GEUA 4GBMA 2YINC 4LBVA 3THYA 4NYJR 2Q6TA 3G0HA 2OCPA 4DZZA 1RC8A 2ZRBA 4Z8YA 3PFIA 1MABA 4ZIRA 1RRGA 1WMSA 4TMXA 2LCFA 3I8XA 1FX0A 1RKBA 3GJXC 4Q03A 4Q9KA 4MKIA 1GWNA 3ZD7A 4MDFA 1WDTA 3U6KA 4P4UA 3L0PA 2BBSA 3GLHE 1UADA 4QG7A 2WIAA 2WWHA 2CLDX 2XTZA 1ZM2A 1GRQA 1TTTA 4IVRA 5HR5A 4C7NA 1A1VA 1ZMXA 2UVQA 5B2ZA 3NTNA 3QVVA 3DMDA 4BFWA 1G5RA 1P6XA 4MTXA 1YR7A 1S9KE 2XTNA 3T06B 1A7JA 2DFTA 2J87A 4JS0A 3AUYA 4KFUA 3JZAA 3BXZA 3KB1A 4RZ3A 1HE1C 1D2NA 1H65A 2RGDA 3BFXA 3BH7A 5LB4A 4WOPA 4QNRA 1AS3A 1AM4D 5AUPB 2AX4A 4PQFA 4RJLA 1K5DA 1KGDA 5JWRA 3OFNA 2I4IA 2QG6A 1T3SA 2PZFA 1N5KA 3U7EB 4HUQA 1EFRA 1W48A 4GKGA 2MMCA 4P31A 4C0SA 4BASA 2WPRA 4BFZA 4URXR 1C9KA 2ZRNA 4UKDA 4V0OA 4Q9IA 1IXRC 4M1SA 1HY3A 3HE4A 3KKPA 5FBVB 2ZS8A 3DZ8A 2F43B 3AP2A 3TE6A 1QRAA 1OIWA 3M0EA 3BB1A 4I1UA 1GIAA 2J7PD 3ZZTA 3N2IA 1KK0A 3CW2A 3U61B 1KI4A 3UG6A 3Q5DA 2VP6A 2ZI4A 2ZREA 4D2IA 3WBJA 4EUNA 3MWYW 2V6JA 3PEYA 4C0AC 1O87A 3RLFA 1E2NA 2PT5A 1VIYA 2QP4A 4BEJA 1R0WA 5FUWA 4MYHA 4BUJA 2CJWB 3OEED 3KJIA 5FPSA 3CKLA 1SXJA 4LBYA 3B1YA 5AVQB 3GEEA 1PV4A 1A2BA 3L8YA 2ZYTX 1XTRA 3L0SA 3LLMA 3O47A 1EFUA 2GJ8A 4R2IA 1TX4B 1JEEA 3KKNA 1DO0A 3U60B 1F5NA 4PHGA 3ECCA 2PMKA 4L4UA 1EX7A 4MGKR 3IPYA 1CJMA 1JAHA 1G3MA 1VKJA 4GT1A 2W2XA 2F1RA 3A1SA 1SKQA 1KOFA 1SGWA 4LY6A 5FTJA 2ZSEA 3QVUA 3QUSA 4EPWA 4W7SA 2J7PA 4NYIR 3DGEA 3K0EA 4G01B 4M22A 4Q1AA 5KPJA 1KO5A 2QAGA 2QTVB 3TAHA 1LTQA 3BGWA 5SZJA 3CNNA 1AS2A 4PPFA 4DLXA 4UJ5A 3RVBA 2ZJ2A 4XVUA 3NC1C 2EFCB 2ANCA 3V4QA 5FOVA 5IRCD 2VHUA 4HATA 4LHWA 4NHOA 5FPTA 5LD2C 1MO5A 5APYA 3CLVA 3UMFA 4H1VA 3W9YA 1PLKA 3QY0A 5UKDA 1KO4A 4LJ4A 5DNYB 1M6NA 1AJEA 2G77B 2V54A 2QPTA 1NKTA 3CX6A 4IHQA 4OK5A 5EE1A 1W0KD 3LRPA 3OE7A 1RJ9A 3UIEA 2VP4A 1J7KA 1HA3A 5APVA 1NRJB 2QT0A 2D4HA 3AGPA 1K5GA 1XX6A 1XTJA 4KP4A 5FL7A 2NTYC 5CITA 4JKYA 3Q7PA 3FMFA 3SZRA 4M21A 4JKIA 4KSBA 4U5XA 4BFVA 2IS1A 3K9GA 1QDEA 1R5BA 2CL0X 1TMKA 2CDNA 4XE5B 1M7BA 1XJCA 4G1UC 4Q1EA 4CZ2A 2WPQA 4JLVA 3LIDA 1BOFA 4A36A 1JNMA 1QHSA 4P3YA 3T35A 3ZIAA 2O8BB 1XMVA 3B1XA 4C7OA 1Z5ZA 2IXGA 4D25A 2IS2A 3R9XA 3FFBA 1NNEA 2REXB 2D2EA 3NTUA 2VSXA 1XJ0A 4C0LA 1XPOA 2AL7A 4Q1CA 1E94E 1LVGA 1PUIA 3AF0A 1W0KA 4OHYA 3WYGA 3VR5A 4KVGA 3AKDA 1VTKA 2ATVA 1ZC4A 5LB2A 4A4DA 4HI0E 2P7JA 5HE9A 4XSGA 1Q1BA 2W83A 4CF7A 1XD2B 2YJTD 2UKDA 4DDUA 3UATA 2A5FA 3FYHA 3THXA 2Q9AA 4FN5A 3ZS9A 5JHGB 3SDZA 2OFXA 4QPJA 5J4YA 3SE0A 4K8OA 3IO3A 4A6XA 4TN1A 3U6BA 2XOKD 2O52A 1ZM7A 3QF4A 3GLIA 5FTNA 3ZQJA 3PUYA 4DLSA 1QHXA 3LO5A 1NP6A 4MRNA 2PX3A 2OHFA 1E2EA 4L15A 4AYCA 1S4QA 5KNBA 2GESA 5J4VA 4CEJB 1RZ3A 3TYYA 4IEIA 2Q9CA 4MRSA 3HTKA 3EASA 4G0NA 1T4GA 1E2JA 2WIBA 1VYVA 2O0JA 1E2DA 2OUKA 5DI3A 2WOJA 4UNPA 1W47A 1GNRA 1XEXA 1YRBA 2YOFA 4LHZA 5ANRB 3RRYA 3KQKA 1E0JA 2HLDA 3EPLA 2Q3FA 2QPOA 5HKKD 1GK6A 4QHTA 1UKEA 3U4QA 3GJ8A 3WNCA 1OHHA 3EZ7A 4YC7A 3UKDA 4EPTA 5H8WA 1DAEA 1YZKA 5GVRA 2WPDD 2AK3A 3ZJYA 5KYKA 4C30A 4DXAA 4AG6A 4JYBA 2VHQA 2ZE8A 3ICQB 5L3SA 3QKSA 2QL6A 1Q1ZA 4HB0A 2NPIA 4LV5B 4UJ3A 3LAWA 5JJKA 3T5DA 1N25A 1OH6A 1UBFA 1QF9A 3TW4A 4O2LA 2ZRAA 4QHSA 1MV8A 4DLRA 1G291 2CVHA 1N3BA 1CXZA 3GJ4A 4OQMA 1G1MA 3RS4A 3ZVLA 1YE8A 2QP9X 1D5CA 2FMXA 1B0UA 2FSFA 4B3BA 4ZKEA 1CR2A 5KTYA 3AF2A 1VG1A 1U8ZA 4QGGA 4AIIA 1HBWA 2Z83A 2DWPA 2CHQA 3CPEA 4JASA 2VA8A 5JRZA 2BMFA 4M1MA 1N6NA 1YZUA 4W9MC 4BIUA 1MUUA 5AW9B 1JJ7A 2QGNA 4IVQA 1VHTA 1TADA 3EIEA 5G53C 2DFNA 3OAKA 2IUSA 4FCVA 5K8IA 1KHTA 5EXPA 2VP0A 1GU5A 1N2CE 1VECA 3NBXX 2WWXA 2OFWA 5AR1A 3TJZA 3W6PA 4Y0VA 2BMEA 2ZRMA 1J70A 4DLUA 2AK2A 3ADDA 1BS1A 4Q7KA 4LPSA 2MSCB 4JLMA 5HTKA 2E87A 2VEDA 1MH1A 3M0AA 3TH5A 1OFIA 3C15C 3DOFA 4DLYA 3LW7A 2X2EA 3NH9A 4QJ4A 2RHDA 1JI0A 3KQGA 3CR7A 3F0TA 3LNCA 2G83A 4Q02A 2B21A 2FU5C 1E9DA 1CI6B 4NH0A 4TLBA 5L3QB 3KQUA 1DADA 2XB2A 3EA5A 1Z29A 4HB3A 4XIGS 1RIFA 3VYIA 1OT3A 1JEDA 3CF0A 5AJWA 3D3QA 4D81A 4D4LA 4JBXA 3VN0A 3M9HA 4XTCS 3ZVRA 1Z0DA 4NYJQ 2IYZA 4BWYA 1WCV1 4DCVA 4JL6A 3JVUA 4E22A 1XPRA 3I1FA 3LX5A 4YMWA 3V4WA 4GMDA 4XOIA 2YKGA 3GLGE 4AY2A 4KSCA 4IXMA 1G8PA 1CLUA 1NMXA 2JA1A 2ZRGA 3BAFA 2PEYA 5IDVA 3R9WA 1G16A 3U7HB 1AKYA 1TEXA 3GJ0A 3VR1A 3WHKA 4Q9JA 5APTA 2WZQA 2DYKA 2RGBA 3A1VA 4DIEA 5KOYA 5FOUA 4Q20A 2EU8A 3P32A 3T5GA 2Q21A 3X1ZA 3IO5A 3TGPA 4QFMA 3N5CA 2CEAA 2ZRCA 4UNSA 2A2ZA 2KJQA 3KQLA 4QHYA 4KV9A 2IWRA 2REOA 4AYXA 4DT1B 3H2YA 1KY2A 3GFOA 1NJFA 4BEBA 4FD2A 3EIHA 2WT7B 3KTAA 1IONA 2O8DB 4KJZA 1ZCBA 3QXSA 4LV8B 1ZP6A 2FSGA 5FI0B 1J2JB 4IOMA 3SN6A 4KHXA 1P61B 1T3HA 2ZS7A 3SYLA 1D2MA 1G17A 2O0KA 5AVWB 3GEIA 4FMDB 1I2MA 1Q0UA 4A8JB 1G6HA 4LJAA 1ZM3A 3KUCA 3W5JA 4CIDA 2QBYB 1JXOA 3RS2A 1G5PA 2CL7X 2JLWA 2BJWA 2PH1A 5F98A 4OKSA 1BH2A 1E9SA 1IBRA 3MMPA 5L3VA 3O8DA 2B8WA 2ZVPX 2YO3A 3BD9A 1LNZA 1VCMA 2CMKA 2ZTSA 4P4SA 1E9EA 1NIJA 3ZS8A 2GJ9A 5JLJA 3FHTA 1G4UR 1ZM4A 3DPUA 3UK6A 4US2R 5JRJA 4GI7A 2ZSBA 2QMOA 2W2VA 3TQCA 4RCZA 4YMVA 1TF7A 4JVSB 1CKEA 2W6ID 4XWOA 4XD7D 2F9LA 2R6CA 2R2AA 3GMTA 4TLAA 4BFUA 2R6DA 4URVR 3D36A 1NMYA 3QKTA 3SFVA 2FSHA 3VHXA 1FNNA 5DO9A 2H5EA 1Z63A 2GXSA 2Q0HA 3IBGA 3P4YA 4Q7LA 3SOPA 2IYUA 2DWQA 4RD4A 4ACAA 1NVWQ 4OK3A 3W34A 1N6RA 1E1QA 4PSKA 1CEEA 5D3QA 4D0LB 1W0JA 4CYMA 4LI0A 4GP7A 2G1JA 2ZRKA 3THOA 4MRPA 2ZE5A 3M6AA 4TL9A 4DDWA 3P26A 4CT5A 5J4LA 5G40A 1KZGB 1Z6XA 4NYIQ 1EFTA 3KB2A 4ZDJA 4KITB 3SJBA 3A1UA 3UANA 4XWAA 3PQCA 1CR4A 1O3YA 1GL6A 1ELOA 2REBA 2ZS9A 4S2EA 4JYCA 2XNDA 1X1RA 3BH0A 1FOSE 3W3AA 4GFDA 721PA 3H0KA 4NKRA 5B30A 3G5UA 3WP0A 1LB1B 4D0GA 1FUKA 3GCGA 2JIZA 1ZD1A 1ZINA 2ZUDA 3A4NA 4EPRA 3KFXA 5DN6D 1IN8A 1DAMA 5EZ6B 5JMTA 3WXMA 4PSAA 2JJ1D 2VL7A 3UIAA 5EP4A 1OV4A 1AN0A 4TMVA 3VR3A 4I1VA 2G0NA 1OSNA 2GCPA 1ZNXA 1MV5A 2LKCA 1COWA 3M4YA 3AVYA 2RHMA 4I81A 3TNFA 2XV5A 3AVOA 3MGNA 1S9HA 3RHFA 5GVSA 4EOTA 5FUVA 3ZH9B 4IDOA 2XU6A 2L0XA 1T5LA 3ONWA 4HAUA 4K46A 2R65A 1ZM9A 1E32A 4LDJA 1D6JA 1QHYA 3IEUA 3KUDA 4GSYA 5FFMA 5LBIA 5JI3E 3UWOA 3T61A 1G7SA 3W6OA 2NG1A 3FMPB 3W8NA 2WWFA 3OIWA 1F2UB 2O8CB 4D0NA 4U00A 2AWNA 2ERXA 2V7QD 3CNOA 1GITA 3IGFA 4GMXA 2FZ4A 1E96A 1E0AA 1OIXA 1TEVA 3HYRA 1FQKA 1OFUX 3UPUA 1LS6A 2MMGA 5JEEA 3GLHB 1E0KA 4B43A 4EKDA 2JJ1A 2IYSA 3PJRA 3SQXA 4MGIR 1G8FA 1HV8A 1X8LA 1Z6YA 4DLVA 1GDDA 5C4MA 1MR3F 2ZXUA 2BV3A 1OW3B 1GD2E 5F9FA 3FDIA 4TMZA 3CH5A 4F4CA 1J8YF 4YXWA 2VHCA 4L16A 4RZXA 1S2MA 2B7BA 2WOOA 5SZIA 4QGAA 3NXSA 1LV7A 1QHNA 2GKSA 1K6MA 1VIAA 5FL3A 5IHPA 3SJZA 1NL3A 4JL5A 3H4MA 1CIPA 2GVZC 2WWGA 3IDQA 5C1BA 2J9RA 2JLXA 3K1JA 4TMWA 1HUQA 2ZITA 3CRMA 2EVWX 1OH7A 2O8EB 4DUGA 5APWA 4HLUC 2DR3A 3LQQA 5KDDA 3CRQA 2Z43A 4LV6A 3FVQA 5P21A 1KZ7B 1N6IA 2JJ8A 3BS4A 1Z6GA 4ITRC 1KNXA 4N0DA 1NSFA 3X1DA 2GXAA 2PBRA 4BGDA 1EFHA 3RSLA 4M1KA 3W90A 2H92A 2J1LA 3QG1A 4R98A 5LD2B 3RS7A 1DELA 1KSFX 1KSGA 3HE5B 1KI6A 4V0ME 1G19A 2ZYVX 3IR9A 3MJHA 3MWLA 5EUMA 4C4PA 5IDJA 4MRVA 4D4KA 3TIFA 4NBSA 5C2JB 1CP2A 1E1RA 2B8TA 4JZKA 3ZGXA 2ZVQX 1FP7A 5FOWA 3NVAA 2H18A 3DZDA 3A0RA 5IK2A 1NVVR 1OXUA 2CNWD 5LDDC 4OHWA 2IX3A 4OK6A 1KDTA 1RYFA 2J41A 2C9YA 4B34A 3AVUA 2D2FA 1XEWX 4PSVA 3S1AB 3SFZA 1OH5A 1KO8A 2GF9A 3BFKA 3VR4A 2W6JD 2IYRA 3AKYA 3BORA 1II8B 4TYYA 4LOAA 1RRFA 1R5NA 1Q3HA 1ZD9A 3VMXA 3W5IA 3H1TA 1LFDB 2BOVA 1OH8A 2P65A 3CF6R 1AQYA 5J4HA 4TZ6A 2CL6X 3BBPA 1DE0A 2R6FA 2P6RA 5AW3B 4Q5IA 1OXTA 4KXFB 4HAZA 3HU2A 3SJCA 1U9IC 1N6OA 1DOAA 2DWOA 4ASUD 3L36A 1W36D 4KFRA 1Q20A 4RD2A 2ZETA 4BLSA 3FOZA 4JLDA 4N3NA 1R10A 3SJAA 4V0KA 4OQLA 1CBUA 1NN0A 1IXZA 1HEIA 1M7HA 2D62A 3NEYA 4FMBB 3SNHA 5AW6B 4I4LA 3L37A 4PQYA 4ZDKA 3GLFE 3HU3A 2QN6A 2RGNC 4JSYA 4B2IA 2IWHA 5HCIA 3LWNA 2RCNA 4A6PA 5FBQB 3LX8A 3CIOA 3K0AB 1GG2A 4C9BA 5A5GA 2VIIA 4B48A 3B1VA 2IF2A 3AKEA 3DL0A 4RVCA 4PO1A 4ZO4A 1ZVQA 2Z6VA 1GM5A 2A5DA 2F43A 4B86A 2N46A 4AC9A 1T91A 5AK0A 5FBLB 4QM6A 4B3GA 2VH5R 5AUQA 1JR3D 3KJEA 1T5IA 2N1BA 4HAWA 4L9SA 4PC2A 3SHFA 2CHGA 2GZHA 2DFLA 3DM5A 1KSHA 3MCAA 4ASUA 2BEKA 1EG7A 5DH9A 4ERNA 3QE0A 1XP8A 2GF0A 2EFGA 4A2QA 4B71A 2BKEA 1Z0IA 2JJ2A 1HQYE 3MWJA 5J40A 1IY2A 3TQFA 1UDXA 4OHZA 2CJWA 2WSMA 4KODA 1NAFA 4RD0A 4Q9HA 3KJGA 4PQRA 1E9AA 1SVOA 4P4TA 2W00A 2XITA 3IILA 3OFND 1NN3A 3WRYC 4KBFA 4AQRD 1DS6A 5TMPA 1NLYA 2FFAA 1N5JA 1XWIA 3MJRA 5AUNB 1NLFA 1EFRD 1TQDA 3CRW1 4Z1MA 2G0TA 2Z5FA 5KPDA 3L2OB 1U2RA 3RYTC 3ADBA 2JDIA 3EPJA 4D26A 2WICA 1QHIA 5DHAA 3T1OA 2H57A 1OXSC 1U8AA 1CZQA 1PLJA 2NO9A 2O5VA 3DMNA 1DVRA 1GAJA 1GL7A 3PENA 4GZMA 2IHBA 3CR8A 1FNMA 4B2LA 1W2HA 2DHRA 4JLPA 2G3YA 4NP6A 4ARZB 3GJ3A 1JR3A 1HYQA 4DJTA 2J0QA 5HCNA 5EXTA 2E9SA 1Z47A 1ESMA 5AW0B 2FSIA 2GVDC 2OO7A 1R8SA 5KHOC 3LBNA 2HYIC 4QJ5A 1AQUA 2YVUA 1GVNB 2ZJBA 4LWZA 1P3JA 3QBTA 1FFHA 1KAOA 5DYGA 5C93A 1CJKC 2ZUCA 4TMTA 1KMQA 1SXJD 3K0CC 3AVWA 1DG3A 3EARA 2ZR9A 2XTMA 3AB3A 1WE2A 3RRMA 3HPQA 2I3BA 3BJIC 2QTHA 4L8GA 2QRZA 4MYUA 3QXCA 4MDEA 1XCGB 2OM2A 2QAJA 2V1XA 4GCZA 1MO6A 4PHFA 2YOGA 1AGRA 4TLDA 1KAGA 2ORIA 4AKGA 4JAUA 4Q4JB 3DDCA 2IYLD 2BCGY 2NZJA 4QNMA 1NN5A 1OYWA 4IFBA 4PZLA 1X6VA 5AVSB 1J8MF 3JVVA 4G5SA 4EIWA 1V5WA 5C4GB 3KDSE 4JL8A 3VAAA 1ZYUA 2FEOA 2ZI6A 1IN5A 2XZRA 4MGZR 3I73A 3TUZC 2B92A 2O8BA 3E1SA 2C5LA 4F93B 1KI9A 3KKOA 4KHZA 3LVQE 3FB4A 1BIFA 3C4JA 3TLXA 2OEPA 1H89A 3B5JA 4M9SA 3PXGA 3RRZA 5BYKA 3CPHA 4TLCA 5EP1A 3PIRA 1LF0A 4X8HA 3CUEF 3OE7D 4F4IA 4PTLA 3UWKA 1E4YA 5ELXA 1GFIA 4ILEA 1OWAA 3KL4A 4MGYR 1CS4C 5DIFA 5FL7D 1ZJ6A 4F4JA 3Q3JB 2J0UB 2IYXA 3EZFA 4LCBA 4A92A 1E9BA 1E79A 1XD2A 4RKEA 5FBWB 5AVVB 2GCOB 4XVRA 4UNQA 3NBFA 1OKKD 4NCIA 2JJLA 2GCNA 1MRNA 4P32A 4DEXA 4QJ3A 4RFSB 4ESHA 1UAAA 1MRSA 4PHTA 5CK5A 2I1QA 3IKJA 1KK1A 4CEJA 4GL2A 4ZCMA 2QP3A 3LLUA 3IQWA 1TPZA 3VU9B 1DAIA 3FMIA 3ZIAD 5AVZB 4OQXA 2OSBA 4M53A 1XXHE 1RRCA 2PX0A 1Y3AA 4I99A 3KJHA 5FOXA 1G64A 3TSZA 4Q18A 5CB8A 1VG9B 3AQ4A 1P7CA 2WBLC 1W4AA 2IYTA 2GHIA 1W4CA 2X1VA 2ZI5A 5FUYA 1CRQA 1A5TA 1G18A 3X1XA 1NVXQ 4JSTA 1SVKA 1YR6A 4KAXA 3GLGB 4D6PA 1E99A 1OKKA 4URZR 1CR0A 3KXIA 4W5WA 3QPWA 4NZYA 3TSOA 4JBYA 3EPKA 1A2KC 4TTPA 1NKSA 1QG4A 3P7KA 2IA5A 4EDHA 1AIPA 1UKVY 5EQTA 1JBKA 4B3CA 3REFA 1OPXA 4A9AA 2SHKA 4JJZA 2ZJAA 3I5YA 1YR8A 2OZEA 3P4XA 1N6KA 1W5SA 4QBGB 5AJYA 3AM1A 5APSA 4Q7MB 4TQ9A 3QQ5A 2C96A 2P6NA 4L5BA 3K09A 1ESNA 4R2HA 2IPPA 2ZEJA 4LGMA 4AUWA 2A3RA 2H8KA 4KBGA 1SLQA 2XX3A 3U3JA 2ZXEB 2HLDD 2ZJ5A 2GILA 2CE7A 1X3SA 4P33A 2D7DA 4C0BA 1PLLA 1XD9A 1Z06A 2ZSFA 5SZKB 3EC2A 4RCYA 1OHHD 3KKMA 4TL8A 2GTPA 1TUEA 1YZQA 2WTYA 2KBFA 1BMFD 5K8LA 2OAQ1 2YZ2A 2QSZA 3K53A 1F60A 4Q00A 5CJ2A 3BC1A 3PUVA 2OG2A 2X77A 4MKGA 3V5BA 1CJVC 4TT3A 3A6PC 1HTWA 2C2HA 621PA 2RB4A 3U7FB 2VRSA 4C46A 5CM8B 5TV2A 4A0GA 2BM0A 1P5ZB 2ZU0C 5L3RA 3Q5EA 4MYTA 1YZLA 1NVVQ 3IIMA 3B9QA 3K0FB 1CI6A 3U44B 4LYJA 5L3QA 2V4ZA 5G3ZA 2HXSA 2IK8A 1YKSA 4I6MC 4HYTB 2EFDB 2VLIA 3TNUB 2CK3A 4JIMA 2YOHA 4ZDIA 5CLLA 5F2EA 3P20A 521PA 4AK9A 3CWQA 4HDQB 3DKPA 3VNVA 3M0DA 3K9NA 3PUXA 1BMFA 2IXEA 3ZZ0A 4CEIB 3B1ZA 3P27A 2QPAA 4XSHA 2AD1A 4ZV4A 3Q7QA 1JALA 1FPMA 4KCGA 5EE5B 5BYJA 1R8QA 1NWQA 2JASA 2ZRIA 2ZYWX 4A0HA 3KX2A 2J0VA 4B47A 3EX7C 5CDFA 2C03A 4NCNA 3R7WB 3GP8A 4M4SA 4GPTA 1IXMA 4HDCA 3QXXA 1IY1A 1IJEA 1E9CA 2GWHA 2IXFA 2JCSA 5CK4A 3A7OA 1U0LA 3PVSA 5CYPA 4DT1A 4B3FX 1DH3A 3B6EA 3EXAA 3GFPA 2YV5A 3AF3A 2WT7A 3WRXC 3K70D 4TMKA 2IS6A 4Q7JB 2O8DA 1KDPA 4EJSC 3SWFA 5B57C 4DBLC 2DFKB 3V00A 5BWMA 1J2JA 2Q9BA 1D9ZA 2EYUA 2XXAB 4WXRA 3WY9A 2TMKA 3MSXA 3EC1A 4GOXA 4A8JA 4DHEA 2IW3A 4LC1A 2QBYA 1WF3A 4DLWA 2GBLC 2R62A 2ZSDA 3A36A 1U0HC 1DARA 1LY1A 2FE4A 1NVUQ 3DHWC 3ADCA 4V03A 2KP8A 1JAIA 3F5FA 4LJYA 4BLPA 2CVFA 5J4KA 5FPYA 4WZ6A 1W4BA 4OI4A 3C5HA 3TW8B 3MUFA 1DBSA 221PA 5JS7A 5G41A 5GJCA 3TRFA 4I2LC 4NCJA 1G7TA 1XU4A 3RS3A 1AGPA 4URWR 3ADKA 3GQBA 2F1IA 4JBWA 4W5HA 4KYUA 3Q72A 4RSGA 2NPFA 1L4YA 2J45A 3B1WA 4RY2A 1VYTA 1QG2A 2GAAA 3B9PA 1MOZA 5CIQA 2WTUA 2AKYA 2JLQA 1E4VA 4IDNA 1G21E 3AKCA 3HDTA 3CONA 2KB0A 1JR3E 3MRSA 3NG1A 2R6GA 3H86A 4B35A 4PO9A 4LJ6A 4AYTA 3IHLA 1NBMA 4BRUA 2J7KA 4LRWA 4HLCA 3FE2A 4QBIA 4LJ9A 1E69A 1M34E 3EIQA 1UKYA 1E2MA 4M9XA 4BZXA 2RGAA 1N0UA 2A9KA 4EQ6B 2GEVA 3P1JA 2ZI3A 4V02A 1UJ2A 1Q1EA 1XNJA 4MUAA 1S96A 1CTQA 4YDHB 2F55A 5E7IA 1H88A 1S3SA 2AWOA 1W36C 5B58C 5JSZB 5AW1B 4C0HA 2QI9C 2ZANA 4DRZA 1ONBA 1IHUA 2BASA 1JPNA 3NHAA 5JFGA 1F51A 4IW3B 1GUAA 2ZU6A 2KE5A 2IYWA 3U3OA 2J46A 4A15A 1II9A 1GZLA 1P2UA 4C0KA 4LK2A 1KTVA 1YZNA 2YC2C 2H17A 1OFTA 2GNOA 5JI2E 1DTSA 2FTKA 2ZRDA 1VPLA 4IDHA 3IEVA 2HV8A 4LHXA 5FTKA 4G5QA 5AJXA 1E1QD 2ODWA 3GFTA 1W0JD 2RH5A 4LBZA 4OJQA 3ASYA 3VX4A 1BKDR 1SXJE 2OESA 3KXLA 3QOFA 3GJ7A 2LWIA 3IQXA 2WWWA 5AW5B 1EGAA 3RNLA 1XMJA 2FFBA 2HYDA 2XNDD 3RC3A 3IHWA 3WMGA 4RESB 4XH9B 4TZ0A 1XMSA 2BDTA 2FJUA 2O8CA 1F2UA 5TB5A 3QKRB 1XTSA 4HAVA 4JMPA 3T1QA 4FXPA 3A1TA 4D4JA 2D3WA 1E2GA 1NI3A 2IEZA 1MFZA 2JIZD 3OHMA 4TQUS 4LSGA 3LIEA 3RWOA 3GLHA 3VR6A 1GKIA 2Z4RA 2FA9A 3AUXA 1JXMA 1YR9A 1XPUA 2F3RA 3R20A 2ZRHA 3MFYA 3ZRWB 1BO6A 1WXQA 2QENA 2OBMA 1PZNA 2WAYA 3LV8A 5FOSA 5APXA 1HT2E 5AVUB 2YHSA 1S9DA 1COWD 3I92A 4YLGA 4G5RA 3RANA 2X8AA 5H1YA 2V1UA 5B1OA 2AHOA 3OAAD 2F9MA 4ZKDA 1E2QA 4QXAA 4LJ7A 4FI3C 1E2HA 3GLFB 3A8TA 3CO5A 1OF1A 2A7QA 3NIBA 2QY9A 4Q66C 5J5CA 2VSFA 1P9NA 2O8EA 1DAKA 1HH4A 1GP2A 3CRRA 4U7NA 3B13B 3ZQ6A 3A4MA 3VMYA 2GK6A 3D6TB 5EUQB 4WXPA 1SXJC 1A02J 2BJVA 1ZNYA 3SEAA 1TNDA 1ZUHA 1KDOA 4V0NA 1GU4A 3VFDA 3VTKA 4BFYA 4O2RA 4FPPA 5JCPA 1I4TD 5A0FA 4N0EA 1CSBA 3BB3A 4NYMR 3HE5A 3GD7A 3TVDA 4V0LA 2ODEA 3OF5A 1E98A 1VDZA 821PA 4YXWD 2IT1A 1AZTA 1SP4A 2XB4A 3R8CA 3A1WA 4HZUB 2B6HA 2OXRA 4TTRA 3OAAA 2QAGC 2NGRA 1MO3A 4FMDF 4BFTA 1EX6A 1F2TB 4CRWB 1G3RA 1E0SA 4R9UC 3REGA 3S1AA 3O8BA 1A4RA 4WAUA 1IN6A 5GJVC 1X86B 3Q9LA 3R9IA 2DCUA 4DUGD 1X8JA 1XEWY 5J47A 4YDSA 5LPNA 2FEMA 1II8A 4FIDA 4Q21A 2V8OA 4NL4H 1OXVA 1L8QA 2O0HA 3MWKA 2BMJA 4AI6A 3LVRE 2MSDB 3AVPA 3I4LA 2FPLA 3VR2A 3CBQA 1N5IA 3GLIE 1DG1G 1FP6A 1OB2A 1VYUA 3HWSA 2BBWA 3GPLA 3THWB 1HE8B 4X8MA 2HT6A 2XEXA 1R4AA 5G3YA 1LF5A 1E1RD 2EW1A 5EXXA 1IN4A 4Q4HB 2QZ4A 4JVLA 4HEJA 3SYNA 5IK2D 4XVQA 5TDHA 2ZR0A 1E2PA 3AF4A 4NE2A 4TL7A 4BZQA 3AP1A 1VHLA 3U2QA 2C99A 3IPXA 5F9HA 2QORA 2A78A 4ACBA 2ZROA 5CYOA 3UMRA 2FGJA 3K0AA 3LA6A 1EWQA 5FR1A 1D2EA 4ABYA 4HSEA 2C2AA 4CT4B 4DCTA 2GETA 4KO8A 1UEJA 1J99A 2NO7A 4FCWA 4OQFA 3AVTA 2DBYA 3TAUA 1G7CA 2KSQA 1S3GA 3PEVA 2ZAOA 3ZZUA 3QXHA 3OZXA 4NCKA 2C98A 4EFLA 2ONKA 3WMFA 5CDFE 1JNYA 2IYVA 1GKUB 4PC6A 4B2PA 5AVXB 3I61A 1FL9A 3B82A 4FCTA 4US1R 1FAVA 3F8TA 2RGCA 4GRAA 4E07A 4EFMA 1ZU4A 1CU1A 3E70C 3RWMB 1M2OB 3EWAA 1E2IA 2C04A 3HP1A 5EJEA 3OESA 1DPFA 1HJBA 2VQSA 4F91B 2ZUBA 3P8MC 4DDTA 4BZPA 2PLFA 4DCNA 1US8B 2ZRLA 5JZVA 2A5JA 5CM9C 3F3YA 4CDGA 1ZIOA 3PITA 2Z5HA 2OT3B 2X19A 3GJ6A 1TL7C 121PA 4PR0A 2R5DA 1GZSA 3WYFA 1SVMA 2WV9A 3CPJB 1P2VA 5IT5A 2QGZA 3B7GA 3L0IB 3OEHA 1VMAA 2V6IA 3WHLA 1ZNZA 5JCZA 4FMTA 5KNCA 5D3MB 2Q3HA 4ARZA 4QRHA 5DISB 2LFSA 4M8NE 1XFAA 2HF8A 2VHJA 1N0WA 4L9WA 3U3MA 2J0SA 1QVAA 1G20E 1R7RA 2BC9A 4PANA 4WW0A 4A1FA 2H7VA 1XD8A 3IUYA 4LJ5A 1OLOA 2IL1A 4ON9A 3NHBA 3C5CA 1XRJA 3A58B 3U3RA 1P4SA 5FBRB 4F92B 2ZQ5A 4JAVA 2JJ2D 4U7DA 3VNUA 1AS0A 1SVLA 4O25A 4Z54A 1XXHB 4TL6A 2WJIA 2FGKA 4PPGA 2BIFA 1JQJC 4KYIB 4OJKA 4Q1FA 1H8AA 4F38A 4A82A 1XTKA 2VF7A 4KVAA 4D82A 1RW4A 4Z1MD 1U94A 4GZLA 4KFTA 5E3HA 2H1LA 2UZIR 2OCYC 1R0XA 2JDID 3WP1B 5FPHA 2AXNA 3KFVA 1YU9A 5JWOA 1GOTA 2JLRA 1G5TA 3LFUA 3N70A 4BFXA 4Q4JA 4Q1BA 3FKSA 4DSNA 1QHGA 1ANKA 3ASZA 3UMSA 1C1YA 2HCJB 4DEYA 4E03A 3M91A 4WZBE 4Q19A 4IDQA 1Z28A 2IYYA 1QBKC 2EFHB 2QNRA 2VP5A 2KBEA 4QGHA 5EXSA 1NF3A 3KDPB 2NQ2C 1JR6A 3CRVA 2CLCX 4ZCLA 2OCBA 4DLTA 2HDNB 2ANBA 5B1NA 2XJ4A 2PL3A 4EPVA
chains in the Genus database with same CATH superfamily
3DUWA 3QFHA 5TC4A 3ETCA 4AX4A 1Y1QA 1EX9A 1EZVI 3OIFA 2QN2A 3E82A 3RKUA 2HMUA 1Y76B 3QENA 4IOIH 1QV9A 4Y7DA 3C6BA 2ZRPA 1N2CA 4MCHA 4XJSA 1E63A 4PBSA 2NSYA 2R3SA 1JMYA 1PNKA 1BX0A 3RGGA 3GDFA 2FPPB 4X1OA 1JU9A 1LTHR 1KYTA 3GBSA 1H8HA 4YCBA 1T3GA 2QTLA 1QL1A 2IKSA 1B0AA 4BCCA 1JA1A 3O93A 3ZY2A 1X8KA 2WVRA 1OX6A 4NPHA 2WVJA 3R3XA 1FA9A 3UJ8A 1W4LA 4D7TA 3WU2E 4X7RA 3AF5A 2KYVA 5AUOB 1UDWA 3DB2A 3E27A 1FMJA 1Z83A 1PWZA 4LHVA 3AV0B 1CDZA 1A77A 1UC5B 4ZRNA 3K3PA 1PR3A 3OIUA 3OZFA 1I7PA 3TVTA 4WECA 5KLVH 4TQAA 3FHJA 4RY9A 1G3UA 1PWEA 4Q93A 1U81A 5JWHA 3INRA 1BOOA 4NSNA 3THYB 2L19A 5F35A 2FPMA 1MJFA 3S8EA 3L5OA 3U44A 2IEYA 2HRQA 2IBMA 1VL1A 5KA5A 4J42A 3AF6A 3BEOA 5JSHA 3BA6A 4IV5A 3COJA 3IAS1 4ER7A 1PSDA 4HDOB 1XJ5A 4AL4A 4DJ5X 3NDRA 3VHQA 1C4XA 2J5QA 1NRIA 1U04A 3W0LB 1C3OA 5KQLA 1G0OA 4LSWA 3H5LA 3WKEA 3VPFA 3D1VA 2M6YA 2ZT5A 3MINA 4EJMA 3HUEA 4AMVA 3M06A 4FW9A 4DXHA 5CDTA 1GXSB 1UC8A 3ND6A 3HVIA 1VE1A 3F8SA 4HLUA 1AUPA 1JQLB 4E5UA 1HSZA 3EEIA 3IOMA 1M6HA 10MHA 1LT9C 2X5KO 2QI9F 2DXIA 1IEWA 1XZFA 2IQ5A 3IHTA 2OL4A 2VZ0A 2O7RA 2Y0PA 1YZGA 3HR7A 1J9EA 4LP8A 1Y8CA 3WSVA 3I72A 3IELA 1UFKA 4D8TA 5JV5A 3AUAA 4B7CA 3FFAA 2WSCJ 4EQ6A 1KEEB 1DBIA 2DYSC 4IDDA 4G3XA 4DNFA 3CF4G 4X94A 1A7UA 7REQA 3FX2A 5JSZA 3GF4A 3E35A 3A0BZ 4G4IA 5H83A 3PEEA 2Z1NA 2VP2A 3O91A 5KSWB 3M6MD 4XM0A 3X2FA 4FGSA 2JI6A 2PJRA 1T3ZA 2KS1B 3L1IA 4FZ3A 3NBZC 2ZKLA 1L7RA 3RUEA 1ZUNB 3OZIA 1P1JA 5J2TF 3L74D 3IR7A 3E61A 1F1BA 1SHKA 5TVKA 1JQDA 3FGPA 3HJBA 3LIPA 1LPBB 3O8QA 4MINA 4GDFA 2W5UA 4DSZA 4QWMA 3GW8A 1CUHA 4P3PA 4L76A 1Q82Q 2OFPA 1ONOA 3A4LA 3WRYA 4KL1A 4NV0A 1ULBA 1QC5B 3KK0A 1RLTA 5DI3B 2WZCA 4RMIA 1XEXB 2C5SA 3TLBA 5EYPA 2YW9A 3DBHA 4RFLA 3GLFA 1Y4AE 2CXNA 5CCGA 3F5TA 3UWDA 2PD3A 2H2DA 4A0RA 1ODFA 4HYEA 2XNCA 5HOEA 3DC6A 3EMVA 5ELMA 4P0TA 2V9PA 3M4XA 3NDPA 1S9KD 1NTZD 5H68A 3AE2C 5AJZA 3M9BA 4WUTA 4M83A 1XP5A 2CCKA 2EW2A 4MNTA 1OLSB 1J2YA 2RHWA 3OCUA 3DVAA 3DXYA 5JTTA 4Z7NB 3EGDB 2KOGA 2J58A 3QEJA 1XEFA 5AIAA 3TBKA 2L6LA 2BM1A 3OLCX 3B5IA 1WB9A 1Y5RA 4KH1A 1QGZA 1APBA 3PXDA 5F21A 3UG7A 4H3VA 3CRCA 1YK1A 5HF8A 1XFDA 4GHWA 4BTEA 2FB9A 1PGJA 2QDKA 4CM1A 4IGIA 2FYUH 3CZ9A 3FYUB 2A5GA 3MC1A 4AILC 3GDGA 1Z15A 2WLIB 4ITUA 3KLNA 2P10A 1W1WA 5U9CA 3GG2A 1FJGB 4OP2A 3IEXA 1CB0A 2K5UA 2DRIA 1V55C 2DMRA 3NOVA 3PGA1 4UOZA 2PZSA 4OJYA 5A3QA 3DTTA 1H1LB 2NPSA 1AQNA 3DG9A 4ND4A 1ZVMA 5K20A 4QOFA 4DKJA 1G8MA 4KXXA 3D8BA 3QE2A 4YRNA 2NZVG 3LT5A 4OVKA 1T8WA 3T5TA 4ZHQB 1CEQA 2CGOA 3K09C 1QP0A 2CCGA 2YYZA 1HSOA 5A3JA 3HRKA 5HX7A 1YVDA 1UKZA 3O4RA 1UBGA 3AEBC 4DW1A 1VSUA 4AJNA 1GRNA 1JF8A 1W7AA 5G1OA 1U2DA 3SYRA 4HWRA 4G4JA 5D6OA 2W2LA 1Q3EA 2XECA 3HN7A 2FWNA 1YTZT 4K8RB 3H6HA 5JCJD 2GTHA 3CX4A 4H7PA 3UHOA 2ZDHA 4OHUA 3RS0A 1YL7A 4YAKA 4G24A 5ALEA 4PE5B 1SQVK 5G0UA 1E6CA 4B4UA 2GBLA 2VH1A 1D07A 1GPMA 2WLTA 3N8NA 3A4IA 3IKTA 2D2CD 1WZUA 1Z0FA 1PP9G 3HACA 2K88A 2Y4NA 1RS0A 3UCXA 4P7JA 1XSEA 4NXMO 4ZPXA 3L05A 4HN4B 2YS8A 3MTJA 5AK5A 3B48A 1CZRA 1T1GA 4EZBA 1YQTA 4LH6A 3IBYA 2RMKA 1T8SA 1H0KA 2XCQA 4NDNE 3U13A 1F8XA 2Q5ZA 1CY0A 3TUJC 1CZKA 1SN7A 1Z17A 1GUBA 2ZJ0A 3FHLA 3B38A 4Z2WA 1LK7A 1Q81Q 2XYHA 3EWSA 4KXLA 3AUKA 3A0RB 3RJ9A 4NWIA 3E1IA 4R1SA 4YT2A 2E1RA 2H2IA 1C9EA 4L3WA 2Q6TA 4D3SA 3SIXA 5IYCO 2H52A 4Q3DA 3F6CA 2GFHA 4NZPA 2JGUA 3V2GA 1E1QG 1WDTA 3C6XA 4QG7A 2ZUFA 3AUTA 1KHHA 1JU3A 2ZCVA 4I4TB 1FYWA 4DQKA 2CKDA 1A7JA 3PJSK 4JS0A 2TECE 1ST2A 3BEDA 2B4YA 1JQBA 1H65A 1SCUA 2IDJA 2X1MA 3TZEA 2H48A 1N5KA 2X7RB 2Q9IA 1R74A 5DHQA 4BFZA 1JX9A 3UO3A 1OIWA 5BORA 4MUNA 5LQSA 1HXHA 3ZZTA 4NDAA 2VT3A 2VP6A 3HUSC 2H8PD 2OXEA 3H6KA 3HNPA 1O87A 3PQFA 2XDQA 4ZQBA 3FYSA 4HWOA 3ZQ4A 3F96A 1A2BA 2ZYTX 3ONDA 1EFUA 3W9UA 4RLHA 2XA1A 3ABKB 1EX7A 4LY6A 1MJ5A 3L49A 5AO9A 4YUZA 2WWRA 3UV6A 4HATA 4PLYA 1UXOA 3MRXA 4H1VA 1KYVA 2X42A 2LXCB 2R7NA 2FWJA 3SPHA 5KX5A 3OE7A 4YRIA 2X4GA 1O0SA 1NRJB 5IWCA 3H8VA 3E8SA 3ROFA 4BFVA 1FSSA 4G1MB 4JB0A 3HJHA 3K5LA 4CZ2A 3A0BE 1UXHA 1FJGO 2AI1A 2O8BB 4PV1B 1RMTA 2D2EA 4JV5B 5J9PC 4WASA 2G4VA 3JYCA 1E94E 4OHYA 3K0GA 4HI0E 2EP5A 4M0FA 1Q1BA 4IDAA 4QPCA 3SDZA 2OFXA 3CLTC 2O2XA 3EGWA 1Z37A 2O1XA 4YX9A 5AI6A 3E3OA 5HK8A 3TYYA 4FOOA 5BXZA 4WX2B 2B4QA 4DMHA 2IODA 4GGPA 2AJBA 5HFNA 4TN5A 3TSIA 1E0JA 4FJ2A 2FJPA 2V9CA 3LT1A 4CV2A 1LJ2A 2V7GA 3ZJYA 4FFLA 1SWWA 5L3SA 3TPZA 1G2IA 1YO6A 2XMPA 3C8VA 3S68A 3QJ5A 4MZDA 5GINE 1G291 2WMMA 1P1RA 3H97A 3O8OB 1B0UA 2R70A 2PVPA 1CUJA 3H25A 1F5SA 3RJZA 5GIOE 4UMEA 3U4DA 4ARUA 1MUUA 2HSZA 3EIEA 1J5EO 5D1HA 2BI4A 2YEVA 1UBRS 3TIVA 4Q7KA 3MB8A 1OFIA 2HWXA 3LNCA 4YRFA 2QG9A 3T9CA 1GUZA 5CVJA 4RNDB 4LJSA 1OT3A 3ANNA 4CG3A 2PMWB 1NH4A 4D81A 1U97A 3B8EA 1U7MA 3SIWA 2A06H 1VBNA 3CEIA 3GLGE 1DV2A 2CV1A 2GZ3A 2EEZA 2BGKA 3OQJA 4DIEA 4C20A 2HHCA 2KJQA 2YL2A 2XF8A 4BEBA 2P1DA 4B6QA 5HF9A 1W96A 1EQ7A 2ECOA 1NXVA 1GMJA 4XBFA 3L75H 2FWMX 2JLWA 4PEVA 2Y1EA 4X1YB 2C00A 2WD7A 3SZUA 1UWCA 1L8AA 3VKVA 4XWOA 5ALLA 3UVEA 3SOPA 1QANA 4FKMA 1MVNA 5TS3A 4BX9A 2FVXA 3Q0TA 4DDWA 4ZKUA 1SCAA 5ALMA 3OIDA 2PKQP 1X3LA 2WRZA 4ZOLF 3R3UA 3AOGA 2D1SA 4XUGB 1L0LJ 3RT9A 1HKUA 2R87A 3I04A 3LCRA 3DAOA 3CVYA 4EPRA 4OPAA 3L7YA 3WXMA 1JIQA 4PD4D 4RF3A 3WISA 3IEKA 3MK31 1XLWA 2DTDA 1T1JA 3PGJA 3MGNA 3SVZA 1E32A 2Q5EA 4GSYA 1TC2A 2LCIA 5EQFA 3H0CA 2WWFA 1FQWA 3GLSA 4RPHA 1PE0A 3WUTA 1TKCA 2E82A 2B4KA 1Z6YA 3H1FA 4N18A 2Q6QA 2OD2A 3H32A 4UB6H 4C3VA 1S0VA 1QGUB 1SG0A 3TLEA 2J9FB 4KDFA 2JJ8A 1Z6GA 1KNXA 4XDJA 1EFHA 3RS7A 1VA5A 1KEPA 2RBKA 4O4IB 1UPGA 1AJQA 2QUIA 4ANFA 3U1AA 4JZKA 4ZVUA 2ZVQX 4ND8B 2H4FA 1RHUA 2Z2ZA 1BT8A 1BSNA 3STLC 1CUBA 5DM70 4B34A 1VPEA 1M1KW 3OPVA 1H2FA 3GN2A 1U6KA 3GH3A 4CS4A 5DF1A 1P80A 4WCEV 4QYSA 1C4KA 4MA0A 5AW3B 5HHTA 3WB2A 1ZVKA 2ZVOB 3B2QA 3U7RA 4KFRA 1R10A 2RH0A 1B16A 3NO4A 5IBPA 3ZBUA 1AUXA 2BI8A 3IJRA 4PNHA 4OFWA 1GG2A 4PO1A 4DO2A 5F3RA 1FE6A 5EFOA 3C45A 2HW8A 2H3HA 1X7ZA 3Q6MA 2GZHA 1U1IA 2N47A 6CHYA 2WSCH 3X1KA 1V95A 3H1GA 4D44A 3MWJA 2YHIA 4MYRA 3UEOA 1JJOA 4IMIB 2IPOA 1SVOA 2WFAA 3ABOB 4JJEA 5BQPA 3LDHA 3QLEA 2X3FA 3KQSA 2P9JA 3H1ID 4KX5A 1U8AA 3L4JA 2QVGA 2Z08A 4B2LA 4JH0A 2AMVA 2O7VA 1ZRTE 3H6PA 3CS3A 4JYYA 1ESMA 2OO7A 1KEUA 5CFMA 4QJ5A 3LHDA 3QBTA 1EJ6A 3RVYA 2C0WA 3T3HA 2OV1A 4HDMB 3PIIA 5IVKA 3AE1C 2C1ZA 1LBSA 1L8DA 2YDXA 1W4ZA 4QNMA 2Z1MA 3ZHXA 2XZRA 3NGMA 2GZRA 2CXSA 1YSCA 1BIFA 4EFKA 3CISA 5MGNA 3C4JA 4RULA 4L51A 3V8PA 1ZJ6A 3CCSV 3SJ7A 2J0UB 3WR5A 4H37A 3BCHA 1M1YA 5EC1C 4NENB 4DEXA 4NPEA 4IP0A 2VK4A 1SXPA 3IKJA 2C3OA 2MINA 4HH0A 4I2NA 1DAIA 2IUFA 1G64A 4YN3A 3OKCA 3U1VA 3RRBA 4UTXA 4YLYA 5BWBA 3H1JE 4JI0O 3X1XA 1YCIA 3DC2A 2RH8A 4KREA 3PD1A 3BMQA 4G9EA 1QG4A 2AZXA 1I7DA 4KQMA 1QORA 3H2SA 2P6NA 3B2EE 4AUWA 1SZJG 1F7UA 3SCZA 1LDEA 3USSA 3FCOA 2H88C 4KVFA 4TT3A 2YIVX 3T9DA 1U65A 5F9MA 4TUYB 1RKVA 2V03A 3EXIA 3DYIA 1U9JA 5EWJA 1BN6A 2QN3A 3RVKA 3IT3A 5E1MA 1TJ3A 1GZ5A 5F2EA 2R47A 2BE3A 3L6CA 2BSKA 1BMFA 3FCAA 3ZX4A 3PQ2A 1BCSB 4YA6A 4Q9NA 1Z4IA 5CT8A 3HWX1 2JASA 2EG9A 4AM8A 5E9AA 5CVTA 2JJ2G 4NCNA 1YTFB 3G4SP 1KQFA 1V11B 4RKUJ 5COBA 1WHSA 2IXFA 4FJ0A 5EHNA 3GFPA 3WYEA 1HDXA 3G5MA 2ZWPA 3K1AA 5IY5C 2DFKB 4D4IA 3SIPA 3PLAE 3WY9A 1Y81A 5KTKA 5ESWA 1A98A 1XXLA 1U57A 3TCXB 3CGGA 4WZ6A 1O95C 3CFYA 1LI7A 1JJFA 5G41A 1A2QA 2X8WA 1QVFO 3EMBA 2AMFA 1JEKA 2DFDA 2HJSA 2WTUA 1EUZA 2JLQA 4IDNA 1GZ3A 3AKCA 1E7QA 1YJQA 2HM7A 4YP1A 1T2DA 3FE2A 4A6EA 4M9XA 3EH2A 2HG5C 3AX6A 3VUEA 4QBKA 1S96A 3J7TA 3WYCA 2AR9A 2H54A 1LNQA 3R0ZA 2GM5A 2ZANA 3PP8A 4ALLA 4Y6OA 5EHIA 2C2OA 1FJHA 2JGDB 1UPXA 2AC2A 1GZLA 3G0DA 2NTVA 3A4YA 1ABBA 5FTKA 4IFTA 2ZSHA 3NZEA 2RH5A 4OJQA 2QW0X 2H11A 3K4QA 5I7RA 2WWWA 1AJYA 4TRNA 2FF5A 4MS4A 1KILC 3OJFA 2QRPA 3Q7IA 1CE8B 2A84A 4WY2A 1Y3FE 3VR6A 4TKMA 3D8RA 3NPMA 1OFCX 3K96A 4YJHA 3V1YA 5AVUB 3P7MA 3HM9A 3ELUA 5A9RA 1NSYA 4H0FA 5H1YA 4G8JA 2AHOA 3OAAD 4U2CA 1U6JA 4FKBA 2BCCJ 2QJKB 1E2HA 9GPBA 1BVHA 4R8CA 1M2JA 4U7NA 3UUEA 4JMLA 1KRXA 3JAMN 2QVLA 4N0EA 1FVXA 1N73C 1E98A 3OMIB 2B6HA 2HB6A 4L7QA 5EKDA 3STTA 3AB7A 4TTTS 1K9MW 4DIUA 5KOJB 2PSSA 4Q21A 3UHJA 1E7SA 1GK9A 3HG7A 1MB3A 4EYQA 5H5JA 3PNYA 4NKGB 3ULKA 1O96A 5D86A 2PSDA 4GYJA 1YS7A 1NVBA 3B7PA 5IDWA 1M5IA 4W7HA 4TL7A 3GNSA 3MJSA 4N5MA 5DVZA 3AW9A 2WAMA 2W48A 3IPLA 2GB4A 4O6VA 2AZ2A 1CUIA 3OEWA 5ITWA 3LNMB 2X22A 1RPRA 2W83C 2KS6A 4N0QA 1ZU4A 3AILA 1E2IA 2CVZA 1GH6A 4EM6A 4R7GA 3DBRA 5TIIA 1BQ3A 4FBMA 2WY2D 5JSUA 2WV9A 1I10A 3EA4A 2A3QA 4GL4A 4UBKA 1QTNA 3QWIA 5KOIA 2GYVA 3FDZA 4RJKA 2WPVB 4L9WA 1PJ4A 2E85A 3LUAA 2YYAA 2EP7A 1OLOA 4ON9A 4V2IA 1M76A 3RSHA 3QNEA 1XT6A 4V38A 4D82A 2J09A 2H1LA 4GODA 5AQEA 3Q10A 5DBFA 5HXAA 1JH8A 1P7ZA 3CH6A 3FZGA 5JS2A 4BUZA 4NNJA 5GY7A 1NBWB 1HEUA 1YZFA 1R0LA 4Z49A 1Z28A 4DXWA 4EUFA 3D6NB 1QLHA 3EVBA 2HDNB 3HCEA 1QX3A 2XJ4A 5CDGA 4ZARA 1PT6A 3ABLC 4PA3A 1WY5A 1U5BA 2PDAA 4U39A 4B3SB 4WKNA 4JBLA 4EKYA 4Q4AB 5DASA 4RFSA 3ZCCA 3O92A 3T1TA 1T9HA 3L8MA 1J2TA 3P9ZA 4BFSA 2FOXA 4GDMA 3PCRB 3ZK8A 3R65A 1A04A 2IUUA 3VR6H 4RW0A 1YE5A 4LZOA 4ODIA 2HEIA 3T94A 4PYLA 3BE5A 4KWTA 3LW8A 2WJGA 3ZLJA 1UBEA 2Q2NA 3OJXA 3B60A 3A9TA 4DSOA 4YMTA 4LF5B 1V54C 3U4IA 3CBGA 2J0EA 2F93B 2FHPA 4OGLA 5GJWC 1IK4A 4KIJA 2YVLA 1X22A 1KH3A 2XD9A 2ZDIA 1NT4A 3RKRA 4BS9A 1QK4A 1S1MA 4KFMA 1FX0B 3RL0g 2VQEO 1Q6ZA 2XVAA 4M9ZA 1EAYA 3LQYA 2CUGA 3W7AA 1Y3DE 2OYOA 2Z8XA 1OD6A 5TY0A 4YXWH 3ND8A 4BNJA 4WB4A 2C5HA 4HWKA 1N2SA 5HJ7A 2FR8C 4N8DA 2NZUG 1T6YA 4JGBA 1NVOA 1YTZI 3VSAA 1K08A 2A6PA 3TSWA 2IZ0A 4UVGA 3NM6B 3BL6A 4OPMA 1C80A 4OXKA 2P9GA 4B08A 4GOKA 1GTL1 4LQLA 4MQUA 5TXGA 1L0LH 5IKXA 4QQ8A 1GT6A 2FDCA 3ESBA 2H4HA 1IY0A 2CLFB 2VSQA 4HN9A 2P4HX 3GAAA 1LZKA 1H6CA 1WDWB 3NEPX 3VMAA 3O82A 3O2NA 1KFCB 3OQHA 4QOIA 4ALMA 2P9EA 1KJWA 5CCDA 3N2EA 5AK4A 4BIOA 1Y63A 2Q0QA 2V4UA 4MVWA 1E3LA 1M1UA 4XRGA 1VF5D 1JUDA 3F5WC 1ZNWA 1H2EA 2WLSA 3QA3E 2HIAA 4BW9A 2JGFA 1Z08A 1NBAA 9LDTA 5HJEA 2RGNA 2YX1A 2P6UA 2ZJZA 4D9KA 2G80A 4DR4B 4AMUA 2CLOB 5EMLA 2JATA 2UZ1A 1CUFA 3ESYA 4L6IA 1TK9A 4MT8A 1CZHA 4KLRA 1JHZA 1GKYA 2QUZA 3HVRA 4NNOA 4DUPA 1K2WA 2YWFA 3AM3A 3SJAC 4MH0R 3LFTA 5AKZA 1Z0ZA 4Z1MH 1BC5A 3G6EP 2X7HA 1W5AA 4UXJA 2GZDA 4DE5A 2AV6A 1NG1A 1UMKA 1DZ3A 2EX4A 4EHLA 2I91A 3RCBA 1LBIA 1FRZA 4CM8B 3RYCB 3H6GA 2FL4A 2X2OA 1O7JA 5BSFA 4WD3A 1R8YA 1XN4A 1MTOA 3CEAA 5KLVJ 4C0XA 2D1TA 5JNLA 5EMMA 4KYVA 1CY6A 1XNQO 2UYOA 2AQHA 3K05A 3KLPX 1P4HA 4HZUA 4E1BA 1ZV8A 3DDWA 1EDDA 2PV7A 3OW2O 2FMHA 5CXQA 3U1CA 2WU1A 3NIDB 1S76D 2D3OW 2R7LA 1BVYF 1GLVA 4C7JA 3MHVA 3OR7C 5T67A 3E8BA 5JCOC 1N2JA 3RGWS 2CLLB 2VBCA 2RDMA 2JFHA 2Z6AA 2JGNA 2JO1A 1E20A 2XUJA 3OWOA 2QMEA 3MYYA 3K70B 1UIXA 4HLDA 1HDOA 4MO9A 3QWFA 3MS2A 5IKMA 1ETHA 1PSWA 1E7WA 4IOJA 4MEAA 3Q5PA 5AKKA 2B0JA 2OMEA 4CDMA 2Y68A 3DLPX 1N0NA 3A25A 3TQRA 3W8RA 1J07A 4LF5O 4FMPA 2V7EA 1H2YA 2CE2X 4UAGA 1VDMA 3M6FA 2DBVO 3BGDA 2Q6OA 4W5QA 4NVRA 1XCOA 3TGLA 4MJ3A 1JEQB 5L6LB 4F3RA 1VQ4P 4DXDA 3FSGA 3CCVV 4FFNA 3VSDA 1L6RA 2W9XA 4QODA 1XXHA 2RGRA 3F71A 3WWCA 3HJAA 4R8LA 3PQDA 2P1RA 5CMLA 4I8XA 2P5SA 4IIBA 4BLRA 1CG6A 3TECE 1TLTA 1NHLA 4YJ3F 1R12A 4MR8A 3KSMA 2W2KA 4PGFA 4YRQA 4ZCRA 1T3UA 2BFFA 1I6MA 4ZD6A 4D57A 3ZVNA 2B25A 3GT4A 1KKMA 4H1UA 5E38A 2PA0A 4O4HA 1AG9A 4BQRA 4DS3A 3EEYA 3MEQA 3ISTA 2M6RA 4AMZA 3DMPA 3CCLV 4EJSA 1LS1A 1WBDA 2Q7DA 3EC7A 1EMDA 1AKRA 4R4MA 2G8NA 1ZXBA 1NBME 2FK8A 3HDQA 2VBIA 2NU9B 2ONJA 4M7WA 1K7YA 2W27A 4PAQA 5CHXA 3ICPA 2KIKA 1Q7YQ 1NW8A 2JK1A 2J3QA 3O38A 5CD9A 2D00A 1LDMA 1P7GA 1N0VC 1FP4B 2PS0A 1EESA 2VRWA 4DR4O 3K5MA 3NHJA 1VCOA 2GV9A 3X2QB 2COKA 4FLTA 2VRZA 5JZSA 4ZIRA 3BX1A 1WMSA 4M0UA 4PX2A 1P2FA 4HNUA 4KEAA 1N0HA 4WNAB 1VJDA 2R79A 1FFDA 2CLDX 1T1EA 2HA5A 1GRQA 2GN9A 4IVRA 4Y30A 1X9IA 4M49A 4YPOA 3KU1A 3AG4B 2N1TB 3FLEA 1GADO 1F0PA 1PX0A 4JJ4A 2M7WA 3DYBA 1XUQA 1YL5A 2PZFA 4HUQA 1GRCA 2OZLB 4RHFA 4P31A 2Y1XA 1ECBA 2JLCA 2C5FA 2JIZG 3OX4A 1FNBA 3BCSA 3D8NA 2GT1A 2BPOA 1XHXA 4OGQD 1COWG 5IABA 4G86A 1BVRA 2YXPX 3F46A 2WHEA 5IW8A 1HE3A 1ZK3A 5F7OA 2IOFA 5B37A 4PX3A 1K92A 4KWIA 3H1KE 2X6QA 2GJ8A 1RKUA 2CFSA 1RBQA 3GVMA 4RIEA 1TIKA 5FTJA 4P9PA 1GR0A 4L0DA 1WCXA 2JFQA 3O3NB 1OFUA 1Y9DA 4S0XA 4LHWA 3ZGYA 4NHOA 1MO5A 1NKNA 3CLVA 3RVRA 5HIJA 3N7AA 5HYVA 1AJEA 4XDKA 2YIJA 1DK1A 1XBLA 3L71D 1RJ9A 1H4QA 1VE3A 4CCYB 1V16B 5JD6A 4M21A 4EF4A 3EEOA 1M0EA 3AG1C 1LUVA 1CD5A 3K9GA 2E4WA 5KTTA 3MQFA 1O4WA 4RZHA 5CG2A 2CDNA 1E4EA 1JNMA 3TX2A 3N07A 1XELA 1U0NA 1RLIA 1B04A 2B2NA 5CB4A 3W77A 5C9ZA 1B3QA 1ZONA 4N3CA 4FGJA 3MERA 4J8PA 2AN5A 3THXA 2R5NA 4QPJA 4K8OA 3IO3A 3QF4A 4L15A 3BFJA 1AVYA 2BTOA 5C5DA 4DMMA 1N9GA 4DJFC 3KR1A 3CX5I 1DAEA 2VNKA 2VHQA 4K40A 1JOCA 1GL2C 1SZXA 2WABA 2V74B 3BM5A 4OV6B 4X62B 4UJ3A 3KR2A 1ODKA 4Z4FA 3T7JA 3D71A 5CBHA 3G2KA 2HCRA 3UFBA 2R00C 1FDVA 3EVFA 4MWBA 3QEMA 4B81A 4UVCA 2FSFA 1ZHFA 1DAPA 3L92A 4E32A 4ARCA 2XMSA 3ABMC 4JASA 2P0AA 4HLNA 4NV1A 2YI9A 5AI5A 4JAVC 1AXEA 1P1HA 1T5TA 4Q05A 1XAJA 3TJZA 2BMEA 3V4SA 2CPSA 1V3UA 1W5CE 4JLMA 3AZQA 2I8LA 1JHUA 5DM0A 3KQGA 3Q7RA 4EP1A 1T9GR 3Q3DA 3ZE7A 1D7OA 5DM1A 4KQJA 1SRQA 4J2HA 5DTJA 1T2AA 4GUAA 2C82A 3JVUA 4N0PA 3CRZA 3I1FA 1L4NA 4LZAA 4XOIA 1QIEA 4AY2A 2PEYA 4RE6A 5SYAA 1YFLA 1AKYA 2XGOA 1C8BA 1JTFA 3KJZA 3KAJA 1UJCA 5M7EA 4G56A 5FJIA 1VLMA 3GFOA 2E0IA 3TKYA 1ZP6A 3RVSA 3OETA 1WHTA 4F46A 3MM4A 3G8DA 1G6HA 5DOVA 5TMDA 2CVPA 2BJWA 3EXFA 1QG0A 4FOTA 4FT2A 3NVDA 1E9EA 1KYXA 4MLZA 4BVHA 4B4OA 5BU8B 3F2IA 3H9JA 2W8BB 4QSHA 2ZRQA 5IN4A 3AL2A 4BMXA 3P0HA 1N86A 4OK3A 5KC9A 2F62A 3B6KA 1N6RA 3JRNA 2A4KA 2EGHA 1GZHB 4UARA 4QX6A 1IXYA 1CR4A 1AI7A 1ELOA 1CZOA 4S2EA 1AI5A 1RWPA 5JANA 1GNSA 2YXNA 4OTZA 3G6BA 1JDSA 1FUKA 2QQ5A 1J9ZA 3A4NA 1O03A 1BE3D 1R64A 4FE3A 1V8OA 1OSNA 4AQ7A 2LKCA 4G89A 4H15A 4B6PA 3FNFA 4RYDA 4JUDX 3X1JA 2WWVD 3ZXUB 4J7AA 5KA6A 4K46A 5KVCA 3AE8C 1W30A 1EEXB 3WIUA 1OBHA 2ERXA 2NWQA 2V7QD 5AM5A 1VHJA 2VS1A 5D00A 1HV8A 5JJ5A 2GD2A 4HQ0A 1J8YF 2X5OA 4RXUA 2X8JA 2REQA 5ICSA 3FRJA 4UD6A 4WESA 1VXRA 1Q11A 4EYEA 2Q4EA 4PO3X 2IGTA 1MP0A 4MUXA 2QYSA 1JE1A 1AU9A 2Y48A 3P9XA 2ZYVX 3MJHA 3MWLA 1R8EA 1YRLA 4CR8A 3WA6A 3DZDA 2IX3A 1AHIA 3LZ6A 2P0YA 1KO8A 3UUWA 2A9FA 2C07A 3NALA 1K0FA 3BBPA 1BXKA 1MAUA 3SJCA 1DF5A 1N6OA 4CKWA 4WN9B 4ND7A 4ZHQF 2H08A 4JOSA 4OQLA 2DULA 2ZWOA 2QN6A 3ZWPA 1IC6A 4JWTA 4UM8B 4RHXA 5LHHA 2FDRA 3WLPA 3TZQA 4JJFA 5FBLB 5AUQA 4PC2A 1WMFA 4P4NA 2BKVA 3M1AA 4ZZ2A 5B1AB 4ARSA 2GF0A 2FJ0A 2QKYA 3MP7B 2C5AA 4RD0A 2PUJA 4JR2A 1XWIA 1LUAA 3RYTC 2ICAA 2PV0A 4CE6A 4WKGA 3VU3A 4R40A 1G21A 1R4ZA 1SQXE 3LXMA 4IX9A 4M0PA 4M7OA 1SOUA 3G17A 1WD7A 2FP4A 4J9YB 2R1VA 4OQQA 4KGZA 1KAOA 2AYZA 5A1TA 4GOEA 2QWNB 3VH1A 5JAPA 2ZR8A 4PN7A 3CLSD 2V1XA 5K8JB 4Z0NA 3NAZA 3NTXA 4YRKA 2DWUA 1R0SA 3LSSA 2IOHA 4ER6A 2ADPA 2L42A 1ZYUA 3BRWA 3CKMA 2LXBA 3MMZA 4P3OA 1M6VB 5AD1A 3R7SA 2PH7A 2XKAA 3D81A 4NX2A 1P6UA 1Y37A 3N76A 5LGNA 1JA9A 4F97A 1GFIA 1KXJA 2IYXA 3OTWA 4H0LD 1XD2A 5FBWB 1IFIA 5JWPA 4ZAGA 2JJLA 4D8YA 2EZPA 4DOJA 1WCIA 1UAAA 3IGAC 1USGA 2NXNA 4I4TF 1FYXA 1R0KA 5HJ2A 3DKRA 1V7PC 4WXMA 4MYDA 2NVOA 1JQ3A 4QYIB 2QD1A 1H2MA 3K03A 2J85A 4RK5A 1U1CA 1O9HA 2Q7EA 1PNRA 1QWOA 3X3HA 4ZTZB 1WKBA 3NT2A 5KNBD 1TKBA 3QBDA 3WJ2A 2C96A 4W5OA 1C0KA 1GMGA 2G0AA 4MQEA 1N7HA 1PLLA 3ASUA 2ZSFA 3I83A 4FK5C 3QITA 3KT0A 2QSZA 4P3KA 5BVZA 3TGUD 3PUVA 1M9NA 4Y99C 1VQKP 4NFSA 5H2FH 3M82A 3T7AA 4N12A 4GXQA 5DGHA 4I6MC 1EDEA 1RYNA 1Z35A 4AK9A 2AN3A 4M0MA 3HA5A 3VH4A 1SWVA 4O2AB 5SY9A 1T4CB 4MP6A 4B47A 3ZTTA 3NHLA 3L72E 3NRCA 1PZGA 3ZJZA 3D54D 4G5XA 4B3FX 5LZ7A 3EXAA 1A5AB 5E4YA 5JDIC 1DNPA 5LMUO 2TMKA 4WVLA 2KP8A 4LJYA 4RM3A 221PA 2VP3A 1G7TA 1XU4A 4HS4A 4Z1VA 2EX0A 4MULA 3IDFA 3MTEA 4D98A 1E4VA 4QDUA 1Z73A 2KB0A 3WI7A 3B7WA 4Y9DA 3EG9B 3LSTA 1AHHA 1D2CA 1WDLA 2WJ6A 3UJ3X 5D8DA 4F4HA 4X24A 3LLSA 4N3AA 3W67A 2WYVA 5AW1B 4NZNA 1CQWA 3A9SA 4A15A 1II9A 2Q6KA 3K6KA 2YC2C 4B4KA 4P1ZA 5A02A 1W0JD 3VVBA 5TE9A 4ZGBA 3PDIA 4RPGA 3U3ZA 4OBXA 3P3NA 2PK3A 1A9XB 3A1CA 1MX3A 2P3OA 2AOTA 1IDN1 4JMPA 4K9MA 1N3LA 3RASA 5B5EZ 1DIGA 1NI3A 2SKCA 4XYBA 5EZQA 1Q5PA 3AUXA 4EX7A 2HYNA 1XPUA 3QWOC 3P9QA 5G1NA 4EF6A 5K2OA 4YLGA 1MGOA 3VZQA 1A7AA 1SH7A 5DYWA 3S44A 2ZIOA 1I1NA 1HH4A 1YXBA 4TV8A 4DNQA 1PL7A 1AO3A 4K88A 1RLUA 4D97A 1TNDA 3BQMB 1I6KA 1GU4A 1WJZA 4H13B 5EWLB 6YASA 4AUKA 1I4TD 2ZTUA 2ESRA 1L4AB 1VMKA 1XAGA 2QAGC 1G3RA 3DP9A 1YRYE 4A1OA 3QE3A 4YV1A 5EWMB 3DHNA 1J8QA 3CY6A 2C2BA 1AV7A 1ZWLA 1KPGA 3BQNB 1HR0B 2HT6A 4UV9A 2CXUA 1XQWA 1RF0A 4RQUA 4GICA 1AQJA 3O75A 2AOUA 9ABPA 4E94A 4P80A 2C54A 3L6EA 4V2UA 3OH8A 4DCTA 1HTLC 5BN5B 2PMFA 1G7CA 4HX2A 3PEV