2QM8A

Meab, a bacterial homolog of mmaa, in the nucleotide free form
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
326
structure length
320
Chain Sequence
TLPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase/ATPase
publication title Crystal structure and mutagenesis of the metallochaperone MeaB: insight into the causes of methylmalonic aciduria.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
total genus 118
structure length 320
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qm8A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2qm8A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qm8A02
2IYUA 3B78A 2LFSA 1E98A 1NMZA 3Q5EA 2GXQA 3C15C 4DDTA 3NTUA 2V4ZA 4HAXA 2ZM5A 1Z3IX 2DFKB 4B3DA 2MSCB 2OUKA 4URXR 4TMZA 4PSVA 4B47A 1HE1C 3VAAA 4N1AA 3NH6A 4AKEA 2BEJA 2QGNA 4DSOA 5FOXA 5CDFE 4HATA 1OV4A 2JLYA 3BB4A 3K0EA 4AD8A 2IYYA 2ODWA 3SYNA 1G3MA 4EJSA 1GOTA 3I8SA 2XZRA 3QF7A 1DS6A 4IFBA 2OCBA 2FZLA 2QP4A 4G3XA 4CEIB 4PX9A 2ZROA 3TSOA 1J99A 1MABA 4KJZA 4F4CA 2Z0MA 2ZJOA 2C98A 4Z1MD 1TMKA 2O8CB 1N2CE 2LKCA 3EXAA 5K8TA 3E2IA 2Q9CA 4FINA 1CR0A 3RVBA 2FMXA 1FTNA 2R32A 2IEZA 2IYWA 3K09A 1XTJA 4UQOA 4D4KA 2RHMA 1CEEA 4ON9A 4MQBA 1BKDR 1P2UA 1CBUA 2DB3A 2AWNA 4D4MA 2P7JA 1JPNA 2ZEJA 1NKTA 1W0KA 3D7MA 3KXLA 1Z0JA 2OCYC 1TU3A 3RHFA 3JZAA 5EP1A 1FMJA 2O8FB 3SEAA 1KSHA 1X3SA 3A37A 3B9PA 1GIAA 4OHWA 4Z8YA 3T06B 3WP0A 4F4JA 1S1MA 2ZI6A 1KI4A 1QRAA 4XTCS 2BKEA 2ZR7A 4HB0A 5AW3B 1LY1A 5JI2E 2O8EB 5LBIA 4EFLA 1OFIA 1SXJB 4LV6A 4NE2A 2ATXA 4RVCA 5EXPA 3I1FA 2QORA 2J0SA 3BRWD 1NMYA 1NIPA 1FTSA 2BBWA 4IRUB 4DCSA 1CJKC 1XP8A 4ESHA 1HT1E 1KNXA 4N0DA 4FPPA 4BLOA 2ZRCA 4WZAE 2R5BA 3GQBA 4PO8A 2KSQA 4XSHA 4ZCIA 5AUOB 3QSYA 1P9NA 1B0UA 2GDJA 3BB1A 2AR7A 2W0SA 1COWD 4LHWA 1PUIA 721PA 4FMTA 1NN0A 1NVVQ 1DH3A 2IW3A 2ONKA 1NN5A 4AI6A 1RIFA 1F48A 3SQXA 2QQEA 2J59A 3UANA 2WZQA 2XEXA 5E95A 1AQUA 2F1RA 3A8TA 4AKIA 4GMXA 1AM4D 1N5IA 3ICQB 4Q5IA 2QMUA 1N0WA 5EE1A 3O8DA 3CX6A 1II8B 4JLPA 2GJAA 4CEJA 3T1QA 1E2GA 2OFXA 4DSUA 1EWRA 4P32A 4KODA 5IK2A 3UG6A 2J45A 1WB9A 3DHWC 2QRNA 3CRW1 4IJMA 2W2XA 2AXPA 3TRFA 3TVTA 1QDEA 2ECKA 2CE7A 1W7AA 3GPLA 1F6BA 1E99A 2VP9A 4Q01A 1KSJA 4TLCA 5JBQA 2PZGA 5TV2A 4DJTA 5AVVB 4CF7A 4B43A 3AVUA 1KO8A 3MUFA 5EXTA 4AIIA 5JS7A 4ZKDA 1I2DA 4B34A 2FPLA 2IT1A 3FMIA 5JCZA 1ZM7A 3C4JA 1ZNWA 1P60A 2A5FA 2QE7D 3IEVA 1Q1QA 3RS5A 4XVUA 2QG6A 4Z8XA 1LNZA 4FMDB 2R6AA 4NCHA 1Z0FA 3P4YA 4Q7JB 4R2HA 4V0LA 4ZCLA 4AKGA 3QF4A 5UKDA 4FMDF 1D2NA 2C03A 3NMDA 2FH5B 3GLGA 3I5XA 5G41A 2PX0A 4AYCA 2PZFA 4TYWA 4OQXA 4KO8A 1GTVA 2V6JA 3AV0B 4BFYA 1JBKA 2IK8A 4QJ4A 1GITA 2CJWB 2QQ0A 3ZRWA 4FMBB 1RW4A 4AK9A 4XWOA 4QC2A 4A2WA 2YNYA 1XB2A 4RKEA 1G3UA 4ARZA 2QT0A 2GWHA 3LBIA 5KDLA 1IN5A 3J81k 2C95A 4IXMA 4KFSA 2WTUA 1ZUNB 4CYMA 3IILA 2YOFA 3M6AA 1E2EA 4H1VA 2ZIAA 3WNDA 1IAQA 1L4UA 4WXPA 3AB3A 4F38A 3HR8A 2XZOA 2PBRA 5CDFA 5KTYA 3WHKA 3EIHA 5JEEA 4JIMA 4PHGA 1E9SA 1X1SA 1KI8A 1BYIA 3P27A 1GKUB 4IOLA 5TVKA 1CF4A 2D4HA 4AYTA 3LQQA 4LY6A 3THXA 4EPYA 3PCRB 4NU0A 4KVGA 2WTYA 3FFAA 4CGZA 4ESVA 2WWFA 4LDJA 1VCNA 1MRSA 1YKSA 1S96A 4YMWA 4P33A 5BXQC 3SN6A 1QVAA 2F1IA 5APUA 1G2CB 1QZXA 2CHGA 1UKEA 1UBGA 1G5TA 3FKSA 3TYYA 4I2LC 3NC0C 3AKCA 2ZRIA 3I8XA 2ZYUX 1LB1B 1G21E 2IYTA 3B6EA 4TLBA 3A1TA 2WWGA 4TLEA 2JLVA 2QL6A 2V54A 3MMPA 5FTLA 3A0RA 1CU1A 4M9QA 4JMPA 4IFEA 5SZHB 4MGIR 2HXSA 1S9DA 2ZJAA 3AKDA 4OHVA 1XCPA 1IXZA 1P3JA 1GUAA 2BMDA 4UXJA 3S1AA 2FF7A 2PCJA 3RYTC 3QXCA 4C7NB 1G8YA 4BLSA 2H17A 1HTWA 1FP7A 2MSDB 3WNBA 4HAYA 2QT1A 4AURA 2WIBA 3TSZA 5AVRB 3ZLJA 5TY0A 1W0KD 4UNPA 4WBSA 3TW8B 4A6PA 1YZQA 4JS0A 1JEEA 3AVTA 1LW7A 2GNOA 3TNFA 4M1YA 1E0JA 3EPKA 4IEIA 3N70A 1XU4A 4PAQA 3VX4A 2CLDX 3BAFA 5APSA 1HBWA 2P6UA 1EFUA 4LGMA 4A1FA 3NDBB 4FWTA 2EFGA 2GXSA 1E69A 5IT5A 2OSBA 4KFUA 1FOSE 1GDDA 1KI9A 1Q3HA 1GNQA 2GZDA 1XEWY 2BMEA 2O52A 3B1VA 3ND8A 4LHVA 1EX7A 3K1JA 4TWZA 3I73A 2H1LA 3U3OA 2JLWA 5KDOA 1SVIA 4MYUA 3IO5A 1ZU4A 2ZI5A 3IBYA 1W2HA 1NI3A 1MR3F 4XD7A 1HQYE 3TNUA 4MRNA 1GK6A 3GLGB 5HE9A 1FMLA 1FX0A 3FGNA 4RD6A 5L3VA 3CH5A 5AW9B 2N42A 1EFRA 1A7JA 1GVNB 1OH7A 4AYXA 1NVVR 2RGBA 5CM9C 1JR6A 4RESB 1TUEA 4HDOB 4GP7A 2XJ9A 2OT3B 2PJRA 1DAFA 1CXZA 1U98A 3ZH9B 1E2FA 4CRWB 4HUTA 4XVRA 2IBMA 2XTNA 1W36D 2O8BA 2JEOA 1IJFA 4TT3A 1NVWQ 2CCJA 1UKYA 3A58B 4PHHA 3NBZC 4CZ2A 5GADl 1NLYA 1I2MA 1NP6A 1XXHE 2ZSFA 4QHSA 5JS8A 2C5LA 1VG8A 5J47A 3HPQA 3T1VA 3FMOB 1EG7A 2WJVA 2BASA 2JDIA 5B1NA 5IK2D 1XMJA 1XD2B 2ZRGA 3VMYA 4Q9JA 5JFGA 4D2IA 4P31A 4DHEA 3BERA 4OI0A 1G8GA 4PQYA 3THXB 4M1WA 3PUVA 1PZNA 4E5UA 1HE8B 2BDTA 3CKLA 2NMVA 1TTTA 2HF9A 2NO7A 4C2TA 4TMVA 3CUEF 1P2SA 5P21A 3WYFA 5EP3A 4DEYA 2RHDA 1FUUA 3A5TA 2A5DA 1F2UB 3KL4A 4QPKA 4MGKR 2ZQ5A 4TTRA 4V0KA 1E2JA 1G16A 3Q7PA 1JI0A 5DE3A 3ADKA 2H7HA 4U7NA 4JSTA 3H84A 1VCOA 3U7GA 5F9HA 1P73A 1JNYA 2CLCX 2V1UA 1DG3A 2EFDB 4BASA 3M9HA 3A1SA 5KSZA 4A82A 4IDHA 3E1SA 4RZXA 3RWOA 3BK7A 5FTKA 4OQLA 4RD4A 4Q9LA 2NIPA 3THOA 3K0FA 1KO4A 4Q9HA 121PA 1R2QA 3BH6A 1FNNA 3NTNA 1R5BA 4PC6A 4PHFA 2WMOB 2GBLA 2FTKA 2O0HA 4A9AA 3P1JA 1HA3A 3SC3A 3UMSA 1R0YA 1UJ2A 2O0KA 1FUKA 4YDSA 2XB4A 4OK3A 3WP1B 4MYTA 2FEOA 2HYIC 2X2EA 2D06A 3KJIA 2XZPA 4LPKA 5K8UA 5F98A 1AKYA 3K0CA 1GKYA 4X8LA 1XPOA 2Q9BA 4JLJA 1GZLA 1U81A 3RS2A 4IEEA 2ORIA 5AVUB 2VP4A 1CJTC 1W5TA 3ZRXA 2QPAA 1IY2A 3EC2A 1XZQA 3AP3A 4QG7A 3TVDA 4A2QA 4MH0R 1HYQA 2VSXA 2VL7A 1G41A 1N6OA 2YO2A 1M7BA 3W8RA 2ZS7A 1N5LA 4U02A 2NO0A 2V55B 4EPVA 3FKSD 1OH8A 2ZJ2A 3VYIA 2XTZA 3H86A 2RCNA 1FFHA 2IWHA 2FV8A 4M9SA 1HQCA 3IGFA 1JPJA 1UF9A 4QOSA 3NDPA 4Q4HB 3K70C 3I5YA 4HUQA 5APTA 2ZAMA 4KFRA 4O2LA 4Z51A 3ZD7A 2AFHE 2WKRA 3B8EB 3QVUA 2J5XA 1Q44A 4IXNA 2Z83A 1AS3A 3CPEA 1D2EA 5B2ZA 4JBXA 3K9HA 3ZZTA 4Q48A 1HY3A 4MTXA 2ZI9A 4MITA 1N6IA 2VPPA 3WMFA 4BFSA 4Q4JA 1FZQA 1G6OA 2IS1A 1DE0A 1F2TA 5B1OA 1A2BA 2XSZA 4RSGA 2ZRLA 2QAJA 1R4AA 1U8ZA 1KIMA 3OE7A 3WYGA 2QBYB 1II0A 1SVWA 1S4QA 3M9BA 4KLNA 2WWIA 2QAGC 2FE4A 4P4UA 2EYUA 1FP6A 3B8HA 5C1BA 2CL0X 1WMSA 1T0HB 3K70D 4OBEA 4C4PA 1XDBA 1AKEA 1XX6A 3CBQA 3OIVA 1O3YA 2IF0A 4YDHB 1WDTA 1K5GA 3KX2A 2DFLA 4LI0A 4N0EA 1ETUA 2OHFA 2HXYA 3QJYA 3LX8A 3F8TA 3IDQA 2ZXEB 1GRQA 3BGWA 4V0NA 3SNHA 4D0LB 3NH9A 4EPRA 2F43B 2BM0A 3NWJA 1J2JB 2RB4A 1OH6A 1N6PA 3B13B 1DPFA 4M1KA 1UAAA 3ZVNA 1IY0A 1XRJA 2J87A 3KKMA 1A82A 4AUWA 1JOYA 2VSFA 4LHZA 1XXHA 2OAP1 2VEDA 3W6NA 4XD7D 2VP5A 4PQFA 5AUQA 5GJCA 3GMTA 3DGEA 2XX3A 4WOPA 2E87A 2C8VA 1P4SA 1QBKC 4LC1A 4QNMA 1EFRD 2AN9A 4IOMA 3Q3JB 4Q7MB 3KQLA 1XTQA 3QE0A 2B7BA 2IHYA 4YXWA 1X86B 1MV5A 4NZYA 4BFWA 1J8YF 1NF3A 2EFHB 3U61B 4TT3D 1HH4A 1KAGA 2OZEA 5BQ5A 1T8UA 2O5VA 3ZZUA 1YE8A 1KO7A 1C9KA 2AWOA 5JWHA 5FBVB 1T2KD 5KO2A 3VTKA 3KZ1E 4HLCA 3OHMA 2GJ9A 1Z6AA 3GJ8A 1AK2A 1GL9B 3ASZA 5DO9A 2JDID 5J40A 3TAHA 3WXMA 1SVOA 2FSGA 5JHGB 1OE0A 1NY5A 3EARA 3VU9B 3KQNA 3AQ4A 1RRPA 2C9CA 3L0PA 3SFVA 4CDGA 4B35A 2A2ZA 4DIEA 4TSFA 1ZNXA 2JASA 4V0OA 1OIWA 5JLJA 1E9AA 2JCSA 1G7SA 4C0BA 4IDPA 4ZIRA 1IXRC 3DPUA 1GP2A 2GEDA 2IYQA 2CVHA 1DARA 3MJHA 3B9QA 1G4AE 5LD2B 4US0R 3RSLA 2YWEA 3FMFA 3SJZA 1U9IA 2ODNA 4FCTA 1W5SA 4PO9A 4QM6A 3B1XA 4DIDA 2ASEA 4WZBE 5C4MA 3TKLA 4IHQA 1KDRA 5AW2B 1W4AA 1IY1A 3VQTA 1TAGA 3ZVRA 4BZXA 4ZI3A 5JSZA 4IDQA 2ZXUA 4XWKA 4URZR 1E4VA 4GT1A 1FQJA 4HZIA 1F5NA 3DO6A 5AVQB 8OHMA 2VHTA 4I4LA 1G3RA 2X1VA 1VMAA 1EGAA 2ERYA 2W6IA 3LIDA 3RS3A 3UKDA 2ZRNA 2R5DA 1E2LA 4KI0A 5E7IA 1RYFA 1F2TB 1L7VC 3U2QA 2HLDA 1YZNA 4OHYA 4WVFA 3L35A 1R5NA 1CP2A 3FHCB 1QHNA 3GCGA 3X1DA 1NAFA 1VIYA 2C96A 4BZQA 1E6CA 2B7CA 4KV9A 3EC1A 3GJ7A 4PPGA 1ZM3A 1X8JA 2I3BA 2WHXA 2BMFA 1X8KA 3CNLA 4G0NA 3TUZC 2VBCA 5A5GA 2ZE8A 1G5RA 5EZ5A 1YR7A 2RH5A 4QJ5A 1MV8A 2YWGA 2QTVB 1AGPA 4AG5A 3AVPA 3BD9A 1VECA 2WJJA 2BVNA 2EVWX 3VHLB 1YZTA 4JJKA 1KI6B 4G5RA 2WICA 2XNSA 4B3CA 2A78A 2OE2A 3C16C 2ZITA 3CNNA 2V7QA 3PG5A 4RZ3A 5EE0A 3A6PC 2FNAA 1JNMA 1E32A 4LJ5A 2GA8A 1XXHB 3RC3A 4KSCA 4FIDA 1GSIA 1Z2AA 3C5HA 3U3MA 1ZU5A 3RS7A 1YZLA 2RGCA 3ZS8A 2G83A 2ZFCA 1FNMA 4BFZA 4BRUA 3SWFA 2WOJA 1E9BA 1E2DA 1S1CA 4BZPA 4PSAA 4A8JB 5HCNA 1KNQA 4PANA 3KKQA 3EWSA 1MO3A 4ZCMA 5TDHA 1GD2E 2WV9A 4H1UA 4ZDWA 5A4JA 2XSZD 1W4BA 1E2NA 1T6NA 4YLGA 2IYXA 3OE7D 1N0VC 2V8OA 1NLZA 1UM8A 2VRSA 5DHAA 3AVYA 3VR4A 3A1UA 3AVQA 3L0IB 5J4HA 4D4LA 3B1WA 1P9RA 2FFAA 3M06A 3RRYA 3HJNA 1RYHA 4C0AC 4QJ3A 2YO3A 3QPVA 4C3ZA 4ZIRB 3SYKA 4NL4H 3AKYA 5AW1B 1Z47A 2ZETA 4IW3B 1VTKA 4M9XA 1ZUIA 4CEHA 2BEKA 5KUTA 3TR0A 1IN4A 2YOHA 4JJZA 2PEYA 4M22A 2ZJZA 5LB4A 3TMKA 4M1OA 2KJQA 2GESA 2IUSA 5EQTA 2R6CA 5HKKA 2H7VA 1U0HC 3AUYA 3TLXA 5TMPA 3CRQA 2AK2A 1S3SA 3VMZA 2FWRA 4Y0AA 3BS4A 3LQRA 3EIEA 5DISB 1Q1BA 5JI3E 1DAMA 3E70C 1KK0A 3CF0A 5FPKA 3PEVA 4Q4LA 4A92A 4YXWD 5JWOA 2WJIA 3GFTA 3NVAA 2J3EA 4A0FA 2ZRPA 3CF6R 1KI1A 1AGRA 1RJ9B 3RNLA 2C9LY 2HCBA 2WSSA 1EXMA 4QKQA 2JLUA 2GK6A 2VHQA 4RKFA 3QKUA 1QHHB 2WPRA 1OJLA 4JLDA 4RD2A 1H8HA 1NVXQ 3M91A 4BEJA 5AVWB 2QM7A 3F0TA 4V0ME 3F5FA 3KQGA 2OFWA 4JYCA 2Q6TA 2W58A 3ND9A 4B75A 1Z07A 4OK5A 1JUNA 2IS2A 2IYRA 1TF7A 2ZREA 5SZJA 2UVQA 4DLYA 1U0LA 1BH2A 4ACBA 3ADCA 4P4SB 4TSFD 2WM9B 3T1OA 3LH5A 4NMMA 2J7PA 2NOAA 5HTKA 2ZJBA 3D6TB 2NZ8A 2ZTSA 2CL7X 2ZR9A 1IO4A 2Z5HA 2A9KA 3U5ZB 2IUTA 3A1WA 3FHOA 4WW0A 2Z5IA 1JAIA 4LJ9A 4BLQA 1P6XA 3IIKA 3C8UA 3ZS9A 5L3SB 1KTVA 1ZP6A 3DZDA 4BPBA 2W83A 1LV7A 1VCMA 3T1TA 3P32A 5M04A 3BFXA 3R9WA 4JBWA 1KDTA 3FE2A 4LYFA 3AF0A 4KITB 3B7GA 5FOSA 4OHXA 2C99A 3CO5A 4NYJQ 1XMVA 2R6GA 4O3MA 4A2PA 2OLKA 3MWYW 3OZXA 4HLDA 3EX7C 2W6ID 4G1UC 5TARA 1NJGA 2ZAOA 2OESA 1PLKA 4HB4A 3REGA 4QBHA 2P67A 1Z0KA 2FSIA 4JLNA 3I92A 2FDCA 1FW6A 4GBMA 2XZLA 2HLDD 5BN4A 4OKSA 5GJVC 1GG2A 1KGDA 3FMPB 3GJ5A 3IUYA 2BOVA 1KO1A 1OKKA 2ZPTX 1UBCA 4OI2A 3OIWA 3IEUA 4LJ4A 2HYDA 5L3QA 1CR2A 2FPKA 4QHTA 2BMJA 1LF5A 3PV0A 2WPQA 1Z28A 2EW1A 3KDSE 3LFUA 1UKZA 1Z0DA 1H89A 1IN6A 5DSZA 1XPUA 4JVNA 2N1BA 1ZIOA 5CLLA 1SLQA 4TLDA 4LJ6A 2Q21A 2VO1A 2RGXA 2QA5A 3NFQA 4FXPA 4EJSB 2JA1A 5HPYB 1HEIA 2ZE5A 5DN6A 2WT7A 1JAHA 3AM1A 1OFHA 2H16A 4DLTA 4Q9IA 1EFTA 3LRPA 2H18A 1MABB 2V7QD 1A02F 1DOAA 1L2TA 1UPTA 2NPIA 2W6AA 4M21A 4B71A 1B23P 3OEHA 2VP0A 2HV8A 3E5HA 2AK3A 3JZMA 4MUAA 1XCMA 2JLSA 5KNDA 4KXFB 3FTQA 1ZD8A 2WKPA 5E4FA 4LYJA 4PZYA 2WPDA 4DCVA 3KKNA 1S9HA 2X19A 4LYAA 3SJCA 1E0AA 1SVLA 3OAKA 2CHVA 3KTAA 4RFSA 4HAWA 3RLFA 5AUPB 4DLUA 4IOKA 3L2OB 5BN3A 4NCJA 4BECA 2FN4A 1FPMA 1MFZA 2DFTA 5FL7A 3VR2A 2QROA 5J4LA 1OB5A 1SXJC 3VR5A 3X2SA 4I99A 3I61A 2G1JA 3PITA 1R8SA 3GEHA 3DKVA 1TQDA 3LV8A 2QU8A 3UXMA 1ZINA 3C7KA 1Z06A 2WIAA 2F3TA 5FUVA 4UNRA 5HR5A 3EA0A 4NDZA 1NRJB 1YU9A 2FJUA 1QHYA 2NO9A 3I72A 4OL0A 5D3MA 3GLFE 1XZPA 1CR4A 2AX4A 3X1XA 3SZRA 1EWQA 2P3SA 2R62A 2WMNB 1Z83A 4Q1EA 3QG5A 2YC4C 1HURA 2BCJQ 2OM2A 4NCKA 1XD9A 3LO5A 1R0ZA 2RKOA 3MSXA 3OIYA 5FUWA 4KCGA 4BLTA 4CVNA 1ZM4A 4BFVA 2XTMA 4TTQA 2ZRKA 3A4LA 1T9HA 4NPHA 4M0LA 1GK4A 1D6JA 2XNDA 5G3ZA 3VR6A 1Q1EA 1G7TA 3PUXA 421PA 4H9GA 5IDJA 1FQKA 2J0UA 5HKKD 1W36B 4JASA 3PQCA 3PXGA 3VX3A 4CT4B 4R2IA 1T4GA 1KJYA 4W9MC 1QHSA 1JXMA 4X8MA 4V0MA 4F4IA 3W5IA 5JCPA 3QPWA 2IUUA 2G88A 3VHXA 1F51A 1F60A 1SKYE 3BE4A 4CEJB 3L37A 4UJ3A 1G6HA 3NBXX 2XB2A 1VYVA 2NPFA 1XJCA 5E7JA 4I1OA 1Q22A 2GAAA 4QRHA 5CK4A 3ECCA 3DM9B 3ADDA 1NL3A 1VKJA 1YZKA 4KBGA 2CMKA 4IDOA 2WSSD 2W6JA 3BH0A 5J4YA 4P4TA 3KUDA 3CZPA 4HDCA 2K5UA 1I4TD 1JJ7A 5LB2A 1H8HD 1TEVA 1RZ3A 5KSOA 3PENA 4HZUA 3VKGA 3ZRVA 1YZUA 4OI4A 3LXXA 1OXUA 1Y3AA 1KKMA 3MWJA 3L8YA 2UZIR 1DBSA 2KB0A 1ZJ6A 2OLJA 1UDWA 1H8EA 3EWAA 3WNCA 3K0AA 3A2AA 2J7PD 2JLXA 1JR3E 1PUJA 3LLMA 4TQUS 1QF9A 5F2EA 4UKDA 2WT7B 1EFHA 2X8AA 2GJ8A 3QF4B 4LK2A 2ZE6A 5C4GB 1N0UA 4PC2A 2OXRA 4NCNA 2G3YA 2OILA 2F9LA 3GJ4A 4M53A 4F91B 3QG1A 2P6NA 2XV5A 1KDPA 2GCOA 4GP6A 3ZRWB 1NJFA 1Q57A 3WRXC 2P2LA 1OYYA 1FAVA 1G291 3P7KA 3CRMA 4ARZB 1Z29A 4Q47A 4BRWA 1A4RA 3T15A 2CCGA 3QY0A 3TE6A 4TMWA 3EPJA 4F7WA 2IHBA 3OF5A 3HDTA 4MRPA 4PZLA 1N6LA 3X1ZA 4NYJR 4PQRA 4YQFA 5DI3A 2C2AA 3WY9A 5AJZA 3N2EA 2IYSA 4RCZA 5AW8B 1AA9A 1I4DD 4KAXA 4MKFA 2AL7A 3W9YA 1OIXA 1CKEA 5G53C 5FBQB 1ODFA 2D74A 1TU4A 4URVR 3HWSA 2QI9C 3NHBA 1RRGA 4G5SA 4TL8A 1OXVA 4BLPA 3ZVLA 2BC9A 2P6RA 3GLHA 4EDHA 5C46F 1C1YA 2OAQ1 3BJIC 2OBMA 3LW8A 3RSOA 4BLRA 2B6HA 1S8FA 4ZO4A 1CLUA 3HE4A 1NMXA 3SHWA 1NLFA 5D3MB 3EPHA 3QENA 1UBFA 2ANCA 3RRNA 3QOFA 4M2LA 4DKXA 3FB4A 2GILA 3IHLA 1M74A 3K0SA 4L5BA 4QNRA 3TH5A 2ZRMA 1TF2A 1OXXK 2HDNB 2P0EA 1HJBA 5CYOA 4QM7A 3M0EA 1K6MA 3WYAA 1G1MA 1L8QA 4GOXA 4V03A 5DN6D 1RFLA 2CDNA 2Z5FA 3M1IA 3AEZA 3U44A 4D25A 1KHTA 2ZYTX 3V4WA 2E42A 1GWNA 1S2MA 1PV4A 4I1UA 3DL0A 1W0JA 3OEHD 2J0UB 3TUIC 2G77B 1W4CA 5L8VA 1UDXA 1CJMA 1VPLA 3S1AB 2OV2A 2D3WA 4MKGA 1CIPA 1W4RA 4BFTA 3B82A 4B2IA 2CLSA 1DO0A 2WPDD 5CB8A 3GLFA 4E07A 1XMSA 3WMEA 4MYHA 2REOA 3VR1A 2UZ3A 5K8IA 4DRZA 4NKRA 1N5JA 2LFRA 4ZV4A 2NZJA 1IQPA 2O0JA 3W3AA 5GJWC 4DLZA 1KJWA 1U90A 2XITA 5FL7D 2QMEA 2IYVA 1KDOA 1V5WA 3BORA 4EFMA 4U7DA 3QI2A 5AK0A 4C0QC 1TNDA 3TR5A 1YJ5A 1ZD9A 2V3CC 1VHTA 1QG4A 2DR3A 3FPAA 1VDZA 2DWOA 1ZCAA 2IC5A 1OF1A 2VHUA 4W5WA 2PX3A 3W3ZB 3ZZ0A 4II7A 1VG1A 2XGJA 5ANRB 2ZRJA 2CNWA 5FBLB 5B57C 1II9A 1YR6A 1XF9A 2PT7A 5EUMA 5IRCD 1W2GA 1ZNYA 4NCIA 3P4XA 1TPZA 3TNUB 1OXSC 2HT6A 1P72A 2BV3A 2KBEA 2W2TA 4HLQB 4JLMA 4URUR 1T5LA 1FX0B 2IL1A 3CNOA 4TYYA 4D4JA 4RZUA 3B60A 2GCOB 4WAUA 3LXRA 1XEXA 2GTPA 4JVLA 1U99A 2I1VB 4TMXA 4CT5A 1G8FA 2Q5UA 2YV5A 1UFQA 4LSGA 5G40A 2XNDD 2G0TA 3H4MA 5CJPA 2ERXA 2YINC 2IS6A 4BEBA 5EP4A 3CRRA 1DADA 3X1YA 2O8BB 3UWKA 3K9GA 3SJAA 3C5CA 3VR3A 1T3SA 3UPUA 2CHQA 2DWQA 1GL6A 1G5PA 2I1QA 2RAPA 1U94A 5JRJA 3R7WA 5F9FA 3BH7A 2C04A 4B44A 5LDDC 3M4YA 4DSTA 3RANA 2E43A 2ORWA 1CRQA 3QEJA 3OAAA 1SXJE 4TYQA 1E79A 1RE0A 4JZKA 3UK6A 3N5CA 3TBKA 3VNUA 3ZJYA 1JR3A 4LJAA 3BOSA 1Q1ZA 1BOFA 1YRBA 5SZKB 1T3HA 2F9MA 2QTFA 3PUYA 4D80A 2R9VA 2ZUDA 3UIAA 4C30A 2W6JD 1NBME 3ADBA 1P7CA 3HE4B 2CK3A 2Z6VA 3CW2A 4Q1DA 3VKWA 5KYKA 2DCUA 2OXCA 2VF8A 2QUZA 5CM8B 1V43A 5GVSA 3ZVMA 4DB2A 4BFXA 1GAJA 1ZCBA 3RC8A 3HP1A 2YOGA 4DDUA 3FKQA 1YZGA 4NTZA 3LA6A 5JRZA 4UXIA 5FTJA 3FYHA 2REXB 4NHOA 1H8ED 3QNUA 1CS4C 4LHYA 4JSYA 2A5GA 2GVZC 5JECA 3W8NA 3VMXA 3U44B 3AVWA 1R10A 1US8A 2D62A 2FFBA 3CPJB 4LV5B 4HLUC 2ZJ8A 5APWA 1XNJA 4US1R 2H5EA 2PZEA 4US2R 2BJVA 3ZDQA 2ZS9A 4KP4A 4MDFA 3K0FB 2R44A 1RRFA 4EPXA 4C9BA 1KK1A 5KU1A 1UADA 4FCWA 3R8FA 4GL2A 3TQFA 3VNVA 3GLFB 3D8BA 1QG2A 1JEDA 2PL3A 1W49A 5DGXA 4LV8B 4C0HA 2KI5A 2QSZA 4TYPA 1NWQA 2WWHA 4IDNA 1NVUQ 2EFEB 1W1WA 1WBBA 2RGNC 3QVVA 5FOUA 1G7RA 1WXQA 1G9XA 1JXOA 3FDIA 5IHPA 1OLOA 3P20A 5E3HA 5B30A 4JKIA 4MUBA 5CK5A 1T3LA 4UNQA 4EUNA 2BM1A 5AW4B 2Z4RA 3T12A 4Q20A 4PXAA 3W34A 1E2KA 1TQ6A 3KJGA 4XVQA 2BBSA 4OHZA 1CRPA 1KY2A 1IXSB 1E0SA 1SULA 3B5JA 1ZAKA 2GEUA 2CBZA 4XIGS 2PMDA 1TF5A 2VP2A 5AJYA 3L0SA 3QXHA 4LX0A 2A7QA 3SYLA 4C7OA 1OWAA 4TN1A 5G3YA 2J46A 2VTKA 4ZPXA 3T34A 1E9DA 2CVFA 5FR2A 3SI7A 3WBKA 2ZRBA 3V5BA 4RFVA 2J0VA 4KYIB 5JJKA 3K9LA 2SHKA 4URYR 1E1QA 2GHIA 4HUQB 3B1YA 1E2QA 3SR0A 1OYWA 1XEXB 2AD5A 2GCPA 4HAVA 4GDFA 2GZAA 1EX6A 2RGGA 1W48A 3ZYCA 2NTYC 4L9SA 1X8YA 1W0JD 2YKGA 1G20E 3NEJA 1XBTA 4FWIB 1N6RA 1P62B 2FSHA 4Q4JB 1M34E 2JJ2A 2P5TB 4GMDA 1XTSA 1P2TA 3U7FB 3R7WB 4CEIA 1H65A 4QBFA 4MYCA 1FOSF 5KSPA 3EA5A 1G19A 4QBGB 3A36A 3NHAA 4F93B 4ILEA 4I1SA 1OXZA 4AQRD 1TEXA 3MWKA 4WA7A 2JAQA 4UNNA 2VRWA 4GZLA 1U0JA 4EOTA 1P5ZB 2H57A 1J70A 4R7ZA 2GRJA 2YVUA 3A1VA 2IYZA 5H8WA 3W5JA 3RWMB 2FU5C 2YJTD 3A7OA 3N2IA 1E3MA 5AR1A 2WKQA 3QXJA 4M4SA 4PAMA 2JLRA 1AIPA 1P9WA 2CNWD 3EZ9A 3QBVA 3DMDA 4Q9KA 3R20A 3RS4A 3A4MA 3BXZA 1AS2A 4POAA 1BS1A 4B3BA 3SE0A 4BFUA 5APVA 2KP8A 4ZDKA 2O8EA 1NN3A 1FL9A 4UXHA 1XFAA 4M1TA 4S35A 2F1JA 4X8OA 3CR8A 1BYUA 4JL6A 3CH4B 3QQ5A 1SXJA 4DC9A 1A1VA 4GSYA 3T35A 1KSGA 3K53A 3MFYA 2GBLC 4LJYA 5AW6B 1KMHA 3ZGXA 4GFDA 2JJ1A 3EZ7A 4PPNA 5KNCA 3RRZA 3QXXA 2C9YA 4ERNA 1I4LD 1NBMA 1QHXA 4HB2A 4MA4A 3UMRA 1H8AA 1LVGA 1G3QA 1JQLB 2KBFA 4Q7KA 3CIOA 4DZZA 5CJ2A 3LAWA 3QUSA 4UNSA 1MKYA 4E09A 1VG0B 1Y63A 1P2VA 1LS1A 1R7RA 2D2FA 2BHRA 5APYA 2FX3A 1ZC4A 4W7SA 4W5JA 2Q3FA 2YYZA 1GM5A 2XU6A 3U3KA 2Q3HA 4L4UA 3OAAD 4OQNA 1E79D 1CSBA 1XWIA 2FFHA 2VLIA 3H1TA 5CMZA 5D3QA 1JR3D 1PJRA 1BMFA 1CULC 1LF0A 3M0DA 3M0AA 3FVQA 5SZIA 2OG2A 1U2RA 1OSNA 3FOZA 3NEYA 1E2IA 4KYUA 1WCV1 3MAAC 4MT8A 4B73A 4ZI2A 3AF4A 4Q1AA 2ZI3A 2CK3D 2YWHA 3CB4A 2C78A 2UKDA 1CJVC 1VHLA 1ZD1A 4B86A 3AGQA 3GJ0A 4JAUA 2N46A 2J7KA 5DHFA 5FI0B 1MO5A 2J0QA 2IS4A 5EE3A 4Q21A 3MD0A 4PC3A 3ZQ6A 5C18A 1IBRA 4C7OB 1Z6YA 4FI3C 1OFTA 2CCKA 3IBGA 2EQBA 3IPYA 1OIVA 2DY1A 3X1WA 1WRBA 3U6KA 2VYFA 2Y8EA 3GD7A 2NO1A 4G5GA 3Q85A 1GNRA 1SVSA 4OJKA 3CF2A 2C2HA 3LD9A 5BN5A 1P75A 4ASUA 4JKYA 5JSZB 2MSEB 4Q00A 3G82C 1VIAA 4CW7A 3CX8A 1R0WA 3LY5A 4DUGA 5FBWB 3QXSA 1VG9B 1W47A 4L9WA 4S2EA 4TMKA 3REFA 2WJHA 1JQJC 5AVXB 3FWYA 5KOYA 3DVLA 2OBNA 5GJBA 1AQYA 2NQ2C 3EZFA 2F3RA 4LC0A 1Q20A 5CIWA 1ZIPA 5JEDA 3IIMA 1Z6XA 1HV8A 1UBEA 3GJ3A 5CLQA 1NY6A 3BFVA 4C46A 2W00A 2CJWA 3GFPA 1L4YA 3MGCA 5AUNB 2D7DA 4G5OA 2OFOA 1N6HA 3GEIA 2PCLA 4QL3A 1ZYUA 4D26A 1E0KA 1Z2CA 4EQ6A 4OK6A 1SZPA 2NO6A 2H8KA 2CE2X 1YR9A 1IN7A 4LUCA 1N25A 2ZYWX 1M7HA 3K9NA 2R3CA 1Q0UA 1GNPA 3ZCCA 1KYIA 4PTLA 1NIJA 1LS6A 2QM8A 3KJEA 3AVVA 5J4KA 2A30A 4FD2A 4W5HA 4GOJA 1P61B 3NBYC 4JL5A 4JLAA 1QHIA 3P26A 4PAOA 1MO4A 2PLRA 3LBNA 3RAPR 3CWQA 4B76A 4P3YA 4MKHA 3G0HA 2QMOA 2IPPA 4A8JC 2WJYA 3R9IA 1E1QD 2OO7A 4DLVA 1LFDB 4M1MA 4AC9A 4M3LA 2KE5A 2NGRA 3T5DA 5DNYB 1KO5A 1OB2A 2NG1A 4KSBA 1KK2A 2V1XA 2ONJA 1KMHB 1XTRA 2WAYA 4DLRA 4DVGA 4Q4AA 4LBVA 4HI0E 4LJ7A 4QGAA 2ODBA 1C4OA 5EE9A 2J1LA 1E2MA 1VYUA 4B6EA 1GRRA 4D0NA 4R71A 3THYA 4Q02A 1WE2A 2X77A 1ZUHA 3ONWA 2JJ2D 2GAOA 3OESA 4JLBA 2C77A 5FOVA 4KHXA 2IXFA 3EIQA 3GEEA 2A5YB 2ZSBA 4LBYA 3ZD6A 1J90A 1AJEA 4O0MA 4RY2A 3AGPA 5L3RA 4C7NA 2OCAA 3OEEA 4F92B 1H88A 4L8GA 3WBJA 4MDEA 3I3SR 4OI1A 2B8TA 5FPTA 3W6PA 3F3YA 3G5UA 1XJQA 4EAQA 5AJVB 1U9IC 4DEXA 2OCPA 1A5TA 5CYPA 1Z63A 2REBA 5FFMA 4GKGA 1YHNA 1IHUA 2XOKA 1BIFA 4CEHB 3O8BA 5FL3A 5FPSA 3GLHE 2ATVA 5C2JB 2G9NA 2QSYA 3WRYC 1X8LA 2Q3MA 3NXSA 2FPMA 3LDAA 3MG9A 3TQCA 2ZJ5A 5JMTA 3MRSA 1VYTA 5BYJA 4IVRA 4X8HA 2QP9X 3DZ8A 4A15A 1Z0IA 4I5SA 221PA 1AS0A 1SXJD 4TTPA 1IXMA 2FA9A 4PFSA 1ZM2A 3BC1A 1ZVQA 5AW7B 1WQ1R 2Q0HA 3DEFA 3FFBA 4LZZA 3LIEA 4OQFA 4EFNA 3B1ZA 1SVKA 1ZW6A 1KAOA 1E1RA 2GF0A 2JJ1D 1KK3A 1TUIA 2BWJA 4HYTB 1NBMD 1IM2A 3H2YA 2WWYA 2WBLC 3HPRA 1KI2A 3VKHA 3DDCA 3UIEA 3AP2A 2LCFA 4HB3A 1XEWX 3ICEA 4JVMA 5LPNA 5H68A 4C0JA 1M6NA 4PR0A 4EQ6B 1G17A 1CTQA 3NBFA 4JVSB 2QN6A 1Q3TA 2HJVA 1YR8A 4Y0VA 1N6KA 1BMFD 3KXIA 3IPXA 4KU4A 2IX3A 4ZKIA 1DG1G 4HAUA 5EP2A 5BWMA 2IF2A 4RJLA 3BIFA 3BB3A 1KZGB 3D3QA 2P5SA 3LVQE 4RCYA 4M1SA 1G4UR 1CR1A 1QVRA 3UG7A 5TB5A 3U7HB 1XD2A 1GFIA 2PEZA 1BO6A 1TX4B 4QPJA 1KZ7B 5DLQC 1DO2A 1MOZA 2VF7A 3CLVA 4EPWA 6Q21A 3EW9A 1Z8FA 4LBZA 1RPZA 5JJLA 1DAHA 1SGWA 1N6NA 3HYTA 4JT2A 5A0FA 4TQAA 2QAGA 1NG1A 1A02J 1KJZA 1WA5A 2BCGY 4JLKA 2MMCA 4B3GA 3QKRA 3TK1A 4QBIA 2DWPA 3O47A 4MRRA 1DAEA 3Q5DA 4ASUD 3SHFA 1F2UA 2Q9AA 2EU8A 2ZSEA 4FW9A 3BFKA 5AVZB 4JLOA 5FR1A 4ACAA 4Q4AB 4B2PA 2DYKA 2ZSAA 4YMUA 3B85A 1R0XA 3UWOA 2QEQA 4DUGD 1R8QA 2P65A 1TQ2A 4DSNA 1E9FA 4B3XA 1XCGB 3THYB 3MGNA 5CIQA 3QKTA 3CWZA 3U4QA 4E22A 3V4QA 3AUXA 4URWR 1DELA 2ZRAA 4KBFA 1GZSA 3MLEA 1M2OB 3CONA 3QEOA 4LYHA 1PVOA 3DMNA 4MRSA 1GTWA 3B2EA 4QGFA 4ZDJA 1GKIA 1LTQA 4TLAA 3PJRA 4A6XA 4BE7B 2BJWA 4AYWA 1PLJA 3OIUA 1Q21A 4FN5A 5JHHB 3NKVA 1E4YA 1NSFA 1W46A 1ZC3A 2HUPA 5H70A 5L3QB 2V6IA 5FUYA 1KOFA 3TUJC 1KY3A 4C0SA 4EJSC 5APQA 3KJHA 4GRAA 4DWJA 5EXXA 3L36A 1KQLA 2CL6X 4D82A 1S9KE 1E2HA 4HLUA 5HZKA 5JWRA 4TZ0A 1OT3A 1GU4A 1IONA 4B6FA 1S0UA 4PPFA 4UJ5A 3GFOA 4LWZA 2HJGA 4LPSA 4GCZA 4BIUA 5FOTA 4DLWA 2FG5A 3Q9LA 3W6OA 3EASA 4K8OA 1FOEB 2DHRA 1XTKA 3SS8A 3GJXC 3K09C 5JJIA 3C41J 4QFMA 821PA 4B33A 5AJXA 2A5JA 2WPSA 2RGNA 4TL6A 5DYGA 3WMGA 3I4LA 1ELOA 1G3IA 4JBYA 5DH9A 4YMSA 1HWTC 2HCJB 3OFNA 2N9BA 3TJZA 1M1YE 5GVRA 1JJVA 2QMHA 3PEWA 1G18A 1TQ4A 3QPUA 2QRZA 2F55A 1RRCA 3UATA 2VQSA 3KTAB 4RFSB 2GK7A 3EPLA 4PZZA 1ONBA 2CXXA 3L82B 4Q4HA 1DAKA 3SDZA 3KDPB 3NIBA 4RD1A 2PJZA 1O87A 2F6RA 1DAIA 3AP1A 621PA 3SBDA 4WZ6A 3HYRA 1EK0A 2FGKA 3VFDA 4R98A 3VMFA 5AJWA 1G64A 2IXGA 1T5IA 2PT5A 3PFIA 4IKEA 4ABYA 1NNEA 2G1KA 2ZJYA 1OKKD 3K70B 3KFXA 2HF8A 5KNBA 3K8YA 2ZANA 4NP6A 1RKBA 3OEED 2RGDA 2JIZA 3PVSA 1K5DA 2YNMA 2FSFA 4TMTA 521PA 2QBYA 4NYIQ 3I62A 4PO1A 2DFNA 1NKSA 3ETLA 5FTNA 5EZ6B 5H1YA 5AVYB 4GI7A 2ZE7A 4RD0A 2ZI4A 5APXA 3D31A 3LNCA 1W36C 3GLIE 2XOKD 1ZM9A 4B74A 4AG6A 3U60B 2AKAB 1UEIA 3CR7A 4J0QA 2JGNA 2QAGB 3LWNA 2AXNA 2IXEA 4TL9A 5IDVA 2Z4SA 2F43A 4JAVA 3QKRB 3QKSA 3KB2A 1J2JA 5B58C 4YC7A 4HYYA 1M8PA 1JALA 2QGZA 2LWIA 4JL8A 4XTRA 2R6FA 1ZRHA 5K8LA 4DLXA 1YRAA 3VN0A 3GP8A 2IYLD 1T8TA 4OYHA 1N5KA 2GJSA 3HTKA 1MT0A 3SOPA 3AVXA 2G0NA 2EYQA 1E1RD 3O8CA 3U4QB 2J9RA 5C93A 3IQXA 1YQTA 3KB1A 2VH5R 3VTPC 2EFCB 5BW8A 1R6BX 4I81A 2JJ8A 4LJ8A 1Z6TA 3U3RA 3KQKA 2R2AA 2F7SA 2PH1A 4U5XA 4I6MC 2ZI7A 5J4VA 2WVJA 3LX5A 5EXSA 3A4NA 2QY9A 5AVTB 4AY2A 4Q1FA 2RGAA 3JVVA 2WOOA 1OHHA 2IWRA 3A3YB 2CEAA 2JLZA 4KVAA 5BYKA 1SHZA 4HZUB 3I5CA 4CIDA 1PLLA 1T0JB 5KPJA 2YWFA 4GPTA 1ANKA 4R9UC 3BWDD 3ASYA 4ZDIA 2JLQA 3ZIAA 4GNKA 1ZNZA 2WAXA 2YHSA 4Q7LA 3K0AB 5DI9A 4EIWA 1T91A 4XSGA 1EFCA 4RZ2A 5KSYA 1IN8A 2Z43A 4XOIA 5FUXA 1R5OA 3MCAA 4D6PA 2EWVA 4JYBA 1UEJA 2HEIA 3DOFA 3U7EB 3VU9A 1MH1A 1XJ0A 3C14C 4N3NA 2KWIA 3HE5A 4Q03A 4MGYR 4KLZA 1GU5A 3MWLA 3D36A 3TW4A 3THWA 2VIIA 1GRNA 4QGGA 3PEUA 4BWYA 4PC1A 2ZS8A 5FI1B 2GVDC 1D9XA 3SQWA 2ZR0A 2DBYA 3NC1C 3O8RA 3PR1A 3RDPA 3KQUA 1XD8A 5FTMA 3R8CA 2GXAA 5DI3B 5FH9A 3CPHA 4M8NE 3IQWA 1ESNA 2ZSDA 4PHTA 1Z0AA 2ZUBA 4XE5B 4O25A 4DT1A 5CITA 5FPYA 3U6BA 3QIAA 2QTHA 2AD1A 3IO3A 3CM0A 4OQMA 2GEVA 2G6BA 4A0RA 4K46A 1KKLA 1D2MA 2GCNA 3DOEA 4K81B 4XWAA 3GLHB 5EJEA 5KDDA 3UMFA 4PSKA 3RS0A 4MRVA 5AWFC 4FCVA 4IOJA 4PPQA 1X1RA 4G5QA 1CZQA 3LLUA 4FMCB 1G7CA 4DCTA 2BIFA 2ZU0C 4NYMQ 2YC2C 1SKQA 4PC7A 4TQ9A 2VHJA 3EZ6A 4XJXA 4FMCF 4NH0A 1Z5ZA 4QXAA 1A2KC 2LKDA 1IJEA 3JVUA 2E1RA 5CB6A 3V00A 1YVDA 1SHKA 2P2UA 2RMKA 4BGDA 3IHWA 3MJRA 4LOAA 2MMGA 2WWWA 1WF3A 2QZ4A 4U00A 3SBEA 4IVPA 3H0KA 5J5CA 1E96A 1KI7A 2PLFA 3QKSB 4JT4A 4DCUA 1NSTA 4ITRC 4B48A 4L15A 3AF1A 2GZHA 2W0MA 1SQ5A 2X2FA 3OFND 3SFZA 1KI6A 1YYCA 5E7MA 3AVOA 4DB4A 1J8MF 1XMIA 3WHLA 4HSEA 4O2RA 4NONA 4Z1MA 4V02A 1U8YA 5DYIA 1W44A 2F1HA 3P8MC 2L0XA 1XPRA 2ODEA 2PMKA 2TMKA 2ZRDA 4A4DA 2XXAA 1E9CA 1E9EA 3HU2A 2GXUA 2EWWA 4KHZA 2GJKA 4DZOA 2J41A 2AFIE 4OJQA 4D0GA 4TZ6A 3GLIA 2O8DA 2GETA 1D8TA 2XAUA 4B2LA 4ZKEA 4GOKA 3T61A 2ZYVX 4A8JA 4U7OA 4D81A 2IEYA 3R9XA 4B3FX 1CJUC 3CRVA 1AZTA 2DPXA 3IKJA 2A3RA 4BIZA 2C9NY 2JIZD 1E2PA 4IVQA 1EESA 4NYIR 3TSWA 1CI6A 5HZHA 2VHCA 1DVRA 4Q66C 3RRMA 5FBRB 2VP6A 3V9PA 4DXAA 5LD2C 4Q19A 4JLVA 4Q18A 1ZMXA 1SKYB 1E9RA 2AHOA 2BBTA 4LHXA 2WWXA 3AKEA 4LCBA 1S3GA 1F3OA 2QENA 3Q72A 4C2UA 1UKVY 3GJ6A 3HE5B 2ANBA 3L43A 3THWB 1SP4A 3AH8A 3EG5A 3NG1A 3QBTA 3T97A 4YONB 5ELXA 3FHTA 1JECA 2Q7CA 4BQSA 2QPTA 1T2KC 2W27A 3RABA 3O8ZA 2ZRHA 1Z08A 3KFVA 3SJBA 5FOWA 3KKOA 3U3JA 2W2VA 3CX7A 3IR9A 3KUCA 3LBHA 4P0TA 4YMTA 3BBPA 1OPXA 4HAZA 2ZVPX 1MUUA 3KQHA 1NN1A 2E9SA 2BKUA 1TL7C 1COWA 1WP9A 1IOZA 4DDVA 1E94E 4I1VA 1D5CA 2ZU6A 4DT1B 4E03A 4EPTA 2D7CA 4Q1CA 2O8CA 2GKSA 2ZVQX 3DKPA 3LW7A 4YMVA 1DAGA 3TIFA 5IF9A 1K8RA 1RVDA 1NG9A 1XTIA 3SU8A 2OEPA 1XEFA 4AWXA 1OFUX 4DBLC 4A0GA 2AKYA 1KMQA 1D9ZA 4LRWA 1ZBDA 4DDWA 5JZVA 5HCIA 3EAQA 3W90A 5AW0B 1KSFX 1M7GA 4BUJA 1OHHD 4C0LA 4DLSA 2HT1A 1KI3A 4QGHA 1MO6A 4WXRA 4AKHA 1OXTA 1RJ9A 2B8WA 2D2EA 1HT2E 1Z6GA 2B21A 2O8FA 3TGPA 4QHYA 1QHHA 3EZ2A 3PIRA 4XH9B 3HR7A 1AN0A 2XJ4A 2JATA 3ZIAD 2RGEA 4Q1BA 2YZ2A 2R8RA 3LVRE 5B64A 3T5GA 1N3BA 2FZ4A 2QNRA 1SVMA 4RD3A 3L0OA 4LBWA 1GILA 4MGZR 1US8B 4EKDA 3TAUA 2OBLA 3IIJA 1ESMA 1AZSC 2QPOA 2QE7A 4P4SA 1OW3B 1GL7A 3DM5A 5EUQB 1VCIA 5DIFA 1G8HA 3KKPA 4A36A 3Q7QA 4HEJA 1X6VA 2JJLA 4TL7A 5KHOC 3L8ZA 1WBDA 2R6DA 5TXGA 1HUCA 2BBOA 4B32A 2V9PA 5AVSB 3K0CC 3V4RA 3PUWA 2H92A 5EE5B 5KPDA 2ORVA 3HU3A 3AF3A 1S9KD 1J7KA 2I4IA 3ZQJA 2IA5A 1G8PA 5L3SA 2Q3IA 4TYNA 2GF9A 1RC8A 2XXAB 1Q12A 2C9OA 4Z54A 3CZQA 2R65A 1HUQA 1TADA 4GZMA 4KFTA 3PUZA 4NBSA 1OH5A 3AF2A 4WIAA 1JB1A 3GLIB 3Q8XB 2O8DB 2ZRFA 3I32A 3V4FA 4C0KA 1DTSA 4MKIA 2VA8A 2FEMA 2FOLA 1II8A 4HDQB 2WSMA 4G01B 4DCNA 1QHGA 2VSOA 4NYMR 3KXKA 1U8AA 5HE8A 4A0HA 3GLGE 1DEKA 2FFQA 4M9ZA 3PEYA 5F3WB 2B92A 2WJGA 5FPHA 1CI6B 4L16A 3HU1A 1Z22A 2FGJA 2ZUCA 1MRNA 5AW5B 2QP3A
chains in the Genus database with same CATH superfamily
3Q2YA 1KC8Q 2DFKB 3U81A 2EQ5A 2B4TO 1JWBB 4F71A 2I2AA 4AJJA 1YS4A 3GAAA 4AAYA 4REMA 1F4MA 4LWSB 4DNFA 1W52X 4CKZA 2BCCD 1BN6A 4X6UA 2V9ZA 4MROA 4GKVA 1TIKA 3WJ2A 3WS7A 1QBZA 2FW6A 2EZOA 4X95A 3JQQA 1V5EA 5AKZA 2NN4A 3COJA 3AG4C 1P1JA 4DCJA 2O8FB 3Q7RA 4R2XA 1QYVA 3A37A 1SQSA 3N9IA 4D9JA 1DLBA 4RVCA 4F06A 2AOUB 3SWKA 2BL4A 4ESHA 2X5JO 4I3HA 1L5NA 4RV9A 4Z3DA 5AUOB 1OWMA 1VL1A 2EZ9A 2WA1A 2IYPA 2IW3A 2J59A 1SRYA 3H7AA 3WYDA 1WWKA 3CX6A 2NQ8A 4HWKA 5CVDA 1QFMA 5E4JA 3PE3A 3SFDC 4DSUA 1WB9A 1P7YA 2AXPA 1GQSA 3CF4A 3SLRA 4WI1A 4F9FA 4J11A 2H2GA 3PKZA 1D5WA 4D3SA 4BXOB 4HNSA 3AE7C 3AE2C 1K6IA 4ARCA 2NO5A 2HNBA 1XJWA 1ZM7A 2OO5A 3C4JA 1VP7A 4M38A 3VR0A 2I65A 3SSAA 5C4IA 2FH5B 3RK3B 2Q5FA 4KO8A 2QV7A 1RY3A 3ZRWA 4FMBB 2JI8A 3T1NA 2Z3ZA 1B14A 5HUQA 3J81k 1Q86W 1CUHA 2WTUA 3AEQB 4LXUA 4L51A 3OQNA 4K87A 5A02A 4Y67A 3NV9A 3T0IA 2NW6A 3THXA 3SVTA 1N5DA 4GX5A 3RU2A 2WJPA 3CVWA 4ESVA 5CA1B 3ZEIA 4A5UB 2FFDA 2QI9F 4U8GA 2OV8A 4WLOA 2DWEC 1G21E 3CGGA 3D4BA 4BNNA 1H6DA 1R9MA 2GMWA 1TZ2A 3FSGD 1JBQA 3LPLA 3DXYA 3H32B 3GNTA 2AXCA 1A88A 1I3NA 2G17A 3AKDA 1Z9BA 3OE4A 2FF7A 1K88A 2H17A 2A14A 3WNBA 4FZ5A 4JIGA 3WO1A 2QT1A 3DVRX 4KP7A 1VKZA 4F12A 2C2WA 2JA2A 2DQZA 1D5AA 1QIFA 4F2GA 1JG3A 2PUHA 2P6UA 1I7QB 2BGTA 2XT9A 2O52A 2IPXA 1URQB 2OK7A 3AESA 2OB2A 2HFKA 3QVXA 1EZVD 1W2HA 3LCMA 3VMAA 4R4JA 3PXEA 5ENDA 1JQBA 2KLBA 3BEOA 4FM1A 2O8BA 1EXJA 4MTFA 3OMAB 2CCJA 4JJAA 3EFOA 5EIBD 1E3EA 1VQ9P 1AE1A 2OYSA 1FRNA 3CUEF 4DEYA 4I50F 4XIYA 4NWIA 2A5DA 4QQFA 2FI1A 3QWOC 1O9HA 2PUVA 3N0XA 1BZKA 1V7ZA 4U7NA 3H84A 1WMEA 3ES9A 2Y1DA 3I4FA 2XT0A 3VSAA 2FAXA 2IJKA 1YQUA 3THOA 1Z34A 2NIPA 3KCXA 121PA 3OJEA 1KOLA 5CTAA 4YCDA 3L1JA 3AERA 2V4UA 4XM1A 1D09A 1G21A 1NW9B 1NVPD 4WZAB 1E3QA 5BQOA 3OQMA 1X1TA 2UXBO 4MICA 2XVXA 1VL2A 1CJTC 1W5TA 1XZQA 1DKOA 4H27A 2YEVA 3PNYA 3TVDA 2P4EA 2MKVA 3GRYA 5EUBA 5LHIA 2ZS7A 1IK4A 5A9TA 2W8ZA 2IP4A 4H3HB 4N01A 4E5VA 2LCQA 4WVZA 4EO4A 2AFHE 4B82A 4U2KA 2YIBD 3Q8KA 1VE6A 5AVQA 1TFRA 1ECBA 2MOKA 3H1LE 2IPNA 1DE0A 3L75E 4R5MA 3RSGA 1DTEA 2ETXA 3QUAA 4EW1A 2CL0X 4IIDA 1PP9D 4OBEA 3V7WA 2NSJA 2WFLB 1XZLA 2ENUA 4YAGA 2EKBA 2ZBRA 3E3LA 2PV7A 4MMZB 2AN1A 1LA2A 1Z7WA 1N6PA 1YJ8A 1DOZA 1XRJA 5DCUA 1W4ZA 2X15A 3A6FA 3W6NA 4REOA 4XD7D 1GSAA 3LHIA 3OW2U 2E87A 1QBKC 1N73C 4MVJF 1XLVA 2XUQA 4WTOA 3ZDXB 1D3AA 3SS9X 2QR4A 1EFLA 2JDID 3RFFA 3EARA 3VU9B 3UMBA 3L0PA 1Z8HA 4ZEWA 2AXTE 4Y2UA 8ATCA 2DZDA 1P0CA 3IESA 3FIJA 1JEJA 4NS4A 1U9IA 1JO5A 1Y4ZA 3ZE8A 4ER0A 1ZBQA 1B0AA 4F9GA 5TT0A 2QKAA 1AUQA 2EKDA 1X39A 5CX1B 2GYWA 3WSWA 5JAZA 2JGEA 1RYFA 2ISCA 2ZSJA 1SQBK 2B7CA 4PPGA 1DQSA 3OURA 1FLNA 2G40A 5EZ5A 2O8VA 1FPQA 1KFJB 1AGPA 1AILA 3IPRA 1NYLA 3WA6A 2EVWX 4RM3A 3VVBA 2A33A 4KSCA 3VC7A 1L5QA 2ZKLA 3RS7A 3SYTA 3LIPA 3LL4A 4QYIB 2P30A 1OU0A 1JDZA 5H5JA 2CZQA 4UZSA 2LO1A 1YAHA 3R4YA 5LQJA 3AUAA 1CZLA 3A28A 1XK6A 4PV1B 1VQPP 1MD9A 3DP7A 3QRWA 3GRRA 4IW3B 1JW9B 4PGMA 3KJFA 2PFKA 1KDVA 2PA0A 1EDIA 3VMZA 4S0XA 2Q0QA 4B6SA 3BAZA 3VVCA 4PIPA 5IJXA 1OBFO 1GPBA 2AZ2A 1D5NA 2RGRA 1AGRA 3ZW8A 4JYYA 1WV0A 2CFOA 4TRMA 3V3TA 3M91A 3S8YA 3DGFC 3GIDA 3ADCA 1N2OA 4BO7A 2J7PA 4YJGB 5IJ0A 2QKCA 4KIFA 4OH7A 4BN4A 4MTLA 1IFNA 2V7QG 4KREA 1WS6A 3ZDRA 4N78D 3UJNA 3FE2A 1X4TA 4HVLA 2OP0A 4O3MA 1ZSVA 2GERA 5HRAA 3EX7C 2A06E 4I55B 2XZLA 4Z4GA 2X0LA 3K0KA 4INAA 5GJVC 2RE8A 1FZAA 2IBZH 4BE9A 5DSZA 4JVNA 1PTKA 1AVMA 1ZIOA 4L4ZA 3HFJA 3ODGA 1GV0A 4GO1A 5ER9A 3WAKA 1B26A 2BGWA 3MC1A 4B40A 3ZHYA 3ZLUA 3OEHA 1RHUA 1EP9A 3E5HA 2WD7A 1BGYG 5CPFA 4MUAA 3FTQA 4D4HA 1KILB 1DZIA 2W22A 2HGZA 4UTPA 4YJFA 2P77A 3PFHA 1FPMA 2WF8A 2EDAA 2P2NA 1XZPA 3X1XA 1ZX1A 4PCUA 3HZHA 2PR2A 2B1QA 4C22A 4OUDB 1JY3O 1P3DA 4IX9A 1VKRA 5HIKA 4CTKA 2CEKA 3ZGOA 4AWAA 1NOJA 1UC9A 4WY4A 3KVVA 1JHQA 4Q3DA 3BWEA 4OQPA 3PUXA 1J1UA 3U3ZA 3PQCA 2WMDA 4KXNA 2R1VA 4IUCS 3UT6A 2WSFJ 5H83A 1DGQA 4AJKA 3L0DA 1F60A 4I5IA 1K8ZB 2ILTA 3G9TA 1KU9A 3NBQA 2XAAA 3O0DA 1VKJA 3EVGA 1Q0HA 3PC8C 2B4YA 3TTXA 3RYFA 3G23A 3QWAA 3DBLA 1W581 1EINA 5JPDA 3DWEX 3L8YA 2KB0A 3UBMA 4NJMA 3WNCA 1JR3E 1PUJA 4U3FG 1IHPA 4UKDA 2X8AA 1EK5A 3L8HA 1N0UA 1EX9A 3KXDA 1VA5A 2F9LA 1FFEA 1PL4A 5E9QA 2WPDG 5HEKA 1P9OA 2KS1B 1IWBB 3S3TA 1OVVA 1C1YA 2POQX 4HNAA 4U7HA 3HE4A 3AK4A 1RABA 3JQFA 4DKXA 4ZCTA 2GILA 2Y27A 1J5XA 5LSAA 5J3JA 1VM6A 3I1IA 5EVJA 1RFLA 2CDNA 2HIMA 4BGIA 3S1AB 5HXAA 1N7IA 5E4TA 2FYUH 4MYHA 1FFDA 4BV2A 1VEWA 1OFGA 2WSBA 2YDEA 1MX5A 4X6YA 3NPAA 3TQSA 1KJWA 2D7JA 2WU3A 1B8PA 2IYVA 3AF5A 2L35A 1H0TA 2ZD9A 2QRMA 1XQVA 1NYRA 4YO8A 1C3OA 1M56C 5IRCD 3U3DA 4QOHA 2KBEA 3ZGLA 1FMFA 4IV5A 4RTRA 1UMCA 1G8FA 1USWA 1V3UA 3JQ9A 5KLIC 3VR3A 1EE2A 2EIXA 2KXPB 1WP4A 2I1QA 4QPJC 3R7WA 1K63A 1G1JA 2CJFA 3CRCA 1NQUA 1Y9EA 1IVSA 1JR3A 3DC6A 4JQZA 1BVRA 5K1XA 3PUYA 3C3PA 4Y7DA 1HE4A 3F6EX 3UIAA 2QYOA 4PGAA 2C4VA 4MYRA 4KGZA 2PIAA 2RG7A 3F8SA 2GDSA 1LLDA 4FUQA 3ZVMA 1WB7A 1A50B 5JRZA 4S1VA 4EO9A 3VU1A 5JECA 2VDJA 1LPOA 5H9CA 5MN6A 1XHXA 3K9CA 3R23A 3FOEC 3USCS 1YJAA 2PYLA 4C0HA 3L72H 2HJHA 3FDIA 5JMPA 2CH7B 4UNQA 2LW7A 1K5QA 2VCEA 1N1DA 1GN8A 1N7SB 1C1DA 1SULA 3WQQA 3PSAA 1QX8A 1HNWO 1K5HA 3T34A 1E9DA 2J0VA 1E3SA 4KYIB 1EKXA 1EX6A 4X85A 2JVJA 1W0JD 2WLLA 1P62B 4Q4JB 4GMDA 3ZXSA 3LUJA 3IOMA 4IMJB 4INPA 1G98A 3PWKA 4QBGB 1REQB 4JAVC 2DPMA 3V32A 1K9MQ 3CUYA 2HODA 3W5JA 4AS2A 2OAEA 4G0MA 4I0WB 4BWGA 4HBNA 1NBWB 2IHVA 4LZPA 3LPNA 2QRHA 5K3FA 1B6TA 5APVA 4MR8B 5A03A 1N9ZA 2CUGA 2C4MA 3LRXA 3X3HA 2XRZA 2ZB7A 5L6MB 5LKAA 5LYYA 5JYEA 3RRZA 2CTWA 1JQLB 3LAWA 5HF6A 1K3TA 4W7SA 4X65O 3MTIA 4IHAA 4NPEA 2EW2A 4RH0A 3BA8A 1BMFA 2G25A 2FYNB 3STZC 1ZK4A 2FMKA 4L8VA 1WCV1 5KTTA 5GONF 3AF4A 5JDCA 4JQ0D 1E5VA 1FF9A 2Z8YA 1Z8NA 4PC3A 1MJ5A 2HD4A 4PE5B 3L0YA 4LVNA 5G2OA 3PL1A 4BKRA 3ZHTA 3PFBA 4PW0A 3QM1A 4Q00A 5I7OA 4KQHA 1JIVA 4S2EA 3TNDA 4UU0A 1KYWA 5BMVA 3FSGA 2K2QB 4RYDA 1V35A 1FUIA 3BFVA 2IOYA 4CIYA 2ILMA 1ODKA 4IQGA 1T29A 4C20A 1L8AA 4V24A 2CJYA 1JU4A 4ZU3A 1M8OB 2FW8A 3J80A 2J3QA 1WXGA 3H2BA 2ZYWX 4TVSA 2R3CA 1RWXA 1NIJA 3DV2A 3II6X 5IVIA 1HDZA 3SQLA 3JWPA 3F5QA 1KEVA 4WE3A 2FPIA 3RAPR 1DC4A 3CWQA 1AROP 3FVWA 2FDXA 1MAWA 2PUBA 2JGAA 1GPH1 3L7BA 4OHBA 2Y1OA 2X8WA 4LBVA 4K8XA 4XQGA 2QDOA 2FPGB 2WA4A 2J1LA 1ISRA 5KCMA 4ML3A 3OESA 5IBPA 3RBXA 2P9YA 4LBYA 2DERA 1UMBB 5FUMA 3WG7B 4GZRB 3U56A 5FPTA 1U0TA 3H8WA 1P3Y1 3MHPA 3D54D 2O2GA 4HMPA 1IHUA 4JB8A 4GBJA 1L5ZA 3EW7A 4DV1O 3KPWA 3TQCA 3I9V1 3BRSA 1BX0A 3FROA 2J5KA 4QDOA 4ILKA 3B1ZA 1NBMD 5DTQA 4FQ8A 4CKEB 3FYTA 4CPDA 2SKDA 1ONPA 2W6OA 5TNXA 1Z5PA 1VRWA 1CTQA 3NBFA 1AI7A 4EJ2A 5TPZA 3KHUA 3D9QX 1NR1A 1Y80A 5CPBA 4D4IA 3OOEA 1XZ8A 1HYEA 3OLXA 1G4UR 3UG7A 1BO6A 1TX4B 1FJXA 1DO2A 1LDNA 1ND6A 1OZHA 3ONEA 3IMKA 3FIUA 1DAHA 3I83A 3CX5I 2IM9A 2QAGA 1R6XA 1KJZA 1NVTA 2AA3A 1L1FA 3OM8A 1PR6A 4B2PA 3ZQKA 1BHJA 2P3QA 2QEQA 3ZCTA 2YJ3A 3W4IA 3EEQA 1SC9A 5FTWA 4BE7B 1H2GA 1GQFA 5K5GB 4WHMA 1NSFA 1W46A 5H70A 4F97A 5HZKA 2CL6X 4L22A 2PI5A 3EFFK 3K1YA 1RPAA 2UUCB 2GPNA 4IYHA 1QF6A 2H4YA 4OGQB 1L5OA 3JCUZ 3O8OB 1AR1B 2ZTMA 4OJTA 3E89A 2WPSA 4P4GA 4WESA 2SICE 3MTGA 1DEXA 3FJ1A 1TM7E 3K06A 2ZIXA 1QGDA 5BYBA 2CXXA 1SPXA 5DNCA 3WB9A 3I64A 4W5TA 1FVXA 2HF8A 5KNBA 4QE9A 3R0IA 1RKBA 2RGDA 5DBOA 3RADC 3PVSA 4CZZA 1Y3CE 5H1YA 1TA0A 4GI7A 1OWOA 1U7TA 1IFDA 5TVGA 4WFAV 5IDVA 2OCLA 4NBKA 2J9ZB 4MS4B 3VN0A 1MT0A 5KTSA 3AVXA 3WBBA 3O8CA 3IQXA 3GRUA 2VH5R 3TGUJ 3EQ2A 3U3RA 5JH7A 1K8YB 1VC2A 3RFXA 2AR9A 2FG7C 4K0KB 2YXPX 3TOSA 2JIPA 2JLQA 5AT1A 2CL5A 3U37A 1I7SB 3M7MX 3SPCA 3MCAA 3ABSB 4YP6A 1U1CA 2IEBA 1TC2A 2KWIA 4HXFB 3D36A 5HGJA 5BWLA 3UQYS 1WP7A 1M2NA 3CBGA 3PR1A 4ZXFA 3RRFA 1Z0AA 4DMHA 1P7BA 2G6BA 1ILEA 3A0HE 3UMFA 5FI3A 3V8QA 2EL9A 2YJ4A 5MGBA 4FMCB 2WM8A 2QJYC 3Q98A 4HHEA 5EIXA 5TQ2B 5ENVA 5KJFA 1E2UA 1ND5A 1BWQA 1QVFU 1YTFD 3WGVA 4D8UA 4O0LA 2ZJ7A 1XMIA 3GUVA 3GRZA 1SIOA 2ODEA 2YFHA 4N48A 2YZMA 2X0FA 1E9EA 3K8QA 3B8MA 2NU6A 3O4IA 1RP7A 2AFIE 3RFRA 1MORA 2GETA 5DJUB 3EEIA 3RGGA 5CHYA 3VKVA 2IEYA 1BHO1 3TWOA 4FM2A 3V9PA 4DXAA 3HRHA 2UUPA 2AEJA 2KLUA 3KOOA 5KVCA 5B6JA 3BJRA 3T3PB 3AH8A 4BMOB 4F8JA 3KTDA 1N34O 5TR9A 4G84A 2A1UA 3ILSA 4Y2HA 4YMTA 3BBPA 2BCEA 5ADVA 1PJCA 4I1VA 4P4NA 2D7CA 2EBFX 2GKSA 3IFMA 5IF9A 4B87A 2IDJA 5SYMA 3GGPA 2AOTB 4D8WA 4MR7B 4YV2A 2B3TA 2XCSB 3U0ZA 2JVDA 3TGPA 3HR7A 3ZIAD 3U26A 2DW3A 1JQAA 3QHPA 1NUSA 2QS9A 5HQ3B 3GMAA 1ESMA 3RSHA 1X6VA 4COKA 4MVJM 1PL0A 1GG5A 3LY9A 2BCCG 3S55A 3ZQJA 5L3SA 1NMQA 4WIAA 3SFTA 2HG5C 4CM9A 4FFOA 2HX1A 2BFAA 1QCEA 3LT5A 3GV0A 4UBMA 4O4HB 4EMUA 3FGAD 1LK5A 1NH2D 2I4TA 3L18A 1I8TA 2R2GA 2YXNA 1NMZA 3PHGA 3C15C 3H11A 4OGFA 3S8MA 1UINA 3KAQA 5FLKA 2OGWA 3GT3A 3K3PA 1QIGA 4DSOA 2AFIA 2VK2A 3WA7A 5HSGA 1R4MA 4LW8A 3EXAA 5K8TA 2PSSA 2YASA 2QD5A 4PEVA 3QFRA 4EY6A 4J8PA 2IEZA 2IYWA 5EMJA 3TS1A 1JPNA 1QZZA 1W0KA 2GZSA 1TU3A 1C3EA 1FMJA 1FYVA 3PR3A 2A4KA 5IJ9B 4R1TA 1KI4A 5LBIA 1PO7A 4QXPA 3MAJA 3L4SO 4DJEC 4X0EA 1F0PA 4ABMA 4ZV7A 4ZCIA 1W0CA 3LF1A 4FMTA 3CCRP 1N77A 2VG8A 2ONKA 1KE1A 4RO0A 3QU9A 4RTMA 2WZQA 2IVZA 3TLGA 1AHIA 1ZSPA 3D2AA 4G1VA 3QLUA 4FBGA 2H51A 1HGZA 3FVRA 2PP6A 2XCQA 3TRFA 5DNWA 3ZBHA 2P9TA 2CE7A 1P4RA 4RV4A 4DXWA 3G2QA 4Q01A 4IJVA 2V7QJ 3B6ZA 1TMOA 3NJ4A 2E18A 3RS5A 3GUHA 3KZIE 3AG1C 3LGXA 3CN9A 4WN9A 3WGTA 5DYTA 1GTVA 4NU8X 3RSFA 1T4MA 4AK9A 4XWOA 1TDJA 3RT3C 3VBCA 3ESRA 4ND4A 5CNIA 3FWHA 2EJCA 5DF1A 4FVTA 3ICXA 5CTJA 5KLVJ 4BVEA 3HR8A 3MA0A 4BIOA 3ZRSA 5JEEA 1DQYA 1J25A 4JSRA 3VQVA 5EGNA 1BGYJ 3FKSA 3EGVA 4FYYA 3NC0C 1FVHA 1EZVG 1VF6C 1OT5A 1M2EA 4JMPA 1PFWA 1K05A 4CLEA 1S72P 5SZHB 1XCBA 4C14A 2MSDB 3DE4X 2CDYA 4J2HA 4BBZA 4AURA 2WIBA 2YW2A 4HO1X 2K9YA 5AVRB 1YQQA 4WBSA 1SS3A 5LXTA 3OPVA 3OFJA 4R1NA 4MQEB 3NDBB 4P6VF 2I7CA 4KFUA 1MSDA 1GDDA 1N9GB 3B1VA 3G3EA 4TWZA 4LBEC 1J1DC 1SVIA 4MYUA 3WV4A 1JHUA 3P8CE 3L71E 2X7HA 1B00A 1JZSA 4HGPA 1O94A 1NO4A 2Z1MA 1SBNE 1DUIA 2PJRA 3ZH2A 2XMCA 2IBMA 1XZMA 1IBKB 4CF5A 3FSJX 4KPFC 2QVAA 2RH9B 5JS8A 3T4DA 2COKA 5B1BB 4EJ6A 1JJAA 4L07A 4U3FJ 1HE8B 2VRNA 4P34A 1P2SA 3EPPA 3PUHA 3A5TA 1AQ5A 4B7UA 3KL4A 3S6JA 2M3EA 1HNXB 4A2CA 1DC8A 4EI7A 1NF9A 1DG3A 4MPTA 5CX4A 3GX1A 4CTJA 4RZXA 4LXGA 4M60A 1CEZA 2AHZA 1BT8A 2HJDA 3ROQA 1A8UA 3TLMA 3CC7P 3FFQA 3JYLA 4CMKA 1XG5A 4H3VA 5EC8A 1FMCA 4L02A 2AJ8A 3HKBA 1PP9G 4EVRA 1JS1X 4BXLA 5AW4A 3EC2A 1XCLA 4RIHA 4Z7NB 5TX7A 3VHRA 1C4WA 4X1YA 5BZBA 4ETNA 2FPXA 2WK1A 1B6SA 3B8EB 2WYIA 1V9PA 4JBXA 2GN4A 4XIJA 3A2LA 1DU4A 2ZI9A 4ZXPA 2AI3A 2D5LA 1PD1A 1KEZA 3WYGA 4E94A 3M9BA 1IZ9A 1AZLA 4OFXA 2O05A 1NP3A 1U3WA 4QQ8A 1ZQ1A 4HSGA 1I33A 5F7XA 3A11A 3W5UA 2NPSC 2BM0A 1HDXA 2OL4A 4M1KA 3TCNA 4NMHA 5ALUA 1PTJC 1B8UA 4GI3A 5ECWA 3A6LA 1GKKA 2ID7A 4TUYB 1I5YA 2PT6A 2W4MA 3R3ZA 4R1PA 3KQLA 1VZ2A 3OO0A 2IHYA 2JD0A 1GN9A 3KT0A 4ZIBA 2IITA 3KZ1E 5IN5A 4EDFA 4P2BA 1T5TA 3TAHA 3WXMA 3NI2A 2EJRA 4TSFA 2NU9B 2HRCA 3ZJTA 1OOEA 4MVQA 4JOSA 2Q1KA 1FYXA 3E7DA 2D8AA 5KX5B 3Q6IA 4KQ9A 3CS3A 3CXHE 2P4SA 3HHPA 1W5SA 4QM6A 2J33A 3K0BA 4WZBE 1KDRA 4CS3A 4KZPA 1JILA 8OHMA 3KZVA 4I4LA 4LDRA 4A3SA 2X1VA 3G2MA 1E2LA 5E7IA 1F2TB 1MENA 3HCCA 2YRXA 4RKYA 4KNYA 3VKUA 4HPXB 1W2BO 4ZMDA 1ZI8A 1LUAA 3EC1A 3S40A 3LKZA 3RUIA 5HTOA 2QTVB 3AVPA 2O01N 2IYEA 3G6EV 4YIHA 1EAMA 4BIIA 1OW8A 2DYSB 4RZ3A 1E32A 1Y76B 1VPWA 4N54A 1FJHA 5B7QA 3E9RA 4PICA 3TINA 5B55A 2QTLA 2GUVA 2WOJA 4JI7O 1DKMA 2IU6A 2QPLA 4H3SA 4RLHA 3KKQA 4HWPA 3FGZA 1IURA 5TDHA 3NP7A 1L4HA 5BT9A 2V8OA 1NLZA 1AHHA 3A9VA 1ESEA 2XHEA 1L5HB 3SJAC 3UHOA 1TE2A 3P8ZA 4XB2A 4LOIA 2ZBVA 3SYKA 4NL4H 3K20A 2ZETA 4MVMA 5HP4A 5KUTA 3GRCA 4LMPA 5E4YA 3OSZA 2FWIA 5C7IO 4MW5A 3BAAA 1MTOA 5DSXA 3WHIA 1CQPA 4UTXA 4D3FA 4XPZA 4EUEA 2N9YB 4G85A 5AVWB 1KJIA 1XRLA 4WZBA 3FSRA 2XE4A 5FDFA 3SXJA 3TR6A 1NUQA 2VSQA 2ZUWA 4R54A 4W6QA 5TQVA 4H3KB 2IUTA 5ESDA 4GYCB 2CXOA 4E5YA 3AMVA 3DZDA 4P0QB 1LV7A 4GR9A 4ZI7A 5IJAA 3CCCA 3GLVA 4HK4A 3B7GA 3GD5A 1VHWA 4R6WA 3HHEA 3OZXA 2OCGA 4UUNA 2P67A 2F1OA 4DOJA 3GJ5A 2BOVA 1KO1A 2ZPTX 2XA9A 2OCCC 4LJ4A 1SQGA 2Y3IA 1UKZA 4IXDA 2AE1A 4PAWA 1ABFA 4AF7A 2EKLA 4ZAVA 2F59A 4FXPA 1P33A 1HEIA 3K4HA 3H1LD 1VI5A 1DOAA 3L75D 1ZR4A 2P2GA 1FXSA 1S9HA 4S3MA 5TIIA 2IYOA 2O1JA 3L2OB 4DR7O 2DFTA 2P8JA 1UPAA 2V0CA 1Q81W 2O3QA 3QJ5A 4IF4A 3L5KA 4YRLA 3UXMA 5IE9A 4G28B 5EJ8A 4I7ZB 3EA0A 1NRJB 1N1EA 4X64O 1EZJA 1PJ4A 2P3SA 2ZB3A 2YC4C 4IFFA 3LQYA 4XYMA 2D5BA 4I1PA 3M0DC 1G7TA 2WG1A 2J0UA 1W36B 4JASA 1P1KA 4R2IA 1EFAA 3CCQP 3ABKC 3DZFA 5ITSA 3BEHA 2IUUA 2WSEJ 4CEJB 3NBXX 3IXMA 1LBTA 2PS9A 3EXHA 2JVKA 2QZSA 4HEA6 4FKMA 1L0NE 1PDWA 4OJNA 2F4NA 4D43A 1PAUA 5B1YA 4YJHA 3DHYA 1NRWA 2OKGA 1SCDA 4WFIA 4B09A 1VQ6V 1XZEA 4ZPJA 1SQXE 1UDWA 4J7AA 4HZ3A 3WWPA 2J7PD 1E1MA 3LLMA 2GVNA 5BVGA 1YQWA 5C4GB 4ZMRA 3TDKA 3IBFA 4G23A 2QTAA 5JO0A 5F3DA 2GKOA 5TQ0B 1CYEA 2BE7A 4YRZA 3DXFA 3OF5A 2NTVA 3UV3A 2ZDHA 3X1ZA 1GNLA 5DI3A 1P7VA 2I8LA 2ZWIA 3N2EA 3WC4A 1TI7A 4XE5A 3W9YA 4RDCA 5LOVF 2PGIA 2QI9C 1WA8B 2ZNIA 1JYFA 3AU8A 2OBMA 1S8FA 5K4AA 5MN4A 3IJ4A 5J1SB 3A0BZ 1NQVA 2JZOA 1L9XA 2B2XA 4MDHA 4KI7A 4MUYA 1KAQA 3ANTA 5K6AA 4EX6A 2QJPB 4A8HA 1AXGA 5DW3A 3OEYA 1EIWA 1G66A 3OEHD 3JAMN 2B30A 5CLIA 3Q12A 4BFTA 3RWRD 2VPWA 1VSTA 3WK7A 5CB8A 1C0KA 3V2HA 1EXVA 4PD4I 2UZ3A 5K8IA 3FXAA 4NKRA 1FS0G 3ZHVA 1L0LH 1IBLB 1AV6A 1JFRA 3M6LA 1YSCA 3T1YO 3I2HA 1YQ3C 1ZCAA 1A4UA 3FNHA 2XTAA 1TD9A 2I9PA 3UAYA 4HNVA 1I1QB 3NVDA 3G2PA 5B1AC 2BMVA 1UWLA 4JVLA 1U99A 4CHTA 2DT5A 3H4MA 5EP4A 2C5EA 4URFA 3VO2A 4B44A 1SCUB 2I3GA 3LDEA 4GUNA 1WAMA 4G25A 1NF2A 4PBTA 5GM2A 1JFTA 2OORC 4EVIA 1P7CA 1NFQA 1EG2A 1D2AA 3ANSA 2VZLA 1MP0A 3G6BA 3IFXA 1XRMA 1FVFA 1XHLA 2M2IA 3RC8A 1IU9A 1U2QA 1YJNP 1X2BA 3MGAA 5JRDS 2QKSA 2A06D 1JLKA 4LECA 4WERA 1QYIA 1HE3A 1W0JG 3B71A 4C9BA 3TQFA 4J0IA 1K4CC 3E9YA 5EQJB 2D1QA 3LYHA 1I7PA 1NVUQ 2DUUA 3D2BA 4MSWC 4PZDA 2PRIA 2PZKA 1A9OA 1SY7A 3FG9A 4MUBA 4EUNA 4WWHA 4W6ZA 5BWBA 4O4IF 2R6JA 1USIA 3L70E 2E1PA 3N2ZB 4XIGS 4NARA 4LX0A 1ZI9A 2NNLD 3JWHA 2VTKA 4E4TA 2NZWA 3REQB 4PLYA 5JJKA 4H35A 1SF9A 5LP6B 2HYNA 4J3FA 1OYWA 2BGKA 3PTZA 1VF5B 3OG9A 2FSHA 2P5TB 1FYEA 2I34A 4C4OA 3KCQA 4ZHQA 1KH1A 2YW9A 4RKWA 1NTRA 3R0XA 5K3EA 3V2PA 1GU0A 2OC9A 2HFJA 4KR3A 4Y6OA 2QX7A 2WYUA 5K3BA 3TJMA 2SCUB 5EPEA 4G56A 1DCFA 3KM0A 1QG0A 3WK9A 1QK3A 4Y1GA 5KNCA 2XMQA 3AR2A 1MC4A 3DV0A 2CB9A 4DZZA 4ES6A 1QP0A 1XTGB 4NPFX 1WXFA 5K9ZA 4ZQEA 2X40A 5D3QA 1JR3D 2PUCA 3IFSA 1EWVA 4JP3A 3L6RA 2GLTA 3ZXXA 1U2ZA 4B86A 4JAUA 4YR7A 1THGA 1H4VB 1FS6A 3RSZA 4JT8A 2O59A 4EB6B 3TSYA 4LH7A 2BCCJ 2NU8B 2XQIA 2R5WA 3IPLA 4I9UA 4EHHA 5I3ZA 5CT9A 1R0WA 5U4XA 4NEHB 1WMAA 2HWUA 1UZUA 3E58A 2HB6A 3RIMA 2YIUC 1PZEA 1UBEA 4LWOA 4LDZA 4F96A 1N6HA 3DMHA 4TVBA 1T2NA 3EUWA 4ZOLB 1SZPA 1HFEL 2J09A 1U5BB 2CE2X 3CR3C 1PR3A 5K8CA 4I0XB 1BC5A 3L79A 3P9ZA 4OLFA 3QV1A 2ZSUA 4GOJA 3B2EE 4UB6H 1QHIA 1Y74A 3NANA 1CD5A 4YJ2B 1S8OA 5DGHA 1YDWA 1PL8A 3EXIA 3RYIA 3VVMA 5D5HA 2N74A 1Z45A 2KE5A 5AM1A 1AGYA 3FB6C 1KMHB 3JSLA 2CXQA 4UAUA 4WJLA 1NBMG 1GM8A 4BEWA 2GAOA 3C1LA 4JLBA 4D57A 1J90A 3FB5C 1WVIA 3P3PA 3D1VA 3PQ7A 4S1NA 3K5MA 2ZCVA 2G80A 3OETA 2E4WA 3CZCA 3WBFA 4E2LA 4TTVA 3NXSA 4GMGA 2P10A 1M57C 1GCOA 3IB6A 4IVRA 3KPEA 4JOCA 1ECLA 2FA9A 3FFBA 4AQDA 5T6MA 1E1RA 1CR6A 2BWJA 4P22A 3KWLA 4W99A 2Z9CA 1XEWX 5LR6A 3HEMA 4QXMA 5HBRA 1GADO 3CWBE 2QD3A 3M4JA 1Q3TA 5E1AC 1YITV 1YR8A 2BKVA 1BMFD 1Q50A 3WFIA 1RSOA 1KZGB 1YR2A 2I1JA 2RJNA 2FZEA 2DBVO 4GVPA 1PK9A 1X79B 2BP7A 1V54C 2IRWA 2R1TB 1XTVA 3O47A 3SHFA 2EU8A 1NNUA 2ECPA 2DUMA 2P65A 4XASA 2OPHA 4I1LA 4E22A 3NCTA 1KJ8A 4HFJA 1GTWA 3B2EA 1UDRA 2R8XA 5JHHB 1Q21A 4BE4A 1V8FA 5L3QB 4EJSC 4V1CA 5EXXA 3ZWOA 1VP3A 2P5OA 4R81A 4J94A 1NW8A 2G5GX 4ZYVA 5HFMA 3K05A 5JNLA 4S2UA 4FSXA 2ZVDA 4EW3A 2YN4A 3KSMA 3PPIA 3WISA 2VUUA 4BZZA 3VAYA 3RAGA 4JLWA 4YP9A 1DAIA 4K03A 1LSSA 3KB8A 4R98A 4LQDA 3I5UA 4Y28J 1NNEA 2ZJYA 4F0JA 5IASA 2ZANA 1E1DA 2C59A 3TGUG 2QR3A 1K5DA 2DPGA 1POWA 1HZJA 4RIGA 1QLWA 2ZIEA 4XFDA 2PMEA 2EBUA 4J0GA 4J03A 3P97A 4B74A 5ALJA 3I3OA 2HQSA 2XAQA 4BQOA 2AXNA 4OD0A 1C41A 4WBXC 3X2QC 1ZRHA 5H82A 4KJMA 2WZDA 1T36B 5DW0A 3RGUA 1K5PA 3LHDA 3VTPC 3IAS6 4EEXA 3LY8A 3HDQA 1M1UA 4NULA 4Q1FA 1OHHA 4L0MA 2GD1O 4RE6A 1IM5A 5TPZD 2A5LA 2C8JA 1PLLA 5BQXA 1RE4C 4GPTA 1R1BA 1ZNZA 4ZODA 2ZQYA 4XOIA 2C5FA 4XR4A 4UVCA 5F12A 4Q03A 3GJRA 3TCKA 3HE5A 1A2OA 1GEGA 2NZVG 4OQQA 3R77A 3SR2C 4PC1A 5FI1B 5FTMA 2ZTVA 3KSZO 4TV8F 1PGQA 1S5LH 2Q3EA 2I4LA 1JHZA 4I5GA 4PFKA 4Z0TA 1SMKA 1W88B 1PK8A 4L78A 1PP9J 1RXIA 2BIFA 3RROA 4ZQFA 1VIBA 3E9DA 2I7VA 2CPBA 1A2KC 5AK5A 1IJEA 1UWKA 2H2DA 3V00A 3VISA 3BE5A 4C4AA