2QM8A

Meab, a bacterial homolog of mmaa, in the nucleotide free form
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
326
structure length
320
Chain Sequence
TLPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase/ATPase
publication title Crystal structure and mutagenesis of the metallochaperone MeaB: insight into the causes of methylmalonic aciduria.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
total genus 118
structure length 320
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qm8A03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2qm8A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qm8A02
1KKMA 1HE1C 2Z0MA 3LRPA 2OFWA 4NYJQ 3MGNA 5EZ5A 2GJ9A 2ZJAA 3I61A 4BEBA 2ZVPX 4P32A 2Q5UA 3DEFA 3QE0A 5APWA 5DE3A 1N5KA 3FMFA 4AG6A 4B44A 5H68A 2B8TA 4PANA 3HPRA 4L9SA 2NZJA 2OAP1 3WYAA 1JR6A 2H18A 4G5SA 3U2QA 1BH2A 4KYUA 4JL5A 4Q03A 5J4YA 1W7AA 2H16A 3CNLA 3QPVA 2ATVA 4FCVA 2CL6X 1U9IC 3CPHA 2QRNA 4KBGA 2ZI4A 1LTQA 1JEEA 2P65A 3NH9A 4ABYA 5G3YA 2WKPA 1GKYA 2Y8EA 3AGQA 3EIEA 1U90A 2OCBA 2A7QA 2H7VA 2V54A 3L8YA 3FTQA 4OI1A 2O8FA 1VYTA 2YJTD 4WAUA 3UG6A 2IA5A 1KIMA 3U3MA 5CITA 1G4AE 2VP4A 2ZUBA 5G40A 2QMHA 2AXPA 4YQFA 2UZIR 4Q02A 2VHUA 2IYZA 1RJ9B 1KSHA 2CEAA 2ZSEA 3LXRA 5TARA 4CEIA 2FPMA 4N1AA 2RH5A 4BZXA 4GNKA 2MMGA 2D3WA 3WRYC 4UJ3A 3ZZUA 4B76A 2PLRA 5DIFA 1RRPA 1XJQA 1XPOA 4NCJA 4D6PA 1YHNA 3EZFA 1JECA 5TXGA 4MUAA 4TLEA 3LW8A 5GADl 1DAMA 1JR3A 1NRJB 3D31A 1Z6TA 1FAVA 4EJSA 3D7MA 1AIPA 2JJLA 3IBGA 5SZKB 3TKLA 1XXHB 2XX3A 4N3NA 1M8PA 4R71A 2Q9CA 1ZBDA 5B2ZA 4V0LA 1CEEA 3AP1A 4M9ZA 3NBXX 1IAQA 1D2MA 1X1SA 2UVQA 3NC1C 3PR1A 1KI6B 3H2YA 4JLVA 5M04A 3D36A 1CJVC 1QBKC 2CCKA 2TMKA 5K8TA 3RSOA 1U94A 3A4NA 1UDWA 1RE0A 3AP3A 5FTKA 1IOZA 4BFUA 1XTKA 2FZLA 2JCSA 3BE4A 4GP7A 4KAXA 4US1R 3IILA 4B43A 1T3SA 4A6PA 1PVOA 1ZNWA 3CRQA 4I1UA 1FOSF 2XJ9A 1AZTA 4O3MA 1EWQA 4OBEA 3VR4A 1Q12A 3QJYA 3NWJA 4IVRA 3DMNA 4B6FA 3MMPA 4BUJA 2ANBA 4MKHA 4DCTA 2CLSA 4DRZA 1WBDA 3A1TA 4F4IA 4QBGB 3QXHA 4GZLA 5TMPA 1G5PA 1JXMA 1QDEA 2GCOB 1IN5A 4RCYA 2BHRA 2HT6A 3KX2A 2VF7A 4QFMA 2YO3A 3K9NA 2A9KA 4MH0R 4QGFA 4Q19A 1RFLA 2QGNA 3QBTA 2XGJA 1X8LA 2BMDA 3NBFA 4XWOA 1NG9A 1Q44A 1KNXA 2YKGA 3L0SA 2E43A 1GSIA 2GDJA 3A58B 2WTUA 1MO5A 4DZOA 4FXPA 2JLYA 3CPEA 4FMDB 4UXIA 1CJMA 5KSYA 2I3BA 4M1OA 4DLVA 1EK0A 2QPAA 4M1WA 3UWOA 5HR5A 4YONB 1CKEA 4HB4A 4JSTA 3ADDA 1EG7A 4AQRD 2EFDB 2IK8A 5FPKA 2Z4SA 2J9RA 2QBYB 2WIBA 4RZUA 1XXHA 5E95A 2V7QA 4V03A 2QPTA 2PJZA 4HDCA 4AYCA 2B6HA 2ZRMA 3GEHA 3ND9A 4Q18A 2FZ4A 4KSCA 5FOXA 2GWHA 4ZDJA 3T06B 3NHAA 1E9AA 3UK6A 2R6FA 5AUPB 2DPXA 2VPPA 2BM0A 4PPGA 3ZLJA 1X3SA 1ZRHA 2VSFA 3SBDA 2D74A 1VCIA 1TAGA 4TMXA 4A0GA 3BIFA 4URVR 3LAWA 1W0KD 4DHEA 2WJGA 4LSGA 2P0EA 2GVDC 1R8QA 1W4AA 2RCNA 4ZPXA 3HU1A 2WPSA 4DCUA 3I32A 1S9DA 4B6EA 2ZYUX 4C3ZA 1XD2A 3ICEA 2WJVA 3V5BA 1S3GA 4TQ9A 1IONA 4QC2A 1GILA 4Q1FA 3B2EA 1QZXA 4U7OA 1ZCAA 4LHVA 4N0EA 1ONBA 3BD9A 1G8FA 1GNRA 2W6ID 2IC5A 1GVNB 2WWGA 4HLCA 2DHRA 1VG9B 5ANRB 5AVSB 3ZGXA 5J40A 3WY9A 4Z54A 4TMTA 1DAKA 2ZUCA 3T34A 3TAHA 4MDFA 2G0NA 2ORIA 1G3UA 5FL7D 4JLPA 2GZDA 2WHXA 2O8EA 1WF3A 2F1RA 1G3RA 3NH6A 1N6LA 2R6AA 2GAAA 2FE4A 3EPJA 5HCNA 4OK5A 3RHFA 4JZKA 1A2BA 1XCGB 3CF0A 2WWWA 4AKIA 1CU1A 1BS1A 1SKYE 1R0WA 4A15A 1G8YA 1JQLB 3PCRB 5DLQC 4ZV4A 1T3HA 4I6MC 4OYHA 1VG0B 2ZSFA 5SZHB 1BO6A 2OSBA 2IYRA 4IJMA 2QBYA 3PUWA 2CDNA 5APYA 3IIMA 4C46A 1R0XA 3OAAD 3VU9B 2WPDA 5CDFA 3VMYA 1LV7A 2YC2C 4ARZB 1R5NA 4U7NA 4MITA 1NG1A 1ZM9A 1RRCA 2QENA 5AW3B 3GLGE 2ZRDA 3F8TA 4AD8A 3KQHA 1R5BA 2DFNA 2D4HA 4M9SA 1RPZA 4TTRA 4QGHA 2RKOA 4TZ0A 5FTMA 2WWHA 3EW9A 4LX0A 4E09A 2VL7A 3AEZA 3ND8A 3AVVA 1GG2A 5IK2A 1XZPA 1D2EA 5AJYA 4IVPA 1G6HA 3CIOA 3L43A 4ZCLA 2J0UB 2QROA 4PPFA 2OE2A 3KQNA 1WE2A 4JS0A 4AWXA 1JJ7A 3F0TA 2IYWA 1W5SA 1KMHB 4M53A 2OLKA 2VP9A 3B9QA 3C41J 3CNNA 4TSFA 2PH1A 2JLZA 4HSEA 4FD2A 1T4GA 5JHGB 1NF3A 1GRQA 2GF0A 1L2TA 2Q9AA 4OHZA 1SP4A 5CB8A 1DAFA 1XD9A 1KAGA 4IW3B 2Z5IA 2MSEB 2F3RA 4PPQA 3KFVA 2CVFA 1AS2A 1D5CA 1ZNXA 2PT7A 3W5JA 1ZD1A 1U0JA 2NO0A 2BBTA 4Q9IA 4LHZA 1MO3A 3ZYCA 3Q7PA 4HAXA 3X1ZA 2GEVA 1ZU5A 2NZ8A 4IFEA 4DT1B 1E1RA 2BKUA 5GJWC 1DTSA 5GJBA 3E1SA 4PSVA 1KK1A 3QF7A 1HUCA 5KHOC 2NO7A 3BS4A 2FFAA 1HH4A 1OB5A 1E6CA 2PMKA 4X8OA 4BFZA 4AURA 4JYCA 5EE1A 3A0RA 5EUQB 5AVWB 3QF4A 1G6OA 2HXYA 3TE6A 3CW2A 3W3ZB 1XMVA 5GVSA 2OBMA 2ZJZA 2HV8A 4D4JA 4ZDIA 1YR6A 4M3LA 4W5WA 3CNOA 3VU9A 5FBVB 4B2PA 2ZFCA 4ZO4A 3ZD7A 3OIWA 5KPJA 4D81A 4ESVA 3DMDA 4ARZA 5E3HA 3CB4A 2A5JA 3WMFA 5AJWA 1U8AA 4Q7KA 5JMTA 5GJCA 2C77A 2ZRPA 4IXMA 2WWYA 3ZDQA 2IS1A 3OIVA 3RS3A 4HYYA 1YYCA 2C03A 3JZMA 2JLRA 2BMEA 1E2MA 4JLMA 2W6JA 4IXNA 2ZAMA 3E70C 4KLZA 1G64A 3RYTC 3KTAB 3E5HA 3KXKA 1C1YA 1KHTA 1YJ5A 2AWNA 4RD0A 2L0XA 3M9BA 3W8NA 3U3JA 2J59A 2IYTA 1KSJA 1CZQA 4IOJA 1MT0A 1KMHA 2PZFA 4MKGA 1E2IA 4BLPA 1FFHA 5FR2A 5JJKA 4FMCB 1KKLA 4OI4A 1KK0A 2KB0A 4EPRA 4LY6A 4IFBA 4PC2A 2ZSAA 5IDVA 4FMDF 5DHAA 5D3QA 2AXNA 1YRAA 2Z5FA 4JAUA 2WT7A 3P4YA 4MA4A 1FTSA 4RZ2A 221PA 2EFEB 3EZ7A 2W6IA 1PV4A 2X19A 2XZPA 1M7HA 4MT8A 4KFRA 1KZGB 3GLGB 3GLFE 4PZYA 4DT1A 4OHYA 4XD7A 2G83A 1R2QA 4FW9A 4QBHA 2JLWA 1A82A 5DYIA 4ZI3A 3LLUA 1KAOA 4E07A 1X86B 1XCPA 1S0UA 4PSKA 3GP8A 4DCSA 3HR7A 3ADBA 2R32A 1TU3A 1Z47A 2ZI6A 5APVA 5AUOB 3FMIA 2V6IA 4OQFA 1BIFA 2REBA 1N0UA 3K70D 3AVXA 1FUKA 1AJEA 1TUEA 2ZR9A 2EYQA 4PAOA 1LW7A 5C1BA 5HPYB 5CJPA 3QOFA 3EIHA 1G7RA 3KB2A 3FVQA 2GA8A 1E4VA 1KI2A 2DFKB 4XSHA 2QI9C 4BQSA 3M9HA 1T3LA 1JXOA 2V9PA 2WKRA 5AWFC 1CULC 2R3CA 1KSFX 1Q57A 2O52A 3GJ7A 3NBYC 4NCNA 2FG5A 4PHHA 1S9KD 1FP6A 4A2WA 3A4LA 3MG9A 1H8ED 3KXIA 4A8JB 3KTAA 2JASA 2GZHA 5FTLA 3BJIC 5L8VA 4J0QA 2GETA 3ZQ6A 2GK6A 2QU8A 3AKEA 3N2IA 5KPDA 3KKQA 4HAWA 3K70C 2WJJA 1FOEB 1H8HA 3PXGA 4JJZA 4FCTA 2KBEA 2CMKA 4RFSA 1DARA 3IEVA 4KHXA 2CK3D 1Q22A 2IS6A 2XOKA 5TVKA 1G8GA 3VTKA 2C04A 4D4LA 1IY1A 1ETUA 2IYUA 1F2TB 2SHKA 5FUYA 5AVQB 4LJYA 1ZW6A 4BZQA 4OQNA 1JB1A 4ZCMA 1MUUA 4URZR 3R8FA 1D6JA 4MTXA 1KMQA 1MH1A 2J46A 1ZM2A 4P3YA 4W5HA 3FKQA 1GD2E 2BEJA 1T2KD 1P73A 1JEDA 2WKQA 1G20E 4IDHA 5JSZA 4AI6A 3GLGA 1G1MA 2W6AA 2R8RA 2WICA 3Q5DA 4LHWA 1EX6A 1OXUA 2AHOA 2CHVA 1C4OA 3B7GA 2QM7A 2F3TA 3AVOA 4EPXA 5AVXB 1EXMA 3O8CA 1ZUIA 3PIRA 1VDZA 2REXB 5IF9A 4DSOA 4Q1EA 3HYRA 4DVGA 1N5JA 3SU8A 5J47A 4LBVA 1UKVY 1E2PA 3BH6A 2R5BA 1W2GA 3U3KA 1P62B 5P21A 2QZ4A 2C9YA 1XFAA 2KP8A 3CZQA 2CLDX 1E0SA 3LA6A 3M1IA 4NYMQ 4U7DA 4I99A 1XX6A 4PO1A 5HZKA 1EFHA 1T2KC 1ZD9A 4Z8YA 3VR5A 1Z28A 4ACBA 4DWJA 2EQBA 3LFUA 1E2NA 3GLHE 4TL9A 1UM8A 5FBWB 1S3SA 2DY1A 3W8RA 3K70B 2JLQA 4Z1MA 4HEJA 4F93B 1EFTA 2BC9A 2QMOA 2OILA 2JLXA 5H8WA 2IHBA 1VPLA 4HDOB 1KI9A 2GZAA 4Z51A 5B58C 1S96A 4FMTA 1QVAA 4AYTA 1DE0A 2KSQA 3BOSA 3I5CA 3ZD6A 4LYFA 1ZU4A 2HXSA 2RGGA 3NEJA 5CLQA 1EESA 2N46A 3LIDA 2BEKA 1KO4A 4Q7MB 1Z63A 4LC0A 1KQLA 3ZRXA 1LF0A 1TF2A 3IQWA 1R6BX 2V3CC 1Z2CA 4PXAA 4B34A 4BLSA 3V4FA 1LY1A 2Q21A 3TSWA 4B33A 2IUTA 1VG8A 2W58A 1VHTA 3D6TB 3HU2A 2QT0A 3NKVA 1NVVQ 1T5IA 4M1KA 2Z6VA 1F2TA 3QVVA 4CVNA 3G5UA 1IQPA 1P2UA 4DEXA 2FDCA 4KODA 4LOAA 1NN3A 1YZNA 2ONJA 1S8FA 4WVFA 1G8PA 2W0SA 1OXZA 2ODEA 2NGRA 4C0BA 2FSHA 2ERXA 2YWHA 1II0A 3GMTA 4I1VA 1F3OA 2E1RA 3EC2A 3KDSE 3ASYA 2IBMA 2FPKA 4GRAA 1SGWA 3WNCA 2H5EA 3BB4A 1GZSA 3QUSA 4B3GA 1WB9A 4GFDA 3ZIAD 1OWAA 2C9CA 1NLFA 3PG5A 1E2HA 3GEEA 3SNHA 4YC7A 3RS7A 1TQ2A 1XBTA 4LRWA 4XIGS 3I72A 2HCBA 3FWYA 3AVWA 4MDEA 4B3CA 1W1WA 5L3VA 2BBWA 3LQRA 1DEKA 2XV5A 1L4YA 2UZ3A 1FMLA 3SHWA 3GJ5A 1ZMXA 2GBLC 3MLEA 121PA 4JMPA 4Q66C 3P27A 2J7KA 3I5XA 4PC1A 4KYIB 2IWRA 2B7CA 3VMZA 1KO7A 1NIPA 4LK2A 5DISB 4YMWA 1G5TA 2LCFA 3KJIA 3KKPA 4FMCF 4MYHA 1UADA 2JGNA 5CIWA 2BJWA 3Q3JB 2OAQ1 4NYMR 4F91B 3I8SA 1S1MA 2C78A 4C0AC 3KKOA 1W0JD 3GFPA 4AK9A 2YYZA 2K5UA 2RGDA 1H8EA 2AL7A 4DJTA 3GLIB 4JVMA 3I1FA 5TY0A 1VG1A 2GCNA 2ZM5A 1KO8A 3PUXA 5J4VA 5AW8B 3BB1A 1AK2A 1G3MA 2F55A 1F2UB 1PLJA 1TQ6A 5BWMA 4PZZA 5KDOA 2CXXA 2XZOA 1JQJC 3PUYA 1BYIA 3MD0A 2CK3A 2FV8A 4P4SB 4YMVA 1KSGA 2P6RA 3AF0A 5CJ2A 1HQYE 4PAMA 1E9CA 3A5TA 2OT3B 1IY2A 1HT2E 1MKYA 3B85A 2EW1A 2F43A 1A2KC 3K8YA 2WSMA 1TPZA 4TLDA 4OK6A 2J87A 1KDOA 3B60A 1DPFA 3PQCA 4GZMA 4HAVA 1NVVR 3AF1A 3NTNA 2IYVA 3NVAA 4C9BA 3C5CA 4D0GA 1GL7A 1XZQA 5JJIA 4QM6A 3SYLA 3SWFA 5JS8A 2ZU6A 3LWNA 4OK3A 4KI0A 1OXVA 5CK5A 3PUZA 4EOTA 1SQ5A 6Q21A 3RS0A 4DSTA 5DGXA 1AKEA 2J41A 4NE2A 2J0VA 4BIUA 2FJUA 4EQ6B 5A0FA 1W5TA 4M1TA 4OL0A 1E69A 3CBQA 4MGIR 3TH5A 1OV4A 4UQOA 4X8MA 3B5JA 2CCJA 1ANKA 1WXQA 3AV0B 5JWHA 2CJWB 4QRHA 3UXMA 3RC8A 5AUQA 3KJEA 1EFCA 5KSZA 2EFHB 3BORA 4UXJA 2G9NA 2FH5B 4MRPA 2OFOA 1XJ0A 3W6OA 5JS7A 4RKEA 4A9AA 2ZROA 3UIEA 2RAPA 2FF7A 3VMXA 4LGMA 2CE7A 1UBEA 2GJSA 1XPUA 4BASA 3GLIA 4IDQA 1F51A 2BMJA 4WOPA 4GCZA 2W00A 1MV5A 1X8KA 2HJGA 1YZGA 4NH0A 3TIFA 3ZVMA 1BKDR 3IIJA 4DBLC 2ZRCA 1GL6A 3T1TA 2AFHE 2BKEA 4QGGA 4US0R 5FFMA 4DLSA 4EIWA 4P4SA 2NO6A 3THWB 4N0DA 3P32A 2YHSA 3MFYA 2QQ0A 2XU6A 2HYDA 5EXSA 5JI2E 4URYR 1LFDB 3QKUA 1J90A 3C16C 1Q21A 3SJBA 4ACAA 1L7VC 1G5RA 3LXXA 2VBCA 1GU5A 3A4MA 3IQXA 4HUTA 5JFGA 4B71A 1YVDA 1COWA 4OHVA 4XVUA 1OH5A 4QHSA 3A37A 2ASEA 4WZBE 2DBYA 4Q4AB 1XMJA 3HU3A 3PITA 5KNBA 4RVCA 4EFNA 1LNZA 2P5SA 2OM2A 2VEDA 3CZPA 3M0EA 2OCPA 5FOSA 1Z6YA 2CLCX 4JIMA 1S1CA 2HLDA 2V1XA 5BN3A 4C2UA 4RJLA 2JEOA 4ZDKA 1FP7A 1LS1A 1Z6AA 1ZIOA 3KUDA 3B82A 4Z8XA 3THOA 3S1AA 3VN0A 2EYUA 1RKBA 4I2LC 2WAYA 1IJFA 2QY9A 3KQUA 1GL9B 2GJKA 2JIZD 3L0IB 4G5OA 1Z0KA 2CJWA 1E2DA 3CUEF 1KTVA 3LBHA 3QNUA 4DLRA 5FUXA 8OHMA 2WSSD 3RWMB 4C0LA 4M8NE 1NKSA 3B1ZA 1CR2A 4Q4JB 3UMSA 4R98A 4DC9A 3RS4A 2V1UA 4BWYA 4DLYA 5FPTA 4HB3A 3KFXA 3AQ4A 4KBFA 3SJZA 3WBJA 3TQCA 3MWLA 4I1SA 4JLJA 5DI3A 2X77A 2QAJA 3RAPR 5JLJA 5CM9C 2DYKA 2ZJBA 4D80A 3DOEA 3RSLA 3FHCB 5E4FA 5F98A 3QXXA 1CXZA 3PJRA 2XZRA 1NMYA 1G21E 821PA 1K5GA 1P61B 1S2MA 4H1UA 1E9EA 2ZSBA 1DVRA 4LJ6A 3WNBA 1FW6A 4BIZA 4FWIB 1RRGA 2J5XA 3M0AA 4LJ4A 5EP1A 3ZVRA 3THWA 1C9KA 4WXPA 2X2FA 3TW4A 3EPHA 3U44B 1RRFA 1I4LD 2A5YB 3VYIA 4PO9A 3RS2A 2IEZA 3RDPA 4IOKA 3P7KA 1YZUA 3MWJA 4FI3C 4HLQB 2AKAB 3K9LA 4HUQB 4AIIA 2IYQA 1E1QA 3BERA 1HURA 2ZS9A 3QEJA 3SHFA 5AW2B 1RZ3A 1NMXA 1VIYA 3EASA 3LVRE 1KY3A 2QTFA 2BV3A 3AKYA 2I1QA 2J45A 4Q4AA 5E7IA 5EXPA 1OH6A 1H89A 1I2MA 5B1NA 2J7PD 1SHZA 2OO7A 1NMZA 2ZETA 1E9BA 2EVWX 5K8LA 3CPJB 3HR8A 3FOZA 2H17A 2WOJA 2AK3A 3U3RA 4B3FX 1GU4A 3OE7D 4BRUA 5BN5A 4OKSA 4C7NB 1NI3A 2AFIE 3L8ZA 3VKWA 1QHXA 1Z2AA 1IXMA 1DAHA 1RJ9A 3G82C 1GTWA 1EX7A 1Z29A 4R2HA 3W90A 2RB4A 3WMEA 1IHUA 4D25A 3P1JA 2A2ZA 2IXFA 3KL4A 3ZQJA 4LHXA 4WZ6A 2YO2A 1IXZA 1XTIA 1ZNZA 1D9XA 2W27A 4Q4JA 1E32A 1UBCA 1E2JA 1W44A 4PX9A 1P9NA 3P8MC 1GRNA 4BLTA 5BW8A 4WXRA 3AF2A 1M2OB 1Q0UA 4QBIA 4JSYA 4CF7A 4XVQA 3AB3A 1P5ZB 4G0NA 2JDIA 5FOVA 2GXAA 2P5TB 4YDHB 1RC8A 2RGNC 2IHYA 1KI6A 1SVWA 3IR9A 1CJTC 3ETLA 3NFQA 5APUA 3AF4A 1Z08A 3C5HA 4JKYA 1U9IA 4ASUD 1OKKD 1YRBA 4OHXA 3U44A 3DKVA 5B64A 5E7JA 2OG2A 1T8UA 1GKUB 4DDUA 1SLQA 1N25A 4HUQA 1NSFA 3FYHA 4LZZA 3QI2A 3TVDA 2GVZC 3FKSD 2ZPTX 5FUWA 3B1YA 1XTRA 1ZVQA 2OCAA 2YZ2A 3ZH9B 4B74A 1MO4A 3SOPA 3FFAA 1OXTA 2XTZA 1HJBA 3SC3A 2XNDD 4IDNA 4FMBB 2WTYA 5EE5B 2OEPA 3L0PA 2BM1A 4W9MC 1NY6A 4LBYA 3G0HA 2GCOA 5HZHA 1PLKA 4PR0A 1AGRA 1G7SA 421PA 3TRFA 3HJNA 2F9LA 3PEUA 4M1YA 1Z5ZA 4WZAE 1OPXA 3K0EA 4V0MA 3UPUA 1XEXB 3UKDA 4NP6A 1GK4A 3FDIA 3K0AB 5EP3A 2W2TA 2H7HA 1UEIA 1YR7A 2FN4A 2N1BA 2ZJ2A 3REGA 4TL8A 2XZLA 3QSYA 1U8YA 2ZJYA 3B1WA 4F4JA 1DG3A 3QXJA 3B8EB 4DSUA 1QHIA 2C2HA 4MRNA 2DR3A 1W4BA 1AN0A 3T12A 2ZAOA 1GWNA 5KNCA 1VCMA 2JIZA 3LW7A 3M91A 4MGZR 2LFSA 2WSSA 3RVBA 3MUFA 1E3MA 1HUQA 4KP4A 5IRCD 1G3QA 1KK3A 3EWAA 3IUYA 3IO5A 1LS6A 3TBKA 1JPNA 2QG6A 4KO8A 4HAYA 4DLWA 2LKDA 2OUKA 2XJ4A 2VP6A 4MRVA 1FL9A 1X1RA 3SQWA 4X8LA 3UWKA 1N6HA 2QE7D 4Q4HB 1IXRC 2AK2A 3T61A 2DWQA 1HQCA 4URUR 3SFVA 2VHQA 1Q1QA 4K81B 2YNMA 4A0HA 1U98A 3MCAA 1US8B 1UPTA 3SE0A 2VSOA 2QL6A 4GBMA 4K8OA 3IHLA 5C93A 3PFIA 4Q1AA 1HA3A 1KDTA 2VYFA 1T5LA 3GJ0A 1WP9A 4QBFA 3TSZA 4DLZA 4AC9A 4CRWB 4Q47A 1XPRA 5FOTA 4TYWA 3OEED 2CVHA 3QQ5A 1XTSA 3I92A 3W6PA 2XSZD 3SYKA 2D2EA 4A2PA 4C0JA 3I5YA 5HCIA 2RHDA 1FTNA 1NNEA 3NDBB 1XMIA 1SVLA 1JAHA 2QEQA 1AKYA 1R4AA 4QHTA 4WA7A 2J7PA 4A0FA 4K46A 1XEXA 3THXB 2ZRJA 1E9RA 4XJXA 2AN9A 2JAQA 2FNAA 4Q1CA 4FPPA 3OE7A 1DG1G 2P2LA 4PAQA 1GM5A 2KBFA 1E99A 1QHHB 3PV0A 2ZRGA 4PHTA 1JNYA 4IOLA 4V02A 5UKDA 5KSPA 2BIFA 3AVTA 1OF1A 3AVUA 4Q21A 4EKDA 1IBRA 721PA 3IHWA 1JUNA 1YKSA 1MR3F 4EFMA 2IW3A 3T35A 3UANA 1W4CA 3SI7A 1G3IA 1IN8A 4CGZA 3OZXA 3HE4B 1E2FA 4AKGA 2QPOA 3CF6R 5AW5B 4UNQA 5JEEA 3EXAA 4Q4HA 4QJ4A 2IX3A 1KO5A 5BQ5A 1FX0B 2DCUA 3Q8XB 3H0KA 3TLXA 2W2VA 4UNRA 2RGBA 1NLZA 2ORVA 1HEIA 4HYTB 4G01B 3AKCA 2J0UA 3SEAA 1NKTA 1OKKA 1W0KA 3KQGA 4QJ3A 5CLLA 5G3ZA 3V4QA 1SKYB 2G3YA 3HPQA 3RWOA 1JAIA 3K0CC 5FH9A 5JBQA 5AW1B 1EWRA 2AKYA 2QTHA 4IRUB 4ZIRB 2HT1A 5FI1B 3ZCCA 1DH3A 4GSYA 1L8QA 2IYXA 2AD1A 2VIIA 4KJZA 1NJGA 2VHCA 4YMSA 4B2LA 1Y63A 4MRRA 2G77B 4RD6A 3VFDA 3TUZC 4KHZA 4M9XA 1WBBA 1J7KA 3QKSB 1ZJ6A 2FGJA 3MJHA 2R6GA 2CL0X 3R7WB 2ATXA 2P3SA 2IL1A 2NIPA 3AF3A 1GK6A 4PTLA 3BWDD 3H1TA 3RS5A 4GDFA 2PLFA 3BH7A 1DS6A 5BYJA 3SJAA 3U4QB 2W83A 3U6KA 1NVXQ 3MWKA 5FL7A 1EFUA 5HE9A 2BCGY 3FE2A 1A02F 3RABA 1QHHA 4YMUA 1OH7A 5G53C 3TUIC 4B73A 5KO2A 1YE8A 3IGFA 2A5FA 2ZYWX 4RSGA 1UDXA 2WJYA 2VHJA 5C2JB 3BRWD 3EC1A 2PCJA 4RZXA 1QG4A 2J0QA 2G0TA 2VQSA 4AUWA 4JBYA 1G19A 2PL3A 4EPVA 1MRSA 2PX0A 5SZIA 1MV8A 3NDPA 4G5GA 4HB0A 2R65A 4C0HA 3N5CA 5FPSA 4P0TA 4CEJB 2HJVA 5AK0A 3LLMA 5KDLA 2XB2A 4JAVA 5EZ6B 2B92A 4GT1A 4ESHA 4KSBA 1Z3IX 3OAAA 2QQEA 5DNYB 3OIYA 1FX0A 3RC3A 2AWOA 3I73A 4NTZA 3RANA 2JLUA 4LV6A 3DM5A 1SXJE 4MYCA 1MABB 5ELXA 1LVGA 4MRSA 3QKTA 1F5NA 4F92B 3RLFA 2BASA 3SJCA 2OXRA 5LPNA 5AJVB 1XTQA 2GF9A 4TLCA 1FQJA 3NXSA 4ZKDA 3VQTA 2PT5A 4G5QA 1GP2A 2C8VA 4DB2A 1U8ZA 4NONA 3NEYA 2XAUA 3C8UA 5EE0A 5FR1A 3LVQE 2VP5A 3ZVNA 3WNDA 3OEEA 3QKSA 2QP3A 1HBWA 2XSZA 2ZXUA 4TYYA 3VAAA 2VSXA 1NBME 3R7WA 3BB3A 2F1HA 1II9A 4WBSA 2P7JA 1SXJD 1X6VA 2O5VA 1FOSE 2PCLA 3A36A 3AGPA 3L82B 4W7SA 3ICQB 1OLOA 3RRMA 1R8SA 4YLGA 5CYPA 3TNFA 2F9MA 2CNWD 1I2DA 1KO1A 4O2RA 2D2FA 1NP6A 1OYWA 1O87A 1ZD8A 2BVNA 2IF2A 2KE5A 3U61B 1M7BA 1Q3HA 2ZJ8A 4TWZA 1G41A 3K9GA 2O8CB 1KY2A 1OJLA 1N6RA 1P9WA 3L2OB 1TX4B 2HF9A 2HYIC 4DZZA 3B1VA 2IWHA 1FNMA 4RZ3A 1ESMA 1ZM4A 5TB5A 2VH5R 5CYOA 1SXJC 2NTYC 3CKLA 3W6NA 4KV9A 4CEJA 1OFTA 2ZQ5A 3IPYA 2O8DB 3C7KA 5L3SB 4QL3A 3R20A 4V0NA 2XB4A 3VNUA 3VNVA 1O3YA 4GP6A 4LC1A 4XE5B 3LY5A 5A4JA 2A30A 1RIFA 4PQRA 3GLFB 3CR8A 1TQDA 1SVMA 2EFCB 4LV8B 1NAFA 2PMDA 1YQTA 5EXXA 1DADA 2YINC 4XH9B 1NSTA 1J2JB 3AM1A 3QIAA 3NTUA 3ADKA 1GRRA 1G291 1N0VC 2X2EA 4TL7A 2NG1A 5EE3A 5EQTA 1CRQA 3CX7A 4Q7JB 1N0WA 2QORA 3CWZA 1BOFA 2PZEA 1TADA 1TEVA 4ERNA 3OEHD 2BJVA 2YOGA 1NN1A 3LDAA 4TN1A 5L3QB 1G9XA 4FCWA 2O8BB 4TQAA 2PZGA 1YR9A 4IDPA 1XMSA 1SVOA 2QP9X 2X8AA 2FPLA 4A4DA 4AKEA 1W2HA 2WV9A 5EE9A 3M4YA 1IN6A 3SFZA 1E96A 3HTKA 1DO2A 1JJVA 1OIWA 2ZTSA 2A3RA 2ZVQX 2ZRKA 1SXJB 621PA 1Z0AA 4TZ6A 4HDQB 5FI0B 2O8CA 1Q1ZA 2NO1A 4Q7LA 1NL3A 2FSIA 2QMUA 1FZQA 1WRBA 5AW6B 1LF5A 1TNDA 3A1VA 3HP1A 4B32A 4XVRA 4C7OB 2J1LA 1E2LA 1IY0A 3NC0C 1QF9A 1JR3E 1TMKA 1N2CE 1WA5A 2OCYC 3IBYA 5AR1A 4KITB 2BWJA 1GUAA 4US2R 1XJCA 1J99A 1E2QA 1B0UA 4GPTA 1ODFA 3F5FA 3KUCA 4U00A 1H65A 5L3SA 2H57A 5APTA 2IT1A 3CR7A 2GXUA 5JECA 2GKSA 4JJKA 3I4LA 3ZZTA 3UIAA 1N3BA 4ZCIA 5F9FA 1ZC3A 1IN4A 4JKIA 3NG1A 3GLFA 4B48A 1G7CA 4JYBA 1Z6XA 2LFRA 3EWSA 4NMMA 2Z4RA 5CIQA 1J70A 5JHHB 3R9WA 2ZXEB 1U0HC 2ZE7A 4C0KA 1DAGA 1OXSC 2GJ8A 2ZE5A 3GFOA 3T1OA 3H86A 3O8BA 4POAA 2IPPA 3BBPA 4MYUA 1VTKA 3A8TA 3QPUA 4A0RA 2ZYVX 3AUYA 1U81A 1ZM3A 2E87A 3WYFA 1PUIA 1QHSA 3CO5A 5L3QA 3MAAC 1Z0JA 1KJZA 3FMPB 2ZRNA 1WQ1R 2DB3A 4HI0E 3GLHB 1GNPA 4QNMA 5CK4A 3IO3A 4E5UA 3BAFA 2WWXA 4LJAA 4DXAA 4QPKA 1AQUA 5LBIA 3IPXA 3EARA 4Q9KA 5C46F 3U5ZB 2CL7X 1AM4D 4OI2A 3N2EA 4JL8A 2F6RA 521PA 3FMOB 1VIAA 2WWIA 1KI8A 1IM2A 4HATA 4RFVA 1NLYA 4ITRC 3A6PC 2I1VB 2QN6A 4QNRA 5AW4B 4BECA 1Q1BA 4G3XA 2PJRA 1XEFA 1GFIA 4TTQA 4P4TA 1OIXA 4PC6A 1E2KA 4RD4A 4C7OA 3UMRA 1VMAA 4V0KA 2VLIA 4IVQA 2MSDB 3E2IA 2YVUA 1VKJA 1Z0FA 4II7A 3EZ6A 4HAZA 3QENA 3DHWC 2KI5A 4KVGA 5TDHA 4BLOA 3QG1A 4I81A 2FSGA 1XXHE 2NPFA 3NIBA 5FPYA 3I3SR 4JASA 3SBEA 4XWAA 1X8YA 4YXWD 2BDTA 4V0OA 1UKYA 3LQQA 2JLVA 1NVWQ 1Z0IA 2MMCA 3TR0A 1T91A 1RW4A 1UBGA 3ECCA 3EG5A 1VCOA 4G1UC 1OIVA 4Q1DA 2LKCA 2D7DA 1B23P 4JVNA 4S35A 3O8DA 4LBWA 1Q3TA 4DLUA 4UJ5A 5A5GA 4CEIB 2ZS7A 2EFGA 1GOTA 3IDQA 2EWVA 3C4JA 1XDBA 4NCKA 1KI7A 1VECA 4HZUB 3VHLB 3OHMA 3EZ9A 1M74A 2RGAA 4DCNA 1F2UA 2ZE8A 2B21A 4NDZA 2VP2A 5GJVC 5CB6A 3OIUA 4XOIA 3FGNA 4Q9JA 2V7QD 2PX3A 1P9RA 2HDNB 3CX6A 5FL3A 2CCGA 4BFXA 3GLHA 2ZS8A 4OQXA 1YU9A 2VO1A 3BH0A 4FINA 4DLXA 2A5GA 3K0SA 4D82A 2Z83A 5F3WB 4DDWA 1S4QA 4PC7A 4B35A 5EXTA 4L8GA 1UAAA 2YV5A 3JVUA 4CZ2A 2XTNA 2GBLA 1AZSC 3NBZC 4P33A 2ODWA 2CHGA 2ERYA 2ZRLA 5DO9A 1FUUA 2WPQA 2ZSDA 2IYLD 3GD7A 3CH4B 2QMEA 1YZLA 5JEDA 1YZQA 3BGWA 4XWKA 3ZIAA 3KQLA 1GNQA 5GVRA 4EQ6A 1RVDA 4L9WA 1CTQA 1VHLA 1CJKC 4P31A 1UBFA 4JLBA 3K09C 2R62A 2FFQA 4C2TA 1A5TA 3SS8A 1Z83A 4TQUS 3V4WA 4PO8A 4UXHA 2R6CA 5E7MA 1ZUNB 4TMVA 4NHOA 4TMKA 3D3QA 3QBVA 5CDFE 1XB2A 4NYIR 1P7CA 5JRZA 5APQA 1OXXK 5FUVA 1FNNA 2BBSA 1ZAKA 2NMVA 4A2QA 1HT1E 1DOAA 3WRXC 3A3YB 1ZNYA 1P60A 1A4RA 2ORWA 4PSAA 1J8MF 4MKIA 4XTRA 4L15A 3KKNA 4UNNA 2PEYA 2V6JA 4TL6A 2Q3FA 5LB4A 4F38A 3AH8A 2RMKA 5AVYB 4QG7A 4HZUA 3BK7A 3HDTA 4OHWA 2JJ1D 3Q85A 5JJLA 3AP2A 1W0JA 1FMJA 4Q48A 1TU4A 2WMNB 4B3XA 2VRWA 2F1JA 1OSNA 2YOHA 4IDOA 3ZS9A 4TMWA 2WPDD 3SN6A 4FWTA 3L0OA 1CLUA 2KWIA 1Q1EA 2IF0A 2ZEJA 4IHQA 1GAJA 4DLTA 5DN6D 5AJXA 3KXLA 1ZC4A 5D3MB 5K8UA 1N6PA 4GL2A 3MGCA 1SZPA 4MGKR 3BFXA 4R7ZA 3U60B 2F1IA 2CE2X 3CM0A 4TYQA 3A1SA 3V00A 3DZ8A 4DIDA 1KZ7B 3C14C 3DDCA 3TMKA 1E94E 1U2RA 2G6BA 4L16A 2P6NA 4A82A 2Q6TA 4RD1A 5IK2D 4KVAA 3VKHA 2FFBA 1NIJA 1R5OA 2HCJB 2WMOB 1CBUA 3DO6A 1HTWA 1GZLA 3M06A 4LWZA 3ONWA 5SZJA 2FSFA 4MUBA 4W5JA 3AVYA 3WP1B 4LHYA 3T1QA 1T0HB 1CP2A 3CF2A 4BFYA 1ZM7A 4TSFD 3DGEA 5FBLB 4KFTA 3LV8A 4XSGA 2IUSA 2A5DA 3LNCA 1SHKA 1XD2B 3PEYA 4TYNA 1W49A 1MFZA 4RY2A 2ANCA 3VKGA 1WDTA 4NYJR 4Q1BA 3W5IA 2JATA 2QA5A 1P2VA 1D9ZA 3A7OA 2IEYA 1Z06A 2ZJ5A 2EWWA 3PEVA 2ONKA 2R2AA 4DSNA 4QM7A 1E1RD 1XTJA 2QTVB 3ZRVA 1SVIA 4YXWA 2B7BA 5EJEA 1E0JA 3A2AA 2O8EB 4A1FA 2GXQA 3HWSA 4M4SA 4M0LA 2IS2A 4IKEA 1Q20A 5BN4A 3VR1A 1M6NA 2RGEA 1OB2A 1QG2A 1BMFD 1E9DA 3FB4A 3TNUB 1PLLA 1NN0A 2GXSA 4JT2A 2VHTA 2Q9BA 4LYAA 4KXFB 1NJFA 5EUMA 1GKIA 2IXEA 5KYKA 3LH5A 3HE5B 5APXA 1DBSA 4B3DA 1K6MA 1SVSA 5TV2A 4PHGA 1YR8A 5F9HA 2QUZA 2FFHA 3QKRB 5CMZA 5D3MA 1N6KA 1T6NA 5AVVB 1TF7A 5B57C 4Y0VA 2ZIAA 2W6JD 1G8HA 1HV8A 2XTMA 3K09A 1UF9A 2YC4C 3GQBA 4HLDA 4OQMA 4JLKA 1ZYUA 3V9PA 1QVRA 3CRMA 3P20A 2C9NY 1CSBA 4EUNA 1T0JB 4NCHA 3QPWA 3BXZA 2H92A 3N70A 4MGYR 3U7EB 4C4PA 3B8HA 3I62A 4D2IA 4C7NA 3CRRA 3WXMA 3NMDA 3SR0A 1H88A 2XEXA 4MKFA 1G2CB 1F48A 1XEWY 3VX4A 3W9YA 2BCJQ 3X2SA 4GMXA 2FEOA 2QAGC 5IDJA 4YMTA 4TMZA 4GOJA 3LD9A 4OI0A 3IIKA 2WWFA 1CI6B 3K0FB 3T97A 1G16A 4C30A 3V4RA 2IS4A 4JLOA 4JVLA 4LYJA 4XD7D 2DWOA 2GTPA 1F60A 1N5IA 3EIQA 2ZI5A 3CWQA 1LB1B 2AR7A 3WBKA 3K9HA 5AW9B 4D4MA 4A8JC 1VCNA 2GNOA 2ZRFA 3BFVA 3WHLA 2P67A 4WW0A 4QGAA 1DELA 3TNUA 2ECKA 2E9SA 2WAXA 2OXCA 4URXR 3JVVA 1Z6GA 3FFBA 2ZANA 1EGAA 5DI9A 4QPJA 1ESNA 3HE5A 5IT5A 1BYUA 5JWOA 1F6BA 1W46A 2JJ1A 2YWGA 4L4UA 4X8HA 3QF4B 3TK1A 3D8BA 4LBZA 2A78A 3LO5A 3QKRA 4LUCA 2ZRBA 2IYYA 5DH9A 1OFHA 4PZLA 5KU1A 4JVSB 2ZI3A 4ZKIA 2JJ8A 1KNQA 2QSYA 4JLNA 1CR0A 1DO0A 3CONA 2GESA 4PQFA 4BFVA 1Z0DA 1II8B 4CW7A 1L4UA 3OFND 5DN6A 2IXGA 3WP0A 1D8TA 1HE8B 1CJUC 1WCV1 5EP4A 3VR6A 4U02A 1W47A 1P2SA 1CS4C 2QAGB 1AQYA 5DHFA 1KJYA 1IN7A 1H8HD 1KGDA 3LBNA 4M9QA 4JLAA 1G7TA 5FBQB 1W4RA 3RRYA 2D06A 2FMXA 2XOKD 2N42A 3KQKA 4ZI2A 4A92A 4C0SA 1NVUQ 3I8XA 3ZVLA 1TF5A 3EZ2A 3OF5A 4FIDA 4I1OA 3REFA 3CRW1 3K0AA 3W3AA 4MYTA 2HUPA 2ZJOA 2OV2A 3MWYW 4AY2A 2R44A 4BRWA 5AUNB 4O25A 3THYB 1Z8FA 2VP0A 2B8WA 2BMFA 2HF8A 4NCIA 4QJ5A 2OFXA 1R7RA 3GJXC 4JLDA 4ZKEA 1CI6A 1M1YE 1E79D 1AA9A 3K0FA 3PEWA 1JOYA 4RCZA 3MSXA 2RGNA 2V8OA 4NL4H 2RGCA 1E0AA 2WT7B 1JPJA 5LD2C 2LWIA 2FTKA 2J3EA 3DPUA 1CR4A 5FOWA 3U6BA 4M1SA 1KI1A 2I4IA 4OJQA 4EPYA 4CEHB 4Q00A 2Q3IA 4TTPA 1I4DD 1JALA 1P72A 3EA0A 4HLUC 3NHBA 4NBSA 3RRNA 1N6NA 5J4KA 1U99A 3GEIA 4BFSA 1MOZA 2F7SA 3VHXA 1KDRA 2XNSA 2D7CA 3KB1A 2Q3HA 1US8A 1HY3A 5C4MA 2ODNA 1BMFA 4BZPA 2PBRA 3RNLA 1UKZA 5FOUA 4ILEA 4Z1MD 2WIAA 4P4UA 5BYKA 4XTCS 2CHQA 2FGKA 4C0QC 4ASUA 4ON9A 4DDTA 5JZVA 1XD8A 1HYQA 1V5WA 3CRVA 4AYWA 2GHIA 1II8A 4IEIA 4PQYA 3FKSA 1OFUX 1Z07A 4BFTA 2QAGA 2WPRA 3SZRA 3ZS8A 2C9OA 3Q5EA 2QM8A 3GJ8A 3FHTA 1ZIPA 1X8JA 2H1LA 2XNDA 5IHPA 3TSOA 3THXA 2W0MA 4JBWA 2WOOA 4LJ8A 3PUVA 4I4LA 1G4UR 3JZAA 5LD2B 3DL0A 4RFSB 5DYGA 1K8RA 1KDPA 1UFQA 4GKGA 3AVPA 3GJ4A 3W34A 3THYA 4A8JA 3Q7QA 4M21A 1N6OA 3MRSA 2WJHA 1XWIA 3B6EA 3TGPA 1KK2A 3U7HB 1Z22A 1QHGA 3KJHA 5J4HA 4U5XA 2XXAB 1OE0A 5J5CA 5K8IA 1KI4A 3U7FB 1NWQA 2ZI9A 4E22A 2ZRHA 1EFRD 3LIEA 3B78A 2FX3A 5JSZB 4A36A 1KYIA 1OT3A 4LPKA 5B30A 3QEOA 4B3BA 4CEHA 4KU4A 3HE4A 2C2AA 5KDDA 1S9KE 3GCGA 3VX3A 1QHNA 1A7JA 2O0KA 4KLNA 2VRSA 2FWRA 2C9LY 2JLSA 3TAUA 2EU8A 1M34E 4GOXA 3Q72A 4JBXA 4RESB 2AD5A 3FPAA 4Q5IA 4TT3D 5G41A 1I4TD 3R8CA 2GEUA 5H1YA 3SQXA 2E42A 2X1VA 4IEEA 1XF9A 3SDZA 1IO4A 1TTTA 2AX4A 4E03A 3BFKA 4UNPA 2QE7A 4LYHA 1R0ZA 2FOLA 1FPMA 3ASZA 2OBLA 2Q0HA 3QG5A 4RKFA 4DIEA 1ELOA 1YZTA 2Z43A 1R10A 4BGDA 1V43A 3B13B 3LX8A 2Q3MA 4OJKA 4GOKA 3WYGA 1MRNA 4ZIRA 3A1WA 3DOFA 3L36A 4JT4A 2ZREA 1G17A 2ODBA 1XP8A 2ZUDA 4DKXA 3OFNA 4LJ5A 1S9HA 2WBLC 3GFTA 5APSA 1H8AA 3L35A 3KKMA 3AVQA 5C4GB 4DCVA 1W36D 1J8YF 4EFLA 4PPNA 3T5DA 3U4QA 1QRAA 4BE7B 4G5RA 4URWR 3C15C 1UEJA 5FPHA 3T15A 4F4CA 1OH8A 4Q9HA 2YOFA 2G1KA 4HLUA 4AG5A 5JCZA 3TR5A 3BC1A 1QHYA 4RD3A 5B1OA 2OLJA 2QNRA 2XXAA 3Q9LA 1RYHA 2R6DA 1E4YA 1GDDA 3CX8A 3X1XA 5KSOA 2D62A 2RGXA 1E79A 5JCPA 1G18A 1P4SA 3H84A 1W36C 4AKHA 1NBMD 2PEZA 3ZJYA 2NOAA 4RD2A 5H70A 5C18A 1SULA 3F3YA 4LJ9A 1E9SA 1KOFA 2JJ2D 5KUTA 3GLIE 3U7GA 3K0CA 4D0LB 4BLRA 3R9XA 2FEMA 1E0KA 1KJWA 4DDVA 4BFWA 4D4KA 4CT4B 1UKEA 1MABA 1OHHD 3B1XA 3OESA 1E2EA 2J0SA 3IEUA 4TLAA 3M0DA 2YWFA 1TUIA 5LB2A 2ZU0C 1WMSA 3K1JA 1N6IA 2GAOA 5AVUB 2QGZA 1AS3A 3TW8B 4CIDA 1ZP6A 1VYUA 4B2IA 5AW7B 5HTKA 2OHFA 2GRJA 4F7WA 3HYTA 1R0YA 4BEJA 3RRZA 5KTYA 3KDPB 2GK7A 4H1VA 1K5DA 4DUGD 2ZR0A 1SVKA 3UG7A 1A1VA 4HB2A 3TUJC 2VTKA 1T9HA 4JL6A 1W48A 1CF4A 5HKKD 1SKQA 2BBOA 3P4XA 4DB4A 2V4ZA 4IOMA 3VR2A 2R9VA 2DFLA 2DWPA 4HZIA 4M2LA 3SYNA 4WIAA 2W2XA 3M6AA 4KFSA 5AVTB 3QVUA 3LBIA 1TQ4A 3O8ZA 1ZUHA 1W36B 1OFIA 3X1DA 2VA8A 3TQFA 1FQKA 4EAQA 4QXAA 1HWTC 4FN5A 3WHKA 1NY5A 4EDHA 2Z5HA 1VYVA 3DM9B 2GJAA 4R2IA 2N9BA 4S2EA 2ZRAA 2YWEA 4EPWA 1JI0A 2C99A 1COWD 1P75A 1U0LA 4LV5B 1PUJA 4O0MA 3QY0A 3EPKA 1OYYA 1N5LA 2F43B 1MO6A 3WMGA 3VR3A 1EFRA 4LPSA 3TYYA 5HE8A 2FA9A 4M1MA 2HLDD 2O8DA 2DFTA 1M7GA 4HAUA 1PJRA 4LI0A 1XEWX 2BOVA 3TVTA 1OW3B 3O8RA 1ZCBA 4LDJA 1GTVA 3EAQA 3H4MA 3IKJA 4NKRA 3GPLA 3X1YA 1JNMA 4Q20A 4NU0A 4R9UC 2R5DA 2O0JA 4O2LA 4PC3A 1JBKA 4TT3A 5LDDC 2RHMA 4PHFA 2UKDA 4MQBA 4LJ7A 3FHOA 2MSCB 4H9GA 5JI3E 2NPIA 4Q4LA 3QXSA 2ZRIA 1IJEA 1J2JA 3PVSA 1JR3D 4BLQA 3ZRWB 3LX5A 1CIPA 1ZINA 5AJZA 3PENA 4EPTA 2XITA 1A02J 4GMDA 1E9FA 1GIAA 2ZITA 5EP2A 3P26A 5J4LA 5AW0B 1YZKA 1IXSB 4L5BA 3J81k 2O8BA 1P3JA 3UATA 1P6XA 5F2EA 4QHYA 2OZEA 2WZQA 3MJRA 4KFUA 2QSZA 1RYFA 4DEYA 4QKQA 2QRZA 4KCGA 3R9IA 3ADCA 2IUUA 2WVJA 1TL7C 2IYSA 3L37A 3GJ3A 2C96A 1SXJA 4NYIQ 1XU4A 4CYMA 2ZR7A 5CM8B 3K53A 1E1QD 3B9PA 4CDGA 4EJSC 3U3OA 2WM9B 1D2NA 5DSZA 1GITA 4Q9LA 5AVRB 2CNWA 4LCBA 1CR1A 3UMFA 5JWRA 3VTPC 4BPBA 4UKDA 1XCMA 1DAEA 1AS0A 1T8TA 1CRPA 5L3RA 2GEDA 2OESA 2ZI7A 4NZYA 2G1JA 1DAIA 4CT5A 4NPHA 3EX7C 5JRJA 3EA5A 2QT1A 1TEXA 4UNSA 3CLVA 5AVZB 4M22A 4D26A 2ZYTX 2ZE6A 1E98A 2FU5C 4GI7A 5FTJA 3A1UA 4Y0AA 1P2TA 1NN5A 3T1VA 2P6UA 2G88A 1NBMA 1KI3A 3AUXA 4A6XA 2GILA 2WJIA 2O8FB 2Q7CA 4PFSA 4Q01A 5KOYA 5KNDA 1Y3AA 2JJ2A 3GJ6A 4AYXA 4I5SA 2C98A 4TLBA 4TYPA 4QOSA 2YNYA 3DZDA 4OQLA 3EPLA 3X1WA 1OHHA 3S1AB 5FBRB 5BXQC 2C5LA 2REOA 3QXCA 3KZ1E 3ZRWA 1XRJA 2NQ2C 2OBNA 1UJ2A 3VMFA 3DVLA 2GCPA 3OAKA 4B86A 2O0HA 4B47A 2V55B 2KJQA 3DKPA 3KJGA 4ZDWA 3ZZ0A 1AGPA 4D0NA 1XNJA 1E2GA 2JDID 2QP4A 3TJZA 2P2UA 3CH5A 4DUGA 2VF8A 4EJSB 3AKDA 2H8KA 5DI3B 2HEIA 2C95A 2JA1A 3OEHA 2NO9A 1PZNA 3O47A 2CBZA 4V0ME 4YDSA 5FTNA 3T5GA 4B75A 5HKKA
chains in the Genus database with same CATH superfamily
3OTIA 5C35A 4BMVA 2Z2XA 1P44A 2H18A 3QWFA 5JCXA 1RSOB 5G3YA 2CV1A 1WLYA 3A1CA 1U90A 4OAOA 2A7QA 4TWBA 3TIIA 3MMXA 3JAKB 1G4AE 1XLVA 2CY0A 2XCTB 2UZIR 1W5BA 3ZZUA 1QF6A 3HVKA 2P0AA 4N39A 2QLNA 1NQWA 5TXGA 2B1QA 4S1OA 3BCCJ 5IX8A 4F9FA 4UUBA 1YQDA 4N3NA 1PWHA 5DXFA 2ZT8A 5KYXB 1YR3A 4OATA 2X6QA 4US1R 2GBPA 2RC5A 3SMQA 4IIJB 1L7NA 3A6FA 2I87A 1YS7A 2BHRA 4QATA 4MH0R 1JE0A 2BMDA 1Q44A 5BR1A 1AA6A 1E3LA 2GDJA 3S1LA 2CDAA 2XUFA 5TPZD 4JGGA 2FKXA 2V7GA 2WIDA 4JSTA 1P0FA 3ORFA 2I34A 3G9ZA 2V7QA 4KSCA 4ZQBA 2GPBA 4ZDJA 3D8UA 4XIFA 2E4XA 3BHNA 2LV8A 2H52A 1OY1A 1YVPA 1J09A 1P8AA 3ZLJA 5EJ9A 4A0GA 5GAJA 1QGDA 2VOEA 1AP6A 1IK4A 3GJRA 4DVJA 1K4YA 2WJVA 4UFNA 1IONA 4EG1A 2FN3A 3ACDA 1WSWA 5CBOA 4DQVA 4EZEA 2J3MA 5JTTA 1DAKA 1O8BA 5ALVA 3UAZA 1Y3BE 5FL7D 4JI8O 2I03A 3EDOA 4DUZO 1UWKA 1A2QA 1SKYE 4K3AA 1G8YA 4B2YA 1Z36A 4MUJA 3NRJA 3E48A 4RFLA 4B6JA 1LV7A 1R5NA 1TYAE 3AHFA 3UV7A 2DFNA 3RIYA 5FTMA 4LX0A 5IZ4A 2ONYA 1NT2B 4RJTA 3C3KA 1N86A 4IS2A 3HMKA 1V55B 1G6HA 3L43A 3PRKE 4NBVA 1W5SA 3SLKA 1ODJA 2D00A 4FD2A 2Q67A 1NF3A 3WLSA 3AZOA 1PFVA 1NVPB 2Z5IA 1I4EB 1U0JA 3DMTC 5LP6C 1WA8A 2VG8A 3WL4A 1IDOA 1X7ZA 3X1ZA 3ABLC 4E6EA 1C30A 1E6CA 4JYCA 4J41A 5GVSA 1UL1X 3M34A 2VZ8A 5AJWA 4F4FA 2YBDA 2C1EA 1NF9A 3N6VA 3DLCA 2X6AA 3CXHI 4IDBA 1UZMA 2MYUA 5EA2A 1DWQA 1OYVA 2QPLA 3V1MA 4XKJA 4DYHA 4FMCB 3U0ZA 1NH2D 3B6MA 2XADA 1WSBA 2QW0X 2X19A 1TT5A 2A9PA 2YMKA 1QO9A 4RORA 1S0UA 4DCSA 4EUFA 3RFUA 2V3VA 5AUOB 2REBA 1AJEA 1E4EB 5CJPA 4G4GA 2ZM6O 2DFKB 1L5HA 3H25A 1I7DA 3O84A 3ZLBA 3NBYC 2PYZA 4A2WA 4TVSA 3D8TA 3V2HA 5K3SA 4KH0A 3ZQ6A 3CCBA 4GBED 1YITP 3LK7A 4LJYA 3R8FA 5IH7A 1MH1A 2NV0A 5CCDA 1T2KD 3AFOA 2NSDA 5JYBA 4HWTA 3EGOA 2CHVA 3O8CA 4IHKA 2R5BA 1BX3A 2C4NA 2C3PA 2Y9PB 2QR3A 4G1EB 1T2KC 1NVDA 3CQ9A 5EJGA 4YYZA 5FBWB 3ZG6A 3W8RA 5B3SB 3X2FA 3O38A 3EZGA 4QTUB 4Z51A 1GM9A 3W9UA 3FGZA 2N0SA 3I5CA 1J49A 1BE3E 1RQGA 1HTLC 4N54A 1NTZK 1YE3A 3QLVC 5K5EA 4LOAA 1H8HG 5GTIH 4J10A 4N47A 4OX9O 2FSHA 2YWHA 1Z33A 4BJ1A 4CCWA 3HRNA 2PQ2A 4PGGA 2QTLA 2YEVA 2F3SA 3RWBA 3R7SA 4LRWA 4G9BA 2I1JA 2Q50A 3WZ2A 4MHTA 1W1WA 4FLUA 3C3DA 2JJYA 1ZMXA 3BMOB 3WGHA 4PC1A 4FYWA 1KO7A 5DISB 1IHPA 3I55P 4QUDA 1UR5A 3I5MA 5AKZA 1P1IA 4DJTA 4ZJPA 4L8WB 2ZWPA 1Y0BA 3BB1A 2QVYX 2PXAA 1R8YA 1NU6A 2HWUA 1SIBE 2JH3A 1WWKA 2WSMA 1JKIA 3B60A 4UCQA 4GZMA 3NTNA 3SYPA 2RN0A 1UJ4A 3QU4A 3EYWA 3PN1A 3A9CA 4TUYB 3L0DA 2W2MA 3WA6A 2GVNA 2QXYA 4DSTA 2PGGA 3IFXA 2I8AA 5KSZA 2PKWA 3NONA 2QUAA 1K5QA 4AJNA 1XJ0A 1XVLA 1NR7A 3UIEA 3I9FA 4UVEA 1Y8RA 1PWEA 4HH0A 1PD1A 4AUEA 3AR3A 1DRJA 2BMJA 1ODIA 2W00A 1MV5A 2BKEA 4O4LA 3IP1A 1U2DA 2J33A 4LFAO 3OFJA 2C7RA 5ITSA 3GNLA 4C7RA 2VBCA 5DHPA 1ZOIA 4B4DA 2XKMA 4RVCA 2QD5A 2F43G 1SKAA 5C8YB 2HLDA 1QLEB 1XQ8A 1C8LA 5LWQA 4Z8XA 2BCCJ 1GK9A 2NZ2A 2EL9A 2X2OA 2F1MA 1RJFA 2GJKA 5DHFA 3E8MA 2HWYA 1CR2A 2XCSB 4YO7A 4RK7A 5IXJA 1U0OC 3KFXA 1L5OA 4Q3CA 4NBLA 3O4GA 2ZJBA 2K3RA 1RP3B 3K4QA 1HW7A 1E9EA 3THWA 5H0IA 1NTMH 4PO9A 3RS2A 1ICIA 4HLQB 4HUQB 2HTEA 2RHLA 5LQAA 2G40A 1QIMA 4MVJG 4WNCA 2RGUA 4QPJC 4MQ5A 4MV8A 2RI0A 4GI3A 2JGAA 1AR1B 1F7YA 3VOPA 1Q84A 4L3WA 1KB9D 3T52A 2Y0IA 3GG2A 3HJUA 4OO3A 1S5LZ 1XTIA 3AF2A 2DJVA 3NASA 4R7TA 1E60A 1I6MA 3E8SA 4CMBA 4TLFA 1XHXA 3KWMA 3H1IJ 2FP4B 4LRUA 4BMSA 3SS7X 1YB6A 5P8WA 4ASUD 2YH2A 1OKKD 4TN5A 4G1VA 1GNSA 3TVDA 3TD9A 1ODLA 3B1YA 5AW2A 3GLQA 4Z3DA 1O5IA 3FPKA 421PA 4UUNA 1PNVA 4P7GA 2K4MA 2C2WA 1XEXB 1I9GA 2W8ZA 1E7YA 4HLNA 4YRRA 1STOA 2FZVA 2O2GA 4DSUA 3B8EB 4PS0A 1W4BA 1UWVA 1SFRA 4S04A 2JIZA 3HCDA 4MN4C 1V48A 1HRDA 4QVIA 4OU4A 4KO8A 2LKDA 2OUKA 1XRQA 5TSDA 5BR7A 2XUHA 4PO3X 4MYDA 2C2MA 1L7QA 1GRJA 2QL6A 1PK7A 4GBMA 3WSWA 2VUIB 4I1IA 1CV2A 5JXIA 1RMQA 1KB9H 2VH1A 2ID7A 1XPRA 2XVXA 3CTPA 2ZIEA 1GSOA 1SQQJ 4DV3B 3IRVA 2P3OA 2FE1A 1XMIA 1PL8A 4FLVA 2X15A 1R4AA 3R7BA 4PGAA 4LF8B 4PJ0E 4C7UA 4MOWA 4MZXA 2V97A 1GM5A 2KBFA 1W29A 3WFVA 3WIBA 1JNYA 4V02A 5HGXA 5KSPA 1DQSA 3R24A 721PA 1OLUB 1JUNA 5EMHA 4URFA 3E2EA 5CBKA 1JLLB 3RI3A 5SY9A 5GM1A 1YGPA 1UJ6A 2ZYRA 3NNNA 1XZJA 3ECSA 1DU4A 4FEAA 3RG8A 3FTEA 3AL2A 4Q9NA 3VU1A 1G55A 4GGPA 1UZUA 3MTQA 1ZQ9A 4IRUB 2Q6LA 4GSYA 2IYXA 2G38A 4ZICA 4RVGA 1N5DA 4M9XA 3K1AA 3L1IA 2H48A 3TXYA 1XMOB 1FYVA 3GDFA 2LO1A 1BD4A 4GF5A 4W5OA 2IH2A 1A02F 4G4SP 3H18A 1EBUA 4J8PA 1Q17A 1QG4A 2PL3A 5EGNA 1VL1A 2PL9A 4J0GA 4BNHA 1E62A 3HR4A 4JPRA 4CEJB 4LVCA 1MX1A 5CB4A 3LQ2A 4JU9A 3K3PA 4OP1A 3KYIB 1LI4A 2CVZA 4OOEA 1UKCA 1H0TA 2NNWB 3V2NA 2BSQA 4DQKA 4WESB 4DB2A 1V6CA 4W5RA 5H3HA 2CJYA 2QP3A 5HJ5A 2ZXUA 1LDEA 4S1PA 1TIKA 1CY8A 2IP4A 2BI8A 4D92A 2VBGA 4ZRDA 1ZD8A 1VBKA 4M86A 3ZEAA 1D6SA 1VP3A 4AS3A 2EF0A 1P0IA 4R9SA 5MN4A 1ZM4A 5TF0A 1AGYA 3LUBA 1CRWG 4P2GA 3FBGA 1NO4A 1V7PC 1BWPA 3TSAA 3F9CA 3VNUA 3OEWA 1SOWA 4QLAA 5A4JA 3DE5X 2ZJSE 4UZFA 1NAFA 3PDIA 3V1UA 1YITV 1MA3A 2KS1A 3JASB 4H16A 5ELLA 4OFXA 2VRNA 3EXG1 4UEQA 1EN6A 3DVAA 4P9OA 1U8UA 2WLSA 5J43A 5ALGA 1R37A 3UEOA 4J2TA 4IDPA 2A45I 2X8AA 1DIGA 3SF8B 4H44B 3GF4A 3L7NA 4WKPA 4P81A 5CEFA 4L4RA 3SR3A 2VF4X 621PA 3NT2A 4L73A 3E3NA 3Q0IA 3G17A 5ER9A 4BNKA 4KITB 5AI9A 3PUHA 1P4RA 2HK8A 4JJKA 5BRNA 4DAOA 1IN4A 4JYBA 1N3IA 1HBJA 2H1HA 4NMMA 1WB8A 2XKAA 3BN3A 3C7CB 5CHXA 5J3JA 2BFEB 3Q5SA 1U0HC 2AGVA 3H86A 3A8TA 2Y69B 1I80A 2FSUA 4L02A 1Y80A 3EVTA 4MA0A 1QHSA 1VMIA 4LF6O 3MAAC 4DY6A 1UDCA 3FB7C 3GLHB 1GL2A 3EXIB 3OX4A 1BXKA 1KVUA 1LLQA 4JMLA 1T2VA 3CNQS 4WK0B 4ZVTA 4PC6A 5CD9A 2VLIA 2MSDB 2ZJ1A 5K09A 1BXGB 3SBEA 4V0OA 2HSJA 3TR0A 2O2YA 1YF3A 3UGJA 4CQMA 2HKIA 4D8TA 1NQOA 3OMXA 3EMDA 4M83A 3C4JA 1KKDA 4TPKA 1JIVA 3EZ9A 1SNYA 1VKNA 2VQDA 2PX3A 1EJ6A 4OQXA 4FINA 1R4NA 2LXBA 1NVAA 1LA2A 2Q4PA 3JVUA 5EQJB 4JI2O 2ODWA 3OT5A 4NIMA 2MINA 2WPQA 1DBRA 3ODPA 4NZZA 1OX4B 4EQ6A 3WGVA 3H8JA 1NW5A 4JLBA 1Y4SA 4ND1A 1I6LA 3H6PA 5FBKA 1XTBA 3A6HA 2LRHA 1EFKA 3NHLA 1XMXA 3Q88A 2HEGA 4IJWA 2HQRA 2X1LA 5TQ2B 3BK7A 4OHWA 4LCUC 1LNSA 4OCZA 3K9FC 4TRRA 4ZZ3A 2GM5A 5CIYA 1Z82A 3ME5A 3P3NA 2IF0A 3WB1A 3KXLA 2CXOA 3K96A 2XHZA 3WGYA 4R2JA 2FUG1 1MB4A 4Y8VA 1U97A 1LUAA 1W6UA 2HYNA 2NXNA 3O3CA 3IL2A 3CCMP 1WT6A 3ZZ1A 3ONWA 3VRHA 4H35A 3M70A 1UXKA 1GQSA 1YJBA 1AH2A 4TYNA 2J9GA 1TKAA 1BQEA 3S28A 1H1LA 4WOBA 3DW1X 1E3SA 1SVIA 5EJEA 4A1FA 4Y98A 4M4SA 3CA8A 1F6DA 2ZIZA 3KBOA 4D98A 1SS3A 4LJRA 4GLLA 1DBSA 3B40A 2FFHA 4HEQA 3AERA 3ROFA 1SQSA 4G1MB 3P30A 1ZXLA 3E22B 4TS9A 2E6KA 4FX2A 3TFOA 1N2JA 5TQVA 5BVHA 3LW5H 1HEUA 1UF9A 4OQMA 1U0RA 3U7EB 1VJRA 2DHQA 3WXMA 3WRXA 4DR6O 3GCWA 2A0YA 4ZC1A 3U1VA 4EHKA 2DLCX 1RPNA 4YMTA 3I2YX 4TMZA 4LF5O 1ZH2A 3PA6A 3TRKA 3C1LA 1BAPA 2IS4A 1AJYA 3NAGA 5IT0A 3KE9A 5JAIA 3EIQA 2JF0A 4PY2A 2LKMA 4QFBA 3TLEA 4J4BA 3VMMA 4JQYA 2PO7A 4QGAA 4QQNA 3ID6C 1NYQA 3RIMA 4K26A 5IT5A 4RPCA 1W46A 5MDHA 5JAOA 1CWUA 4PZLA 1FJHA 3X2EA 5IAGA 1Z0DA 2NUPA 1THTA 2IXGA 4GBJA 4J90A 3WP0A 1UPBA 1P2SA 5LZ7A 3TLCA 5M34A 2Q1XA 2YWDA 4U9IS 1YTUA 2Q6AA 3JAWA 2FWIA 3LZ6A 1LLDA 2QG4A 3ESQA 4NPAA 2ZJOA 3G7NA 1Z8FA 2B8WA 4FR2A 1CI6A 2JP3A 1I2AA 1DMRA 1D0IA 1FB5A 3NKLA 1TVMA 3WJ7A 1QGOA 3P9KA 2W8BA 5M2QA 5BQFA 4PZ0A 1P72A 1N6NA 5HKLA 3DHNA 1BMFA 4MKRA 4C0QC 2PZ8A 4JGIA 1MSDA 1Y3DE 4YVFA 1WUHS 3GLUA 2CLIB 2IHZA 2O7NA 1CQPA 4FYKA 1MVLA 3R3WA 4BZWA 3GUYA 1NRIA 3H1BA 3JZAA 5LD2B 3ZE2B 3AVPA 5JR3A 3THYA 2I9PA 4FI3F 1QHGA 2XXAB 2Y1OA 1QEXA 1XCLA 3AEYA 3CGGA 1SCUB 3RRBA 3GHYA 5BO5A 1PDOA 4FX5A 4UPEA 2QRQA 2VRSA 3WTBA 2C9LY 5GTHZ 3TAUA 3E9ZA 5CCEA 4Q5IA 1I4TD 5HZGA 1JDBB 5JSKA 1XF9A 2PH3A 2Q5LA 1IEVA 3BFKA 4BB9A 3DWIA 1AFOA 2YTZA 3PNMA 3L8HA 4HFRA 4K6CA 1U8CB 5KTKA 5JMPA 3AVQA 5C4GB 2WWVD 1YUBA 2AN3A 4PRLA 3ZEDA 3TR5A 3H1KJ 3BC1A 3TSIA 1JWBB 1HOTA 3AHGA 1S3JA 4NZOA 1GLVA 2MJZA 3ZY4A 4ND4A 4C7KA 5C1IA 2ZJ7A 4QUAA 2HBZA 4LFBO 5CD1A 2FWMX 1CIVA 4BFWA 4D4KA 1ZHOA 2PY5A 1E77A 1PJBA 2VRBA 1C7JA 3CRCA 1ZI8A 4M60A 5JNVA 3HD7A 1OV9A 3OPMA 1WMDA 3LHDA 4BO3A 3HADA 1QYWA 4LY0A 1W48A 2XWPA 3HJRA 2WSYB 1QZ3A 4RM2A 1FBNA 3H97A 3FCEA 1QX8A 3DL7A 3OZGA 2OBYA 5KYUA 3I0ZA 3AY3A 4C78A 2HLHA 2IKQA 1U0LA 1IM8A 2EINC 3WMGA 4Y7CA 2O8DA 3UT5B 1PVVA 1VJGA 4CLEA 3IKJA 3GPLA 2A06H 1R8EA 3CNEA 4F4UA 2Z3WA 1XVVA 4PC3A 3UTCA 3SJQC 1QUEA 5FO1A 3S1KA 3O82A 4OHRA 1Z5PA 2BOCC 3ABRB 3EQ8A 2NW6A 4CKYA 4YCDA 3UATA 4KPUB 3NTVA 4W9NC 3R66A 4KCGA 3R9IA 3JPWA 5BVGB 2WVGA 1Y1SA 2Q3CA 1WQ4A 1QPBA 1XU4A 5DT9A 3T3EA 3UK1A 3X3HA 1MOFA 3P2EA 3CKKA 3ASNC 2CNWA 1CR1A 5EIXA 1N2XA 4MV4A 4C20A 5L3RA 3EX7C 2OESA 2G1JA 2HVKC 1DAIA 2YUIA 3R0JA 4LQDA 5LMNB 4YRQA 2Q5QA 4Y9UA 4XA8A 4GI7A 5JSHA 1Y1KE 4EH1A 4ZTBA 4PFSA 4Q01A 2A6PA 3IEIA 2YNYA 5I4KA 5IJ9A 2BONA 4AO7A 1HO3A 5G02A 3L79A 2NQ2C 3FW1A 1JFLA 3JWPA 3L71H 3ZZ0A 1E2GA 2P2UA 4WJKB 3P9YA 5A2QA 3MXOA 2BELA 1L4NA 2NO9A 2QSIA 4B3IA 3GX1A 5CCHD 2OFWA 1M6WA 3R0IA 2ARHA 5KKAA 2FX5A 1M7LA 3LY8A 2UDPA 1H4SA 2ATCA 3CNLA 3BDVA 3R40A 4LW8A 3G3EA 2W43A 2Y8EA 5CCHC 4FFKA 5LKRA 1D0VA 4B87A 5ED4A 2FR8C 3W7AA 1VXRA 3LHIA 5TARA 1MC4A 5G4LA 5LJIA 4KO3S 2IOYA 2IXAA 3S7ZA 5SZKB 3QOXA 4UBLA 3WGNA 1DOHA 3AP1A 1KY4A 3NC1C 3C8VA 3PR1A 4ZOEA 5ECYA 1KI6B 4PWZA 4ER7A 3MWEA 1T3SA 1UMKA 2ET6A 2WM3A 2OWDA 1JWLA 1ONSA 5JJBA 1Q12A 1XK7A 4BUJA 2MK3A 4MKHA 4DRZA 4QBGB 2JCBA 3QWOC 1KGSA 2RG1A 3AI3A 5LUAA 5JDCA 3L4FA 1XZBA 4IEFB 4W4LA 1JY2N 4QYIA 2QPAA 1KHHA 2XF2A 2XA2A 1M6EX 2PD4A 2PSSA 2VAXA 4HAIA 1RIIA 2ZR2A 5HS4A 3T06B 3NHAA 4BAUA 2DPXA 4AX4A 1B1AA 1XZLA 4N78D 3CCMV 5EIWA 1FZCB 1E3JA 1KEPA 3EVKA 3EE6A 3V5BA 2Q7EA 3OQPA 4LXYA 3IFMA 5KHGA 2HRQA 2DWEC 3NPAA 4IXDA 2HXGA 1AURA 1ESZA 1U3GA 3AUFA 1GVNB 5H2FE 3RHTA 3ETQA 1R3IC 2IW1A 3D64A 3AR7A 5FPOA 3IS3A 1E8DA 4Q05A 1CUFA 2QRKA 3KOWA 2N05A 2R7NA 3GN1A 3V7NA 3TS1A 2NTEA 1RZUA 3L18A 1BO6A 3ASOB 1UOQA 3I12A 4FP9A 3UJ7A 5LQMA 4M0CA 1SHTX 3IOEA 1BSNA 1M2JA 1XZMA 3HE3A 4B40A 5K05A 1TCBA 4E09A 5DSXA 3AEZA 5DTJA 1TU0A 5IKEA 4AWXA 1N7IA 1JJ2U 1PW7A 3SFEC 3CNNA 1N2BA 4HAOA 4X41A 1QVGO 5JHGB 1YJXA 3I2IA 5JANA 4XJSA 3M6XA 4LHZA 4O5AA 5AW9A 3QW4B 4DT1B 3W7XA 1LRLA 2YHIB 4V0RA 1HH4A 5AVWB 4KXVA 2DU8A 2RQ6A 4QREA 3GROA 3DMDA 5EVJA 3P5BA 5BORA 2I2WA 3O31A 3AETB 3RBZA 1AUOA 3V2IA 2RD2A 5K0BA 2YQ4A 2JLRA 3K0DA 1P2FA 1C0LA 3C3EA 1KHTA 4RD0A 2AUMA 1NE7A 1KBOA 3OSUA 3QKIA 2MTBA 1UBSB 5C32A 1P7WA 4LY6A 4PC2A 3B5IA 4RKWA 1OBCA 1M7HA 4IWYA 1SQXH 5JXJA 3BJZA 2ACKA 3PYLA 3V8NA 4XQCA 4OHYA 3EMVA 4ZI3A 3LLUA 4X1YB 2Z2JA 2IJIA 4BQOA 5CTJA 4BVJA 2WTEA 3FYSA 1MRZA 1Z7EA 2H59A 4JC8A 4EJ6A 1L7PA 3IJEB 4XLLA 4JBGA 1KFNA 1AKRA 1JMYA 1MKMA 1JXOA 4N3CA 1KB9I 3EDRA 4ND3A 3MLBA 3PXEA 1O9GA 5KKNB 1QAOA 2WYUA 3ADPA 4G0YA 2IEGA 4QWWA 3K4HA 3Q6MA 2IS6A 4UCFA 5KJCA 2J46A 3OOJA 1T2CA 4EW3A 1VDZA 2WKSA 1W19A 1W2GA 1SESA 5P21A 4IIEA 2PYDA 2WA1A 1ZD9A 3GRUA 1D5AA 2VCHA 2JLQA 4TTVA 4F2GA 5H8WA 2YRWA 4AO6A 2EX1A 4LDZA 4P86A 1A69A 2L42A 1WD7A 2W42A 1NQ5A 1QE0A 3JRWA 4NBTA 4CF3A 3FPFA 4F9GA 3D3WB 5KMGA 4X0EA 1CUJA 2XUAA 5T6MA 3EUWA 5IJ0B 4NENB 1GAEO 3U3XA 3G5UA 3UAVA 3LUPA 3O8OB 1VSBA 4NBUA 1S02A 1T2EA 3GHGB 4PDLA 2PGAA 1Q7TA 2PTGA 1U9JA 4J7XA 2IBMA 2HGZA 1ILWA 4PPYA 4ZHQF 4XIGS 3JCZA 4BEVA 1GPKA 4MDEA 4E2WA 2XV5A 4R3UC 3OZCA 3TJMA 4IWNA 2OHXA 2NPSA 4WBNB 4CNQA 4F8EA 1D5NA 5K5GB 3A10A 5CIWA 3E8FA 1UBHS 2OAQ1 3KYCA 3CPSA 3C1AA 5EEGA 2CLLB 1GGMA 1O4WA 1SC3A 5JS6A 5TY0A 3FPLA 5AVTA 2CF6A 2PUWA 3ICPA 3PUYA 1BYIA 1JU9A 1BCSB 5CJ2A 1WB7A 4MR9A 1E9CA 4KC0A 2O7QA 2ZWOA 1DPFA 4HAVA 3A0BE 3ZY6A 3SGLA 4HSGA 4DA7A 4N7JA 1EVIA 3OW2U 4HZGA 1JPUA 3JSLA 3LYUA 1UXOA 3ROKA 3LSYA 1YA8A 3AWDA 1RWBA 2ROQA 3TH5A 4X8MA 3B5JA 1LWUA 2FXPA 4NEGA 3W2HA 2CTRA 1EFCA 2H1SA 4UXJA 3RBVA 4IRMA 5B3KA 5JOQA 4UD6A 2VQEO 2B4KA 4ZHSA 3JPYA 5A05A 4I7ZB 3GLIA 4GCZA 2HJGA 3FOCA 2EDAA 1D2GA 4IZ6A 2IDBA 4YBZA 3V8PA 5LQNA 4BU1A 4U8GA 1W0CA 4DWOA 4MDHA 3GZ4A 3J7AC 3E8HA 2DBYA 4L95C 4MVJM 2QQGA 3S8YA 3QPBA 2I2AA 4D42A 1JEQA 1W35A 3QX7A 3OMWA 1CUYA 3KK0A 3QOWA 5EVCA 1NKSA 4RO0A 4R98A 4KQWA 1M54A 4OHMA 5K1XA 2X77A 1H85A 3RC7A 2K7ZA 3OQJA 3CSXA 2Z30A 2O54A 1QP8A 2X0FA 3M0AA 5BPHA 1C9KA 3JARB 1D03A 3EPHA 1FXKB 3DQZA 5E1AC 5B5EE 4IOKA 3K35A 1E1QA 4ZVLA 5JZMA 4LF7B 1BEEA 2R9RB 5HKBA 4BRYB 3LKBA 4KEAA 1Z0SA 4R5MA 2OO7A 1NMZA 5F51A 4RKQA 5FV4A 1RYEA 4EY7A 3KR1A 1SKVA 3CC7P 5FNVB 2YO2A 4HTAA 1YHYA 2E18A 4DRXB 1IUPA 4HDNB 5LGUA 4FNAA 4CKEA 3SHTA 4AROA 3AR5A 3KKLA 5CVDA 3E4CA 5B64A 1HORA 5PNTA 3A27A 3AHDA 4ZYZA 3D4LA 4FLZA 1BE0A 2DLDA 3A1NA 2X5JO 1I30A 4MKZA 1L7XA 3GBSA 4NJMA 5C37A 1KYOF 1S6YA 4FJ0A 1HGZA 2QM0A 2XZLA 2I2DA 3UCXA 4F4JA 2CNDA 3W2EA 1C0EA 2Q1SA 5D3KA 4Z4EA 1VI6A 3FCYA 2GFIA 3GVHA 1CRZA 2DPMA 2GD2A 3IUYA 4LN1A 4G0WA 1LQTA 2C2KA 5KAIE 5EZYF 1SCJA 1Z34A 4DV6B 3WYEA 3T2MA 2AC7A 4YRBA 3PFIA 1FYEA 1SZXA 5LA6A 5HCIA 1QAMA 5B1AB 5I8ZA 5J2UA 1SVLA 1N34O 1F6WA 5CURA 2GPNA 3GVMA 1YQWA 4K46A 2DC1A 4UEWA 3THXB 1E9RA 4R51A 4MAFA 3T1YB 1J1IA 3OIGA 3UV3A 2QZJA 3GV0A 2J3KA 1AVMA 4N9QA 4KFCA 5DECA 3HLTA 4MCAA 3MBKA 5JDIC 3PRYA 2X58A 4TKVB 3U7QA 1KFMA 3SI7A 3PVZA 1IN8A 5JH7A 2Q5IA 4BNUA 4BYGA 4KL1A 3WA7A 3PDJA 4JLWA 3ICOA 2OTLP 1FX0B 1XIVA 4XYEA 3VJMA 4WK2B 1PR0A 3L75D 3BEDA 3L73J 1EWRA 3JQBC 4ECAA 4KWEA 1L8QA 1SUAA 1NJGA 4PEVA 4AJJA 1J7KA 2R6GA 4KP7A 4S1VA 3HVUA 4OHFA 4ID9A 2W83A 1OH7A 2ZD9A 5JC8A 5KI6A 2A5FA 1P6QA 2A45H 2WVRA 3EBLA 1YJCA 5LZ5A 3H2HA 5ECGC 2XUZA 1MV8A 3CCSP 5AK0A 3S55A 1ISIA 4RIHA 4PFKA 3OAAA 2ETXA 1X13A 4OXQA 4LV6A 2X1MA 4MYCA 1JQDA 1MP0A 4KZPA 1J5XA 3GVCA 2O3SA 5LQRA 1EE2A 1E79H 3P9NA 3NV7A 1Z5GA 2RBEA 3KWJA 4ES6A 1EDOA 2R1VB 4B5LA 2Y1EA 3ICQB 4NMXB 3FX7A 5CYPA 4BXOB 3SQDA 2OPHA 3DBRB 3U4GA 4D4HA 3SM9A 3ZQ4A 1B3BA 3WZLA 1QO7A 4DOJA 5CYOA 3RT3C 1NOKA 4PA9A 3ND5A 3N6XA 1P1CA 3HWRA 4D3SA 2ZIVB 2CHFA 4XE5B 3CMEP 1L9KA 3LY5A 5EERA 3V4ZA 3H3XA 1U4SA 2EFCB 3SC6A 2JFGA 3WYBA 2ZIWB 3CMMA 3TLGB 3VVMA 5KHKA 1LLCA 4Q7JB 5I7VA 4H17A 2O8BB 2PZGA 4F4LA 4D6TJ 1YR9A 3EUAA 4FWBA 1SXPA 2YV1A 2BEZF 5CNKA 4UUMA 1E96A 4PYKA 1YK1A 4IH9A 1Q1ZA 5F1KA 1N3YA 3WQQA 1XZGA 3CZRA 3ZD9A 2EFJA 4J42A 3GB7C 1XA3A 1C7IA 2BWJA 3OTGA 5J58A 3T54A 2G8YA 2GUZA 3E9MA 4QGPA 3OY2A 1T8ZA 3ZE8A 1R3JC 1R27A 3G2HA 2JFBA 1DFHA 5T7BA 2P4QA 1Z6XA 3EHEA 1ZUD1 2IHVA 2ZXEB 1ZJYA 3GFOA 3D43A 1R18A 2ZUEA 3QPUA 5HDQA 1J1EB 4D5GA 3T9CA 4XEHA 1KJZA 1IBLB 5FA6A 2RJOA 2WWXA 5KYYA 4A0SA 2EHJA 4Q9KA 1AM4D 5AQEA 5AYVA 5F52A 4BECA 3BJEA 3VR4D 4IVQA 2A67A 4KE7A 2FSGA 4JBNA 2OYIB 2JGDB 1G2QA 5FOQA 2BDTA 2PPVA 3EG5A 1URQD 1K5SA 1NVMB 1KI7A 3VHLB 1J9ZA 5EJMA 3TQQA 2HDNB 3MD9A 2G06A 1N8TA 4XCXA 1URQC 4ZO6A 2OBFA 2J85A 4EF6A 4PC7A 5EXTA 3D6HA 1N4DA 5BMVA 1LI7A 3KETA 2YBEA 2UU9O 3CH4B 3OOSA 1Y9DA 1PNQA 1VKOA 1GNQA 4TVKA 4C4SA 5L3EA 3UCFA 4F60A 3WO1A 4JU8A 2CXHA 1X70A 2C7QA 2NRGA 2MYPA 2YMYA 1E1LA 1TC2A 4YT4A 3KKNA 1R0LA 2PH7A 2FWBA 1AN9A 2V58A 1ZGBA 1W0JA 1ZN9A 1E5QA 1FMJA 5HQ3B 1OSNA 1YS6A 1XOIA 3CF4A 3H1LJ 1IFIA 4JWKA 5AJXA 2E85A 5D3MB 1N6PA 3OWOA 4MGKR 4MW5A 1KZ7B 3C14C 4F97A 3FCSB 2O20A 1V8ZA 4M37A 1DKOA 3CNBA 3FNEA 5JVDF 2QN3A 2LR0A 2EJRA 1JR4A 1BE3G 3TIVA 4CU5A 3DZBA 1E1YA 3NVMB 1KJNA 4LXTA 3TL6A 3U4AA 2OIGA 3ELUA 5I6DA 3VR1A 3NP9A 3WXBA 3IP9A 1PJTA 4PF1A 2VHTA 5EUMA 3MPUA 4LYAA 1I13A 3DKRA 4PDRA 3FZNA 3MHPA 1YR8A 1YRYE 3D0QA 5M29A 1V2GA 3R0QA 4N65A 2DOKA 2ORYA 4JODA 3GQBA 3AYZB 4UAUA 2PFKA 2VDPB 3ORYA 4EW1A 4F3CA 4TVOA 5H9CA 3R2PA 4NQRA 4WFKA 2QB5A 1XZNA 3IJ5A 2XEXA 1Z6QA 2Y0BA 2OLEA 4FZ1A 5IYCO 2C2XA 3CC7V 1C7FA 3PC8A 5DBEX 2VKTA 3KQTA 4CPDA 1CC1S 1SS1A 2Q1UA 5ALYA 2G4CA 1QHTA 1NW3A 4UE6A 4P98A 4HV4A 2WAXA 1XJ5A 2OXCA 3TK1A 3BMCB 1VPVA 2YUAA 4M0FA 3QMMA 2ZI3A 3A0UA 1CR0A 1DO0A 4MUMA 1LBIA 1L4UA 3MPOA 3PB3A 4CG0A 1C3EA 1IN7A 1H8HD 5BYBA 3JCUH 1W4RA 5EHIA 3WTCA 3RSCA 4IIVA 1EZVE 1T5TA 3HJFA 4BNDB 4XLZA 2DUMA 4O25A 1HE5A 2YJ6A 4H7PA 2NUAB 2P1ZA 4EFKA 5K8VA 1N0IA 4EEZA 4FFVA 3MXTA 2IYOA 4X20A 4PN3A 3K8OE 3AG1C 2F90A 3EDCA 4KXWA 2DPYA 5FUQA 3CUSA 3DDHA 1DIAA 2VWJA 4WZAB 1XZHA 3BREA 3IPAA 4YRAA 2PX5A 4LH7A 2ICAA 3CVYA 1V5WA 3LSTA 2JAOA 2CTWA 3A04A 4RA6B 3WWEA 3GJ8A 1R6TA 1X8JA 1RR6A 3HXTA 5ALWA 2HF2A 4WNAB 3CXHF 3HKEB 1K27A 5DYGA 3HUEA 4PLHA 2DMXA 2XYGA 5HA5A 1YMVA 4JYAO 4E5MA 1KK2A 2ODQA 1SEPA 4DMFA 5KYNA 4OIMA 5K8IA 2ZI9A 3LIEA 4OUDB 1JFVA 4B3BA 3A6LA 3HJCA 5EFOA 2X8JB 1C5KA 5LJLA 1P39A 1RE1A 3RVDA 2G04A 4I4IA 4EA6A 1QPGA 4X66O 4K8RB 3TM5A 2ZPUA 2OTLV 3AQIA 3ZCSA 4LYHA 1PD3A 1CT9A 3ASZA 4RDCA 4EWLA 3QG5A 4RKFA 1R10A 3QLEA 4BGDA 4AJLA 2X4DA 4PCUA 1DQNA 4ZIRA 2R0QC 5DEIA 3IUQA 4JT4A 1KQOA 2P9CA 2WAAA 1JFTA 1SQVD 2IJGX 4IIFA 1S9HA 1WMFA 1TW2A 3L35A 2FUCA 4WPGA 3LC7O 4X93A 3AE1C 1OH8A 3ETCA 4HLUA 2J9FA 5GZ6A 1TJ3A 3CEAA 4K0RA 1GZ3A 1UINA 2HV9A 3MUOA 5DK4A 4EHLA 4UB6E