4RKUJ

Crystal structure of plant photosystem i at 3 angstrom resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
40
structure length
40
Chain Sequence
RDLKTYLSVAPVASTLWFAALAGLLIEINRLFPDALTFPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structure of plant Photosystem I at 3.1 Angstrom resolution
rcsb
molecule tags Photosynthesis
total genus 11
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2014-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4rkuJ00
1Q90D 2WSCJ 4OGQB 4H13B 1S5LX 2E74B 4PV1B 4I7ZB 2FYNC 2QSIA 1VF5B 3C8VA 2E76B 4KT0J 5KLIC 2WPVB 1ZRTE 2WSEJ 2K9YA 2YIUC 2ZT9B 2QJKC 3LW5J 2E75B 4H0LB 4H44B 5KKZC 2QJPC 2WSFJ 2QJYC 4RKUJ 2O01J 4IL6X 2D2CB 2QIWA 4Y28J 1JB0J 5L8RJ
chains in the Genus database with same CATH superfamily
2POHA 3CCEP 1SQBE 3HD7D 1JY3N 2I8DA 2RMZA 1WT6A 3B4SA 1PP9G 2ZFCA 1PFIA 1LTJC 1URQB 1CI6B 3SFEC 1FZAA 1URQA 1CI6A 3NXSA 3PH0A 1X79B 1L4AB 1HGZA 1CZQA 2QM8A 1L4AA 1YJWP 4PV1D 2Q5UA 1KORA 1Q81Q 3GHGB 1AQ5A 1RF0A 1ZV8A 1HJ0A 1JO5A 2B9BA 2E5YA 5BU8B 1PPJE 3VMXA 4DT0A 1SQXK 2KS1B 2H8PD 2KS1A 5KAIE 1X9VA 4KT0J 2WSEJ 2E43A 1S9KD 2WPRA 2YIUC 2WPQA 1GW3A 3TYYA 1RE4A 2ZYDA 1S1CX 2KOGA 1EXIA 1HTLC 5CCHA 3G9RA 3H25A 2XZRA 2A45G 2OGUA 1PL5A 2ZT9B 1Y8AA 3VTPC 4U3FJ 1M1KQ 3E7KA 2YXQB 1PGOA 2QG4A 3A0BH 1KZUB 1ZN5A 3H1KE 4IL6H 5AW3B 2E75D 4PJ0E 3L70J 2E74C 1NWQA 3FXEA 1OXZA 5KJ7A 1VQ7P 2QRXA 1E79H 2NPSB 2A45H 4H44C 2NPSA 2QM7A 3E1IA 3H1LJ 3AE4C 5CJ0A 3RK2C 3V2NA 1EXJA 3TGUE 1BCCE 1EZVD 1U7JA 3VOPA 2ZVNB 2BCCD 3AE1C 1IZNB 5E79E 2IZ0A 1EZVE 5AVXB 5KLIB 2JP3A 2GA1A 3G71P 2Z4EA 1NTMG 2N1TD 1N2DC 4ZKUA 2QSIA 1Q2NA 1VDFA 3A7OA 2PRRA 2KIKA 3MIWA 1HJBA 5KLVD 1N7SB 1R5SA 2FYUJ 4JPZB 1N7SA 2R3CA 1PGQA 3RK3E 1NU1D 2M5AA 2R5DA 1FZFA 1OVRA 3SFDC 1DEBA 4H0LD 4W80A 1BGYJ 1NU1E 1FZEA 2H88C 3M9HA 4O9BA 4UB6H 2A06E 2AEFA 3CCVP 5AVSB 1MUUA 1S5LX 2WSFH 2OARA 3H1JG 1L0NG 2D2CC 4JBZA 5AW8B 1YYCA 2YMYA 4WY4D 2MJZA 3UIAA 3L74E 1NTMK 1RH5B 3FWLA 1H0TB 2B88A 3S1KA 1JY3O 4RJTA 1H0TA 5CCGC 1GK6A 2HG5D 3CMEP 1QVGO 2Y9ZA 2DW3A 1N73C 3L37A 1OIPA 2BEZF 1GK4A 3MP7B 1XTGB 2GM4A 2XNXA 3KPEA 4TLFA 5AW6B 2WSFJ 1SQQD 2WITA 4HYTB 3AEGC 2R44A 3L72D 5KAIH 1SQPG 2CPSA 1LT9B 1L0NK 1GL2B 1LT9A 1GL2A 3P8MC 2LR2A 2QJKC 2WSCH 1QGKB 1JM0A 3I55P 1M1JB 1GDTA 1YTZI 1KC8Q 2G8YA 3U1AA 1Z56A 3II6A 4N3YB 1J1DB 2IBZE 1USEA 3JCUE 3RL0C 3BRTB 1SQXE 2OYOA 3D70A 4K35A 3H1JJ 1EDKA 4JQ0D 5C39A 1GD2E 2QE7H 3HD7B 1VF5D 3L75D 4PJ0H 2AEJA 2FFDC 1KILC 3H1HG 2WQYC 3L75E 1BSHA 5AW1B 2BCCG 4B86A 3S4RA 1IC2A 1NAFA 2WSCJ 1SQPK 2JKVA 1T3UA 1T6AA 4PD4D 4PV1B 2CPBA 1JCDA 1H88A 4PD4I 5CHXA 1VQ9P 5CBNA 4PD4E 3VN0A 1BE3G 2WMMA 3L36A 2QJPC 5KLVG 3CMAP 1KN7A 3R2PA 3CXHD 3CX5D 1IJDB 1FBMA 2FKWB 2OQQA 2XDJA 5APUA 5AVZB 3CXHI 3CX5I 1ZRTD 3D6YA 2JDIH 3CX5E 3W68A 4N78D 2K88A 1FDMA 3R4YA 2O1KA 1XTCC 2LXBA 1JY2O 2C0WA 2FYNB 3JSVC 2Y0DA 1P84D 4LC1A 5B66H 1P84I 3SWYA 3CWBD 1KYOD 1P84E 3AE3C 5AW7B 3IN6A 4D6TD 1KYOI 3P7KA 1LTGC 3CWBE 4D6TE 4LGDE 4EIJA 1EDJA 5CMZA 3V2QA 3AE6C 2ZT9C 1LT1A 2N9BA 3RBXA 1VQKP 2E75B 3SWKA 5KLVK 1IK7A 1IFNA 4EI2A 4JYBA 2I1JA 2NRGA 4OGQD 1YI2P 5B5EH 1OVUA 1IFMA 2KZJA 2BCCJ 2HYNA 2FYZA 5KJ7C 3A0HE 4H44D 2HODB 3FWNA 2NPSC 2RKLA 1SVFA 2HODA 4C7NA 4BXLA 2KB7P 1JUNA 1HWTC 4U3FG 5K5GB 5KLVJ 3F5HA 1PZQA 3HTKB 1SQBD 3HTKA 1NU1J 3L70G 3IFMA 2FXPA 3M06A 2KSJA 1NTME 3MZWB 5BVZA 3BRVB 1Q82Q 1FJKA 2NZ2A 2FFDA 3IAOA 2OTKE 2IFMA 3H1LG 1JY3P 4DOJA 1A02F 1KFNA 2I1KA 3AEEC 3LW5H 2M8RA 1VQ4P 3VP8A 1A02J 1G2CB 3FXDA 2WWWA 1N7SC 3N4XA 3TNUB 3GHGA 1W5CE 5AVTB 3G6EP 3MGNA 1JMBA 3M91A 1IFDA 1PPJD 1VQ6P 2QIWA 3NTNA 2W6BA 2WT7B 1H8AA 4H13D 2WT7A 3AEDC 2YO3A 2J58A 5GTIE 3AEFC 1VQ8P 2V7QH 2FBWC 1T3JA 1D7MA 1L0NE 1KB9D 1DH3A 1NTZG 4Y99B 1KILA 4WY4B 2D2CD 1QLED 1GW4A 4WY4A 2YO2A 1KB9E 2GUVA 1Q90D 1J1EB 3M9BA 4HH2A 3CCUP 1W2BO 2FYUG 1SQQJ 1JTHB 2JWDA 3LW5J 3CC4P 3M0DA 2W27A 2Y9YA 4ASWA 3PHLA 4YXDC 1OW7A 5GTHE 3L72J 3Q5SA 1SFCC 1BGYG 2R32A 4DCKA 3H1KD 1G1JA 1BDCA 1KQFB 4PD4H 1LTBC 2Y0CA 2WPVB 1FU1A 2IYPA 1NTKD 3Q2YA 1NKNA 3G3ZA 1IFPA 1NTKE 2OTLP 4QMAA 1RY3A 2V7QJ 2KNCB 3H1IE 1NVOA 2KNCA 3CXHH 3CX5H 1UIXA 3L71D 2QEXP 4WBAA 1NTZK 3EQ2A 3L71E 2ZXXA 5TISH 1LT9C 4GT1A 3L35A 3V2PA 3L75J 1GL2C 3CCJP 2VRSA 1OW6A 3MD0A 3TGUD 1P84H 2FYUK 1BCCD 1VQMP 2FXOA 1ZW0A 1KYOH 2L5GB 1J1DC 2KYVA 1EZVI 1RE3A 4I7ZC 2H89C 1YQ3C 5KAFH 1HF9A 2HLOA 1FE6A 1NTZJ 1JY2P 1VF5B 1SQVE 2WPSA 3LIEA 1MV8A 1EQ7A 2J5UA 1KILD 1L2PA 3H1HE 2HPCB 1YBKA 4IL6X 1Q7YQ 2KK7A 4I1LA 1OW8A 3RK3D 2YKPA 1KILE 2Y0EA 1LTJB 3A0HH 4IOIH 3O8ZA 2YMKA 3KHUA 3L4FA 2ZAEB 3OW2O 2XV5A 2A06D 3L73D 1BE3E 1RQVA 2IPPA 4PV1C 3CWBJ 3EFFK 3L73E 4D6TJ 1L0LD 2W90A 5CBOA 1NHLA 1NAYA 5H2FE 1JMMA 1L0LE 3CC7P 1FZBA 1LJ2A 3V5BA 5AW0B 3L74D 3O6QB 1PPJG 3O6QA 1LWUB 1M8OB 2WZ7A 1LWUA 3EWKA 2W8ZA 4GOFA 2O3JA 3QWOC 2FYNC 1JNMA 3BCCD 1MKMA 3NFQA 1K8AQ 5APQA 3Q3DA 1AFOA 3BCCE 3OA7A 1FZCC 5AW2B 3TF5A 5M1BA 1ZR2A 4XE5B 5APSA 1BDDA 1K9MQ 1OX3A 4DJGA 3GG2A 1QVFO 1QEXA 1LTAC 1N7LA 5KTBA 1T8ZA 2E76C 3KZIE 5APWA 4OGQB 3Q5RA 2OYHB 2E75C 2OYHA 3W67A 1GU4A 1RQUA 4GKGA 2RH0A 2K9YA 1SQBJ 3VMYA 4GODA 3D6ZA 3B5NC 4H44B 3MUDA 3MHVA 1M1JA 2IBZD 5APYA 2IBZI 3JC22 2AXCA 2NPSD 2Z5IA 1SQXD 3OJAB 3EFGA 1AJYA 2K9JB 1X8YA 2K9JA 1T2KC 2Q3IA 2QJYC 2IX7C 2ZYAA 5BU5A 3AEBC 4K3AA 2OYIC 3TSIA 2O01H 1BCCG 1PP9D 1PIXA 3AE7C 3HD7A 1UIIA 1EZVG 1PP9E 5DJTB 3HE5B 3U1CA 3HE5A 1QL1A 1ZMEC 3V2RA 1CW5A 2WSSH 3OAKA 1URQC 1FJPA 2G3AA 2IZ1A 1K73Q 4XA4A 2ZYGA 1L4AC 2O1JA 3CLQA 4GOEA 3CCMP 4HJGH 1RF0C 3GHGC 2Q3EA 4H13B 1LGHB 3GW6A 1YQ4C 3SSUA 3A0BE 1NU1G 1DD3A 2KUBA 1M7LA 5E79H 1IFJA 2A06G 2O01J 2M0BA 3H1KJ 1RF1B 1E5WA 2D2CB 1RF1A 1HBWA 1KV4A 3PLNA 1NTKJ 1RE4C 4Y99C 4WY4C 5AVUB 5CCHC 2FYUE 2N9YB 3C9IA 3P32A 1OFCX 3SWFA 1ZOYC 1M57D 5AW4B 4Y28J 1S5LE 1PGPA 3L71J 3M0DC 4A7PA 4OWFA 1NJIQ 1SFCD 1DD4A 1N73B 1GU5A 1AVOA 4RO0A 1N73A 1SLQA 1OVVA 4R4LA 3P8CD 1LNQA 2IYOA 4NPDA 3P8CE 3TGUJ 1BCCJ 1JB0J 4EYYQ 2P7JA 1R8EA 2E74D 4Z1MH 1QX8A 1NU1K 1VQOP 1VPCA 1KD1Q 1G1IA 3RGUA 1Y9BA 2LKMA 3Q1MA 3F89A 2M3BA 1SQQG 2BASA 1VL2A 3AE9C 3T97B 1SS1A 3T97A 1BSNA 1VQNP 1AVYA 4M3LA 3WUVA 3L72G 4RESB 3RK2D 1FC2C 3Q5PA 1EDIA 1S4XA 2K3RA 2IBZG 3HUSB 2YKOA 3HUSA 3AE5C 4UB6E 1R5LA 2ZXEB 1NTMD 1RE3C 4IFMA 1GTWA 3L73J 2P67A 5KLIC 2N1TB 3VP9A 2N1TA 4NPFX 1L0LJ 4RKUJ 1KILB 3KZIH 1VF5C 4EOTA 2BEQD 3RK3B 2K37A 3V4WA 3L74J 3B8EB 2Z5HA 3C8VA 3L75G 2UWJE 1G2CA 2JJLA 4KHXA 4C7RA 1MZ9A 2M3EA 4H0LB 3A2AA 3TNUA 2Q9IA 1SQQK 3IR9A 3M9QA 4HB1A 1ZP0C 4OVNF 3BCCJ 2JEEA 2QJPB 3JCUH 2KXPB 3H1JD 2XU6A 3H1JE 1LP1B 1L0ND 4BWNA 1LP1A 1GMJA 1TU3F 2MKVA 5CJ4A 3AEAC 1KB9I 2IDBA 4ZMDA 3S9OA 3ABVC 3C1LA 2YKQA 3FX0A 1IK9A 1LWUC 2HFED 2JWAA 4ZNCA 1H89A 1JTHA 2W6AA 1S9KE 1AA0A 1KQGB 5CCGD 2KLUA 2JO1A 2XKMA 3CL3D 3CWBG 4L74A 2FXMA 1AV1A 1CSBA 3PJSK 3WU2E 4D6TG 2LXCB 4R4MA 3PP5A 1SQXJ 3H1ID 2P58A 2SPZA 1S3JA 1SQPD 2C9LY 1USDA 2E76D 4C46A 1SQPE 3BATA 1W2EA 3V4QA 4OGQC 1M90Q 2OYHC 1WMKA 1X0TA 3B71A 3RBZA 3B5ND 1FOSE 1PP9J 2E42A 1U57A 1YTZT 4TT3H 3MUDC 1PV3A 3KDPB 1M1JC 4GIFA 3I5CA 3RL0D 4ZKPA 1OZHA 5AVQB 1HVVA 4HKZH 1S5LH 4XFJA 1T2KD 4AQRD 1HGVA 5L8RJ 2HR3A 5KKZB 2ZJSE 1SQVD 3H32B 3H32A 3GF3A 2FY8A 4L75A 4L73A 3D71A 3CD6P 3H1HD 1JY2N 1NGMB 4IFFA 4KJMA 3CCLP 3HD7C 2R3SA 2BCCE 2HPCA 2Q6QA 1SQBG 2ZVOB 1S72P 3ZDMA 1JEKA 1LTJA 1RHZB 5B66E 1BE3D 3G4SP 2WVRA 2O01N 1URQD 1PGJA 4YPCA 1JCCA 1EC5A 1YIJP 5APXA 3ITKA 3CC2P 1L4AD 1DEEG 3CCQP 5KLVE 4W7ZA 2M5AB 5AVWB 1FDOA 2ITAA 3AE2C 1KQSO 1NKZB 4H13C 4N6JA 1ZR4A 2YIUB 3HE4B 1N86A 3HE4A 3VMAA 5AVYB 1NH4A 5B5EE 1RF1C 2KZIA 3GLMA 1HUCA 3RL0g 5CCHD 1X22A 1SQBK 5EFWB 3E1RA 4WB4A 2PFXA 3IF4A 1SFCB 3BVHA 4CPGA 2C0XA 1SFCA 2ZT9D 2H43A 5DJUB 1ZXGA 2AXTE 4AYCA 1AQTA 4UB8E 1K04A 3GF7A 4AUWA 4WVZA 2RN0A 2E74B 5GTIH 3H1KG 1NOHA 2AEMA 1IFIA 3KYQA 2Q7CA 1OWAA 2KLVA 2L91A 2K1AA 1YHQP 1NTKG 1Y47A 5KJ7D 1NTMJ 3H1IG 2XNDH 1KB9H 1M56D 3MTUE 1SQQE 2P1JA 4U3FD 1YJ9P 2R5BA 3GMAA 4I2LC 3L72E 3USSA 4U3FE 3RK2B 3L71G 1FZGA 2GUSA 5GTHH 4OH8B 1EDLA 4I6MC 3M0AA 3L70D 4ASVA 3A3YB 3L70E 3TGUG 3HRNA 4I7ZB 1DX7A 3WU2H 3HUSC 1LTSC 3CPWO 1YJNP 4EDFA 3H1LD 1FDIA 3LIDA 3KXDA 1ZLLA 1Q86Q 3A5TA 2N1TC 5AVVB 3H1LE 4U7JA 1L0NJ 3I56P 2OTJP 4L76A 5TJHA 1SQVG 4IFDK 1VQ5P 2KI7B 1NTKK 1VQLP 4YXWH 1NYHA 1IO4A 2W6JH 3RK3C 1QL2A 2V4HA 2H7HA 3CI9A 1N7SD 3AE8C 1J2JB 1WRGA 3FGAD 4BRYB 4BRYA 4H0LC 2IFNA 2JR8A 3TDKA 1KFMA 5APVA 3VMZA 4IL6E 1NTZD 5APTA 1NO4A 3L73G 1MFZA 3CCRP 2PAJA 4WWIA 5AVRB 1NTZE 3WUTA 3N7NA 1L0LG 2QVAA 3CXHE 4DZOA 2B87B 2FYUD 2A45I 2B87A 2YXRB 3QH9A 1ZRTE 2KSEA 3H1IJ 4N78E 3WMM0 3L74G 1J1EC 1JOCA 1SQPJ 1K05A 1MFTA 1FOSF 1BGYD 2PP6A 5TISE 4MN4C 1SQVK 1FZCB 1U7MA 2E5TA 3U59A 1FZCA 1BGYE 5CCGA 3TK1A 2B89A 2YNYA 3BCCG 3PRJA 1KYOE 1GZLA 5AW9B 2W83C 2QA4P 1KTMA 4JF7A 1FS0E 4JYCA 2P2UA 5H2FH 1S2EA 5KAFE 3PTZA 2Q1KA 2E76B 4GDOA 4LLHA 2KP8A 3AECC 1LTIC 1SQVJ 3KQGA 5AW5B 3BASA 2QJKB 1L0LK 3B5NB 2PGDA 4W7YA 1KQLA 2WTYA 1YITP 3B5NA 3H1HJ 4NPEA 3H6PA 4YTPC 1SP4A 2J59M 1GL2D 3K5BA 1LTTC 3NMDA 3RL0B 4C7NB 2QJYB 1BE3J 1SQXG 3WUUA 2AXTH 2CK3H 3CCSP 1HH0A 2OYIB 1DIPA 4UB8H 2OYIA 1VQPP 1OMIA 5KKZC 1KMIZ 1FAVA 3VYIA 2C9NY 1N8RQ 2FFDB 2P10A 3V6IA 2WSEH
chains in the Genus database with same CATH topology
1U57A 1Q90D 1ZMEC 1R8EA 1YQ3C 2E74D 4Z1MH 2OQQA 3RK3E 4TT3H 1HF9A 1PV3A 3D6YA 4I7ZB 1VF5B 2G3AA 3SFDC 3R4YA 4H0LD 2E75D 1GMJA 2QJKC 1TU3F 3LW5J 2H88C 2J5UA 3GLMA 3RL0g 1Y9BA 2MKVA 4YXDC 2E74C 3Q1MA 1OW7A 4IL6X 3SFEC 2G8YA 4XFJA 1FDIA 1OW8A 3AEAC 3Q5SA 1KILE 5L8RJ 2E76C 1VL2A 2IDBA 3AE9C 3T97B 1KTMA 4U7JA 3S9OA 4OGQB 3Q5RA 4H13B 3ABVC 2FXPA 1S5LX 4PV1D 2E75C 1YQ4C 4H44C 1KORA 1KQFB 3AE3C 1RQUA 2E76B 2YMKA 3IN6A 3GF3A 1DD3A 2ZT9D 4GDOA 2WPVB 3D71A 3Q5PA 3D70A 1NYHA 2NZ2A 2K9YA 2D2CC 3Q2YA 1HJ0A 1NGMB 3D6ZA 3AECC 3IAOA 4H44B 1K04A 1RQVA 2O01J 3AE4C 3AE8C 3GF7A 4PV1C 2D2CB 2V7QJ 3AE5C 3AE6C 3AEEC 2ZT9C 3FGAD 1KQGB 4YTPC 2E74B 4H0LC 2JO1A 1VF5D 1UIXA 1EXJA 4KT0J 1AJYA 5KLIC 2WSEJ 2YIUC 2WQYC 2E75B 3AE1C 4R4MA 2QJYC 4RKUJ 3O6QA 1IK7A 1S1CX 2JP3A 1ZOYC 1EXIA 1VF5C 2QIWA 3AEBC 4Y28J 3G9RA 2BEQD 4OGQD 3EWKA 4H13D 1ZP0C 2WSCJ 3H25A 2BEZF 3AEDC 1OW6A 1DD4A 2E76D 3GMAA 4PV1B 1PIXA 2FYNC 2QSIA 3AE7C 3C8VA 3AEFC 1ZRTE 1MKMA 2FBWC 4R4LA 1FDOA 1PL5A 2ZT9B 1DIPA 3AE2C 4H44D 3Q3DA 4H0LB 4OGQC 1OMIA 5KKZC 1KMIZ 2QJPC 2WSFJ 4H13C 1WMKA 1K05A 2D2CD 3B71A 3AEGC 4I7ZC 2P10A 5M1BA 1JB0J 2H89C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q90 D;  2WSC J;  4OGQ B;  4H13 B;  1S5L X;  2E74 B;  4PV1 B;  4I7Z B;  2FYN C;  2QSI A;  1VF5 B;  3C8V A;  2E76 B;  4KT0 J;  5KLI C;  2WPV B;  1ZRT E;  2WSE J;  2K9Y A;  2YIU C;  2ZT9 B;  2QJK C;  3LW5 J;  2E75 B;  4H0L B;  4H44 B;  5KKZ C;  2QJP C;  2WSF J;  2QJY C;  4RKU J;  2O01 J;  4IL6 X;  2D2C B;  2QIW A;  4Y28 J;  1JB0 J;  5L8R J; 
#chains in the Genus database with same CATH topology
 2POH A;  3CCE P;  1SQB E;  3HD7 D;  1JY3 N;  2I8D A;  2RMZ A;  1WT6 A;  3B4S A;  1PP9 G;  2ZFC A;  1PFI A;  1LTJ C;  1URQ B;  1CI6 B;  3SFE C;  1FZA A;  1URQ A;  1CI6 A;  3NXS A;  3PH0 A;  1X79 B;  1L4A B;  1HGZ A;  1CZQ A;  2QM8 A;  1L4A A;  1YJW P;  4PV1 D;  2Q5U A;  1KOR A;  1Q81 Q;  3GHG B;  1AQ5 A;  1RF0 A;  1ZV8 A;  1HJ0 A;  1JO5 A;  2B9B A;  2E5Y A;  5BU8 B;  1PPJ E;  3VMX A;  4DT0 A;  1SQX K;  2KS1 B;  2H8P D;  2KS1 A;  5KAI E;  1X9V A;  4KT0 J;  2WSE J;  2E43 A;  1S9K D;  2WPR A;  2YIU C;  2WPQ A;  1GW3 A;  3TYY A;  1RE4 A;  2ZYD A;  1S1C X;  2KOG A;  1EXI A;  1HTL C;  5CCH A;  3G9R A;  3H25 A;  2XZR A;  2A45 G;  2OGU A;  1PL5 A;  2ZT9 B;  1Y8A A;  3VTP C;  4U3F J;  1M1K Q;  3E7K A;  2YXQ B;  1PGO A;  2QG4 A;  3A0B H;  1KZU B;  1ZN5 A;  3H1K E;  4IL6 H;  5AW3 B;  2E75 D;  4PJ0 E;  3L70 J;  2E74 C;  1NWQ A;  3FXE A;  1OXZ A;  5KJ7 A;  1VQ7 P;  2QRX A;  1E79 H;  2NPS B;  2A45 H;  4H44 C;  2NPS A;  2QM7 A;  3E1I A;  3H1L J;  3AE4 C;  5CJ0 A;  3RK2 C;  3V2N A;  1EXJ A;  3TGU E;  1BCC E;  1EZV D;  1U7J A;  3VOP A;  2ZVN B;  2BCC D;  3AE1 C;  1IZN B;  5E79 E;  2IZ0 A;  1EZV E;  5AVX B;  5KLI B;  2JP3 A;  2GA1 A;  3G71 P;  2Z4E A;  1NTM G;  2N1T D;  1N2D C;  4ZKU A;  2QSI A;  1Q2N A;  1VDF A;  3A7O A;  2PRR A;  2KIK A;  3MIW A;  1HJB A;  5KLV D;  1N7S B;  1R5S A;  2FYU J;  4JPZ B;  1N7S A;  2R3C A;  1PGQ A;  3RK3 E;  1NU1 D;  2M5A A;  2R5D A;  1FZF A;  1OVR A;  3SFD C;  1DEB A;  4H0L D;  4W80 A;  1BGY J;  1NU1 E;  1FZE A;  2H88 C;  3M9H A;  4O9B A;  4UB6 H;  2A06 E;  2AEF A;  3CCV P;  5AVS B;  1MUU A;  1S5L X;  2WSF H;  2OAR A;  3H1J G;  1L0N G;  2D2C C;  4JBZ A;  5AW8 B;  1YYC A;  2YMY A;  4WY4 D;  2MJZ A;  3UIA A;  3L74 E;  1NTM K;  1RH5 B;  3FWL A;  1H0T B;  2B88 A;  3S1K A;  1JY3 O;  4RJT A;  1H0T A;  5CCG C;  1GK6 A;  2HG5 D;  3CME P;  1QVG O;  2Y9Z A;  2DW3 A;  1N73 C;  3L37 A;  1OIP A;  2BEZ F;  1GK4 A;  3MP7 B;  1XTG B;  2GM4 A;  2XNX A;  3KPE A;  4TLF A;  5AW6 B;  2WSF J;  1SQQ D;  2WIT A;  4HYT B;  3AEG C;  2R44 A;  3L72 D;  5KAI H;  1SQP G;  2CPS A;  1LT9 B;  1L0N K;  1GL2 B;  1LT9 A;  1GL2 A;  3P8M C;  2LR2 A;  2QJK C;  2WSC H;  1QGK B;  1JM0 A;  3I55 P;  1M1J B;  1GDT A;  1YTZ I;  1KC8 Q;  2G8Y A;  3U1A A;  1Z56 A;  3II6 A;  4N3Y B;  1J1D B;  2IBZ E;  1USE A;  3JCU E;  3RL0 C;  3BRT B;  1SQX E;  2OYO A;  3D70 A;  4K35 A;  3H1J J;  1EDK A;  4JQ0 D;  5C39 A;  1GD2 E;  2QE7 H;  3HD7 B;  1VF5 D;  3L75 D;  4PJ0 H;  2AEJ A;  2FFD C;  1KIL C;  3H1H G;  2WQY C;  3L75 E;  1BSH A;  5AW1 B;  2BCC G;  4B86 A;  3S4R A;  1IC2 A;  1NAF A;  2WSC J;  1SQP K;  2JKV A;  1T3U A;  1T6A A;  4PD4 D;  4PV1 B;  2CPB A;  1JCD A;  1H88 A;  4PD4 I;  5CHX A;  1VQ9 P;  5CBN A;  4PD4 E;  3VN0 A;  1BE3 G;  2WMM A;  3L36 A;  2QJP C;  5KLV G;  3CMA P;  1KN7 A;  3R2P A;  3CXH D;  3CX5 D;  1IJD B;  1FBM A;  2FKW B;  2OQQ A;  2XDJ A;  5APU A;  5AVZ B;  3CXH I;  3CX5 I;  1ZRT D;  3D6Y A;  2JDI H;  3CX5 E;  3W68 A;  4N78 D;  2K88 A;  1FDM A;  3R4Y A;  2O1K A;  1XTC C;  2LXB A;  1JY2 O;  2C0W A;  2FYN B;  3JSV C;  2Y0D A;  1P84 D;  4LC1 A;  5B66 H;  1P84 I;  3SWY A;  3CWB D;  1KYO D;  1P84 E;  3AE3 C;  5AW7 B;  3IN6 A;  4D6T D;  1KYO I;  3P7K A;  1LTG C;  3CWB E;  4D6T E;  4LGD E;  4EIJ A;  1EDJ A;  5CMZ A;  3V2Q A;  3AE6 C;  2ZT9 C;  1LT1 A;  2N9B A;  3RBX A;  1VQK P;  2E75 B;  3SWK A;  5KLV K;  1IK7 A;  1IFN A;  4EI2 A;  4JYB A;  2I1J A;  2NRG A;  4OGQ D;  1YI2 P;  5B5E H;  1OVU A;  1IFM A;  2KZJ A;  2BCC J;  2HYN A;  2FYZ A;  5KJ7 C;  3A0H E;  4H44 D;  2HOD B;  3FWN A;  2NPS C;  2RKL A;  1SVF A;  2HOD A;  4C7N A;  4BXL A;  2KB7 P;  1JUN A;  1HWT C;  4U3F G;  5K5G B;  5KLV J;  3F5H A;  1PZQ A;  3HTK B;  1SQB D;  3HTK A;  1NU1 J;  3L70 G;  3IFM A;  2FXP A;  3M06 A;  2KSJ A;  1NTM E;  3MZW B;  5BVZ A;  3BRV B;  1Q82 Q;  1FJK A;  2NZ2 A;  2FFD A;  3IAO A;  2OTK E;  2IFM A;  3H1L G;  1JY3 P;  4DOJ A;  1A02 F;  1KFN A;  2I1K A;  3AEE C;  3LW5 H;  2M8R A;  1VQ4 P;  3VP8 A;  1A02 J;  1G2C B;  3FXD A;  2WWW A;  1N7S C;  3N4X A;  3TNU B;  3GHG A;  1W5C E;  5AVT B;  3G6E P;  3MGN A;  1JMB A;  3M91 A;  1IFD A;  1PPJ D;  1VQ6 P;  2QIW A;  3NTN A;  2W6B A;  2WT7 B;  1H8A A;  4H13 D;  2WT7 A;  3AED C;  2YO3 A;  2J58 A;  5GTI E;  3AEF C;  1VQ8 P;  2V7Q H;  2FBW C;  1T3J A;  1D7M A;  1L0N E;  1KB9 D;  1DH3 A;  1NTZ G;  4Y99 B;  1KIL A;  4WY4 B;  2D2C D;  1QLE D;  1GW4 A;  4WY4 A;  2YO2 A;  1KB9 E;  2GUV A;  1Q90 D;  1J1E B;  3M9B A;  4HH2 A;  3CCU P;  1W2B O;  2FYU G;  1SQQ J;  1JTH B;  2JWD A;  3LW5 J;  3CC4 P;  3M0D A;  2W27 A;  2Y9Y A;  4ASW A;  3PHL A;  4YXD C;  1OW7 A;  5GTH E;  3L72 J;  3Q5S A;  1SFC C;  1BGY G;  2R32 A;  4DCK A;  3H1K D;  1G1J A;  1BDC A;  1KQF B;  4PD4 H;  1LTB C;  2Y0C A;  2WPV B;  1FU1 A;  2IYP A;  1NTK D;  3Q2Y A;  1NKN A;  3G3Z A;  1IFP A;  1NTK E;  2OTL P;  4QMA A;  1RY3 A;  2V7Q J;  2KNC B;  3H1I E;  1NVO A;  2KNC A;  3CXH H;  3CX5 H;  1UIX A;  3L71 D;  2QEX P;  4WBA A;  1NTZ K;  3EQ2 A;  3L71 E;  2ZXX A;  5TIS H;  1LT9 C;  4GT1 A;  3L35 A;  3V2P A;  3L75 J;  1GL2 C;  3CCJ P;  2VRS A;  1OW6 A;  3MD0 A;  3TGU D;  1P84 H;  2FYU K;  1BCC D;  1VQM P;  2FXO A;  1ZW0 A;  1KYO H;  2L5G B;  1J1D C;  2KYV A;  1EZV I;  1RE3 A;  4I7Z C;  2H89 C;  1YQ3 C;  5KAF H;  1HF9 A;  2HLO A;  1FE6 A;  1NTZ J;  1JY2 P;  1VF5 B;  1SQV E;  2WPS A;  3LIE A;  1MV8 A;  1EQ7 A;  2J5U A;  1KIL D;  1L2P A;  3H1H E;  2HPC B;  1YBK A;  4IL6 X;  1Q7Y Q;  2KK7 A;  4I1L A;  1OW8 A;  3RK3 D;  2YKP A;  1KIL E;  2Y0E A;  1LTJ B;  3A0H H;  4IOI H;  3O8Z A;  2YMK A;  3KHU A;  3L4F A;  2ZAE B;  3OW2 O;  2XV5 A;  2A06 D;  3L73 D;  1BE3 E;  1RQV A;  2IPP A;  4PV1 C;  3CWB J;  3EFF K;  3L73 E;  4D6T J;  1L0L D;  2W90 A;  5CBO A;  1NHL A;  1NAY A;  5H2F E;  1JMM A;  1L0L E;  3CC7 P;  1FZB A;  1LJ2 A;  3V5B A;  5AW0 B;  3L74 D;  3O6Q B;  1PPJ G;  3O6Q A;  1LWU B;  1M8O B;  2WZ7 A;  1LWU A;  3EWK A;  2W8Z A;  4GOF A;  2O3J A;  3QWO C;  2FYN C;  1JNM A;  3BCC D;  1MKM A;  3NFQ A;  1K8A Q;  5APQ A;  3Q3D A;  1AFO A;  3BCC E;  3OA7 A;  1FZC C;  5AW2 B;  3TF5 A;  5M1B A;  1ZR2 A;  4XE5 B;  5APS A;  1BDD A;  1K9M Q;  1OX3 A;  4DJG A;  3GG2 A;  1QVF O;  1QEX A;  1LTA C;  1N7L A;  5KTB A;  1T8Z A;  2E76 C;  3KZI E;  5APW A;  4OGQ B;  3Q5R A;  2OYH B;  2E75 C;  2OYH A;  3W67 A;  1GU4 A;  1RQU A;  4GKG A;  2RH0 A;  2K9Y A;  1SQB J;  3VMY A;  4GOD A;  3D6Z A;  3B5N C;  4H44 B;  3MUD A;  3MHV A;  1M1J A;  2IBZ D;  5APY A;  2IBZ I;  3JC2 2;  2AXC A;  2NPS D;  2Z5I A;  1SQX D;  3OJA B;  3EFG A;  1AJY A;  2K9J B;  1X8Y A;  2K9J A;  1T2K C;  2Q3I A;  2QJY C;  2IX7 C;  2ZYA A;  5BU5 A;  3AEB C;  4K3A A;  2OYI C;  3TSI A;  2O01 H;  1BCC G;  1PP9 D;  1PIX A;  3AE7 C;  3HD7 A;  1UII A;  1EZV G;  1PP9 E;  5DJT B;  3HE5 B;  3U1C A;  3HE5 A;  1QL1 A;  1ZME C;  3V2R A;  1CW5 A;  2WSS H;  3OAK A;  1URQ C;  1FJP A;  2G3A A;  2IZ1 A;  1K73 Q;  4XA4 A;  2ZYG A;  1L4A C;  2O1J A;  3CLQ A;  4GOE A;  3CCM P;  4HJG H;  1RF0 C;  3GHG C;  2Q3E A;  4H13 B;  1LGH B;  3GW6 A;  1YQ4 C;  3SSU A;  3A0B E;  1NU1 G;  1DD3 A;  2KUB A;  1M7L A;  5E79 H;  1IFJ A;  2A06 G;  2O01 J;  2M0B A;  3H1K J;  1RF1 B;  1E5W A;  2D2C B;  1RF1 A;  1HBW A;  1KV4 A;  3PLN A;  1NTK J;  1RE4 C;  4Y99 C;  4WY4 C;  5AVU B;  5CCH C;  2FYU E;  2N9Y B;  3C9I A;  3P32 A;  1OFC X;  3SWF A;  1ZOY C;  1M57 D;  5AW4 B;  4Y28 J;  1S5L E;  1PGP A;  3L71 J;  3M0D C;  4A7P A;  4OWF A;  1NJI Q;  1SFC D;  1DD4 A;  1N73 B;  1GU5 A;  1AVO A;  4RO0 A;  1N73 A;  1SLQ A;  1OVV A;  4R4L A;  3P8C D;  1LNQ A;  2IYO A;  4NPD A;  3P8C E;  3TGU J;  1BCC J;  1JB0 J;  4EYY Q;  2P7J A;  1R8E A;  2E74 D;  4Z1M H;  1QX8 A;  1NU1 K;  1VQO P;  1VPC A;  1KD1 Q;  1G1I A;  3RGU A;  1Y9B A;  2LKM A;  3Q1M A;  3F89 A;  2M3B A;  1SQQ G;  2BAS A;  1VL2 A;  3AE9 C;  3T97 B;  1SS1 A;  3T97 A;  1BSN A;  1VQN P;  1AVY A;  4M3L A;  3WUV A;  3L72 G;  4RES B;  3RK2 D;  1FC2 C;  3Q5P A;  1EDI A;  1S4X A;  2K3R A;  2IBZ G;  3HUS B;  2YKO A;  3HUS A;  3AE5 C;  4UB6 E;  1R5L A;  2ZXE B;  1NTM D;  1RE3 C;  4IFM A;  1GTW A;  3L73 J;  2P67 A;  5KLI C;  2N1T B;  3VP9 A;  2N1T A;  4NPF X;  1L0L J;  4RKU J;  1KIL B;  3KZI H;  1VF5 C;  4EOT A;  2BEQ D;  3RK3 B;  2K37 A;  3V4W A;  3L74 J;  3B8E B;  2Z5H A;  3C8V A;  3L75 G;  2UWJ E;  1G2C A;  2JJL A;  4KHX A;  4C7R A;  1MZ9 A;  2M3E A;  4H0L B;  3A2A A;  3TNU A;  2Q9I A;  1SQQ K;  3IR9 A;  3M9Q A;  4HB1 A;  1ZP0 C;  4OVN F;  3BCC J;  2JEE A;  2QJP B;  3JCU H;  2KXP B;  3H1J D;  2XU6 A;  3H1J E;  1LP1 B;  1L0N D;  4BWN A;  1LP1 A;  1GMJ A;  1TU3 F;  2MKV A;  5CJ4 A;  3AEA C;  1KB9 I;  2IDB A;  4ZMD A;  3S9O A;  3ABV C;  3C1L A;  2YKQ A;  3FX0 A;  1IK9 A;  1LWU C;  2HFE D;  2JWA A;  4ZNC A;  1H89 A;  1JTH A;  2W6A A;  1S9K E;  1AA0 A;  1KQG B;  5CCG D;  2KLU A;  2JO1 A;  2XKM A;  3CL3 D;  3CWB G;  4L74 A;  2FXM A;  1AV1 A;  1CSB A;  3PJS K;  3WU2 E;  4D6T G;  2LXC B;  4R4M A;  3PP5 A;  1SQX J;  3H1I D;  2P58 A;  2SPZ A;  1S3J A;  1SQP D;  2C9L Y;  1USD A;  2E76 D;  4C46 A;  1SQP E;  3BAT A;  1W2E A;  3V4Q A;  4OGQ C;  1M90 Q;  2OYH C;  1WMK A;  1X0T A;  3B71 A;  3RBZ A;  3B5N D;  1FOS E;  1PP9 J;  2E42 A;  1U57 A;  1YTZ T;  4TT3 H;  3MUD C;  1PV3 A;  3KDP B;  1M1J C;  4GIF A;  3I5C A;  3RL0 D;  4ZKP A;  1OZH A;  5AVQ B;  1HVV A;  4HKZ H;  1S5L H;  4XFJ A;  1T2K D;  4AQR D;  1HGV A;  5L8R J;  2HR3 A;  5KKZ B;  2ZJS E;  1SQV D;  3H32 B;  3H32 A;  3GF3 A;  2FY8 A;  4L75 A;  4L73 A;  3D71 A;  3CD6 P;  3H1H D;  1JY2 N;  1NGM B;  4IFF A;  4KJM A;  3CCL P;  3HD7 C;  2R3S A;  2BCC E;  2HPC A;  2Q6Q A;  1SQB G;  2ZVO B;  1S72 P;  3ZDM A;  1JEK A;  1LTJ A;  1RHZ B;  5B66 E;  1BE3 D;  3G4S P;  2WVR A;  2O01 N;  1URQ D;  1PGJ A;  4YPC A;  1JCC A;  1EC5 A;  1YIJ P;  5APX A;  3ITK A;  3CC2 P;  1L4A D;  1DEE G;  3CCQ P;  5KLV E;  4W7Z A;  2M5A B;  5AVW B;  1FDO A;  2ITA A;  3AE2 C;  1KQS O;  1NKZ B;  4H13 C;  4N6J A;  1ZR4 A;  2YIU B;  3HE4 B;  1N86 A;  3HE4 A;  3VMA A;  5AVY B;  1NH4 A;  5B5E E;  1RF1 C;  2KZI A;  3GLM A;  1HUC A;  3RL0 g;  5CCH D;  1X22 A;  1SQB K;  5EFW B;  3E1R A;  4WB4 A;  2PFX A;  3IF4 A;  1SFC B;  3BVH A;  4CPG A;  2C0X A;  1SFC A;  2ZT9 D;  2H43 A;  5DJU B;  1ZXG A;  2AXT E;  4AYC A;  1AQT A;  4UB8 E;  1K04 A;  3GF7 A;  4AUW A;  4WVZ A;  2RN0 A;  2E74 B;  5GTI H;  3H1K G;  1NOH A;  2AEM A;  1IFI A;  3KYQ A;  2Q7C A;  1OWA A;  2KLV A;  2L91 A;  2K1A A;  1YHQ P;  1NTK G;  1Y47 A;  5KJ7 D;  1NTM J;  3H1I G;  2XND H;  1KB9 H;  1M56 D;  3MTU E;  1SQQ E;  2P1J A;  4U3F D;  1YJ9 P;  2R5B A;  3GMA A;  4I2L C;  3L72 E;  3USS A;  4U3F E;  3RK2 B;  3L71 G;  1FZG A;  2GUS A;  5GTH H;  4OH8 B;  1EDL A;  4I6M C;  3M0A A;  3L70 D;  4ASV A;  3A3Y B;  3L70 E;  3TGU G;  3HRN A;  4I7Z B;  1DX7 A;  3WU2 H;  3HUS C;  1LTS C;  3CPW O;  1YJN P;  4EDF A;  3H1L D;  1FDI A;  3LID A;  3KXD A;  1ZLL A;  1Q86 Q;  3A5T A;  2N1T C;  5AVV B;  3H1L E;  4U7J A;  1L0N J;  3I56 P;  2OTJ P;  4L76 A;  5TJH A;  1SQV G;  4IFD K;  1VQ5 P;  2KI7 B;  1NTK K;  1VQL P;  4YXW H;  1NYH A;  1IO4 A;  2W6J H;  3RK3 C;  1QL2 A;  2V4H A;  2H7H A;  3CI9 A;  1N7S D;  3AE8 C;  1J2J B;  1WRG A;  3FGA D;  4BRY B;  4BRY A;  4H0L C;  2IFN A;  2JR8 A;  3TDK A;  1KFM A;  5APV A;  3VMZ A;  4IL6 E;  1NTZ D;  5APT A;  1NO4 A;  3L73 G;  1MFZ A;  3CCR P;  2PAJ A;  4WWI A;  5AVR B;  1NTZ E;  3WUT A;  3N7N A;  1L0L G;  2QVA A;  3CXH E;  4DZO A;  2B87 B;  2FYU D;  2A45 I;  2B87 A;  2YXR B;  3QH9 A;  1ZRT E;  2KSE A;  3H1I J;  4N78 E;  3WMM 0;  3L74 G;  1J1E C;  1JOC A;  1SQP J;  1K05 A;  1MFT A;  1FOS F;  1BGY D;  2PP6 A;  5TIS E;  4MN4 C;  1SQV K;  1FZC B;  1U7M A;  2E5T A;  3U59 A;  1FZC A;  1BGY E;  5CCG A;  3TK1 A;  2B89 A;  2YNY A;  3BCC G;  3PRJ A;  1KYO E;  1GZL A;  5AW9 B;  2W83 C;  2QA4 P;  1KTM A;  4JF7 A;  1FS0 E;  4JYC A;  2P2U A;  5H2F H;  1S2E A;  5KAF E;  3PTZ A;  2Q1K A;  2E76 B;  4GDO A;  4LLH A;  2KP8 A;  3AEC C;  1LTI C;  1SQV J;  3KQG A;  5AW5 B;  3BAS A;  2QJK B;  1L0L K;  3B5N B;  2PGD A;  4W7Y A;  1KQL A;  2WTY A;  1YIT P;  3B5N A;  3H1H J;  4NPE A;  3H6P A;  4YTP C;  1SP4 A;  2J59 M;  1GL2 D;  3K5B A;  1LTT C;  3NMD A;  3RL0 B;  4C7N B;  2QJY B;  1BE3 J;  1SQX G;  3WUU A;  2AXT H;  2CK3 H;  3CCS P;  1HH0 A;  2OYI B;  1DIP A;  4UB8 H;  2OYI A;  1VQP P;  1OMI A;  5KKZ C;  1KMI Z;  1FAV A;  3VYI A;  2C9N Y;  1N8R Q;  2FFD B;  2P10 A;  3V6I A;  2WSE H; 
#chains in the Genus database with same CATH homology
 1U57 A;  1Q90 D;  1ZME C;  1R8E A;  1YQ3 C;  2E74 D;  4Z1M H;  2OQQ A;  3RK3 E;  4TT3 H;  1HF9 A;  1PV3 A;  3D6Y A;  4I7Z B;  1VF5 B;  2G3A A;  3SFD C;  3R4Y A;  4H0L D;  2E75 D;  1GMJ A;  2QJK C;  1TU3 F;  3LW5 J;  2H88 C;  2J5U A;  3GLM A;  3RL0 g;  1Y9B A;  2MKV A;  4YXD C;  2E74 C;  3Q1M A;  1OW7 A;  4IL6 X;  3SFE C;  2G8Y A;  4XFJ A;  1FDI A;  1OW8 A;  3AEA C;  3Q5S A;  1KIL E;  5L8R J;  2E76 C;  1VL2 A;  2IDB A;  3AE9 C;  3T97 B;  1KTM A;  4U7J A;  3S9O A;  4OGQ B;  3Q5R A;  4H13 B;  3ABV C;  2FXP A;  1S5L X;  4PV1 D;  2E75 C;  1YQ4 C;  4H44 C;  1KOR A;  1KQF B;  3AE3 C;  1RQU A;  2E76 B;  2YMK A;  3IN6 A;  3GF3 A;  1DD3 A;  2ZT9 D;  4GDO A;  2WPV B;  3D71 A;  3Q5P A;  3D70 A;  1NYH A;  2NZ2 A;  2K9Y A;  2D2C C;  3Q2Y A;  1HJ0 A;  1NGM B;  3D6Z A;  3AEC C;  3IAO A;  4H44 B;  1K04 A;  1RQV A;  2O01 J;  3AE4 C;  3AE8 C;  3GF7 A;  4PV1 C;  2D2C B;  2V7Q J;  3AE5 C;  3AE6 C;  3AEE C;  2ZT9 C;  3FGA D;  1KQG B;  4YTP C;  2E74 B;  4H0L C;  2JO1 A;  1VF5 D;  1UIX A;  1EXJ A;  4KT0 J;  1AJY A;  5KLI C;  2WSE J;  2YIU C;  2WQY C;  2E75 B;  3AE1 C;  4R4M A;  2QJY C;  4RKU J;  3O6Q A;  1IK7 A;  1S1C X;  2JP3 A;  1ZOY C;  1EXI A;  1VF5 C;  2QIW A;  3AEB C;  4Y28 J;  3G9R A;  2BEQ D;  4OGQ D;  3EWK A;  4H13 D;  1ZP0 C;  2WSC J;  3H25 A;  2BEZ F;  3AED C;  1OW6 A;  1DD4 A;  2E76 D;  3GMA A;  4PV1 B;  1PIX A;  2FYN C;  2QSI A;  3AE7 C;  3C8V A;  3AEF C;  1ZRT E;  1MKM A;  2FBW C;  4R4L A;  1FDO A;  1PL5 A;  2ZT9 B;  1DIP A;  3AE2 C;  4H44 D;  3Q3D A;  4H0L B;  4OGQ C;  1OMI A;  5KKZ C;  1KMI Z;  2QJP C;  2WSF J;  4H13 C;  1WMK A;  1K05 A;  2D2C D;  3B71 A;  3AEG C;  4I7Z C;  2P10 A;  5M1B A;  1JB0 J;  2H89 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...