4RKUJ

Crystal structure of plant photosystem i at 3 angstrom resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
40
structure length
40
Chain Sequence
b'RDLKTYLSVAPVASTLWFAALAGLLIEINRLFPDALTFPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structure of plant Photosystem I at 3.1 Angstrom resolution
rcsb
molecule tags Photosynthesis
total genus 11
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2014-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4rkuJ00
4Y28J 2WPVB 1JB0J 2D2CB 2WSFJ 1VF5B 3LW5J 4I7ZB 2ZT9B 4H44B 2QSIA 2E76B 2YIUC 4RKUJ 5KLIC 4H13B 4IL6X 2K9YA 4OGQB 1S5LX 2QJPC 2E74B 2QJYC 2WSEJ 3C8VA 2WSCJ 2QJKC 2O01J 4KT0J 2FYNC 1Q90D 2E75B 4H0LB 2QIWA 5KKZC 5L8RJ 4PV1B 1ZRTE
chains in the Genus database with same CATH superfamily
1IZNB 1U7MA 3H1LD 1NHLA 3SFEC 3U1CA 3TF5A 1SQBJ 3KZIH 1Y9BA 2QVAA 3AE4C 5AVYB 1NTMJ 2N1TC 1KD1Q 2WSEJ 3MP7B 1MZ9A 3FX0A 1NAYA 1YI2P 1GMJA 2R5DA 2AXTH 1KC8Q 4EDFA 1LJ2A 1NWQA 3M0DC 1LT9A 1RE4C 2R32A 4HJGH 3A0BE 1SQXK 1HUCA 2W6AA 3MZWB 2C0XA 2ZAEB 1SQQG 5KLVG 4Y28J 2HODB 1JB0J 1NYHA 3AECC 1SP4A 3O6QA 1BCCJ 4I7ZC 3CMEP 3LW5H 1N73C 1GL2A 2Y0CA 2MKVA 2YMYA 2Y0EA 1L0ND 3KXDA 2J5UA 1PL5A 3HD7D 1FZBA 3JCUH 3L74G 3TGUE 2WSFJ 3BRTB 2AEFA 1L0LE 1T2KC 3O8ZA 1XTGB 2KYVA 1LT9B 2KNCA 1KILD 4IFFA 4PV1D 3CWBD 2WWWA 3CXHH 2J59M 4JBZA 1P84I 3H1JD 3S1KA 1KB9H 3GF3A 2B9BA 3V4WA 3KYQA 4K3AA 2I1KA 3RK3B 4GOEA 2C9NY 2YIUC 3VP9A 2QRXA 1HH0A 1P84E 1Q7YQ 3QWOC 1PPJD 5KJ7D 1Y47A 5C39A 1BE3D 3U1AA 1DD4A 2Z5IA 1FOSF 1JUNA 1FC2C 1SQXE 2P1JA 3CWBE 2K88A 3CCRP 1W2EA 3SWYA 4N78E 1NU1K 2FFDA 3MGNA 5AW5B 3L75G 1FZAA 2WSSH 5KKZB 1FDOA 1N7LA 2NPSD 1L0LJ 4HYTB 5APTA 3MHVA 5APWA 1KYOI 1LTIC 2N9BA 5KAIE 4OGQC 1DEEG 5B66E 1BSNA 4I2LC 3AE6C 2E74C 2WSEH 3B4SA 1KMIZ 1AV1A 1L0NJ 1KYOE 5AVSB 1JTHA 3SSUA 4MN4C 3L70D 1JO5A 3CWBJ 2H7HA 4YTPC 3H1JJ 1QGKB 3PRJA 2BEZF 5E79H 3HD7C 3AEFC 3IF4A 5TISH 1A02F 2QJYC 3RK3D 2C0WA 3EWKA 3WUVA 5EFWB 2KOGA 1A02J 1FZGA 4GT1A 5AW0B 2E76B 5H2FE 3CC2P 1PGQA 3AEAC 2FYZA 4U7JA 3PTZA 2IYPA 3LIEA 1LGHB 1CW5A 2IFNA 1KQGB 3TNUB 2G3AA 3KQGA 2XNDH 3A0BH 1NAFA 1T8ZA 2N1TA 1E5WA 1FS0E 4WY4C 1Q2NA 3Q1MA 4YXWH 1AJYA 3TGUG 1J1EC 3VOPA 2HG5D 5AVQB 4KJMA 1N2DC 3M0DA 2HLOA 1QX8A 1RE4A 2AEMA 1VQNP 3V4QA 2OYOA 2M0BA 3L73D 2W83C 1LTJC 2QJPB 2WPSA 1K73Q 2Q3EA 2RMZA 1H88A 2L91A 3RL0g 1N73A 1RF0A 3W68A 1MUUA 4IFDK 2Q1KA 1BDDA 1SQVD 1SQXG 2N9YB 2FYUD 1LTSC 1UIIA 1PP9D 1L4AC 1GZLA 3AEDC 4LGDE 1Q82Q 2HFED 1DIPA 2PAJA 1M56D 1P84H 3BCCE 2IYOA 2JKVA 1EZVI 2ZVOB 1FDIA 4ZKUA 1DX7A 1K04A 1OWAA 4TT3H 1EZVE 3MTUE 2OTJP 2WT7A 3F89A 2Y0DA 3Q5SA 1NTKK 3V2NA 1NTZD 1IK7A 1IFIA 1MFZA 4UB8E 5AVVB 2YKOA 2QIWA 2P58A 1N7SC 1KQLA 4DZOA 1S2EA 1EDIA 5CCGA 2WITA 4HKZH 1SQBK 2K37A 1SS1A 1RF1A 5KAIH 1T3JA 5B66H 1NTMK 4YXDC 3OW2O 3R4YA 2B87B 1KYOH 1BSHA 1JY2O 2Y9YA 4H13D 1RY3A 1GTWA 4I6MC 3RK2C 4D6TE 2D2CC 2MJZA 1ZP0C 2WT7B 5TJHA 4NPFX 4N6JA 2Q9IA 3HUSC 2XDJA 2H89C 4UB6E 1HGZA 4U3FD 2R44A 4GKGA 4R4MA 3H1KD 2Q6QA 5GTIE 3VMYA 2V4HA 1RF1B 3Q2YA 2QJKB 2P67A 4GOFA 1S9KD 3NFQA 3B8EB 2JO1A 3PLNA 1X22A 5H2FH 4O9BA 4TLFA 3VMXA 3L71E 5APVA 5B5EE 1LTGC 2A06D 2P10A 1HJ0A 3H1KE 4JF7A 1FZEA 1GU5A 2O01N 1LT1A 1SQBE 1SFCB 3G3ZA 3SFDC 4D6TJ 2KK7A 3CX5I 1GU4A 2HYNA 3M9HA 4Y99B 4HH2A 2E76C 3CC4P 3CX5E 4IFMA 2ZYDA 3UIAA 2M8RA 1JY2P 3S9OA 2A06E 5CHXA 3L72E 1JEKA 3HE4A 1SQPD 2IZ0A 2ZT9B 1JCCA 4WY4A 2M3BA 1GDTA 4C7NA 2BCCE 1HBWA 3BCCG 4U3FJ 3L71J 3G9RA 1L0LK 3H1KJ 4PD4I 5BU8B 1H0TB 1LTJA 2WQYC 1EZVG 3H32A 1G1JA 1K05A 4PD4E 2W6BA 3AE9C 2WPQA 4JYBA 5CCGD 2O1KA 1FDMA 2KI7B 1RE3C 3FXDA 3CMAP 4C7RA 3H1LE 2KUBA 3T97B 3L72J 2NPSB 4GODA 1L4AA 1NH4A 3L37A 1NJIQ 3CCVP 3U59A 1YJNP 1FU1A 2Y9ZA 1VL2A 1LP1A 2FY8A 2L5GB 1OW6A 1LTTC 1OVUA 4RKUJ 1SFCD 3IR9A 4ZNCA 1EQ7A 4OVNF 3EFFK 2XU6A 2BCCJ 1FOSE 2H88C 2K3RA 4UB8H 1IFMA 1SQPJ 1G2CA 2ZJSE 3A3YB 1VQ9P 1USDA 4L76A 3WMM0 2YNYA 2WTYA 1YHQP 4DCKA 1J1DB 1BGYD 1URQC 1QL1A 3E7KA 2KB7P 2JDIH 3QH9A 2ZT9D 1M1JA 3M9QA 4DT0A 3H25A 3PJSK 1USEA 3H1LJ 2POHA 1L0NE 1LP1B 1NTKG 4B86A 2OYIC 3K5BA 4EOTA 2QG4A 2IBZD 3O6QB 4LLHA 3AEEC 1QLED 4UB6H 1GL2B 1AQTA 3OAKA 1X0TA 2KS1A 5AW4B 1KILE 1FZCC 1JCDA 1SQBG 2ZYGA 5GTIH 3H1JE 3D6ZA 1NTMG 4RESB 1YBKA 3B5NA 1ZRTD 2KNCB 1PPJE 4ASWA 1BE3E 1ZXGA 3OJAB 5B5EH 3AE2C 2PRRA 4YPCA 1JNMA 1GK6A 3CPWO 5CMZA 1VQPP 1S5LX 4K35A 3G71P 5KAFE 3AEGC 1LWUC 2KS1B 3L35A 4H0LB 1OZHA 1BCCG 2UWJE 4LC1A 4H44B 3D71A 3CX5H 3IAOA 3M06A 5AVUB 2K9YA 2FBWC 3Q3DA 2FFDB 3B5NB 1N8RQ 1PGJA 1AFOA 3VMZA 3SWFA 5AW1B 3GHGA 5AVXB 3WU2E 1CZQA 1EC5A 4Y99C 1OMIA 3V6IA 1NU1D 2LXCB 5CBOA 1BE3J 2LR2A 1W5CE 3MUDA 2KZIA 3L70E 1QVGO 2OYHA 3H1LG 2CK3H 2H8PD 1KILC 4PV1C 4Z1MH 3H1HD 3HTKA 1GL2D 3ABVC 2WSFH 3CC7P 1KZUB 1JTHB 5CCHA 3EFGA 4PD4H 1ZW0A 5APQA 2K9JA 5APXA 5KJ7C 3RK3E 2FXPA 1S3JA 3H1HE 1OVRA 3BVHA 3CCUP 3A2AA 2FYNB 3OA7A 3D70A 3AE5C 1L0LG 5AW6B 1RE3A 2W6JH 3RL0B 3H1ID 1UIXA 5KLIB 3HTKB 4H13B 3P7KA 1CSBA 4H0LD 3L70J 2NPSC 2M5AA 1L0NG 4H44D 1FAVA 1DD3A 3VN0A 1S5LE 4BRYA 2Q7CA 3B5ND 2Q5UA 1AVYA 3V5BA 3H1IE 3CWBG 1M1KQ 2N1TB 1ZR2A 3BATA 2XNXA 5GTHE 3H1JG 1VQ7P 3CL3D 1N86A 3L73E 1BDCA 2O3JA 3H1HJ 2K1AA 2GUSA 1PPJG 1BE3G 2GM4A 1LT9C 1SQVE 3GW6A 1LTBC 2FYUE 2KIKA 2OYIA 2YKPA 3Q5PA 3TSIA 1PP9E 4I7ZB 3RK3C 1N73B 3CCMP 1FZFA 3KHUA 1GW4A 2JWDA 4AUWA 3FWLA 5AW8B 3BASA 1FZCA 4ASVA 2YKQA 1NOHA 2H43A 2R3SA 3CCQP 3AEBC 1SQQD 1VQLP 1DH3A 5KLVD 1TU3F 2QM8A 1LTAC 3C1LA 3H1IJ 3SWKA 5APYA 1WMKA 5KAFH 3RL0D 5M1BA 3L73J 1KB9D 1NTZE 2PFXA 1FJPA 4AYCA 5KKZC 2JJLA 1W2BO 1YQ3C 1YJ9P 3L74D 5CCHD 1KQSO 1CI6A 1SQQE 3L70G 4GIFA 1SQVJ 3ZDMA 1LWUA 1R5LA 3CD6P 2FYUJ 1PP9J 3WU2H 1YQ4C 3AE3C 2IDBA 2G8YA 4JPZB 2N1TD 3I56P 1NTKD 4M3LA 1RH5B 3L74E 1GW3A 1HGVA 4AQRD 2FFDC 1KTMA 2KLVA 5AW3B 3W67A 1SQPK 1AQ5A 3HD7A 3LW5J 3V2RA 3BRVB 4U3FE 1XTCC 3B71A 1NTMD 4HB1A 1NTZJ 2BASA 4OGQB 2B88A 2E74B 3L75D 2E75B 5AW9B 4BWNA 1SQQJ 3R2PA 3C9IA 5KLVJ 1S9KE 4NPEA 2YXQB 5CJ4A 2ZXXA 3MD0A 2WSCJ 1M57D 4IOIH 1T2KD 1KFNA 2Z5HA 2E5TA 3JSVC 1FJKA 1PZQA 4NPDA 2KSJA 1K8AQ 3L74J 4EYYQ 2IFMA 3L73G 2A45I 3PH0A 1FE6A 3CCJP 2QJYB 1EDJA 3A0HE 3NMDA 1S5LH 3HE5A 2OQQA 3I55P 1JY3N 2QM7A 3RL0C 2GA1A 3TK1A 4GDOA 1HF9A 2PP6A 1SQPE 1KV4A 4H13C 5GTHH 5BU5A 2BEQD 2QJPC 1E79H 4L73A 1L0NK 1ZR4A 3HE4B 4WBAA 4C46A 3CCLP 2YO2A 4WY4B 1MV8A 2WZ7A 1J1EB 3M91A 4CPGA 1VQKP 3E1IA 2E43A 3GLMA 3GMAA 4C7NB 2OARA 3P8CD 3L75J 1NGMB 1VQOP 2HPCA 3HE5B 4KHXA 4OGQD 1R5SA 2E74D 1NTZG 1JOCA 3USSA 2E75D 1LTJB 3N4XA 3F5HA 4D6TG 3AE8C 3H32B 3TGUD 1L2PA 3CI9A 3P8MC 1L0LD 1S72P 3P8CE 5KTBA 5APSA 1RF0C 4IL6X 1Q81Q 3E1RA 1VQ8P 2W27A 1L4AB 3PHLA 1N7SA 2M3EA 3RGUA 1QL2A 1P84D 4W80A 2HPCB 3II6A 1J2JB 1KFMA 1SQXD 1RQUA 1MKMA 1DEBA 1BGYE 2WSCH 4U3FG 4KT0J 3L71G 4N78D 1KQFB 4JYCA 3H1KG 1Q86Q 3M9BA 5DJUB 2IBZI 1G2CB 3HUSA 1EDKA 1M8OB 2PGDA 1YTZI 1M7LA 1Z56A 3N7NA 3L36A 1JY2N 2IBZE 2DW3A 4PJ0E 2AXCA 2AEJA 1Q90D 1QVFO 1T6AA 1M1JB 1HWTC 1N7SB 4WY4D 5AVWB 3VMAA 1HTLC 3TDKA 4N3YB 2A06G 3MIWA 3L72G 2VRSA 5CBNA 2CPSA 4L74A 5CCGC 5APUA 1KYOD 2ZXEB 1RF1C 3ITKA 4R4LA 2QJKC 1IFPA 3TGUJ 2ZYAA 3RK2B 1Y8AA 2I1JA 1ZRTE 1GD2E 2Z4EA 4XFJA 4ZKPA 2D2CB 4ZMDA 5AW2B 2BCCG 2FXMA 2OTLP 4EIJA 3HUSB 2A45G 1NO4A 1BGYJ 2E42A 1SVFA 1SFCC 2W8ZA 1SQPG 2GUVA 3A7OA 3V2QA 2E75C 3JC22 2NRGA 2XZRA 2WPVB 1OVVA 2QSIA 1L4AD 3LIDA 1KN7A 4OH8B 1SQXJ 1OXZA 3NTNA 3P32A 2JEEA 3TNUA 1OFCX 1VQ5P 3A0HH 3VYIA 2XKMA 1PFIA 1NKZB 4IL6E 2A45H 1IFDA 2YXRB 2W90A 2YMKA 2KLUA 1SLQA 1ZOYC 1IFJA 2LKMA 1X79B 2ZT9C 1ZLLA 1PGPA 2OGUA 2KSEA 4XE5B 1GK4A 2R5BA 1NU1E 3IN6A 2P7JA 4I1LA 3FXEA 3GF7A 3V2PA 3GHGB 5BVZA 1SQVK 1X9VA 1N7SD 1EXIA 3PP5A 2FYUK 3KDPB 2R3CA 3AE7C 2OYHB 1VF5B 1JY3O 3CCEP 3RBZA 4WWIA 3AE1C 4OWFA 1VDFA 2ZVNB 3RK2D 2IZ1A 1H89A 2D2CD 2Q3IA 2IX7C 4WB4A 1JM0A 4A7PA 1HJBA 2WVRA 1IO4A 2JR8A 2K9JB 1ZV8A 1R8EA 1BGYG 1LNQA 4DOJA 1NU1J 1NTZK 2RN0A 2XV5A 1U7JA 2O01J 3IFMA 1EXJA 2KP8A 1PGOA 3BCCD 1SQQK 3RBXA 2WMMA 5KLVK 2V7QJ 1WRGA 1WT6A 1URQA 2IBZG 4XA4A 1AA0A 3KZIE 1J1DC 1EZVD 2JP3A 2M5AB 2I8DA 3VTPC 1VPCA 5AVTB 2AXTE 1MFTA 1JMMA 1IFNA 4BRYB 3M0AA 4QMAA 1HVVA 3KPEA 1OW8A 2B87A 5AVRB 4PJ0H 4EI2A 1GL2C 4BXLA 2LXBA 1D7MA 2E76D 1JY3P 1YJWP 3VP8A 2KZJA 1URQB 3CXHD 4D6TD 1VF5D 3S4RA 1K9MQ 4JQ0D 1IK9A 1M1JC 1YTZT 1YYCA 2OYIB 3JCUE 3TYYA 2YIUB 4RJTA 2E5YA 1G1IA 1FBMA 4WVZA 3CXHI 5KLVE 1QEXA 1KB9I 3H6PA 1NVOA 2CPBA 5K5GB 3FGAD 2JWAA 4W7YA 3CXHE 1AVOA 1FZCB 2KXPB 5L8RJ 3BCCJ 4H0LC 2QEXP 1KB9E 1X8YA 3NXSA 1IJDB 1NU1G 2OTKE 3WUTA 1YIJP 4H44C 1RHZB 1OW7A 1SFCA 4IL6H 2RH0A 1S1CX 1KORA 3B5NC 4DJGA 3A5TA 5CJ0A 2SPZA 1S4XA 3EQ2A 1T3UA 3L71D 2HR3A 1U57A 3H1HG 1ZN5A 1SQBD 1H8AA 1CI6B 5DJTB 4L75A 2ZFCA 1NTKE 1M90Q 3HRNA 5AW7B 1LWUB 3GG2A 3D6YA 2B89A 1JMBA 2O01H 1KILA 3CLQA 2IPPA 2P2UA 2FKWB 1VQ6P 4RO0A 3CX5D 2V7QH 1YITP 1OX3A 3WUUA 3L72D 2C9LY 2O1JA 3Q5RA 2NZ2A 5KJ7A 2QA4P 1NTME 1URQD 1OIPA 1PV3A 3H1IG 1NKNA 1H0TA 5AVZB 3L75E 1BCCD 3GHGC 4W7ZA 3HD7B 2BCCD 2YO3A 2WPRA 3C8VA 2FYNC 3I5CA 3MUDC 1EDLA 1KILB 4PV1B 2QE7H 2RKLA 1VQMP 1IC2A 3CCSP 2OYHC 3L4FA 1ZMEC 3FWNA 1VF5C 1SQVG 3T97A 2FXOA 2NPSA 5KLIC 5E79E 1NTKJ 3G6EP 4PD4D 1BCCE 2FYUG 2J58A 3G4SP 5CCHC 1PP9G 2ITAA 5TISE 1VQ4P 1PIXA 2HODA 1RQVA
chains in the Genus database with same CATH topology
1TU3F 3RL0g 4OGQD 2BEZF 3GF7A 1UIXA 3SFEC 2D2CC 2ZT9B 4H44B 3D71A 1ZP0C 2E74D 2YIUC 3IAOA 4H13B 1Y9BA 3AEFC 2E75D 2K9YA 2FBWC 4H0LD 3AE4C 1OW8A 1WMKA 3Q3DA 1DD4A 5M1BA 1EXIA 3AE8C 2H89C 2WSEJ 2QJYC 4R4LA 2WSCJ 2QJKC 3D6YA 2ZT9D 3EWKA 2E76D 4H44D 3H25A 3AEDC 1GMJA 1DD3A 5KKZC 1ZRTE 1DIPA 3G9RA 3AE7C 4XFJA 1YQ3C 2D2CB 4R4MA 1VF5B 1OMIA 2E76B 3AE1C 4IL6X 2WQYC 3AEAC 3AEEC 4U7JA 3Q2YA 3Q5RA 1FDIA 2D2CD 1KQGB 1K05A 1VF5D 2NZ2A 1K04A 1FDOA 2OQQA 2E75C 3AE9C 1KILE 2JO1A 4TT3H 1PV3A 1YQ4C 4Y28J 4PV1C 2WPVB 2G3AA 3AE3C 2IDBA 1JB0J 2G8YA 1NYHA 4Z1MH 3AECC 1R8EA 2QSIA 3O6QA 3ABVC 4GDOA 4I7ZC 1HF9A 3Q5SA 3D6ZA 4H13C 2P10A 1HJ0A 3T97B 1IK7A 1RQUA 2BEQD 3Q1MA 1AJYA 2MKVA 4OGQC 1MKMA 2QJPC 1KTMA 3C8VA 2O01J 3AE6C 2E74C 3SFDC 1KMIZ 4KT0J 1EXJA 3FGAD 2J5UA 2FYNC 1KQFB 1PL5A 2QIWA 2YMKA 5L8RJ 4PV1B 4H0LC 1VL2A 3Q5PA 1ZOYC 3RK3E 1ZMEC 2WSFJ 2FXPA 2V7QJ 3LW5J 4I7ZB 1VF5C 1OW6A 3AE2C 2ZT9C 4H44C 2E76C 4RKUJ 5KLIC 3B71A 1OW7A 4OGQB 4PV1D 2H88C 1S5LX 3S9OA 4YXDC 1S1CX 2E74B 1KORA 3IN6A 2JP3A 3R4YA 3AEGC 3GLMA 3GMAA 4YTPC 3D70A 3AE5C 1Q90D 2E75B 1NGMB 4H13D 4H0LB 1PIXA 3GF3A 1RQVA 3AEBC 1U57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y28 J;  2WPV B;  1JB0 J;  2D2C B;  2WSF J;  1VF5 B;  3LW5 J;  4I7Z B;  2ZT9 B;  4H44 B;  2QSI A;  2E76 B;  2YIU C;  4RKU J;  5KLI C;  4H13 B;  4IL6 X;  2K9Y A;  4OGQ B;  1S5L X;  2QJP C;  2E74 B;  2QJY C;  2WSE J;  3C8V A;  2WSC J;  2QJK C;  2O01 J;  4KT0 J;  2FYN C;  1Q90 D;  2E75 B;  4H0L B;  2QIW A;  5KKZ C;  5L8R J;  4PV1 B;  1ZRT E; 
#chains in the Genus database with same CATH topology
 1IZN B;  1U7M A;  3H1L D;  1NHL A;  3SFE C;  3U1C A;  3TF5 A;  1SQB J;  3KZI H;  1Y9B A;  2QVA A;  3AE4 C;  5AVY B;  1NTM J;  2N1T C;  1KD1 Q;  2WSE J;  3MP7 B;  1MZ9 A;  3FX0 A;  1NAY A;  1YI2 P;  1GMJ A;  2R5D A;  2AXT H;  1KC8 Q;  4EDF A;  1LJ2 A;  1NWQ A;  3M0D C;  1LT9 A;  1RE4 C;  2R32 A;  4HJG H;  3A0B E;  1SQX K;  1HUC A;  2W6A A;  3MZW B;  2C0X A;  2ZAE B;  1SQQ G;  5KLV G;  4Y28 J;  2HOD B;  1JB0 J;  1NYH A;  3AEC C;  1SP4 A;  3O6Q A;  1BCC J;  4I7Z C;  3CME P;  3LW5 H;  1N73 C;  1GL2 A;  2Y0C A;  2MKV A;  2YMY A;  2Y0E A;  1L0N D;  3KXD A;  2J5U A;  1PL5 A;  3HD7 D;  1FZB A;  3JCU H;  3L74 G;  3TGU E;  2WSF J;  3BRT B;  2AEF A;  1L0L E;  1T2K C;  3O8Z A;  1XTG B;  2KYV A;  1LT9 B;  2KNC A;  1KIL D;  4IFF A;  4PV1 D;  3CWB D;  2WWW A;  3CXH H;  2J59 M;  4JBZ A;  1P84 I;  3H1J D;  3S1K A;  1KB9 H;  3GF3 A;  2B9B A;  3V4W A;  3KYQ A;  4K3A A;  2I1K A;  3RK3 B;  4GOE A;  2C9N Y;  2YIU C;  3VP9 A;  2QRX A;  1HH0 A;  1P84 E;  1Q7Y Q;  3QWO C;  1PPJ D;  5KJ7 D;  1Y47 A;  5C39 A;  1BE3 D;  3U1A A;  1DD4 A;  2Z5I A;  1FOS F;  1JUN A;  1FC2 C;  1SQX E;  2P1J A;  3CWB E;  2K88 A;  3CCR P;  1W2E A;  3SWY A;  4N78 E;  1NU1 K;  2FFD A;  3MGN A;  5AW5 B;  3L75 G;  1FZA A;  2WSS H;  5KKZ B;  1FDO A;  1N7L A;  2NPS D;  1L0L J;  4HYT B;  5APT A;  3MHV A;  5APW A;  1KYO I;  1LTI C;  2N9B A;  5KAI E;  4OGQ C;  1DEE G;  5B66 E;  1BSN A;  4I2L C;  3AE6 C;  2E74 C;  2WSE H;  3B4S A;  1KMI Z;  1AV1 A;  1L0N J;  1KYO E;  5AVS B;  1JTH A;  3SSU A;  4MN4 C;  3L70 D;  1JO5 A;  3CWB J;  2H7H A;  4YTP C;  3H1J J;  1QGK B;  3PRJ A;  2BEZ F;  5E79 H;  3HD7 C;  3AEF C;  3IF4 A;  5TIS H;  1A02 F;  2QJY C;  3RK3 D;  2C0W A;  3EWK A;  3WUV A;  5EFW B;  2KOG A;  1A02 J;  1FZG A;  4GT1 A;  5AW0 B;  2E76 B;  5H2F E;  3CC2 P;  1PGQ A;  3AEA C;  2FYZ A;  4U7J A;  3PTZ A;  2IYP A;  3LIE A;  1LGH B;  1CW5 A;  2IFN A;  1KQG B;  3TNU B;  2G3A A;  3KQG A;  2XND H;  3A0B H;  1NAF A;  1T8Z A;  2N1T A;  1E5W A;  1FS0 E;  4WY4 C;  1Q2N A;  3Q1M A;  4YXW H;  1AJY A;  3TGU G;  1J1E C;  3VOP A;  2HG5 D;  5AVQ B;  4KJM A;  1N2D C;  3M0D A;  2HLO A;  1QX8 A;  1RE4 A;  2AEM A;  1VQN P;  3V4Q A;  2OYO A;  2M0B A;  3L73 D;  2W83 C;  1LTJ C;  2QJP B;  2WPS A;  1K73 Q;  2Q3E A;  2RMZ A;  1H88 A;  2L91 A;  3RL0 g;  1N73 A;  1RF0 A;  3W68 A;  1MUU A;  4IFD K;  2Q1K A;  1BDD A;  1SQV D;  1SQX G;  2N9Y B;  2FYU D;  1LTS C;  1UII A;  1PP9 D;  1L4A C;  1GZL A;  3AED C;  4LGD E;  1Q82 Q;  2HFE D;  1DIP A;  2PAJ A;  1M56 D;  1P84 H;  3BCC E;  2IYO A;  2JKV A;  1EZV I;  2ZVO B;  1FDI A;  4ZKU A;  1DX7 A;  1K04 A;  1OWA A;  4TT3 H;  1EZV E;  3MTU E;  2OTJ P;  2WT7 A;  3F89 A;  2Y0D A;  3Q5S A;  1NTK K;  3V2N A;  1NTZ D;  1IK7 A;  1IFI A;  1MFZ A;  4UB8 E;  5AVV B;  2YKO A;  2QIW A;  2P58 A;  1N7S C;  1KQL A;  4DZO A;  1S2E A;  1EDI A;  5CCG A;  2WIT A;  4HKZ H;  1SQB K;  2K37 A;  1SS1 A;  1RF1 A;  5KAI H;  1T3J A;  5B66 H;  1NTM K;  4YXD C;  3OW2 O;  3R4Y A;  2B87 B;  1KYO H;  1BSH A;  1JY2 O;  2Y9Y A;  4H13 D;  1RY3 A;  1GTW A;  4I6M C;  3RK2 C;  4D6T E;  2D2C C;  2MJZ A;  1ZP0 C;  2WT7 B;  5TJH A;  4NPF X;  4N6J A;  2Q9I A;  3HUS C;  2XDJ A;  2H89 C;  4UB6 E;  1HGZ A;  4U3F D;  2R44 A;  4GKG A;  4R4M A;  3H1K D;  2Q6Q A;  5GTI E;  3VMY A;  2V4H A;  1RF1 B;  3Q2Y A;  2QJK B;  2P67 A;  4GOF A;  1S9K D;  3NFQ A;  3B8E B;  2JO1 A;  3PLN A;  1X22 A;  5H2F H;  4O9B A;  4TLF A;  3VMX A;  3L71 E;  5APV A;  5B5E E;  1LTG C;  2A06 D;  2P10 A;  1HJ0 A;  3H1K E;  4JF7 A;  1FZE A;  1GU5 A;  2O01 N;  1LT1 A;  1SQB E;  1SFC B;  3G3Z A;  3SFD C;  4D6T J;  2KK7 A;  3CX5 I;  1GU4 A;  2HYN A;  3M9H A;  4Y99 B;  4HH2 A;  2E76 C;  3CC4 P;  3CX5 E;  4IFM A;  2ZYD A;  3UIA A;  2M8R A;  1JY2 P;  3S9O A;  2A06 E;  5CHX A;  3L72 E;  1JEK A;  3HE4 A;  1SQP D;  2IZ0 A;  2ZT9 B;  1JCC A;  4WY4 A;  2M3B A;  1GDT A;  4C7N A;  2BCC E;  1HBW A;  3BCC G;  4U3F J;  3L71 J;  3G9R A;  1L0L K;  3H1K J;  4PD4 I;  5BU8 B;  1H0T B;  1LTJ A;  2WQY C;  1EZV G;  3H32 A;  1G1J A;  1K05 A;  4PD4 E;  2W6B A;  3AE9 C;  2WPQ A;  4JYB A;  5CCG D;  2O1K A;  1FDM A;  2KI7 B;  1RE3 C;  3FXD A;  3CMA P;  4C7R A;  3H1L E;  2KUB A;  3T97 B;  3L72 J;  2NPS B;  4GOD A;  1L4A A;  1NH4 A;  3L37 A;  1NJI Q;  3CCV P;  3U59 A;  1YJN P;  1FU1 A;  2Y9Z A;  1VL2 A;  1LP1 A;  2FY8 A;  2L5G B;  1OW6 A;  1LTT C;  1OVU A;  4RKU J;  1SFC D;  3IR9 A;  4ZNC A;  1EQ7 A;  4OVN F;  3EFF K;  2XU6 A;  2BCC J;  1FOS E;  2H88 C;  2K3R A;  4UB8 H;  1IFM A;  1SQP J;  1G2C A;  2ZJS E;  3A3Y B;  1VQ9 P;  1USD A;  4L76 A;  3WMM 0;  2YNY A;  2WTY A;  1YHQ P;  4DCK A;  1J1D B;  1BGY D;  1URQ C;  1QL1 A;  3E7K A;  2KB7 P;  2JDI H;  3QH9 A;  2ZT9 D;  1M1J A;  3M9Q A;  4DT0 A;  3H25 A;  3PJS K;  1USE A;  3H1L J;  2POH A;  1L0N E;  1LP1 B;  1NTK G;  4B86 A;  2OYI C;  3K5B A;  4EOT A;  2QG4 A;  2IBZ D;  3O6Q B;  4LLH A;  3AEE C;  1QLE D;  4UB6 H;  1GL2 B;  1AQT A;  3OAK A;  1X0T A;  2KS1 A;  5AW4 B;  1KIL E;  1FZC C;  1JCD A;  1SQB G;  2ZYG A;  5GTI H;  3H1J E;  3D6Z A;  1NTM G;  4RES B;  1YBK A;  3B5N A;  1ZRT D;  2KNC B;  1PPJ E;  4ASW A;  1BE3 E;  1ZXG A;  3OJA B;  5B5E H;  3AE2 C;  2PRR A;  4YPC A;  1JNM A;  1GK6 A;  3CPW O;  5CMZ A;  1VQP P;  1S5L X;  4K35 A;  3G71 P;  5KAF E;  3AEG C;  1LWU C;  2KS1 B;  3L35 A;  4H0L B;  1OZH A;  1BCC G;  2UWJ E;  4LC1 A;  4H44 B;  3D71 A;  3CX5 H;  3IAO A;  3M06 A;  5AVU B;  2K9Y A;  2FBW C;  3Q3D A;  2FFD B;  3B5N B;  1N8R Q;  1PGJ A;  1AFO A;  3VMZ A;  3SWF A;  5AW1 B;  3GHG A;  5AVX B;  3WU2 E;  1CZQ A;  1EC5 A;  4Y99 C;  1OMI A;  3V6I A;  1NU1 D;  2LXC B;  5CBO A;  1BE3 J;  2LR2 A;  1W5C E;  3MUD A;  2KZI A;  3L70 E;  1QVG O;  2OYH A;  3H1L G;  2CK3 H;  2H8P D;  1KIL C;  4PV1 C;  4Z1M H;  3H1H D;  3HTK A;  1GL2 D;  3ABV C;  2WSF H;  3CC7 P;  1KZU B;  1JTH B;  5CCH A;  3EFG A;  4PD4 H;  1ZW0 A;  5APQ A;  2K9J A;  5APX A;  5KJ7 C;  3RK3 E;  2FXP A;  1S3J A;  3H1H E;  1OVR A;  3BVH A;  3CCU P;  3A2A A;  2FYN B;  3OA7 A;  3D70 A;  3AE5 C;  1L0L G;  5AW6 B;  1RE3 A;  2W6J H;  3RL0 B;  3H1I D;  1UIX A;  5KLI B;  3HTK B;  4H13 B;  3P7K A;  1CSB A;  4H0L D;  3L70 J;  2NPS C;  2M5A A;  1L0N G;  4H44 D;  1FAV A;  1DD3 A;  3VN0 A;  1S5L E;  4BRY A;  2Q7C A;  3B5N D;  2Q5U A;  1AVY A;  3V5B A;  3H1I E;  3CWB G;  1M1K Q;  2N1T B;  1ZR2 A;  3BAT A;  2XNX A;  5GTH E;  3H1J G;  1VQ7 P;  3CL3 D;  1N86 A;  3L73 E;  1BDC A;  2O3J A;  3H1H J;  2K1A A;  2GUS A;  1PPJ G;  1BE3 G;  2GM4 A;  1LT9 C;  1SQV E;  3GW6 A;  1LTB C;  2FYU E;  2KIK A;  2OYI A;  2YKP A;  3Q5P A;  3TSI A;  1PP9 E;  4I7Z B;  3RK3 C;  1N73 B;  3CCM P;  1FZF A;  3KHU A;  1GW4 A;  2JWD A;  4AUW A;  3FWL A;  5AW8 B;  3BAS A;  1FZC A;  4ASV A;  2YKQ A;  1NOH A;  2H43 A;  2R3S A;  3CCQ P;  3AEB C;  1SQQ D;  1VQL P;  1DH3 A;  5KLV D;  1TU3 F;  2QM8 A;  1LTA C;  3C1L A;  3H1I J;  3SWK A;  5APY A;  1WMK A;  5KAF H;  3RL0 D;  5M1B A;  3L73 J;  1KB9 D;  1NTZ E;  2PFX A;  1FJP A;  4AYC A;  5KKZ C;  2JJL A;  1W2B O;  1YQ3 C;  1YJ9 P;  3L74 D;  5CCH D;  1KQS O;  1CI6 A;  1SQQ E;  3L70 G;  4GIF A;  1SQV J;  3ZDM A;  1LWU A;  1R5L A;  3CD6 P;  2FYU J;  1PP9 J;  3WU2 H;  1YQ4 C;  3AE3 C;  2IDB A;  2G8Y A;  4JPZ B;  2N1T D;  3I56 P;  1NTK D;  4M3L A;  1RH5 B;  3L74 E;  1GW3 A;  1HGV A;  4AQR D;  2FFD C;  1KTM A;  2KLV A;  5AW3 B;  3W67 A;  1SQP K;  1AQ5 A;  3HD7 A;  3LW5 J;  3V2R A;  3BRV B;  4U3F E;  1XTC C;  3B71 A;  1NTM D;  4HB1 A;  1NTZ J;  2BAS A;  4OGQ B;  2B88 A;  2E74 B;  3L75 D;  2E75 B;  5AW9 B;  4BWN A;  1SQQ J;  3R2P A;  3C9I A;  5KLV J;  1S9K E;  4NPE A;  2YXQ B;  5CJ4 A;  2ZXX A;  3MD0 A;  2WSC J;  1M57 D;  4IOI H;  1T2K D;  1KFN A;  2Z5H A;  2E5T A;  3JSV C;  1FJK A;  1PZQ A;  4NPD A;  2KSJ A;  1K8A Q;  3L74 J;  4EYY Q;  2IFM A;  3L73 G;  2A45 I;  3PH0 A;  1FE6 A;  3CCJ P;  2QJY B;  1EDJ A;  3A0H E;  3NMD A;  1S5L H;  3HE5 A;  2OQQ A;  3I55 P;  1JY3 N;  2QM7 A;  3RL0 C;  2GA1 A;  3TK1 A;  4GDO A;  1HF9 A;  2PP6 A;  1SQP E;  1KV4 A;  4H13 C;  5GTH H;  5BU5 A;  2BEQ D;  2QJP C;  1E79 H;  4L73 A;  1L0N K;  1ZR4 A;  3HE4 B;  4WBA A;  4C46 A;  3CCL P;  2YO2 A;  4WY4 B;  1MV8 A;  2WZ7 A;  1J1E B;  3M91 A;  4CPG A;  1VQK P;  3E1I A;  2E43 A;  3GLM A;  3GMA A;  4C7N B;  2OAR A;  3P8C D;  3L75 J;  1NGM B;  1VQO P;  2HPC A;  3HE5 B;  4KHX A;  4OGQ D;  1R5S A;  2E74 D;  1NTZ G;  1JOC A;  3USS A;  2E75 D;  1LTJ B;  3N4X A;  3F5H A;  4D6T G;  3AE8 C;  3H32 B;  3TGU D;  1L2P A;  3CI9 A;  3P8M C;  1L0L D;  1S72 P;  3P8C E;  5KTB A;  5APS A;  1RF0 C;  4IL6 X;  1Q81 Q;  3E1R A;  1VQ8 P;  2W27 A;  1L4A B;  3PHL A;  1N7S A;  2M3E A;  3RGU A;  1QL2 A;  1P84 D;  4W80 A;  2HPC B;  3II6 A;  1J2J B;  1KFM A;  1SQX D;  1RQU A;  1MKM A;  1DEB A;  1BGY E;  2WSC H;  4U3F G;  4KT0 J;  3L71 G;  4N78 D;  1KQF B;  4JYC A;  3H1K G;  1Q86 Q;  3M9B A;  5DJU B;  2IBZ I;  1G2C B;  3HUS A;  1EDK A;  1M8O B;  2PGD A;  1YTZ I;  1M7L A;  1Z56 A;  3N7N A;  3L36 A;  1JY2 N;  2IBZ E;  2DW3 A;  4PJ0 E;  2AXC A;  2AEJ A;  1Q90 D;  1QVF O;  1T6A A;  1M1J B;  1HWT C;  1N7S B;  4WY4 D;  5AVW B;  3VMA A;  1HTL C;  3TDK A;  4N3Y B;  2A06 G;  3MIW A;  3L72 G;  2VRS A;  5CBN A;  2CPS A;  4L74 A;  5CCG C;  5APU A;  1KYO D;  2ZXE B;  1RF1 C;  3ITK A;  4R4L A;  2QJK C;  1IFP A;  3TGU J;  2ZYA A;  3RK2 B;  1Y8A A;  2I1J A;  1ZRT E;  1GD2 E;  2Z4E A;  4XFJ A;  4ZKP A;  2D2C B;  4ZMD A;  5AW2 B;  2BCC G;  2FXM A;  2OTL P;  4EIJ A;  3HUS B;  2A45 G;  1NO4 A;  1BGY J;  2E42 A;  1SVF A;  1SFC C;  2W8Z A;  1SQP G;  2GUV A;  3A7O A;  3V2Q A;  2E75 C;  3JC2 2;  2NRG A;  2XZR A;  2WPV B;  1OVV A;  2QSI A;  1L4A D;  3LID A;  1KN7 A;  4OH8 B;  1SQX J;  1OXZ A;  3NTN A;  3P32 A;  2JEE A;  3TNU A;  1OFC X;  1VQ5 P;  3A0H H;  3VYI A;  2XKM A;  1PFI A;  1NKZ B;  4IL6 E;  2A45 H;  1IFD A;  2YXR B;  2W90 A;  2YMK A;  2KLU A;  1SLQ A;  1ZOY C;  1IFJ A;  2LKM A;  1X79 B;  2ZT9 C;  1ZLL A;  1PGP A;  2OGU A;  2KSE A;  4XE5 B;  1GK4 A;  2R5B A;  1NU1 E;  3IN6 A;  2P7J A;  4I1L A;  3FXE A;  3GF7 A;  3V2P A;  3GHG B;  5BVZ A;  1SQV K;  1X9V A;  1N7S D;  1EXI A;  3PP5 A;  2FYU K;  3KDP B;  2R3C A;  3AE7 C;  2OYH B;  1VF5 B;  1JY3 O;  3CCE P;  3RBZ A;  4WWI A;  3AE1 C;  4OWF A;  1VDF A;  2ZVN B;  3RK2 D;  2IZ1 A;  1H89 A;  2D2C D;  2Q3I A;  2IX7 C;  4WB4 A;  1JM0 A;  4A7P A;  1HJB A;  2WVR A;  1IO4 A;  2JR8 A;  2K9J B;  1ZV8 A;  1R8E A;  1BGY G;  1LNQ A;  4DOJ A;  1NU1 J;  1NTZ K;  2RN0 A;  2XV5 A;  1U7J A;  2O01 J;  3IFM A;  1EXJ A;  2KP8 A;  1PGO A;  3BCC D;  1SQQ K;  3RBX A;  2WMM A;  5KLV K;  2V7Q J;  1WRG A;  1WT6 A;  1URQ A;  2IBZ G;  4XA4 A;  1AA0 A;  3KZI E;  1J1D C;  1EZV D;  2JP3 A;  2M5A B;  2I8D A;  3VTP C;  1VPC A;  5AVT B;  2AXT E;  1MFT A;  1JMM A;  1IFN A;  4BRY B;  3M0A A;  4QMA A;  1HVV A;  3KPE A;  1OW8 A;  2B87 A;  5AVR B;  4PJ0 H;  4EI2 A;  1GL2 C;  4BXL A;  2LXB A;  1D7M A;  2E76 D;  1JY3 P;  1YJW P;  3VP8 A;  2KZJ A;  1URQ B;  3CXH D;  4D6T D;  1VF5 D;  3S4R A;  1K9M Q;  4JQ0 D;  1IK9 A;  1M1J C;  1YTZ T;  1YYC A;  2OYI B;  3JCU E;  3TYY A;  2YIU B;  4RJT A;  2E5Y A;  1G1I A;  1FBM A;  4WVZ A;  3CXH I;  5KLV E;  1QEX A;  1KB9 I;  3H6P A;  1NVO A;  2CPB A;  5K5G B;  3FGA D;  2JWA A;  4W7Y A;  3CXH E;  1AVO A;  1FZC B;  2KXP B;  5L8R J;  3BCC J;  4H0L C;  2QEX P;  1KB9 E;  1X8Y A;  3NXS A;  1IJD B;  1NU1 G;  2OTK E;  3WUT A;  1YIJ P;  4H44 C;  1RHZ B;  1OW7 A;  1SFC A;  4IL6 H;  2RH0 A;  1S1C X;  1KOR A;  3B5N C;  4DJG A;  3A5T A;  5CJ0 A;  2SPZ A;  1S4X A;  3EQ2 A;  1T3U A;  3L71 D;  2HR3 A;  1U57 A;  3H1H G;  1ZN5 A;  1SQB D;  1H8A A;  1CI6 B;  5DJT B;  4L75 A;  2ZFC A;  1NTK E;  1M90 Q;  3HRN A;  5AW7 B;  1LWU B;  3GG2 A;  3D6Y A;  2B89 A;  1JMB A;  2O01 H;  1KIL A;  3CLQ A;  2IPP A;  2P2U A;  2FKW B;  1VQ6 P;  4RO0 A;  3CX5 D;  2V7Q H;  1YIT P;  1OX3 A;  3WUU A;  3L72 D;  2C9L Y;  2O1J A;  3Q5R A;  2NZ2 A;  5KJ7 A;  2QA4 P;  1NTM E;  1URQ D;  1OIP A;  1PV3 A;  3H1I G;  1NKN A;  1H0T A;  5AVZ B;  3L75 E;  1BCC D;  3GHG C;  4W7Z A;  3HD7 B;  2BCC D;  2YO3 A;  2WPR A;  3C8V A;  2FYN C;  3I5C A;  3MUD C;  1EDL A;  1KIL B;  4PV1 B;  2QE7 H;  2RKL A;  1VQM P;  1IC2 A;  3CCS P;  2OYH C;  3L4F A;  1ZME C;  3FWN A;  1VF5 C;  1SQV G;  3T97 A;  2FXO A;  2NPS A;  5KLI C;  5E79 E;  1NTK J;  3G6E P;  4PD4 D;  1BCC E;  2FYU G;  2J58 A;  3G4S P;  5CCH C;  1PP9 G;  2ITA A;  5TIS E;  1VQ4 P;  1PIX A;  2HOD A;  1RQV A; 
#chains in the Genus database with same CATH homology
 1TU3 F;  3RL0 g;  4OGQ D;  2BEZ F;  3GF7 A;  1UIX A;  3SFE C;  2D2C C;  2ZT9 B;  4H44 B;  3D71 A;  1ZP0 C;  2E74 D;  2YIU C;  3IAO A;  4H13 B;  1Y9B A;  3AEF C;  2E75 D;  2K9Y A;  2FBW C;  4H0L D;  3AE4 C;  1OW8 A;  1WMK A;  3Q3D A;  1DD4 A;  5M1B A;  1EXI A;  3AE8 C;  2H89 C;  2WSE J;  2QJY C;  4R4L A;  2WSC J;  2QJK C;  3D6Y A;  2ZT9 D;  3EWK A;  2E76 D;  4H44 D;  3H25 A;  3AED C;  1GMJ A;  1DD3 A;  5KKZ C;  1ZRT E;  1DIP A;  3G9R A;  3AE7 C;  4XFJ A;  1YQ3 C;  2D2C B;  4R4M A;  1VF5 B;  1OMI A;  2E76 B;  3AE1 C;  4IL6 X;  2WQY C;  3AEA C;  3AEE C;  4U7J A;  3Q2Y A;  3Q5R A;  1FDI A;  2D2C D;  1KQG B;  1K05 A;  1VF5 D;  2NZ2 A;  1K04 A;  1FDO A;  2OQQ A;  2E75 C;  3AE9 C;  1KIL E;  2JO1 A;  4TT3 H;  1PV3 A;  1YQ4 C;  4Y28 J;  4PV1 C;  2WPV B;  2G3A A;  3AE3 C;  2IDB A;  1JB0 J;  2G8Y A;  1NYH A;  4Z1M H;  3AEC C;  1R8E A;  2QSI A;  3O6Q A;  3ABV C;  4GDO A;  4I7Z C;  1HF9 A;  3Q5S A;  3D6Z A;  4H13 C;  2P10 A;  1HJ0 A;  3T97 B;  1IK7 A;  1RQU A;  2BEQ D;  3Q1M A;  1AJY A;  2MKV A;  4OGQ C;  1MKM A;  2QJP C;  1KTM A;  3C8V A;  2O01 J;  3AE6 C;  2E74 C;  3SFD C;  1KMI Z;  4KT0 J;  1EXJ A;  3FGA D;  2J5U A;  2FYN C;  1KQF B;  1PL5 A;  2QIW A;  2YMK A;  5L8R J;  4PV1 B;  4H0L C;  1VL2 A;  3Q5P A;  1ZOY C;  3RK3 E;  1ZME C;  2WSF J;  2FXP A;  2V7Q J;  3LW5 J;  4I7Z B;  1VF5 C;  1OW6 A;  3AE2 C;  2ZT9 C;  4H44 C;  2E76 C;  4RKU J;  5KLI C;  3B71 A;  1OW7 A;  4OGQ B;  4PV1 D;  2H88 C;  1S5L X;  3S9O A;  4YXD C;  1S1C X;  2E74 B;  1KOR A;  3IN6 A;  2JP3 A;  3R4Y A;  3AEG C;  3GLM A;  3GMA A;  4YTP C;  3D70 A;  3AE5 C;  1Q90 D;  2E75 B;  1NGM B;  4H13 D;  4H0L B;  1PIX A;  3GF3 A;  1RQV A;  3AEB C;  1U57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...