4RKUJ

Crystal structure of plant photosystem i at 3 angstrom resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
40
structure length
40
Chain Sequence
RDLKTYLSVAPVASTLWFAALAGLLIEINRLFPDALTFPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structure of plant Photosystem I at 3.1 Angstrom resolution
rcsb
total genus 11
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2014-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4rkuJ00
2QSIA 4H44B 2O01J 4I7ZB 1ZRTE 2WPVB 5KLIC 2E76B 2WSCJ 2QJPC 1VF5B 5KKZC 2YIUC 2E74B 2QIWA 4H13B 1JB0J 2K9YA 2E75B 1Q90D 2D2CB 3LW5J 4KT0J 2WSEJ 4OGQB 2ZT9B 3C8VA 4IL6X 2WSFJ 4RKUJ 2QJKC 4PV1B 5L8RJ 2QJYC 2FYNC 1S5LX 4H0LB 4Y28J
chains in the Genus database with same CATH superfamily
1TU3F 1BGYG 3FGAD 3GHGC 5KLIC 2Q9IA 4IFFA 4HKZH 2FYZA 3WU2H 1N86A 2WMMA 1T2KC 1SQBK 3G6EP 1JM0A 1LTGC 1MV8A 3RK3D 1VQ7P 5CHXA 3CX5D 5BVZA 4GIFA 1FZAA 3R4YA 3FXEA 3OA7A 4ZKUA 3L75D 3L72E 1IK7A 4L74A 2A45I 4ZMDA 3N7NA 2QA4P 2GM4A 3TF5A 1KYOH 1BE3J 4DCKA 1EZVD 3IR9A 5CJ0A 2AXTE 4PD4H 5AVXB 2E74C 1T6AA 3L71J 2YO3A 1NTKE 1Q7YQ 1L0NJ 3L73J 3BCCJ 5AVTB 3H1IE 2KZJA 2OYHC 2E5YA 2ZT9B 4M3LA 4GKGA 1DEEG 3CL3D 2JP3A 2PGDA 1H89A 4BXLA 1FU1A 1G2CA 2BEQD 5DJUB 1VQ4P 3H1HG 2PP6A 2Y0CA 1WMKA 3EWKA 1WRGA 1NTMG 3H1JJ 1A02J 2P7JA 1EXJA 1IFDA 2IZ1A 1NKZB 1LGHB 1SQVD 4PV1D 3II6A 2HG5D 1L4AA 3CCUP 3AECC 4H0LB 4GDOA 1CI6A 1BCCJ 3UIAA 3Q2YA 2YNYA 3W67A 1AJYA 1HWTC 1Y9BA 1X9VA 3D6ZA 2QM7A 3O6QB 2WVRA 1NU1K 2M3EA 2B87B 2WZ7A 1YQ3C 2O3JA 1KILE 1NTZD 3LW5H 2Z5IA 1NH4A 3KZIH 1HVVA 1RF1B 2ITAA 2V7QJ 1IZNB 3M9BA 2G3AA 1FDIA 3Q3DA 1KQFB 1OXZA 3EFGA 3M91A 2Q1KA 4XA4A 2ZFCA 1VQ9P 1N7SD 2LR2A 2KP8A 3AE6C 5KAIE 2K3RA 1KN7A 3TNUA 1IJDB 4PJ0H 1LWUA 2YMYA 1S9KD 3L70D 1JO5A 4HJGH 3CCLP 4WY4D 1KC8Q 2WT7B 2KI7B 3KPEA 1HJBA 1LP1B 1E5WA 1OVUA 2K9JA 3CC7P 5AW1B 1GTWA 4JQ0D 1BE3E 2KLUA 3H1HD 1SQQK 2N1TA 2SPZA 4I7ZC 1JNMA 5KJ7D 1GD2E 2QG4A 1KYOD 1NTMD 3L71E 1J1EB 4Y28J 3CWBD 1L4AC 4H13C 1L0NE 3L73E 3BCCE 4W7ZA 1SS1A 3MTUE 4RO0A 3C1LA 4Y99B 1Y8AA 2IX7C 1JY3O 3V4QA 3H1JE 1LTIC 1SQPJ 3K5BA 2LKMA 2LXCB 2XNDH 1EC5A 2IBZG 1SFCA 1IFNA 1X79B 1EDIA 2M3BA 5KLVG 1SFCD 1GDTA 2FY8A 1JY3N 2CPBA 1JY2P 5APSA 4ASVA 3P32A 2WSFH 2GUVA 5KTBA 2BCCJ 1NTKK 2JR8A 2KXPB 2ZJSE 1HH0A 1M1KQ 2WQYC 4N78D 3MGNA 1FJPA 1RHZB 2QJKC 1R5SA 4GOFA 5APWA 1LWUC 4GOEA 1NJIQ 1JTHB 2QIWA 2KS1A 3AE4C 3B5NB 3P7KA 3HE4A 3I55P 3GF3A 3M06A 2N1TC 1OW7A 1BE3G 2YKPA 2R5DA 1NVOA 2OYOA 2WPQA 2XV5A 2XNXA 5CMZA 4YPCA 1M7LA 2ZXXA 1QEXA 2MJZA 3RK2B 5GTHE 3RK3E 5CCGD 2Y0EA 3IF4A 3FWLA 3L37A 3H32B 1S5LE 3HD7B 1Q81Q 5E79E 3RL0B 2YIUC 3H1LG 4D6TG 2K88A 3B71A 3L74D 3N4XA 1KILA 3CCJP 3CMAP 5AW2B 1JEKA 3LIDA 2KNCB 3C9IA 1EZVE 4WB4A 3H1HJ 2WWWA 2IBZD 1FE6A 3IAOA 1NTMJ 2V7QH 3CWBJ 1QVGO 1BCCG 2E5TA 3E7KA 2ZAEB 3OAKA 1USEA 2QSIA 2FKWB 1SQPE 3SWFA 1VF5D 2BEZF 3V5BA 1P84D 5AVSB 1M1JB 2C9NY 4UB6E 2R32A 3JSVC 5AVQB 2ZT9D 2IFMA 4OGQB 3CX5H 2W6AA 3KQGA 1S5LH 3VOPA 2HODB 3U1AA 2BCCE 1RE3C 1IO4A 4U7JA 3E1IA 1KORA 3FXDA 1FZCC 4LLHA 1JUNA 4H0LD 4UB8E 2A06D 1YTZI 3NTNA 1VDFA 3CCEP 1KZUB 2XZRA 3PTZA 1L0LD 2FYUD 5B5EE 5KKZB 1FS0E 1KILC 1FAVA 3L75G 3H1LD 1U57A 2E75C 2AXCA 2K1AA 1EZVG 2JO1A 2IDBA 1VPCA 1PGQA 2W6JH 3WU2E 4C7NB 3SSUA 1GL2C 1USDA 2QJYC 3BASA 3NXSA 1Q2NA 2W83C 1G1IA 2HFED 4GODA 2J58A 2WT7A 5AW3B 4H44C 1N73B 3H1HE 1LP1A 1KYOE 1NTME 1NAYA 3A2AA 3CWBE 1KYOI 3AEAC 1VQ6P 1SQVG 2FYNB 2JJLA 3H1KD 1QLED 3HUSC 1HGZA 2WSEJ 1EDLA 1A02F 5KLVJ 3OJAB 2E76C 1S5LX 2OARA 3RBXA 3B4SA 1YTZT 3CCSP 5AVUB 1QL1A 3CMEP 2KSJA 1ZN5A 3C8VA 1NTZG 5AW0B 3IN6A 3BRVB 3LIEA 4C46A 1AVOA 2H8PD 1FC2C 2GUSA 1S3JA 2NRGA 2K37A 2RKLA 1W2EA 1OWAA 3VP8A 3F5HA 2O1KA 1FJKA 2WSFJ 1LTTC 1NU1G 1KMIZ 3KYQA 1LTJA 4JYCA 1SQBD 1URQB 1IFMA 2ZYGA 1VF5B 5TISE 1SQPK 2E43A 3L70G 1L2PA 1S1CX 3KZIE 4K3AA 4WBAA 2WITA 3T97B 1M56D 4AYCA 4WWIA 1L0LJ 2FYUJ 2JEEA 1PL5A 1PGJA 3H1LJ 3QWOC 4D6TJ 3B5ND 3PLNA 1ZP0C 3USSA 2D2CB 1FDMA 3CWBG 4PJ0E 3RL0g 3GLMA 1LT9B 3RK3C 3RK2D 3HE5B 1YJNP 1MUUA 2KIKA 2WPRA 1PV3A 3HD7A 1S4XA 4YXWH 2N9BA 5L8RJ 1Q82Q 4HYTB 3HD7D 3TGUG 1ZRTE 2AEMA 5TISH 1IFJA 3RL0D 2IBZE 2NPSB 3GW6A 3G9RA 2IBZI 1SP4A 4KHXA 3GMAA 3GHGB 5KLIB 3WUUA 4N6JA 2N9YB 5KLVE 1OX3A 4NPEA 4L76A 1NKNA 4WVZA 1OIPA 3H1KJ 1GK6A 1SVFA 2C0XA 1LTJC 1N7SA 3V2PA 2YO2A 1NU1D 1YYCA 1X0TA 1P84E 4IOIH 4NPDA 4WY4A 4R4LA 2OYIA 2KZIA 1M1JA 3GG2A 1BSNA 3CPWO 3EQ2A 3A7OA 2E74B 2FFDA 4YXDC 1GU4A 2R3CA 5KJ7A 4OGQD 4PV1C 2Q3EA 1QGKB 3L75J 2I1JA 5KAFE 3CI9A 2OYHB 3P8MC 5BU5A 2A06E 4W7YA 1DIPA 3Q5RA 2WSEH 4XE5B 3W68A 1LTBC 3CC4P 3G3ZA 1SQBJ 1U7MA 3I5CA 1UIXA 1ZR4A 2FYUE 2FBWC 1OW6A 4U3FD 1VQ8P 3H1LE 3L74G 4D6TE 4AUWA 3PRJA 2RN0A 3WUVA 1KD1Q 3M0AA 1E79H 1P84H 3CXHD 5EFWB 5AW7B 1LJ2A 1WT6A 3TGUD 2H89C 1PPJG 1YBKA 3Q1MA 1K8AQ 1BCCE 1SQVJ 1ZV8A 1N7SC 3RGUA 4EIJA 4C7NA 2RH0A 3AE7C 1HTLC 1H0TA 5KAFH 4BRYA 2OTKE 2OQQA 3HTKA 2YMKA 4WY4C 5AW9B 3M9HA 3D71A 2OYIC 3CD6P 3L72D 1PFIA 2Q7CA 1J1DC 1ZMEC 2WSSH 1YITP 1N73A 2XU6A 4OWFA 2FFDC 1Q90D 1JY2O 1NTZJ 5KJ7C 3JC22 5AW8B 4EYYQ 3WUTA 1RQUA 3O8ZA 1NTKD 4IFDK 2HPCA 1KQSO 2QJPC 1NWQA 2FXPA 5GTIH 3H1ID 4OVNF 2A06G 5CCGA 1G2CB 3VTPC 1NOHA 5AVZB 1HUCA 1NU1J 1JY2N 1VQKP 3CX5E 4I7ZB 3M0DA 3CX5I 3H6PA 1L0LG 2FYUG 3NMDA 3ITKA 1YQ4C 3PJSK 1L4AB 2IFNA 3L70J 3L75E 4H13B 1SQXG 1VQ5P 2GA1A 3VN0A 4KJMA 1HJ0A 3CCRP 4KT0J 1RH5B 1SFCC 5KLVK 4IL6E 1S72P 3KHUA 3SFEC 3B8EB 2AEJA 1EZVI 3VYIA 1PPJD 2FXOA 4RESB 3AE9C 4LC1A 3A5TA 5DJTB 2B9BA 2KLVA 1URQA 2B89A 3AEEC 4AQRD 1VQPP 1FZBA 1R8EA 1H8AA 5K5GB 3EFFK 3VMZA 2O01J 1URQD 1RF0A 4QMAA 4U3FJ 1GK4A 2ZYAA 2P58A 2Z5HA 4CPGA 3G4SP 5APTA 2QM8A 3HRNA 2UWJE 3MIWA 1SQVE 3TGUJ 1AFOA 1K04A 3H1KG 4JPZB 2QJKB 2RMZA 4YTPC 2WPVB 5CCHA 3TNUB 2POHA 3S1KA 2D2CD 1L0NK 3SFDC 1DD3A 2L5GB 1IFPA 1KFNA 5CCGC 5CCHD 3GF7A 2O01N 4IL6H 5APXA 1CSBA 1LT9A 2NZ2A 2K9JB 4RKUJ 2V4HA 1QX8A 2N1TB 1UIIA 3O6QA 2M8RA 1NTZE 2B87A 3CCVP 1GW3A 3L71D 3BRTB 1EDKA 1FBMA 5CJ4A 2JWAA 1HGVA 1SQXD 1K05A 2YKOA 3L73D 3BCCD 2P1JA 1FZFA 3NFQA 3AE5C 1RF1A 2NPSD 4Z1MH 3V4WA 3A0BH 1N8RQ 1NTKJ 1NU1E 1S2EA 2PFXA 1JMMA 2YIUB 3P8CD 1FOSE 1SQBG 2CPSA 3H1IJ 1T2KD 1ZW0A 1VF5C 3A0HH 5B66E 3VMYA 2B88A 1S9KE 3L70E 2JWDA 1RF0C 2P10A 3VMAA 3D6YA 2ZT9C 4DZOA 3MD0A 3BATA 5AVYB 2C9LY 1NYHA 1DH3A 3L74J 3AEFC 3MP7B 2O1JA 2I8DA 1ZXGA 2KYVA 2E74D 4ZKPA 3PHLA 3S4RA 1KQGB 1FZEA 1MZ9A 2Y0DA 2W27A 3I56P 4H0LC 1EXIA 2HLOA 2VRSA 3HE4B 2QEXP 3KXDA 3MUDA 4BWNA 2WTYA 3S9OA 4DJGA 5BU8B 1GW4A 4DOJA 5AVRB 1GU5A 2MKVA 3CXHE 3BVHA 3TGUE 2AEFA 4IL6X 1FZCB 1AA0A 2G8YA 5B66H 1ZOYC 1NHLA 1OW8A 1YIJP 2W8ZA 1H88A 1BDDA 1RF1C 5AW6B 1KV4A 3IFMA 2HR3A 1YI2P 1M90Q 4N78E 1KILB 2BASA 5AW4B 2Q3IA 1CW5A 3JCUH 3G71P 4XFJA 2E75B 2I1KA 1ZR2A 2O01H 1JTHA 1VQMP 1FZGA 3B5NA 1T8ZA 1SQVK 1GL2B 5CBNA 2QJYB 1SQXJ 3TDKA 3CXHH 1DEBA 1RQVA 1K73Q 1J1EC 1SLQA 2M0BA 1SQPD 2QVAA 3M9QA 4JF7A 1PIXA 2YXRB 4H44B 5C39A 3MUDC 1LTAC 4U3FG 4Y99C 3H32A 2OGUA 1NTZK 1PP9D 3L74E 3V2NA 3HUSB 1SQQG 2P2UA 1NAFA 1CZQA 1OVVA 1NO4A 2A45H 2BCCD 1L4AD 2E76B 4H13D 3SWYA 1PPJE 2KNCA 3L4FA 1BGYD 1G1JA 4GT1A 1D7MA 2AXTH 3D70A 2HYNA 1LTSC 2W90A 1X22A 4EOTA 2FXMA 1QL2A 3MZWB 4HH2A 2Y9ZA 3L72G 2A45G 1P84I 1AQTA 4L73A 1KB9D 3V2RA 1AVYA 1VQLP 3B5NC 1NTMK 4A7PA 2IYPA 5APYA 4EDFA 1R5LA 3TYYA 2KOGA 3OW2O 1ZLLA 1KTMA 1NTKG 2HODA 1RE4A 2IZ0A 3FWNA 5AW5B 3H1IG 3H25A 1PGOA 3RK2C 2XKMA 3AEBC 1JY3P 3Q5PA 1HBWA 1L0LE 2R44A 2WSCH 3HD7C 1J2JB 4PD4D 1SQXE 1XTCC 1N2DC 2N1TD 3RL0C 1W2BO 1FOSF 2XDJA 1X8YA 3CCQP 1SQQD 1YJWP 2M5AB 1OVRA 2PAJA 5GTIE 3P8CE 3RK3B 5TJHA 1W5CE 1LNQA 2KK7A 4C7RA 4N3YB 1U7JA 2PRRA 3MHVA 1Q86Q 2R5BA 3SWKA 5KAIH 3Q5SA 2ZYDA 2QRXA 3PP5A 4L75A 1PP9J 4W80A 2IPPA 4B86A 1M1JC 4R4MA 2OTLP 4OGQC 3V6IA 1LTJB 1PZQA 2H43A 1M57D 4ZNCA 1QVFO 1JCDA 1DD4A 1Y47A 3H1KE 1RE4C 1BGYJ 4JBZA 4HB1A 2R3SA 5H2FE 2CK3H 3QH9A 4OH8B 1NGMB 3ZDMA 3KDPB 3AE1C 2Y9YA 5APVA 2H88C 4PV1B 2LXBA 3AE3C 1RE3A 1IC2A 1JOCA 1FZCA 3L71G 5KKZC 3TK1A 3L36A 1L0NG 3L73G 3A3YB 3BCCG 5AVWB 1CI6B 1VQOP 2E42A 1JMBA 1EQ7A 3RBZA 5APQA 4I1LA 3U59A 4TT3H 3E1RA 2Z4EA 3WMM0 2DW3A 3TSIA 1OMIA 2OTJP 1SQBE 4I6MC 1KQLA 3H1JG 3VMXA 4MN4C 3U1CA 1KILD 5H2FH 1ZRTD 2L91A 3VP9A 4I2LC 1AV1A 2KUBA 4K35A 3T97A 5KLVD 2E75D 1N73C 1AQ5A 1N7SB 3A0BE 1LT1A 1GL2A 1SQQJ 3R2PA 2FYNC 1GL2D 1MKMA 2IYOA 3A0HE 4WY4B 2OYIB 1K9MQ 2ZVNB 1LWUB 1J1DB 4EI2A 1Z56A 5GTHH 1IK9A 1PGPA 3FX0A 4NPFX 1PP9E 1OZHA 2FFDB 4H44D 1L0LK 2FYUK 5E79H 4TLFA 3HE5A 1RY3A 3M0DC 1SQXK 3HUSA 1FDOA 1JB0J 4ASWA 3L72J 1BE3D 2K9YA 2QJPB 3F89A 2Q6QA 2YKQA 5CBOA 1BGYE 3ABVC 2NPSA 2QE7H 1L0ND 3GHGA 2E76D 3AEDC 1YHQP 4JYBA 5APUA 4DT0A 1MFZA 3LW5J 4IFMA 2Q5UA 1N7LA 1BSHA 1GZLA 1DX7A 4D6TD 1URQC 5AVVB 3H1JD 1KB9E 1SFCB 1BDCA 1KB9I 4UB6H 2P67A 1OFCX 1MFTA 1IFIA 2ZXEB 1JCCA 1T3UA 2JDIH 1BCCD 5M1BA 2J5UA 1H0TB 4BRYB 1VL2A 3HTKB 1KFMA 2D2CC 3CC2P 4LGDE 1T3JA 3L35A 3PH0A 4O9BA 5CCHC 2OYHA 1SQPG 3JCUE 1XTGB 2KSEA 4UB8H 2YXQB 1EDJA 2C0WA 2KB7P 2KS1B 2J59M 3AE2C 1LT9C 4U3FE 2W6BA 1M8OB 4PD4E 2H7HA 1PP9G 3AE8C 2WSCJ 4PD4I 1HF9A 2ZVOB 3AEGC 3CLQA 5B5EH 3V2QA 1VQNP 1SQQE 4RJTA 2HPCB 2BCCG 2JKVA 3CXHI 3CCMP 1GMJA 1YJ9P 2NPSC 1KB9H 2M5AA 2WPSA
chains in the Genus database with same CATH topology
1TU3F 2O01J 4H13C 4TT3H 1PL5A 2E76D 3AEDC 3AEAC 3FGAD 1ZMEC 5KLIC 4U7JA 1OMIA 1KORA 2E74B 1ZP0C 2P10A 3Q2YA 3D6YA 4XFJA 2ZT9C 4YXDC 2E75B 1Q90D 2D2CB 4OGQD 4PV1C 1AJYA 3LW5J 3Q5SA 1Y9BA 2WSEJ 3D6ZA 1NYHA 3RK3E 4H0LD 3AEFC 2E76C 1YQ3C 3R4YA 1S5LX 1KILE 1K04A 1RQUA 4YTPC 4R4MA 3RL0g 2WPVB 3GLMA 1DIPA 2E74D 3Q5RA 2QJPC 2FXPA 2YIUC 4OGQC 1IK7A 1KQGB 2E75D 2D2CD 3B71A 3SFDC 1DD3A 1RQVA 1KTMA 1DD4A 3GF7A 1PV3A 4H0LC 1UIXA 3C8VA 2V7QJ 1EXIA 2FBWC 2NZ2A 2G3AA 4RKUJ 5L8RJ 1OW6A 3IN6A 1FDIA 5M1BA 1U57A 2J5UA 2FYNC 3Q3DA 1KQFB 1PIXA 2E74C 4H44B 1MKMA 4I7ZB 3H25A 1ZRTE 1VL2A 3S9OA 2E75C 2D2CC 3IAOA 1YQ4C 3O6QA 3G9RA 4H13B 2JO1A 1NGMB 3GMAA 2MKVA 3AEBC 1HJ0A 3AE1C 2IDBA 4KT0J 3Q5PA 3AE6C 2ZT9B 2H89C 2WQYC 4IL6X 2H88C 2WSFJ 2G8YA 2QJKC 4PV1B 1KMIZ 1ZOYC 1K05A 3AE2C 2QJYC 4H44D 3SFEC 3AE3C 3Q1MA 2JP3A 2QSIA 1OW8A 2BEQD 3AE5C 1VF5D 3AE8C 4Z1MH 2BEZF 2E76B 2WSCJ 4H13D 1VF5B 1WMKA 3EWKA 5KKZC 1HF9A 3AEGC 2QIWA 3AE4C 1FDOA 1JB0J 3AE7C 3AE9C 2K9YA 1EXJA 1S1CX 2ZT9D 4OGQB 3GF3A 4PV1D 3ABVC 2OQQA 4H44C 3T97B 4I7ZC 2YMKA 3AEEC 4R4LA 3D70A 1GMJA 1VF5C 3AECC 1R8EA 1OW7A 4H0LB 3D71A 4Y28J 4GDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSI A;  4H44 B;  2O01 J;  4I7Z B;  1ZRT E;  2WPV B;  5KLI C;  2E76 B;  2WSC J;  2QJP C;  1VF5 B;  5KKZ C;  2YIU C;  2E74 B;  2QIW A;  4H13 B;  1JB0 J;  2K9Y A;  2E75 B;  1Q90 D;  2D2C B;  3LW5 J;  4KT0 J;  2WSE J;  4OGQ B;  2ZT9 B;  3C8V A;  4IL6 X;  2WSF J;  4RKU J;  2QJK C;  4PV1 B;  5L8R J;  2QJY C;  2FYN C;  1S5L X;  4H0L B;  4Y28 J; 
#chains in the Genus database with same CATH topology
 1TU3 F;  1BGY G;  3FGA D;  3GHG C;  5KLI C;  2Q9I A;  4IFF A;  4HKZ H;  2FYZ A;  3WU2 H;  1N86 A;  2WMM A;  1T2K C;  1SQB K;  3G6E P;  1JM0 A;  1LTG C;  1MV8 A;  3RK3 D;  1VQ7 P;  5CHX A;  3CX5 D;  5BVZ A;  4GIF A;  1FZA A;  3R4Y A;  3FXE A;  3OA7 A;  4ZKU A;  3L75 D;  3L72 E;  1IK7 A;  4L74 A;  2A45 I;  4ZMD A;  3N7N A;  2QA4 P;  2GM4 A;  3TF5 A;  1KYO H;  1BE3 J;  4DCK A;  1EZV D;  3IR9 A;  5CJ0 A;  2AXT E;  4PD4 H;  5AVX B;  2E74 C;  1T6A A;  3L71 J;  2YO3 A;  1NTK E;  1Q7Y Q;  1L0N J;  3L73 J;  3BCC J;  5AVT B;  3H1I E;  2KZJ A;  2OYH C;  2E5Y A;  2ZT9 B;  4M3L A;  4GKG A;  1DEE G;  3CL3 D;  2JP3 A;  2PGD A;  1H89 A;  4BXL A;  1FU1 A;  1G2C A;  2BEQ D;  5DJU B;  1VQ4 P;  3H1H G;  2PP6 A;  2Y0C A;  1WMK A;  3EWK A;  1WRG A;  1NTM G;  3H1J J;  1A02 J;  2P7J A;  1EXJ A;  1IFD A;  2IZ1 A;  1NKZ B;  1LGH B;  1SQV D;  4PV1 D;  3II6 A;  2HG5 D;  1L4A A;  3CCU P;  3AEC C;  4H0L B;  4GDO A;  1CI6 A;  1BCC J;  3UIA A;  3Q2Y A;  2YNY A;  3W67 A;  1AJY A;  1HWT C;  1Y9B A;  1X9V A;  3D6Z A;  2QM7 A;  3O6Q B;  2WVR A;  1NU1 K;  2M3E A;  2B87 B;  2WZ7 A;  1YQ3 C;  2O3J A;  1KIL E;  1NTZ D;  3LW5 H;  2Z5I A;  1NH4 A;  3KZI H;  1HVV A;  1RF1 B;  2ITA A;  2V7Q J;  1IZN B;  3M9B A;  2G3A A;  1FDI A;  3Q3D A;  1KQF B;  1OXZ A;  3EFG A;  3M91 A;  2Q1K A;  4XA4 A;  2ZFC A;  1VQ9 P;  1N7S D;  2LR2 A;  2KP8 A;  3AE6 C;  5KAI E;  2K3R A;  1KN7 A;  3TNU A;  1IJD B;  4PJ0 H;  1LWU A;  2YMY A;  1S9K D;  3L70 D;  1JO5 A;  4HJG H;  3CCL P;  4WY4 D;  1KC8 Q;  2WT7 B;  2KI7 B;  3KPE A;  1HJB A;  1LP1 B;  1E5W A;  1OVU A;  2K9J A;  3CC7 P;  5AW1 B;  1GTW A;  4JQ0 D;  1BE3 E;  2KLU A;  3H1H D;  1SQQ K;  2N1T A;  2SPZ A;  4I7Z C;  1JNM A;  5KJ7 D;  1GD2 E;  2QG4 A;  1KYO D;  1NTM D;  3L71 E;  1J1E B;  4Y28 J;  3CWB D;  1L4A C;  4H13 C;  1L0N E;  3L73 E;  3BCC E;  4W7Z A;  1SS1 A;  3MTU E;  4RO0 A;  3C1L A;  4Y99 B;  1Y8A A;  2IX7 C;  1JY3 O;  3V4Q A;  3H1J E;  1LTI C;  1SQP J;  3K5B A;  2LKM A;  2LXC B;  2XND H;  1EC5 A;  2IBZ G;  1SFC A;  1IFN A;  1X79 B;  1EDI A;  2M3B A;  5KLV G;  1SFC D;  1GDT A;  2FY8 A;  1JY3 N;  2CPB A;  1JY2 P;  5APS A;  4ASV A;  3P32 A;  2WSF H;  2GUV A;  5KTB A;  2BCC J;  1NTK K;  2JR8 A;  2KXP B;  2ZJS E;  1HH0 A;  1M1K Q;  2WQY C;  4N78 D;  3MGN A;  1FJP A;  1RHZ B;  2QJK C;  1R5S A;  4GOF A;  5APW A;  1LWU C;  4GOE A;  1NJI Q;  1JTH B;  2QIW A;  2KS1 A;  3AE4 C;  3B5N B;  3P7K A;  3HE4 A;  3I55 P;  3GF3 A;  3M06 A;  2N1T C;  1OW7 A;  1BE3 G;  2YKP A;  2R5D A;  1NVO A;  2OYO A;  2WPQ A;  2XV5 A;  2XNX A;  5CMZ A;  4YPC A;  1M7L A;  2ZXX A;  1QEX A;  2MJZ A;  3RK2 B;  5GTH E;  3RK3 E;  5CCG D;  2Y0E A;  3IF4 A;  3FWL A;  3L37 A;  3H32 B;  1S5L E;  3HD7 B;  1Q81 Q;  5E79 E;  3RL0 B;  2YIU C;  3H1L G;  4D6T G;  2K88 A;  3B71 A;  3L74 D;  3N4X A;  1KIL A;  3CCJ P;  3CMA P;  5AW2 B;  1JEK A;  3LID A;  2KNC B;  3C9I A;  1EZV E;  4WB4 A;  3H1H J;  2WWW A;  2IBZ D;  1FE6 A;  3IAO A;  1NTM J;  2V7Q H;  3CWB J;  1QVG O;  1BCC G;  2E5T A;  3E7K A;  2ZAE B;  3OAK A;  1USE A;  2QSI A;  2FKW B;  1SQP E;  3SWF A;  1VF5 D;  2BEZ F;  3V5B A;  1P84 D;  5AVS B;  1M1J B;  2C9N Y;  4UB6 E;  2R32 A;  3JSV C;  5AVQ B;  2ZT9 D;  2IFM A;  4OGQ B;  3CX5 H;  2W6A A;  3KQG A;  1S5L H;  3VOP A;  2HOD B;  3U1A A;  2BCC E;  1RE3 C;  1IO4 A;  4U7J A;  3E1I A;  1KOR A;  3FXD A;  1FZC C;  4LLH A;  1JUN A;  4H0L D;  4UB8 E;  2A06 D;  1YTZ I;  3NTN A;  1VDF A;  3CCE P;  1KZU B;  2XZR A;  3PTZ A;  1L0L D;  2FYU D;  5B5E E;  5KKZ B;  1FS0 E;  1KIL C;  1FAV A;  3L75 G;  3H1L D;  1U57 A;  2E75 C;  2AXC A;  2K1A A;  1EZV G;  2JO1 A;  2IDB A;  1VPC A;  1PGQ A;  2W6J H;  3WU2 E;  4C7N B;  3SSU A;  1GL2 C;  1USD A;  2QJY C;  3BAS A;  3NXS A;  1Q2N A;  2W83 C;  1G1I A;  2HFE D;  4GOD A;  2J58 A;  2WT7 A;  5AW3 B;  4H44 C;  1N73 B;  3H1H E;  1LP1 A;  1KYO E;  1NTM E;  1NAY A;  3A2A A;  3CWB E;  1KYO I;  3AEA C;  1VQ6 P;  1SQV G;  2FYN B;  2JJL A;  3H1K D;  1QLE D;  3HUS C;  1HGZ A;  2WSE J;  1EDL A;  1A02 F;  5KLV J;  3OJA B;  2E76 C;  1S5L X;  2OAR A;  3RBX A;  3B4S A;  1YTZ T;  3CCS P;  5AVU B;  1QL1 A;  3CME P;  2KSJ A;  1ZN5 A;  3C8V A;  1NTZ G;  5AW0 B;  3IN6 A;  3BRV B;  3LIE A;  4C46 A;  1AVO A;  2H8P D;  1FC2 C;  2GUS A;  1S3J A;  2NRG A;  2K37 A;  2RKL A;  1W2E A;  1OWA A;  3VP8 A;  3F5H A;  2O1K A;  1FJK A;  2WSF J;  1LTT C;  1NU1 G;  1KMI Z;  3KYQ A;  1LTJ A;  4JYC A;  1SQB D;  1URQ B;  1IFM A;  2ZYG A;  1VF5 B;  5TIS E;  1SQP K;  2E43 A;  3L70 G;  1L2P A;  1S1C X;  3KZI E;  4K3A A;  4WBA A;  2WIT A;  3T97 B;  1M56 D;  4AYC A;  4WWI A;  1L0L J;  2FYU J;  2JEE A;  1PL5 A;  1PGJ A;  3H1L J;  3QWO C;  4D6T J;  3B5N D;  3PLN A;  1ZP0 C;  3USS A;  2D2C B;  1FDM A;  3CWB G;  4PJ0 E;  3RL0 g;  3GLM A;  1LT9 B;  3RK3 C;  3RK2 D;  3HE5 B;  1YJN P;  1MUU A;  2KIK A;  2WPR A;  1PV3 A;  3HD7 A;  1S4X A;  4YXW H;  2N9B A;  5L8R J;  1Q82 Q;  4HYT B;  3HD7 D;  3TGU G;  1ZRT E;  2AEM A;  5TIS H;  1IFJ A;  3RL0 D;  2IBZ E;  2NPS B;  3GW6 A;  3G9R A;  2IBZ I;  1SP4 A;  4KHX A;  3GMA A;  3GHG B;  5KLI B;  3WUU A;  4N6J A;  2N9Y B;  5KLV E;  1OX3 A;  4NPE A;  4L76 A;  1NKN A;  4WVZ A;  1OIP A;  3H1K J;  1GK6 A;  1SVF A;  2C0X A;  1LTJ C;  1N7S A;  3V2P A;  2YO2 A;  1NU1 D;  1YYC A;  1X0T A;  1P84 E;  4IOI H;  4NPD A;  4WY4 A;  4R4L A;  2OYI A;  2KZI A;  1M1J A;  3GG2 A;  1BSN A;  3CPW O;  3EQ2 A;  3A7O A;  2E74 B;  2FFD A;  4YXD C;  1GU4 A;  2R3C A;  5KJ7 A;  4OGQ D;  4PV1 C;  2Q3E A;  1QGK B;  3L75 J;  2I1J A;  5KAF E;  3CI9 A;  2OYH B;  3P8M C;  5BU5 A;  2A06 E;  4W7Y A;  1DIP A;  3Q5R A;  2WSE H;  4XE5 B;  3W68 A;  1LTB C;  3CC4 P;  3G3Z A;  1SQB J;  1U7M A;  3I5C A;  1UIX A;  1ZR4 A;  2FYU E;  2FBW C;  1OW6 A;  4U3F D;  1VQ8 P;  3H1L E;  3L74 G;  4D6T E;  4AUW A;  3PRJ A;  2RN0 A;  3WUV A;  1KD1 Q;  3M0A A;  1E79 H;  1P84 H;  3CXH D;  5EFW B;  5AW7 B;  1LJ2 A;  1WT6 A;  3TGU D;  2H89 C;  1PPJ G;  1YBK A;  3Q1M A;  1K8A Q;  1BCC E;  1SQV J;  1ZV8 A;  1N7S C;  3RGU A;  4EIJ A;  4C7N A;  2RH0 A;  3AE7 C;  1HTL C;  1H0T A;  5KAF H;  4BRY A;  2OTK E;  2OQQ A;  3HTK A;  2YMK A;  4WY4 C;  5AW9 B;  3M9H A;  3D71 A;  2OYI C;  3CD6 P;  3L72 D;  1PFI A;  2Q7C A;  1J1D C;  1ZME C;  2WSS H;  1YIT P;  1N73 A;  2XU6 A;  4OWF A;  2FFD C;  1Q90 D;  1JY2 O;  1NTZ J;  5KJ7 C;  3JC2 2;  5AW8 B;  4EYY Q;  3WUT A;  1RQU A;  3O8Z A;  1NTK D;  4IFD K;  2HPC A;  1KQS O;  2QJP C;  1NWQ A;  2FXP A;  5GTI H;  3H1I D;  4OVN F;  2A06 G;  5CCG A;  1G2C B;  3VTP C;  1NOH A;  5AVZ B;  1HUC A;  1NU1 J;  1JY2 N;  1VQK P;  3CX5 E;  4I7Z B;  3M0D A;  3CX5 I;  3H6P A;  1L0L G;  2FYU G;  3NMD A;  3ITK A;  1YQ4 C;  3PJS K;  1L4A B;  2IFN A;  3L70 J;  3L75 E;  4H13 B;  1SQX G;  1VQ5 P;  2GA1 A;  3VN0 A;  4KJM A;  1HJ0 A;  3CCR P;  4KT0 J;  1RH5 B;  1SFC C;  5KLV K;  4IL6 E;  1S72 P;  3KHU A;  3SFE C;  3B8E B;  2AEJ A;  1EZV I;  3VYI A;  1PPJ D;  2FXO A;  4RES B;  3AE9 C;  4LC1 A;  3A5T A;  5DJT B;  2B9B A;  2KLV A;  1URQ A;  2B89 A;  3AEE C;  4AQR D;  1VQP P;  1FZB A;  1R8E A;  1H8A A;  5K5G B;  3EFF K;  3VMZ A;  2O01 J;  1URQ D;  1RF0 A;  4QMA A;  4U3F J;  1GK4 A;  2ZYA A;  2P58 A;  2Z5H A;  4CPG A;  3G4S P;  5APT A;  2QM8 A;  3HRN A;  2UWJ E;  3MIW A;  1SQV E;  3TGU J;  1AFO A;  1K04 A;  3H1K G;  4JPZ B;  2QJK B;  2RMZ A;  4YTP C;  2WPV B;  5CCH A;  3TNU B;  2POH A;  3S1K A;  2D2C D;  1L0N K;  3SFD C;  1DD3 A;  2L5G B;  1IFP A;  1KFN A;  5CCG C;  5CCH D;  3GF7 A;  2O01 N;  4IL6 H;  5APX A;  1CSB A;  1LT9 A;  2NZ2 A;  2K9J B;  4RKU J;  2V4H A;  1QX8 A;  2N1T B;  1UII A;  3O6Q A;  2M8R A;  1NTZ E;  2B87 A;  3CCV P;  1GW3 A;  3L71 D;  3BRT B;  1EDK A;  1FBM A;  5CJ4 A;  2JWA A;  1HGV A;  1SQX D;  1K05 A;  2YKO A;  3L73 D;  3BCC D;  2P1J A;  1FZF A;  3NFQ A;  3AE5 C;  1RF1 A;  2NPS D;  4Z1M H;  3V4W A;  3A0B H;  1N8R Q;  1NTK J;  1NU1 E;  1S2E A;  2PFX A;  1JMM A;  2YIU B;  3P8C D;  1FOS E;  1SQB G;  2CPS A;  3H1I J;  1T2K D;  1ZW0 A;  1VF5 C;  3A0H H;  5B66 E;  3VMY A;  2B88 A;  1S9K E;  3L70 E;  2JWD A;  1RF0 C;  2P10 A;  3VMA A;  3D6Y A;  2ZT9 C;  4DZO A;  3MD0 A;  3BAT A;  5AVY B;  2C9L Y;  1NYH A;  1DH3 A;  3L74 J;  3AEF C;  3MP7 B;  2O1J A;  2I8D A;  1ZXG A;  2KYV A;  2E74 D;  4ZKP A;  3PHL A;  3S4R A;  1KQG B;  1FZE A;  1MZ9 A;  2Y0D A;  2W27 A;  3I56 P;  4H0L C;  1EXI A;  2HLO A;  2VRS A;  3HE4 B;  2QEX P;  3KXD A;  3MUD A;  4BWN A;  2WTY A;  3S9O A;  4DJG A;  5BU8 B;  1GW4 A;  4DOJ A;  5AVR B;  1GU5 A;  2MKV A;  3CXH E;  3BVH A;  3TGU E;  2AEF A;  4IL6 X;  1FZC B;  1AA0 A;  2G8Y A;  5B66 H;  1ZOY C;  1NHL A;  1OW8 A;  1YIJ P;  2W8Z A;  1H88 A;  1BDD A;  1RF1 C;  5AW6 B;  1KV4 A;  3IFM A;  2HR3 A;  1YI2 P;  1M90 Q;  4N78 E;  1KIL B;  2BAS A;  5AW4 B;  2Q3I A;  1CW5 A;  3JCU H;  3G71 P;  4XFJ A;  2E75 B;  2I1K A;  1ZR2 A;  2O01 H;  1JTH A;  1VQM P;  1FZG A;  3B5N A;  1T8Z A;  1SQV K;  1GL2 B;  5CBN A;  2QJY B;  1SQX J;  3TDK A;  3CXH H;  1DEB A;  1RQV A;  1K73 Q;  1J1E C;  1SLQ A;  2M0B A;  1SQP D;  2QVA A;  3M9Q A;  4JF7 A;  1PIX A;  2YXR B;  4H44 B;  5C39 A;  3MUD C;  1LTA C;  4U3F G;  4Y99 C;  3H32 A;  2OGU A;  1NTZ K;  1PP9 D;  3L74 E;  3V2N A;  3HUS B;  1SQQ G;  2P2U A;  1NAF A;  1CZQ A;  1OVV A;  1NO4 A;  2A45 H;  2BCC D;  1L4A D;  2E76 B;  4H13 D;  3SWY A;  1PPJ E;  2KNC A;  3L4F A;  1BGY D;  1G1J A;  4GT1 A;  1D7M A;  2AXT H;  3D70 A;  2HYN A;  1LTS C;  2W90 A;  1X22 A;  4EOT A;  2FXM A;  1QL2 A;  3MZW B;  4HH2 A;  2Y9Z A;  3L72 G;  2A45 G;  1P84 I;  1AQT A;  4L73 A;  1KB9 D;  3V2R A;  1AVY A;  1VQL P;  3B5N C;  1NTM K;  4A7P A;  2IYP A;  5APY A;  4EDF A;  1R5L A;  3TYY A;  2KOG A;  3OW2 O;  1ZLL A;  1KTM A;  1NTK G;  2HOD A;  1RE4 A;  2IZ0 A;  3FWN A;  5AW5 B;  3H1I G;  3H25 A;  1PGO A;  3RK2 C;  2XKM A;  3AEB C;  1JY3 P;  3Q5P A;  1HBW A;  1L0L E;  2R44 A;  2WSC H;  3HD7 C;  1J2J B;  4PD4 D;  1SQX E;  1XTC C;  1N2D C;  2N1T D;  3RL0 C;  1W2B O;  1FOS F;  2XDJ A;  1X8Y A;  3CCQ P;  1SQQ D;  1YJW P;  2M5A B;  1OVR A;  2PAJ A;  5GTI E;  3P8C E;  3RK3 B;  5TJH A;  1W5C E;  1LNQ A;  2KK7 A;  4C7R A;  4N3Y B;  1U7J A;  2PRR A;  3MHV A;  1Q86 Q;  2R5B A;  3SWK A;  5KAI H;  3Q5S A;  2ZYD A;  2QRX A;  3PP5 A;  4L75 A;  1PP9 J;  4W80 A;  2IPP A;  4B86 A;  1M1J C;  4R4M A;  2OTL P;  4OGQ C;  3V6I A;  1LTJ B;  1PZQ A;  2H43 A;  1M57 D;  4ZNC A;  1QVF O;  1JCD A;  1DD4 A;  1Y47 A;  3H1K E;  1RE4 C;  1BGY J;  4JBZ A;  4HB1 A;  2R3S A;  5H2F E;  2CK3 H;  3QH9 A;  4OH8 B;  1NGM B;  3ZDM A;  3KDP B;  3AE1 C;  2Y9Y A;  5APV A;  2H88 C;  4PV1 B;  2LXB A;  3AE3 C;  1RE3 A;  1IC2 A;  1JOC A;  1FZC A;  3L71 G;  5KKZ C;  3TK1 A;  3L36 A;  1L0N G;  3L73 G;  3A3Y B;  3BCC G;  5AVW B;  1CI6 B;  1VQO P;  2E42 A;  1JMB A;  1EQ7 A;  3RBZ A;  5APQ A;  4I1L A;  3U59 A;  4TT3 H;  3E1R A;  2Z4E A;  3WMM 0;  2DW3 A;  3TSI A;  1OMI A;  2OTJ P;  1SQB E;  4I6M C;  1KQL A;  3H1J G;  3VMX A;  4MN4 C;  3U1C A;  1KIL D;  5H2F H;  1ZRT D;  2L91 A;  3VP9 A;  4I2L C;  1AV1 A;  2KUB A;  4K35 A;  3T97 A;  5KLV D;  2E75 D;  1N73 C;  1AQ5 A;  1N7S B;  3A0B E;  1LT1 A;  1GL2 A;  1SQQ J;  3R2P A;  2FYN C;  1GL2 D;  1MKM A;  2IYO A;  3A0H E;  4WY4 B;  2OYI B;  1K9M Q;  2ZVN B;  1LWU B;  1J1D B;  4EI2 A;  1Z56 A;  5GTH H;  1IK9 A;  1PGP A;  3FX0 A;  4NPF X;  1PP9 E;  1OZH A;  2FFD B;  4H44 D;  1L0L K;  2FYU K;  5E79 H;  4TLF A;  3HE5 A;  1RY3 A;  3M0D C;  1SQX K;  3HUS A;  1FDO A;  1JB0 J;  4ASW A;  3L72 J;  1BE3 D;  2K9Y A;  2QJP B;  3F89 A;  2Q6Q A;  2YKQ A;  5CBO A;  1BGY E;  3ABV C;  2NPS A;  2QE7 H;  1L0N D;  3GHG A;  2E76 D;  3AED C;  1YHQ P;  4JYB A;  5APU A;  4DT0 A;  1MFZ A;  3LW5 J;  4IFM A;  2Q5U A;  1N7L A;  1BSH A;  1GZL A;  1DX7 A;  4D6T D;  1URQ C;  5AVV B;  3H1J D;  1KB9 E;  1SFC B;  1BDC A;  1KB9 I;  4UB6 H;  2P67 A;  1OFC X;  1MFT A;  1IFI A;  2ZXE B;  1JCC A;  1T3U A;  2JDI H;  1BCC D;  5M1B A;  2J5U A;  1H0T B;  4BRY B;  1VL2 A;  3HTK B;  1KFM A;  2D2C C;  3CC2 P;  4LGD E;  1T3J A;  3L35 A;  3PH0 A;  4O9B A;  5CCH C;  2OYH A;  1SQP G;  3JCU E;  1XTG B;  2KSE A;  4UB8 H;  2YXQ B;  1EDJ A;  2C0W A;  2KB7 P;  2KS1 B;  2J59 M;  3AE2 C;  1LT9 C;  4U3F E;  2W6B A;  1M8O B;  4PD4 E;  2H7H A;  1PP9 G;  3AE8 C;  2WSC J;  4PD4 I;  1HF9 A;  2ZVO B;  3AEG C;  3CLQ A;  5B5E H;  3V2Q A;  1VQN P;  1SQQ E;  4RJT A;  2HPC B;  2BCC G;  2JKV A;  3CXH I;  3CCM P;  1GMJ A;  1YJ9 P;  2NPS C;  1KB9 H;  2M5A A;  2WPS A; 
#chains in the Genus database with same CATH homology
 1TU3 F;  2O01 J;  4H13 C;  4TT3 H;  1PL5 A;  2E76 D;  3AED C;  3AEA C;  3FGA D;  1ZME C;  5KLI C;  4U7J A;  1OMI A;  1KOR A;  2E74 B;  1ZP0 C;  2P10 A;  3Q2Y A;  3D6Y A;  4XFJ A;  2ZT9 C;  4YXD C;  2E75 B;  1Q90 D;  2D2C B;  4OGQ D;  4PV1 C;  1AJY A;  3LW5 J;  3Q5S A;  1Y9B A;  2WSE J;  3D6Z A;  1NYH A;  3RK3 E;  4H0L D;  3AEF C;  2E76 C;  1YQ3 C;  3R4Y A;  1S5L X;  1KIL E;  1K04 A;  1RQU A;  4YTP C;  4R4M A;  3RL0 g;  2WPV B;  3GLM A;  1DIP A;  2E74 D;  3Q5R A;  2QJP C;  2FXP A;  2YIU C;  4OGQ C;  1IK7 A;  1KQG B;  2E75 D;  2D2C D;  3B71 A;  3SFD C;  1DD3 A;  1RQV A;  1KTM A;  1DD4 A;  3GF7 A;  1PV3 A;  4H0L C;  1UIX A;  3C8V A;  2V7Q J;  1EXI A;  2FBW C;  2NZ2 A;  2G3A A;  4RKU J;  5L8R J;  1OW6 A;  3IN6 A;  1FDI A;  5M1B A;  1U57 A;  2J5U A;  2FYN C;  3Q3D A;  1KQF B;  1PIX A;  2E74 C;  4H44 B;  1MKM A;  4I7Z B;  3H25 A;  1ZRT E;  1VL2 A;  3S9O A;  2E75 C;  2D2C C;  3IAO A;  1YQ4 C;  3O6Q A;  3G9R A;  4H13 B;  2JO1 A;  1NGM B;  3GMA A;  2MKV A;  3AEB C;  1HJ0 A;  3AE1 C;  2IDB A;  4KT0 J;  3Q5P A;  3AE6 C;  2ZT9 B;  2H89 C;  2WQY C;  4IL6 X;  2H88 C;  2WSF J;  2G8Y A;  2QJK C;  4PV1 B;  1KMI Z;  1ZOY C;  1K05 A;  3AE2 C;  2QJY C;  4H44 D;  3SFE C;  3AE3 C;  3Q1M A;  2JP3 A;  2QSI A;  1OW8 A;  2BEQ D;  3AE5 C;  1VF5 D;  3AE8 C;  4Z1M H;  2BEZ F;  2E76 B;  2WSC J;  4H13 D;  1VF5 B;  1WMK A;  3EWK A;  5KKZ C;  1HF9 A;  3AEG C;  2QIW A;  3AE4 C;  1FDO A;  1JB0 J;  3AE7 C;  3AE9 C;  2K9Y A;  1EXJ A;  1S1C X;  2ZT9 D;  4OGQ B;  3GF3 A;  4PV1 D;  3ABV C;  2OQQ A;  4H44 C;  3T97 B;  4I7Z C;  2YMK A;  3AEE C;  4R4L A;  3D70 A;  1GMJ A;  1VF5 C;  3AEC C;  1R8E A;  1OW7 A;  4H0L B;  3D71 A;  4Y28 J;  4GDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...