2M8RA

Pre-fusion solution nmr structure of neuronal snare syntaxin 1a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
109
structure length
109
Chain Sequence
b'GSHMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Syntaxin-1A
publication title Prefusion structure of syntaxin-1A suggests pathway for folding into neuronal trans-SNARE complex fusion intermediate.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 29
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05739 SNARE SNARE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2m8rA00
1XTGB 3RK3C 3KYQA 2N1TD 1SFCD 3HD7A 1HVVA 1KILA 4LGDE 4W7ZA 2NPSB 2H8PD 5CCHD 1URQB 1N7SB 3TSIA 2WZ7A 4WY4D 3HTKB 2PP6A 5KJ7D 1KILB 1L4AA 2N1TC 1SFCC 3RK2B 3B5NC 5CCHC 5CCGD 1L4AB 4WY4C 5KJ7C 1GL2B 4N78E 3RK3B 3B5ND 3M0DC 1N7SD 2M8RA 2N1TA 1SFCA 3P8CE 5CCGC 2HFED 3HD7B 3VOPA 1KILD 5CCHA 3RL0B 3RK2D 4WY4A 5KJ7A 1NHLA 1JTHA 1N7SC 4OH8B 1L4AD 1GL2D 1KILC 2XDJA 2NPSD 4WY4B 3RK2C 5CCGA 1JTHB 1URQD 3HD7D 1L4AC 3B5NA 1GL2C 3RL0D 1N7SA 4W80A 2NPSC 2N1TB 1SFCB 1URQC 1T3JA 3B5NB 3HD7C 3RL0C 3RK3D 2KOGA 4W7YA 3PP5A 1GL2A 4JF7A 2YMYA 2NPSA 2HG5D 1URQA
chains in the Genus database with same CATH superfamily
4YPCA 1GU5A 1FZCA 5AW8B 1SFCD 1HJBA 4H0LC 1BDDA 2QJKC 4RESB 2QJPB 2XNDH 2ZT9B 2NPSB 4IFFA 1KTMA 3GHGC 1SQXE 1URQB 1N8RQ 1LTIC 2IBZG 2KK7A 1KB9E 1GK4A 2KI7B 3PRJA 4RO0A 2E75C 2P67A 3L71D 3TGUD 2KZIA 1JOCA 1VQ6P 3BCCE 1YIJP 1AJYA 3VP9A 1S5LH 1FDIA 1SFCA 3USSA 2Y9ZA 2O01J 3VMYA 2W6AA 1EXIA 4TLFA 3OAKA 2IFMA 1IK9A 4IL6E 4IFDK 1RF0C 1BSNA 3L70J 5CBOA 1KD1Q 3CCLP 5AW6B 1PGQA 1GTWA 5AVXB 3CXHE 1LNQA 1Q7YQ 3H1LE 1SQVD 2HODB 1HUCA 1EDJA 3I5CA 3WUUA 1BE3D 5M1BA 3Q5PA 3CL3D 1M56D 3MUDA 2YNYA 1DD4A 2M3EA 4NPEA 1LTGC 3C8VA 3RK3D 4YXDC 4W7YA 1NU1G 3O8ZA 4H13D 1LTJB 1N73A 4ZKPA 1HWTC 2PAJA 3H1HG 2FXPA 1HVVA 4H44D 3L4FA 5KLVG 1FAVA 2OYIC 3L75G 1VQ7P 1L0NG 1LWUB 3AECC 1KILB 1PP9G 1SQXK 3TGUE 2H88C 1WMKA 1S1CX 1Y8AA 5CCGD 2M3BA 4WB4A 2XZRA 2RMZA 1EZVG 1BSHA 3V5BA 1LT9B 2KSJA 1JB0J 1OVVA 1YITP 1LP1A 4IL6H 5AW7B 1FJKA 1IFDA 1RHZB 1AFOA 3RK2D 3VYIA 2QJPC 2PFXA 3CXHH 4I1LA 2CPBA 1SQVE 3AE9C 3OA7A 2DW3A 1GL2D 3M0DA 3F89A 2E76C 3AEGC 5CCGA 2QEXP 3CLQA 4Y28J 2I8DA 1MV8A 3D71A 1VQNP 1K8AQ 1SQXJ 4JYBA 4U7JA 2WMMA 3PLNA 2A45H 2KS1B 2OTKE 1QVFO 3RK3E 3H1JD 5DJTB 1EDKA 1VQ9P 2OYOA 5L8RJ 3HE5B 2ITAA 1R5LA 2QG4A 1JY3N 3KDPB 1GL2A 3U1AA 5BVZA 2FFDA 3BASA 1NKZB 3G6EP 1A02J 4GDOA 1IO4A 2FYZA 1S5LX 1DIPA 1N7SB 2PGDA 2K1AA 4GKGA 2ZVOB 3A2AA 1DD3A 2KP8A 4U3FD 4C7NB 2LXCB 5CJ4A 3L70G 3ZDMA 3TDKA 2YKQA 3VP8A 3EWKA 1X22A 3B5ND 3NTNA 2M8RA 1LTJC 1KMIZ 3G4SP 2OQQA 1SQPD 4C46A 2JKVA 1S9KD 5AW1B 3D6ZA 1GW3A 4OH8B 1IC2A 4GIFA 2ZYDA 3Q3DA 1KILC 3D6YA 4KJMA 4WY4B 4DT0A 4AQRD 1AA0A 3KQGA 1SQVK 3B5NA 1FE6A 3VN0A 1NKNA 5AW4B 1BDCA 4L75A 3E1RA 4WVZA 3CC2P 2K3RA 1LT9C 1PPJG 1R8EA 5KKZB 3L71J 2C0XA 3TGUJ 3VMXA 2WVRA 1T2KD 4DCKA 1RE4A 1WT6A 3PP5A 1JEKA 1OVUA 3HUSA 4GODA 3VMAA 2OYHA 3FWLA 1H88A 1QVGO 1XTGB 3IFMA 1AV1A 3HTKA 2N1TD 1HBWA 4W7ZA 4UB6E 1FS0E 4IL6X 4U3FE 1G1IA 2I1KA 2WZ7A 2P7JA 2PP6A 1SQVJ 1L4AA 1ZP0C 1BE3J 4HH2A 1S2EA 3A0HE 1R5SA 5DJUB 2Q3IA 3L73D 2XV5A 1SQPE 3CC4P 3CCVP 4PD4I 1SQXG 1S9KE 2YIUB 1IJDB 2N1TA 1LTSC 1P84I 3WU2E 1RQUA 3P8CD 1N7SC 3SWYA 4M3LA 3CX5D 1EC5A 2B88A 2QM7A 2K9JA 1KC8Q 4PJ0E 5APUA 1M1JA 3SSUA 1D7MA 5APYA 4H0LD 4OVNF 2Y9YA 4N6JA 2KLVA 3P8MC 3HRNA 1VQMP 1YJNP 2FYNB 3A0HH 4MN4C 1J2JB 3H1KD 2E75D 2A45G 3L73E 3QH9A 1YTZI 1JUNA 1YYCA 2WQYC 1KFMA 5KKZC 1OX3A 3Q5SA 1BGYD 3H1JJ 1JCDA 3WUVA 2JWAA 3M06A 3SWFA 2JJLA 4IFMA 4GT1A 3P8CE 2QIWA 1RF1B 2L5GB 1GMJA 2WPSA 1SQPK 3V6IA 3CX5E 3EFGA 1PGOA 1YHQP 4HJGH 1QLED 4Y99C 3L71G 3TGUG 4ZMDA 4IOIH 3A7OA 1CSBA 4EIJA 1JTHA 1QL2A 1OW8A 2IBZI 1KB9D 1VF5B 5AVSB 1FJPA 3H32A 3KXDA 3AEFC 3P32A 5H2FH 3CMAP 3O6QA 2D2CD 4U3FJ 3AE2C 3BCCD 2FXMA 3MZWB 4W80A 1W5CE 1Q2NA 3GF7A 2GM4A 2YIUC 1J1DC 1RF0A 1M57D 3G71P 1SQVG 1E79H 3SWKA 3MGNA 1FU1A 1BE3G 2Q6QA 1J1EB 4XE5B 3W67A 1SQPJ 2YO3A 5APSA 2W90A 2W83C 1M90Q 3H1LD 4LGDE 3AE5C 3AE7C 5AW9B 1TU3F 2E42A 1JY2O 1NTMD 1JO5A 5AVQB 1FZCB 1BGYE 2FBWC 3OW2O 3SFDC 1PFIA 1G2CA 3AE8C 1H0TB 2ZFCA 3IF4A 2OYIA 3CX5H 2Z5IA 2XKMA 2HLOA 3H1ID 2IYPA 1ZR2A 2E76D 2IZ0A 3JCUE 4RKUJ 3T97B 2FYNC 2WT7A 2WITA 5AW3B 1K9MQ 4XA4A 1JY2N 1X9VA 4PV1C 5APTA 1EZVI 3L73J 3WMM0 2HR3A 1Y9BA 2AEFA 2M5AA 3V2NA 1YQ4C 1KQGB 1KYOI 1S72P 1AQTA 3HE4A 3H1JG 4GOEA 4N3YB 3R2PA 4DZOA 1NTME 2B87A 5GTIE 1M8OB 1OW6A 2H8PD 4OGQC 1N73B 2ZVNB 4EYYQ 3L74E 3CPWO 3CWBD 2J5UA 1U57A 3R4YA 1T3UA 1OFCX 5GTHE 4DJGA 3H1IE 2HODA 1KQSO 1J1EC 1KB9H 2B9BA 3RK3B 2UWJE 3JCUH 1Y47A 2KXPB 4U3FG 2MJZA 1YBKA 4I7ZB 3HD7B 2QVAA 4ASVA 1KILD 2Y0CA 4H13B 3CCMP 1NAFA 2YO2A 4H44B 4RJTA 3Q5RA 1FZCC 4WBAA 1JY3O 1RE3C 1IFJA 5E79E 3AE6C 1SQPG 1LTJA 3CMEP 2QSIA 3H1KJ 3L36A 1UIXA 1FZBA 3QWOC 2ZAEB 3N4XA 2C0WA 3NMDA 3CC7P 3RBZA 1G1JA 1DH3A 1SVFA 2ZT9C 2NPSC 1BGYJ 3FXDA 2OTLP 1URQC 1T6AA 2FKWB 4D6TD 5GTIH 3M9QA 1FZFA 5B5EE 4LLHA 1NOHA 2XNXA 4JF7A 1BCCD 3AEBC 2ZYGA 3CCRP 1NGMB 5KAIE 3M0AA 1W2EA 1DEBA 2I1JA 2P2UA 3S4RA 2FFDB 3CWBE 1NTMK 2WSSH 3L35A 5GTHH 5B66E 3AE1C 3BCCJ 1X0TA 1KILE 2QJYB 1FBMA 2H7HA 1GK6A 1N7SD 1Q86Q 1M1KQ 4BWNA 1RH5B 3L73G 3D70A 3RL0B 2RKLA 1Q82Q 3VMZA 2A06D 1FDOA 1N73C 3H1LJ 1N86A 1OMIA 1Q90D 1NTMJ 2IBZE 1PL5A 3C1LA 2O1KA 1E5WA 4D6TE 3B4SA 1N7SA 3PJSK 5B5EH 2B89A 3JC22 5APQA 3B5NB 1BCCE 1LWUC 4I7ZC 3HD7C 4AYCA 4C7NA 2G3AA 3IN6A 3H1IJ 4EDFA 3ITKA 2J58A 2RH0A 2IPPA 5BU8B 3RBXA 2R32A 2KNCB 1X8YA 2HG5D 3GW6A 3K5BA 2OYHB 3MD0A 3M9BA 1NTZD 1VQ8P 3HTKB 2K9YA 3CCJP 2JO1A 1S3JA 1FZEA 1PV3A 1ZW0A 2R5BA 2ZJSE 2QA4P 5KAFE 2V4HA 1L4AB 2IDBA 3H1KG 3W68A 4N78E 1SQBD 1HH0A 2A06E 1BGYG 1U7JA 3PTZA 4OWFA 5CMZA 4NPDA 2BCCD 2FFDC 5KLVE 2A45I 2G8YA 2XDJA 2O01N 1ZRTE 3TK1A 2Q1KA 5K5GB 1HF9A 3U59A 3CWBJ 1EDIA 2N9YB 3TNUB 1QGKB 2K9JB 3V4QA 2W27A 2E74D 3RL0C 1YQ3C 3C9IA 3BCCG 4I2LC 3GMAA 1IK7A 2HPCB 2ZXXA 1NTZE 2H89C 4LC1A 3M91A 1DEEG 2GUSA 2Q9IA 5KAFH 3BATA 2PRRA 1MKMA 2KIKA 1SQBE 4UB6H 3H1LG 3AEDC 4XFJA 3B5NC 5CCHC 3NFQA 1NTMG 4WY4C 1OW7A 4D6TJ 3FGAD 1T8ZA 2XU6A 1UIIA 2BCCE 2QJKB 3KPEA 5AVVB 1OZHA 3VOPA 3E1IA 1BCCJ 5AW0B 1JY3P 3E7KA 4L76A 2QM8A 3P7KA 2WPRA 3GHGA 4PV1D 3H1IG 2GUVA 3WU2H 3VTPC 1ZR4A 1JTHB 5KLVK 5AVYB 1OVRA 1L4AC 3H32B 4I6MC 1NTKD 1KORA 2WSEH 5APVA 3PH0A 3L37A 3O6QB 2V7QH 2WWWA 4JYCA 2Y0DA 4PJ0H 1ZXGA 4ZNCA 1X79B 1KN7A 1KQFB 4OGQD 3M9HA 3I56P 3LW5H 1LGHB 5AVTB 1RY3A 2WSFH 1MFZA 1CI6A 1CW5A 1ZLLA 2C9LY 3LIEA 1NTZK 1OWAA 2D2CB 2AXTE 2OTJP 3AEAC 3BRTB 1L2PA 5EFWB 1SQBK 4GOFA 2KYVA 1G2CB 3CWBG 1FZGA 1ZMEC 1JMBA 1L0LD 1IFIA 2O01H 5CBNA 3L72D 3H6PA 2WSEJ 1ZOYC 3Q2YA 3L74D 2V7QJ 2WPQA 1GW4A 2ZT9D 2NPSD 1NTZJ 2NZ2A 1URQD 1NTKE 1VQLP 3A0BE 4O9BA 2WT7B 3B8EB 2IYOA 3LW5J 4KT0J 3RL0g 2AEMA 1LTTC 2WSFJ 1SFCB 1RE3A 4BRYA 1SQBJ 4PD4D 4Z1MH 1MZ9A 4TT3H 2FYUD 1NYHA 2C9NY 1H0TA 2E43A 4K3AA 1P84D 2E76B 2JWDA 2M0BA 3TF5A 2M5AB 1ZV8A 1VQKP 2NPSA 1USDA 2BCCJ 2KSEA 4D6TG 1URQA 1MUUA 2E5YA 3HE4B 2AXTH 1YJWP 3CCUP 1RF1C 2B87B 1BCCG 3T97A 3G9RA 3TSIA 1HGVA 2CK3H 5CJ0A 2W8ZA 4JBZA 2POHA 3AE3C 2AEJA 1VF5C 3U1CA 5KJ7C 1L0LE 1RQVA 2O1JA 1MFTA 1PIXA 3L72E 2Y0EA 3II6A 5TISE 2R3CA 3GG2A 4ZKUA 1KFNA 2OARA 3A0BH 3EFFK 2D2CC 1GU4A 2Q7CA 3GLMA 1SQQD 3V4WA 1NO4A 2A06G 3CCEP 4PD4E 3HD7D 1LTAC 1NTKK 1LP1B 2FYUE 1P84E 1T3JA 2VRSA 2R44A 2QRXA 5AVRB 2FXOA 4L73A 2ZXEB 3L71E 3FX0A 2LKMA 2IBZD 2H43A 1LWUA 1NVOA 2JEEA 1KILA 3HD7A 4L74A 1WRGA 5APXA 3CX5I 1SLQA 4YTPC 2P10A 3BRVB 2RN0A 1SFCC 3RK2B 4C7RA 1NTKJ 2MKVA 1K05A 1LT9A 1VQ5P 1NTZG 1YI2P 1GL2B 5TISH 2P58A 1BE3E 2Z4EA 3G3ZA 2JP3A 3KZIE 1QX8A 1L0LK 2Q5UA 2WSCH 1FZAA 3V2QA 1SQBG 4DOJA 3AE4C 2YMKA 2KLUA 1SQQE 2IX7C 4PD4H 3MUDC 1AVOA 3IAOA 3MIWA 2YKOA 2KS1A 3PHLA 2BCCG 1P84H 1CZQA 5BU5A 1GDTA 3SFEC 4N78D 4HYTB 3EQ2A 5E79H 1NU1D 3RL0D 2ZYAA 3AEEC 3HE5A 3RGUA 3ABVC 2YXQB 3LIDA 4EOTA 2FYUK 3H1HD 3CD6P 1L0LJ 1JNMA 5KLVD 3L75D 2KUBA 5AVWB 1SP4A 1L0ND 2KB7P 1FOSF 3L72J 1VQPP 2QE7H 1ZRTD 3RK3C 1PP9D 3L74J 1QL1A 4WWIA 1PGJA 1HTLC 2KZJA 5CCHD 5KAIH 4H13C 3N7NA 1KB9I 4WY4D 4JPZB 1EZVD 2WSCJ 4H44C 1VDFA 2IFNA 1JY2P 3KZIH 5KTBA 1N7LA 5B66H 2LXBA 1KYOD 3HUSB 3MTUE 3OJAB 1KQLA 2SPZA 4UB8E 3M0DC 2FYUJ 3H1JE 5CCGC 5CCHA 2NRGA 1IFPA 1K04A 1JCCA 3GF3A 4JQ0D 4WY4A 2E5TA 1NHLA 3IR9A 2LR2A 2WTYA 4NPFX 1L4AD 1YJ9P 3CXHI 3FWNA 2KNCA 5AVUB 1NU1E 3RK2C 1USEA 1SQQK 3JSVC 4R4LA 1GL2C 3A3YB 2YXRB 5C39A 2N1TB 3H1HE 4Y99B 1H8AA 2HYNA 3MHVA 3L75E 2R5DA 1L0NE 1M7LA 5AW5B 1PP9E 2OGUA 2W6JH 1NTKG 1DX7A 1K73Q 2BEQD 2K88A 1LTBC 1IFNA 2QJYC 3KYQA 1YTZT 1EZVE 3NXSA 1FDMA 1PZQA 3L70D 1J1DB 2N9BA 1ZN5A 1VQOP 1SQQJ 1IZNB 1H89A 1M1JB 1KYOE 5CHXA 3CI9A 5KLIB 1U7MA 1VL2A 3I55P 4UB8H 4K35A 1S4XA 2E74B 1SS1A 3TNUA 1HGZA 2Q3EA 4HB1A 2HFED 1FC2C 5TJHA 2YKPA 4HKZH 2P1JA 3CCSP 3V2RA 2BEZF 5H2FE 3F5HA 4ASWA 1NH4A 1L0LG 1EDLA 3FXEA 2HPCA 3A5TA 4H0LB 1PPJD 4YXWH 3L72G 4BXLA 3GHGB 1RE4C 4B86A 1A02F 1FOSE 3L74G 1NU1K 3HUSC 4AUWA 3BVHA 2GA1A 2OYHC 5APWA 4CPGA 3S9OA 1NJIQ 1IFMA 2E75B 1PGPA 2JDIH 1Z56A 2YMYA 1L0NK 2J59M 2FY8A 2CPSA 3L70E 1T2KC 4R4MA 4PV1B 2K37A 1OXZA 2AXCA 1KYOH 2FYUG 5AW2B 3MP7B 3WUTA 1VF5D 2W6BA 3H25A 5KJ7D 1CI6B 1Q81Q 2N1TC 1JM0A 1SQXD 1NAYA 1NU1J 1LT1A 3B71A 4A7PA 1RF1A 1KV4A 1EQ7A 3H1HJ 1GZLA 4OGQB 5KLVJ 3L75J 1L0NJ 4KHXA 1KZUB 3TYYA 5KJ7A 1PP9J 1PPJE 1S5LE 1N2DC 1AVYA 3V2PA 1M1JC 2IZ1A 2O3JA 2Z5HA 3KHUA 3S1KA 5KLIC 1VQ4P 1HJ0A 2OYIB 3UIAA 2E74C 1W2BO 1GD2E 3CXHD 3H1KE 1LJ2A 4QMAA 4EI2A 1NWQA 1AQ5A 1SQQG 1OIPA 2R3SA 3CCQP 2BASA 5AVZB 2KOGA 2WPVB 1XTCC 4BRYB 2L91A 1VPCA 3Q1MA 1JMMA 1QEXA 1EXJA 2JR8A
chains in the Genus database with same CATH topology
1GU5A 2H43A 1FZCA 3HRNA 5AW8B 1LWUA 1SFCD 1HJBA 2JEEA 1KILA 3HD7A 4RESB 2NPSB 2OYHB 3MD0A 4IFFA 3GHGC 1WRGA 1URQB 3M9BA 5APXA 1J2JB 1SLQA 1LTIC 3HTKB 2A45G 3BRVB 1SFCC 3RK2B 1YTZI 1JUNA 1YYCA 1KFMA 1FZEA 1GK4A 2R5BA 4C7RA 1LT9A 1JCDA 1L4AB 1GL2B 4N78E 2P67A 3M06A 1JOCA 3SWFA 2Z4EA 2JJLA 1HH0A 3G3ZA 3VP9A 4IFMA 4GT1A 1SFCA 3P8CE 1L0LK 1RF1B 2L5GB 2WPSA 1SQPK 2Q5UA 2WSCH 3EFGA 1FZAA 3V2QA 5CMZA 3VMYA 4Y99C 2W6AA 4DOJA 2FFDC 3OAKA 3A7OA 1CSBA 4EIJA 1JTHA 2IFMA 1QL2A 1IK9A 2IX7C 2A45I 5AVSB 4IFDK 1FJPA 3H32A 1RF0C 2XDJA 3MIWA 5AW6B 3TK1A 1GTWA 2YKOA 5AVXB 3P32A 1CZQA 3U59A 2HODB 1HUCA 3I5CA 5BU5A 1GDTA 4N78D 4HYTB 3TNUB 3EQ2A 3RL0D 3CL3D 3HE5A 2FXMA 4W80A 3V4QA 3MUDA 2GM4A 1J1DC 1RF0A 2YNYA 1LTGC 2W27A 3LIDA 4EOTA 3MGNA 1FU1A 3RK3D 3RL0C 3C9IA 2FYUK 4W7YA 1J1EB 1JNMA 4XE5B 4I2LC 2YO3A 1FOSF 5AVWB 1SP4A 2KB7P 3O8ZA 1LTJB 2HPCB 1N73A 5APSA 4ZKPA 3RK3C 1HWTC 2PAJA 4LC1A 1QL1A 3M91A 1HVVA 4LGDE 1HTLC 3L4FA 5AW9B 5CCHD 1FAVA 2OYIC 2E42A 1JY2O 2GUSA 2Q9IA 1JO5A 5AVQB 3N7NA 1FZCB 4WY4D 3BATA 1LWUB 1KILB 1SQXK 1VDFA 3B5NC 5CCHC 3NFQA 1PFIA 2IFNA 1JY2P 5CCGD 1G2CA 5KTBA 1N7LA 2M3BA 4WY4C 2ZFCA 3HUSB 2OYIA 1T8ZA 3MTUE 2XU6A 4WB4A 2Z5IA 2XZRA 2XKMA 3OJAB 1KQLA 3V5BA 1LT9B 2HLOA 2KSJA 3KPEA 3M0DC 5CCGC 5AVVB 5AW7B 1FJKA 1IFDA 3VOPA 3E1IA 5CCHA 5AW0B 1ZR2A 1JY3P 1AFOA 3RK2D 3VYIA 1JCCA 4WY4A 4I1LA 1NHLA 2QM8A 3P7KA 2CPBA 3IR9A 2WPRA 2WTYA 1L4AD 3GHGA 2WT7A 3OA7A 1GL2D 3M0DA 2GUVA 2WITA 5AVUB 5AW3B 3RK2C 5CCGA 3CLQA 3VTPC 1ZR4A 1JTHB 5KLVK 1SQQK 1MV8A 4XA4A 1JY2N 5AVYB 1X9VA 1L4AC 3H32B 4JYBA 5APTA 1GL2C 3A3YB 2A45H 4I6MC 2N1TB 2WSEH 5APVA 3WMM0 4Y99B 3L37A 1H8AA 2WWWA 4JYCA 2HYNA 3V2NA 2R5DA 1M7LA 3HE5B 1X79B 5AW5B 1JY3N 3HE4A 3KDPB 1GL2A 3U1AA 5BVZA 1DX7A 3M9HA 2FFDA 4N3YB 3R2PA 3LW5H 4DZOA 1LTBC 1IFNA 3BASA 1LGHB 5AVTB 1RY3A 1NKZB 2WSFH 1A02J 1IO4A 3KYQA 1MFZA 1CI6A 1CW5A 1YTZT 1ZLLA 2C9LY 2H8PD 2FYZA 3LIEA 3NXSA 1FDMA 1NTZK 1N7SB 1N73B 1J1DB 2N9BA 1OWAA 1ZN5A 4GKGA 1H89A 1M1JB 5CHXA 3CI9A 3A2AA 2KP8A 1T3UA 4C7NB 5CJ4A 3BRTB 2YKQA 2HODA 3VP8A 1SQBK 1J1EC 3RK3B 3TNUA 1HGZA 3B5ND 2KYVA 3NTNA 1G2CB 1FZGA 2M8RA 2MJZA 1LTJC 2HFED 3HD7B 1IFIA 2O01H 1KILD 1NAFA 4C46A 2YO2A 2YKPA 1S9KD 2P1JA 3H6PA 3V2RA 5AW1B 1GW3A 4OH8B 1IC2A 1FZCC 4WBAA 4GIFA 1NH4A 2WPQA 1GW4A 1JY3O 1KILC 1RE3C 1IFJA 2NPSD 4WY4B 1LTJA 2HPCA 4AQRD 3A5TA 3L36A 1URQD 1FZBA 3KQGA 1SQVK 4O9BA 3GHGB 2WT7B 1RE4C 3B8EB 4B86A 1A02F 1FOSE 3B5NA 3N4XA 2C0WA 1NU1K 3NMDA 3HUSC 3VN0A 1NKNA 3BVHA 1G1JA 1DH3A 1SVFA 5AW4B 1LTTC 4AUWA 2NPSC 2OYHC 5APWA 1SFCB 1URQC 1RE3A 1LT9C 2FKWB 2C0XA 3VMXA 1MZ9A 1T2KD 3M9QA 1FZFA 1IFMA 1RE4A 1WT6A 3PP5A 2C9NY 4LLHA 2E43A 1NOHA 2XNXA 1ZV8A 3HUSA 1Z56A 4JF7A 2YMYA 1L0NK 2J59M 2NPSA 2OYHA 2CPSA 1URQA 1MUUA 1H88A 3M0AA 1T2KC 1W2EA 3HE4B 1XTGB 1DEBA 2I1JA 3IFMA 2P2UA 3HTKA 1OXZA 2N1TD 1HBWA 5AW2B 4W7ZA 2FFDB 1RF1C 1NTMK 2W6BA 1G1IA 3T97A 2I1KA 2WZ7A 2P7JA 3TSIA 3L35A 1HGVA 5CJ0A 2PP6A 1CI6B 5KJ7D 1L4AA 2N1TC 4HH2A 2POHA 2Q3IA 2XV5A 3U1CA 5KJ7C 1RF1A 2O1JA 1FBMA 1EQ7A 1S9KE 2H7HA 1IJDB 1GK6A 1N7SD 1GZLA 1LTSC 2N1TA 3II6A 3RL0B 2R3CA 4KHXA 4ZKUA 1KZUB 1KFNA 3TYYA 3VMZA 5KJ7A 2OARA 3P8CD 1N2DC 1N73C 1N7SC 3SWYA 1N86A 4M3LA 3V2PA 1M1JC 1GU4A 2Q7CA 2Z5HA 2O1KA 2QM7A 1E5WA 3V4WA 1NO4A 2OYIB 3HD7D 3UIAA 1GD2E 1N7SA 1LTAC 1NTKK 5APUA 1M1JA 1T3JA 1NWQA 1AQ5A 5APQA 3B5NB 2VRSA 5AVRB 1LWUC 3HD7C 4AYCA 2BASA 5APYA 5AVZB 4C7NA 2KOGA 1XTCC 2ZXEB 1VPCA 2J58A 4N6JA 1JMMA 2IPPA 5BU8B 2R32A 1X8YA 2LKMA 2HG5D 2KLVA 3P8MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XTG B;  3RK3 C;  3KYQ A;  2N1T D;  1SFC D;  3HD7 A;  1HVV A;  1KIL A;  4LGD E;  4W7Z A;  2NPS B;  2H8P D;  5CCH D;  1URQ B;  1N7S B;  3TSI A;  2WZ7 A;  4WY4 D;  3HTK B;  2PP6 A;  5KJ7 D;  1KIL B;  1L4A A;  2N1T C;  1SFC C;  3RK2 B;  3B5N C;  5CCH C;  5CCG D;  1L4A B;  4WY4 C;  5KJ7 C;  1GL2 B;  4N78 E;  3RK3 B;  3B5N D;  3M0D C;  1N7S D;  2M8R A;  2N1T A;  1SFC A;  3P8C E;  5CCG C;  2HFE D;  3HD7 B;  3VOP A;  1KIL D;  5CCH A;  3RL0 B;  3RK2 D;  4WY4 A;  5KJ7 A;  1NHL A;  1JTH A;  1N7S C;  4OH8 B;  1L4A D;  1GL2 D;  1KIL C;  2XDJ A;  2NPS D;  4WY4 B;  3RK2 C;  5CCG A;  1JTH B;  1URQ D;  3HD7 D;  1L4A C;  3B5N A;  1GL2 C;  3RL0 D;  1N7S A;  4W80 A;  2NPS C;  2N1T B;  1SFC B;  1URQ C;  1T3J A;  3B5N B;  3HD7 C;  3RL0 C;  3RK3 D;  2KOG A;  4W7Y A;  3PP5 A;  1GL2 A;  4JF7 A;  2YMY A;  2NPS A;  2HG5 D;  1URQ A; 
#chains in the Genus database with same CATH topology
 4YPC A;  1GU5 A;  1FZC A;  5AW8 B;  1SFC D;  1HJB A;  4H0L C;  1BDD A;  2QJK C;  4RES B;  2QJP B;  2XND H;  2ZT9 B;  2NPS B;  4IFF A;  1KTM A;  3GHG C;  1SQX E;  1URQ B;  1N8R Q;  1LTI C;  2IBZ G;  2KK7 A;  1KB9 E;  1GK4 A;  2KI7 B;  3PRJ A;  4RO0 A;  2E75 C;  2P67 A;  3L71 D;  3TGU D;  2KZI A;  1JOC A;  1VQ6 P;  3BCC E;  1YIJ P;  1AJY A;  3VP9 A;  1S5L H;  1FDI A;  1SFC A;  3USS A;  2Y9Z A;  2O01 J;  3VMY A;  2W6A A;  1EXI A;  4TLF A;  3OAK A;  2IFM A;  1IK9 A;  4IL6 E;  4IFD K;  1RF0 C;  1BSN A;  3L70 J;  5CBO A;  1KD1 Q;  3CCL P;  5AW6 B;  1PGQ A;  1GTW A;  5AVX B;  3CXH E;  1LNQ A;  1Q7Y Q;  3H1L E;  1SQV D;  2HOD B;  1HUC A;  1EDJ A;  3I5C A;  3WUU A;  1BE3 D;  5M1B A;  3Q5P A;  3CL3 D;  1M56 D;  3MUD A;  2YNY A;  1DD4 A;  2M3E A;  4NPE A;  1LTG C;  3C8V A;  3RK3 D;  4YXD C;  4W7Y A;  1NU1 G;  3O8Z A;  4H13 D;  1LTJ B;  1N73 A;  4ZKP A;  1HWT C;  2PAJ A;  3H1H G;  2FXP A;  1HVV A;  4H44 D;  3L4F A;  5KLV G;  1FAV A;  2OYI C;  3L75 G;  1VQ7 P;  1L0N G;  1LWU B;  3AEC C;  1KIL B;  1PP9 G;  1SQX K;  3TGU E;  2H88 C;  1WMK A;  1S1C X;  1Y8A A;  5CCG D;  2M3B A;  4WB4 A;  2XZR A;  2RMZ A;  1EZV G;  1BSH A;  3V5B A;  1LT9 B;  2KSJ A;  1JB0 J;  1OVV A;  1YIT P;  1LP1 A;  4IL6 H;  5AW7 B;  1FJK A;  1IFD A;  1RHZ B;  1AFO A;  3RK2 D;  3VYI A;  2QJP C;  2PFX A;  3CXH H;  4I1L A;  2CPB A;  1SQV E;  3AE9 C;  3OA7 A;  2DW3 A;  1GL2 D;  3M0D A;  3F89 A;  2E76 C;  3AEG C;  5CCG A;  2QEX P;  3CLQ A;  4Y28 J;  2I8D A;  1MV8 A;  3D71 A;  1VQN P;  1K8A Q;  1SQX J;  4JYB A;  4U7J A;  2WMM A;  3PLN A;  2A45 H;  2KS1 B;  2OTK E;  1QVF O;  3RK3 E;  3H1J D;  5DJT B;  1EDK A;  1VQ9 P;  2OYO A;  5L8R J;  3HE5 B;  2ITA A;  1R5L A;  2QG4 A;  1JY3 N;  3KDP B;  1GL2 A;  3U1A A;  5BVZ A;  2FFD A;  3BAS A;  1NKZ B;  3G6E P;  1A02 J;  4GDO A;  1IO4 A;  2FYZ A;  1S5L X;  1DIP A;  1N7S B;  2PGD A;  2K1A A;  4GKG A;  2ZVO B;  3A2A A;  1DD3 A;  2KP8 A;  4U3F D;  4C7N B;  2LXC B;  5CJ4 A;  3L70 G;  3ZDM A;  3TDK A;  2YKQ A;  3VP8 A;  3EWK A;  1X22 A;  3B5N D;  3NTN A;  2M8R A;  1LTJ C;  1KMI Z;  3G4S P;  2OQQ A;  1SQP D;  4C46 A;  2JKV A;  1S9K D;  5AW1 B;  3D6Z A;  1GW3 A;  4OH8 B;  1IC2 A;  4GIF A;  2ZYD A;  3Q3D A;  1KIL C;  3D6Y A;  4KJM A;  4WY4 B;  4DT0 A;  4AQR D;  1AA0 A;  3KQG A;  1SQV K;  3B5N A;  1FE6 A;  3VN0 A;  1NKN A;  5AW4 B;  1BDC A;  4L75 A;  3E1R A;  4WVZ A;  3CC2 P;  2K3R A;  1LT9 C;  1PPJ G;  1R8E A;  5KKZ B;  3L71 J;  2C0X A;  3TGU J;  3VMX A;  2WVR A;  1T2K D;  4DCK A;  1RE4 A;  1WT6 A;  3PP5 A;  1JEK A;  1OVU A;  3HUS A;  4GOD A;  3VMA A;  2OYH A;  3FWL A;  1H88 A;  1QVG O;  1XTG B;  3IFM A;  1AV1 A;  3HTK A;  2N1T D;  1HBW A;  4W7Z A;  4UB6 E;  1FS0 E;  4IL6 X;  4U3F E;  1G1I A;  2I1K A;  2WZ7 A;  2P7J A;  2PP6 A;  1SQV J;  1L4A A;  1ZP0 C;  1BE3 J;  4HH2 A;  1S2E A;  3A0H E;  1R5S A;  5DJU B;  2Q3I A;  3L73 D;  2XV5 A;  1SQP E;  3CC4 P;  3CCV P;  4PD4 I;  1SQX G;  1S9K E;  2YIU B;  1IJD B;  2N1T A;  1LTS C;  1P84 I;  3WU2 E;  1RQU A;  3P8C D;  1N7S C;  3SWY A;  4M3L A;  3CX5 D;  1EC5 A;  2B88 A;  2QM7 A;  2K9J A;  1KC8 Q;  4PJ0 E;  5APU A;  1M1J A;  3SSU A;  1D7M A;  5APY A;  4H0L D;  4OVN F;  2Y9Y A;  4N6J A;  2KLV A;  3P8M C;  3HRN A;  1VQM P;  1YJN P;  2FYN B;  3A0H H;  4MN4 C;  1J2J B;  3H1K D;  2E75 D;  2A45 G;  3L73 E;  3QH9 A;  1YTZ I;  1JUN A;  1YYC A;  2WQY C;  1KFM A;  5KKZ C;  1OX3 A;  3Q5S A;  1BGY D;  3H1J J;  1JCD A;  3WUV A;  2JWA A;  3M06 A;  3SWF A;  2JJL A;  4IFM A;  4GT1 A;  3P8C E;  2QIW A;  1RF1 B;  2L5G B;  1GMJ A;  2WPS A;  1SQP K;  3V6I A;  3CX5 E;  3EFG A;  1PGO A;  1YHQ P;  4HJG H;  1QLE D;  4Y99 C;  3L71 G;  3TGU G;  4ZMD A;  4IOI H;  3A7O A;  1CSB A;  4EIJ A;  1JTH A;  1QL2 A;  1OW8 A;  2IBZ I;  1KB9 D;  1VF5 B;  5AVS B;  1FJP A;  3H32 A;  3KXD A;  3AEF C;  3P32 A;  5H2F H;  3CMA P;  3O6Q A;  2D2C D;  4U3F J;  3AE2 C;  3BCC D;  2FXM A;  3MZW B;  4W80 A;  1W5C E;  1Q2N A;  3GF7 A;  2GM4 A;  2YIU C;  1J1D C;  1RF0 A;  1M57 D;  3G71 P;  1SQV G;  1E79 H;  3SWK A;  3MGN A;  1FU1 A;  1BE3 G;  2Q6Q A;  1J1E B;  4XE5 B;  3W67 A;  1SQP J;  2YO3 A;  5APS A;  2W90 A;  2W83 C;  1M90 Q;  3H1L D;  4LGD E;  3AE5 C;  3AE7 C;  5AW9 B;  1TU3 F;  2E42 A;  1JY2 O;  1NTM D;  1JO5 A;  5AVQ B;  1FZC B;  1BGY E;  2FBW C;  3OW2 O;  3SFD C;  1PFI A;  1G2C A;  3AE8 C;  1H0T B;  2ZFC A;  3IF4 A;  2OYI A;  3CX5 H;  2Z5I A;  2XKM A;  2HLO A;  3H1I D;  2IYP A;  1ZR2 A;  2E76 D;  2IZ0 A;  3JCU E;  4RKU J;  3T97 B;  2FYN C;  2WT7 A;  2WIT A;  5AW3 B;  1K9M Q;  4XA4 A;  1JY2 N;  1X9V A;  4PV1 C;  5APT A;  1EZV I;  3L73 J;  3WMM 0;  2HR3 A;  1Y9B A;  2AEF A;  2M5A A;  3V2N A;  1YQ4 C;  1KQG B;  1KYO I;  1S72 P;  1AQT A;  3HE4 A;  3H1J G;  4GOE A;  4N3Y B;  3R2P A;  4DZO A;  1NTM E;  2B87 A;  5GTI E;  1M8O B;  1OW6 A;  2H8P D;  4OGQ C;  1N73 B;  2ZVN B;  4EYY Q;  3L74 E;  3CPW O;  3CWB D;  2J5U A;  1U57 A;  3R4Y A;  1T3U A;  1OFC X;  5GTH E;  4DJG A;  3H1I E;  2HOD A;  1KQS O;  1J1E C;  1KB9 H;  2B9B A;  3RK3 B;  2UWJ E;  3JCU H;  1Y47 A;  2KXP B;  4U3F G;  2MJZ A;  1YBK A;  4I7Z B;  3HD7 B;  2QVA A;  4ASV A;  1KIL D;  2Y0C A;  4H13 B;  3CCM P;  1NAF A;  2YO2 A;  4H44 B;  4RJT A;  3Q5R A;  1FZC C;  4WBA A;  1JY3 O;  1RE3 C;  1IFJ A;  5E79 E;  3AE6 C;  1SQP G;  1LTJ A;  3CME P;  2QSI A;  3H1K J;  3L36 A;  1UIX A;  1FZB A;  3QWO C;  2ZAE B;  3N4X A;  2C0W A;  3NMD A;  3CC7 P;  3RBZ A;  1G1J A;  1DH3 A;  1SVF A;  2ZT9 C;  2NPS C;  1BGY J;  3FXD A;  2OTL P;  1URQ C;  1T6A A;  2FKW B;  4D6T D;  5GTI H;  3M9Q A;  1FZF A;  5B5E E;  4LLH A;  1NOH A;  2XNX A;  4JF7 A;  1BCC D;  3AEB C;  2ZYG A;  3CCR P;  1NGM B;  5KAI E;  3M0A A;  1W2E A;  1DEB A;  2I1J A;  2P2U A;  3S4R A;  2FFD B;  3CWB E;  1NTM K;  2WSS H;  3L35 A;  5GTH H;  5B66 E;  3AE1 C;  3BCC J;  1X0T A;  1KIL E;  2QJY B;  1FBM A;  2H7H A;  1GK6 A;  1N7S D;  1Q86 Q;  1M1K Q;  4BWN A;  1RH5 B;  3L73 G;  3D70 A;  3RL0 B;  2RKL A;  1Q82 Q;  3VMZ A;  2A06 D;  1FDO A;  1N73 C;  3H1L J;  1N86 A;  1OMI A;  1Q90 D;  1NTM J;  2IBZ E;  1PL5 A;  3C1L A;  2O1K A;  1E5W A;  4D6T E;  3B4S A;  1N7S A;  3PJS K;  5B5E H;  2B89 A;  3JC2 2;  5APQ A;  3B5N B;  1BCC E;  1LWU C;  4I7Z C;  3HD7 C;  4AYC A;  4C7N A;  2G3A A;  3IN6 A;  3H1I J;  4EDF A;  3ITK A;  2J58 A;  2RH0 A;  2IPP A;  5BU8 B;  3RBX A;  2R32 A;  2KNC B;  1X8Y A;  2HG5 D;  3GW6 A;  3K5B A;  2OYH B;  3MD0 A;  3M9B A;  1NTZ D;  1VQ8 P;  3HTK B;  2K9Y A;  3CCJ P;  2JO1 A;  1S3J A;  1FZE A;  1PV3 A;  1ZW0 A;  2R5B A;  2ZJS E;  2QA4 P;  5KAF E;  2V4H A;  1L4A B;  2IDB A;  3H1K G;  3W68 A;  4N78 E;  1SQB D;  1HH0 A;  2A06 E;  1BGY G;  1U7J A;  3PTZ A;  4OWF A;  5CMZ A;  4NPD A;  2BCC D;  2FFD C;  5KLV E;  2A45 I;  2G8Y A;  2XDJ A;  2O01 N;  1ZRT E;  3TK1 A;  2Q1K A;  5K5G B;  1HF9 A;  3U59 A;  3CWB J;  1EDI A;  2N9Y B;  3TNU B;  1QGK B;  2K9J B;  3V4Q A;  2W27 A;  2E74 D;  3RL0 C;  1YQ3 C;  3C9I A;  3BCC G;  4I2L C;  3GMA A;  1IK7 A;  2HPC B;  2ZXX A;  1NTZ E;  2H89 C;  4LC1 A;  3M91 A;  1DEE G;  2GUS A;  2Q9I A;  5KAF H;  3BAT A;  2PRR A;  1MKM A;  2KIK A;  1SQB E;  4UB6 H;  3H1L G;  3AED C;  4XFJ A;  3B5N C;  5CCH C;  3NFQ A;  1NTM G;  4WY4 C;  1OW7 A;  4D6T J;  3FGA D;  1T8Z A;  2XU6 A;  1UII A;  2BCC E;  2QJK B;  3KPE A;  5AVV B;  1OZH A;  3VOP A;  3E1I A;  1BCC J;  5AW0 B;  1JY3 P;  3E7K A;  4L76 A;  2QM8 A;  3P7K A;  2WPR A;  3GHG A;  4PV1 D;  3H1I G;  2GUV A;  3WU2 H;  3VTP C;  1ZR4 A;  1JTH B;  5KLV K;  5AVY B;  1OVR A;  1L4A C;  3H32 B;  4I6M C;  1NTK D;  1KOR A;  2WSE H;  5APV A;  3PH0 A;  3L37 A;  3O6Q B;  2V7Q H;  2WWW A;  4JYC A;  2Y0D A;  4PJ0 H;  1ZXG A;  4ZNC A;  1X79 B;  1KN7 A;  1KQF B;  4OGQ D;  3M9H A;  3I56 P;  3LW5 H;  1LGH B;  5AVT B;  1RY3 A;  2WSF H;  1MFZ A;  1CI6 A;  1CW5 A;  1ZLL A;  2C9L Y;  3LIE A;  1NTZ K;  1OWA A;  2D2C B;  2AXT E;  2OTJ P;  3AEA C;  3BRT B;  1L2P A;  5EFW B;  1SQB K;  4GOF A;  2KYV A;  1G2C B;  3CWB G;  1FZG A;  1ZME C;  1JMB A;  1L0L D;  1IFI A;  2O01 H;  5CBN A;  3L72 D;  3H6P A;  2WSE J;  1ZOY C;  3Q2Y A;  3L74 D;  2V7Q J;  2WPQ A;  1GW4 A;  2ZT9 D;  2NPS D;  1NTZ J;  2NZ2 A;  1URQ D;  1NTK E;  1VQL P;  3A0B E;  4O9B A;  2WT7 B;  3B8E B;  2IYO A;  3LW5 J;  4KT0 J;  3RL0 g;  2AEM A;  1LTT C;  2WSF J;  1SFC B;  1RE3 A;  4BRY A;  1SQB J;  4PD4 D;  4Z1M H;  1MZ9 A;  4TT3 H;  2FYU D;  1NYH A;  2C9N Y;  1H0T A;  2E43 A;  4K3A A;  1P84 D;  2E76 B;  2JWD A;  2M0B A;  3TF5 A;  2M5A B;  1ZV8 A;  1VQK P;  2NPS A;  1USD A;  2BCC J;  2KSE A;  4D6T G;  1URQ A;  1MUU A;  2E5Y A;  3HE4 B;  2AXT H;  1YJW P;  3CCU P;  1RF1 C;  2B87 B;  1BCC G;  3T97 A;  3G9R A;  3TSI A;  1HGV A;  2CK3 H;  5CJ0 A;  2W8Z A;  4JBZ A;  2POH A;  3AE3 C;  2AEJ A;  1VF5 C;  3U1C A;  5KJ7 C;  1L0L E;  1RQV A;  2O1J A;  1MFT A;  1PIX A;  3L72 E;  2Y0E A;  3II6 A;  5TIS E;  2R3C A;  3GG2 A;  4ZKU A;  1KFN A;  2OAR A;  3A0B H;  3EFF K;  2D2C C;  1GU4 A;  2Q7C A;  3GLM A;  1SQQ D;  3V4W A;  1NO4 A;  2A06 G;  3CCE P;  4PD4 E;  3HD7 D;  1LTA C;  1NTK K;  1LP1 B;  2FYU E;  1P84 E;  1T3J A;  2VRS A;  2R44 A;  2QRX A;  5AVR B;  2FXO A;  4L73 A;  2ZXE B;  3L71 E;  3FX0 A;  2LKM A;  2IBZ D;  2H43 A;  1LWU A;  1NVO A;  2JEE A;  1KIL A;  3HD7 A;  4L74 A;  1WRG A;  5APX A;  3CX5 I;  1SLQ A;  4YTP C;  2P10 A;  3BRV B;  2RN0 A;  1SFC C;  3RK2 B;  4C7R A;  1NTK J;  2MKV A;  1K05 A;  1LT9 A;  1VQ5 P;  1NTZ G;  1YI2 P;  1GL2 B;  5TIS H;  2P58 A;  1BE3 E;  2Z4E A;  3G3Z A;  2JP3 A;  3KZI E;  1QX8 A;  1L0L K;  2Q5U A;  2WSC H;  1FZA A;  3V2Q A;  1SQB G;  4DOJ A;  3AE4 C;  2YMK A;  2KLU A;  1SQQ E;  2IX7 C;  4PD4 H;  3MUD C;  1AVO A;  3IAO A;  3MIW A;  2YKO A;  2KS1 A;  3PHL A;  2BCC G;  1P84 H;  1CZQ A;  5BU5 A;  1GDT A;  3SFE C;  4N78 D;  4HYT B;  3EQ2 A;  5E79 H;  1NU1 D;  3RL0 D;  2ZYA A;  3AEE C;  3HE5 A;  3RGU A;  3ABV C;  2YXQ B;  3LID A;  4EOT A;  2FYU K;  3H1H D;  3CD6 P;  1L0L J;  1JNM A;  5KLV D;  3L75 D;  2KUB A;  5AVW B;  1SP4 A;  1L0N D;  2KB7 P;  1FOS F;  3L72 J;  1VQP P;  2QE7 H;  1ZRT D;  3RK3 C;  1PP9 D;  3L74 J;  1QL1 A;  4WWI A;  1PGJ A;  1HTL C;  2KZJ A;  5CCH D;  5KAI H;  4H13 C;  3N7N A;  1KB9 I;  4WY4 D;  4JPZ B;  1EZV D;  2WSC J;  4H44 C;  1VDF A;  2IFN A;  1JY2 P;  3KZI H;  5KTB A;  1N7L A;  5B66 H;  2LXB A;  1KYO D;  3HUS B;  3MTU E;  3OJA B;  1KQL A;  2SPZ A;  4UB8 E;  3M0D C;  2FYU J;  3H1J E;  5CCG C;  5CCH A;  2NRG A;  1IFP A;  1K04 A;  1JCC A;  3GF3 A;  4JQ0 D;  4WY4 A;  2E5T A;  1NHL A;  3IR9 A;  2LR2 A;  2WTY A;  4NPF X;  1L4A D;  1YJ9 P;  3CXH I;  3FWN A;  2KNC A;  5AVU B;  1NU1 E;  3RK2 C;  1USE A;  1SQQ K;  3JSV C;  4R4L A;  1GL2 C;  3A3Y B;  2YXR B;  5C39 A;  2N1T B;  3H1H E;  4Y99 B;  1H8A A;  2HYN A;  3MHV A;  3L75 E;  2R5D A;  1L0N E;  1M7L A;  5AW5 B;  1PP9 E;  2OGU A;  2W6J H;  1NTK G;  1DX7 A;  1K73 Q;  2BEQ D;  2K88 A;  1LTB C;  1IFN A;  2QJY C;  3KYQ A;  1YTZ T;  1EZV E;  3NXS A;  1FDM A;  1PZQ A;  3L70 D;  1J1D B;  2N9B A;  1ZN5 A;  1VQO P;  1SQQ J;  1IZN B;  1H89 A;  1M1J B;  1KYO E;  5CHX A;  3CI9 A;  5KLI B;  1U7M A;  1VL2 A;  3I55 P;  4UB8 H;  4K35 A;  1S4X A;  2E74 B;  1SS1 A;  3TNU A;  1HGZ A;  2Q3E A;  4HB1 A;  2HFE D;  1FC2 C;  5TJH A;  2YKP A;  4HKZ H;  2P1J A;  3CCS P;  3V2R A;  2BEZ F;  5H2F E;  3F5H A;  4ASW A;  1NH4 A;  1L0L G;  1EDL A;  3FXE A;  2HPC A;  3A5T A;  4H0L B;  1PPJ D;  4YXW H;  3L72 G;  4BXL A;  3GHG B;  1RE4 C;  4B86 A;  1A02 F;  1FOS E;  3L74 G;  1NU1 K;  3HUS C;  4AUW A;  3BVH A;  2GA1 A;  2OYH C;  5APW A;  4CPG A;  3S9O A;  1NJI Q;  1IFM A;  2E75 B;  1PGP A;  2JDI H;  1Z56 A;  2YMY A;  1L0N K;  2J59 M;  2FY8 A;  2CPS A;  3L70 E;  1T2K C;  4R4M A;  4PV1 B;  2K37 A;  1OXZ A;  2AXC A;  1KYO H;  2FYU G;  5AW2 B;  3MP7 B;  3WUT A;  1VF5 D;  2W6B A;  3H25 A;  5KJ7 D;  1CI6 B;  1Q81 Q;  2N1T C;  1JM0 A;  1SQX D;  1NAY A;  1NU1 J;  1LT1 A;  3B71 A;  4A7P A;  1RF1 A;  1KV4 A;  1EQ7 A;  3H1H J;  1GZL A;  4OGQ B;  5KLV J;  3L75 J;  1L0N J;  4KHX A;  1KZU B;  3TYY A;  5KJ7 A;  1PP9 J;  1PPJ E;  1S5L E;  1N2D C;  1AVY A;  3V2P A;  1M1J C;  2IZ1 A;  2O3J A;  2Z5H A;  3KHU A;  3S1K A;  5KLI C;  1VQ4 P;  1HJ0 A;  2OYI B;  3UIA A;  2E74 C;  1W2B O;  1GD2 E;  3CXH D;  3H1K E;  1LJ2 A;  4QMA A;  4EI2 A;  1NWQ A;  1AQ5 A;  1SQQ G;  1OIP A;  2R3S A;  3CCQ P;  2BAS A;  5AVZ B;  2KOG A;  2WPV B;  1XTC C;  4BRY B;  2L91 A;  1VPC A;  3Q1M A;  1JMM A;  1QEX A;  1EXJ A;  2JR8 A; 
#chains in the Genus database with same CATH homology
 1GU5 A;  2H43 A;  1FZC A;  3HRN A;  5AW8 B;  1LWU A;  1SFC D;  1HJB A;  2JEE A;  1KIL A;  3HD7 A;  4RES B;  2NPS B;  2OYH B;  3MD0 A;  4IFF A;  3GHG C;  1WRG A;  1URQ B;  3M9B A;  5APX A;  1J2J B;  1SLQ A;  1LTI C;  3HTK B;  2A45 G;  3BRV B;  1SFC C;  3RK2 B;  1YTZ I;  1JUN A;  1YYC A;  1KFM A;  1FZE A;  1GK4 A;  2R5B A;  4C7R A;  1LT9 A;  1JCD A;  1L4A B;  1GL2 B;  4N78 E;  2P67 A;  3M06 A;  1JOC A;  3SWF A;  2Z4E A;  2JJL A;  1HH0 A;  3G3Z A;  3VP9 A;  4IFM A;  4GT1 A;  1SFC A;  3P8C E;  1L0L K;  1RF1 B;  2L5G B;  2WPS A;  1SQP K;  2Q5U A;  2WSC H;  3EFG A;  1FZA A;  3V2Q A;  5CMZ A;  3VMY A;  4Y99 C;  2W6A A;  4DOJ A;  2FFD C;  3OAK A;  3A7O A;  1CSB A;  4EIJ A;  1JTH A;  2IFM A;  1QL2 A;  1IK9 A;  2IX7 C;  2A45 I;  5AVS B;  4IFD K;  1FJP A;  3H32 A;  1RF0 C;  2XDJ A;  3MIW A;  5AW6 B;  3TK1 A;  1GTW A;  2YKO A;  5AVX B;  3P32 A;  1CZQ A;  3U59 A;  2HOD B;  1HUC A;  3I5C A;  5BU5 A;  1GDT A;  4N78 D;  4HYT B;  3TNU B;  3EQ2 A;  3RL0 D;  3CL3 D;  3HE5 A;  2FXM A;  4W80 A;  3V4Q A;  3MUD A;  2GM4 A;  1J1D C;  1RF0 A;  2YNY A;  1LTG C;  2W27 A;  3LID A;  4EOT A;  3MGN A;  1FU1 A;  3RK3 D;  3RL0 C;  3C9I A;  2FYU K;  4W7Y A;  1J1E B;  1JNM A;  4XE5 B;  4I2L C;  2YO3 A;  1FOS F;  5AVW B;  1SP4 A;  2KB7 P;  3O8Z A;  1LTJ B;  2HPC B;  1N73 A;  5APS A;  4ZKP A;  3RK3 C;  1HWT C;  2PAJ A;  4LC1 A;  1QL1 A;  3M91 A;  1HVV A;  4LGD E;  1HTL C;  3L4F A;  5AW9 B;  5CCH D;  1FAV A;  2OYI C;  2E42 A;  1JY2 O;  2GUS A;  2Q9I A;  1JO5 A;  5AVQ B;  3N7N A;  1FZC B;  4WY4 D;  3BAT A;  1LWU B;  1KIL B;  1SQX K;  1VDF A;  3B5N C;  5CCH C;  3NFQ A;  1PFI A;  2IFN A;  1JY2 P;  5CCG D;  1G2C A;  5KTB A;  1N7L A;  2M3B A;  4WY4 C;  2ZFC A;  3HUS B;  2OYI A;  1T8Z A;  3MTU E;  2XU6 A;  4WB4 A;  2Z5I A;  2XZR A;  2XKM A;  3OJA B;  1KQL A;  3V5B A;  1LT9 B;  2HLO A;  2KSJ A;  3KPE A;  3M0D C;  5CCG C;  5AVV B;  5AW7 B;  1FJK A;  1IFD A;  3VOP A;  3E1I A;  5CCH A;  5AW0 B;  1ZR2 A;  1JY3 P;  1AFO A;  3RK2 D;  3VYI A;  1JCC A;  4WY4 A;  4I1L A;  1NHL A;  2QM8 A;  3P7K A;  2CPB A;  3IR9 A;  2WPR A;  2WTY A;  1L4A D;  3GHG A;  2WT7 A;  3OA7 A;  1GL2 D;  3M0D A;  2GUV A;  2WIT A;  5AVU B;  5AW3 B;  3RK2 C;  5CCG A;  3CLQ A;  3VTP C;  1ZR4 A;  1JTH B;  5KLV K;  1SQQ K;  1MV8 A;  4XA4 A;  1JY2 N;  5AVY B;  1X9V A;  1L4A C;  3H32 B;  4JYB A;  5APT A;  1GL2 C;  3A3Y B;  2A45 H;  4I6M C;  2N1T B;  2WSE H;  5APV A;  3WMM 0;  4Y99 B;  3L37 A;  1H8A A;  2WWW A;  4JYC A;  2HYN A;  3V2N A;  2R5D A;  1M7L A;  3HE5 B;  1X79 B;  5AW5 B;  1JY3 N;  3HE4 A;  3KDP B;  1GL2 A;  3U1A A;  5BVZ A;  1DX7 A;  3M9H A;  2FFD A;  4N3Y B;  3R2P A;  3LW5 H;  4DZO A;  1LTB C;  1IFN A;  3BAS A;  1LGH B;  5AVT B;  1RY3 A;  1NKZ B;  2WSF H;  1A02 J;  1IO4 A;  3KYQ A;  1MFZ A;  1CI6 A;  1CW5 A;  1YTZ T;  1ZLL A;  2C9L Y;  2H8P D;  2FYZ A;  3LIE A;  3NXS A;  1FDM A;  1NTZ K;  1N7S B;  1N73 B;  1J1D B;  2N9B A;  1OWA A;  1ZN5 A;  4GKG A;  1H89 A;  1M1J B;  5CHX A;  3CI9 A;  3A2A A;  2KP8 A;  1T3U A;  4C7N B;  5CJ4 A;  3BRT B;  2YKQ A;  2HOD A;  3VP8 A;  1SQB K;  1J1E C;  3RK3 B;  3TNU A;  1HGZ A;  3B5N D;  2KYV A;  3NTN A;  1G2C B;  1FZG A;  2M8R A;  2MJZ A;  1LTJ C;  2HFE D;  3HD7 B;  1IFI A;  2O01 H;  1KIL D;  1NAF A;  4C46 A;  2YO2 A;  2YKP A;  1S9K D;  2P1J A;  3H6P A;  3V2R A;  5AW1 B;  1GW3 A;  4OH8 B;  1IC2 A;  1FZC C;  4WBA A;  4GIF A;  1NH4 A;  2WPQ A;  1GW4 A;  1JY3 O;  1KIL C;  1RE3 C;  1IFJ A;  2NPS D;  4WY4 B;  1LTJ A;  2HPC A;  4AQR D;  3A5T A;  3L36 A;  1URQ D;  1FZB A;  3KQG A;  1SQV K;  4O9B A;  3GHG B;  2WT7 B;  1RE4 C;  3B8E B;  4B86 A;  1A02 F;  1FOS E;  3B5N A;  3N4X A;  2C0W A;  1NU1 K;  3NMD A;  3HUS C;  3VN0 A;  1NKN A;  3BVH A;  1G1J A;  1DH3 A;  1SVF A;  5AW4 B;  1LTT C;  4AUW A;  2NPS C;  2OYH C;  5APW A;  1SFC B;  1URQ C;  1RE3 A;  1LT9 C;  2FKW B;  2C0X A;  3VMX A;  1MZ9 A;  1T2K D;  3M9Q A;  1FZF A;  1IFM A;  1RE4 A;  1WT6 A;  3PP5 A;  2C9N Y;  4LLH A;  2E43 A;  1NOH A;  2XNX A;  1ZV8 A;  3HUS A;  1Z56 A;  4JF7 A;  2YMY A;  1L0N K;  2J59 M;  2NPS A;  2OYH A;  2CPS A;  1URQ A;  1MUU A;  1H88 A;  3M0A A;  1T2K C;  1W2E A;  3HE4 B;  1XTG B;  1DEB A;  2I1J A;  3IFM A;  2P2U A;  3HTK A;  1OXZ A;  2N1T D;  1HBW A;  5AW2 B;  4W7Z A;  2FFD B;  1RF1 C;  1NTM K;  2W6B A;  1G1I A;  3T97 A;  2I1K A;  2WZ7 A;  2P7J A;  3TSI A;  3L35 A;  1HGV A;  5CJ0 A;  2PP6 A;  1CI6 B;  5KJ7 D;  1L4A A;  2N1T C;  4HH2 A;  2POH A;  2Q3I A;  2XV5 A;  3U1C A;  5KJ7 C;  1RF1 A;  2O1J A;  1FBM A;  1EQ7 A;  1S9K E;  2H7H A;  1IJD B;  1GK6 A;  1N7S D;  1GZL A;  1LTS C;  2N1T A;  3II6 A;  3RL0 B;  2R3C A;  4KHX A;  4ZKU A;  1KZU B;  1KFN A;  3TYY A;  3VMZ A;  5KJ7 A;  2OAR A;  3P8C D;  1N2D C;  1N73 C;  1N7S C;  3SWY A;  1N86 A;  4M3L A;  3V2P A;  1M1J C;  1GU4 A;  2Q7C A;  2Z5H A;  2O1K A;  2QM7 A;  1E5W A;  3V4W A;  1NO4 A;  2OYI B;  3HD7 D;  3UIA A;  1GD2 E;  1N7S A;  1LTA C;  1NTK K;  5APU A;  1M1J A;  1T3J A;  1NWQ A;  1AQ5 A;  5APQ A;  3B5N B;  2VRS A;  5AVR B;  1LWU C;  3HD7 C;  4AYC A;  2BAS A;  5APY A;  5AVZ B;  4C7N A;  2KOG A;  1XTC C;  2ZXE B;  1VPC A;  2J58 A;  4N6J A;  1JMM A;  2IPP A;  5BU8 B;  2R32 A;  1X8Y A;  2LKM A;  2HG5 D;  2KLV A;  3P8M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...