2M8RA

Pre-fusion solution nmr structure of neuronal snare syntaxin 1a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
109
structure length
109
Chain Sequence
GSHMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Syntaxin-1A
publication title Prefusion structure of syntaxin-1A suggests pathway for folding into neuronal trans-SNARE complex fusion intermediate.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 29
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05739 SNARE SNARE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2m8rA00
3B5ND 1T3JA 3KYQA 1JTHB 5CCHC 3B5NC 5CCGC 1L4AA 1GL2A 1N7SA 1GL2D 1N7SD 2M8RA 1SFCD 4JF7A 2NPSB 1HVVA 2HG5D 3RK2C 1SFCC 4W80A 1URQA 3RK3C 5KJ7C 1URQB 3RL0B 4WY4C 2H8PD 1KILB 2NPSA 1L4AD 2N1TB 3HD7B 3M0DC 2NPSD 5CCHA 1L4AC 1GL2C 1N7SC 3B5NB 4N78E 2XDJA 4OH8B 1URQD 1KILA 3HTKB 2KOGA 2N1TA 3HD7A 1XTGB 3RK2B 3HD7D 1SFCB 4LGDE 1NHLA 3RK3B 3B5NA 5CCGA 3P8CE 5CCHD 2HFED 5CCGD 2YMYA 4WY4B 2NPSC 3TSIA 3PP5A 3RL0D 4W7YA 1SFCA 2PP6A 1KILD 4W7ZA 3RK2D 1URQC 2N1TD 3RL0C 1L4AB 1GL2B 1N7SB 5KJ7A 3RK3D 1KILC 4WY4A 5KJ7D 2WZ7A 2N1TC 3VOPA 3HD7C 1JTHA 4WY4D
chains in the Genus database with same CATH superfamily
2E76C 1AQ5A 1IJDB 3M0AA 1ZRTD 1KB9H 3ZDMA 5AW8B 2KZJA 2ZVOB 3RK2C 3RGUA 3AEAC 3AE5C 1HBWA 1SQXK 3L72D 2YKQA 2PGDA 3MHVA 1JEKA 1BSHA 2IZ0A 2KYVA 4N78D 1QLED 3SWKA 1GL2C 1SQXE 4JQ0D 2QSIA 3CWBD 1NKZB 2WT7B 1LTAC 3GHGC 2XNDH 2RN0A 3L73E 3CMEP 1X79B 1QVFO 2GUVA 5AW0B 4IFDK 1S72P 2QJPC 3HE4B 1JOCA 4ASVA 4WVZA 1PIXA 2Q1KA 1RF0A 3CXHH 2WITA 3RL0D 4AYCA 3LIEA 2RKLA 1NTMK 4GKGA 4UB8E 1N73A 1KN7A 2M0BA 2M3BA 5APXA 2FFDA 4QMAA 1T3JA 1PGOA 4H13B 3L75J 1NTME 4RO0A 1M8OB 3HUSB 1FDIA 4PJ0E 5APWA 3CX5D 5M1BA 3V2QA 4GODA 1IC2A 1M1KQ 2L5GB 1S5LH 1N7SD 4JF7A 4H0LB 2YMKA 3WUUA 3G9RA 4UB6H 3FXDA 1LNQA 1OW6A 1DEEG 3VTPC 1MZ9A 1SQQG 1ZW0A 1X9VA 3IR9A 1UIIA 2H8PD 1KILB 3RBZA 3L37A 1L0NJ 1SS1A 1LT9C 1EDLA 4I1LA 2Y9ZA 1X0TA 4ZNCA 2FBWC 4EDFA 3OW2O 4PD4E 4N78E 5L8RJ 2JWDA 4I7ZB 2KNCB 3BCCJ 1SQBD 1FZCB 2IPPA 2E74B 1N2DC 5APVA 4BRYB 1VQLP 2Y0CA 1YHQP 1J2JB 3JCUH 1YJNP 1BCCG 1NO4A 2W6JH 4U3FG 4BXLA 1BGYD 1AQTA 5AVTB 2H7HA 2QJKB 2ZFCA 1USEA 3RK3D 5KLVD 1SQPG 2IX7C 1JTHA 3EWKA 2WSFJ 1SQVG 1JM0A 2IBZG 3CCRP 2R3CA 4UB8H 3N4XA 2O3JA 5H2FE 2R3SA 3V6IA 1S4XA 1HF9A 2FXMA 1SQXJ 3L70G 4PJ0H 3IN6A 2DW3A 2N1TB 3TNUA 2XZRA 4H44B 2POHA 2BCCE 2B88A 3L73J 1HJBA 1N7SC 4PD4I 4YPCA 1NU1E 2L91A 1J1EB 1M1JB 4NPDA 4EIJA 1SQBK 3LW5H 3HTKB 4MN4C 3M9HA 1JMMA 4IL6E 1S5LX 1YQ3C 1PPJG 1G1JA 3I56P 3HD7D 3W67A 2WQYC 4LGDE 1GDTA 2B87B 1LT1A 1SQBE 2FXOA 4RKUJ 2A06G 1VQPP 4N6JA 1IK9A 1E79H 2AXCA 1OXZA 3TSIA 5KLVK 3H25A 2QG4A 2BEQD 2PP6A 3L74D 5AW7B 2SPZA 1AA0A 3OA7A 2P10A 2HODA 1NTMJ 2K3RA 3I5CA 1M57D 4OVNF 3G71P 3B5ND 5KLIC 3R4YA 3H1JG 1NTKE 1IFMA 1N86A 4PV1D 5AVRB 3L71G 3EFGA 1KD1Q 2E5TA 4W80A 4DJGA 3MTUE 2FYUG 3TGUG 2C9LY 2QEXP 3RK3C 1KB9D 1FZBA 1H0TA 2FXPA 5BU5A 1A02J 1GU4A 2E75B 1KFMA 1SQQD 1L4AD 2XNXA 4U7JA 5AVWB 3A0HE 5C39A 4HB1A 3WMM0 3VN0A 4A7PA 4L75A 2W6BA 1LTJA 2ZYGA 2YXQB 1PP9G 1JCCA 4EYYQ 3CCJP 1N73B 4XFJA 3B5NA 1VL2A 3CD6P 2QIWA 5CBOA 1K9MQ 4WBAA 2FFDB 2YIUB 2GA1A 3P7KA 2JP3A 3WU2E 4IL6H 1RQUA 3WUTA 1OVUA 5AW4B 3L74E 3RL0g 2E76D 4U3FD 3CXHD 2E43A 2WZ7A 3HD7C 4OWFA 1JY2P 2OYIA 3NTNA 3AEFC 3AECC 3C9IA 3UIAA 2JKVA 1E5WA 2Q5UA 1SQPD 3A5TA 1N8RQ 1S9KD 1K05A 1L4AA 1M90Q 1IZNB 3T97B 2YXRB 2M8RA 3E1RA 2KSEA 2IBZD 2K37A 1OW8A 1LTJC 2Z5IA 3O6QA 1SQQK 2KSJA 2BCCJ 3RL0B 1LWUC 2WSEH 3C8VA 5AW3B 1NU1J 3M0DC 2Q7CA 1FZEA 2W6AA 3S1KA 1OFCX 1GMJA 4PV1C 3H1IG 4CPGA 1HH0A 3GF3A 2Y0EA 4HYTB 3MZWB 1JY2O 3F89A 1RH5B 1PGQA 3OJAB 4I2LC 1PPJD 3KDPB 1VPCA 2PRRA 5AVSB 5KKZB 1LJ2A 1G2CA 2VRSA 1OW7A 1OWAA 3AEEC 2A06D 1GU5A 3Q3DA 3H1KG 1Q90D 1SQPK 1AVOA 1J1DC 1NTKJ 1OZHA 2WWWA 1NTZG 4KHXA 2FKWB 2LXCB 2W27A 2WTYA 3O8ZA 3CMAP 2LXBA 3KYQA 5AVZB 1DEBA 2Q3IA 1GL2A 5KTBA 3JSVC 3GHGA 2P58A 3TF5A 4K35A 4Y99C 1L0LG 4YTPC 3VMAA 3SWYA 1KQSO 4IL6X 1URQB 1OVVA 2FYUD 3TGUD 3S9OA 1QL1A 3HE5A 2B9BA 2OQQA 1Q2NA 3B8EB 2P2UA 3E7KA 3H1HE 5B5EE 2ZT9B 3PHLA 1LTIC 2P67A 2YNYA 1RHZB 3IAOA 2OYHC 1QGKB 4GT1A 1FOSE 1XTCC 2PFXA 2KK7A 2ZJSE 1EXJA 3AE3C 1MFTA 5AW5B 1Y9BA 3USSA 4YXWH 2QRXA 1PP9D 5CCHD 5KAFE 1EDIA 5CCGD 2D2CD 3L74J 1OVRA 2QM8A 4C46A 5B66E 1U7MA 1H8AA 4LC1A 2AXTE 1YJ9P 3GW6A 4D6TD 1DD4A 1BE3D 1Q81Q 1VF5B 4HKZH 1JMBA 1EZVG 4JPZB 3M9BA 4HH2A 1LT9A 1S3JA 1VQ9P 1KYOE 2J58A 3EFFK 3H1LE 3V4QA 5E79H 2R32A 4HJGH 2FYUK 3AE6C 1SFCC 1JNMA 1YQ4C 1HGVA 4OGQD 3L4FA 2R5BA 3P8CD 3F5HA 2NPSD 5BU8B 5APQA 5CCHA 1ZRTE 2B89A 3B5NB 1PFIA 2XDJA 1FAVA 3FWNA 2WMMA 3H1ID 2QJYB 2WSFH 3L72E 2XV5A 2YKPA 1P84D 3AEGC 3PRJA 1L2PA 2HFED 2YMYA 3L75G 1KQLA 3CC2P 1GW3A 1IFDA 2OYIB 2OYOA 3TYYA 2KXPB 4W7YA 1A02F 3CWBE 1L4AB 1U57A 4D6TE 1Q7YQ 1BE3E 4WY4D 1ZXGA 5KAFH 2C0WA 1NTZD 3FX0A 3GF7A 5GTHE 1KYOI 3O6QB 2IDBA 1FZGA 2Q3EA 5B66H 5CCHC 5CCGC 1L0NG 2D2CC 1N7SA 4YXDC 1PV3A 1DD3A 3M9QA 1JY3P 2HPCB 1NKNA 2KP8A 1JCDA 1T8ZA 2BASA 2IZ1A 4DZOA 2NZ2A 1MFZA 2FYNC 1L0LD 3H1HJ 2BEZF 1KYOH 3KZIE 5CBNA 3BCCG 3K5BA 3S4RA 3A7OA 1NAYA 3CX5E 2E76B 2K9JA 3AE4C 3PTZA 2CK3H 1ZN5A 4OH8B 1NH4A 3MIWA 1W5CE 1G1IA 2ZAEB 1JUNA 1MKMA 1AFOA 4OGQC 3QH9A 3RK2B 1RE3C 2QE7H 3A3YB 1NOHA 1R8EA 2KUBA 3BRTB 1P84E 2NPSC 3U59A 1QEXA 1RF1A 1JY3O 2O1JA 4GIFA 5AVUB 3MGNA 1HTLC 1FDOA 3PLNA 3IFMA 1GL2B 1NTZK 3H1LJ 4C7NA 3CCSP 5KJ7D 3E1IA 3II6A 4IOIH 3GHGB 1LTBC 1ZLLA 1M56D 3OAKA 4PD4H 3NMDA 2FYZA 1EZVD 1SQXG 1GD2E 2QVAA 2ZYDA 2QJPB 3KXDA 1CSBA 1IO4A 3Q5PA 1X22A 3L73G 1BGYE 2JO1A 1LTTC 5APUA 3SFDC 2Z4EA 1SVFA 3V2NA 3RK3E 5KLVE 2LKMA 5AW9B 4WY4C 1H89A 4NPEA 3VP9A 2P7JA 1OIPA 2PAJA 3VMZA 4H0LD 1JY2N 2G8YA 3G6EP 3CX5I 3VMYA 1RF1C 5AW1B 3L72J 3HRNA 4L74A 2AEFA 5APSA 3G3ZA 3N7NA 1ZMEC 3HD7A 2CPBA 5GTIE 1NTMG 3HE4A 2M3EA 4EI2A 3FXEA 4WB4A 1YTZI 3Q5SA 5AVXB 3CWBJ 5H2FH 4KT0J 3IF4A 1WMKA 3MD0A 1HUCA 1NGMB 1R5SA 1LT9B 4N3YB 4D6TJ 3L75D 1VQ7P 1BE3J 1Q86Q 2AEMA 1GK6A 1S2EA 1HWTC 2E74D 3SFEC 1LWUA 3VOPA 3GG2A 3M0DA 1FBMA 5EFWB 2ZXXA 1NWQA 2H89C 1FU1A 1BCCD 1L0ND 1HVVA 1KQFB 2IYPA 3CPWO 1JB0J 2YKOA 4AUWA 1ZOYC 1N7LA 3EQ2A 5KJ7C 4TLFA 3AEBC 1SQVD 2JJLA 5CJ4A 1GW4A 5TISE 4C7RA 2HLOA 3D71A 1JO5A 2Y9YA 5CHXA 3RBXA 4H13C 1KB9E 1KMIZ 3PJSK 3CCUP 1T3UA 1LP1A 3HUSC 4H44D 1VQOP 4BRYA 3L70D 1SQQE 4H0LC 2KS1A 1CZQA 3VMXA 3PP5A 1ZR4A 1VQ5P 2WSCJ 2WSSH 1BDCA 5CJ0A 1SQBJ 2MJZA 5GTIH 3SWFA 4L73A 2OTJP 1N7SB 2C0XA 2KLUA 1KILC 3A0HH 3BATA 2O01H 1AVYA 1D7MA 2J5UA 1SLQA 1X8YA 2BCCG 1JTHB 1VQ6P 1YI2P 1BGYJ 5BVZA 1NU1G 3AE1C 3A0BE 1S1CX 5KLVJ 4I7ZC 1SFCD 1SQXD 2OYHA 1PL5A 1PZQA 1Z56A 1BCCE 1FZCC 4U3FE 3CXHE 1SQVK 3WUVA 2E74C 3L73D 2W83C 1SQPE 3WU2H 2KIKA 3H1JD 3A2AA 1S9KE 1SQVE 1GZLA 5KLIB 1M1JA 3MUDC 2R44A 3TNUB 2IBZE 1VQKP 2QJKC 1SP4A 3L71D 1GTWA 2O01J 2E75D 1S5LE 2N9YB 1H88A 1KB9I 1NTKG 5TJHA 4UB6E 3RK3B 3CC7P 1NTMD 4C7NB 3H6PA 1KZUB 3L70E 1RY3A 1T2KC 3AE7C 1SFCA 3CCQP 1MUUA 1YBKA 2A45I 1UIXA 1FOSF 2HODB 4L76A 2N1TC 2KZIA 1PPJE 4H44C 3NXSA 2NRGA 1OMIA 1J1EC 2JDIH 1M1JC 2RMZA 4ZKUA 4WWIA 2C9NY 1CW5A 2A45H 4I6MC 4PD4D 3KHUA 2A06E 1ZP0C 2OTLP 4R4MA 5KAIE 3CXHI 3I55P 3U1CA 3JCUE 3V2PA 4TT3H 2V7QH 2I1JA 1EDJA 2N9BA 1KORA 3ITKA 1IFIA 4R4LA 4M3LA 1H0TB 3A0BH 3HD7B 3H1JE 2IBZI 3L74G 1EC5A 1JY3N 2J59M 2YO2A 2IYOA 4JBZA 1SQQJ 2WPRA 3L71E 4GDOA 1HJ0A 1Y8AA 3JC22 3V5BA 2IFNA 2FYUE 1LTJB 3TGUE 1ZV8A 1PGJA 1NHLA 1QX8A 5CCGA 1FJPA 2KB7P 1LWUB 1LTSC 1RQVA 4NPFX 1VDFA 2XKMA 1NVOA 1USDA 1BSNA 3R2PA 2E5YA 3BRVB 4PV1B 2E75C 2V7QJ 5APTA 1YITP 3B71A 4DT0A 5B5EH 4XA4A 4IFMA 1CI6A 1EDKA 3D6ZA 1PP9E 3T97A 2ZVNB 3Q2YA 1BCCJ 2P1JA 4U3FJ 2BCCD 1RF0C 1NAFA 1NU1D 1YJWP 2HG5D 3TDKA 1KV4A 3VYIA 1SQPJ 2A45G 2WVRA 3H1KD 1RE3A 2LR2A 1N73C 2XU6A 1SQVJ 5CMZA 1ZR2A 3U1AA 1K04A 1J1DB 2FFDC 2YIUC 2NPSA 4GOFA 2I1KA 2AXTH 3W68A 3AE2C 1AV1A 2K88A 1LP1B 3ABVC 1LGHB 1FS0E 2OGUA 1RE4A 4ZMDA 5KAIH 4RESB 1URQD 2OTKE 2KS1B 1KTMA 4Y99B 2G3AA 1XTGB 3TK1A 3L70J 3BVHA 1T6AA 2HR3A 2ZT9D 2QM7A 3P8CE 1NTKD 2M5AA 4B86A 2K1AA 1OX3A 2O01N 3AEDC 1VQ8P 3M06A 3AE8C 2V4HA 1G2CB 3RL0C 3KPEA 3H1IE 1YTZT 4WY4A 1NJIQ 3KQGA 2QA4P 3LIDA 2OYHB 4AQRD 2ITAA 2FY8A 3H1HG 1MV8A 1NU1K 1IFNA 5APYA 4XE5B 1RE4C 4ZKPA 1KFNA 3GMAA 3H32A 1VF5D 5K5GB 3D6YA 4Z1MH 1URQA 2JR8A 3L35A 3G4SP 3H1KE 3H1JJ 2JEEA 1NTZE 5KKZC 1TU3F 5AVYB 5AW6B 1L0LK 1M7LA 1Y47A 3HE5B 4O9BA 4EOTA 3L71J 1LTGC 2FYUJ 5DJTB 4H13D 3TGUJ 5AVVB 5GTHH 2W8ZA 1L0LE 1NTKK 2GUSA 3H1LG 1SFCB 2HYNA 3SSUA 1FC2C 1VQNP 1DX7A 3Q1MA 3VP8A 1K73Q 3P32A 2WT7A 2RH0A 1FZFA 1W2BO 3CLQA 1KILD 4W7ZA 3KZIH 2Y0DA 1URQC 4RJTA 3LW5J 5KJ7A 1PP9J 3CX5H 1PGPA 3M91A 2ZT9C 1P84I 3C1LA 3CCLP 1YIJP 2O1KA 3CC4P 2KLVA 2CPSA 2K9YA 3L72G 2Q9IA 2JWAA 1P84H 3HUSA 3NFQA 2WPQA 1VQ4P 3L36A 1EXIA 1FJKA 1EZVE 2H88C 4LLHA 2Z5HA 3CWBG 1WT6A 2WSCH 1VF5C 2WPVB 2GM4A 2D2CB 4ASWA 4D6TG 1GK4A 1KILA 2ZXEB 1BE3G 2KOGA 3CI9A 3QWOC 2YO3A 4JYCA 2FYNB 1NYHA 5DJUB 1T2KD 3BCCD 1KQGB 5AVQB 1FZAA 2KNCA 3H1IJ 1CI6B 1FE6A 1W2EA 1FZCA 2WPSA 3RK2D 2R5DA 1Q82Q 3BASA 4GOEA 2N1TD 1KILE 1WRGA 1DH3A 4DCKA 3MP7B 3CCVP 1BDDA 4KJMA 1K8AQ 4K3AA 3B4SA 2UWJE 4OGQB 3CCEP 1YYCA 1QL2A 3V2RA 3B5NC 3MUDA 3H1HD 2HPCA 2Q6QA 3FGAD 4JYBA 1GL2D 3D70A 1IFJA 2AEJA 3L75E 2ZYAA 2QJYC 2NPSB 3H1KJ 1NTZJ 5AW2B 3V4WA 2I8DA 1U7JA 2KI7B 2OARA 4IFFA 2MKVA 1L0NK 2OYIC 4Y28J 1KC8Q 1EZVI 2H43A 3P8MC 3CL3D 2E42A 1FDMA 1L4AC 1L0LJ 1AJYA 3GLMA 1L0NE 2K9JB 2IFMA 1QVGO 2M5AB 5E79E 1SQBG 2N1TA 3CCMP 1R5LA 1DIPA 3FWLA 2W90A 1IFPA 2WSEJ 1HGZA 1KYOD 3AE9C 3H1LD 3HTKA 4WY4B 3BCCE 1BGYG 1IK7A 4DOJA 5KLVG 1RF1B 1EQ7A 3Q5RA 1VQMP 2B87A 3PH0A 4BWNA 3H32B 5TISH
chains in the Genus database with same CATH topology
1CI6A 3C9IA 3UIAA 3OAKA 1E5WA 3NMDA 2Q5UA 1AQ5A 2FYZA 3A5TA 3T97A 1IJDB 1GD2E 1S9KD 3M0AA 1L4AA 2P1JA 1CSBA 2M8RA 1RF0C 5AW8B 1NAFA 1IO4A 2HG5D 3RK2C 3VYIA 1LTTC 1LTJC 5APUA 2A45G 2Z4EA 2Z5IA 1SVFA 3V2NA 1RE3A 1N73C 1SQQK 2XU6A 2LKMA 1HBWA 5AW9B 1SQXK 5CMZA 2KSJA 3RL0B 2YKQA 1ZR2A 1LWUC 4WY4C 3U1AA 1H89A 1J1DB 2WSEH 3VP9A 2P7JA 5AW3B 2FFDC 2PAJA 3VMZA 2NPSA 2I1KA 1JY2N 3M0DC 2Q7CA 2KYVA 1FZEA 2W6AA 3VMYA 1RF1C 4N78D 5AW1B 1GL2C 1LGHB 1RE4A 4RESB 1HH0A 1NKZB 3HRNA 2WT7B 1URQD 1LTAC 3GHGC 5APSA 3G3ZA 3N7NA 3HD7A 2CPBA 4Y99B 4HYTB 1XTGB 3TK1A 1JY2O 1X79B 3HE4A 3BVHA 4WB4A 2GUVA 3OJAB 4I2LC 5AW0B 1YTZI 4IFDK 3KDPB 1VPCA 5AVXB 3HE4B 1JOCA 2QM7A 3P8CE 3MD0A 4B86A 5AVSB 1RF0A 1HUCA 2WITA 1G2CA 3RL0D 1LT9B 4N3YB 4AYCA 3M06A 2VRSA 1OWAA 3LIEA 1NTMK 4GKGA 1GU5A 1G2CB 1N73A 3RL0C 3KPEA 1GK6A 1SQPK 1J1DC 2WWWA 1HWTC 1YTZT 1LWUA 4WY4A 2M3BA 4KHXA 3KQGA 2FKWB 3VOPA 3LIDA 2OYHB 2W27A 4AQRD 5APXA 2WTYA 2FFDA 3O8ZA 1T3JA 3M0DA 1FBMA 1MV8A 3KYQA 5AVZB 1DEBA 2Q3IA 1NU1K 3HUSB 1IFNA 5APWA 3V2QA 1GL2A 5APYA 1IC2A 4XE5B 1NWQA 1RE4C 2L5GB 4ZKPA 1N7SD 4JF7A 1KFNA 5KTBA 1FU1A 3H32A 3GHGA 4Y99C 1HVVA 1URQA 3SWYA 4AUWA 2YKOA 3L35A 3VTPC 1N7LA 3EQ2A 1MZ9A 5KJ7C 1URQB 1X9VA 3IR9A 2JEEA 1QL1A 2H8PD 1KILB 3L37A 3HE5A 1LT9C 5AVYB 2JJLA 3B8EB 2P2UA 4I1LA 5CJ4A 1GW4A 5AW6B 1L0LK 1M7LA 3HE5B 4O9BA 4C7RA 4EOTA 1LTGC 1LTIC 2HLOA 2P67A 2YNYA 4N78E 5AVVB 1JO5A 2OYHC 5CHXA 4GT1A 1FOSE 1NTKK 2GUSA 1XTCC 1T3UA 1SFCB 2HYNA 3HUSC 1FZCB 2IPPA 1DX7A 5AW5B 3VP8A 1N2DC 3P32A 5CCHD 2WT7A 5CCGD 5APVA 1J2JB 2QM8A 1FZFA 1CZQA 3VMXA 3CLQA 3PP5A 1ZR4A 4C46A 1NO4A 1H8AA 5CJ0A 1KILD 4W7ZA 2MJZA 4LC1A 3SWFA 1URQC 5AVTB 1N7SB 2C0XA 2H7HA 5KJ7A 2ZFCA 3RK3D 1KILC 2IX7C 3BATA 2O01H 1JTHA 3M91A 3M9BA 4HH2A 1LT9A 1SLQA 1X8YA 2J58A 2OYIA 1JTHB 3V4QA 5BVZA 2O1KA 2R3CA 3N4XA 1SFCD 2KLVA 2R32A 2CPSA 2OYHA 2FYUK 1SFCC 1Z56A 1JNMA 2Q9IA 1FZCC 1HGVA 1SQVK 3L4FA 3HUSA 3NFQA 2FXMA 2R5BA 2WPQA 3L36A 1FJKA 2N1TB 3P8CD 3A2AA 4LLHA 1S9KE 3TNUA 2NPSD 2Z5HA 2XZRA 5BU8B 5APQA 5CCHA 2POHA 1GZLA 1M1JA 1WT6A 2WSCH 3TNUB 1HJBA 1N7SC 3B5NB 1SP4A 1PFIA 1J1EB 2GM4A 2XDJA 1M1JB 1FAVA 4EIJA 1GK4A 1GTWA 1SQBK 1KILA 3HTKB 3LW5H 2ZXEB 3M9HA 1JMMA 2KOGA 1G1JA 3CI9A 1H88A 3HD7D 2WSFH 4LGDE 2XV5A 2YO3A 4JYCA 2YKPA 1GDTA 3RK3B 1T2KD 4C7NB 3H6PA 1KZUB 5AVQB 2HFED 2YMYA 1KQLA 1FZAA 1GW3A 1RY3A 1T2KC 4N6JA 1IFDA 2OYIB 1IK9A 3TSIA 3TYYA 1OXZA 1CI6B 4W7YA 5KLVK 1A02F 1SFCA 1W2EA 2PP6A 5AW7B 1FZCA 1MUUA 2WPSA 2R5DA 3RK2D 3OA7A 3BASA 2N1TD 2HODA 1L4AB 2A45I 1WRGA 1DH3A 1FOSF 3I5CA 2HODB 2N1TC 4WY4D 2C0WA 3B5ND 3NXSA 1YYCA 1IFMA 1FZGA 5CCHC 1QL2A 3V2RA 3B5NC 3MUDA 5CCGC 1J1EC 2HPCA 1N7SA 1M1JC 1N86A 4ZKUA 2C9NY 4JYBA 1CW5A 1GL2D 3M9QA 1IFJA 1JY3P 5AVRB 2A45H 4I6MC 2HPCB 1NKNA 2KP8A 2NPSB 1JCDA 3EFGA 1T8ZA 5AW2B 3V4WA 4W80A 2BASA 3MTUE 4DZOA 1MFZA 2C9LY 3U1CA 3RK3C 3V2PA 2OARA 4IFFA 1FZBA 1L0NK 5BU5A 1A02J 1GU4A 2I1JA 2N9BA 2OYIC 1IFIA 4M3LA 1KFMA 1L4AD 2XNXA 3HD7B 3A7OA 2H43A 5AVWB 3P8MC 3CL3D 2E42A 1FDMA 1L4AC 1ZN5A 3WMM0 3VN0A 4OH8B 1NH4A 2IFMA 3MIWA 1JY3N 2J59M 2YO2A 1G1IA 2W6BA 1LTJA 2WPRA 2N1TA 1JUNA 1AFOA 3RK2B 3V5BA 1RE3C 2IFNA 1LTJB 3A3YB 1ZV8A 1JCCA 1NHLA 1N73B 1NOHA 3B5NA 5CCGA 1HGZA 1FJPA 3BRTB 2KB7P 1LWUB 3HTKA 2NPSC 4WY4B 1LTSC 3U59A 1VDFA 4WBAA 1RF1A 1JY3O 2FFDB 2XKMA 2O1JA 4GIFA 4DOJA 3P7KA 5AVUB 3MGNA 1HTLC 1RF1B 1EQ7A 5AW4B 3R2PA 3BRVB 3IFMA 1GL2B 1NTZK 4C7NA 2E43A 5APTA 5KJ7D 2WZ7A 3E1IA 3H32B 3II6A 4XA4A 3HD7C 3GHGB 1LTBC 1JY2P 4IFMA 1ZLLA 3NTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B5N D;  1T3J A;  3KYQ A;  1JTH B;  5CCH C;  3B5N C;  5CCG C;  1L4A A;  1GL2 A;  1N7S A;  1GL2 D;  1N7S D;  2M8R A;  1SFC D;  4JF7 A;  2NPS B;  1HVV A;  2HG5 D;  3RK2 C;  1SFC C;  4W80 A;  1URQ A;  3RK3 C;  5KJ7 C;  1URQ B;  3RL0 B;  4WY4 C;  2H8P D;  1KIL B;  2NPS A;  1L4A D;  2N1T B;  3HD7 B;  3M0D C;  2NPS D;  5CCH A;  1L4A C;  1GL2 C;  1N7S C;  3B5N B;  4N78 E;  2XDJ A;  4OH8 B;  1URQ D;  1KIL A;  3HTK B;  2KOG A;  2N1T A;  3HD7 A;  1XTG B;  3RK2 B;  3HD7 D;  1SFC B;  4LGD E;  1NHL A;  3RK3 B;  3B5N A;  5CCG A;  3P8C E;  5CCH D;  2HFE D;  5CCG D;  2YMY A;  4WY4 B;  2NPS C;  3TSI A;  3PP5 A;  3RL0 D;  4W7Y A;  1SFC A;  2PP6 A;  1KIL D;  4W7Z A;  3RK2 D;  1URQ C;  2N1T D;  3RL0 C;  1L4A B;  1GL2 B;  1N7S B;  5KJ7 A;  3RK3 D;  1KIL C;  4WY4 A;  5KJ7 D;  2WZ7 A;  2N1T C;  3VOP A;  3HD7 C;  1JTH A;  4WY4 D; 
#chains in the Genus database with same CATH topology
 2E76 C;  1AQ5 A;  1IJD B;  3M0A A;  1ZRT D;  1KB9 H;  3ZDM A;  5AW8 B;  2KZJ A;  2ZVO B;  3RK2 C;  3RGU A;  3AEA C;  3AE5 C;  1HBW A;  1SQX K;  3L72 D;  2YKQ A;  2PGD A;  3MHV A;  1JEK A;  1BSH A;  2IZ0 A;  2KYV A;  4N78 D;  1QLE D;  3SWK A;  1GL2 C;  1SQX E;  4JQ0 D;  2QSI A;  3CWB D;  1NKZ B;  2WT7 B;  1LTA C;  3GHG C;  2XND H;  2RN0 A;  3L73 E;  3CME P;  1X79 B;  1QVF O;  2GUV A;  5AW0 B;  4IFD K;  1S72 P;  2QJP C;  3HE4 B;  1JOC A;  4ASV A;  4WVZ A;  1PIX A;  2Q1K A;  1RF0 A;  3CXH H;  2WIT A;  3RL0 D;  4AYC A;  3LIE A;  2RKL A;  1NTM K;  4GKG A;  4UB8 E;  1N73 A;  1KN7 A;  2M0B A;  2M3B A;  5APX A;  2FFD A;  4QMA A;  1T3J A;  1PGO A;  4H13 B;  3L75 J;  1NTM E;  4RO0 A;  1M8O B;  3HUS B;  1FDI A;  4PJ0 E;  5APW A;  3CX5 D;  5M1B A;  3V2Q A;  4GOD A;  1IC2 A;  1M1K Q;  2L5G B;  1S5L H;  1N7S D;  4JF7 A;  4H0L B;  2YMK A;  3WUU A;  3G9R A;  4UB6 H;  3FXD A;  1LNQ A;  1OW6 A;  1DEE G;  3VTP C;  1MZ9 A;  1SQQ G;  1ZW0 A;  1X9V A;  3IR9 A;  1UII A;  2H8P D;  1KIL B;  3RBZ A;  3L37 A;  1L0N J;  1SS1 A;  1LT9 C;  1EDL A;  4I1L A;  2Y9Z A;  1X0T A;  4ZNC A;  2FBW C;  4EDF A;  3OW2 O;  4PD4 E;  4N78 E;  5L8R J;  2JWD A;  4I7Z B;  2KNC B;  3BCC J;  1SQB D;  1FZC B;  2IPP A;  2E74 B;  1N2D C;  5APV A;  4BRY B;  1VQL P;  2Y0C A;  1YHQ P;  1J2J B;  3JCU H;  1YJN P;  1BCC G;  1NO4 A;  2W6J H;  4U3F G;  4BXL A;  1BGY D;  1AQT A;  5AVT B;  2H7H A;  2QJK B;  2ZFC A;  1USE A;  3RK3 D;  5KLV D;  1SQP G;  2IX7 C;  1JTH A;  3EWK A;  2WSF J;  1SQV G;  1JM0 A;  2IBZ G;  3CCR P;  2R3C A;  4UB8 H;  3N4X A;  2O3J A;  5H2F E;  2R3S A;  3V6I A;  1S4X A;  1HF9 A;  2FXM A;  1SQX J;  3L70 G;  4PJ0 H;  3IN6 A;  2DW3 A;  2N1T B;  3TNU A;  2XZR A;  4H44 B;  2POH A;  2BCC E;  2B88 A;  3L73 J;  1HJB A;  1N7S C;  4PD4 I;  4YPC A;  1NU1 E;  2L91 A;  1J1E B;  1M1J B;  4NPD A;  4EIJ A;  1SQB K;  3LW5 H;  3HTK B;  4MN4 C;  3M9H A;  1JMM A;  4IL6 E;  1S5L X;  1YQ3 C;  1PPJ G;  1G1J A;  3I56 P;  3HD7 D;  3W67 A;  2WQY C;  4LGD E;  1GDT A;  2B87 B;  1LT1 A;  1SQB E;  2FXO A;  4RKU J;  2A06 G;  1VQP P;  4N6J A;  1IK9 A;  1E79 H;  2AXC A;  1OXZ A;  3TSI A;  5KLV K;  3H25 A;  2QG4 A;  2BEQ D;  2PP6 A;  3L74 D;  5AW7 B;  2SPZ A;  1AA0 A;  3OA7 A;  2P10 A;  2HOD A;  1NTM J;  2K3R A;  3I5C A;  1M57 D;  4OVN F;  3G71 P;  3B5N D;  5KLI C;  3R4Y A;  3H1J G;  1NTK E;  1IFM A;  1N86 A;  4PV1 D;  5AVR B;  3L71 G;  3EFG A;  1KD1 Q;  2E5T A;  4W80 A;  4DJG A;  3MTU E;  2FYU G;  3TGU G;  2C9L Y;  2QEX P;  3RK3 C;  1KB9 D;  1FZB A;  1H0T A;  2FXP A;  5BU5 A;  1A02 J;  1GU4 A;  2E75 B;  1KFM A;  1SQQ D;  1L4A D;  2XNX A;  4U7J A;  5AVW B;  3A0H E;  5C39 A;  4HB1 A;  3WMM 0;  3VN0 A;  4A7P A;  4L75 A;  2W6B A;  1LTJ A;  2ZYG A;  2YXQ B;  1PP9 G;  1JCC A;  4EYY Q;  3CCJ P;  1N73 B;  4XFJ A;  3B5N A;  1VL2 A;  3CD6 P;  2QIW A;  5CBO A;  1K9M Q;  4WBA A;  2FFD B;  2YIU B;  2GA1 A;  3P7K A;  2JP3 A;  3WU2 E;  4IL6 H;  1RQU A;  3WUT A;  1OVU A;  5AW4 B;  3L74 E;  3RL0 g;  2E76 D;  4U3F D;  3CXH D;  2E43 A;  2WZ7 A;  3HD7 C;  4OWF A;  1JY2 P;  2OYI A;  3NTN A;  3AEF C;  3AEC C;  3C9I A;  3UIA A;  2JKV A;  1E5W A;  2Q5U A;  1SQP D;  3A5T A;  1N8R Q;  1S9K D;  1K05 A;  1L4A A;  1M90 Q;  1IZN B;  3T97 B;  2YXR B;  2M8R A;  3E1R A;  2KSE A;  2IBZ D;  2K37 A;  1OW8 A;  1LTJ C;  2Z5I A;  3O6Q A;  1SQQ K;  2KSJ A;  2BCC J;  3RL0 B;  1LWU C;  2WSE H;  3C8V A;  5AW3 B;  1NU1 J;  3M0D C;  2Q7C A;  1FZE A;  2W6A A;  3S1K A;  1OFC X;  1GMJ A;  4PV1 C;  3H1I G;  4CPG A;  1HH0 A;  3GF3 A;  2Y0E A;  4HYT B;  3MZW B;  1JY2 O;  3F89 A;  1RH5 B;  1PGQ A;  3OJA B;  4I2L C;  1PPJ D;  3KDP B;  1VPC A;  2PRR A;  5AVS B;  5KKZ B;  1LJ2 A;  1G2C A;  2VRS A;  1OW7 A;  1OWA A;  3AEE C;  2A06 D;  1GU5 A;  3Q3D A;  3H1K G;  1Q90 D;  1SQP K;  1AVO A;  1J1D C;  1NTK J;  1OZH A;  2WWW A;  1NTZ G;  4KHX A;  2FKW B;  2LXC B;  2W27 A;  2WTY A;  3O8Z A;  3CMA P;  2LXB A;  3KYQ A;  5AVZ B;  1DEB A;  2Q3I A;  1GL2 A;  5KTB A;  3JSV C;  3GHG A;  2P58 A;  3TF5 A;  4K35 A;  4Y99 C;  1L0L G;  4YTP C;  3VMA A;  3SWY A;  1KQS O;  4IL6 X;  1URQ B;  1OVV A;  2FYU D;  3TGU D;  3S9O A;  1QL1 A;  3HE5 A;  2B9B A;  2OQQ A;  1Q2N A;  3B8E B;  2P2U A;  3E7K A;  3H1H E;  5B5E E;  2ZT9 B;  3PHL A;  1LTI C;  2P67 A;  2YNY A;  1RHZ B;  3IAO A;  2OYH C;  1QGK B;  4GT1 A;  1FOS E;  1XTC C;  2PFX A;  2KK7 A;  2ZJS E;  1EXJ A;  3AE3 C;  1MFT A;  5AW5 B;  1Y9B A;  3USS A;  4YXW H;  2QRX A;  1PP9 D;  5CCH D;  5KAF E;  1EDI A;  5CCG D;  2D2C D;  3L74 J;  1OVR A;  2QM8 A;  4C46 A;  5B66 E;  1U7M A;  1H8A A;  4LC1 A;  2AXT E;  1YJ9 P;  3GW6 A;  4D6T D;  1DD4 A;  1BE3 D;  1Q81 Q;  1VF5 B;  4HKZ H;  1JMB A;  1EZV G;  4JPZ B;  3M9B A;  4HH2 A;  1LT9 A;  1S3J A;  1VQ9 P;  1KYO E;  2J58 A;  3EFF K;  3H1L E;  3V4Q A;  5E79 H;  2R32 A;  4HJG H;  2FYU K;  3AE6 C;  1SFC C;  1JNM A;  1YQ4 C;  1HGV A;  4OGQ D;  3L4F A;  2R5B A;  3P8C D;  3F5H A;  2NPS D;  5BU8 B;  5APQ A;  5CCH A;  1ZRT E;  2B89 A;  3B5N B;  1PFI A;  2XDJ A;  1FAV A;  3FWN A;  2WMM A;  3H1I D;  2QJY B;  2WSF H;  3L72 E;  2XV5 A;  2YKP A;  1P84 D;  3AEG C;  3PRJ A;  1L2P A;  2HFE D;  2YMY A;  3L75 G;  1KQL A;  3CC2 P;  1GW3 A;  1IFD A;  2OYI B;  2OYO A;  3TYY A;  2KXP B;  4W7Y A;  1A02 F;  3CWB E;  1L4A B;  1U57 A;  4D6T E;  1Q7Y Q;  1BE3 E;  4WY4 D;  1ZXG A;  5KAF H;  2C0W A;  1NTZ D;  3FX0 A;  3GF7 A;  5GTH E;  1KYO I;  3O6Q B;  2IDB A;  1FZG A;  2Q3E A;  5B66 H;  5CCH C;  5CCG C;  1L0N G;  2D2C C;  1N7S A;  4YXD C;  1PV3 A;  1DD3 A;  3M9Q A;  1JY3 P;  2HPC B;  1NKN A;  2KP8 A;  1JCD A;  1T8Z A;  2BAS A;  2IZ1 A;  4DZO A;  2NZ2 A;  1MFZ A;  2FYN C;  1L0L D;  3H1H J;  2BEZ F;  1KYO H;  3KZI E;  5CBN A;  3BCC G;  3K5B A;  3S4R A;  3A7O A;  1NAY A;  3CX5 E;  2E76 B;  2K9J A;  3AE4 C;  3PTZ A;  2CK3 H;  1ZN5 A;  4OH8 B;  1NH4 A;  3MIW A;  1W5C E;  1G1I A;  2ZAE B;  1JUN A;  1MKM A;  1AFO A;  4OGQ C;  3QH9 A;  3RK2 B;  1RE3 C;  2QE7 H;  3A3Y B;  1NOH A;  1R8E A;  2KUB A;  3BRT B;  1P84 E;  2NPS C;  3U59 A;  1QEX A;  1RF1 A;  1JY3 O;  2O1J A;  4GIF A;  5AVU B;  3MGN A;  1HTL C;  1FDO A;  3PLN A;  3IFM A;  1GL2 B;  1NTZ K;  3H1L J;  4C7N A;  3CCS P;  5KJ7 D;  3E1I A;  3II6 A;  4IOI H;  3GHG B;  1LTB C;  1ZLL A;  1M56 D;  3OAK A;  4PD4 H;  3NMD A;  2FYZ A;  1EZV D;  1SQX G;  1GD2 E;  2QVA A;  2ZYD A;  2QJP B;  3KXD A;  1CSB A;  1IO4 A;  3Q5P A;  1X22 A;  3L73 G;  1BGY E;  2JO1 A;  1LTT C;  5APU A;  3SFD C;  2Z4E A;  1SVF A;  3V2N A;  3RK3 E;  5KLV E;  2LKM A;  5AW9 B;  4WY4 C;  1H89 A;  4NPE A;  3VP9 A;  2P7J A;  1OIP A;  2PAJ A;  3VMZ A;  4H0L D;  1JY2 N;  2G8Y A;  3G6E P;  3CX5 I;  3VMY A;  1RF1 C;  5AW1 B;  3L72 J;  3HRN A;  4L74 A;  2AEF A;  5APS A;  3G3Z A;  3N7N A;  1ZME C;  3HD7 A;  2CPB A;  5GTI E;  1NTM G;  3HE4 A;  2M3E A;  4EI2 A;  3FXE A;  4WB4 A;  1YTZ I;  3Q5S A;  5AVX B;  3CWB J;  5H2F H;  4KT0 J;  3IF4 A;  1WMK A;  3MD0 A;  1HUC A;  1NGM B;  1R5S A;  1LT9 B;  4N3Y B;  4D6T J;  3L75 D;  1VQ7 P;  1BE3 J;  1Q86 Q;  2AEM A;  1GK6 A;  1S2E A;  1HWT C;  2E74 D;  3SFE C;  1LWU A;  3VOP A;  3GG2 A;  3M0D A;  1FBM A;  5EFW B;  2ZXX A;  1NWQ A;  2H89 C;  1FU1 A;  1BCC D;  1L0N D;  1HVV A;  1KQF B;  2IYP A;  3CPW O;  1JB0 J;  2YKO A;  4AUW A;  1ZOY C;  1N7L A;  3EQ2 A;  5KJ7 C;  4TLF A;  3AEB C;  1SQV D;  2JJL A;  5CJ4 A;  1GW4 A;  5TIS E;  4C7R A;  2HLO A;  3D71 A;  1JO5 A;  2Y9Y A;  5CHX A;  3RBX A;  4H13 C;  1KB9 E;  1KMI Z;  3PJS K;  3CCU P;  1T3U A;  1LP1 A;  3HUS C;  4H44 D;  1VQO P;  4BRY A;  3L70 D;  1SQQ E;  4H0L C;  2KS1 A;  1CZQ A;  3VMX A;  3PP5 A;  1ZR4 A;  1VQ5 P;  2WSC J;  2WSS H;  1BDC A;  5CJ0 A;  1SQB J;  2MJZ A;  5GTI H;  3SWF A;  4L73 A;  2OTJ P;  1N7S B;  2C0X A;  2KLU A;  1KIL C;  3A0H H;  3BAT A;  2O01 H;  1AVY A;  1D7M A;  2J5U A;  1SLQ A;  1X8Y A;  2BCC G;  1JTH B;  1VQ6 P;  1YI2 P;  1BGY J;  5BVZ A;  1NU1 G;  3AE1 C;  3A0B E;  1S1C X;  5KLV J;  4I7Z C;  1SFC D;  1SQX D;  2OYH A;  1PL5 A;  1PZQ A;  1Z56 A;  1BCC E;  1FZC C;  4U3F E;  3CXH E;  1SQV K;  3WUV A;  2E74 C;  3L73 D;  2W83 C;  1SQP E;  3WU2 H;  2KIK A;  3H1J D;  3A2A A;  1S9K E;  1SQV E;  1GZL A;  5KLI B;  1M1J A;  3MUD C;  2R44 A;  3TNU B;  2IBZ E;  1VQK P;  2QJK C;  1SP4 A;  3L71 D;  1GTW A;  2O01 J;  2E75 D;  1S5L E;  2N9Y B;  1H88 A;  1KB9 I;  1NTK G;  5TJH A;  4UB6 E;  3RK3 B;  3CC7 P;  1NTM D;  4C7N B;  3H6P A;  1KZU B;  3L70 E;  1RY3 A;  1T2K C;  3AE7 C;  1SFC A;  3CCQ P;  1MUU A;  1YBK A;  2A45 I;  1UIX A;  1FOS F;  2HOD B;  4L76 A;  2N1T C;  2KZI A;  1PPJ E;  4H44 C;  3NXS A;  2NRG A;  1OMI A;  1J1E C;  2JDI H;  1M1J C;  2RMZ A;  4ZKU A;  4WWI A;  2C9N Y;  1CW5 A;  2A45 H;  4I6M C;  4PD4 D;  3KHU A;  2A06 E;  1ZP0 C;  2OTL P;  4R4M A;  5KAI E;  3CXH I;  3I55 P;  3U1C A;  3JCU E;  3V2P A;  4TT3 H;  2V7Q H;  2I1J A;  1EDJ A;  2N9B A;  1KOR A;  3ITK A;  1IFI A;  4R4L A;  4M3L A;  1H0T B;  3A0B H;  3HD7 B;  3H1J E;  2IBZ I;  3L74 G;  1EC5 A;  1JY3 N;  2J59 M;  2YO2 A;  2IYO A;  4JBZ A;  1SQQ J;  2WPR A;  3L71 E;  4GDO A;  1HJ0 A;  1Y8A A;  3JC2 2;  3V5B A;  2IFN A;  2FYU E;  1LTJ B;  3TGU E;  1ZV8 A;  1PGJ A;  1NHL A;  1QX8 A;  5CCG A;  1FJP A;  2KB7 P;  1LWU B;  1LTS C;  1RQV A;  4NPF X;  1VDF A;  2XKM A;  1NVO A;  1USD A;  1BSN A;  3R2P A;  2E5Y A;  3BRV B;  4PV1 B;  2E75 C;  2V7Q J;  5APT A;  1YIT P;  3B71 A;  4DT0 A;  5B5E H;  4XA4 A;  4IFM A;  1CI6 A;  1EDK A;  3D6Z A;  1PP9 E;  3T97 A;  2ZVN B;  3Q2Y A;  1BCC J;  2P1J A;  4U3F J;  2BCC D;  1RF0 C;  1NAF A;  1NU1 D;  1YJW P;  2HG5 D;  3TDK A;  1KV4 A;  3VYI A;  1SQP J;  2A45 G;  2WVR A;  3H1K D;  1RE3 A;  2LR2 A;  1N73 C;  2XU6 A;  1SQV J;  5CMZ A;  1ZR2 A;  3U1A A;  1K04 A;  1J1D B;  2FFD C;  2YIU C;  2NPS A;  4GOF A;  2I1K A;  2AXT H;  3W68 A;  3AE2 C;  1AV1 A;  2K88 A;  1LP1 B;  3ABV C;  1LGH B;  1FS0 E;  2OGU A;  1RE4 A;  4ZMD A;  5KAI H;  4RES B;  1URQ D;  2OTK E;  2KS1 B;  1KTM A;  4Y99 B;  2G3A A;  1XTG B;  3TK1 A;  3L70 J;  3BVH A;  1T6A A;  2HR3 A;  2ZT9 D;  2QM7 A;  3P8C E;  1NTK D;  2M5A A;  4B86 A;  2K1A A;  1OX3 A;  2O01 N;  3AED C;  1VQ8 P;  3M06 A;  3AE8 C;  2V4H A;  1G2C B;  3RL0 C;  3KPE A;  3H1I E;  1YTZ T;  4WY4 A;  1NJI Q;  3KQG A;  2QA4 P;  3LID A;  2OYH B;  4AQR D;  2ITA A;  2FY8 A;  3H1H G;  1MV8 A;  1NU1 K;  1IFN A;  5APY A;  4XE5 B;  1RE4 C;  4ZKP A;  1KFN A;  3GMA A;  3H32 A;  1VF5 D;  5K5G B;  3D6Y A;  4Z1M H;  1URQ A;  2JR8 A;  3L35 A;  3G4S P;  3H1K E;  3H1J J;  2JEE A;  1NTZ E;  5KKZ C;  1TU3 F;  5AVY B;  5AW6 B;  1L0L K;  1M7L A;  1Y47 A;  3HE5 B;  4O9B A;  4EOT A;  3L71 J;  1LTG C;  2FYU J;  5DJT B;  4H13 D;  3TGU J;  5AVV B;  5GTH H;  2W8Z A;  1L0L E;  1NTK K;  2GUS A;  3H1L G;  1SFC B;  2HYN A;  3SSU A;  1FC2 C;  1VQN P;  1DX7 A;  3Q1M A;  3VP8 A;  1K73 Q;  3P32 A;  2WT7 A;  2RH0 A;  1FZF A;  1W2B O;  3CLQ A;  1KIL D;  4W7Z A;  3KZI H;  2Y0D A;  1URQ C;  4RJT A;  3LW5 J;  5KJ7 A;  1PP9 J;  3CX5 H;  1PGP A;  3M91 A;  2ZT9 C;  1P84 I;  3C1L A;  3CCL P;  1YIJ P;  2O1K A;  3CC4 P;  2KLV A;  2CPS A;  2K9Y A;  3L72 G;  2Q9I A;  2JWA A;  1P84 H;  3HUS A;  3NFQ A;  2WPQ A;  1VQ4 P;  3L36 A;  1EXI A;  1FJK A;  1EZV E;  2H88 C;  4LLH A;  2Z5H A;  3CWB G;  1WT6 A;  2WSC H;  1VF5 C;  2WPV B;  2GM4 A;  2D2C B;  4ASW A;  4D6T G;  1GK4 A;  1KIL A;  2ZXE B;  1BE3 G;  2KOG A;  3CI9 A;  3QWO C;  2YO3 A;  4JYC A;  2FYN B;  1NYH A;  5DJU B;  1T2K D;  3BCC D;  1KQG B;  5AVQ B;  1FZA A;  2KNC A;  3H1I J;  1CI6 B;  1FE6 A;  1W2E A;  1FZC A;  2WPS A;  3RK2 D;  2R5D A;  1Q82 Q;  3BAS A;  4GOE A;  2N1T D;  1KIL E;  1WRG A;  1DH3 A;  4DCK A;  3MP7 B;  3CCV P;  1BDD A;  4KJM A;  1K8A Q;  4K3A A;  3B4S A;  2UWJ E;  4OGQ B;  3CCE P;  1YYC A;  1QL2 A;  3V2R A;  3B5N C;  3MUD A;  3H1H D;  2HPC A;  2Q6Q A;  3FGA D;  4JYB A;  1GL2 D;  3D70 A;  1IFJ A;  2AEJ A;  3L75 E;  2ZYA A;  2QJY C;  2NPS B;  3H1K J;  1NTZ J;  5AW2 B;  3V4W A;  2I8D A;  1U7J A;  2KI7 B;  2OAR A;  4IFF A;  2MKV A;  1L0N K;  2OYI C;  4Y28 J;  1KC8 Q;  1EZV I;  2H43 A;  3P8M C;  3CL3 D;  2E42 A;  1FDM A;  1L4A C;  1L0L J;  1AJY A;  3GLM A;  1L0N E;  2K9J B;  2IFM A;  1QVG O;  2M5A B;  5E79 E;  1SQB G;  2N1T A;  3CCM P;  1R5L A;  1DIP A;  3FWL A;  2W90 A;  1IFP A;  2WSE J;  1HGZ A;  1KYO D;  3AE9 C;  3H1L D;  3HTK A;  4WY4 B;  3BCC E;  1BGY G;  1IK7 A;  4DOJ A;  5KLV G;  1RF1 B;  1EQ7 A;  3Q5R A;  1VQM P;  2B87 A;  3PH0 A;  4BWN A;  3H32 B;  5TIS H; 
#chains in the Genus database with same CATH homology
 1CI6 A;  3C9I A;  3UIA A;  3OAK A;  1E5W A;  3NMD A;  2Q5U A;  1AQ5 A;  2FYZ A;  3A5T A;  3T97 A;  1IJD B;  1GD2 E;  1S9K D;  3M0A A;  1L4A A;  2P1J A;  1CSB A;  2M8R A;  1RF0 C;  5AW8 B;  1NAF A;  1IO4 A;  2HG5 D;  3RK2 C;  3VYI A;  1LTT C;  1LTJ C;  5APU A;  2A45 G;  2Z4E A;  2Z5I A;  1SVF A;  3V2N A;  1RE3 A;  1N73 C;  1SQQ K;  2XU6 A;  2LKM A;  1HBW A;  5AW9 B;  1SQX K;  5CMZ A;  2KSJ A;  3RL0 B;  2YKQ A;  1ZR2 A;  1LWU C;  4WY4 C;  3U1A A;  1H89 A;  1J1D B;  2WSE H;  3VP9 A;  2P7J A;  5AW3 B;  2FFD C;  2PAJ A;  3VMZ A;  2NPS A;  2I1K A;  1JY2 N;  3M0D C;  2Q7C A;  2KYV A;  1FZE A;  2W6A A;  3VMY A;  1RF1 C;  4N78 D;  5AW1 B;  1GL2 C;  1LGH B;  1RE4 A;  4RES B;  1HH0 A;  1NKZ B;  3HRN A;  2WT7 B;  1URQ D;  1LTA C;  3GHG C;  5APS A;  3G3Z A;  3N7N A;  3HD7 A;  2CPB A;  4Y99 B;  4HYT B;  1XTG B;  3TK1 A;  1JY2 O;  1X79 B;  3HE4 A;  3BVH A;  4WB4 A;  2GUV A;  3OJA B;  4I2L C;  5AW0 B;  1YTZ I;  4IFD K;  3KDP B;  1VPC A;  5AVX B;  3HE4 B;  1JOC A;  2QM7 A;  3P8C E;  3MD0 A;  4B86 A;  5AVS B;  1RF0 A;  1HUC A;  2WIT A;  1G2C A;  3RL0 D;  1LT9 B;  4N3Y B;  4AYC A;  3M06 A;  2VRS A;  1OWA A;  3LIE A;  1NTM K;  4GKG A;  1GU5 A;  1G2C B;  1N73 A;  3RL0 C;  3KPE A;  1GK6 A;  1SQP K;  1J1D C;  2WWW A;  1HWT C;  1YTZ T;  1LWU A;  4WY4 A;  2M3B A;  4KHX A;  3KQG A;  2FKW B;  3VOP A;  3LID A;  2OYH B;  2W27 A;  4AQR D;  5APX A;  2WTY A;  2FFD A;  3O8Z A;  1T3J A;  3M0D A;  1FBM A;  1MV8 A;  3KYQ A;  5AVZ B;  1DEB A;  2Q3I A;  1NU1 K;  3HUS B;  1IFN A;  5APW A;  3V2Q A;  1GL2 A;  5APY A;  1IC2 A;  4XE5 B;  1NWQ A;  1RE4 C;  2L5G B;  4ZKP A;  1N7S D;  4JF7 A;  1KFN A;  5KTB A;  1FU1 A;  3H32 A;  3GHG A;  4Y99 C;  1HVV A;  1URQ A;  3SWY A;  4AUW A;  2YKO A;  3L35 A;  3VTP C;  1N7L A;  3EQ2 A;  1MZ9 A;  5KJ7 C;  1URQ B;  1X9V A;  3IR9 A;  2JEE A;  1QL1 A;  2H8P D;  1KIL B;  3L37 A;  3HE5 A;  1LT9 C;  5AVY B;  2JJL A;  3B8E B;  2P2U A;  4I1L A;  5CJ4 A;  1GW4 A;  5AW6 B;  1L0L K;  1M7L A;  3HE5 B;  4O9B A;  4C7R A;  4EOT A;  1LTG C;  1LTI C;  2HLO A;  2P67 A;  2YNY A;  4N78 E;  5AVV B;  1JO5 A;  2OYH C;  5CHX A;  4GT1 A;  1FOS E;  1NTK K;  2GUS A;  1XTC C;  1T3U A;  1SFC B;  2HYN A;  3HUS C;  1FZC B;  2IPP A;  1DX7 A;  5AW5 B;  3VP8 A;  1N2D C;  3P32 A;  5CCH D;  2WT7 A;  5CCG D;  5APV A;  1J2J B;  2QM8 A;  1FZF A;  1CZQ A;  3VMX A;  3CLQ A;  3PP5 A;  1ZR4 A;  4C46 A;  1NO4 A;  1H8A A;  5CJ0 A;  1KIL D;  4W7Z A;  2MJZ A;  4LC1 A;  3SWF A;  1URQ C;  5AVT B;  1N7S B;  2C0X A;  2H7H A;  5KJ7 A;  2ZFC A;  3RK3 D;  1KIL C;  2IX7 C;  3BAT A;  2O01 H;  1JTH A;  3M91 A;  3M9B A;  4HH2 A;  1LT9 A;  1SLQ A;  1X8Y A;  2J58 A;  2OYI A;  1JTH B;  3V4Q A;  5BVZ A;  2O1K A;  2R3C A;  3N4X A;  1SFC D;  2KLV A;  2R32 A;  2CPS A;  2OYH A;  2FYU K;  1SFC C;  1Z56 A;  1JNM A;  2Q9I A;  1FZC C;  1HGV A;  1SQV K;  3L4F A;  3HUS A;  3NFQ A;  2FXM A;  2R5B A;  2WPQ A;  3L36 A;  1FJK A;  2N1T B;  3P8C D;  3A2A A;  4LLH A;  1S9K E;  3TNU A;  2NPS D;  2Z5H A;  2XZR A;  5BU8 B;  5APQ A;  5CCH A;  2POH A;  1GZL A;  1M1J A;  1WT6 A;  2WSC H;  3TNU B;  1HJB A;  1N7S C;  3B5N B;  1SP4 A;  1PFI A;  1J1E B;  2GM4 A;  2XDJ A;  1M1J B;  1FAV A;  4EIJ A;  1GK4 A;  1GTW A;  1SQB K;  1KIL A;  3HTK B;  3LW5 H;  2ZXE B;  3M9H A;  1JMM A;  2KOG A;  1G1J A;  3CI9 A;  1H88 A;  3HD7 D;  2WSF H;  4LGD E;  2XV5 A;  2YO3 A;  4JYC A;  2YKP A;  1GDT A;  3RK3 B;  1T2K D;  4C7N B;  3H6P A;  1KZU B;  5AVQ B;  2HFE D;  2YMY A;  1KQL A;  1FZA A;  1GW3 A;  1RY3 A;  1T2K C;  4N6J A;  1IFD A;  2OYI B;  1IK9 A;  3TSI A;  3TYY A;  1OXZ A;  1CI6 B;  4W7Y A;  5KLV K;  1A02 F;  1SFC A;  1W2E A;  2PP6 A;  5AW7 B;  1FZC A;  1MUU A;  2WPS A;  2R5D A;  3RK2 D;  3OA7 A;  3BAS A;  2N1T D;  2HOD A;  1L4A B;  2A45 I;  1WRG A;  1DH3 A;  1FOS F;  3I5C A;  2HOD B;  2N1T C;  4WY4 D;  2C0W A;  3B5N D;  3NXS A;  1YYC A;  1IFM A;  1FZG A;  5CCH C;  1QL2 A;  3V2R A;  3B5N C;  3MUD A;  5CCG C;  1J1E C;  2HPC A;  1N7S A;  1M1J C;  1N86 A;  4ZKU A;  2C9N Y;  4JYB A;  1CW5 A;  1GL2 D;  3M9Q A;  1IFJ A;  1JY3 P;  5AVR B;  2A45 H;  4I6M C;  2HPC B;  1NKN A;  2KP8 A;  2NPS B;  1JCD A;  3EFG A;  1T8Z A;  5AW2 B;  3V4W A;  4W80 A;  2BAS A;  3MTU E;  4DZO A;  1MFZ A;  2C9L Y;  3U1C A;  3RK3 C;  3V2P A;  2OAR A;  4IFF A;  1FZB A;  1L0N K;  5BU5 A;  1A02 J;  1GU4 A;  2I1J A;  2N9B A;  2OYI C;  1IFI A;  4M3L A;  1KFM A;  1L4A D;  2XNX A;  3HD7 B;  3A7O A;  2H43 A;  5AVW B;  3P8M C;  3CL3 D;  2E42 A;  1FDM A;  1L4A C;  1ZN5 A;  3WMM 0;  3VN0 A;  4OH8 B;  1NH4 A;  2IFM A;  3MIW A;  1JY3 N;  2J59 M;  2YO2 A;  1G1I A;  2W6B A;  1LTJ A;  2WPR A;  2N1T A;  1JUN A;  1AFO A;  3RK2 B;  3V5B A;  1RE3 C;  2IFN A;  1LTJ B;  3A3Y B;  1ZV8 A;  1JCC A;  1NHL A;  1N73 B;  1NOH A;  3B5N A;  5CCG A;  1HGZ A;  1FJP A;  3BRT B;  2KB7 P;  1LWU B;  3HTK A;  2NPS C;  4WY4 B;  1LTS C;  3U59 A;  1VDF A;  4WBA A;  1RF1 A;  1JY3 O;  2FFD B;  2XKM A;  2O1J A;  4GIF A;  4DOJ A;  3P7K A;  5AVU B;  3MGN A;  1HTL C;  1RF1 B;  1EQ7 A;  5AW4 B;  3R2P A;  3BRV B;  3IFM A;  1GL2 B;  1NTZ K;  4C7N A;  2E43 A;  5APT A;  5KJ7 D;  2WZ7 A;  3E1I A;  3H32 B;  3II6 A;  4XA4 A;  3HD7 C;  3GHG B;  1LTB C;  1JY2 P;  4IFM A;  1ZLL A;  3NTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...