2M8RA

Pre-fusion solution nmr structure of neuronal snare syntaxin 1a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
109
structure length
109
Chain Sequence
GSHMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Syntaxin-1A
publication title Prefusion structure of syntaxin-1A suggests pathway for folding into neuronal trans-SNARE complex fusion intermediate.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 29
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05739 SNARE SNARE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2m8rA00
3RK3D 4W7YA 5CCGA 3B5NA 3P8CE 1N7SC 1JTHB 3VOPA 3M0DC 2XDJA 1KILB 2PP6A 4WY4A 3RL0B 2N1TA 2HG5D 1GL2A 1SFCC 5CCGC 1N7SA 5CCGD 4W80A 2NPSB 4WY4C 3RK2D 2N1TC 1GL2C 1SFCA 4WY4D 2N1TD 1GL2D 1N7SD 1URQA 3B5NB 2KOGA 5CCHC 3HTKB 1L4AC 4N78E 3RK2B 5CCHD 3RK3B 1SFCD 2H8PD 5KJ7C 4WY4B 1L4AD 2N1TB 1GL2B 1URQC 5CCHA 1N7SB 1L4AA 1URQD 4JF7A 3HD7A 1NHLA 5KJ7A 3RL0C 1SFCB 3RL0D 1JTHA 3HD7C 4W7ZA 1URQB 2NPSC 1T3JA 1KILA 3HD7D 5KJ7D 2NPSD 2HFED 3TSIA 4OH8B 2YMYA 2NPSA 2WZ7A 3KYQA 1KILC 3PP5A 3B5NC 1L4AB 2M8RA 3RK2C 1KILD 4LGDE 1HVVA 3B5ND 3HD7B 3RK3C 1XTGB
chains in the Genus database with same CATH superfamily
5CCGA 4W7YA 3B5NA 3GHGB 1L0LJ 4EYYQ 3A0BE 2BCCE 2IBZI 3A3YB 2XDJA 1KILB 1NU1E 1LTJA 3HE5A 3RL0B 5BU5A 4AQRD 2NPSB 1SS1A 1VQ4P 4KHXA 3TGUD 2RH0A 2PFXA 3D6ZA 3JC22 3S9OA 3FWNA 4GOFA 3B5NB 3HUSA 1CI6A 2QRXA 1LTJB 3GF3A 4XE5B 3V2NA 1YBKA 2XV5A 1YIJP 5H2FE 3N4XA 3T97A 1L2PA 1RY3A 2KK7A 1NU1K 3M06A 1SQXE 4GT1A 2DW3A 2R3SA 3A0BH 1SQPE 5APSA 1QX8A 1KB9D 3K5BA 3L72G 1DEEG 3BCCD 4MN4C 1T3JA 4IFMA 1AFOA 2XKMA 3KHUA 5B66E 5APXA 3HUSB 1NTME 1CI6B 2BCCJ 2WPVB 1NU1J 1FZBA 4D6TG 3T97B 1USDA 1RHZB 2R3CA 1PPJG 1OMIA 4AUWA 3P7KA 5AVUB 4H13D 3F89A 1VQMP 4GIFA 1JM0A 4YTPC 3L37A 1Q90D 3BASA 1SQXK 3L75E 5H2FH 4BRYA 1SQPK 2P1JA 3CX5I 4WVZA 2HODA 4H0LB 5AVWB 3S4RA 3L72D 3SFDC 1NTMK 1YQ3C 2Q3EA 1H89A 3G9RA 3CCLP 1FU1A 1SQXJ 3BRTB 2LKMA 1HJ0A 1SQPJ 3NFQA 2VRSA 3M9HA 1JY3P 4BRYB 1NTMJ 1FJKA 3V5BA 5AW2B 2HODB 3G71P 1S9KE 1NHLA 3VN0A 1JCDA 3AE8C 5AVTB 4I1LA 4EOTA 3L74G 3CCEP 1OW6A 2IZ0A 2QA4P 3KXDA 2YKQA 1IFJA 1PGOA 2W83C 2B9BA 4ZKUA 1KYOD 3L75J 1SQQK 3MUDA 4YXDC 4OVNF 2J5UA 1KILD 1H0TA 1EQ7A 5E79H 1GTWA 1X9VA 3RGUA 3L72E 1N7SC 3AECC 5AW7B 3Q5RA 5K5GB 2MJZA 2B89A 4ZKPA 2PAJA 2BEQD 3VTPC 3L4FA 3AE2C 4D6TE 1VQ9P 2Z5IA 3EFGA 4EIJA 5CCGD 2QM8A 2I1JA 2CPBA 1OVVA 3L74D 5AVSB 1GL2C 1SFCA 1PPJE 4B86A 1PP9G 1ZMEC 4JYCA 2E74C 3KDPB 2OARA 1MUUA 4DOJA 3PRJA 4N78E 3V6IA 2JWAA 1IZNB 3SSUA 1GZLA 2AEJA 1URQC 1FAVA 4IL6E 1NYHA 5KTBA 4GOEA 1KN7A 1BE3D 3CXHE 2P58A 3H1LG 2ZT9C 1KYOE 1SFCB 3L70G 2FYNC 5CMZA 2WQYC 4Y28J 2N9BA 2FXOA 2JJLA 4JBZA 3L72J 1QEXA 3A7OA 2NRGA 3M9QA 1JMBA 2IPPA 1SQVG 1VDFA 2FXMA 1R5SA 1PP9D 1T2KC 1QL2A 4D6TJ 3IF4A 2W6JH 4ZMDA 2KZJA 5GTIH 3L74E 4TT3H 3R4YA 2A45G 4H0LD 1EDLA 3Q1MA 1JB0J 3M0DC 4IL6H 3I55P 2K88A 1GL2A 3CXHH 1DIPA 1VQ8P 1XTCC 5AW5B 2H7HA 3PLNA 4OWFA 2YMKA 1FZEA 4HB1A 2KIKA 1YQ4C 4R4LA 3F5HA 1URQA 3SFEC 3CCVP 2B87A 5CCHC 3RK2B 1USEA 3WUUA 1GMJA 1JOCA 2IZ1A 3H25A 3LIDA 1N7LA 3I56P 1GL2B 2Z5HA 3Q3DA 2E74B 2KSEA 3AE5C 5KJ7A 1PP9E 3C9IA 1AJYA 3CC7P 3GLMA 2YKOA 4GDOA 1T3UA 2LR2A 1BSNA 1URQB 5DJUB 1HTLC 2B87B 2WSSH 3L74J 3L71G 4Y99C 2E43A 1KB9I 1LTTC 2ZT9B 4IL6X 2N9YB 1BDCA 3H1LE 2ZYDA 4PV1C 5APUA 3L70E 3M0DA 4Z1MH 2E42A 4U7JA 4XFJA 1M57D 2J58A 1RF0C 1X0TA 1M1KQ 2JDIH 4UB8E 1SQVE 4XA4A 2KXPB 1IJDB 2HG5D 3CCJP 1JMMA 2BEZF 1WMKA 1VQ7P 2HLOA 1JO5A 2N1TC 3G4SP 4GODA 3L71D 1PP9J 3CLQA 4HKZH 2QJYB 1VQ5P 1K9MQ 2O01N 5AVRB 4OGQB 1IFDA 2FKWB 2FYUK 1SFCD 4H13B 3VMXA 3R2PA 2M5AA 2QIWA 1PGPA 3AE9C 1HF9A 4JYBA 1LWUC 1EXJA 1SLQA 5BVZA 1U57A 5TISH 2P2UA 2BCCD 1UIIA 1NU1D 1SQVK 1PIXA 3H1LJ 3L70J 4UB8H 1VQOP 5KKZC 3H1HG 3CWBG 1AVYA 1J1DC 3I5CA 1SQVJ 1P84E 3CX5H 1BGYG 1RF0A 2Y0EA 3MHVA 4LGDE 4DJGA 1KYOI 1YTZT 4N3YB 4H44B 4RO0A 3KQGA 3RBXA 3L71E 3SWYA 4WBAA 3VOPA 3PHLA 1SQXD 2N1TA 2XNDH 1SQPD 2P10A 4PV1B 1KZUB 3UIAA 3RK2D 2QJPB 2GUVA 5APVA 1NTMD 1A02J 2C0XA 1YTZI 2JKVA 1SQQG 2PRRA 1GL2D 2M3EA 1GDTA 1UIXA 2E74D 1EZVG 1LWUA 3CCUP 1HWTC 1P84H 4HYTB 3H1IG 1K73Q 2N1TB 3H1JG 4NPEA 1AQTA 1URQD 2AEFA 1NTZK 1H8AA 1S1CX 3L75D 2ZT9D 3PH0A 1JTHA 1JY3N 1LTSC 3HD7C 2KLUA 3H1KG 1FDMA 3HE5B 1S5LE 1LWUB 1FZGA 3OJAB 5KJ7D 1RF1C 3L71J 2KLVA 2KSJA 5KLIC 2YKPA 1VL2A 2KNCA 3PTZA 1SQQD 2IDBA 1HJBA 5KKZB 1T2KD 2LXBA 1H88A 1PV3A 1YJNP 1HGVA 3RK3C 2ZYGA 2OTKE 1U7JA 2P7JA 1FZCA 2H88C 3H1ID 3H1HE 3CWBE 2JR8A 3H1JD 5APWA 3HTKA 1JTHB 3WU2E 1S9KD 1BDDA 5CJ4A 2OTJP 3C1LA 1PZQA 1RQUA 4TLFA 5AW9B 1LTAC 4JQ0D 2YXQB 4YXWH 1YJ9P 1PL5A 1BGYE 1GK6A 2W8ZA 2KNCB 5AW3B 1WRGA 4OGQD 1ZN5A 1Z56A 2G3AA 3CL3D 2H43A 2Y0CA 2AEMA 1S5LH 2KZIA 3RL0g 2GUSA 1FZCB 2Y9YA 4HH2A 3HTKB 3W67A 5CCHD 3VMAA 3E1IA 2ZXXA 3HD7A 2V7QH 4PD4E 1SQQE 2R5DA 2Y0DA 5E79E 3VMZA 1RF1A 3WU2H 4D6TD 1GU5A 4IFDK 1EC5A 1EZVE 2A06G 5TJHA 3H1HJ 3CWBJ 2V4HA 2V7QJ 4NPDA 1FOSE 1SQBG 2IFNA 1K04A 1PPJD 3L73G 3OAKA 3H1IE 2FFDC 1RQVA 3H1JE 4H44D 3P8MC 3TSIA 2M8RA 4N78D 1BGYJ 1X8YA 3HD7B 1MFZA 1L0NG 4I7ZC 1KMIZ 4O9BA 4PV1D 1RF1B 3H1KE 1S5LX 3CXHD 1IO4A 2R5BA 3S1KA 2D2CC 1MFTA 3GW6A 2IBZG 5APYA 4PD4H 3CCSP 5AVYB 1NTKG 3AEBC 2N1TD 3A0HE 3L73D 2C9LY 3O8ZA 1SQQJ 1AVOA 1EDKA 4C7NA 4JPZB 4L76A 1PGJA 4C46A 1NWQA 2ZAEB 2UWJE 5KAIE 3H1IJ 1BSHA 1KQGB 1ZV8A 3H1JJ 4JF7A 4U3FG 5AW4B 1H0TB 5APQA 1NJIQ 1NKZB 1EDIA 5KLVG 2FFDA 1BCCG 5GTIE 5EFWB 4N6JA 2AXCA 4C7NB 1JY2O 3H32A 2B88A 3H1KJ 3Q5SA 1CZQA 2J59M 3FXDA 2WZ7A 2GA1A 3A0HH 2E5TA 2FYUG 5C39A 3H6PA 4NPFX 2K9JA 2FFDB 1VPCA 3MGNA 2ZVNB 1DD3A 3ITKA 5KAIH 1LNQA 1SQBE 2ZYAA 3L73E 3H32B 2PP6A 5AVQB 1NVOA 1NH4A 1OXZA 1N7SA 2Q1KA 3CC2P 4RKUJ 1BCCD 4DCKA 3P8CD 4LC1A 2WTYA 1L0NE 2GM4A 1IK7A 1FBMA 1VQ6P 2D2CB 1DH3A 2K9JB 2JP3A 2KUBA 2YO2A 3B4SA 2OYHC 1ZOYC 3H1LD 1Q7YQ 3N7NA 1VQNP 5CBNA 1NGMB 2FYUD 3L70D 2IBZE 3WMM0 1RH5B 1SVFA 1N7SB 2WPRA 2QG4A 2R32A 1SQBK 1NTKE 1SQVD 5KAFH 3V2QA 1JY2N 2E5YA 1ZR4A 1X22A 1AV1A 5AVVB 1L0NK 5AVZB 3HD7D 1VF5C 1AA0A 3CX5D 1SQBJ 1K8AQ 3L73J 2IYPA 2YNYA 3JSVC 3ABVC 2WT7A 1IFPA 2Z4EA 1M7LA 2W6BA 1Q81Q 1L0NJ 1BCCE 1J2JB 3RK3D 3P8CE 1FC2C 1FZFA 2OYIC 1NTZG 3CMAP 1SP4A 1NTKK 4RESB 1GW4A 1IC2A 2FYNB 1MV8A 2FYUE 1PGQA 4KT0J 4ZNCA 5TISE 2OYHA 2W6AA 3Q2YA 2I1KA 2K37A 3NTNA 5AW0B 2WT7B 4DZOA 1NTKJ 4IFFA 3MTUE 1P84D 2KOGA 3AEGC 1L4AC 1HGZA 5KLVK 3B71A 5CJ0A 2HR3A 5CCHA 5BU8B 2ZVOB 1YITP 3CX5E 3GHGC 1N2DC 1JNMA 1NTZD 3II6A 3NXSA 2OYHB 3RL0C 2Q3IA 2QJKC 1JY2P 1BCCJ 2M3BA 2NPSC 3D6YA 3RK3E 1KV4A 2WWWA 1KTMA 3TK1A 3U59A 2LXCB 4RJTA 1QLED 3B5NC 5CBOA 4YPCA 1T6AA 3EWKA 2FYUJ 1LTJC 1VF5B 2YIUC 4K35A 2L91A 1LP1A 2M5AB 5B5EH 4L75A 3KZIH 2QEXP 1G1IA 2WPQA 3M91A 2D2CD 3OW2O 2RMZA 3CXHI 1GW3A 2HPCA 4LLHA 2XNXA 4Y99B 5AW6B 3HUSC 1CSBA 2K3RA 1X79B 2NZ2A 1N7SD 1NTZE 3TNUA 5AW8B 2KP8A 3TGUG 2Q5UA 4L74A 4L73A 1MZ9A 3G3ZA 1OFCX 3A5TA 3TYYA 1W2EA 3H1HD 2XU6A 3CWBD 3MD0A 2KB7P 2HPCB 2KYVA 1L0LK 3FXEA 2YXRB 3L36A 4PJ0E 1BGYD 3TNUB 1N73C 1ZRTE 3C8VA 1OIPA 3SWKA 3KYQA 4I6MC 1LGHB 1VQKP 1LT9C 3BCCG 2QJKB 1HVVA 1WT6A 2RKLA 2WVRA 2E75C 2CPSA 1S2EA 3VMYA 2OGUA 1M56D 1NTZJ 3V4WA 3FGAD 4PD4D 3V4QA 3W68A 4C7RA 3D71A 1W5CE 2Y9ZA 1EZVD 3BRVB 2YIUB 4ASVA 1J1DB 4PJ0H 3M9BA 1KORA 1N86A 2QE7H 2Q9IA 3AE4C 1N8RQ 1Y9BA 1KQFB 1FS0E 1D7MA 3BATA 3AEFC 1M90Q 2FXPA 1YHQP 3VP8A 3CPWO 5APTA 3CCMP 3PJSK 3H1KD 1KD1Q 1FDOA 4M3LA 3QH9A 1N73A 1OW7A 2AXTE 4W7ZA 1QGKB 1VQLP 3MUDC 3TGUE 1LT9A 1IK9A 4EI2A 1IFNA 1YI2P 1VF5D 3AE6C 3GMAA 3USSA 1GK4A 2OYOA 1S3JA 1W2BO 1KFMA 3FX0A 2I8DA 3ZDMA 2SPZA 2E76C 2A45I 3NMDA 1N73B 3D70A 1MKMA 1M1JC 1ZXGA 2WMMA 3M0AA 2HYNA 5B66H 1QVFO 2R44A 3O6QA 1LT9B 3U1AA 1SFCC 1KB9E 1DEBA 1IFIA 1YJWP 3BCCE 2E75B 4WY4C 1FE6A 2AXTH 2IX7C 1NAFA 3KPEA 5GTHE 4DT0A 5KLIB 2MKVA 3IFMA 2POHA 3AEAC 3G6EP 3BVHA 1IFMA 2WSCH 2ZFCA 1J1EC 3RK3B 2BASA 2ZJSE 1P84I 3O6QB 1L4AD 3TGUJ 3IR9A 2O1JA 1S4XA 2O3JA 1PFIA 2A06D 3EFFK 5M1BA 2WSCJ 1T8ZA 3CD6P 1SQBD 1KFNA 1E79H 1AQ5A 2IYOA 1EXIA 5AVXB 3RL0D 1A02F 1U7MA 2QVAA 4K3AA 4UB6E 1BE3G 1OW8A 1L0ND 1KB9H 1GD2E 1NOHA 2QM7A 2NPSD 3GF7A 1ZLLA 1JCCA 5GTHH 3AEDC 1M1JA 4KJMA 4WWIA 2WSEH 3RK2C 3BCCJ 1G2CA 3B5ND 1R8EA 2YO3A 2IBZD 3E1RA 2H89C 3CCRP 2WSEJ 1RE4C 1EDJA 1NTKD 3MZWB 1OX3A 1OVRA 4WY4A 3CCQP 1KQSO 1TU3F 2E76B 2K9YA 4W80A 1JUNA 1M1JB 3QWOC 2L5GB 1NKNA 3LIEA 1OVUA 3Q5PA 2A06E 1LTBC 5L8RJ 1LTGC 1G2CB 2FYZA 5KAFE 4UB6H 1ZR2A 4U3FD 1HUCA 3B8EB 2W90A 2WPSA 1KILE 3MIWA 5KLVD 1VQPP 4I7ZB 2P67A 5KJ7C 4WY4B 1QVGO 4HJGH 5CHXA 3CMEP 4A7PA 2W27A 2IFMA 1J1EB 1QL1A 1Q86Q 1ZP0C 2PGDA 1FJPA 3P32A 1LJ2A 3AE7C 2YMYA 2QJYC 3HRNA 3U1CA 2XZRA 2OQQA 1YYCA 4OGQC 1RE4A 1KYOH 2JEEA 2JO1A 4H13C 3TF5A 1CW5A 3A2AA 4R4MA 1XTGB 2KI7B 4ASWA 1L0LG 2E75D 2O01H 1BE3E 3VP9A 4U3FE 1Y47A 1S72P 3AEEC 2O01J 2WITA 3IAOA 5KLVE 1KQLA 3EQ2A 4PD4I 1ZW0A 1EZVI 3WUTA 1DD4A 4BXLA 1RE3C 4AYCA 2JWDA 3AE3C 3V2RA 3AE1C 2ITAA 2H8PD 1HH0A 2FBWC 4H44C 2OTLP 2K1AA 3E7KA 1GU4A 1FDIA 1L0LD 3CC4P 2WSFH 2Q7CA 2FY8A 3VYIA 3HE4A 2WSFJ 2QJPC 2BCCG 3WUVA 1BE3J 5B5EE 1NU1G 1E5WA 1OZHA 3V2PA 3KZIE 1OWAA 4U3FJ 1KILC 3PP5A 2G8YA 1DX7A 5AW1B 1FOSF 4EDFA 5KLVJ 1NO4A 1JEKA 2E76D 4CPGA 1LTIC 3JCUE 2Q6QA 4I2LC 3HE4B 2ZXEB 2KS1A 5CCGC 2OYIA 3TDKA 3SWFA 3MP7B 1ZRTD 1K05A 1RE3A 4QMAA 4WY4D 1SQXG 2C0WA 1Q2NA 1L0LE 1SQPG 1LT1A 1G1JA 3CI9A 4GKGA 1NTMG 1NAYA 2KS1B 1JY3O 1R5LA 4IOIH 5DJTB 4BWNA 2OYIB 1Q82Q 1L4AA 3GG2A 4WB4A 2CK3H 3L35A 2M0BA 1Y8AA 3JCUH 2A45H 3GHGA 3IN6A 1LP1B 1M8OB 2RN0A 3FWLA 3LW5H 1KILA 2C9NY 2HFED 3L75G 4OH8B 1KC8Q 1HBWA 2NPSA 1FZCC 3LW5J 3RBZA 1L4AB 3OA7A 2O1KA 1FZAA 2QSIA 4H0LC
chains in the Genus database with same CATH topology
2FFDB 2J58A 4W7YA 5CCGA 1M1JC 3B5NA 1VPCA 3MGNA 1RF0C 3GHGB 3M0AA 2HYNA 3A3YB 3H32B 2XDJA 1KILB 2PP6A 1LTJA 5AVQB 3HE5A 4XA4A 1LT9B 3RL0B 1IJDB 1NH4A 2HG5D 3U1AA 1SFCC 5BU5A 1OXZA 4AQRD 1N7SA 1JMMA 1DEBA 1IFIA 2HLOA 2NPSB 4WY4C 1JO5A 4KHXA 3P8CD 4LC1A 2N1TC 2WTYA 2GM4A 2IX7C 1NAFA 3KPEA 1FBMA 3CLQA 3IFMA 1DH3A 2POHA 2YO2A 3BVHA 3B5NB 1IFMA 5AVRB 2OYHC 2WSCH 1IFDA 2ZFCA 3HUSA 3N7NA 1J1EC 1CI6A 3RK3B 2FKWB 2BASA 2FYUK 1SFCD 3VMXA 3R2PA 1LTJB 1L4AD 3IR9A 3WMM0 2O1JA 4XE5B 3V2NA 1SVFA 1PFIA 4JYBA 1N7SB 1LWUC 2XV5A 2WPRA 1SLQA 1T8ZA 5BVZA 3N4XA 2R32A 2P2UA 3T97A 1SQBK 1RY3A 1KFNA 1NU1K 1SQVK 3M06A 1AQ5A 4GT1A 3V2QA 5APSA 1JY2N 5AVXB 3RL0D 1A02F 1ZR4A 1T3JA 4IFMA 1AFOA 2XKMA 5AVVB 1L0NK 1J1DC 1GD2E 5AVZB 3HD7D 1NOHA 2QM7A 5APXA 3HUSB 2NPSD 1CI6B 3I5CA 1ZLLA 1FZBA 1JCCA 1M1JA 2YNYA 1RF0A 2WSEH 3RK2C 4LGDE 1G2CA 3B5ND 2WT7A 2Z4EA 2R3CA 1M7LA 1YTZT 2W6BA 2YO3A 4N3YB 4AUWA 1J2JB 3RK3D 3P7KA 3P8CE 5AVUB 3KQGA 1FZFA 2OYIC 1RE4C 4GIFA 1SP4A 3SWYA 4WBAA 3VOPA 3L37A 1NTKK 4RESB 3BASA 4WY4A 1SQXK 2N1TA 1GW4A 1IC2A 1SQPK 2P1JA 1KZUB 2HODA 1MV8A 4W80A 5AVWB 3UIAA 1JUNA 1M1JB 3RK2D 2GUVA 2L5GB 2W6AA 2OYHA 1NKNA 3LIEA 2I1KA 3NTNA 5APVA 5AW0B 1LTBC 1NTMK 2C0XA 1A02J 1LTGC 1G2CB 1YTZI 4DZOA 2WT7B 1H89A 2FYZA 1GL2D 4IFFA 3MTUE 1FU1A 3BRTB 2LKMA 1GDTA 1ZR2A 1HUCA 2KOGA 3B8EB 1LWUA 2WPSA 3NFQA 1L4AC 2VRSA 1HWTC 3M9HA 1HGZA 3MIWA 5KLVK 4HYTB 2P67A 5KJ7C 4WY4B 1JY3P 2N1TB 5CJ0A 5CCHA 5BU8B 1FJKA 3V5BA 5AW2B 1URQD 5CHXA 2HODB 3GHGC 1N2DC 1S9KE 1NHLA 1JNMA 3NXSA 1NTZK 3II6A 1H8AA 2W27A 2OYHB 2IFMA 2Q3IA 3RL0C 3VN0A 1JCDA 1J1EB 1QL1A 5AVTB 4I1LA 4EOTA 1JY2P 1JTHA 1JY3N 1LTSC 3HD7C 2M3BA 1FDMA 2NPSC 3HE5B 1LWUB 1FZGA 3OJAB 1FJPA 5KJ7D 1RF1C 2KLVA 2KSJA 2WWWA 1IFJA 2YKQA 3P32A 2YKPA 4ZKUA 3TK1A 2YMYA 3U59A 1SQQK 3HRNA 3U1CA 2XZRA 3MUDA 3B5NC 1HJBA 1YYCA 1RE4A 1T2KD 1KILD 1H88A 1HGVA 2JEEA 3RK3C 1EQ7A 1GTWA 1X9VA 1LTJC 2P7JA 1CW5A 3A2AA 1XTGB 1FZCA 1N7SC 5APWA 5AW7B 2O01H 3HTKA 1JTHB 3VP9A 2MJZA 1S9KD 5CJ4A 4ZKPA 2PAJA 5AW9B 1G1IA 2WPQA 3VTPC 3M91A 3L4FA 1LTAC 2Z5IA 3EFGA 4EIJA 5CCGD 2WITA 1GW3A 1GK6A 2HPCA 4LLHA 5AW3B 1WRGA 2QM8A 1KQLA 2I1JA 3EQ2A 2XNXA 1ZN5A 2CPBA 5AVSB 4Y99B 1Z56A 1GL2C 1SFCA 5AW6B 4B86A 3CL3D 3HUSC 4JYCA 1CSBA 2H43A 1X79B 3KDPB 1N7SD 2GUSA 1FZCB 2OARA 3TNUA 5AW8B 1MUUA 4DOJA 1RE3C 4AYCA 4HH2A 3HTKB 2KP8A 4N78E 3V2RA 5CCHD 2Q5UA 2H8PD 1HH0A 1GZLA 1MZ9A 3E1IA 3G3ZA 1URQC 3A5TA 3TYYA 1W2EA 1FAVA 2XU6A 5KTBA 1GU4A 3MD0A 2KB7P 2HPCB 2KYVA 1L0LK 3HD7A 2WSFH 2Q7CA 1SFCB 2R5DA 3VMZA 1RF1A 4IFDK 1GU5A 3L36A 5CMZA 2N9BA 3VYIA 2JJLA 3HE4A 3TNUB 1N73C 3A7OA 3M9QA 1FOSE 2IFNA 2FFDC 3OAKA 2IPPA 1E5WA 1VDFA 2FXMA 3V2PA 3P8MC 3TSIA 1OWAA 3KYQA 4I6MC 1KILC 1LGHB 3PP5A 1T2KC 1DX7A 5AW1B 1LT9C 1QL2A 1FOSF 2M8RA 4N78D 1HVVA 1X8YA 1WT6A 3HD7B 1NO4A 1MFZA 4O9BA 2CPSA 1RF1B 1LTIC 3VMYA 2A45G 1IO4A 4I2LC 2R5BA 3M0DC 3V4WA 3HE4B 3V4QA 2ZXEB 1GL2A 4C7RA 5CCGC 2OYIA 5APYA 3BRVB 5AVYB 1XTCC 3SWFA 1J1DB 1RE3A 3M9BA 5AW5B 1N86A 4WY4D 2H7HA 2Q9IA 2C0WA 2N1TD 1FZEA 2C9LY 3O8ZA 1URQA 4C7NA 5CCHC 3BATA 1G1JA 3RK2B 3CI9A 4GKGA 3VP8A 4C46A 1NWQA 1JOCA 3LIDA 1N7LA 1GL2B 1JY3O 5APTA 1ZV8A 2Z5HA 2OYIB 1L4AA 4JF7A 5AW4B 4WB4A 5APQA 4M3LA 5KJ7A 3L35A 3C9IA 1NKZB 1N73A 2FFDA 2YKOA 2A45H 1T3UA 3GHGA 4N6JA 4W7ZA 1URQB 4C7NB 1JY2O 1HTLC 3H32A 3LW5H 1KILA 2C9NY 1LT9A 4Y99C 2E43A 1IK9A 2HFED 1IFNA 4OH8B 1LTTC 1CZQA 2J59M 1HBWA 2NPSA 2WZ7A 1FZCC 1GK4A 1KFMA 1L4AB 3OA7A 3H6PA 2O1KA 1FZAA 5APUA 3M0DA 2A45I 2E42A 3NMDA 1N73B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RK3 D;  4W7Y A;  5CCG A;  3B5N A;  3P8C E;  1N7S C;  1JTH B;  3VOP A;  3M0D C;  2XDJ A;  1KIL B;  2PP6 A;  4WY4 A;  3RL0 B;  2N1T A;  2HG5 D;  1GL2 A;  1SFC C;  5CCG C;  1N7S A;  5CCG D;  4W80 A;  2NPS B;  4WY4 C;  3RK2 D;  2N1T C;  1GL2 C;  1SFC A;  4WY4 D;  2N1T D;  1GL2 D;  1N7S D;  1URQ A;  3B5N B;  2KOG A;  5CCH C;  3HTK B;  1L4A C;  4N78 E;  3RK2 B;  5CCH D;  3RK3 B;  1SFC D;  2H8P D;  5KJ7 C;  4WY4 B;  1L4A D;  2N1T B;  1GL2 B;  1URQ C;  5CCH A;  1N7S B;  1L4A A;  1URQ D;  4JF7 A;  3HD7 A;  1NHL A;  5KJ7 A;  3RL0 C;  1SFC B;  3RL0 D;  1JTH A;  3HD7 C;  4W7Z A;  1URQ B;  2NPS C;  1T3J A;  1KIL A;  3HD7 D;  5KJ7 D;  2NPS D;  2HFE D;  3TSI A;  4OH8 B;  2YMY A;  2NPS A;  2WZ7 A;  3KYQ A;  1KIL C;  3PP5 A;  3B5N C;  1L4A B;  2M8R A;  3RK2 C;  1KIL D;  4LGD E;  1HVV A;  3B5N D;  3HD7 B;  3RK3 C;  1XTG B; 
#chains in the Genus database with same CATH topology
 5CCG A;  4W7Y A;  3B5N A;  3GHG B;  1L0L J;  4EYY Q;  3A0B E;  2BCC E;  2IBZ I;  3A3Y B;  2XDJ A;  1KIL B;  1NU1 E;  1LTJ A;  3HE5 A;  3RL0 B;  5BU5 A;  4AQR D;  2NPS B;  1SS1 A;  1VQ4 P;  4KHX A;  3TGU D;  2RH0 A;  2PFX A;  3D6Z A;  3JC2 2;  3S9O A;  3FWN A;  4GOF A;  3B5N B;  3HUS A;  1CI6 A;  2QRX A;  1LTJ B;  3GF3 A;  4XE5 B;  3V2N A;  1YBK A;  2XV5 A;  1YIJ P;  5H2F E;  3N4X A;  3T97 A;  1L2P A;  1RY3 A;  2KK7 A;  1NU1 K;  3M06 A;  1SQX E;  4GT1 A;  2DW3 A;  2R3S A;  3A0B H;  1SQP E;  5APS A;  1QX8 A;  1KB9 D;  3K5B A;  3L72 G;  1DEE G;  3BCC D;  4MN4 C;  1T3J A;  4IFM A;  1AFO A;  2XKM A;  3KHU A;  5B66 E;  5APX A;  3HUS B;  1NTM E;  1CI6 B;  2BCC J;  2WPV B;  1NU1 J;  1FZB A;  4D6T G;  3T97 B;  1USD A;  1RHZ B;  2R3C A;  1PPJ G;  1OMI A;  4AUW A;  3P7K A;  5AVU B;  4H13 D;  3F89 A;  1VQM P;  4GIF A;  1JM0 A;  4YTP C;  3L37 A;  1Q90 D;  3BAS A;  1SQX K;  3L75 E;  5H2F H;  4BRY A;  1SQP K;  2P1J A;  3CX5 I;  4WVZ A;  2HOD A;  4H0L B;  5AVW B;  3S4R A;  3L72 D;  3SFD C;  1NTM K;  1YQ3 C;  2Q3E A;  1H89 A;  3G9R A;  3CCL P;  1FU1 A;  1SQX J;  3BRT B;  2LKM A;  1HJ0 A;  1SQP J;  3NFQ A;  2VRS A;  3M9H A;  1JY3 P;  4BRY B;  1NTM J;  1FJK A;  3V5B A;  5AW2 B;  2HOD B;  3G71 P;  1S9K E;  1NHL A;  3VN0 A;  1JCD A;  3AE8 C;  5AVT B;  4I1L A;  4EOT A;  3L74 G;  3CCE P;  1OW6 A;  2IZ0 A;  2QA4 P;  3KXD A;  2YKQ A;  1IFJ A;  1PGO A;  2W83 C;  2B9B A;  4ZKU A;  1KYO D;  3L75 J;  1SQQ K;  3MUD A;  4YXD C;  4OVN F;  2J5U A;  1KIL D;  1H0T A;  1EQ7 A;  5E79 H;  1GTW A;  1X9V A;  3RGU A;  3L72 E;  1N7S C;  3AEC C;  5AW7 B;  3Q5R A;  5K5G B;  2MJZ A;  2B89 A;  4ZKP A;  2PAJ A;  2BEQ D;  3VTP C;  3L4F A;  3AE2 C;  4D6T E;  1VQ9 P;  2Z5I A;  3EFG A;  4EIJ A;  5CCG D;  2QM8 A;  2I1J A;  2CPB A;  1OVV A;  3L74 D;  5AVS B;  1GL2 C;  1SFC A;  1PPJ E;  4B86 A;  1PP9 G;  1ZME C;  4JYC A;  2E74 C;  3KDP B;  2OAR A;  1MUU A;  4DOJ A;  3PRJ A;  4N78 E;  3V6I A;  2JWA A;  1IZN B;  3SSU A;  1GZL A;  2AEJ A;  1URQ C;  1FAV A;  4IL6 E;  1NYH A;  5KTB A;  4GOE A;  1KN7 A;  1BE3 D;  3CXH E;  2P58 A;  3H1L G;  2ZT9 C;  1KYO E;  1SFC B;  3L70 G;  2FYN C;  5CMZ A;  2WQY C;  4Y28 J;  2N9B A;  2FXO A;  2JJL A;  4JBZ A;  3L72 J;  1QEX A;  3A7O A;  2NRG A;  3M9Q A;  1JMB A;  2IPP A;  1SQV G;  1VDF A;  2FXM A;  1R5S A;  1PP9 D;  1T2K C;  1QL2 A;  4D6T J;  3IF4 A;  2W6J H;  4ZMD A;  2KZJ A;  5GTI H;  3L74 E;  4TT3 H;  3R4Y A;  2A45 G;  4H0L D;  1EDL A;  3Q1M A;  1JB0 J;  3M0D C;  4IL6 H;  3I55 P;  2K88 A;  1GL2 A;  3CXH H;  1DIP A;  1VQ8 P;  1XTC C;  5AW5 B;  2H7H A;  3PLN A;  4OWF A;  2YMK A;  1FZE A;  4HB1 A;  2KIK A;  1YQ4 C;  4R4L A;  3F5H A;  1URQ A;  3SFE C;  3CCV P;  2B87 A;  5CCH C;  3RK2 B;  1USE A;  3WUU A;  1GMJ A;  1JOC A;  2IZ1 A;  3H25 A;  3LID A;  1N7L A;  3I56 P;  1GL2 B;  2Z5H A;  3Q3D A;  2E74 B;  2KSE A;  3AE5 C;  5KJ7 A;  1PP9 E;  3C9I A;  1AJY A;  3CC7 P;  3GLM A;  2YKO A;  4GDO A;  1T3U A;  2LR2 A;  1BSN A;  1URQ B;  5DJU B;  1HTL C;  2B87 B;  2WSS H;  3L74 J;  3L71 G;  4Y99 C;  2E43 A;  1KB9 I;  1LTT C;  2ZT9 B;  4IL6 X;  2N9Y B;  1BDC A;  3H1L E;  2ZYD A;  4PV1 C;  5APU A;  3L70 E;  3M0D A;  4Z1M H;  2E42 A;  4U7J A;  4XFJ A;  1M57 D;  2J58 A;  1RF0 C;  1X0T A;  1M1K Q;  2JDI H;  4UB8 E;  1SQV E;  4XA4 A;  2KXP B;  1IJD B;  2HG5 D;  3CCJ P;  1JMM A;  2BEZ F;  1WMK A;  1VQ7 P;  2HLO A;  1JO5 A;  2N1T C;  3G4S P;  4GOD A;  3L71 D;  1PP9 J;  3CLQ A;  4HKZ H;  2QJY B;  1VQ5 P;  1K9M Q;  2O01 N;  5AVR B;  4OGQ B;  1IFD A;  2FKW B;  2FYU K;  1SFC D;  4H13 B;  3VMX A;  3R2P A;  2M5A A;  2QIW A;  1PGP A;  3AE9 C;  1HF9 A;  4JYB A;  1LWU C;  1EXJ A;  1SLQ A;  5BVZ A;  1U57 A;  5TIS H;  2P2U A;  2BCC D;  1UII A;  1NU1 D;  1SQV K;  1PIX A;  3H1L J;  3L70 J;  4UB8 H;  1VQO P;  5KKZ C;  3H1H G;  3CWB G;  1AVY A;  1J1D C;  3I5C A;  1SQV J;  1P84 E;  3CX5 H;  1BGY G;  1RF0 A;  2Y0E A;  3MHV A;  4LGD E;  4DJG A;  1KYO I;  1YTZ T;  4N3Y B;  4H44 B;  4RO0 A;  3KQG A;  3RBX A;  3L71 E;  3SWY A;  4WBA A;  3VOP A;  3PHL A;  1SQX D;  2N1T A;  2XND H;  1SQP D;  2P10 A;  4PV1 B;  1KZU B;  3UIA A;  3RK2 D;  2QJP B;  2GUV A;  5APV A;  1NTM D;  1A02 J;  2C0X A;  1YTZ I;  2JKV A;  1SQQ G;  2PRR A;  1GL2 D;  2M3E A;  1GDT A;  1UIX A;  2E74 D;  1EZV G;  1LWU A;  3CCU P;  1HWT C;  1P84 H;  4HYT B;  3H1I G;  1K73 Q;  2N1T B;  3H1J G;  4NPE A;  1AQT A;  1URQ D;  2AEF A;  1NTZ K;  1H8A A;  1S1C X;  3L75 D;  2ZT9 D;  3PH0 A;  1JTH A;  1JY3 N;  1LTS C;  3HD7 C;  2KLU A;  3H1K G;  1FDM A;  3HE5 B;  1S5L E;  1LWU B;  1FZG A;  3OJA B;  5KJ7 D;  1RF1 C;  3L71 J;  2KLV A;  2KSJ A;  5KLI C;  2YKP A;  1VL2 A;  2KNC A;  3PTZ A;  1SQQ D;  2IDB A;  1HJB A;  5KKZ B;  1T2K D;  2LXB A;  1H88 A;  1PV3 A;  1YJN P;  1HGV A;  3RK3 C;  2ZYG A;  2OTK E;  1U7J A;  2P7J A;  1FZC A;  2H88 C;  3H1I D;  3H1H E;  3CWB E;  2JR8 A;  3H1J D;  5APW A;  3HTK A;  1JTH B;  3WU2 E;  1S9K D;  1BDD A;  5CJ4 A;  2OTJ P;  3C1L A;  1PZQ A;  1RQU A;  4TLF A;  5AW9 B;  1LTA C;  4JQ0 D;  2YXQ B;  4YXW H;  1YJ9 P;  1PL5 A;  1BGY E;  1GK6 A;  2W8Z A;  2KNC B;  5AW3 B;  1WRG A;  4OGQ D;  1ZN5 A;  1Z56 A;  2G3A A;  3CL3 D;  2H43 A;  2Y0C A;  2AEM A;  1S5L H;  2KZI A;  3RL0 g;  2GUS A;  1FZC B;  2Y9Y A;  4HH2 A;  3HTK B;  3W67 A;  5CCH D;  3VMA A;  3E1I A;  2ZXX A;  3HD7 A;  2V7Q H;  4PD4 E;  1SQQ E;  2R5D A;  2Y0D A;  5E79 E;  3VMZ A;  1RF1 A;  3WU2 H;  4D6T D;  1GU5 A;  4IFD K;  1EC5 A;  1EZV E;  2A06 G;  5TJH A;  3H1H J;  3CWB J;  2V4H A;  2V7Q J;  4NPD A;  1FOS E;  1SQB G;  2IFN A;  1K04 A;  1PPJ D;  3L73 G;  3OAK A;  3H1I E;  2FFD C;  1RQV A;  3H1J E;  4H44 D;  3P8M C;  3TSI A;  2M8R A;  4N78 D;  1BGY J;  1X8Y A;  3HD7 B;  1MFZ A;  1L0N G;  4I7Z C;  1KMI Z;  4O9B A;  4PV1 D;  1RF1 B;  3H1K E;  1S5L X;  3CXH D;  1IO4 A;  2R5B A;  3S1K A;  2D2C C;  1MFT A;  3GW6 A;  2IBZ G;  5APY A;  4PD4 H;  3CCS P;  5AVY B;  1NTK G;  3AEB C;  2N1T D;  3A0H E;  3L73 D;  2C9L Y;  3O8Z A;  1SQQ J;  1AVO A;  1EDK A;  4C7N A;  4JPZ B;  4L76 A;  1PGJ A;  4C46 A;  1NWQ A;  2ZAE B;  2UWJ E;  5KAI E;  3H1I J;  1BSH A;  1KQG B;  1ZV8 A;  3H1J J;  4JF7 A;  4U3F G;  5AW4 B;  1H0T B;  5APQ A;  1NJI Q;  1NKZ B;  1EDI A;  5KLV G;  2FFD A;  1BCC G;  5GTI E;  5EFW B;  4N6J A;  2AXC A;  4C7N B;  1JY2 O;  3H32 A;  2B88 A;  3H1K J;  3Q5S A;  1CZQ A;  2J59 M;  3FXD A;  2WZ7 A;  2GA1 A;  3A0H H;  2E5T A;  2FYU G;  5C39 A;  3H6P A;  4NPF X;  2K9J A;  2FFD B;  1VPC A;  3MGN A;  2ZVN B;  1DD3 A;  3ITK A;  5KAI H;  1LNQ A;  1SQB E;  2ZYA A;  3L73 E;  3H32 B;  2PP6 A;  5AVQ B;  1NVO A;  1NH4 A;  1OXZ A;  1N7S A;  2Q1K A;  3CC2 P;  4RKU J;  1BCC D;  4DCK A;  3P8C D;  4LC1 A;  2WTY A;  1L0N E;  2GM4 A;  1IK7 A;  1FBM A;  1VQ6 P;  2D2C B;  1DH3 A;  2K9J B;  2JP3 A;  2KUB A;  2YO2 A;  3B4S A;  2OYH C;  1ZOY C;  3H1L D;  1Q7Y Q;  3N7N A;  1VQN P;  5CBN A;  1NGM B;  2FYU D;  3L70 D;  2IBZ E;  3WMM 0;  1RH5 B;  1SVF A;  1N7S B;  2WPR A;  2QG4 A;  2R32 A;  1SQB K;  1NTK E;  1SQV D;  5KAF H;  3V2Q A;  1JY2 N;  2E5Y A;  1ZR4 A;  1X22 A;  1AV1 A;  5AVV B;  1L0N K;  5AVZ B;  3HD7 D;  1VF5 C;  1AA0 A;  3CX5 D;  1SQB J;  1K8A Q;  3L73 J;  2IYP A;  2YNY A;  3JSV C;  3ABV C;  2WT7 A;  1IFP A;  2Z4E A;  1M7L A;  2W6B A;  1Q81 Q;  1L0N J;  1BCC E;  1J2J B;  3RK3 D;  3P8C E;  1FC2 C;  1FZF A;  2OYI C;  1NTZ G;  3CMA P;  1SP4 A;  1NTK K;  4RES B;  1GW4 A;  1IC2 A;  2FYN B;  1MV8 A;  2FYU E;  1PGQ A;  4KT0 J;  4ZNC A;  5TIS E;  2OYH A;  2W6A A;  3Q2Y A;  2I1K A;  2K37 A;  3NTN A;  5AW0 B;  2WT7 B;  4DZO A;  1NTK J;  4IFF A;  3MTU E;  1P84 D;  2KOG A;  3AEG C;  1L4A C;  1HGZ A;  5KLV K;  3B71 A;  5CJ0 A;  2HR3 A;  5CCH A;  5BU8 B;  2ZVO B;  1YIT P;  3CX5 E;  3GHG C;  1N2D C;  1JNM A;  1NTZ D;  3II6 A;  3NXS A;  2OYH B;  3RL0 C;  2Q3I A;  2QJK C;  1JY2 P;  1BCC J;  2M3B A;  2NPS C;  3D6Y A;  3RK3 E;  1KV4 A;  2WWW A;  1KTM A;  3TK1 A;  3U59 A;  2LXC B;  4RJT A;  1QLE D;  3B5N C;  5CBO A;  4YPC A;  1T6A A;  3EWK A;  2FYU J;  1LTJ C;  1VF5 B;  2YIU C;  4K35 A;  2L91 A;  1LP1 A;  2M5A B;  5B5E H;  4L75 A;  3KZI H;  2QEX P;  1G1I A;  2WPQ A;  3M91 A;  2D2C D;  3OW2 O;  2RMZ A;  3CXH I;  1GW3 A;  2HPC A;  4LLH A;  2XNX A;  4Y99 B;  5AW6 B;  3HUS C;  1CSB A;  2K3R A;  1X79 B;  2NZ2 A;  1N7S D;  1NTZ E;  3TNU A;  5AW8 B;  2KP8 A;  3TGU G;  2Q5U A;  4L74 A;  4L73 A;  1MZ9 A;  3G3Z A;  1OFC X;  3A5T A;  3TYY A;  1W2E A;  3H1H D;  2XU6 A;  3CWB D;  3MD0 A;  2KB7 P;  2HPC B;  2KYV A;  1L0L K;  3FXE A;  2YXR B;  3L36 A;  4PJ0 E;  1BGY D;  3TNU B;  1N73 C;  1ZRT E;  3C8V A;  1OIP A;  3SWK A;  3KYQ A;  4I6M C;  1LGH B;  1VQK P;  1LT9 C;  3BCC G;  2QJK B;  1HVV A;  1WT6 A;  2RKL A;  2WVR A;  2E75 C;  2CPS A;  1S2E A;  3VMY A;  2OGU A;  1M56 D;  1NTZ J;  3V4W A;  3FGA D;  4PD4 D;  3V4Q A;  3W68 A;  4C7R A;  3D71 A;  1W5C E;  2Y9Z A;  1EZV D;  3BRV B;  2YIU B;  4ASV A;  1J1D B;  4PJ0 H;  3M9B A;  1KOR A;  1N86 A;  2QE7 H;  2Q9I A;  3AE4 C;  1N8R Q;  1Y9B A;  1KQF B;  1FS0 E;  1D7M A;  3BAT A;  3AEF C;  1M90 Q;  2FXP A;  1YHQ P;  3VP8 A;  3CPW O;  5APT A;  3CCM P;  3PJS K;  3H1K D;  1KD1 Q;  1FDO A;  4M3L A;  3QH9 A;  1N73 A;  1OW7 A;  2AXT E;  4W7Z A;  1QGK B;  1VQL P;  3MUD C;  3TGU E;  1LT9 A;  1IK9 A;  4EI2 A;  1IFN A;  1YI2 P;  1VF5 D;  3AE6 C;  3GMA A;  3USS A;  1GK4 A;  2OYO A;  1S3J A;  1W2B O;  1KFM A;  3FX0 A;  2I8D A;  3ZDM A;  2SPZ A;  2E76 C;  2A45 I;  3NMD A;  1N73 B;  3D70 A;  1MKM A;  1M1J C;  1ZXG A;  2WMM A;  3M0A A;  2HYN A;  5B66 H;  1QVF O;  2R44 A;  3O6Q A;  1LT9 B;  3U1A A;  1SFC C;  1KB9 E;  1DEB A;  1IFI A;  1YJW P;  3BCC E;  2E75 B;  4WY4 C;  1FE6 A;  2AXT H;  2IX7 C;  1NAF A;  3KPE A;  5GTH E;  4DT0 A;  5KLI B;  2MKV A;  3IFM A;  2POH A;  3AEA C;  3G6E P;  3BVH A;  1IFM A;  2WSC H;  2ZFC A;  1J1E C;  3RK3 B;  2BAS A;  2ZJS E;  1P84 I;  3O6Q B;  1L4A D;  3TGU J;  3IR9 A;  2O1J A;  1S4X A;  2O3J A;  1PFI A;  2A06 D;  3EFF K;  5M1B A;  2WSC J;  1T8Z A;  3CD6 P;  1SQB D;  1KFN A;  1E79 H;  1AQ5 A;  2IYO A;  1EXI A;  5AVX B;  3RL0 D;  1A02 F;  1U7M A;  2QVA A;  4K3A A;  4UB6 E;  1BE3 G;  1OW8 A;  1L0N D;  1KB9 H;  1GD2 E;  1NOH A;  2QM7 A;  2NPS D;  3GF7 A;  1ZLL A;  1JCC A;  5GTH H;  3AED C;  1M1J A;  4KJM A;  4WWI A;  2WSE H;  3RK2 C;  3BCC J;  1G2C A;  3B5N D;  1R8E A;  2YO3 A;  2IBZ D;  3E1R A;  2H89 C;  3CCR P;  2WSE J;  1RE4 C;  1EDJ A;  1NTK D;  3MZW B;  1OX3 A;  1OVR A;  4WY4 A;  3CCQ P;  1KQS O;  1TU3 F;  2E76 B;  2K9Y A;  4W80 A;  1JUN A;  1M1J B;  3QWO C;  2L5G B;  1NKN A;  3LIE A;  1OVU A;  3Q5P A;  2A06 E;  1LTB C;  5L8R J;  1LTG C;  1G2C B;  2FYZ A;  5KAF E;  4UB6 H;  1ZR2 A;  4U3F D;  1HUC A;  3B8E B;  2W90 A;  2WPS A;  1KIL E;  3MIW A;  5KLV D;  1VQP P;  4I7Z B;  2P67 A;  5KJ7 C;  4WY4 B;  1QVG O;  4HJG H;  5CHX A;  3CME P;  4A7P A;  2W27 A;  2IFM A;  1J1E B;  1QL1 A;  1Q86 Q;  1ZP0 C;  2PGD A;  1FJP A;  3P32 A;  1LJ2 A;  3AE7 C;  2YMY A;  2QJY C;  3HRN A;  3U1C A;  2XZR A;  2OQQ A;  1YYC A;  4OGQ C;  1RE4 A;  1KYO H;  2JEE A;  2JO1 A;  4H13 C;  3TF5 A;  1CW5 A;  3A2A A;  4R4M A;  1XTG B;  2KI7 B;  4ASW A;  1L0L G;  2E75 D;  2O01 H;  1BE3 E;  3VP9 A;  4U3F E;  1Y47 A;  1S72 P;  3AEE C;  2O01 J;  2WIT A;  3IAO A;  5KLV E;  1KQL A;  3EQ2 A;  4PD4 I;  1ZW0 A;  1EZV I;  3WUT A;  1DD4 A;  4BXL A;  1RE3 C;  4AYC A;  2JWD A;  3AE3 C;  3V2R A;  3AE1 C;  2ITA A;  2H8P D;  1HH0 A;  2FBW C;  4H44 C;  2OTL P;  2K1A A;  3E7K A;  1GU4 A;  1FDI A;  1L0L D;  3CC4 P;  2WSF H;  2Q7C A;  2FY8 A;  3VYI A;  3HE4 A;  2WSF J;  2QJP C;  2BCC G;  3WUV A;  1BE3 J;  5B5E E;  1NU1 G;  1E5W A;  1OZH A;  3V2P A;  3KZI E;  1OWA A;  4U3F J;  1KIL C;  3PP5 A;  2G8Y A;  1DX7 A;  5AW1 B;  1FOS F;  4EDF A;  5KLV J;  1NO4 A;  1JEK A;  2E76 D;  4CPG A;  1LTI C;  3JCU E;  2Q6Q A;  4I2L C;  3HE4 B;  2ZXE B;  2KS1 A;  5CCG C;  2OYI A;  3TDK A;  3SWF A;  3MP7 B;  1ZRT D;  1K05 A;  1RE3 A;  4QMA A;  4WY4 D;  1SQX G;  2C0W A;  1Q2N A;  1L0L E;  1SQP G;  1LT1 A;  1G1J A;  3CI9 A;  4GKG A;  1NTM G;  1NAY A;  2KS1 B;  1JY3 O;  1R5L A;  4IOI H;  5DJT B;  4BWN A;  2OYI B;  1Q82 Q;  1L4A A;  3GG2 A;  4WB4 A;  2CK3 H;  3L35 A;  2M0B A;  1Y8A A;  3JCU H;  2A45 H;  3GHG A;  3IN6 A;  1LP1 B;  1M8O B;  2RN0 A;  3FWL A;  3LW5 H;  1KIL A;  2C9N Y;  2HFE D;  3L75 G;  4OH8 B;  1KC8 Q;  1HBW A;  2NPS A;  1FZC C;  3LW5 J;  3RBZ A;  1L4A B;  3OA7 A;  2O1K A;  1FZA A;  2QSI A;  4H0L C; 
#chains in the Genus database with same CATH homology
 2FFD B;  2J58 A;  4W7Y A;  5CCG A;  1M1J C;  3B5N A;  1VPC A;  3MGN A;  1RF0 C;  3GHG B;  3M0A A;  2HYN A;  3A3Y B;  3H32 B;  2XDJ A;  1KIL B;  2PP6 A;  1LTJ A;  5AVQ B;  3HE5 A;  4XA4 A;  1LT9 B;  3RL0 B;  1IJD B;  1NH4 A;  2HG5 D;  3U1A A;  1SFC C;  5BU5 A;  1OXZ A;  4AQR D;  1N7S A;  1JMM A;  1DEB A;  1IFI A;  2HLO A;  2NPS B;  4WY4 C;  1JO5 A;  4KHX A;  3P8C D;  4LC1 A;  2N1T C;  2WTY A;  2GM4 A;  2IX7 C;  1NAF A;  3KPE A;  1FBM A;  3CLQ A;  3IFM A;  1DH3 A;  2POH A;  2YO2 A;  3BVH A;  3B5N B;  1IFM A;  5AVR B;  2OYH C;  2WSC H;  1IFD A;  2ZFC A;  3HUS A;  3N7N A;  1J1E C;  1CI6 A;  3RK3 B;  2FKW B;  2BAS A;  2FYU K;  1SFC D;  3VMX A;  3R2P A;  1LTJ B;  1L4A D;  3IR9 A;  3WMM 0;  2O1J A;  4XE5 B;  3V2N A;  1SVF A;  1PFI A;  4JYB A;  1N7S B;  1LWU C;  2XV5 A;  2WPR A;  1SLQ A;  1T8Z A;  5BVZ A;  3N4X A;  2R32 A;  2P2U A;  3T97 A;  1SQB K;  1RY3 A;  1KFN A;  1NU1 K;  1SQV K;  3M06 A;  1AQ5 A;  4GT1 A;  3V2Q A;  5APS A;  1JY2 N;  5AVX B;  3RL0 D;  1A02 F;  1ZR4 A;  1T3J A;  4IFM A;  1AFO A;  2XKM A;  5AVV B;  1L0N K;  1J1D C;  1GD2 E;  5AVZ B;  3HD7 D;  1NOH A;  2QM7 A;  5APX A;  3HUS B;  2NPS D;  1CI6 B;  3I5C A;  1ZLL A;  1FZB A;  1JCC A;  1M1J A;  2YNY A;  1RF0 A;  2WSE H;  3RK2 C;  4LGD E;  1G2C A;  3B5N D;  2WT7 A;  2Z4E A;  2R3C A;  1M7L A;  1YTZ T;  2W6B A;  2YO3 A;  4N3Y B;  4AUW A;  1J2J B;  3RK3 D;  3P7K A;  3P8C E;  5AVU B;  3KQG A;  1FZF A;  2OYI C;  1RE4 C;  4GIF A;  1SP4 A;  3SWY A;  4WBA A;  3VOP A;  3L37 A;  1NTK K;  4RES B;  3BAS A;  4WY4 A;  1SQX K;  2N1T A;  1GW4 A;  1IC2 A;  1SQP K;  2P1J A;  1KZU B;  2HOD A;  1MV8 A;  4W80 A;  5AVW B;  3UIA A;  1JUN A;  1M1J B;  3RK2 D;  2GUV A;  2L5G B;  2W6A A;  2OYH A;  1NKN A;  3LIE A;  2I1K A;  3NTN A;  5APV A;  5AW0 B;  1LTB C;  1NTM K;  2C0X A;  1A02 J;  1LTG C;  1G2C B;  1YTZ I;  4DZO A;  2WT7 B;  1H89 A;  2FYZ A;  1GL2 D;  4IFF A;  3MTU E;  1FU1 A;  3BRT B;  2LKM A;  1GDT A;  1ZR2 A;  1HUC A;  2KOG A;  3B8E B;  1LWU A;  2WPS A;  3NFQ A;  1L4A C;  2VRS A;  1HWT C;  3M9H A;  1HGZ A;  3MIW A;  5KLV K;  4HYT B;  2P67 A;  5KJ7 C;  4WY4 B;  1JY3 P;  2N1T B;  5CJ0 A;  5CCH A;  5BU8 B;  1FJK A;  3V5B A;  5AW2 B;  1URQ D;  5CHX A;  2HOD B;  3GHG C;  1N2D C;  1S9K E;  1NHL A;  1JNM A;  3NXS A;  1NTZ K;  3II6 A;  1H8A A;  2W27 A;  2OYH B;  2IFM A;  2Q3I A;  3RL0 C;  3VN0 A;  1JCD A;  1J1E B;  1QL1 A;  5AVT B;  4I1L A;  4EOT A;  1JY2 P;  1JTH A;  1JY3 N;  1LTS C;  3HD7 C;  2M3B A;  1FDM A;  2NPS C;  3HE5 B;  1LWU B;  1FZG A;  3OJA B;  1FJP A;  5KJ7 D;  1RF1 C;  2KLV A;  2KSJ A;  2WWW A;  1IFJ A;  2YKQ A;  3P32 A;  2YKP A;  4ZKU A;  3TK1 A;  2YMY A;  3U59 A;  1SQQ K;  3HRN A;  3U1C A;  2XZR A;  3MUD A;  3B5N C;  1HJB A;  1YYC A;  1RE4 A;  1T2K D;  1KIL D;  1H88 A;  1HGV A;  2JEE A;  3RK3 C;  1EQ7 A;  1GTW A;  1X9V A;  1LTJ C;  2P7J A;  1CW5 A;  3A2A A;  1XTG B;  1FZC A;  1N7S C;  5APW A;  5AW7 B;  2O01 H;  3HTK A;  1JTH B;  3VP9 A;  2MJZ A;  1S9K D;  5CJ4 A;  4ZKP A;  2PAJ A;  5AW9 B;  1G1I A;  2WPQ A;  3VTP C;  3M91 A;  3L4F A;  1LTA C;  2Z5I A;  3EFG A;  4EIJ A;  5CCG D;  2WIT A;  1GW3 A;  1GK6 A;  2HPC A;  4LLH A;  5AW3 B;  1WRG A;  2QM8 A;  1KQL A;  2I1J A;  3EQ2 A;  2XNX A;  1ZN5 A;  2CPB A;  5AVS B;  4Y99 B;  1Z56 A;  1GL2 C;  1SFC A;  5AW6 B;  4B86 A;  3CL3 D;  3HUS C;  4JYC A;  1CSB A;  2H43 A;  1X79 B;  3KDP B;  1N7S D;  2GUS A;  1FZC B;  2OAR A;  3TNU A;  5AW8 B;  1MUU A;  4DOJ A;  1RE3 C;  4AYC A;  4HH2 A;  3HTK B;  2KP8 A;  4N78 E;  3V2R A;  5CCH D;  2Q5U A;  2H8P D;  1HH0 A;  1GZL A;  1MZ9 A;  3E1I A;  3G3Z A;  1URQ C;  3A5T A;  3TYY A;  1W2E A;  1FAV A;  2XU6 A;  5KTB A;  1GU4 A;  3MD0 A;  2KB7 P;  2HPC B;  2KYV A;  1L0L K;  3HD7 A;  2WSF H;  2Q7C A;  1SFC B;  2R5D A;  3VMZ A;  1RF1 A;  4IFD K;  1GU5 A;  3L36 A;  5CMZ A;  2N9B A;  3VYI A;  2JJL A;  3HE4 A;  3TNU B;  1N73 C;  3A7O A;  3M9Q A;  1FOS E;  2IFN A;  2FFD C;  3OAK A;  2IPP A;  1E5W A;  1VDF A;  2FXM A;  3V2P A;  3P8M C;  3TSI A;  1OWA A;  3KYQ A;  4I6M C;  1KIL C;  1LGH B;  3PP5 A;  1T2K C;  1DX7 A;  5AW1 B;  1LT9 C;  1QL2 A;  1FOS F;  2M8R A;  4N78 D;  1HVV A;  1X8Y A;  1WT6 A;  3HD7 B;  1NO4 A;  1MFZ A;  4O9B A;  2CPS A;  1RF1 B;  1LTI C;  3VMY A;  2A45 G;  1IO4 A;  4I2L C;  2R5B A;  3M0D C;  3V4W A;  3HE4 B;  3V4Q A;  2ZXE B;  1GL2 A;  4C7R A;  5CCG C;  2OYI A;  5APY A;  3BRV B;  5AVY B;  1XTC C;  3SWF A;  1J1D B;  1RE3 A;  3M9B A;  5AW5 B;  1N86 A;  4WY4 D;  2H7H A;  2Q9I A;  2C0W A;  2N1T D;  1FZE A;  2C9L Y;  3O8Z A;  1URQ A;  4C7N A;  5CCH C;  3BAT A;  1G1J A;  3RK2 B;  3CI9 A;  4GKG A;  3VP8 A;  4C46 A;  1NWQ A;  1JOC A;  3LID A;  1N7L A;  1GL2 B;  1JY3 O;  5APT A;  1ZV8 A;  2Z5H A;  2OYI B;  1L4A A;  4JF7 A;  5AW4 B;  4WB4 A;  5APQ A;  4M3L A;  5KJ7 A;  3L35 A;  3C9I A;  1NKZ B;  1N73 A;  2FFD A;  2YKO A;  2A45 H;  1T3U A;  3GHG A;  4N6J A;  4W7Z A;  1URQ B;  4C7N B;  1JY2 O;  1HTL C;  3H32 A;  3LW5 H;  1KIL A;  2C9N Y;  1LT9 A;  4Y99 C;  2E43 A;  1IK9 A;  2HFE D;  1IFN A;  4OH8 B;  1LTT C;  1CZQ A;  2J59 M;  1HBW A;  2NPS A;  2WZ7 A;  1FZC C;  1GK4 A;  1KFM A;  1L4A B;  3OA7 A;  3H6P A;  2O1K A;  1FZA A;  5APU A;  3M0D A;  2A45 I;  2E42 A;  3NMD A;  1N73 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...