2R3CA

Structure of the gp41 n-peptide in complex with the hiv entry inhibitor pie1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
b'RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gp41 N-peptide
publication title Potent D-peptide inhibitors of HIV-1 entry
pubmed doi rcsb
molecule tags Viral protein/viral protein inhibitor
total genus 20
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r3cA00
1HJBA 2WTYA 1A02J 5AVQB 2Q7CA 2WT7A 5APUA 4GKGA 2BASA 3VMZA 5AW6B 1CI6B 1GK4A 1OXZA 3P7KA 2Q5UA 1HWTC 1GD2E 4I6MC 3KQGA 5AVSB 1SLQA 5AVWB 5AW3B 1CSBA 3HE4B 1CI6A 5AW0B 2C9NY 3NFQA 4KHXA 3TNUB 2R5DA 3VYIA 4HYTB 2WWWA 3NTNA 4C46A 3HTKA 3SWFA 4B86A 3MGNA 2Z5HA 2WPSA 2JJLA 1MFZA 1MV8A 3A3YB 3M9HA 3L36A 4DZOA 1CZQA 1GK6A 3O8ZA 5APSA 5AW7B 4AQRD 3A5TA 3M9BA 2XV5A 2QM7A 3A2AA 3L37A 5APQA 3V4WA 3NXSA 1YYCA 2WPQA 4JYCA 4EOTA 1GTWA 1FAVA 2N9BA 3M91A 5CMZA 2P67A 5APTA 2P7JA 3L35A 3IR9A 4AYCA 3B8EB 5AVUB 5AVZB 2IPPA 5APXA 3NMDA 2W6AA 4LC1A 1T2KC 1DH3A 1IO4A 3I5CA 2KP8A 4M3LA 1SP4A 4XE5B 5AVYB 2R3CA 1GU4A 5AVRB 5AW4B 3M0DA 3T97A 1NWQA 3TYYA 1MUUA 2YO2A 3TK1A 3M06A 3VMXA 5AVTB 4GT1A 3KDPB 4RESB 1J2JB 5AW8B 3V5BA 2Z5IA 1X8YA 5AVXB 4AUWA 3V4QA 2QM8A 4I2LC 3HE5B 1JUNA 5AW1B 1FOSE 4C7NB 1FOSF 2C9LY 5APVA 1KQLA 5APWA 2WPRA 1HBWA 5APYA 3HE5A 1A02F 2R32A 2XU6A 2XZRA 2W27A 2E43A 2R5BA 1S9KD 1T2KD 1JNMA 2E42A 4C7NA 2YO3A 1H88A 1H89A 1HUCA 3P8MC 1S9KE 1OWAA 3VN0A 5AVVB 1H8AA 1GZLA 3A7OA 3P32A 3VTPC 2P2UA 3LIEA 5AW2B 1GU5A 3OAKA 4JYBA 1G2CB 3LIDA 2H7HA 3MD0A 1NAFA 2WT7B 3HE4A 3M0AA 2ZFCA 5AW9B 2YNYA 5AW5B 2VRSA 3UIAA 2ZXEB 2Q3IA 3TNUA 3VMYA
chains in the Genus database with same CATH superfamily
5KLVK 1N7SA 2ZJSE 2NZ2A 1CI6B 1LT9B 5GTHH 1RF1C 2C0XA 3L75G 4GODA 2H88C 1L2PA 3U1AA 2BCCJ 2OGUA 2O01N 5TJHA 5CJ4A 4DZOA 1NU1K 1IK9A 3MUDA 1L0NG 1Q86Q 1ZXGA 1LWUC 3V2RA 3H1LG 2XNXA 1FAVA 1N7LA 1NH4A 3M91A 4KT0J 1KFNA 3B5NA 1W2EA 1VQ7P 2RMZA 4M3LA 3W67A 5KLVE 5AW4B 2JEEA 4N78D 1NKZB 3CCEP 1X8YA 3PP5A 3RK3B 1VF5C 2QM8A 3H1IJ 3B4SA 2QIWA 3HD7B 3MHVA 3AE5C 4N6JA 2K37A 5KLVD 1RHZB 3H1HG 1URQD 2PFXA 2PRRA 1LT9C 1Y47A 1PIXA 1S9KE 1CW5A 1YJNP 4HB1A 2ZT9C 2OARA 2FYNC 4K35A 3KYQA 3N4XA 3CCVP 2OTKE 1A02J 1BCCE 2M5AB 1USEA 1JCDA 3KQGA 2OYHA 2E76D 3Q1MA 1TU3F 3FXEA 1FS0E 1BCCD 1T3JA 1SQVK 1ZLLA 2OYOA 1S5LE 4NPEA 1T3UA 2KSJA 3L73E 2YKQA 2W90A 3QH9A 1DH3A 3CLQA 1HH0A 5CJ0A 3G9RA 2NPSD 3L73D 1KB9H 5GTHE 1VQ4P 2QJYB 2FYZA 1DIPA 3BCCJ 3CX5H 5K5GB 5CCGD 1VQOP 3JSVC 1N73A 1FOSE 1IFPA 1VL2A 1GL2B 3VMAA 3L70J 3L72G 1T2KD 4I1LA 1SQVE 2B88A 3S1KA 3HE4A 2I1JA 1M8OB 2FYUJ 1Q82Q 3CCSP 1DD4A 3E1IA 4WY4B 1IJDB 3L75E 1GK4A 1AVOA 2A45H 4I6MC 4W80A 2NPSA 5AW3B 1CSBA 1YJWP 1S5LX 2A06E 3D70A 2FY8A 4Y99C 3F89A 3R2PA 3SWFA 1MFZA 3RL0B 3L75D 1X9VA 2OYHB 5APSA 3H1LE 3G3ZA 1PV3A 1IFJA 2B89A 3H32A 1LTJA 2KXPB 2QJYC 3Q5PA 3LW5H 3CWBJ 4AYCA 1L0ND 1NJIQ 1RY3A 1NTKG 1NTZK 3HUSB 3H1LD 1KQGB 2ZYDA 2D2CC 3SFEC 1U57A 3TK1A 4ZNCA 3KDPB 2QSIA 2JKVA 3N7NA 4ASVA 1YITP 4I2LC 4HH2A 3H1HE 4IL6H 1SQXK 2B9BA 4D6TG 1RQVA 1KQLA 2I1KA 2Q6QA 1JY2P 1A02F 3CC7P 1P84H 2WSSH 1NTMG 3R4YA 3C9IA 1OWAA 1LNQA 3Q2YA 3TF5A 3P32A 1KQSO 3AEAC 4JYBA 1SQBG 1Q7YQ 3H1HD 5AW9B 1KILB 2SPZA 1J1DC 2N1TA 1EZVG 1KB9I 5AVQB 1VQ5P 3RL0C 4U3FJ 1NTZE 4R4MA 3MZWB 3RK2B 1HWTC 1GD2E 1ZN5A 1KORA 1SLQA 1GW4A 3HE4B 2LXBA 3L71J 5KJ7C 3GG2A 4DOJA 3FWLA 2NRGA 2OYIB 2WWWA 1KB9E 4B86A 3EFGA 1SQXE 4ZKUA 3HUSC 1NTZD 3CCUP 3HRNA 3BRTB 2XV5A 1SQQG 1EXJA 3E7KA 3GF3A 4HKZH 1PGJA 1KB9D 2A45I 5AVUB 4WVZA 4UB6H 1SS1A 3CX5D 1KZUB 1PZQA 2Y9YA 5AVTB 1JOCA 5CHXA 1SQPJ 2YXQB 5CBOA 2KSEA 1RE3C 3HE5B 3L72E 1LTIC 2G8YA 1KQFB 2BCCG 3EQ2A 3CCQP 1PPJG 2YO3A 2Q9IA 2KLUA 2KK7A 4OVNF 5AW2B 3MTUE 2FFDA 4KJMA 3AE2C 3L72D 4PV1B 2OYIC 1NAYA 4GIFA 5EFWB 3FWNA 1VPCA 3RK3E 1HJBA 3C1LA 1BDDA 5H2FH 2E75B 1EDJA 2KOGA 1CI6A 4XFJA 1LT9A 1P84I 2RKLA 2W6JH 3RK3D 2ZVNB 2WPSA 2Z5HA 3H1IG 3HD7D 1MFTA 4IL6E 3O8ZA 3O6QB 3A5TA 1JY3N 2QJKC 1BE3G 1L0LJ 3V4WA 1FBMA 1P84E 2GA1A 1NTKE 3A0BH 2QJPC 3CPWO 2UWJE 1T2KC 2IZ1A 3WU2E 5DJTB 2BEQD 2YO2A 4RESB 1P84D 1RF1B 4D6TE 3TGUE 5AVXB 1NTKD 1VQPP 3W68A 2LR2A 1NO4A 1HBWA 1QLED 1NGMB 2AEMA 2XZRA 2KUBA 4R4LA 3WUVA 5BVZA 2M0BA 3PRJA 2E75C 2O1KA 3AE9C 4JF7A 4D6TD 3A7OA 4QMAA 1EZVE 1LTTC 1LWUB 1OW6A 1S3JA 2FXPA 2R44A 3UIAA 3E1RA 2WSCJ 3H1KJ 1FZBA 2Q7CA 2BASA 4UB6E 2JWAA 5AW6B 1GDTA 3D71A 2LXCB 4IL6X 1EZVD 2C9NY 2J58A 4H0LD 1VF5B 3KZIH 1MKMA 4H13C 1VQMP 1BGYJ 3GHGC 1SQQE 3BCCG 1RF0C 1JM0A 2Y0EA 2QM7A 2WSEJ 2Q1KA 3L70G 2ZT9B 4CPGA 1UIXA 4BWNA 3PJSK 2FYNB 1K9MQ 4YXWH 1FE6A 1BGYE 1SQQD 3WUUA 2HLOA 1XTGB 3CMAP 2R3CA 2FYUG 3M06A 4WY4D 5H2FE 4N78E 1VQKP 1LGHB 2ITAA 1JEKA 2BCCE 2E5TA 4PJ0H 1PPJE 3KPEA 1LTBC 3G71P 3H25A 1GL2A 1FZFA 1JCCA 1T8ZA 4H44C 5AVVB 1KD1Q 1S72P 1PL5A 1GMJA 1BSHA 1PP9J 2BCCD 1XTCC 1PPJD 2ZXEB 3H1JJ 3IN6A 3A0BE 3CWBG 2LKMA 1BE3J 2L5GB 1RE4C 4PD4H 1NU1J 1KC8Q 1EDIA 4WY4A 4NPFX 2AXTH 2YMYA 2HPCB 2H8PD 3H1IE 4I7ZC 1M56D 3BRVB 4DJGA 2N9YB 3A2AA 2P10A 3TSIA 1R5SA 3H1ID 5APTA 2P7JA 3S9OA 1AQTA 2IPPA 1IO4A 2K9YA 5KJ7A 1RH5B 1VQ6P 2QVAA 4OGQC 1KILD 3GLMA 2GUSA 3I55P 3HUSA 4TLFA 4U3FG 3RK2D 4AUWA 4Y99B 1M57D 1FDMA 2C0WA 3L71G 3FX0A 3C8VA 3H6PA 1SVFA 5APVA 3KZIE 5B5EH 2XU6A 5CCHC 1L4AB 3PH0A 2MKVA 1KYOH 2WVRA 1QGKB 1GU5A 2J5UA 2L91A 1K05A 5B66H 1L0NK 4GKGA 1KILA 1HVVA 2K3RA 1K04A 2D2CB 1SQVJ 3CCJP 2KS1B 3AEDC 1OX3A 4KHXA 2JDIH 3BCCE 1PFIA 3CCRP 4OH8B 5KAFH 1PGPA 1SQPG 1Y8AA 2XKMA 2JJLA 3PTZA 1VQLP 1M1KQ 1K8AQ 3IF4A 2OYIA 1GK6A 3L70E 2IFMA 2KZIA 1QX8A 3EWKA 2Y0DA 1YI2P 4EOTA 3BCCD 2N9BA 2P67A 1N7SC 4PD4I 3L35A 3IR9A 1EC5A 3B8EB 5KLIC 2FYUE 2ZYGA 3V2PA 1GW3A 1J1DB 4PV1D 2OTJP 1L0NE 3L70D 1L4AC 2KI7B 3FXDA 3AE4C 5AW8B 3AE3C 4PD4E 4WWIA 2FYUD 3MUDC 2AXTE 2N1TD 1Q2NA 2PGDA 2ZXXA 1SFCC 3HE5A 5C39A 2H43A 2R5BA 3IFMA 2KNCB 4H0LC 1JTHB 3B5NC 4PD4D 2RH0A 1DD3A 1N86A 2P2UA 2H7HA 1L0LG 3MD0A 2ZFCA 1U7JA 2ZVOB 4JPZB 1H0TA 3BASA 1AQ5A 1KV4A 3VMZA 2GUVA 3VOPA 4WB4A 2ZYAA 1W2BO 4DT0A 4LGDE 4UB8H 4L76A 2J59M 1YHQP 1KYOI 2IZ0A 1MV8A 2I8DA 2P58A 1IFDA 2Z4EA 1OFCX 1JY3O 3CX5I 3JCUH 5B5EE 1NHLA 1FJPA 3O6QA 1G1IA 2E74D 1KYOE 3IAOA 2BEZF 4W7ZA 3SSUA 1LP1B 4LC1A 1X79B 1SQXJ 5B66E 3CX5E 4U3FE 1SP4A 3GF7A 3AEBC 1YTZI 4XE5B 5AVYB 3D6ZA 3H1KG 1HTLC 2M3BA 2YMKA 1J2JB 2V7QJ 1KYOD 2P1JA 1U7MA 2K1AA 1RF0A 5AW1B 1URQC 1RF1A 1FOSF 1VF5D 4U3FD 5APYA 1MZ9A 2W8ZA 1BGYG 2QJKB 1HUCA 3P8MC 3A0HH 5E79H 2WSCH 2GM4A 1EDKA 2QG4A 3LIDA 2WT7B 3U1CA 3M0AA 2QJPB 4ASWA 2ZT9D 1LWUA 3TNUA 4BRYB 1YTZT 1AV1A 3AEFC 2E76C 1DX7A 1N73C 2KYVA 1SQPE 3AE8C 3NFQA 1NTKK 1H0TB 1FZEA 3VYIA 3M9QA 4HYTB 4ZKPA 5BU5A 4C46A 2HODA 2JP3A 1NYHA 2WSEH 3M9HA 4EYYQ 3CXHH 1L0LK 1KN7A 3D6YA 4IFDK 1SQPD 1RE4A 3MIWA 1GTWA 3AECC 5KKZC 2W6AA 1NTMK 1QVGO 2NPSC 1PP9G 2YIUC 1SQBK 2WZ7A 3H1JG 1M1JB 3L74J 5CCGC 1FU1A 2OQQA 1S2EA 4YPCA 3CI9A 1NU1G 1WRGA 1JY2O 1ZV8A 4UB8E 1QEXA 4H13B 1LTAC 3P8CE 3GHGB 3RL0g 3CD6P 2JR8A 2E42A 1L0LE 1IFNA 1ZW0A 3JCUE 3TGUJ 1G2CB 4L75A 1EZVI 1JB0J 1YBKA 3P8CD 1OMIA 1SQQK 1NTME 1VQ8P 1KTMA 3B71A 1L0LD 1PGOA 1Y9BA 1SQBE 1J1EB 1M90Q 1BSNA 5CCHA 2Q3EA 3TNUB 5DJUB 1NTMD 2FXOA 2HPCA 1NVOA 3A3YB 3ABVC 3Q3DA 1WMKA 1M1JC 1SQBD 2O01J 3M9BA 5CBNA 3GMAA 5APQA 4H44B 2HODB 4W7YA 1FZCC 3CL3D 4U7JA 1Q90D 5E79E 3QWOC 5APXA 4MN4C 3H1KE 4IFFA 1OVUA 4N3YB 2WSFJ 2JO1A 2AXCA 1GU4A 1GL2D 1R5LA 5GTIH 4GT1A 3V5BA 5KAIH 3S4RA 3CXHI 2D2CD 1SQVG 3H1KD 4I7ZB 5APWA 2KLVA 2E5YA 1IK7A 2W27A 1FDIA 1JNMA 2AEFA 3CC2P 1J1EC 3CXHE 1GZLA 1L4AA 1ZP0C 3KXDA 3V2NA 2IX7C 1IFMA 1BGYD 2YNYA 1JY2N 2IYOA 3USSA 2A06G 5APUA 2WPVB 3V6IA 4OGQB 2E74C 5KLVJ 1N2DC 3P7KA 2Q5UA 3CXHD 1R8EA 3RL0D 1SFCA 1WT6A 1PGQA 3HTKB 5KJ7D 4K3AA 3CC4P 3M0DC 2KS1A 3RBZA 2FXMA 2YKPA 1FZAA 3PHLA 2FFDC 3K5BA 1OVRA 2W83C 2O3JA 4JYCA 3OA7A 1YJ9P 1PP9E 2R3SA 3H1JE 3T97B 1BE3E 1FDOA 4YTPC 1KILE 1NU1E 1BCCJ 1ZMEC 3FGAD 3TYYA 1MUUA 2V4HA 1AA0A 2Z5IA 3WMM0 1PP9D 4EIJA 1OW7A 3V4QA 1AJYA 3H1JD 1JO5A 4L73A 1JMBA 4C7NB 1BE3D 2MJZA 3EFFK 2QA4P 3RGUA 1NU1D 2E43A 1G1JA 1S9KD 3OW2O 2CPSA 1NTZG 4C7RA 2KNCA 3L73J 1JTHA 1OIPA 1N7SB 5KLIB 2VRSA 4GOFA 2WMMA 1USDA 2QRXA 1ZR2A 1EXIA 1URQA 1SQXG 5M1BA 3AE1C 2PAJA 2O1JA 1JY3P 3RK3C 4DCKA 2KZJA 5GTIE 5KAIE 1LJ2A 3HD7C 2FYUK 1YIJP 2HR3A 4NPDA 1UIIA 1K73Q 2XDJA 1RE3A 1SFCB 1DEEG 2QE7H 4H0LB 3B5NB 1VDFA 4EI2A 1JMMA 3NMDA 3CMEP 1LT1A 2A45G 2KP8A 1NKNA 2HFED 2V7QH 1LP1A 2IBZG 4PJ0E 3L75J 5AVRB 3MP7B 1NOHA 2CPBA 1ZR4A 3KHUA 1IZNB 2AEJA 2Y0CA 1L0NJ 3H1LJ 1SQVD 3U59A 4L74A 5TISH 1AFOA 2E75D 5CCGA 2FKWB 4XA4A 1E5WA 3SWYA 1QVFO 2WT7A 4BRYA 1YQ4C 2A06D 1LTSC 2IFNA 2JWDA 2B87A 3CWBE 3L74G 1AVYA 3H1HJ 3SWKA 3MGNA 4LLHA 1GL2C 1URQB 4BXLA 1HJ0A 1HGZA 4H13D 3L37A 1OW8A 3PLNA 4GOEA 3CWBD 5CMZA 1EDLA 3TGUG 1BDCA 1HF9A 4WY4C 2W6BA 1NTZJ 1M7LA 1OZHA 1NWQA 2E76B 1N8RQ 3VMXA 2QEXP 1N73B 2KB7P 1M1JA 1OVVA 1FZCA 3WU2H 1IC2A 3ITKA 2OYHC 1E79H 2R32A 4WBAA 1HGVA 3GHGA 4RJTA 3BVHA 3VN0A 1SQPK 3L71E 1FZGA 3OAKA 3I56P 4IOIH 4H44D 2XNDH 5KKZB 2Q3IA 1S1CX 1G2CA 2WTYA 2NPSB 2IDBA 5KAFE 3TDKA 2YIUB 1DEBA 4Z1MH 1IFIA 3CCLP 2HYNA 5AVWB 3L71D 4JBZA 5AW0B 2M8RA 1QL2A 2R5DA 2FBWC 1SQXD 3VP9A 3L72J 1EQ7A 2O01H 3SFDC 2IBZI 3L4FA 3H32B 1CZQA 2CK3H 1LTJB 4AQRD 2KIKA 2B87B 3NXSA 1YYCA 2WPQA 4TT3H 2K88A 3II6A 2K9JA 5TISE 1KILC 3VP8A 5AVZB 1KMIZ 2WSFH 2IBZE 3G4SP 3LW5J 1LTGC 2H89C 2OTLP 3RK2C 3M0DA 4OGQD 3AEEC 5KLVG 2M3EA 4IFMA 1JUNA 2IBZD 3JC22 4A7PA 2YXRB 2C9LY 1KFMA 2POHA 5KTBA 2ZAEB 1X22A 1VQ9P 1W5CE 4OWFA 3F5HA 1FJKA 1H88A 3G6EP 5CCHD 1H8AA 2PP6A 1RQUA 2N1TB 1FZCB 1ZRTE 2HG5D 5BU8B 1NTKJ 2WITA 3V2QA 5AW5B 1FC2C 4RKUJ 1X0TA 3VMYA 1S4XA 1LTJC 1OXZA 3ZDMA 3L74E 5AVSB 2RN0A 2WQYC 1ZRTD 4D6TJ 1BCCG 5L8RJ 3NTNA 3HTKA 4ZMDA 1NTMJ 3L36A 2Y9ZA 5AW7B 4HJGH 3L74D 4EDFA 1D7MA 1SQBJ 2G3AA 1Q81Q 1YQ3C 4YXDC 4PV1C 4O9BA 3OJAB 3L73G 1N7SD 3I5CA 4GDOA 3HD7A 2E74B 3T97A 3WUTA 2K9JB 3TGUD 2N1TC 1L4AD 2DW3A 2YKOA 3A0HE 3RBXA 1T6AA 2WPRA 1S5LH 1SQQJ 2IYPA 3BATA 1QL1A 4RO0A 4JQ0D 4C7NA 3AEGC 2FFDB 1H89A 1SFCD 4Y28J 1Z56A 3CCMP 3VTPC 3AE6C 3AE7C 3LIEA 2M5AA 3Q5SA 1NAFA 3B5ND 1VQNP 1ZOYC 3GW6A 3Q5RA
chains in the Genus database with same CATH topology
1HJBA 3BASA 1AQ5A 5KLVK 1N7SA 3VMZA 2GUVA 3VOPA 1ZR2A 1CI6B 1URQA 4WB4A 1LT9B 1RF1C 2C0XA 2PAJA 4LGDE 2O1JA 2KOGA 1JY3P 2J59M 3RK3C 1CI6A 1LT9A 3HD7C 2FYUK 3U1AA 3RK3D 2WPSA 2Z5HA 1MV8A 2XDJA 1RE3A 3HD7D 4DZOA 5CJ4A 1IFDA 1SFCB 2Z4EA 1NU1K 3O8ZA 1IK9A 1JY3O 3MUDA 3A5TA 1JY3N 3V4WA 1NHLA 1FJPA 1FBMA 3B5NB 1LWUC 1VDFA 1G1IA 3V2RA 2XNXA 1FAVA 1N7LA 1NH4A 3M91A 1KFNA 4W7ZA 1JMMA 3NMDA 4LC1A 3B5NA 1T2KC 1X79B 2A45G 1W2EA 2KP8A 1NKNA 4M3LA 1SP4A 1YTZI 2HFED 4XE5B 5AVYB 5AVRB 5AW4B 1HTLC 1NOHA 2JEEA 2M3BA 2YO2A 4N78D 2CPBA 4RESB 1J2JB 1NKZB 1ZR4A 2P1JA 1RF1B 1X8YA 3PP5A 5AVXB 3RK3B 1RF0A 2QM8A 5AW1B 3HD7B 1URQC 1RF1A 4N6JA 1FOSF 1NO4A 1HBWA 5APYA 2XZRA 1MZ9A 1URQD 5BVZA 1LT9C 3U59A 2O1KA 1HUCA 3P8MC 1S9KE 1CW5A 4JF7A 3A7OA 1LTTC 2WSCH 1LWUB 2GM4A 1AFOA 2OARA 3LIDA 2WT7B 3U1CA 3KYQA 3M0AA 5CCGA 2FKWB 3UIAA 3N4XA 1LWUA 3TNUA 4XA4A 1A02J 1FZBA 1E5WA 3SWYA 2Q7CA 2WT7A 1YTZT 2BASA 5AW6B 1GDTA 1DX7A 1JCDA 3KQGA 1N73C 2OYHA 2KYVA 1LTSC 2IFNA 2C9NY 3NFQA 1NTKK 1FZEA 3VYIA 2J58A 3M9QA 4HYTB 4ZKPA 5BU5A 4C46A 2HODA 3MGNA 4LLHA 1GL2C 1URQB 3GHGC 2WSEH 3M9HA 1HGZA 1T3JA 1L0LK 1RF0C 1SQVK 2QM7A 1ZLLA 3L37A 4IFDK 1RE4A 3MIWA 1T3UA 1GTWA 2KSJA 5CMZA 2YKQA 2W6AA 1NTMK 3CLQA 1DH3A 2NPSC 2HLOA 4WY4C 1HH0A 1XTGB 2R3CA 5CJ0A 2W6BA 1SQBK 2WZ7A 1M7LA 1M1JB 1NWQA 2NPSD 3M06A 3VMXA 4WY4D 5CCGC 4N78E 1N73B 1FU1A 2KB7P 1M1JA 3CI9A 1LGHB 1WRGA 1JY2O 2FYZA 1ZV8A 5CCGD 1N73A 1FOSE 1FZCA 1IC2A 1LTAC 3KPEA 1GL2B 1LTBC 3P8CE 3GHGB 2OYHC 2R32A 1T2KD 4I1LA 4WBAA 2E42A 1HGVA 1GL2A 1FZFA 1IFNA 1JCCA 3GHGA 1T8ZA 3BVHA 3VN0A 5AVVB 1SQPK 1FZGA 3OAKA 1G2CB 3HE4A 2I1JA 1XTCC 2ZXEB 3P8CD 2Q3IA 1SQQK 2WTYA 1G2CA 2LKMA 2NPSB 2L5GB 3E1IA 1RE4C 4WY4B 1DEBA 1IJDB 1GK4A 1IFIA 2A45H 4I6MC 1J1EB 4W80A 2NPSA 2HYNA 5AVWB 5AW3B 4WY4A 1CSBA 5CCHA 2YMYA 5AW0B 2M8RA 1QL2A 2HPCB 3TNUB 2H8PD 2R5DA 4Y99C 3VP9A 3R2PA 3SWFA 1EQ7A 2O01H 3BRVB 1MFZA 2HPCA 3A3YB 3L4FA 3H32B 3RL0B 1CZQA 1X9VA 2OYHB 1LTJB 5APSA 4AQRD 1M1JC 3M9BA 3G3ZA 1IFJA 3A2AA 5APQA 3H32A 3NXSA 1YYCA 2WPQA 1LTJA 2HODB 4W7YA 1FZCC 3CL3D 3TSIA 3II6A 5APTA 2P7JA 3LW5H 4AYCA 1KILC 3VP8A 5AVZB 2IPPA 5APXA 2WSFH 1IO4A 5KJ7A 1RY3A 1NTZK 3HUSB 1KILD 4IFFA 1LTGC 2GUSA 4N3YB 3RK2C 1GU4A 3M0DA 1GL2D 3TK1A 3HUSA 4GT1A 3KDPB 3V5BA 3RK2D 3N7NA 4AUWA 4IFMA 4I2LC 1JUNA 4HH2A 4Y99B 1FDMA 2C0WA 1SQXK 3H6PA 1SVFA 2C9LY 5APVA 1KQLA 2I1KA 2KLVA 1KFMA 5APWA 2POHA 5KTBA 1JY2P 1A02F 2XU6A 5CCHC 2W27A 1JNMA 1L4AB 1FJKA 3C9IA 1H88A 1J1EC 1OWAA 5CCHD 1H8AA 1GZLA 2PP6A 3P32A 2N1TB 1GU5A 1L4AA 1FZCB 4JYBA 3V2NA 2HG5D 5BU8B 2IX7C 2WITA 1IFMA 3V2QA 5AW9B 2YNYA 1JY2N 1KILB 5AW5B 1J1DC 2N1TA 1L0NK 3VMYA 5AVQB 5APUA 4GKGA 3RL0C 1KILA 1HVVA 1LTJC 1OXZA 1N2DC 3P7KA 2Q5UA 3RK2B 1HWTC 1GD2E 5AVSB 3RL0D 1SFCA 1WT6A 1ZN5A 1SLQA 1GW4A 3HTKB 3HE4B 5KJ7C 4DOJA 4KHXA 1PFIA 4OH8B 2OYIB 2WWWA 3NTNA 3HTKA 5KJ7D 4B86A 3M0DC 2XKMA 3EFGA 2JJLA 4ZKUA 2FXMA 3HUSC 3L36A 2YKPA 1FZAA 2OYIA 1GK6A 3HRNA 3BRTB 5AW7B 2IFMA 2FFDC 2XV5A 4JYCA 4EOTA 3OA7A 2N9BA 2P67A 1N7SC 3L35A 3IR9A 3B8EB 4O9BA 2A45I 5AVUB 3V2PA 3OJAB 1GW3A 1J1DB 1N7SD 3I5CA 1KZUB 3HD7A 1L4AC 3T97A 3TYYA 1MUUA 5AVTB 5AW8B 1JOCA 3WMM0 2Z5IA 2N1TC 1L4AD 5CHXA 4EIJA 1RE3C 2YKOA 3V4QA 3HE5B 1JO5A 2N1TD 4C7NB 2MJZA 1LTIC 2WPRA 1SFCC 3HE5A 3BATA 1QL1A 3EQ2A 2E43A 2H43A 2R5BA 1G1JA 3IFMA 1S9KD 4C7NA 2YO3A 2Q9IA 2FFDB 1JTHB 1H89A 1SFCD 3B5NC 1Z56A 2CPSA 1N86A 3VTPC 4C7RA 2P2UA 3LIEA 5AW2B 3MTUE 2FFDA 2H7HA 1JTHA 3MD0A 1NAFA 1N7SB 2OYIC 3B5ND 2ZFCA 2VRSA 4GIFA 1VPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJB A;  2WTY A;  1A02 J;  5AVQ B;  2Q7C A;  2WT7 A;  5APU A;  4GKG A;  2BAS A;  3VMZ A;  5AW6 B;  1CI6 B;  1GK4 A;  1OXZ A;  3P7K A;  2Q5U A;  1HWT C;  1GD2 E;  4I6M C;  3KQG A;  5AVS B;  1SLQ A;  5AVW B;  5AW3 B;  1CSB A;  3HE4 B;  1CI6 A;  5AW0 B;  2C9N Y;  3NFQ A;  4KHX A;  3TNU B;  2R5D A;  3VYI A;  4HYT B;  2WWW A;  3NTN A;  4C46 A;  3HTK A;  3SWF A;  4B86 A;  3MGN A;  2Z5H A;  2WPS A;  2JJL A;  1MFZ A;  1MV8 A;  3A3Y B;  3M9H A;  3L36 A;  4DZO A;  1CZQ A;  1GK6 A;  3O8Z A;  5APS A;  5AW7 B;  4AQR D;  3A5T A;  3M9B A;  2XV5 A;  2QM7 A;  3A2A A;  3L37 A;  5APQ A;  3V4W A;  3NXS A;  1YYC A;  2WPQ A;  4JYC A;  4EOT A;  1GTW A;  1FAV A;  2N9B A;  3M91 A;  5CMZ A;  2P67 A;  5APT A;  2P7J A;  3L35 A;  3IR9 A;  4AYC A;  3B8E B;  5AVU B;  5AVZ B;  2IPP A;  5APX A;  3NMD A;  2W6A A;  4LC1 A;  1T2K C;  1DH3 A;  1IO4 A;  3I5C A;  2KP8 A;  4M3L A;  1SP4 A;  4XE5 B;  5AVY B;  2R3C A;  1GU4 A;  5AVR B;  5AW4 B;  3M0D A;  3T97 A;  1NWQ A;  3TYY A;  1MUU A;  2YO2 A;  3TK1 A;  3M06 A;  3VMX A;  5AVT B;  4GT1 A;  3KDP B;  4RES B;  1J2J B;  5AW8 B;  3V5B A;  2Z5I A;  1X8Y A;  5AVX B;  4AUW A;  3V4Q A;  2QM8 A;  4I2L C;  3HE5 B;  1JUN A;  5AW1 B;  1FOS E;  4C7N B;  1FOS F;  2C9L Y;  5APV A;  1KQL A;  5APW A;  2WPR A;  1HBW A;  5APY A;  3HE5 A;  1A02 F;  2R32 A;  2XU6 A;  2XZR A;  2W27 A;  2E43 A;  2R5B A;  1S9K D;  1T2K D;  1JNM A;  2E42 A;  4C7N A;  2YO3 A;  1H88 A;  1H89 A;  1HUC A;  3P8M C;  1S9K E;  1OWA A;  3VN0 A;  5AVV B;  1H8A A;  1GZL A;  3A7O A;  3P32 A;  3VTP C;  2P2U A;  3LIE A;  5AW2 B;  1GU5 A;  3OAK A;  4JYB A;  1G2C B;  3LID A;  2H7H A;  3MD0 A;  1NAF A;  2WT7 B;  3HE4 A;  3M0A A;  2ZFC A;  5AW9 B;  2YNY A;  5AW5 B;  2VRS A;  3UIA A;  2ZXE B;  2Q3I A;  3TNU A;  3VMY A; 
#chains in the Genus database with same CATH topology
 5KLV K;  1N7S A;  2ZJS E;  2NZ2 A;  1CI6 B;  1LT9 B;  5GTH H;  1RF1 C;  2C0X A;  3L75 G;  4GOD A;  2H88 C;  1L2P A;  3U1A A;  2BCC J;  2OGU A;  2O01 N;  5TJH A;  5CJ4 A;  4DZO A;  1NU1 K;  1IK9 A;  3MUD A;  1L0N G;  1Q86 Q;  1ZXG A;  1LWU C;  3V2R A;  3H1L G;  2XNX A;  1FAV A;  1N7L A;  1NH4 A;  3M91 A;  4KT0 J;  1KFN A;  3B5N A;  1W2E A;  1VQ7 P;  2RMZ A;  4M3L A;  3W67 A;  5KLV E;  5AW4 B;  2JEE A;  4N78 D;  1NKZ B;  3CCE P;  1X8Y A;  3PP5 A;  3RK3 B;  1VF5 C;  2QM8 A;  3H1I J;  3B4S A;  2QIW A;  3HD7 B;  3MHV A;  3AE5 C;  4N6J A;  2K37 A;  5KLV D;  1RHZ B;  3H1H G;  1URQ D;  2PFX A;  2PRR A;  1LT9 C;  1Y47 A;  1PIX A;  1S9K E;  1CW5 A;  1YJN P;  4HB1 A;  2ZT9 C;  2OAR A;  2FYN C;  4K35 A;  3KYQ A;  3N4X A;  3CCV P;  2OTK E;  1A02 J;  1BCC E;  2M5A B;  1USE A;  1JCD A;  3KQG A;  2OYH A;  2E76 D;  3Q1M A;  1TU3 F;  3FXE A;  1FS0 E;  1BCC D;  1T3J A;  1SQV K;  1ZLL A;  2OYO A;  1S5L E;  4NPE A;  1T3U A;  2KSJ A;  3L73 E;  2YKQ A;  2W90 A;  3QH9 A;  1DH3 A;  3CLQ A;  1HH0 A;  5CJ0 A;  3G9R A;  2NPS D;  3L73 D;  1KB9 H;  5GTH E;  1VQ4 P;  2QJY B;  2FYZ A;  1DIP A;  3BCC J;  3CX5 H;  5K5G B;  5CCG D;  1VQO P;  3JSV C;  1N73 A;  1FOS E;  1IFP A;  1VL2 A;  1GL2 B;  3VMA A;  3L70 J;  3L72 G;  1T2K D;  4I1L A;  1SQV E;  2B88 A;  3S1K A;  3HE4 A;  2I1J A;  1M8O B;  2FYU J;  1Q82 Q;  3CCS P;  1DD4 A;  3E1I A;  4WY4 B;  1IJD B;  3L75 E;  1GK4 A;  1AVO A;  2A45 H;  4I6M C;  4W80 A;  2NPS A;  5AW3 B;  1CSB A;  1YJW P;  1S5L X;  2A06 E;  3D70 A;  2FY8 A;  4Y99 C;  3F89 A;  3R2P A;  3SWF A;  1MFZ A;  3RL0 B;  3L75 D;  1X9V A;  2OYH B;  5APS A;  3H1L E;  3G3Z A;  1PV3 A;  1IFJ A;  2B89 A;  3H32 A;  1LTJ A;  2KXP B;  2QJY C;  3Q5P A;  3LW5 H;  3CWB J;  4AYC A;  1L0N D;  1NJI Q;  1RY3 A;  1NTK G;  1NTZ K;  3HUS B;  3H1L D;  1KQG B;  2ZYD A;  2D2C C;  3SFE C;  1U57 A;  3TK1 A;  4ZNC A;  3KDP B;  2QSI A;  2JKV A;  3N7N A;  4ASV A;  1YIT P;  4I2L C;  4HH2 A;  3H1H E;  4IL6 H;  1SQX K;  2B9B A;  4D6T G;  1RQV A;  1KQL A;  2I1K A;  2Q6Q A;  1JY2 P;  1A02 F;  3CC7 P;  1P84 H;  2WSS H;  1NTM G;  3R4Y A;  3C9I A;  1OWA A;  1LNQ A;  3Q2Y A;  3TF5 A;  3P32 A;  1KQS O;  3AEA C;  4JYB A;  1SQB G;  1Q7Y Q;  3H1H D;  5AW9 B;  1KIL B;  2SPZ A;  1J1D C;  2N1T A;  1EZV G;  1KB9 I;  5AVQ B;  1VQ5 P;  3RL0 C;  4U3F J;  1NTZ E;  4R4M A;  3MZW B;  3RK2 B;  1HWT C;  1GD2 E;  1ZN5 A;  1KOR A;  1SLQ A;  1GW4 A;  3HE4 B;  2LXB A;  3L71 J;  5KJ7 C;  3GG2 A;  4DOJ A;  3FWL A;  2NRG A;  2OYI B;  2WWW A;  1KB9 E;  4B86 A;  3EFG A;  1SQX E;  4ZKU A;  3HUS C;  1NTZ D;  3CCU P;  3HRN A;  3BRT B;  2XV5 A;  1SQQ G;  1EXJ A;  3E7K A;  3GF3 A;  4HKZ H;  1PGJ A;  1KB9 D;  2A45 I;  5AVU B;  4WVZ A;  4UB6 H;  1SS1 A;  3CX5 D;  1KZU B;  1PZQ A;  2Y9Y A;  5AVT B;  1JOC A;  5CHX A;  1SQP J;  2YXQ B;  5CBO A;  2KSE A;  1RE3 C;  3HE5 B;  3L72 E;  1LTI C;  2G8Y A;  1KQF B;  2BCC G;  3EQ2 A;  3CCQ P;  1PPJ G;  2YO3 A;  2Q9I A;  2KLU A;  2KK7 A;  4OVN F;  5AW2 B;  3MTU E;  2FFD A;  4KJM A;  3AE2 C;  3L72 D;  4PV1 B;  2OYI C;  1NAY A;  4GIF A;  5EFW B;  3FWN A;  1VPC A;  3RK3 E;  1HJB A;  3C1L A;  1BDD A;  5H2F H;  2E75 B;  1EDJ A;  2KOG A;  1CI6 A;  4XFJ A;  1LT9 A;  1P84 I;  2RKL A;  2W6J H;  3RK3 D;  2ZVN B;  2WPS A;  2Z5H A;  3H1I G;  3HD7 D;  1MFT A;  4IL6 E;  3O8Z A;  3O6Q B;  3A5T A;  1JY3 N;  2QJK C;  1BE3 G;  1L0L J;  3V4W A;  1FBM A;  1P84 E;  2GA1 A;  1NTK E;  3A0B H;  2QJP C;  3CPW O;  2UWJ E;  1T2K C;  2IZ1 A;  3WU2 E;  5DJT B;  2BEQ D;  2YO2 A;  4RES B;  1P84 D;  1RF1 B;  4D6T E;  3TGU E;  5AVX B;  1NTK D;  1VQP P;  3W68 A;  2LR2 A;  1NO4 A;  1HBW A;  1QLE D;  1NGM B;  2AEM A;  2XZR A;  2KUB A;  4R4L A;  3WUV A;  5BVZ A;  2M0B A;  3PRJ A;  2E75 C;  2O1K A;  3AE9 C;  4JF7 A;  4D6T D;  3A7O A;  4QMA A;  1EZV E;  1LTT C;  1LWU B;  1OW6 A;  1S3J A;  2FXP A;  2R44 A;  3UIA A;  3E1R A;  2WSC J;  3H1K J;  1FZB A;  2Q7C A;  2BAS A;  4UB6 E;  2JWA A;  5AW6 B;  1GDT A;  3D71 A;  2LXC B;  4IL6 X;  1EZV D;  2C9N Y;  2J58 A;  4H0L D;  1VF5 B;  3KZI H;  1MKM A;  4H13 C;  1VQM P;  1BGY J;  3GHG C;  1SQQ E;  3BCC G;  1RF0 C;  1JM0 A;  2Y0E A;  2QM7 A;  2WSE J;  2Q1K A;  3L70 G;  2ZT9 B;  4CPG A;  1UIX A;  4BWN A;  3PJS K;  2FYN B;  1K9M Q;  4YXW H;  1FE6 A;  1BGY E;  1SQQ D;  3WUU A;  2HLO A;  1XTG B;  3CMA P;  2R3C A;  2FYU G;  3M06 A;  4WY4 D;  5H2F E;  4N78 E;  1VQK P;  1LGH B;  2ITA A;  1JEK A;  2BCC E;  2E5T A;  4PJ0 H;  1PPJ E;  3KPE A;  1LTB C;  3G71 P;  3H25 A;  1GL2 A;  1FZF A;  1JCC A;  1T8Z A;  4H44 C;  5AVV B;  1KD1 Q;  1S72 P;  1PL5 A;  1GMJ A;  1BSH A;  1PP9 J;  2BCC D;  1XTC C;  1PPJ D;  2ZXE B;  3H1J J;  3IN6 A;  3A0B E;  3CWB G;  2LKM A;  1BE3 J;  2L5G B;  1RE4 C;  4PD4 H;  1NU1 J;  1KC8 Q;  1EDI A;  4WY4 A;  4NPF X;  2AXT H;  2YMY A;  2HPC B;  2H8P D;  3H1I E;  4I7Z C;  1M56 D;  3BRV B;  4DJG A;  2N9Y B;  3A2A A;  2P10 A;  3TSI A;  1R5S A;  3H1I D;  5APT A;  2P7J A;  3S9O A;  1AQT A;  2IPP A;  1IO4 A;  2K9Y A;  5KJ7 A;  1RH5 B;  1VQ6 P;  2QVA A;  4OGQ C;  1KIL D;  3GLM A;  2GUS A;  3I55 P;  3HUS A;  4TLF A;  4U3F G;  3RK2 D;  4AUW A;  4Y99 B;  1M57 D;  1FDM A;  2C0W A;  3L71 G;  3FX0 A;  3C8V A;  3H6P A;  1SVF A;  5APV A;  3KZI E;  5B5E H;  2XU6 A;  5CCH C;  1L4A B;  3PH0 A;  2MKV A;  1KYO H;  2WVR A;  1QGK B;  1GU5 A;  2J5U A;  2L91 A;  1K05 A;  5B66 H;  1L0N K;  4GKG A;  1KIL A;  1HVV A;  2K3R A;  1K04 A;  2D2C B;  1SQV J;  3CCJ P;  2KS1 B;  3AED C;  1OX3 A;  4KHX A;  2JDI H;  3BCC E;  1PFI A;  3CCR P;  4OH8 B;  5KAF H;  1PGP A;  1SQP G;  1Y8A A;  2XKM A;  2JJL A;  3PTZ A;  1VQL P;  1M1K Q;  1K8A Q;  3IF4 A;  2OYI A;  1GK6 A;  3L70 E;  2IFM A;  2KZI A;  1QX8 A;  3EWK A;  2Y0D A;  1YI2 P;  4EOT A;  3BCC D;  2N9B A;  2P67 A;  1N7S C;  4PD4 I;  3L35 A;  3IR9 A;  1EC5 A;  3B8E B;  5KLI C;  2FYU E;  2ZYG A;  3V2P A;  1GW3 A;  1J1D B;  4PV1 D;  2OTJ P;  1L0N E;  3L70 D;  1L4A C;  2KI7 B;  3FXD A;  3AE4 C;  5AW8 B;  3AE3 C;  4PD4 E;  4WWI A;  2FYU D;  3MUD C;  2AXT E;  2N1T D;  1Q2N A;  2PGD A;  2ZXX A;  1SFC C;  3HE5 A;  5C39 A;  2H43 A;  2R5B A;  3IFM A;  2KNC B;  4H0L C;  1JTH B;  3B5N C;  4PD4 D;  2RH0 A;  1DD3 A;  1N86 A;  2P2U A;  2H7H A;  1L0L G;  3MD0 A;  2ZFC A;  1U7J A;  2ZVO B;  4JPZ B;  1H0T A;  3BAS A;  1AQ5 A;  1KV4 A;  3VMZ A;  2GUV A;  3VOP A;  4WB4 A;  2ZYA A;  1W2B O;  4DT0 A;  4LGD E;  4UB8 H;  4L76 A;  2J59 M;  1YHQ P;  1KYO I;  2IZ0 A;  1MV8 A;  2I8D A;  2P58 A;  1IFD A;  2Z4E A;  1OFC X;  1JY3 O;  3CX5 I;  3JCU H;  5B5E E;  1NHL A;  1FJP A;  3O6Q A;  1G1I A;  2E74 D;  1KYO E;  3IAO A;  2BEZ F;  4W7Z A;  3SSU A;  1LP1 B;  4LC1 A;  1X79 B;  1SQX J;  5B66 E;  3CX5 E;  4U3F E;  1SP4 A;  3GF7 A;  3AEB C;  1YTZ I;  4XE5 B;  5AVY B;  3D6Z A;  3H1K G;  1HTL C;  2M3B A;  2YMK A;  1J2J B;  2V7Q J;  1KYO D;  2P1J A;  1U7M A;  2K1A A;  1RF0 A;  5AW1 B;  1URQ C;  1RF1 A;  1FOS F;  1VF5 D;  4U3F D;  5APY A;  1MZ9 A;  2W8Z A;  1BGY G;  2QJK B;  1HUC A;  3P8M C;  3A0H H;  5E79 H;  2WSC H;  2GM4 A;  1EDK A;  2QG4 A;  3LID A;  2WT7 B;  3U1C A;  3M0A A;  2QJP B;  4ASW A;  2ZT9 D;  1LWU A;  3TNU A;  4BRY B;  1YTZ T;  1AV1 A;  3AEF C;  2E76 C;  1DX7 A;  1N73 C;  2KYV A;  1SQP E;  3AE8 C;  3NFQ A;  1NTK K;  1H0T B;  1FZE A;  3VYI A;  3M9Q A;  4HYT B;  4ZKP A;  5BU5 A;  4C46 A;  2HOD A;  2JP3 A;  1NYH A;  2WSE H;  3M9H A;  4EYY Q;  3CXH H;  1L0L K;  1KN7 A;  3D6Y A;  4IFD K;  1SQP D;  1RE4 A;  3MIW A;  1GTW A;  3AEC C;  5KKZ C;  2W6A A;  1NTM K;  1QVG O;  2NPS C;  1PP9 G;  2YIU C;  1SQB K;  2WZ7 A;  3H1J G;  1M1J B;  3L74 J;  5CCG C;  1FU1 A;  2OQQ A;  1S2E A;  4YPC A;  3CI9 A;  1NU1 G;  1WRG A;  1JY2 O;  1ZV8 A;  4UB8 E;  1QEX A;  4H13 B;  1LTA C;  3P8C E;  3GHG B;  3RL0 g;  3CD6 P;  2JR8 A;  2E42 A;  1L0L E;  1IFN A;  1ZW0 A;  3JCU E;  3TGU J;  1G2C B;  4L75 A;  1EZV I;  1JB0 J;  1YBK A;  3P8C D;  1OMI A;  1SQQ K;  1NTM E;  1VQ8 P;  1KTM A;  3B71 A;  1L0L D;  1PGO A;  1Y9B A;  1SQB E;  1J1E B;  1M90 Q;  1BSN A;  5CCH A;  2Q3E A;  3TNU B;  5DJU B;  1NTM D;  2FXO A;  2HPC A;  1NVO A;  3A3Y B;  3ABV C;  3Q3D A;  1WMK A;  1M1J C;  1SQB D;  2O01 J;  3M9B A;  5CBN A;  3GMA A;  5APQ A;  4H44 B;  2HOD B;  4W7Y A;  1FZC C;  3CL3 D;  4U7J A;  1Q90 D;  5E79 E;  3QWO C;  5APX A;  4MN4 C;  3H1K E;  4IFF A;  1OVU A;  4N3Y B;  2WSF J;  2JO1 A;  2AXC A;  1GU4 A;  1GL2 D;  1R5L A;  5GTI H;  4GT1 A;  3V5B A;  5KAI H;  3S4R A;  3CXH I;  2D2C D;  1SQV G;  3H1K D;  4I7Z B;  5APW A;  2KLV A;  2E5Y A;  1IK7 A;  2W27 A;  1FDI A;  1JNM A;  2AEF A;  3CC2 P;  1J1E C;  3CXH E;  1GZL A;  1L4A A;  1ZP0 C;  3KXD A;  3V2N A;  2IX7 C;  1IFM A;  1BGY D;  2YNY A;  1JY2 N;  2IYO A;  3USS A;  2A06 G;  5APU A;  2WPV B;  3V6I A;  4OGQ B;  2E74 C;  5KLV J;  1N2D C;  3P7K A;  2Q5U A;  3CXH D;  1R8E A;  3RL0 D;  1SFC A;  1WT6 A;  1PGQ A;  3HTK B;  5KJ7 D;  4K3A A;  3CC4 P;  3M0D C;  2KS1 A;  3RBZ A;  2FXM A;  2YKP A;  1FZA A;  3PHL A;  2FFD C;  3K5B A;  1OVR A;  2W83 C;  2O3J A;  4JYC A;  3OA7 A;  1YJ9 P;  1PP9 E;  2R3S A;  3H1J E;  3T97 B;  1BE3 E;  1FDO A;  4YTP C;  1KIL E;  1NU1 E;  1BCC J;  1ZME C;  3FGA D;  3TYY A;  1MUU A;  2V4H A;  1AA0 A;  2Z5I A;  3WMM 0;  1PP9 D;  4EIJ A;  1OW7 A;  3V4Q A;  1AJY A;  3H1J D;  1JO5 A;  4L73 A;  1JMB A;  4C7N B;  1BE3 D;  2MJZ A;  3EFF K;  2QA4 P;  3RGU A;  1NU1 D;  2E43 A;  1G1J A;  1S9K D;  3OW2 O;  2CPS A;  1NTZ G;  4C7R A;  2KNC A;  3L73 J;  1JTH A;  1OIP A;  1N7S B;  5KLI B;  2VRS A;  4GOF A;  2WMM A;  1USD A;  2QRX A;  1ZR2 A;  1EXI A;  1URQ A;  1SQX G;  5M1B A;  3AE1 C;  2PAJ A;  2O1J A;  1JY3 P;  3RK3 C;  4DCK A;  2KZJ A;  5GTI E;  5KAI E;  1LJ2 A;  3HD7 C;  2FYU K;  1YIJ P;  2HR3 A;  4NPD A;  1UII A;  1K73 Q;  2XDJ A;  1RE3 A;  1SFC B;  1DEE G;  2QE7 H;  4H0L B;  3B5N B;  1VDF A;  4EI2 A;  1JMM A;  3NMD A;  3CME P;  1LT1 A;  2A45 G;  2KP8 A;  1NKN A;  2HFE D;  2V7Q H;  1LP1 A;  2IBZ G;  4PJ0 E;  3L75 J;  5AVR B;  3MP7 B;  1NOH A;  2CPB A;  1ZR4 A;  3KHU A;  1IZN B;  2AEJ A;  2Y0C A;  1L0N J;  3H1L J;  1SQV D;  3U59 A;  4L74 A;  5TIS H;  1AFO A;  2E75 D;  5CCG A;  2FKW B;  4XA4 A;  1E5W A;  3SWY A;  1QVF O;  2WT7 A;  4BRY A;  1YQ4 C;  2A06 D;  1LTS C;  2IFN A;  2JWD A;  2B87 A;  3CWB E;  3L74 G;  1AVY A;  3H1H J;  3SWK A;  3MGN A;  4LLH A;  1GL2 C;  1URQ B;  4BXL A;  1HJ0 A;  1HGZ A;  4H13 D;  3L37 A;  1OW8 A;  3PLN A;  4GOE A;  3CWB D;  5CMZ A;  1EDL A;  3TGU G;  1BDC A;  1HF9 A;  4WY4 C;  2W6B A;  1NTZ J;  1M7L A;  1OZH A;  1NWQ A;  2E76 B;  1N8R Q;  3VMX A;  2QEX P;  1N73 B;  2KB7 P;  1M1J A;  1OVV A;  1FZC A;  3WU2 H;  1IC2 A;  3ITK A;  2OYH C;  1E79 H;  2R32 A;  4WBA A;  1HGV A;  3GHG A;  4RJT A;  3BVH A;  3VN0 A;  1SQP K;  3L71 E;  1FZG A;  3OAK A;  3I56 P;  4IOI H;  4H44 D;  2XND H;  5KKZ B;  2Q3I A;  1S1C X;  1G2C A;  2WTY A;  2NPS B;  2IDB A;  5KAF E;  3TDK A;  2YIU B;  1DEB A;  4Z1M H;  1IFI A;  3CCL P;  2HYN A;  5AVW B;  3L71 D;  4JBZ A;  5AW0 B;  2M8R A;  1QL2 A;  2R5D A;  2FBW C;  1SQX D;  3VP9 A;  3L72 J;  1EQ7 A;  2O01 H;  3SFD C;  2IBZ I;  3L4F A;  3H32 B;  1CZQ A;  2CK3 H;  1LTJ B;  4AQR D;  2KIK A;  2B87 B;  3NXS A;  1YYC A;  2WPQ A;  4TT3 H;  2K88 A;  3II6 A;  2K9J A;  5TIS E;  1KIL C;  3VP8 A;  5AVZ B;  1KMI Z;  2WSF H;  2IBZ E;  3G4S P;  3LW5 J;  1LTG C;  2H89 C;  2OTL P;  3RK2 C;  3M0D A;  4OGQ D;  3AEE C;  5KLV G;  2M3E A;  4IFM A;  1JUN A;  2IBZ D;  3JC2 2;  4A7P A;  2YXR B;  2C9L Y;  1KFM A;  2POH A;  5KTB A;  2ZAE B;  1X22 A;  1VQ9 P;  1W5C E;  4OWF A;  3F5H A;  1FJK A;  1H88 A;  3G6E P;  5CCH D;  1H8A A;  2PP6 A;  1RQU A;  2N1T B;  1FZC B;  1ZRT E;  2HG5 D;  5BU8 B;  1NTK J;  2WIT A;  3V2Q A;  5AW5 B;  1FC2 C;  4RKU J;  1X0T A;  3VMY A;  1S4X A;  1LTJ C;  1OXZ A;  3ZDM A;  3L74 E;  5AVS B;  2RN0 A;  2WQY C;  1ZRT D;  4D6T J;  1BCC G;  5L8R J;  3NTN A;  3HTK A;  4ZMD A;  1NTM J;  3L36 A;  2Y9Z A;  5AW7 B;  4HJG H;  3L74 D;  4EDF A;  1D7M A;  1SQB J;  2G3A A;  1Q81 Q;  1YQ3 C;  4YXD C;  4PV1 C;  4O9B A;  3OJA B;  3L73 G;  1N7S D;  3I5C A;  4GDO A;  3HD7 A;  2E74 B;  3T97 A;  3WUT A;  2K9J B;  3TGU D;  2N1T C;  1L4A D;  2DW3 A;  2YKO A;  3A0H E;  3RBX A;  1T6A A;  2WPR A;  1S5L H;  1SQQ J;  2IYP A;  3BAT A;  1QL1 A;  4RO0 A;  4JQ0 D;  4C7N A;  3AEG C;  2FFD B;  1H89 A;  1SFC D;  4Y28 J;  1Z56 A;  3CCM P;  3VTP C;  3AE6 C;  3AE7 C;  3LIE A;  2M5A A;  3Q5S A;  1NAF A;  3B5N D;  1VQN P;  1ZOY C;  3GW6 A;  3Q5R A; 
#chains in the Genus database with same CATH homology
 1HJB A;  3BAS A;  1AQ5 A;  5KLV K;  1N7S A;  3VMZ A;  2GUV A;  3VOP A;  1ZR2 A;  1CI6 B;  1URQ A;  4WB4 A;  1LT9 B;  1RF1 C;  2C0X A;  2PAJ A;  4LGD E;  2O1J A;  2KOG A;  1JY3 P;  2J59 M;  3RK3 C;  1CI6 A;  1LT9 A;  3HD7 C;  2FYU K;  3U1A A;  3RK3 D;  2WPS A;  2Z5H A;  1MV8 A;  2XDJ A;  1RE3 A;  3HD7 D;  4DZO A;  5CJ4 A;  1IFD A;  1SFC B;  2Z4E A;  1NU1 K;  3O8Z A;  1IK9 A;  1JY3 O;  3MUD A;  3A5T A;  1JY3 N;  3V4W A;  1NHL A;  1FJP A;  1FBM A;  3B5N B;  1LWU C;  1VDF A;  1G1I A;  3V2R A;  2XNX A;  1FAV A;  1N7L A;  1NH4 A;  3M91 A;  1KFN A;  4W7Z A;  1JMM A;  3NMD A;  4LC1 A;  3B5N A;  1T2K C;  1X79 B;  2A45 G;  1W2E A;  2KP8 A;  1NKN A;  4M3L A;  1SP4 A;  1YTZ I;  2HFE D;  4XE5 B;  5AVY B;  5AVR B;  5AW4 B;  1HTL C;  1NOH A;  2JEE A;  2M3B A;  2YO2 A;  4N78 D;  2CPB A;  4RES B;  1J2J B;  1NKZ B;  1ZR4 A;  2P1J A;  1RF1 B;  1X8Y A;  3PP5 A;  5AVX B;  3RK3 B;  1RF0 A;  2QM8 A;  5AW1 B;  3HD7 B;  1URQ C;  1RF1 A;  4N6J A;  1FOS F;  1NO4 A;  1HBW A;  5APY A;  2XZR A;  1MZ9 A;  1URQ D;  5BVZ A;  1LT9 C;  3U59 A;  2O1K A;  1HUC A;  3P8M C;  1S9K E;  1CW5 A;  4JF7 A;  3A7O A;  1LTT C;  2WSC H;  1LWU B;  2GM4 A;  1AFO A;  2OAR A;  3LID A;  2WT7 B;  3U1C A;  3KYQ A;  3M0A A;  5CCG A;  2FKW B;  3UIA A;  3N4X A;  1LWU A;  3TNU A;  4XA4 A;  1A02 J;  1FZB A;  1E5W A;  3SWY A;  2Q7C A;  2WT7 A;  1YTZ T;  2BAS A;  5AW6 B;  1GDT A;  1DX7 A;  1JCD A;  3KQG A;  1N73 C;  2OYH A;  2KYV A;  1LTS C;  2IFN A;  2C9N Y;  3NFQ A;  1NTK K;  1FZE A;  3VYI A;  2J58 A;  3M9Q A;  4HYT B;  4ZKP A;  5BU5 A;  4C46 A;  2HOD A;  3MGN A;  4LLH A;  1GL2 C;  1URQ B;  3GHG C;  2WSE H;  3M9H A;  1HGZ A;  1T3J A;  1L0L K;  1RF0 C;  1SQV K;  2QM7 A;  1ZLL A;  3L37 A;  4IFD K;  1RE4 A;  3MIW A;  1T3U A;  1GTW A;  2KSJ A;  5CMZ A;  2YKQ A;  2W6A A;  1NTM K;  3CLQ A;  1DH3 A;  2NPS C;  2HLO A;  4WY4 C;  1HH0 A;  1XTG B;  2R3C A;  5CJ0 A;  2W6B A;  1SQB K;  2WZ7 A;  1M7L A;  1M1J B;  1NWQ A;  2NPS D;  3M06 A;  3VMX A;  4WY4 D;  5CCG C;  4N78 E;  1N73 B;  1FU1 A;  2KB7 P;  1M1J A;  3CI9 A;  1LGH B;  1WRG A;  1JY2 O;  2FYZ A;  1ZV8 A;  5CCG D;  1N73 A;  1FOS E;  1FZC A;  1IC2 A;  1LTA C;  3KPE A;  1GL2 B;  1LTB C;  3P8C E;  3GHG B;  2OYH C;  2R32 A;  1T2K D;  4I1L A;  4WBA A;  2E42 A;  1HGV A;  1GL2 A;  1FZF A;  1IFN A;  1JCC A;  3GHG A;  1T8Z A;  3BVH A;  3VN0 A;  5AVV B;  1SQP K;  1FZG A;  3OAK A;  1G2C B;  3HE4 A;  2I1J A;  1XTC C;  2ZXE B;  3P8C D;  2Q3I A;  1SQQ K;  2WTY A;  1G2C A;  2LKM A;  2NPS B;  2L5G B;  3E1I A;  1RE4 C;  4WY4 B;  1DEB A;  1IJD B;  1GK4 A;  1IFI A;  2A45 H;  4I6M C;  1J1E B;  4W80 A;  2NPS A;  2HYN A;  5AVW B;  5AW3 B;  4WY4 A;  1CSB A;  5CCH A;  2YMY A;  5AW0 B;  2M8R A;  1QL2 A;  2HPC B;  3TNU B;  2H8P D;  2R5D A;  4Y99 C;  3VP9 A;  3R2P A;  3SWF A;  1EQ7 A;  2O01 H;  3BRV B;  1MFZ A;  2HPC A;  3A3Y B;  3L4F A;  3H32 B;  3RL0 B;  1CZQ A;  1X9V A;  2OYH B;  1LTJ B;  5APS A;  4AQR D;  1M1J C;  3M9B A;  3G3Z A;  1IFJ A;  3A2A A;  5APQ A;  3H32 A;  3NXS A;  1YYC A;  2WPQ A;  1LTJ A;  2HOD B;  4W7Y A;  1FZC C;  3CL3 D;  3TSI A;  3II6 A;  5APT A;  2P7J A;  3LW5 H;  4AYC A;  1KIL C;  3VP8 A;  5AVZ B;  2IPP A;  5APX A;  2WSF H;  1IO4 A;  5KJ7 A;  1RY3 A;  1NTZ K;  3HUS B;  1KIL D;  4IFF A;  1LTG C;  2GUS A;  4N3Y B;  3RK2 C;  1GU4 A;  3M0D A;  1GL2 D;  3TK1 A;  3HUS A;  4GT1 A;  3KDP B;  3V5B A;  3RK2 D;  3N7N A;  4AUW A;  4IFM A;  4I2L C;  1JUN A;  4HH2 A;  4Y99 B;  1FDM A;  2C0W A;  1SQX K;  3H6P A;  1SVF A;  2C9L Y;  5APV A;  1KQL A;  2I1K A;  2KLV A;  1KFM A;  5APW A;  2POH A;  5KTB A;  1JY2 P;  1A02 F;  2XU6 A;  5CCH C;  2W27 A;  1JNM A;  1L4A B;  1FJK A;  3C9I A;  1H88 A;  1J1E C;  1OWA A;  5CCH D;  1H8A A;  1GZL A;  2PP6 A;  3P32 A;  2N1T B;  1GU5 A;  1L4A A;  1FZC B;  4JYB A;  3V2N A;  2HG5 D;  5BU8 B;  2IX7 C;  2WIT A;  1IFM A;  3V2Q A;  5AW9 B;  2YNY A;  1JY2 N;  1KIL B;  5AW5 B;  1J1D C;  2N1T A;  1L0N K;  3VMY A;  5AVQ B;  5APU A;  4GKG A;  3RL0 C;  1KIL A;  1HVV A;  1LTJ C;  1OXZ A;  1N2D C;  3P7K A;  2Q5U A;  3RK2 B;  1HWT C;  1GD2 E;  5AVS B;  3RL0 D;  1SFC A;  1WT6 A;  1ZN5 A;  1SLQ A;  1GW4 A;  3HTK B;  3HE4 B;  5KJ7 C;  4DOJ A;  4KHX A;  1PFI A;  4OH8 B;  2OYI B;  2WWW A;  3NTN A;  3HTK A;  5KJ7 D;  4B86 A;  3M0D C;  2XKM A;  3EFG A;  2JJL A;  4ZKU A;  2FXM A;  3HUS C;  3L36 A;  2YKP A;  1FZA A;  2OYI A;  1GK6 A;  3HRN A;  3BRT B;  5AW7 B;  2IFM A;  2FFD C;  2XV5 A;  4JYC A;  4EOT A;  3OA7 A;  2N9B A;  2P67 A;  1N7S C;  3L35 A;  3IR9 A;  3B8E B;  4O9B A;  2A45 I;  5AVU B;  3V2P A;  3OJA B;  1GW3 A;  1J1D B;  1N7S D;  3I5C A;  1KZU B;  3HD7 A;  1L4A C;  3T97 A;  3TYY A;  1MUU A;  5AVT B;  5AW8 B;  1JOC A;  3WMM 0;  2Z5I A;  2N1T C;  1L4A D;  5CHX A;  4EIJ A;  1RE3 C;  2YKO A;  3V4Q A;  3HE5 B;  1JO5 A;  2N1T D;  4C7N B;  2MJZ A;  1LTI C;  2WPR A;  1SFC C;  3HE5 A;  3BAT A;  1QL1 A;  3EQ2 A;  2E43 A;  2H43 A;  2R5B A;  1G1J A;  3IFM A;  1S9K D;  4C7N A;  2YO3 A;  2Q9I A;  2FFD B;  1JTH B;  1H89 A;  1SFC D;  3B5N C;  1Z56 A;  2CPS A;  1N86 A;  3VTP C;  4C7R A;  2P2U A;  3LIE A;  5AW2 B;  3MTU E;  2FFD A;  2H7H A;  1JTH A;  3MD0 A;  1NAF A;  1N7S B;  2OYI C;  3B5N D;  2ZFC A;  2VRS A;  4GIF A;  1VPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...