2R3CA

Structure of the gp41 n-peptide in complex with the hiv entry inhibitor pie1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gp41 N-peptide
publication title Potent D-peptide inhibitors of HIV-1 entry
pubmed doi rcsb
molecule tags Viral protein/viral protein inhibitor
total genus 20
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r3cA00
2WPRA 1H8AA 4I6MC 3O8ZA 1G2CB 1CI6B 2WT7A 4AQRD 1CSBA 2QM7A 3TNUA 2R5BA 3HE5A 1FAVA 5APQA 5AW9B 3M91A 1HJBA 4GT1A 2ZXEB 2P2UA 3OAKA 4C7NA 1GZLA 2Q3IA 5AVWB 2Z5IA 2C9LY 2VRSA 2QM8A 2ZFCA 3UIAA 1GK6A 3VMZA 5APYA 5APTA 1YYCA 3L37A 1A02F 5AVUB 2Z5HA 1GU4A 3P7KA 5AVVB 3HE4B 5AW1B 2Q7CA 1GU5A 1S9KE 1SP4A 3I5CA 5AW2B 1T2KD 4I2LC 2WWWA 1NAFA 2YO2A 3V4WA 2WPSA 1OXZA 2W6AA 3P32A 1JUNA 2JJLA 4M3LA 1JNMA 4HYTB 5AVXB 3TNUB 2P67A 3HE5B 5APVA 2E43A 3IR9A 5AVQB 1MV8A 4C46A 3T97A 1HBWA 5APXA 1T2KC 3L36A 3NMDA 4GKGA 3VN0A 4C7NB 1X8YA 4XE5B 5AW4B 4AYCA 4DZOA 3B8EB 5AW7B 2XV5A 5AVTB 1HUCA 5APUA 2Q5UA 3M9HA 2YNYA 3VYIA 2H7HA 1J2JB 3LIEA 5AW3B 3TK1A 1DH3A 1S9KD 3A3YB 4RESB 1NWQA 5APWA 5AVRB 2KP8A 3A7OA 3VMYA 2WT7B 1IO4A 1MUUA 3M0AA 1MFZA 5CMZA 5AW5B 5AW0B 2W27A 1KQLA 1GD2E 3LIDA 4KHXA 1SLQA 1HWTC 2E42A 2R3CA 5AW6B 1CZQA 2WPQA 2BASA 3P8MC 2N9BA 3NTNA 4LC1A 1A02J 2XU6A 2C9NY 3KDPB 4JYCA 4B86A 3NFQA 3MGNA 5AVZB 2YO3A 3NXSA 1FOSE 1CI6A 3V4QA 1FOSF 3SWFA 4EOTA 5AVSB 5AW8B 2R32A 3V5BA 3VTPC 1H88A 3M0DA 3VMXA 2XZRA 4AUWA 1OWAA 3A5TA 1H89A 5AVYB 2P7JA 5APSA 3KQGA 3M9BA 2IPPA 1GK4A 2R5DA 3M06A 3A2AA 3HE4A 3L35A 3MD0A 4JYBA 3TYYA 2WTYA 1GTWA 3HTKA
chains in the Genus database with same CATH superfamily
1VF5C 5H2FE 2WT7A 2DW3A 1KFMA 2CPSA 1HVVA 1JY2O 1OFCX 1K73Q 3EWKA 2KK7A 3PH0A 3VMZA 2FYUJ 2C0WA 2QJKB 1QVGO 1ZW0A 4PJ0E 5KJ7D 1E5WA 2OYOA 2YKPA 2GM4A 2LXCB 1NH4A 1KYOE 2Q1KA 3HE5B 3LW5H 3AEDC 3U59A 1HBWA 1L0LK 4MN4C 1LTIC 1URQA 1LP1B 1S3JA 2M5AA 1JCDA 3H25A 4EIJA 2WSFH 1KILA 2Y9YA 4GODA 3L74E 2J58A 2E75B 3BRVB 4I1LA 2MKVA 1VQOP 1SQVK 1KQLA 1VF5B 3H1KD 1P84I 2OYHA 1QX8A 3JCUE 3P8MC 2N9BA 1IFMA 2G8YA 2C9NY 1KN7A 1PGJA 2KXPB 3MIWA 3KHUA 4H44C 2PP6A 2YO3A 4UB8E 1L4AD 3V4QA 1D7MA 5BU5A 2AXTE 1M7LA 3SWFA 4EOTA 2M0BA 3VTPC 3VMXA 1BGYD 2KNCB 1SQQG 3H1JD 1RE3A 3BASA 4YXWH 1VQ8P 3CWBJ 3MTUE 1SQBE 4PD4D 2IBZD 2WSEJ 4AQRD 3CCEP 3KXDA 2QM7A 3Q5RA 3BCCG 3B5NC 3GMAA 4PD4H 3M91A 2FFDA 1X9VA 1VQ9P 3L71G 1W5CE 1N7SA 3S9OA 1SQPK 3CXHE 4K3AA 5CCHD 4EI2A 1VQLP 2Z5HA 1ZRTD 1PGPA 1JY3N 2B87A 3CCMP 5E79E 3KZIE 3N7NA 1LTJC 1FJKA 3AEBC 1RH5B 1L0LG 2E43A 4H44B 3G3ZA 5DJUB 3CCJP 2CK3H 1NU1G 3C1LA 3B8EB 1Y9BA 1M1JA 2PFXA 3MUDA 2E5YA 3TSIA 4NPDA 3GF3A 1YJ9P 1SLQA 3B5NB 3SWKA 3AE5C 1JMBA 2ZXXA 2W6JH 2NRGA 3L74J 2QVAA 1NTZE 3TGUE 3OW2O 1LTSC 2YXQB 3SFDC 1MZ9A 1SQQD 1SQQE 2K9JB 3M9BA 4DOJA 4DJGA 1JO5A 1LTJB 3A2AA 3MD0A 4HB1A 3HTKA 1NTKD 3Q1MA 4KJMA 5CCGD 4H0LC 3BCCE 2ZAEB 4GT1A 1Z56A 1SQPG 4GIFA 3L71D 2VRSA 4L76A 1YYCA 1SQBJ 1N8RQ 2O01N 5B5EH 2K3RA 1PV3A 2YMYA 1L0LE 1SVFA 3NMDA 2J59M 3M0DC 1NU1D 1NU1E 4IOIH 3VOPA 2H7HA 2HODB 1VQ6P 2AXCA 2WT7B 3GLMA 1LTTC 1LTBC 3M0AA 1NYHA 1RF1C 3CX5E 2YKOA 1KYOI 2OYIC 4H0LB 1KQGB 3BVHA 4JBZA 1RQUA 1QL2A 3HUSA 2KSJA 2N1TC 1JY3P 4H13D 1H88A 2MJZA 1NKZB 1PP9G 2ZYGA 1QVFO 3Q5PA 3WUUA 3F5HA 3D6ZA 1EDJA 2WTYA 2M5AB 1IO4A 2I1KA 3TGUJ 3WMM0 2FFDC 3G4SP 2P58A 4ASVA 1EXJA 1X0TA 1N7SC 3HE5A 1FAVA 1R8EA 1JMMA 1SQQJ 4KT0J 1BE3G 1LP1A 1SQPE 2Z5IA 1RF1B 1S9KE 1NAFA 3CCQP 2JR8A 3L73D 4RJTA 3V4WA 2OYIB 3BCCJ 1TU3F 2N1TB 1JB0J 5AW4B 1JM0A 1EZVG 1HUCA 4IFMA 5KAFE 4RO0A 5KAIH 2FYNC 3LIEA 1JEKA 3CXHI 1P84D 1P84E 2KNCA 5B66E 4N78E 5KKZC 1L0LJ 2HFED 3GG2A 2FFDB 3H6PA 4LC1A 1IC2A 3JSVC 1ZOYC 1N7SB 1NAYA 3IN6A 3M9QA 1NU1J 1WT6A 2Y9ZA 3ZDMA 3D70A 3R2PA 1FOSF 1FJPA 1OW7A 1ZLLA 3SSUA 1OZHA 3U1CA 4U3FD 5TISH 1L4AC 3I55P 1KB9H 5APSA 2FXPA 3S1KA 1PP9E 3CWBG 4UB6H 2YKQA 1PGOA 3CC7P 2PGDA 4JF7A 2AEJA 2SPZA 2HYNA 1DD3A 3CD6P 2V7QH 5APQA 1T8ZA 2FYNB 2RH0A 1BE3E 2D2CD 2O01J 3AEEC 5APYA 1FZBA 1PPJD 1VQKP 3GHGC 5AVUB 1PL5A 2FYUD 5AVVB 2Q7CA 5KKZB 5AW2B 2A45G 4OGQD 5CCHC 4PV1D 4HYTB 1OVRA 1AVOA 1SQPJ 4GOFA 3AE7C 1JCCA 3B5NA 3VN0A 1KMIZ 3Q3DA 2YNYA 4IFDK 4ZMDA 1AFOA 1EZVE 5AW3B 1L4AB 1DH3A 3F89A 2YIUC 1NWQA 5GTIH 1EDKA 1KZUB 4W80A 3PTZA 1LTJA 2XU6A 3KDPB 3AE4C 4YXDC 1KILE 2QIWA 2Q3EA 3WU2E 2XZRA 5C39A 1CW5A 2QRXA 1FZCC 1GMJA 3CMEP 3CWBD 1SFCD 3CX5I 1HF9A 2QJPC 1KTMA 3H1LG 3D71A 1VQ5P 3CC2P 1GDTA 2ZYDA 2KI7B 2YIUB 1PP9J 2QM8A 5CCGC 2WSSH 5APTA 1YHQP 3RK3B 3P7KA 2B89A 5AW1B 2HODA 3USSA 3R4YA 1NKNA 3HUSB 4I2LC 2L91A 1SQXK 2WPSA 2W6AA 3A0BE 2Z4EA 3PLNA 1ZXGA 5H2FH 3P8CE 1BE3J 2H89C 1USEA 1FZCB 1M8OB 2P1JA 4W7YA 1G1JA 1KYOD 3LIDA 4PJ0H 3RBXA 3B4SA 2BASA 2QJPB 3PRJA 1KYOH 3Q2YA 4EDFA 3L74D 3M0DA 2BCCG 4AUWA 4TT3H 1VQNP 2GA1A 4H13C 2Y0CA 1NTMK 2OARA 1RF1A 1NTZG 3TGUG 3JCUH 2H8PD 2OYIA 4C7RA 3Q5SA 2N1TA 3H1LD 3H1LE 4UB8H 2AXTH 1SQBD 1GU4A 1SQXG 1KFNA 2KIKA 3CCUP 1WMKA 4WY4A 3PJSK 4N3YB 3RBZA 2ZJSE 2AEFA 5AVXB 1YQ3C 5AVQB 3T97A 1IFJA 5APXA 1Q82Q 3CXHD 4Y28J 4AYCA 5AW7B 2XV5A 3HD7D 5EFWB 1J2JB 3TK1A 3CXHH 5AVRB 4H13B 3A7OA 3VMYA 1MUUA 3CCVP 1GD2E 3CLQA 3NTNA 5E79H 3KZIH 1IFIA 1FZGA 5CHXA 1DIPA 5KJ7A 2I1JA 4OVNF 2B88A 5M1BA 1KORA 1X22A 5BU8B 2QEXP 3FWLA 1SQVG 5KLVK 1YIJP 1EZVI 2BCCD 2BCCE 3AE8C 4LGDE 1S5LH 1IK7A 2E76D 3RK3E 3BRTB 2YMKA 1GTWA 1UIIA 1KQSO 1GL2D 1NTZD 3TGUD 2JDIH 1FDMA 1NVOA 2OGUA 2V4HA 3MHVA 1N73C 1A02F 2O3JA 1YI2P 4WWIA 1L4AA 1LTAC 2WSCJ 1SQXE 2YO2A 1AQTA 1RF0C 1L0NK 3H1LJ 1VQPP 3BCCD 5KLIC 4OH8B 3GF7A 4OGQC 4PV1C 1Q86Q 5APUA 2E75D 4IL6E 2NPSD 3GHGA 2R44A 3TF5A 1OIPA 3EQ2A 1PGQA 5AW5B 2Y0DA 2PRRA 1W2BO 5B5EE 1L0LD 5CCHA 3L72G 1VQ4P 2A45I 1EXIA 2M3EA 3QH9A 1KQFB 3V2PA 3G6EP 1BSHA 2H88C 1N73B 2H43A 3A0HE 3WUVA 5AVYB 2HLOA 1SQVE 3H1IG 1U7JA 2I8DA 3EFFK 3W68A 1NTME 3CX5D 1LT1A 2Y0EA 1IFPA 5KLIB 1JY2N 3CI9A 4PV1B 2BCCJ 5GTHH 2ZXEB 3CCSP 4WY4C 5CJ0A 2XNDH 1NTZJ 3H32B 2HPCA 1FZCA 1KV4A 2O01H 2K88A 3P32A 4I7ZC 4H44D 3FX0A 2LR2A 4LLHA 5CJ4A 1MV8A 2JWAA 2OTJP 1SQPD 1ZMEC 1H0TB 2UWJE 1S9KD 5CCGA 1SQXJ 3G9RA 4WBAA 5CMZA 1OVVA 4L73A 3AE9C 5KJ7C 2R3SA 3B5ND 1A02J 3NFQA 3L70G 3L72E 1R5LA 2WZ7A 3G71P 1JOCA 3D6YA 1FU1A 3A5TA 3ABVC 4GOEA 4WY4B 3CCRP 4N78D 4ASWA 5CBOA 1XTCC 3L75G 1P84H 3H1IE 3T97B 4R4LA 1T3JA 3L35A 4I7ZB 5B66H 4TLFA 1EC5A 2BEQD 1J1EC 1G2CB 1Q2NA 3CC4P 1SQVJ 1NTMJ 1S2EA 1PP9D 4DT0A 4IL6X 5TISE 1KB9E 1JY3O 2FKWB 2A06G 1OXZA 1DD4A 1L0NE 1JUNA 3IR9A 5KTBA 2ZVOB 1BE3D 3HRNA 1KD1Q 2WITA 2P10A 1K04A 4YPCA 2JEEA 3HD7C 1MFTA 4JPZB 2N9YB 1J1EB 1N7LA 5AW6B 3AE2C 4JYCA 4L74A 2QE7H 1DEBA 1IFNA 3L70D 3L70E 1EZVD 2K1AA 4A7PA 1BSNA 1HGZA 1ZV8A 1N2DC 1RHZB 1JTHA 1URQD 1YBKA 2LXBA 2R5DA 3L75E 3L72J 5GTIE 1KILD 2GUVA 1H8AA 4I6MC 4L75A 2E76C 2R5BA 5AW9B 3GHGB 3V2QA 4YTPC 2JKVA 1DX7A 3OAKA 1N86A 1FZEA 1GL2C 1GZLA 3H1IJ 3UIAA 3V2RA 3WU2H 2HG5D 2ITAA 2KOGA 3HE4B 1W2EA 4WVZA 1VQMP 3HD7B 3RL0D 2AEMA 4HJGH 4BWNA 3EFGA 3E7KA 3H1KG 2JJLA 4M3LA 2A06D 2A06E 2P67A 2IFNA 1IFDA 2WSEH 3IAOA 3N4XA 4GDOA 2M8RA 1N73A 1BGYG 3H1JG 1L0NJ 1YQ4C 2NZ2A 1VQ7P 5AW0B 2ZT9D 1SQQK 2R3CA 3O6QA 3P8CD 2WPQA 1N7SD 1Q90D 2POHA 1RF0A 2NPSC 4Y99C 4B86A 2A45H 2K37A 2KUBA 1LNQA 1NTKK 1GL2B 5AW8B 2R32A 2HPCB 2OTLP 1OWAA 3U1AA 1RQVA 3V2NA 3W67A 2HR3A 3RK2D 1J1DC 2IDBA 1GK4A 3H32A 3L70J 1AVYA 1EDIA 3RGUA 1YITP 1FC2C 1PFIA 2XDJA 1KC8Q 1HJBA 1FBMA 3FGAD 2C9LY 1H0TA 2O1KA 1GW4A 2QA4P 3L75J 1NU1K 2RKLA 1U7MA 2IX7C 3E1RA 2B9BA 1X79B 4K35A 1YTZI 1T2KD 2KZIA 2WWWA 4WB4A 2NPSB 4Y99B 3TNUB 3H1KE 3II6A 2WSCH 2BEZF 1FDIA 4C7NB 1USDA 4XA4A 4DZOA 1K05A 1VPCA 1FZAA 1AV1A 1NJIQ 1SFCA 2W8ZA 2GUSA 1BGYE 2FYZA 1J1DB 2XNXA 3H1JE 1M57D 1KB9I 2E42A 2RN0A 3E1IA 3MGNA 1NTKG 4PD4E 5AVZB 5CBNA 1G2CA 1DEEG 2IBZE 1ZP0C 1LT9C 1R5SA 1L2PA 2P7JA 4IFFA 1LTGC 2M3BA 2QSIA 1RE4C 3FWNA 1ZRTE 4O9BA 3IF4A 1OW6A 3O8ZA 1CI6B 2E74D 1NHLA 1NGMB 2ZYAA 1LJ2A 1ZN5A 1NTMG 1HJ0A 2Q3IA 2ZFCA 2PAJA 3RK3D 3LW5J 1S5LE 1T3UA 1SP4A 2IFMA 2OTKE 1LWUC 2WSFJ 2KLVA 2Q6QA 4C46A 4JQ0D 1LT9B 4GKGA 2KYVA 1JTHB 4W7ZA 2KS1A 2IYOA 1ZR2A 1BDCA 1NO4A 4QMAA 1SQXD 2D2CC 1MFZA 3H1KJ 1OX3A 3QWOC 4KHXA 1QLED 2CPBA 3MP7B 4BRYA 1SS1A 1NTKE 4EYYQ 2OQQA 1MKMA 2W6BA 1BGYJ 4HKZH 3H1JJ 3FXDA 1H89A 5BVZA 1BCCG 1VF5D 3ITKA 4IL6H 3L71E 2IPPA 2QJYC 1LWUB 1IZNB 4JYBA 3HE4A 3HD7A 2FYUK 3TYYA 3IFMA 2WPRA 4N6JA 3L73G 4OWFA 5L8RJ 1S1CX 1CSBA 5KLVG 1Q7YQ 1URQC 4NPFX 1KILC 1T6AA 3CL3D 1SQVD 3H1HG 1ZR4A 1GW3A 1FZFA 1NTMD 3O6QB 4R4MA 1BDDA 2D2CB 2W90A 3A0HH 4U7JA 1NOHA 1GU5A 3I5CA 3CMAP 2WQYC 2OYHC 3B71A 3CX5H 1EQ7A 4OGQB 3TDKA 3RL0C 1SFCC 2G3AA 4XE5B 2FY8A 4D6TG 5GTHE 1RE3C 1GL2A 3AE6C 1VDFA 4RESB 4U3FG 3S4RA 1L0NG 2QJYB 3C8VA 3VMAA 1K8AQ 1HWTC 3CPWO 1PZQA 1URQB 3RL0g 4Z1MH 3PHLA 3NXSA 1KILB 4HH2A 2ZT9C 5DJTB 3OA7A 1YJWP 1IJDB 1BCCD 1BCCE 1E79H 1PPJG 3KQGA 2OYHB 2FYUG 3MZWB 2O1JA 1S5LX 1HTLC 1QEXA 3L72D 1YTZT 1NTKJ 3RL0B 2IYPA 1QGKB 1S4XA 1SFCB 3L73E 2NPSA 3RK2C 4PD4I 3TNUA 3WUTA 5KLVD 5KLVE 3AEGC 1FDOA 2IBZI 5KAIE 5KAFH 1VL2A 3L71J 4C7NA 5AVWB 1M1JC 1Y47A 3L4FA 3H1HD 1WRGA 1GK6A 3H1HE 3H1ID 1M56D 3MUDC 5TJHA 1M90Q 3JC22 2WMMA 2JP3A 2FXMA 2E5TA 1JNMA 3VP8A 2ZT9B 1T2KC 3L36A 5AVTB 3CCLP 2Q5UA 3M9HA 1FE6A 3VYIA 4D6TD 4D6TE 1KB9D 2C0XA 3C9IA 2IZ1A 3A3YB 1K9MQ 2WVRA 1RY3A 2KP8A 2B87B 4UB6E 4U3FE 1L0ND 2WPVB 4ZNCA 2J5UA 2W27A 1CZQA 1LGHB 2FXOA 3RK2B 1Y8AA 1PIXA 4RKUJ 2YXRB 2KLUA 1FOSE 1CI6A 2KSEA 2XKMA 3AECC 5AVSB 1IK9A 1M1JB 1JY2P 2L5GB 2QG4A 3SFEC 3I56P 1PPJE 3M06A 4H0LD 2FYUE 1SQBK 3KYQA 2KS1B 2ZVNB 1XTGB 1S72P 3V6IA 2LKMA 4DCKA 2W83C 1LT9A 1BCCJ 2P2UA 2KZJA 2E74C 1YJNP 3L37A 3L75D 4BRYB 2JO1A 3HTKB 1RE4A 3L73J 1HGVA 4ZKUA 3RK3C 5KLVJ 4BXLA 3OJAB 5APVA 2K9JA 3HUSC 1QL1A 4NPEA 1OMIA 3AEFC 3H1HJ 1AJYA 1AQ5A 1X8YA 1FS0E 3FXEA 3L74G 1HH0A 1M1KQ 3AE1C 3GW6A 5APWA 1G1IA 1EDLA 2QJKC 4ZKPA 2N1TD 3VP9A 3BATA 2KB7P 1LWUA 1AA0A 3CWBE 1OVUA 4D6TJ 1UIXA 1NTZK 3KPEA 4CPGA 3PP5A 1U57A 2FBWC 3V5BA 2E74B 2RMZA 4WY4D 4U3FJ 2Q9IA 5K5GB 1OW8A 4XFJA 2JWDA 3K5BA 3SWYA 3AEAC 2IZ0A 2E75C 1SQBG 2E76B 2V7QJ 3AE3C 3A0BH 2K9YA 1Q81Q 2IBZG
chains in the Genus database with same CATH topology
4JF7A 3O8ZA 1CI6B 2WT7A 1KFMA 2HYNA 2CPSA 1NHLA 1JY2N 1HVVA 1JY2O 3CI9A 5APQA 1T8ZA 2ZXEB 1ZN5A 2Q3IA 2ZFCA 2PAJA 3VMZA 5APYA 3RK3D 1FZBA 3GHGC 5AVUB 4WY4C 5AVVB 2C0WA 5CJ0A 2Q7CA 1T3UA 1SP4A 5KJ7D 5AW2B 3H32B 2HPCA 1E5WA 2IFMA 1FZCA 2YKPA 1LWUC 2A45G 2O01H 5CCHC 3P32A 2GM4A 1NH4A 4HYTB 2KLVA 3HE5B 3LW5H 4LLHA 5CJ4A 1MV8A 4C46A 3U59A 1HBWA 1L0LK 1LT9B 4GKGA 1LTIC 1URQA 2KYVA 1JCCA 3B5NA 3VN0A 1JTHB 1JCDA 4W7ZA 4EIJA 2WSFH 1KILA 2YNYA 4IFDK 1ZR2A 1AFOA 5AW3B 1L4AB 1DH3A 1S9KD 5CCGA 2J58A 1NWQA 1NO4A 4WBAA 3BRVB 4I1LA 1MFZA 5CMZA 1SQVK 1KQLA 1KZUB 4KHXA 4W80A 2OYHA 5KJ7C 3P8MC 1LTJA 2N9BA 3B5ND 1A02J 1IFMA 2XU6A 2C9NY 2CPBA 3KDPB 3MIWA 3NFQA 2WZ7A 2PP6A 2YO3A 1L4AD 3V4QA 5BU5A 1JOCA 1M7LA 2W6BA 3SWFA 4EOTA 3VTPC 1FU1A 3VMXA 2XZRA 3A5TA 4WY4B 1H89A 1RE3A 5BVZA 4N78D 3BASA 1CW5A 1XTCC 1FZCC 2IPPA 1LWUB 3MTUE 4JYBA 1T3JA 3HE4A 3L35A 3HD7A 2FYUK 3TYYA 3IFMA 2WPRA 4N6JA 1J1EC 1SFCD 1G2CB 4AQRD 1CSBA 2QM7A 1URQC 3B5NC 3M91A 2FFDA 1KILC 3CL3D 1X9VA 1GDTA 1ZR4A 1N7SA 1GW3A 1FZFA 1SQPK 2QM8A 5CCGC 5APTA 5CCHD 3RK3B 2Z5HA 3P7KA 5AW1B 1NOHA 1GU5A 1JY3N 2HODA 1JY3O 3I5CA 1NKNA 3HUSB 4I2LC 2OYHC 2FKWB 3N7NA 1LTJC 1SQXK 2WPSA 1OXZA 1EQ7A 2W6AA 1JUNA 1FJKA 2Z4EA 2E43A 3IR9A 3G3ZA 3RL0C 3P8CE 1SFCC 5KTBA 4XE5B 3HRNA 3B8EB 2WITA 1RE3C 1GL2A 1M1JA 1VDFA 4RESB 2JEEA 1FZCB 3MUDA 2P1JA 4W7YA 1G1JA 3TSIA 3HD7C 3LIDA 1SLQA 1HWTC 1J1EB 1N7LA 5AW6B 2BASA 1URQB 3B5NB 4JYCA 3NXSA 1DEBA 1KILB 4HH2A 1IFNA 3OA7A 3M0DA 1LTSC 4AUWA 1HGZA 1MZ9A 1ZV8A 1N2DC 1IJDB 1JTHA 3KQGA 3M9BA 2OYHB 4DOJA 1URQD 1NTMK 2O1JA 1JO5A 1LTJB 2R5DA 2OARA 3A2AA 1HTLC 3MD0A 1RF1A 3HTKA 1KILD 2GUVA 1H8AA 1YTZT 4I6MC 3RL0B 1SFCB 2H8PD 2NPSA 5CCGD 3RK2C 2OYIA 3TNUA 2R5BA 4C7RA 5AW9B 3GHGB 3V2QA 4GT1A 2N1TA 1Z56A 1DX7A 3OAKA 1N86A 1FZEA 4C7NA 1GL2C 1GZLA 4GIFA 5AVWB 1M1JC 2VRSA 3UIAA 3L4FA 1WRGA 1GK6A 3V2RA 1YYCA 2HG5D 1GU4A 2KOGA 3HE4B 1W2EA 3HD7B 3RL0D 1KFNA 4WY4A 3EFGA 2YMYA 2FXMA 4N3YB 2JJLA 4M3LA 1JNMA 5AVXB 2P67A 5AVQB 3VP8A 3T97A 1SVFA 1IFJA 2IFNA 5APXA 3L36A 3NMDA 1IFDA 1T2KC 2J59M 2WSEH 4AYCA 5AW7B 2XV5A 3M0DC 5AVTB 2Q5UA 3N4XA 3M9HA 3HD7D 3VOPA 3VYIA 2H7HA 1J2JB 2M8RA 3TK1A 1N73A 2C0XA 3C9IA 2HODB 3A3YB 5AVRB 1RY3A 2KP8A 3A7OA 3VMYA 2WT7B 1LTTC 1MUUA 1LTBC 3M0AA 5AW0B 2W27A 1GD2E 1RF1C 3CLQA 1SQQK 2R3CA 3P8CD 2WPQA 1CZQA 1LGHB 1N7SD 2POHA 3NTNA 1IFIA 1RF0A 1FZGA 2NPSC 2YKOA 4Y99C 3RK2B 5CHXA 4B86A 2OYIC 2A45H 3BVHA 1QL2A 3HUSA 1FOSE 1CI6A 5KJ7A 2I1JA 2KSJA 2N1TC 1JY3P 1NTKK 2XKMA 1GL2B 5AVSB 5AW8B 1IK9A 2R32A 1M1JB 1H88A 2HPCB 5BU8B 1OWAA 2MJZA 5KLVK 1JY2P 2L5GB 4LGDE 1NKZB 3U1AA 3V2NA 3RK2D 1J1DC 1GK4A 3BRTB 3M06A 1SQBK 2WTYA 1GTWA 1IO4A 3H32A 3KYQA 2I1KA 3WMM0 2FFDC 1GL2D 1FDMA 1XTGB 1N7SC 1PFIA 2XDJA 3HE5A 1FAVA 2LKMA 1HJBA 1JMMA 1FBMA 1LT9A 2P2UA 1N73C 2C9LY 2Z5IA 2O1KA 1GW4A 3L37A 1A02F 1NU1K 2IX7C 1L4AA 1LTAC 1X79B 1RF1B 1S9KE 3HTKB 1YTZI 1T2KD 1RE4A 2WWWA 1NAFA 1HGVA 2YO2A 4WB4A 3V4WA 4ZKUA 3RK3C 2NPSB 1RF0C 4Y99B 1L0NK 2OYIB 3TNUB 3OJAB 5APVA 3HUSC 1QL1A 3II6A 2N1TB 2WSCH 4OH8B 4C7NB 1AQ5A 1X8YA 4XA4A 5AW4B 4DZOA 1HUCA 5APUA 4IFMA 1VPCA 1FZAA 1HH0A 1SFCA 3LIEA 2GUSA 5APWA 2NPSD 1G1IA 2FYZA 3GHGA 1J1DB 3EQ2A 2XNXA 5AW5B 4N78E 4ZKPA 2N1TD 2HFED 2E42A 3VP9A 2FFDB 3BATA 3H6PA 2KB7P 1LWUA 4LC1A 1IC2A 5CCHA 3E1IA 1N7SB 2A45I 3M9QA 3MGNA 1WT6A 5AVZB 1G2CA 3R2PA 3V2PA 1NTZK 1LT9C 3KPEA 1FOSF 3PP5A 1FJPA 1N73B 1ZLLA 2H43A 3V5BA 4WY4D 2Q9IA 3U1CA 5AVYB 2HLOA 3SWYA 1L4AC 2P7JA 4IFFA 5APSA 1LTGC 2M3BA 1RE4C 2YKQA 4O9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPR A;  1H8A A;  4I6M C;  3O8Z A;  1G2C B;  1CI6 B;  2WT7 A;  4AQR D;  1CSB A;  2QM7 A;  3TNU A;  2R5B A;  3HE5 A;  1FAV A;  5APQ A;  5AW9 B;  3M91 A;  1HJB A;  4GT1 A;  2ZXE B;  2P2U A;  3OAK A;  4C7N A;  1GZL A;  2Q3I A;  5AVW B;  2Z5I A;  2C9L Y;  2VRS A;  2QM8 A;  2ZFC A;  3UIA A;  1GK6 A;  3VMZ A;  5APY A;  5APT A;  1YYC A;  3L37 A;  1A02 F;  5AVU B;  2Z5H A;  1GU4 A;  3P7K A;  5AVV B;  3HE4 B;  5AW1 B;  2Q7C A;  1GU5 A;  1S9K E;  1SP4 A;  3I5C A;  5AW2 B;  1T2K D;  4I2L C;  2WWW A;  1NAF A;  2YO2 A;  3V4W A;  2WPS A;  1OXZ A;  2W6A A;  3P32 A;  1JUN A;  2JJL A;  4M3L A;  1JNM A;  4HYT B;  5AVX B;  3TNU B;  2P67 A;  3HE5 B;  5APV A;  2E43 A;  3IR9 A;  5AVQ B;  1MV8 A;  4C46 A;  3T97 A;  1HBW A;  5APX A;  1T2K C;  3L36 A;  3NMD A;  4GKG A;  3VN0 A;  4C7N B;  1X8Y A;  4XE5 B;  5AW4 B;  4AYC A;  4DZO A;  3B8E B;  5AW7 B;  2XV5 A;  5AVT B;  1HUC A;  5APU A;  2Q5U A;  3M9H A;  2YNY A;  3VYI A;  2H7H A;  1J2J B;  3LIE A;  5AW3 B;  3TK1 A;  1DH3 A;  1S9K D;  3A3Y B;  4RES B;  1NWQ A;  5APW A;  5AVR B;  2KP8 A;  3A7O A;  3VMY A;  2WT7 B;  1IO4 A;  1MUU A;  3M0A A;  1MFZ A;  5CMZ A;  5AW5 B;  5AW0 B;  2W27 A;  1KQL A;  1GD2 E;  3LID A;  4KHX A;  1SLQ A;  1HWT C;  2E42 A;  2R3C A;  5AW6 B;  1CZQ A;  2WPQ A;  2BAS A;  3P8M C;  2N9B A;  3NTN A;  4LC1 A;  1A02 J;  2XU6 A;  2C9N Y;  3KDP B;  4JYC A;  4B86 A;  3NFQ A;  3MGN A;  5AVZ B;  2YO3 A;  3NXS A;  1FOS E;  1CI6 A;  3V4Q A;  1FOS F;  3SWF A;  4EOT A;  5AVS B;  5AW8 B;  2R32 A;  3V5B A;  3VTP C;  1H88 A;  3M0D A;  3VMX A;  2XZR A;  4AUW A;  1OWA A;  3A5T A;  1H89 A;  5AVY B;  2P7J A;  5APS A;  3KQG A;  3M9B A;  2IPP A;  1GK4 A;  2R5D A;  3M06 A;  3A2A A;  3HE4 A;  3L35 A;  3MD0 A;  4JYB A;  3TYY A;  2WTY A;  1GTW A;  3HTK A; 
#chains in the Genus database with same CATH topology
 1VF5 C;  5H2F E;  2WT7 A;  2DW3 A;  1KFM A;  2CPS A;  1HVV A;  1JY2 O;  1OFC X;  1K73 Q;  3EWK A;  2KK7 A;  3PH0 A;  3VMZ A;  2FYU J;  2C0W A;  2QJK B;  1QVG O;  1ZW0 A;  4PJ0 E;  5KJ7 D;  1E5W A;  2OYO A;  2YKP A;  2GM4 A;  2LXC B;  1NH4 A;  1KYO E;  2Q1K A;  3HE5 B;  3LW5 H;  3AED C;  3U59 A;  1HBW A;  1L0L K;  4MN4 C;  1LTI C;  1URQ A;  1LP1 B;  1S3J A;  2M5A A;  1JCD A;  3H25 A;  4EIJ A;  2WSF H;  1KIL A;  2Y9Y A;  4GOD A;  3L74 E;  2J58 A;  2E75 B;  3BRV B;  4I1L A;  2MKV A;  1VQO P;  1SQV K;  1KQL A;  1VF5 B;  3H1K D;  1P84 I;  2OYH A;  1QX8 A;  3JCU E;  3P8M C;  2N9B A;  1IFM A;  2G8Y A;  2C9N Y;  1KN7 A;  1PGJ A;  2KXP B;  3MIW A;  3KHU A;  4H44 C;  2PP6 A;  2YO3 A;  4UB8 E;  1L4A D;  3V4Q A;  1D7M A;  5BU5 A;  2AXT E;  1M7L A;  3SWF A;  4EOT A;  2M0B A;  3VTP C;  3VMX A;  1BGY D;  2KNC B;  1SQQ G;  3H1J D;  1RE3 A;  3BAS A;  4YXW H;  1VQ8 P;  3CWB J;  3MTU E;  1SQB E;  4PD4 D;  2IBZ D;  2WSE J;  4AQR D;  3CCE P;  3KXD A;  2QM7 A;  3Q5R A;  3BCC G;  3B5N C;  3GMA A;  4PD4 H;  3M91 A;  2FFD A;  1X9V A;  1VQ9 P;  3L71 G;  1W5C E;  1N7S A;  3S9O A;  1SQP K;  3CXH E;  4K3A A;  5CCH D;  4EI2 A;  1VQL P;  2Z5H A;  1ZRT D;  1PGP A;  1JY3 N;  2B87 A;  3CCM P;  5E79 E;  3KZI E;  3N7N A;  1LTJ C;  1FJK A;  3AEB C;  1RH5 B;  1L0L G;  2E43 A;  4H44 B;  3G3Z A;  5DJU B;  3CCJ P;  2CK3 H;  1NU1 G;  3C1L A;  3B8E B;  1Y9B A;  1M1J A;  2PFX A;  3MUD A;  2E5Y A;  3TSI A;  4NPD A;  3GF3 A;  1YJ9 P;  1SLQ A;  3B5N B;  3SWK A;  3AE5 C;  1JMB A;  2ZXX A;  2W6J H;  2NRG A;  3L74 J;  2QVA A;  1NTZ E;  3TGU E;  3OW2 O;  1LTS C;  2YXQ B;  3SFD C;  1MZ9 A;  1SQQ D;  1SQQ E;  2K9J B;  3M9B A;  4DOJ A;  4DJG A;  1JO5 A;  1LTJ B;  3A2A A;  3MD0 A;  4HB1 A;  3HTK A;  1NTK D;  3Q1M A;  4KJM A;  5CCG D;  4H0L C;  3BCC E;  2ZAE B;  4GT1 A;  1Z56 A;  1SQP G;  4GIF A;  3L71 D;  2VRS A;  4L76 A;  1YYC A;  1SQB J;  1N8R Q;  2O01 N;  5B5E H;  2K3R A;  1PV3 A;  2YMY A;  1L0L E;  1SVF A;  3NMD A;  2J59 M;  3M0D C;  1NU1 D;  1NU1 E;  4IOI H;  3VOP A;  2H7H A;  2HOD B;  1VQ6 P;  2AXC A;  2WT7 B;  3GLM A;  1LTT C;  1LTB C;  3M0A A;  1NYH A;  1RF1 C;  3CX5 E;  2YKO A;  1KYO I;  2OYI C;  4H0L B;  1KQG B;  3BVH A;  4JBZ A;  1RQU A;  1QL2 A;  3HUS A;  2KSJ A;  2N1T C;  1JY3 P;  4H13 D;  1H88 A;  2MJZ A;  1NKZ B;  1PP9 G;  2ZYG A;  1QVF O;  3Q5P A;  3WUU A;  3F5H A;  3D6Z A;  1EDJ A;  2WTY A;  2M5A B;  1IO4 A;  2I1K A;  3TGU J;  3WMM 0;  2FFD C;  3G4S P;  2P58 A;  4ASV A;  1EXJ A;  1X0T A;  1N7S C;  3HE5 A;  1FAV A;  1R8E A;  1JMM A;  1SQQ J;  4KT0 J;  1BE3 G;  1LP1 A;  1SQP E;  2Z5I A;  1RF1 B;  1S9K E;  1NAF A;  3CCQ P;  2JR8 A;  3L73 D;  4RJT A;  3V4W A;  2OYI B;  3BCC J;  1TU3 F;  2N1T B;  1JB0 J;  5AW4 B;  1JM0 A;  1EZV G;  1HUC A;  4IFM A;  5KAF E;  4RO0 A;  5KAI H;  2FYN C;  3LIE A;  1JEK A;  3CXH I;  1P84 D;  1P84 E;  2KNC A;  5B66 E;  4N78 E;  5KKZ C;  1L0L J;  2HFE D;  3GG2 A;  2FFD B;  3H6P A;  4LC1 A;  1IC2 A;  3JSV C;  1ZOY C;  1N7S B;  1NAY A;  3IN6 A;  3M9Q A;  1NU1 J;  1WT6 A;  2Y9Z A;  3ZDM A;  3D70 A;  3R2P A;  1FOS F;  1FJP A;  1OW7 A;  1ZLL A;  3SSU A;  1OZH A;  3U1C A;  4U3F D;  5TIS H;  1L4A C;  3I55 P;  1KB9 H;  5APS A;  2FXP A;  3S1K A;  1PP9 E;  3CWB G;  4UB6 H;  2YKQ A;  1PGO A;  3CC7 P;  2PGD A;  4JF7 A;  2AEJ A;  2SPZ A;  2HYN A;  1DD3 A;  3CD6 P;  2V7Q H;  5APQ A;  1T8Z A;  2FYN B;  2RH0 A;  1BE3 E;  2D2C D;  2O01 J;  3AEE C;  5APY A;  1FZB A;  1PPJ D;  1VQK P;  3GHG C;  5AVU B;  1PL5 A;  2FYU D;  5AVV B;  2Q7C A;  5KKZ B;  5AW2 B;  2A45 G;  4OGQ D;  5CCH C;  4PV1 D;  4HYT B;  1OVR A;  1AVO A;  1SQP J;  4GOF A;  3AE7 C;  1JCC A;  3B5N A;  3VN0 A;  1KMI Z;  3Q3D A;  2YNY A;  4IFD K;  4ZMD A;  1AFO A;  1EZV E;  5AW3 B;  1L4A B;  1DH3 A;  3F89 A;  2YIU C;  1NWQ A;  5GTI H;  1EDK A;  1KZU B;  4W80 A;  3PTZ A;  1LTJ A;  2XU6 A;  3KDP B;  3AE4 C;  4YXD C;  1KIL E;  2QIW A;  2Q3E A;  3WU2 E;  2XZR A;  5C39 A;  1CW5 A;  2QRX A;  1FZC C;  1GMJ A;  3CME P;  3CWB D;  1SFC D;  3CX5 I;  1HF9 A;  2QJP C;  1KTM A;  3H1L G;  3D71 A;  1VQ5 P;  3CC2 P;  1GDT A;  2ZYD A;  2KI7 B;  2YIU B;  1PP9 J;  2QM8 A;  5CCG C;  2WSS H;  5APT A;  1YHQ P;  3RK3 B;  3P7K A;  2B89 A;  5AW1 B;  2HOD A;  3USS A;  3R4Y A;  1NKN A;  3HUS B;  4I2L C;  2L91 A;  1SQX K;  2WPS A;  2W6A A;  3A0B E;  2Z4E A;  3PLN A;  1ZXG A;  5H2F H;  3P8C E;  1BE3 J;  2H89 C;  1USE A;  1FZC B;  1M8O B;  2P1J A;  4W7Y A;  1G1J A;  1KYO D;  3LID A;  4PJ0 H;  3RBX A;  3B4S A;  2BAS A;  2QJP B;  3PRJ A;  1KYO H;  3Q2Y A;  4EDF A;  3L74 D;  3M0D A;  2BCC G;  4AUW A;  4TT3 H;  1VQN P;  2GA1 A;  4H13 C;  2Y0C A;  1NTM K;  2OAR A;  1RF1 A;  1NTZ G;  3TGU G;  3JCU H;  2H8P D;  2OYI A;  4C7R A;  3Q5S A;  2N1T A;  3H1L D;  3H1L E;  4UB8 H;  2AXT H;  1SQB D;  1GU4 A;  1SQX G;  1KFN A;  2KIK A;  3CCU P;  1WMK A;  4WY4 A;  3PJS K;  4N3Y B;  3RBZ A;  2ZJS E;  2AEF A;  5AVX B;  1YQ3 C;  5AVQ B;  3T97 A;  1IFJ A;  5APX A;  1Q82 Q;  3CXH D;  4Y28 J;  4AYC A;  5AW7 B;  2XV5 A;  3HD7 D;  5EFW B;  1J2J B;  3TK1 A;  3CXH H;  5AVR B;  4H13 B;  3A7O A;  3VMY A;  1MUU A;  3CCV P;  1GD2 E;  3CLQ A;  3NTN A;  5E79 H;  3KZI H;  1IFI A;  1FZG A;  5CHX A;  1DIP A;  5KJ7 A;  2I1J A;  4OVN F;  2B88 A;  5M1B A;  1KOR A;  1X22 A;  5BU8 B;  2QEX P;  3FWL A;  1SQV G;  5KLV K;  1YIJ P;  1EZV I;  2BCC D;  2BCC E;  3AE8 C;  4LGD E;  1S5L H;  1IK7 A;  2E76 D;  3RK3 E;  3BRT B;  2YMK A;  1GTW A;  1UII A;  1KQS O;  1GL2 D;  1NTZ D;  3TGU D;  2JDI H;  1FDM A;  1NVO A;  2OGU A;  2V4H A;  3MHV A;  1N73 C;  1A02 F;  2O3J A;  1YI2 P;  4WWI A;  1L4A A;  1LTA C;  2WSC J;  1SQX E;  2YO2 A;  1AQT A;  1RF0 C;  1L0N K;  3H1L J;  1VQP P;  3BCC D;  5KLI C;  4OH8 B;  3GF7 A;  4OGQ C;  4PV1 C;  1Q86 Q;  5APU A;  2E75 D;  4IL6 E;  2NPS D;  3GHG A;  2R44 A;  3TF5 A;  1OIP A;  3EQ2 A;  1PGQ A;  5AW5 B;  2Y0D A;  2PRR A;  1W2B O;  5B5E E;  1L0L D;  5CCH A;  3L72 G;  1VQ4 P;  2A45 I;  1EXI A;  2M3E A;  3QH9 A;  1KQF B;  3V2P A;  3G6E P;  1BSH A;  2H88 C;  1N73 B;  2H43 A;  3A0H E;  3WUV A;  5AVY B;  2HLO A;  1SQV E;  3H1I G;  1U7J A;  2I8D A;  3EFF K;  3W68 A;  1NTM E;  3CX5 D;  1LT1 A;  2Y0E A;  1IFP A;  5KLI B;  1JY2 N;  3CI9 A;  4PV1 B;  2BCC J;  5GTH H;  2ZXE B;  3CCS P;  4WY4 C;  5CJ0 A;  2XND H;  1NTZ J;  3H32 B;  2HPC A;  1FZC A;  1KV4 A;  2O01 H;  2K88 A;  3P32 A;  4I7Z C;  4H44 D;  3FX0 A;  2LR2 A;  4LLH A;  5CJ4 A;  1MV8 A;  2JWA A;  2OTJ P;  1SQP D;  1ZME C;  1H0T B;  2UWJ E;  1S9K D;  5CCG A;  1SQX J;  3G9R A;  4WBA A;  5CMZ A;  1OVV A;  4L73 A;  3AE9 C;  5KJ7 C;  2R3S A;  3B5N D;  1A02 J;  3NFQ A;  3L70 G;  3L72 E;  1R5L A;  2WZ7 A;  3G71 P;  1JOC A;  3D6Y A;  1FU1 A;  3A5T A;  3ABV C;  4GOE A;  4WY4 B;  3CCR P;  4N78 D;  4ASW A;  5CBO A;  1XTC C;  3L75 G;  1P84 H;  3H1I E;  3T97 B;  4R4L A;  1T3J A;  3L35 A;  4I7Z B;  5B66 H;  4TLF A;  1EC5 A;  2BEQ D;  1J1E C;  1G2C B;  1Q2N A;  3CC4 P;  1SQV J;  1NTM J;  1S2E A;  1PP9 D;  4DT0 A;  4IL6 X;  5TIS E;  1KB9 E;  1JY3 O;  2FKW B;  2A06 G;  1OXZ A;  1DD4 A;  1L0N E;  1JUN A;  3IR9 A;  5KTB A;  2ZVO B;  1BE3 D;  3HRN A;  1KD1 Q;  2WIT A;  2P10 A;  1K04 A;  4YPC A;  2JEE A;  3HD7 C;  1MFT A;  4JPZ B;  2N9Y B;  1J1E B;  1N7L A;  5AW6 B;  3AE2 C;  4JYC A;  4L74 A;  2QE7 H;  1DEB A;  1IFN A;  3L70 D;  3L70 E;  1EZV D;  2K1A A;  4A7P A;  1BSN A;  1HGZ A;  1ZV8 A;  1N2D C;  1RHZ B;  1JTH A;  1URQ D;  1YBK A;  2LXB A;  2R5D A;  3L75 E;  3L72 J;  5GTI E;  1KIL D;  2GUV A;  1H8A A;  4I6M C;  4L75 A;  2E76 C;  2R5B A;  5AW9 B;  3GHG B;  3V2Q A;  4YTP C;  2JKV A;  1DX7 A;  3OAK A;  1N86 A;  1FZE A;  1GL2 C;  1GZL A;  3H1I J;  3UIA A;  3V2R A;  3WU2 H;  2HG5 D;  2ITA A;  2KOG A;  3HE4 B;  1W2E A;  4WVZ A;  1VQM P;  3HD7 B;  3RL0 D;  2AEM A;  4HJG H;  4BWN A;  3EFG A;  3E7K A;  3H1K G;  2JJL A;  4M3L A;  2A06 D;  2A06 E;  2P67 A;  2IFN A;  1IFD A;  2WSE H;  3IAO A;  3N4X A;  4GDO A;  2M8R A;  1N73 A;  1BGY G;  3H1J G;  1L0N J;  1YQ4 C;  2NZ2 A;  1VQ7 P;  5AW0 B;  2ZT9 D;  1SQQ K;  2R3C A;  3O6Q A;  3P8C D;  2WPQ A;  1N7S D;  1Q90 D;  2POH A;  1RF0 A;  2NPS C;  4Y99 C;  4B86 A;  2A45 H;  2K37 A;  2KUB A;  1LNQ A;  1NTK K;  1GL2 B;  5AW8 B;  2R32 A;  2HPC B;  2OTL P;  1OWA A;  3U1A A;  1RQV A;  3V2N A;  3W67 A;  2HR3 A;  3RK2 D;  1J1D C;  2IDB A;  1GK4 A;  3H32 A;  3L70 J;  1AVY A;  1EDI A;  3RGU A;  1YIT P;  1FC2 C;  1PFI A;  2XDJ A;  1KC8 Q;  1HJB A;  1FBM A;  3FGA D;  2C9L Y;  1H0T A;  2O1K A;  1GW4 A;  2QA4 P;  3L75 J;  1NU1 K;  2RKL A;  1U7M A;  2IX7 C;  3E1R A;  2B9B A;  1X79 B;  4K35 A;  1YTZ I;  1T2K D;  2KZI A;  2WWW A;  4WB4 A;  2NPS B;  4Y99 B;  3TNU B;  3H1K E;  3II6 A;  2WSC H;  2BEZ F;  1FDI A;  4C7N B;  1USD A;  4XA4 A;  4DZO A;  1K05 A;  1VPC A;  1FZA A;  1AV1 A;  1NJI Q;  1SFC A;  2W8Z A;  2GUS A;  1BGY E;  2FYZ A;  1J1D B;  2XNX A;  3H1J E;  1M57 D;  1KB9 I;  2E42 A;  2RN0 A;  3E1I A;  3MGN A;  1NTK G;  4PD4 E;  5AVZ B;  5CBN A;  1G2C A;  1DEE G;  2IBZ E;  1ZP0 C;  1LT9 C;  1R5S A;  1L2P A;  2P7J A;  4IFF A;  1LTG C;  2M3B A;  2QSI A;  1RE4 C;  3FWN A;  1ZRT E;  4O9B A;  3IF4 A;  1OW6 A;  3O8Z A;  1CI6 B;  2E74 D;  1NHL A;  1NGM B;  2ZYA A;  1LJ2 A;  1ZN5 A;  1NTM G;  1HJ0 A;  2Q3I A;  2ZFC A;  2PAJ A;  3RK3 D;  3LW5 J;  1S5L E;  1T3U A;  1SP4 A;  2IFM A;  2OTK E;  1LWU C;  2WSF J;  2KLV A;  2Q6Q A;  4C46 A;  4JQ0 D;  1LT9 B;  4GKG A;  2KYV A;  1JTH B;  4W7Z A;  2KS1 A;  2IYO A;  1ZR2 A;  1BDC A;  1NO4 A;  4QMA A;  1SQX D;  2D2C C;  1MFZ A;  3H1K J;  1OX3 A;  3QWO C;  4KHX A;  1QLE D;  2CPB A;  3MP7 B;  4BRY A;  1SS1 A;  1NTK E;  4EYY Q;  2OQQ A;  1MKM A;  2W6B A;  1BGY J;  4HKZ H;  3H1J J;  3FXD A;  1H89 A;  5BVZ A;  1BCC G;  1VF5 D;  3ITK A;  4IL6 H;  3L71 E;  2IPP A;  2QJY C;  1LWU B;  1IZN B;  4JYB A;  3HE4 A;  3HD7 A;  2FYU K;  3TYY A;  3IFM A;  2WPR A;  4N6J A;  3L73 G;  4OWF A;  5L8R J;  1S1C X;  1CSB A;  5KLV G;  1Q7Y Q;  1URQ C;  4NPF X;  1KIL C;  1T6A A;  3CL3 D;  1SQV D;  3H1H G;  1ZR4 A;  1GW3 A;  1FZF A;  1NTM D;  3O6Q B;  4R4M A;  1BDD A;  2D2C B;  2W90 A;  3A0H H;  4U7J A;  1NOH A;  1GU5 A;  3I5C A;  3CMA P;  2WQY C;  2OYH C;  3B71 A;  3CX5 H;  1EQ7 A;  4OGQ B;  3TDK A;  3RL0 C;  1SFC C;  2G3A A;  4XE5 B;  2FY8 A;  4D6T G;  5GTH E;  1RE3 C;  1GL2 A;  3AE6 C;  1VDF A;  4RES B;  4U3F G;  3S4R A;  1L0N G;  2QJY B;  3C8V A;  3VMA A;  1K8A Q;  1HWT C;  3CPW O;  1PZQ A;  1URQ B;  3RL0 g;  4Z1M H;  3PHL A;  3NXS A;  1KIL B;  4HH2 A;  2ZT9 C;  5DJT B;  3OA7 A;  1YJW P;  1IJD B;  1BCC D;  1BCC E;  1E79 H;  1PPJ G;  3KQG A;  2OYH B;  2FYU G;  3MZW B;  2O1J A;  1S5L X;  1HTL C;  1QEX A;  3L72 D;  1YTZ T;  1NTK J;  3RL0 B;  2IYP A;  1QGK B;  1S4X A;  1SFC B;  3L73 E;  2NPS A;  3RK2 C;  4PD4 I;  3TNU A;  3WUT A;  5KLV D;  5KLV E;  3AEG C;  1FDO A;  2IBZ I;  5KAI E;  5KAF H;  1VL2 A;  3L71 J;  4C7N A;  5AVW B;  1M1J C;  1Y47 A;  3L4F A;  3H1H D;  1WRG A;  1GK6 A;  3H1H E;  3H1I D;  1M56 D;  3MUD C;  5TJH A;  1M90 Q;  3JC2 2;  2WMM A;  2JP3 A;  2FXM A;  2E5T A;  1JNM A;  3VP8 A;  2ZT9 B;  1T2K C;  3L36 A;  5AVT B;  3CCL P;  2Q5U A;  3M9H A;  1FE6 A;  3VYI A;  4D6T D;  4D6T E;  1KB9 D;  2C0X A;  3C9I A;  2IZ1 A;  3A3Y B;  1K9M Q;  2WVR A;  1RY3 A;  2KP8 A;  2B87 B;  4UB6 E;  4U3F E;  1L0N D;  2WPV B;  4ZNC A;  2J5U A;  2W27 A;  1CZQ A;  1LGH B;  2FXO A;  3RK2 B;  1Y8A A;  1PIX A;  4RKU J;  2YXR B;  2KLU A;  1FOS E;  1CI6 A;  2KSE A;  2XKM A;  3AEC C;  5AVS B;  1IK9 A;  1M1J B;  1JY2 P;  2L5G B;  2QG4 A;  3SFE C;  3I56 P;  1PPJ E;  3M06 A;  4H0L D;  2FYU E;  1SQB K;  3KYQ A;  2KS1 B;  2ZVN B;  1XTG B;  1S72 P;  3V6I A;  2LKM A;  4DCK A;  2W83 C;  1LT9 A;  1BCC J;  2P2U A;  2KZJ A;  2E74 C;  1YJN P;  3L37 A;  3L75 D;  4BRY B;  2JO1 A;  3HTK B;  1RE4 A;  3L73 J;  1HGV A;  4ZKU A;  3RK3 C;  5KLV J;  4BXL A;  3OJA B;  5APV A;  2K9J A;  3HUS C;  1QL1 A;  4NPE A;  1OMI A;  3AEF C;  3H1H J;  1AJY A;  1AQ5 A;  1X8Y A;  1FS0 E;  3FXE A;  3L74 G;  1HH0 A;  1M1K Q;  3AE1 C;  3GW6 A;  5APW A;  1G1I A;  1EDL A;  2QJK C;  4ZKP A;  2N1T D;  3VP9 A;  3BAT A;  2KB7 P;  1LWU A;  1AA0 A;  3CWB E;  1OVU A;  4D6T J;  1UIX A;  1NTZ K;  3KPE A;  4CPG A;  3PP5 A;  1U57 A;  2FBW C;  3V5B A;  2E74 B;  2RMZ A;  4WY4 D;  4U3F J;  2Q9I A;  5K5G B;  1OW8 A;  4XFJ A;  2JWD A;  3K5B A;  3SWY A;  3AEA C;  2IZ0 A;  2E75 C;  1SQB G;  2E76 B;  2V7Q J;  3AE3 C;  3A0B H;  2K9Y A;  1Q81 Q;  2IBZ G; 
#chains in the Genus database with same CATH homology
 4JF7 A;  3O8Z A;  1CI6 B;  2WT7 A;  1KFM A;  2HYN A;  2CPS A;  1NHL A;  1JY2 N;  1HVV A;  1JY2 O;  3CI9 A;  5APQ A;  1T8Z A;  2ZXE B;  1ZN5 A;  2Q3I A;  2ZFC A;  2PAJ A;  3VMZ A;  5APY A;  3RK3 D;  1FZB A;  3GHG C;  5AVU B;  4WY4 C;  5AVV B;  2C0W A;  5CJ0 A;  2Q7C A;  1T3U A;  1SP4 A;  5KJ7 D;  5AW2 B;  3H32 B;  2HPC A;  1E5W A;  2IFM A;  1FZC A;  2YKP A;  1LWU C;  2A45 G;  2O01 H;  5CCH C;  3P32 A;  2GM4 A;  1NH4 A;  4HYT B;  2KLV A;  3HE5 B;  3LW5 H;  4LLH A;  5CJ4 A;  1MV8 A;  4C46 A;  3U59 A;  1HBW A;  1L0L K;  1LT9 B;  4GKG A;  1LTI C;  1URQ A;  2KYV A;  1JCC A;  3B5N A;  3VN0 A;  1JTH B;  1JCD A;  4W7Z A;  4EIJ A;  2WSF H;  1KIL A;  2YNY A;  4IFD K;  1ZR2 A;  1AFO A;  5AW3 B;  1L4A B;  1DH3 A;  1S9K D;  5CCG A;  2J58 A;  1NWQ A;  1NO4 A;  4WBA A;  3BRV B;  4I1L A;  1MFZ A;  5CMZ A;  1SQV K;  1KQL A;  1KZU B;  4KHX A;  4W80 A;  2OYH A;  5KJ7 C;  3P8M C;  1LTJ A;  2N9B A;  3B5N D;  1A02 J;  1IFM A;  2XU6 A;  2C9N Y;  2CPB A;  3KDP B;  3MIW A;  3NFQ A;  2WZ7 A;  2PP6 A;  2YO3 A;  1L4A D;  3V4Q A;  5BU5 A;  1JOC A;  1M7L A;  2W6B A;  3SWF A;  4EOT A;  3VTP C;  1FU1 A;  3VMX A;  2XZR A;  3A5T A;  4WY4 B;  1H89 A;  1RE3 A;  5BVZ A;  4N78 D;  3BAS A;  1CW5 A;  1XTC C;  1FZC C;  2IPP A;  1LWU B;  3MTU E;  4JYB A;  1T3J A;  3HE4 A;  3L35 A;  3HD7 A;  2FYU K;  3TYY A;  3IFM A;  2WPR A;  4N6J A;  1J1E C;  1SFC D;  1G2C B;  4AQR D;  1CSB A;  2QM7 A;  1URQ C;  3B5N C;  3M91 A;  2FFD A;  1KIL C;  3CL3 D;  1X9V A;  1GDT A;  1ZR4 A;  1N7S A;  1GW3 A;  1FZF A;  1SQP K;  2QM8 A;  5CCG C;  5APT A;  5CCH D;  3RK3 B;  2Z5H A;  3P7K A;  5AW1 B;  1NOH A;  1GU5 A;  1JY3 N;  2HOD A;  1JY3 O;  3I5C A;  1NKN A;  3HUS B;  4I2L C;  2OYH C;  2FKW B;  3N7N A;  1LTJ C;  1SQX K;  2WPS A;  1OXZ A;  1EQ7 A;  2W6A A;  1JUN A;  1FJK A;  2Z4E A;  2E43 A;  3IR9 A;  3G3Z A;  3RL0 C;  3P8C E;  1SFC C;  5KTB A;  4XE5 B;  3HRN A;  3B8E B;  2WIT A;  1RE3 C;  1GL2 A;  1M1J A;  1VDF A;  4RES B;  2JEE A;  1FZC B;  3MUD A;  2P1J A;  4W7Y A;  1G1J A;  3TSI A;  3HD7 C;  3LID A;  1SLQ A;  1HWT C;  1J1E B;  1N7L A;  5AW6 B;  2BAS A;  1URQ B;  3B5N B;  4JYC A;  3NXS A;  1DEB A;  1KIL B;  4HH2 A;  1IFN A;  3OA7 A;  3M0D A;  1LTS C;  4AUW A;  1HGZ A;  1MZ9 A;  1ZV8 A;  1N2D C;  1IJD B;  1JTH A;  3KQG A;  3M9B A;  2OYH B;  4DOJ A;  1URQ D;  1NTM K;  2O1J A;  1JO5 A;  1LTJ B;  2R5D A;  2OAR A;  3A2A A;  1HTL C;  3MD0 A;  1RF1 A;  3HTK A;  1KIL D;  2GUV A;  1H8A A;  1YTZ T;  4I6M C;  3RL0 B;  1SFC B;  2H8P D;  2NPS A;  5CCG D;  3RK2 C;  2OYI A;  3TNU A;  2R5B A;  4C7R A;  5AW9 B;  3GHG B;  3V2Q A;  4GT1 A;  2N1T A;  1Z56 A;  1DX7 A;  3OAK A;  1N86 A;  1FZE A;  4C7N A;  1GL2 C;  1GZL A;  4GIF A;  5AVW B;  1M1J C;  2VRS A;  3UIA A;  3L4F A;  1WRG A;  1GK6 A;  3V2R A;  1YYC A;  2HG5 D;  1GU4 A;  2KOG A;  3HE4 B;  1W2E A;  3HD7 B;  3RL0 D;  1KFN A;  4WY4 A;  3EFG A;  2YMY A;  2FXM A;  4N3Y B;  2JJL A;  4M3L A;  1JNM A;  5AVX B;  2P67 A;  5AVQ B;  3VP8 A;  3T97 A;  1SVF A;  1IFJ A;  2IFN A;  5APX A;  3L36 A;  3NMD A;  1IFD A;  1T2K C;  2J59 M;  2WSE H;  4AYC A;  5AW7 B;  2XV5 A;  3M0D C;  5AVT B;  2Q5U A;  3N4X A;  3M9H A;  3HD7 D;  3VOP A;  3VYI A;  2H7H A;  1J2J B;  2M8R A;  3TK1 A;  1N73 A;  2C0X A;  3C9I A;  2HOD B;  3A3Y B;  5AVR B;  1RY3 A;  2KP8 A;  3A7O A;  3VMY A;  2WT7 B;  1LTT C;  1MUU A;  1LTB C;  3M0A A;  5AW0 B;  2W27 A;  1GD2 E;  1RF1 C;  3CLQ A;  1SQQ K;  2R3C A;  3P8C D;  2WPQ A;  1CZQ A;  1LGH B;  1N7S D;  2POH A;  3NTN A;  1IFI A;  1RF0 A;  1FZG A;  2NPS C;  2YKO A;  4Y99 C;  3RK2 B;  5CHX A;  4B86 A;  2OYI C;  2A45 H;  3BVH A;  1QL2 A;  3HUS A;  1FOS E;  1CI6 A;  5KJ7 A;  2I1J A;  2KSJ A;  2N1T C;  1JY3 P;  1NTK K;  2XKM A;  1GL2 B;  5AVS B;  5AW8 B;  1IK9 A;  2R32 A;  1M1J B;  1H88 A;  2HPC B;  5BU8 B;  1OWA A;  2MJZ A;  5KLV K;  1JY2 P;  2L5G B;  4LGD E;  1NKZ B;  3U1A A;  3V2N A;  3RK2 D;  1J1D C;  1GK4 A;  3BRT B;  3M06 A;  1SQB K;  2WTY A;  1GTW A;  1IO4 A;  3H32 A;  3KYQ A;  2I1K A;  3WMM 0;  2FFD C;  1GL2 D;  1FDM A;  1XTG B;  1N7S C;  1PFI A;  2XDJ A;  3HE5 A;  1FAV A;  2LKM A;  1HJB A;  1JMM A;  1FBM A;  1LT9 A;  2P2U A;  1N73 C;  2C9L Y;  2Z5I A;  2O1K A;  1GW4 A;  3L37 A;  1A02 F;  1NU1 K;  2IX7 C;  1L4A A;  1LTA C;  1X79 B;  1RF1 B;  1S9K E;  3HTK B;  1YTZ I;  1T2K D;  1RE4 A;  2WWW A;  1NAF A;  1HGV A;  2YO2 A;  4WB4 A;  3V4W A;  4ZKU A;  3RK3 C;  2NPS B;  1RF0 C;  4Y99 B;  1L0N K;  2OYI B;  3TNU B;  3OJA B;  5APV A;  3HUS C;  1QL1 A;  3II6 A;  2N1T B;  2WSC H;  4OH8 B;  4C7N B;  1AQ5 A;  1X8Y A;  4XA4 A;  5AW4 B;  4DZO A;  1HUC A;  5APU A;  4IFM A;  1VPC A;  1FZA A;  1HH0 A;  1SFC A;  3LIE A;  2GUS A;  5APW A;  2NPS D;  1G1I A;  2FYZ A;  3GHG A;  1J1D B;  3EQ2 A;  2XNX A;  5AW5 B;  4N78 E;  4ZKP A;  2N1T D;  2HFE D;  2E42 A;  3VP9 A;  2FFD B;  3BAT A;  3H6P A;  2KB7 P;  1LWU A;  4LC1 A;  1IC2 A;  5CCH A;  3E1I A;  1N7S B;  2A45 I;  3M9Q A;  3MGN A;  1WT6 A;  5AVZ B;  1G2C A;  3R2P A;  3V2P A;  1NTZ K;  1LT9 C;  3KPE A;  1FOS F;  3PP5 A;  1FJP A;  1N73 B;  1ZLL A;  2H43 A;  3V5B A;  4WY4 D;  2Q9I A;  3U1C A;  5AVY B;  2HLO A;  3SWY A;  1L4A C;  2P7J A;  4IFF A;  5APS A;  1LTG C;  2M3B A;  1RE4 C;  2YKQ A;  4O9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...