2R3CA

Structure of the gp41 n-peptide in complex with the hiv entry inhibitor pie1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent D-peptide inhibitors of HIV-1 entry
pubmed doi rcsb
molecule tags Viral protein/viral protein inhibitor
molecule keywords gp41 N-peptide
total genus 20
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r3cA00
5AVRB 3T97A 2C9NY 2W27A 1HUCA 3M0AA 3L35A 1A02F 3TYYA 5APXA 5AVWB 4AYCA 1FOSF 1GU5A 3P32A 5APVA 2H7HA 1GK4A 1CSBA 3KQGA 2WPQA 2P7JA 3KDPB 2KP8A 3LIEA 4I6MC 2QM7A 3MD0A 3UIAA 4B86A 5AW1B 1T2KC 1S9KE 3A2AA 3HTKA 1HWTC 2WPSA 2R32A 5AW9B 3NXSA 1HJBA 3P7KA 1SP4A 5AVSB 1H8AA 1KQLA 3NMDA 5AVXB 1DH3A 2Z5IA 3L36A 2Q3IA 2ZXEB 4KHXA 5APSA 2WPRA 1JNMA 5AVTB 3A5TA 5APTA 2XV5A 3A7OA 1YYCA 2Q7CA 4GT1A 3V4QA 5AW6B 1MV8A 2WWWA 1SLQA 2P67A 3OAKA 1H88A 5AW0B 3VTPC 3VMZA 3A3YB 1FOSE 2QM8A 1HBWA 2Z5HA 3IR9A 1CI6A 5APYA 2R3CA 1GD2E 2C9LY 3MGNA 4I2LC 1IO4A 4GKGA 4XE5B 1T2KD 5AVVB 1OXZA 2WT7A 3V4WA 4AQRD 5AW7B 3HE4B 2YO2A 1A02J 5CMZA 2ZFCA 5AW3B 4C7NB 1GK6A 5AVZB 2Q5UA 1GTWA 2JJLA 1JUNA 3I5CA 5AW8B 2YO3A 5APWA 4AUWA 3M9HA 3HE5A 5APQA 1J2JB 4JYBA 4EOTA 5AVQB 3VYIA 3NFQA 1X8YA 1GU4A 5AW5B 3HE5B 3NTNA 2IPPA 3VN0A 1S9KD 4RESB 2XU6A 2N9BA 1MFZA 3L37A 3LIDA 3M0DA 1NWQA 2W6AA 4M3LA 3TK1A 1CI6B 3B8EB 1G2CB 1MUUA 2WTYA 4DZOA 4JYCA 1GZLA 3P8MC 2E43A 1OWAA 5APUA 5AVYB 3TNUA 3VMYA 5AW2B 5AVUB 2R5DA 3M91A 3M9BA 3HE4A 4HYTB 3M06A 2P2UA 2E42A 3TNUB 4C7NA 1CZQA 4LC1A 4C46A 3SWFA 2VRSA 5AW4B 3V5BA 1NAFA 3VMXA 2R5BA 1FAVA 3O8ZA 2XZRA 2BASA 1H89A 2WT7B 2YNYA
chains in the Genus database with same CATH superfamily
2JO1A 3L75E 2MJZA 1PGJA 4RKUJ 2W8ZA 3FWNA 3L75D 4TT3H 3RGUA 4OH8B 1VQNP 3MUDC 1YJ9P 3L35A 2H88C 1LTIC 3TYYA 1QVGO 1AA0A 4NPEA 3G3ZA 1RF1A 3GHGC 5TISE 1JY3P 2UWJE 3F5HA 1BGYD 1NVOA 2CK3H 1JB0J 2W90A 4U3FJ 1L0NK 1ZV8A 1LWUB 2I8DA 1N73B 1WT6A 2HG5D 1NTKG 2A45I 2KYVA 2K9JA 4TLFA 2P7JA 1IK9A 2OYIC 3L73D 1NU1K 5B5EE 3AE6C 3MD0A 4C7RA 4B86A 5AW1B 1EZVG 4WWIA 4IL6H 1KB9I 1NYHA 1HWTC 3D6YA 2FFDC 2JP3A 4PV1D 2PFXA 1PIXA 2R32A 3H1JJ 5GTHE 1VQ9P 1GW4A 1SQQD 4HKZH 5KJ7C 2QJPB 1SP4A 3P7KA 3RL0B 1AJYA 1ZXGA 1G2CA 1KQLA 3RL0D 2OTLP 1DH3A 1OW7A 2Y9ZA 3PP5A 1UIIA 5CBNA 1P84I 4IFMA 4RO0A 5APSA 3SSUA 1VQLP 4CPGA 5GTIE 3MHVA 1JY2P 1FDMA 2HODB 4D6TJ 2OARA 2OQQA 1AFOA 1FDIA 1KYOI 1L0NE 2WSFJ 4EIJA 3A5TA 5KKZB 2BCCJ 4GT1A 2ITAA 1BDDA 1GL2A 1KQFB 2R44A 1MV8A 1NTKJ 1N2DC 2FYUJ 4PV1C 2WWWA 3HUSC 1Q82Q 1SFCD 2OYHC 3AEEC 1SLQA 5KLVG 1DIPA 1OFCX 1JY3O 2P67A 5KAIE 1R5SA 3L72J 5AW0B 3VTPC 1HF9A 1E5WA 3CCJP 2FXPA 2KUBA 2IBZG 3A3YB 3N4XA 2Y0DA 4K3AA 1LGHB 1LT1A 2QJPC 2WSCJ 2Z5HA 3RL0C 1GD2E 4I7ZB 2HFED 1QVFO 3H25A 2M3EA 4XE5B 2E76C 1VQ6P 1FE6A 1NTMG 3TGUE 1VQOP 1DEBA 3CXHI 1XTGB 1PV3A 2C0WA 1OXZA 4GOFA 5AVVB 3BRVB 3PHLA 4LGDE 3AE8C 3HD7A 3V4WA 3VP8A 3BRTB 1K73Q 3HE4B 1NOHA 3BCCJ 2POHA 3PJSK 5CMZA 1OW6A 4ZKUA 5AVZB 1SQVG 1HTLC 1LP1B 2QE7H 2PAJA 4PD4H 1K05A 3AE5C 3I5CA 4ASVA 3Q2YA 2ZXXA 5DJTB 3CL3D 2GM4A 3HE5A 4W7YA 1HJ0A 1FJPA 3H1HD 3VYIA 1VF5C 3FXEA 3GHGB 3NFQA 4HJGH 1ZW0A 3HD7D 1ZRTE 3L71J 3V6IA 1GU4A 1NU1D 1S9KD 2NPSD 3JCUE 1M1KQ 3KPEA 4WB4A 1FZCA 4I1LA 1RY3A 1JOCA 2RMZA 1MFZA 2RKLA 1L4AC 3L37A 4N78D 3LIDA 1JY2N 3CWBG 4Y99C 1BE3G 1TU3F 2I1JA 4OVNF 2OYHA 2YXQB 3B71A 1ZMEC 1SQQG 3L70J 1YJWP 3FWLA 3BCCG 1MUUA 2HYNA 1QEXA 2N1TA 1OVUA 1Z56A 3IN6A 1KN7A 1G1JA 2KXPB 1Q81Q 1PPJG 1SFCA 2FBWC 3KYQA 3AEBC 1SQVK 1S4XA 3AE9C 1GL2D 1LTSC 3IF4A 5E79H 1NU1J 3CCLP 3AE4C 1R5LA 3M06A 1RH5B 4IOIH 1SQBD 2CPSA 1HVVA 3USSA 4C7NA 1SQVD 1DX7A 2WSCH 1OVVA 1OZHA 3V5BA 3H1LD 1L0ND 3B5NC 4WY4B 1U57A 2KS1A 4PV1B 1L0LK 3H1ID 2WVRA 5AVRB 2IBZE 2IFMA 2KNCB 3T97A 5CJ4A 1KQGB 2Z4EA 1KILB 3M0AA 1BCCE 2J59M 4PJ0E 2WSFH 1R8EA 3GW6A 1IFMA 4KT0J 5APXA 2ZT9C 3CCVP 4AYCA 4WVZA 1NTZG 2M8RA 3CX5E 4N3YB 1M8OB 2K37A 2WPVB 1GU5A 1S2EA 1SQVJ 2Y0CA 1QL1A 2M0BA 3P32A 5CCHC 1GK4A 2D2CB 1VQ8P 2IYPA 4GDOA 2WPQA 1K04A 2A45H 3HTKB 3RK3D 1LWUA 1NHLA 1IZNB 2IYOA 1FZBA 4I6MC 1ZRTD 1BCCD 1AV1A 1BGYJ 3OA7A 3TSIA 3UIAA 3U1CA 1S9KE 1L4AA 2B9BA 3HRNA 3WMM0 3TDKA 3WU2H 3S9OA 1NTZK 1HJBA 2C0XA 4K35A 3AE1C 2AXTH 1FZFA 3NMDA 1HGZA 3L36A 2A06D 2ZXEB 1FZGA 2KK7A 2W6BA 1S5LH 3H1JD 1LTAC 2JDIH 2CPBA 3R4YA 3Q5SA 2V4HA 5KLVE 1BSNA 1D7MA 2XV5A 3A0BH 3A7OA 3B5NB 1SQPK 2HLOA 2L5GB 2O01N 2O1JA 1KV4A 3RL0g 1BE3D 1SQQE 4GODA 2H43A 3TGUD 1JY2O 1NTMK 3KXDA 2HR3A 3Q5RA 3CCQP 5KJ7D 2B87B 3A0HH 2B89A 2N1TD 4W7ZA 1RF1C 1H0TA 3EFGA 3RBZA 3JCUH 3E1IA 2QA4P 3II6A 4YTPC 2Q9IA 1NH4A 1NTKD 2QM8A 1GMJA 1YBKA 2ZYAA 5B5EH 5CCHA 1M1JB 1CI6A 2KB7P 3IFMA 3IR9A 2YKQA 4H0LC 4HB1A 5KLIC 1IO4A 2XNXA 3FXDA 4GKGA 1LWUC 2AXCA 1J1DC 1KYOE 3D71A 1VQKP 4H44C 2QIWA 1NTMJ 2FYNC 3EWKA 1L0LJ 1FJKA 2FYNB 1SQXG 3M0DC 1SQVE 1URQC 1SQQJ 2WT7A 4AQRD 2JR8A 1JTHB 3RK3C 2IBZI 1DEEG 2YO2A 1A02J 1USDA 1X22A 3L72E 4BRYB 1BCCG 4OGQD 2A06G 1BSHA 1FBMA 2JJLA 1NGMB 1IFPA 1LTJA 5AW8B 1N7LA 2SPZA 1IC2A 3H32B 3L74D 1SQBK 5APWA 3BVHA 4AUWA 1NTZE 5APQA 3CCEP 1J2JB 1YI2P 1LP1A 2IX7C 4JYBA 5CCGC 4A7PA 4YPCA 4ASWA 2QEXP 4EOTA 3MP7B 1SQPG 3CXHD 3OW2O 1NJIQ 3IAOA 1RF0A 1RQVA 3VN0A 1L0LD 3MIWA 1E79H 3P8CD 1EXIA 3CC4P 5KLIB 2XU6A 1AQTA 1BE3E 2H8PD 2KLUA 3L73G 3S1KA 2N9BA 1VQ5P 1JY3N 2E5TA 1EDKA 1IFIA 1IJDB 1L0NJ 2FYZA 1NTZD 3BCCE 4H13C 1HGVA 3W68A 3CCRP 2FFDA 3RBXA 1VQPP 4OWFA 3H1JE 1N7SB 3CLQA 3H6PA 3CX5H 3D70A 3VP9A 2L91A 2P1JA 3B8EB 2OYIA 3L70G 1S1CX 2AEFA 1JMBA 1W2BO 2WTYA 5EFWB 2NZ2A 3CMEP 1IFDA 1GZLA 3L73J 2YKOA 5APUA 4QMAA 3VMYA 4UB6E 1YHQP 5AW2B 4EI2A 1ZLLA 2R5DA 2N1TB 2QJKB 3M9QA 3VMAA 1FC2C 1RE3C 3CWBJ 3A0HE 1SFCB 1OMIA 2NPSB 3WU2E 1UIXA 1M7LA 1NTMD 3AEGC 4C46A 1URQD 2E5YA 4MN4C 5AW4B 1SQXD 1OVRA 3AEAC 2R5BA 2FXMA 1LT9B 2P10A 2Q6QA 3E1RA 2HODA 3O8ZA 4WY4C 4IFFA 3C9IA 2YNYA 2FYUG 3HUSB 3I55P 2JWAA 2PRRA 1S5LE 4L74A 5CCGD 1GW3A 1SQPD 4XFJA 3W67A 2K88A 2C9NY 2W27A 2M3BA 5BVZA 4EDFA 3S4RA 2IFNA 1S5LX 1VQ7P 3L74G 2ZAEB 3AEDC 5AVWB 4Z1MH 3TGUJ 1IFJA 1SQXE 1FOSF 3CWBD 1MZ9A 2QSIA 3E7KA 1URQA 3L72D 3SFEC 2O1KA 2H7HA 1QGKB 4H44B 1CSBA 1Q90D 2AEJA 1YIJP 1FZEA 1RE4A 4H13B 1N73A 1S72P 3AE3C 3KDPB 1HH0A 1BE3J 2KP8A 3H1HE 3LIEA 2A06E 4H44D 4Y99B 2QM7A 3CMAP 4L75A 4KJMA 1CW5A 5E79E 2E75C 2DW3A 1JCDA 4GOEA 1YITP 3HD7C 5AW9B 3HD7B 1N8RQ 3NXSA 2OTJP 5AVSB 2OTKE 1H8AA 2QG4A 1KTMA 2Z5IA 1DD3A 1KILD 1RF0C 1Y47A 2GUSA 2Q3IA 4JQ0D 4W80A 1K9MQ 1PPJD 4KHXA 1FZCC 1JNMA 4R4MA 1NO4A 2XKMA 5AVTB 4D6TG 1LTBC 1JM0A 3CX5D 2FYUK 5APTA 4PJ0H 1YTZI 2ZYDA 2IZ1A 3PRJA 1YYCA 1L0LE 2AEMA 3Q5PA 1PP9E 3C8VA 3H1KE 3JSVC 3MUDA 2IDBA 4DJGA 1KB9E 1MKMA 3L70E 2XDJA 3L71D 2B88A 1Q2NA 3AE7C 3CX5I 3B5NA 3FGAD 2YMYA 1GL2B 4XA4A 1KILE 1RF1B 2KIKA 1FZAA 3ITKA 1W2EA 1LTGC 1Y8AA 2QJYC 2ZT9D 3OAKA 3RK2C 3L74J 1KMIZ 3CXHH 3WUUA 5B66E 3G4SP 1FOSE 1P84E 1Q86Q 2K9YA 1YJNP 1EDLA 3R2PA 3CC7P 3SFDC 5APYA 4H0LB 3O6QA 3GG2A 5KTBA 5M1BA 4YXWH 4EYYQ 2O01J 4PD4I 2HPCA 4DT0A 2YKPA 1SFCC 4BWNA 1AQ5A 2YIUC 3L72G 1BDCA 1FDOA 3RK3E 4YXDC 2FYUE 3D6ZA 1K8AQ 4DOJA 5KKZC 3BATA 3CCUP 5AW7B 1RE4C 1W5CE 4PD4D 1IK7A 1LT9C 2N9YB 2ZFCA 4IFDK 3C1LA 5AW3B 4C7NB 2BCCG 1GK6A 1EDIA 2Q5UA 1EZVD 3Q1MA 1PGPA 1YQ3C 1SQPE 2R3SA 3A0BE 1M57D 3KZIE 3GHGA 3CPWO 1RHZB 2WSEH 3K5BA 2JEEA 5KJ7A 3L73E 1BGYG 1ZOYC 2W83C 5AVQB 1M90Q 3MZWB 1X8YA 5AW5B 3HE5B 2IPPA 3CD6P 1USEA 2K9JB 2WMMA 1NU1E 4U7JA 1RQUA 2E75D 3H1IE 3L4FA 3H1JG 4I7ZC 5KLVD 5TJHA 1NAYA 2FKWB 1EC5A 1SS1A 1FS0E 2M5AB 4GIFA 1PZQA 1PGOA 2KI7B 5H2FH 3CWBE 3V2NA 2W6JH 1QX8A 1Y9BA 1SQBE 1DD4A 1NTKK 1GL2C 1OIPA 1PP9J 3H1KJ 1KYOH 1NWQA 1P84D 1SQPJ 2E74D 2IZ0A 3V2RA 1VF5D 1X0TA 1G2CB 2B87A 3G71P 2G3AA 2J5UA 4DZOA 2RN0A 1T8ZA 3B5ND 2E43A 1OWAA 3V2PA 1L4AD 3L71E 1JMMA 1FU1A 5AVYB 1L2PA 1SVFA 3TNUA 4D6TE 5AVUB 3ZDMA 2Y9YA 3ABVC 2ZVOB 4UB8H 1KFNA 3HE4A 4HYTB 4U3FE 2ZVNB 1PP9G 2YIUB 3H1KG 3MTUE 3BASA 4RJTA 4LC1A 4WY4D 5BU8B 2KOGA 2VRSA 3CXHE 2WSSH 1M56D 2G8YA 2Q3EA 1JO5A 1T3JA 2BASA 1H89A 2WT7B 1EXJA 1KILA 5DJUB 4D6TD 1AVOA 2LKMA 5L8RJ 3L74E 1EDJA 2A45G 2FY8A 4JF7A 1NKNA 1X9VA 1PFIA 1T3UA 1LT9A 1YQ4C 2IBZD 3U1AA 1HUCA 1N7SD 1S3JA 1OW8A 1XTCC 3HUSA 3PTZA 4L73A 3RK2B 2K1AA 3QWOC 1A02F 1U7MA 1KORA 1FZCB 3CCMP 3H1LE 3RK2D 3LW5J 3AE2C 1H0TB 1M1JC 1NTZJ 3H1HG 5KLVK 2LXCB 5KAIH 2GA1A 5APVA 3F89A 4OGQC 2QVAA 2ZJSE 1ZR2A 2E76B 1JEKA 1VDFA 3KQGA 4WBAA 1L4AB 1KZUB 1YTZT 4ZMDA 1J1EB 1URQB 2BCCE 2E76D 2WQYC 4ZNCA 3TF5A 4LLHA 3CCSP 1NTKE 2Q1KA 2QJYB 3A2AA 3HTKA 1LTJC 3QH9A 5KAFE 2WPSA 1T2KC 1X79B 1N7SA 2WZ7A 4Y28J 2KLVA 5CCGA 1SQXK 2KZIA 4H0LD 3U59A 1EZVE 5AVXB 2JWDA 2J58A 4ZKPA 1NU1G 1SQXJ 1WMKA 1KFMA 1L0LG 1VF5B 3H1IJ 3JC22 4JBZA 2E74B 5H2FE 3SWKA 1MFTA 2WPRA 3EFFK 1ZP0C 4R4LA 4WY4A 2NRGA 2QRXA 4PD4E 1KQSO 3SWYA 3N7NA 2Q7CA 3KZIH 1SQBG 3V4QA 3WUVA 2NPSA 5AW6B 2V7QH 1QL2A 2WITA 1ZR4A 2Y0EA 1N86A 1L0NG 2KSEA 2YMKA 3G9RA 1H88A 4JPZB 1KILC 1KD1Q 3CC2P 4UB8E 2PP6A 3VMZA 2MKVA 5BU5A 2FFDB 1VL2A 3L75G 4IL6X 1JCCA 2RH0A 1HBWA 3G6EP 1VQ4P 2I1KA 5C39A 1EZVI 2R3CA 2K3RA 4U3FG 3L70D 2C9LY 3MGNA 3BCCD 4I2LC 2LXBA 1PP9D 2N1TC 2QJKC 1SQQK 3H1KD 1M1JA 5GTHH 1KB9D 3WUTA 4DCKA 3OJAB 5KLVJ 1Q7YQ 3AECC 1T2KD 1QLED 2LR2A 3O6QB 2BEQD 2KS1B 4O9BA 1N7SC 5TISH 2HPCB 1RE3A 3KHUA 3P8CE 3I56P 1VPCA 1G1IA 2KNCA 3H1HJ 3T97B 2KSJA 1WRGA 2KZJA 3GF7A 1SQBJ 3H32A 1GTWA 1BGYE 1JUNA 2O3JA 3H1LG 1AVYA 2V7QJ 3H1LJ 5CBOA 2FXOA 2YO3A 3M9HA 3PH0A 4L76A 3H1IG 2FYUD 1KB9H 4UB6H 4IL6E 1IFNA 2ZT9B 4HH2A 1LTTC 2NPSC 3EQ2A 5K5GB 3NTNA 2OYOA 1N73C 2OGUA 2GUVA 4RESB 2BEZF 3GLMA 4N6JA 2D2CC 3AEFC 4NPDA 2WSEJ 2YXRB 2OYHB 3FX0A 2AXTE 5CJ0A 2OYIB 1KYOD 2P58A 5GTIH 1J1EC 5CCHD 1VQMP 4NPFX 2W6AA 4BXLA 3GMAA 4M3LA 3L71G 1CI6B 2O01H 2M5AA 2XNDH 3TK1A 1LNQA 2ZYGA 1GDTA 3L75J 3PLNA 3VOPA 1U7JA 2PGDA 5CHXA 4JYCA 1BCCJ 3P8MC 4H13D 1NKZB 5B66H 1PGQA 4OGQB 1J1DB 1EQ7A 2D2CD 2H89C 3GF3A 1JTHA 3M91A 3M9BA 4N78E 4U3FD 5KAFH 2E74C 2P2UA 1PL5A 2E42A 3TNUB 1P84H 1PPJE 2BCCD 3V2QA 4BRYA 1CZQA 1KC8Q 3RK3B 2JKVA 1LJ2A 3SWFA 3Q3DA 1NTME 2E75B 1NAFA 3TGUG 3LW5H 1LTJB 1FAVA 1OX3A 2XZRA 3VMXA 3M0DA 1ZN5A 3CI9A 3B4SA 1T6AA
chains in the Genus database with same CATH topology
2MJZA 4OH8B 3L35A 1LTIC 3TYYA 3G3ZA 1RF1A 3GHGC 1JY3P 1N73B 1L0NK 1ZV8A 1LWUB 1WT6A 2HG5D 2A45I 2KYVA 2P7JA 1IK9A 2OYIC 1NU1K 3MD0A 4C7RA 4B86A 5AW1B 1HWTC 2FFDC 2R32A 1GW4A 5KJ7C 3P7KA 1SP4A 3RL0B 1G2CA 1KQLA 3RL0D 1DH3A 3PP5A 4IFMA 5APSA 1JY2P 1FDMA 2HODB 2OARA 1AFOA 3A5TA 4EIJA 4GT1A 1GL2A 1MV8A 2OYHC 1N2DC 2WWWA 3HUSC 1SFCD 1SLQA 1JY3O 2P67A 5AW0B 3VTPC 1E5WA 3A3YB 3N4XA 1LGHB 2Z5HA 3RL0C 1GD2E 2HFED 4XE5B 1DEBA 1XTGB 2C0WA 5AVVB 1OXZA 3BRVB 4LGDE 3HD7A 3V4WA 3VP8A 3BRTB 3HE4B 1NOHA 2POHA 5CMZA 4ZKUA 5AVZB 1HTLC 2PAJA 3I5CA 3CL3D 2GM4A 3HE5A 4W7YA 1FJPA 3VYIA 3GHGB 3NFQA 3HD7D 1GU4A 1S9KD 2NPSD 3KPEA 4WB4A 1FZCA 4I1LA 1RY3A 1JOCA 1MFZA 3L37A 1L4AC 4N78D 3LIDA 1JY2N 4Y99C 2I1JA 2OYHA 1MUUA 2HYNA 2N1TA 1Z56A 1G1JA 1SFCA 3KYQA 1SQVK 1GL2D 1LTSC 3M06A 2CPSA 1HVVA 4C7NA 1DX7A 2WSCH 3V5BA 3B5NC 4WY4B 1L0LK 5AVRB 2IFMA 3T97A 5CJ4A 2Z4EA 1KILB 3M0AA 2J59M 2WSFH 5APXA 1IFMA 4AYCA 2M8RA 4N3YB 1GU5A 3P32A 1QL1A 5CCHC 1GK4A 2WPQA 2A45H 3HTKB 3RK3D 1LWUA 1NHLA 4I6MC 3TSIA 1FZBA 3UIAA 3OA7A 3U1CA 1S9KE 1L4AA 3HRNA 3WMM0 1NTZK 1HJBA 2C0XA 3NMDA 1HGZA 3L36A 2ZXEB 1FZGA 2W6BA 1LTAC 2CPBA 2XV5A 3A7OA 3B5NB 1SQPK 2HLOA 2L5GB 2O1JA 2H43A 1JY2O 1NTMK 5KJ7D 1RF1C 2N1TD 4W7ZA 3EFGA 3E1IA 3II6A 2Q9IA 1NH4A 2QM8A 5CCHA 1M1JB 1CI6A 2KB7P 3IFMA 3IR9A 2YKQA 1IO4A 2XNXA 4GKGA 1LWUC 1J1DC 1FJKA 3M0DC 1URQC 2WT7A 4AQRD 3RK3C 1JTHB 2YO2A 1A02J 1FBMA 2JJLA 1LTJA 5AW8B 1N7LA 1IC2A 3H32B 3BVHA 1SQBK 5APWA 4AUWA 5APQA 1J2JB 4JYBA 2IX7C 5CCGC 4EOTA 1RF0A 3VN0A 3MIWA 3P8CD 2XU6A 2H8PD 2N9BA 1JY3N 1IFIA 1IJDB 2FYZA 1HGVA 2FFDA 1N7SB 3CLQA 3H6PA 3VP9A 2P1JA 3B8EB 2OYIA 2WTYA 1IFDA 1GZLA 2YKOA 5APUA 3VMYA 5AW2B 1ZLLA 2R5DA 2N1TB 3M9QA 1RE3C 1SFCB 2NPSB 1M7LA 4C46A 1URQD 5AW4B 1FZFA 2R5BA 2FXMA 1LT9B 3O8ZA 4WY4C 2HODA 4IFFA 3C9IA 3HUSB 2YNYA 5CCGD 1GW3A 2C9NY 2W27A 2M3BA 5BVZA 2IFNA 5AVWB 1IFJA 1FOSF 1MZ9A 1URQA 2O1KA 2H7HA 1CSBA 1N73A 1FZEA 1RE4A 3KDPB 1HH0A 2KP8A 3LIEA 4Y99B 2QM7A 1CW5A 1JCDA 3HD7C 5AW9B 3HD7B 3NXSA 5AVSB 1H8AA 2Z5IA 1KILD 2GUSA 1RF0C 2Q3IA 4W80A 4KHXA 1FZCC 1JNMA 1NO4A 2XKMA 5AVTB 1LTBC 2FYUK 5APTA 1YTZI 1YYCA 3MUDA 2XDJA 3B5NA 4XA4A 2YMYA 1GL2B 1RF1B 3OAKA 1FZAA 1W2EA 1LTGC 3RK2C 1FOSE 3R2PA 5APYA 5KTBA 2HPCA 2YKPA 1SFCC 4DOJA 3BATA 5AW7B 1RE4C 1LT9C 2ZFCA 4IFDK 5AW3B 4C7NB 1GK6A 2Q5UA 3GHGA 2WSEH 2JEEA 5KJ7A 5AVQB 1X8YA 5AW5B 3HE5B 2IPPA 3L4FA 2FKWB 4GIFA 3V2NA 1NTKK 1NWQA 1GL2C 3V2RA 1G2CB 4DZOA 1T8ZA 3B5ND 2E43A 1OWAA 3V2PA 1L4AD 5AVYB 1JMMA 1FU1A 3TNUA 1SVFA 5AVUB 1KFNA 3HE4A 4HYTB 3MTUE 3BASA 5BU8B 4LC1A 4WY4D 2KOGA 2VRSA 1JO5A 2BASA 1T3JA 1H89A 2WT7B 1KILA 2LKMA 2A45G 4JF7A 1PFIA 1NKNA 1X9VA 1T3UA 1LT9A 3U1AA 1HUCA 1N7SD 3RK2B 1XTCC 3HUSA 1A02F 1FZCB 3RK2D 1M1JC 5KLVK 5APVA 1ZR2A 1VDFA 3KQGA 4WBAA 1L4AB 1KZUB 1YTZT 1J1EB 1URQB 4LLHA 1T2KC 3A2AA 3HTKA 1LTJC 2WPSA 1X79B 1N7SA 2WZ7A 2KLVA 5CCGA 1SQXK 3U59A 5AVXB 2J58A 4ZKPA 1AQ5A 1KFMA 2WPRA 4WY4A 3SWYA 3N7NA 2Q7CA 3V4QA 2NPSA 5AW6B 1QL2A 2WITA 1ZR4A 1N86A 1H88A 1KILC 2PP6A 3VMZA 5BU5A 2FFDB 1JCCA 1HBWA 2I1KA 2R3CA 2C9LY 3MGNA 4I2LC 2N1TC 1SQQK 1M1JA 3OJAB 1T2KD 4O9BA 1N7SC 2HPCB 1RE3A 3P8CE 1VPCA 1G1IA 2KSJA 1WRGA 3H32A 1GTWA 1JUNA 2YO3A 3M9HA 1IFNA 4HH2A 1LTTC 2NPSC 3EQ2A 3NTNA 1N73C 2GUVA 4RESB 4N6JA 2OYHB 2OYIB 5CJ0A 1J1EC 5CCHD 2W6AA 4M3LA 3TK1A 1CI6B 2O01H 1GDTA 3VOPA 5CHXA 4JYCA 3P8MC 1NKZB 1J1DB 1EQ7A 3M91A 3M9BA 1JTHA 4N78E 2P2UA 2E42A 3TNUB 3V2QA 1CZQA 3RK3B 3SWFA 3VMXA 1NAFA 3LW5H 1LTJB 1FAVA 2XZRA 3M0DA 1ZN5A 3CI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVR B;  3T97 A;  2C9N Y;  2W27 A;  1HUC A;  3M0A A;  3L35 A;  1A02 F;  3TYY A;  5APX A;  5AVW B;  4AYC A;  1FOS F;  1GU5 A;  3P32 A;  5APV A;  2H7H A;  1GK4 A;  1CSB A;  3KQG A;  2WPQ A;  2P7J A;  3KDP B;  2KP8 A;  3LIE A;  4I6M C;  2QM7 A;  3MD0 A;  3UIA A;  4B86 A;  5AW1 B;  1T2K C;  1S9K E;  3A2A A;  3HTK A;  1HWT C;  2WPS A;  2R32 A;  5AW9 B;  3NXS A;  1HJB A;  3P7K A;  1SP4 A;  5AVS B;  1H8A A;  1KQL A;  3NMD A;  5AVX B;  1DH3 A;  2Z5I A;  3L36 A;  2Q3I A;  2ZXE B;  4KHX A;  5APS A;  2WPR A;  1JNM A;  5AVT B;  3A5T A;  5APT A;  2XV5 A;  3A7O A;  1YYC A;  2Q7C A;  4GT1 A;  3V4Q A;  5AW6 B;  1MV8 A;  2WWW A;  1SLQ A;  2P67 A;  3OAK A;  1H88 A;  5AW0 B;  3VTP C;  3VMZ A;  3A3Y B;  1FOS E;  2QM8 A;  1HBW A;  2Z5H A;  3IR9 A;  1CI6 A;  5APY A;  2R3C A;  1GD2 E;  2C9L Y;  3MGN A;  4I2L C;  1IO4 A;  4GKG A;  4XE5 B;  1T2K D;  5AVV B;  1OXZ A;  2WT7 A;  3V4W A;  4AQR D;  5AW7 B;  3HE4 B;  2YO2 A;  1A02 J;  5CMZ A;  2ZFC A;  5AW3 B;  4C7N B;  1GK6 A;  5AVZ B;  2Q5U A;  1GTW A;  2JJL A;  1JUN A;  3I5C A;  5AW8 B;  2YO3 A;  5APW A;  4AUW A;  3M9H A;  3HE5 A;  5APQ A;  1J2J B;  4JYB A;  4EOT A;  5AVQ B;  3VYI A;  3NFQ A;  1X8Y A;  1GU4 A;  5AW5 B;  3HE5 B;  3NTN A;  2IPP A;  3VN0 A;  1S9K D;  4RES B;  2XU6 A;  2N9B A;  1MFZ A;  3L37 A;  3LID A;  3M0D A;  1NWQ A;  2W6A A;  4M3L A;  3TK1 A;  1CI6 B;  3B8E B;  1G2C B;  1MUU A;  2WTY A;  4DZO A;  4JYC A;  1GZL A;  3P8M C;  2E43 A;  1OWA A;  5APU A;  5AVY B;  3TNU A;  3VMY A;  5AW2 B;  5AVU B;  2R5D A;  3M91 A;  3M9B A;  3HE4 A;  4HYT B;  3M06 A;  2P2U A;  2E42 A;  3TNU B;  4C7N A;  1CZQ A;  4LC1 A;  4C46 A;  3SWF A;  2VRS A;  5AW4 B;  3V5B A;  1NAF A;  3VMX A;  2R5B A;  1FAV A;  3O8Z A;  2XZR A;  2BAS A;  1H89 A;  2WT7 B;  2YNY A; 
#chains in the Genus database with same CATH topology
 2JO1 A;  3L75 E;  2MJZ A;  1PGJ A;  4RKU J;  2W8Z A;  3FWN A;  3L75 D;  4TT3 H;  3RGU A;  4OH8 B;  1VQN P;  3MUD C;  1YJ9 P;  3L35 A;  2H88 C;  1LTI C;  3TYY A;  1QVG O;  1AA0 A;  4NPE A;  3G3Z A;  1RF1 A;  3GHG C;  5TIS E;  1JY3 P;  2UWJ E;  3F5H A;  1BGY D;  1NVO A;  2CK3 H;  1JB0 J;  2W90 A;  4U3F J;  1L0N K;  1ZV8 A;  1LWU B;  2I8D A;  1N73 B;  1WT6 A;  2HG5 D;  1NTK G;  2A45 I;  2KYV A;  2K9J A;  4TLF A;  2P7J A;  1IK9 A;  2OYI C;  3L73 D;  1NU1 K;  5B5E E;  3AE6 C;  3MD0 A;  4C7R A;  4B86 A;  5AW1 B;  1EZV G;  4WWI A;  4IL6 H;  1KB9 I;  1NYH A;  1HWT C;  3D6Y A;  2FFD C;  2JP3 A;  4PV1 D;  2PFX A;  1PIX A;  2R32 A;  3H1J J;  5GTH E;  1VQ9 P;  1GW4 A;  1SQQ D;  4HKZ H;  5KJ7 C;  2QJP B;  1SP4 A;  3P7K A;  3RL0 B;  1AJY A;  1ZXG A;  1G2C A;  1KQL A;  3RL0 D;  2OTL P;  1DH3 A;  1OW7 A;  2Y9Z A;  3PP5 A;  1UII A;  5CBN A;  1P84 I;  4IFM A;  4RO0 A;  5APS A;  3SSU A;  1VQL P;  4CPG A;  5GTI E;  3MHV A;  1JY2 P;  1FDM A;  2HOD B;  4D6T J;  2OAR A;  2OQQ A;  1AFO A;  1FDI A;  1KYO I;  1L0N E;  2WSF J;  4EIJ A;  3A5T A;  5KKZ B;  2BCC J;  4GT1 A;  2ITA A;  1BDD A;  1GL2 A;  1KQF B;  2R44 A;  1MV8 A;  1NTK J;  1N2D C;  2FYU J;  4PV1 C;  2WWW A;  3HUS C;  1Q82 Q;  1SFC D;  2OYH C;  3AEE C;  1SLQ A;  5KLV G;  1DIP A;  1OFC X;  1JY3 O;  2P67 A;  5KAI E;  1R5S A;  3L72 J;  5AW0 B;  3VTP C;  1HF9 A;  1E5W A;  3CCJ P;  2FXP A;  2KUB A;  2IBZ G;  3A3Y B;  3N4X A;  2Y0D A;  4K3A A;  1LGH B;  1LT1 A;  2QJP C;  2WSC J;  2Z5H A;  3RL0 C;  1GD2 E;  4I7Z B;  2HFE D;  1QVF O;  3H25 A;  2M3E A;  4XE5 B;  2E76 C;  1VQ6 P;  1FE6 A;  1NTM G;  3TGU E;  1VQO P;  1DEB A;  3CXH I;  1XTG B;  1PV3 A;  2C0W A;  1OXZ A;  4GOF A;  5AVV B;  3BRV B;  3PHL A;  4LGD E;  3AE8 C;  3HD7 A;  3V4W A;  3VP8 A;  3BRT B;  1K73 Q;  3HE4 B;  1NOH A;  3BCC J;  2POH A;  3PJS K;  5CMZ A;  1OW6 A;  4ZKU A;  5AVZ B;  1SQV G;  1HTL C;  1LP1 B;  2QE7 H;  2PAJ A;  4PD4 H;  1K05 A;  3AE5 C;  3I5C A;  4ASV A;  3Q2Y A;  2ZXX A;  5DJT B;  3CL3 D;  2GM4 A;  3HE5 A;  4W7Y A;  1HJ0 A;  1FJP A;  3H1H D;  3VYI A;  1VF5 C;  3FXE A;  3GHG B;  3NFQ A;  4HJG H;  1ZW0 A;  3HD7 D;  1ZRT E;  3L71 J;  3V6I A;  1GU4 A;  1NU1 D;  1S9K D;  2NPS D;  3JCU E;  1M1K Q;  3KPE A;  4WB4 A;  1FZC A;  4I1L A;  1RY3 A;  1JOC A;  2RMZ A;  1MFZ A;  2RKL A;  1L4A C;  3L37 A;  4N78 D;  3LID A;  1JY2 N;  3CWB G;  4Y99 C;  1BE3 G;  1TU3 F;  2I1J A;  4OVN F;  2OYH A;  2YXQ B;  3B71 A;  1ZME C;  1SQQ G;  3L70 J;  1YJW P;  3FWL A;  3BCC G;  1MUU A;  2HYN A;  1QEX A;  2N1T A;  1OVU A;  1Z56 A;  3IN6 A;  1KN7 A;  1G1J A;  2KXP B;  1Q81 Q;  1PPJ G;  1SFC A;  2FBW C;  3KYQ A;  3AEB C;  1SQV K;  1S4X A;  3AE9 C;  1GL2 D;  1LTS C;  3IF4 A;  5E79 H;  1NU1 J;  3CCL P;  3AE4 C;  1R5L A;  3M06 A;  1RH5 B;  4IOI H;  1SQB D;  2CPS A;  1HVV A;  3USS A;  4C7N A;  1SQV D;  1DX7 A;  2WSC H;  1OVV A;  1OZH A;  3V5B A;  3H1L D;  1L0N D;  3B5N C;  4WY4 B;  1U57 A;  2KS1 A;  4PV1 B;  1L0L K;  3H1I D;  2WVR A;  5AVR B;  2IBZ E;  2IFM A;  2KNC B;  3T97 A;  5CJ4 A;  1KQG B;  2Z4E A;  1KIL B;  3M0A A;  1BCC E;  2J59 M;  4PJ0 E;  2WSF H;  1R8E A;  3GW6 A;  1IFM A;  4KT0 J;  5APX A;  2ZT9 C;  3CCV P;  4AYC A;  4WVZ A;  1NTZ G;  2M8R A;  3CX5 E;  4N3Y B;  1M8O B;  2K37 A;  2WPV B;  1GU5 A;  1S2E A;  1SQV J;  2Y0C A;  1QL1 A;  2M0B A;  3P32 A;  5CCH C;  1GK4 A;  2D2C B;  1VQ8 P;  2IYP A;  4GDO A;  2WPQ A;  1K04 A;  2A45 H;  3HTK B;  3RK3 D;  1LWU A;  1NHL A;  1IZN B;  2IYO A;  1FZB A;  4I6M C;  1ZRT D;  1BCC D;  1AV1 A;  1BGY J;  3OA7 A;  3TSI A;  3UIA A;  3U1C A;  1S9K E;  1L4A A;  2B9B A;  3HRN A;  3WMM 0;  3TDK A;  3WU2 H;  3S9O A;  1NTZ K;  1HJB A;  2C0X A;  4K35 A;  3AE1 C;  2AXT H;  1FZF A;  3NMD A;  1HGZ A;  3L36 A;  2A06 D;  2ZXE B;  1FZG A;  2KK7 A;  2W6B A;  1S5L H;  3H1J D;  1LTA C;  2JDI H;  2CPB A;  3R4Y A;  3Q5S A;  2V4H A;  5KLV E;  1BSN A;  1D7M A;  2XV5 A;  3A0B H;  3A7O A;  3B5N B;  1SQP K;  2HLO A;  2L5G B;  2O01 N;  2O1J A;  1KV4 A;  3RL0 g;  1BE3 D;  1SQQ E;  4GOD A;  2H43 A;  3TGU D;  1JY2 O;  1NTM K;  3KXD A;  2HR3 A;  3Q5R A;  3CCQ P;  5KJ7 D;  2B87 B;  3A0H H;  2B89 A;  2N1T D;  4W7Z A;  1RF1 C;  1H0T A;  3EFG A;  3RBZ A;  3JCU H;  3E1I A;  2QA4 P;  3II6 A;  4YTP C;  2Q9I A;  1NH4 A;  1NTK D;  2QM8 A;  1GMJ A;  1YBK A;  2ZYA A;  5B5E H;  5CCH A;  1M1J B;  1CI6 A;  2KB7 P;  3IFM A;  3IR9 A;  2YKQ A;  4H0L C;  4HB1 A;  5KLI C;  1IO4 A;  2XNX A;  3FXD A;  4GKG A;  1LWU C;  2AXC A;  1J1D C;  1KYO E;  3D71 A;  1VQK P;  4H44 C;  2QIW A;  1NTM J;  2FYN C;  3EWK A;  1L0L J;  1FJK A;  2FYN B;  1SQX G;  3M0D C;  1SQV E;  1URQ C;  1SQQ J;  2WT7 A;  4AQR D;  2JR8 A;  1JTH B;  3RK3 C;  2IBZ I;  1DEE G;  2YO2 A;  1A02 J;  1USD A;  1X22 A;  3L72 E;  4BRY B;  1BCC G;  4OGQ D;  2A06 G;  1BSH A;  1FBM A;  2JJL A;  1NGM B;  1IFP A;  1LTJ A;  5AW8 B;  1N7L A;  2SPZ A;  1IC2 A;  3H32 B;  3L74 D;  1SQB K;  5APW A;  3BVH A;  4AUW A;  1NTZ E;  5APQ A;  3CCE P;  1J2J B;  1YI2 P;  1LP1 A;  2IX7 C;  4JYB A;  5CCG C;  4A7P A;  4YPC A;  4ASW A;  2QEX P;  4EOT A;  3MP7 B;  1SQP G;  3CXH D;  3OW2 O;  1NJI Q;  3IAO A;  1RF0 A;  1RQV A;  3VN0 A;  1L0L D;  3MIW A;  1E79 H;  3P8C D;  1EXI A;  3CC4 P;  5KLI B;  2XU6 A;  1AQT A;  1BE3 E;  2H8P D;  2KLU A;  3L73 G;  3S1K A;  2N9B A;  1VQ5 P;  1JY3 N;  2E5T A;  1EDK A;  1IFI A;  1IJD B;  1L0N J;  2FYZ A;  1NTZ D;  3BCC E;  4H13 C;  1HGV A;  3W68 A;  3CCR P;  2FFD A;  3RBX A;  1VQP P;  4OWF A;  3H1J E;  1N7S B;  3CLQ A;  3H6P A;  3CX5 H;  3D70 A;  3VP9 A;  2L91 A;  2P1J A;  3B8E B;  2OYI A;  3L70 G;  1S1C X;  2AEF A;  1JMB A;  1W2B O;  2WTY A;  5EFW B;  2NZ2 A;  3CME P;  1IFD A;  1GZL A;  3L73 J;  2YKO A;  5APU A;  4QMA A;  3VMY A;  4UB6 E;  1YHQ P;  5AW2 B;  4EI2 A;  1ZLL A;  2R5D A;  2N1T B;  2QJK B;  3M9Q A;  3VMA A;  1FC2 C;  1RE3 C;  3CWB J;  3A0H E;  1SFC B;  1OMI A;  2NPS B;  3WU2 E;  1UIX A;  1M7L A;  1NTM D;  3AEG C;  4C46 A;  1URQ D;  2E5Y A;  4MN4 C;  5AW4 B;  1SQX D;  1OVR A;  3AEA C;  2R5B A;  2FXM A;  1LT9 B;  2P10 A;  2Q6Q A;  3E1R A;  2HOD A;  3O8Z A;  4WY4 C;  4IFF A;  3C9I A;  2YNY A;  2FYU G;  3HUS B;  3I55 P;  2JWA A;  2PRR A;  1S5L E;  4L74 A;  5CCG D;  1GW3 A;  1SQP D;  4XFJ A;  3W67 A;  2K88 A;  2C9N Y;  2W27 A;  2M3B A;  5BVZ A;  4EDF A;  3S4R A;  2IFN A;  1S5L X;  1VQ7 P;  3L74 G;  2ZAE B;  3AED C;  5AVW B;  4Z1M H;  3TGU J;  1IFJ A;  1SQX E;  1FOS F;  3CWB D;  1MZ9 A;  2QSI A;  3E7K A;  1URQ A;  3L72 D;  3SFE C;  2O1K A;  2H7H A;  1QGK B;  4H44 B;  1CSB A;  1Q90 D;  2AEJ A;  1YIJ P;  1FZE A;  1RE4 A;  4H13 B;  1N73 A;  1S72 P;  3AE3 C;  3KDP B;  1HH0 A;  1BE3 J;  2KP8 A;  3H1H E;  3LIE A;  2A06 E;  4H44 D;  4Y99 B;  2QM7 A;  3CMA P;  4L75 A;  4KJM A;  1CW5 A;  5E79 E;  2E75 C;  2DW3 A;  1JCD A;  4GOE A;  1YIT P;  3HD7 C;  5AW9 B;  3HD7 B;  1N8R Q;  3NXS A;  2OTJ P;  5AVS B;  2OTK E;  1H8A A;  2QG4 A;  1KTM A;  2Z5I A;  1DD3 A;  1KIL D;  1RF0 C;  1Y47 A;  2GUS A;  2Q3I A;  4JQ0 D;  4W80 A;  1K9M Q;  1PPJ D;  4KHX A;  1FZC C;  1JNM A;  4R4M A;  1NO4 A;  2XKM A;  5AVT B;  4D6T G;  1LTB C;  1JM0 A;  3CX5 D;  2FYU K;  5APT A;  4PJ0 H;  1YTZ I;  2ZYD A;  2IZ1 A;  3PRJ A;  1YYC A;  1L0L E;  2AEM A;  3Q5P A;  1PP9 E;  3C8V A;  3H1K E;  3JSV C;  3MUD A;  2IDB A;  4DJG A;  1KB9 E;  1MKM A;  3L70 E;  2XDJ A;  3L71 D;  2B88 A;  1Q2N A;  3AE7 C;  3CX5 I;  3B5N A;  3FGA D;  2YMY A;  1GL2 B;  4XA4 A;  1KIL E;  1RF1 B;  2KIK A;  1FZA A;  3ITK A;  1W2E A;  1LTG C;  1Y8A A;  2QJY C;  2ZT9 D;  3OAK A;  3RK2 C;  3L74 J;  1KMI Z;  3CXH H;  3WUU A;  5B66 E;  3G4S P;  1FOS E;  1P84 E;  1Q86 Q;  2K9Y A;  1YJN P;  1EDL A;  3R2P A;  3CC7 P;  3SFD C;  5APY A;  4H0L B;  3O6Q A;  3GG2 A;  5KTB A;  5M1B A;  4YXW H;  4EYY Q;  2O01 J;  4PD4 I;  2HPC A;  4DT0 A;  2YKP A;  1SFC C;  4BWN A;  1AQ5 A;  2YIU C;  3L72 G;  1BDC A;  1FDO A;  3RK3 E;  4YXD C;  2FYU E;  3D6Z A;  1K8A Q;  4DOJ A;  5KKZ C;  3BAT A;  3CCU P;  5AW7 B;  1RE4 C;  1W5C E;  4PD4 D;  1IK7 A;  1LT9 C;  2N9Y B;  2ZFC A;  4IFD K;  3C1L A;  5AW3 B;  4C7N B;  2BCC G;  1GK6 A;  1EDI A;  2Q5U A;  1EZV D;  3Q1M A;  1PGP A;  1YQ3 C;  1SQP E;  2R3S A;  3A0B E;  1M57 D;  3KZI E;  3GHG A;  3CPW O;  1RHZ B;  2WSE H;  3K5B A;  2JEE A;  5KJ7 A;  3L73 E;  1BGY G;  1ZOY C;  2W83 C;  5AVQ B;  1M90 Q;  3MZW B;  1X8Y A;  5AW5 B;  3HE5 B;  2IPP A;  3CD6 P;  1USE A;  2K9J B;  2WMM A;  1NU1 E;  4U7J A;  1RQU A;  2E75 D;  3H1I E;  3L4F A;  3H1J G;  4I7Z C;  5KLV D;  5TJH A;  1NAY A;  2FKW B;  1EC5 A;  1SS1 A;  1FS0 E;  2M5A B;  4GIF A;  1PZQ A;  1PGO A;  2KI7 B;  5H2F H;  3CWB E;  3V2N A;  2W6J H;  1QX8 A;  1Y9B A;  1SQB E;  1DD4 A;  1NTK K;  1GL2 C;  1OIP A;  1PP9 J;  3H1K J;  1KYO H;  1NWQ A;  1P84 D;  1SQP J;  2E74 D;  2IZ0 A;  3V2R A;  1VF5 D;  1X0T A;  1G2C B;  2B87 A;  3G71 P;  2G3A A;  2J5U A;  4DZO A;  2RN0 A;  1T8Z A;  3B5N D;  2E43 A;  1OWA A;  3V2P A;  1L4A D;  3L71 E;  1JMM A;  1FU1 A;  5AVY B;  1L2P A;  1SVF A;  3TNU A;  4D6T E;  5AVU B;  3ZDM A;  2Y9Y A;  3ABV C;  2ZVO B;  4UB8 H;  1KFN A;  3HE4 A;  4HYT B;  4U3F E;  2ZVN B;  1PP9 G;  2YIU B;  3H1K G;  3MTU E;  3BAS A;  4RJT A;  4LC1 A;  4WY4 D;  5BU8 B;  2KOG A;  2VRS A;  3CXH E;  2WSS H;  1M56 D;  2G8Y A;  2Q3E A;  1JO5 A;  1T3J A;  2BAS A;  1H89 A;  2WT7 B;  1EXJ A;  1KIL A;  5DJU B;  4D6T D;  1AVO A;  2LKM A;  5L8R J;  3L74 E;  1EDJ A;  2A45 G;  2FY8 A;  4JF7 A;  1NKN A;  1X9V A;  1PFI A;  1T3U A;  1LT9 A;  1YQ4 C;  2IBZ D;  3U1A A;  1HUC A;  1N7S D;  1S3J A;  1OW8 A;  1XTC C;  3HUS A;  3PTZ A;  4L73 A;  3RK2 B;  2K1A A;  3QWO C;  1A02 F;  1U7M A;  1KOR A;  1FZC B;  3CCM P;  3H1L E;  3RK2 D;  3LW5 J;  3AE2 C;  1H0T B;  1M1J C;  1NTZ J;  3H1H G;  5KLV K;  2LXC B;  5KAI H;  2GA1 A;  5APV A;  3F89 A;  4OGQ C;  2QVA A;  2ZJS E;  1ZR2 A;  2E76 B;  1JEK A;  1VDF A;  3KQG A;  4WBA A;  1L4A B;  1KZU B;  1YTZ T;  4ZMD A;  1J1E B;  1URQ B;  2BCC E;  2E76 D;  2WQY C;  4ZNC A;  3TF5 A;  4LLH A;  3CCS P;  1NTK E;  2Q1K A;  2QJY B;  3A2A A;  3HTK A;  1LTJ C;  3QH9 A;  5KAF E;  2WPS A;  1T2K C;  1X79 B;  1N7S A;  2WZ7 A;  4Y28 J;  2KLV A;  5CCG A;  1SQX K;  2KZI A;  4H0L D;  3U59 A;  1EZV E;  5AVX B;  2JWD A;  2J58 A;  4ZKP A;  1NU1 G;  1SQX J;  1WMK A;  1KFM A;  1L0L G;  1VF5 B;  3H1I J;  3JC2 2;  4JBZ A;  2E74 B;  5H2F E;  3SWK A;  1MFT A;  2WPR A;  3EFF K;  1ZP0 C;  4R4L A;  4WY4 A;  2NRG A;  2QRX A;  4PD4 E;  1KQS O;  3SWY A;  3N7N A;  2Q7C A;  3KZI H;  1SQB G;  3V4Q A;  3WUV A;  2NPS A;  5AW6 B;  2V7Q H;  1QL2 A;  2WIT A;  1ZR4 A;  2Y0E A;  1N86 A;  1L0N G;  2KSE A;  2YMK A;  3G9R A;  1H88 A;  4JPZ B;  1KIL C;  1KD1 Q;  3CC2 P;  4UB8 E;  2PP6 A;  3VMZ A;  2MKV A;  5BU5 A;  2FFD B;  1VL2 A;  3L75 G;  4IL6 X;  1JCC A;  2RH0 A;  1HBW A;  3G6E P;  1VQ4 P;  2I1K A;  5C39 A;  1EZV I;  2R3C A;  2K3R A;  4U3F G;  3L70 D;  2C9L Y;  3MGN A;  3BCC D;  4I2L C;  2LXB A;  1PP9 D;  2N1T C;  2QJK C;  1SQQ K;  3H1K D;  1M1J A;  5GTH H;  1KB9 D;  3WUT A;  4DCK A;  3OJA B;  5KLV J;  1Q7Y Q;  3AEC C;  1T2K D;  1QLE D;  2LR2 A;  3O6Q B;  2BEQ D;  2KS1 B;  4O9B A;  1N7S C;  5TIS H;  2HPC B;  1RE3 A;  3KHU A;  3P8C E;  3I56 P;  1VPC A;  1G1I A;  2KNC A;  3H1H J;  3T97 B;  2KSJ A;  1WRG A;  2KZJ A;  3GF7 A;  1SQB J;  3H32 A;  1GTW A;  1BGY E;  1JUN A;  2O3J A;  3H1L G;  1AVY A;  2V7Q J;  3H1L J;  5CBO A;  2FXO A;  2YO3 A;  3M9H A;  3PH0 A;  4L76 A;  3H1I G;  2FYU D;  1KB9 H;  4UB6 H;  4IL6 E;  1IFN A;  2ZT9 B;  4HH2 A;  1LTT C;  2NPS C;  3EQ2 A;  5K5G B;  3NTN A;  2OYO A;  1N73 C;  2OGU A;  2GUV A;  4RES B;  2BEZ F;  3GLM A;  4N6J A;  2D2C C;  3AEF C;  4NPD A;  2WSE J;  2YXR B;  2OYH B;  3FX0 A;  2AXT E;  5CJ0 A;  2OYI B;  1KYO D;  2P58 A;  5GTI H;  1J1E C;  5CCH D;  1VQM P;  4NPF X;  2W6A A;  4BXL A;  3GMA A;  4M3L A;  3L71 G;  1CI6 B;  2O01 H;  2M5A A;  2XND H;  3TK1 A;  1LNQ A;  2ZYG A;  1GDT A;  3L75 J;  3PLN A;  3VOP A;  1U7J A;  2PGD A;  5CHX A;  4JYC A;  1BCC J;  3P8M C;  4H13 D;  1NKZ B;  5B66 H;  1PGQ A;  4OGQ B;  1J1D B;  1EQ7 A;  2D2C D;  2H89 C;  3GF3 A;  1JTH A;  3M91 A;  3M9B A;  4N78 E;  4U3F D;  5KAF H;  2E74 C;  2P2U A;  1PL5 A;  2E42 A;  3TNU B;  1P84 H;  1PPJ E;  2BCC D;  3V2Q A;  4BRY A;  1CZQ A;  1KC8 Q;  3RK3 B;  2JKV A;  1LJ2 A;  3SWF A;  3Q3D A;  1NTM E;  2E75 B;  1NAF A;  3TGU G;  3LW5 H;  1LTJ B;  1FAV A;  1OX3 A;  2XZR A;  3VMX A;  3M0D A;  1ZN5 A;  3CI9 A;  3B4S A;  1T6A A; 
#chains in the Genus database with same CATH homology
 2MJZ A;  4OH8 B;  3L35 A;  1LTI C;  3TYY A;  3G3Z A;  1RF1 A;  3GHG C;  1JY3 P;  1N73 B;  1L0N K;  1ZV8 A;  1LWU B;  1WT6 A;  2HG5 D;  2A45 I;  2KYV A;  2P7J A;  1IK9 A;  2OYI C;  1NU1 K;  3MD0 A;  4C7R A;  4B86 A;  5AW1 B;  1HWT C;  2FFD C;  2R32 A;  1GW4 A;  5KJ7 C;  3P7K A;  1SP4 A;  3RL0 B;  1G2C A;  1KQL A;  3RL0 D;  1DH3 A;  3PP5 A;  4IFM A;  5APS A;  1JY2 P;  1FDM A;  2HOD B;  2OAR A;  1AFO A;  3A5T A;  4EIJ A;  4GT1 A;  1GL2 A;  1MV8 A;  2OYH C;  1N2D C;  2WWW A;  3HUS C;  1SFC D;  1SLQ A;  1JY3 O;  2P67 A;  5AW0 B;  3VTP C;  1E5W A;  3A3Y B;  3N4X A;  1LGH B;  2Z5H A;  3RL0 C;  1GD2 E;  2HFE D;  4XE5 B;  1DEB A;  1XTG B;  2C0W A;  5AVV B;  1OXZ A;  3BRV B;  4LGD E;  3HD7 A;  3V4W A;  3VP8 A;  3BRT B;  3HE4 B;  1NOH A;  2POH A;  5CMZ A;  4ZKU A;  5AVZ B;  1HTL C;  2PAJ A;  3I5C A;  3CL3 D;  2GM4 A;  3HE5 A;  4W7Y A;  1FJP A;  3VYI A;  3GHG B;  3NFQ A;  3HD7 D;  1GU4 A;  1S9K D;  2NPS D;  3KPE A;  4WB4 A;  1FZC A;  4I1L A;  1RY3 A;  1JOC A;  1MFZ A;  3L37 A;  1L4A C;  4N78 D;  3LID A;  1JY2 N;  4Y99 C;  2I1J A;  2OYH A;  1MUU A;  2HYN A;  2N1T A;  1Z56 A;  1G1J A;  1SFC A;  3KYQ A;  1SQV K;  1GL2 D;  1LTS C;  3M06 A;  2CPS A;  1HVV A;  4C7N A;  1DX7 A;  2WSC H;  3V5B A;  3B5N C;  4WY4 B;  1L0L K;  5AVR B;  2IFM A;  3T97 A;  5CJ4 A;  2Z4E A;  1KIL B;  3M0A A;  2J59 M;  2WSF H;  5APX A;  1IFM A;  4AYC A;  2M8R A;  4N3Y B;  1GU5 A;  3P32 A;  1QL1 A;  5CCH C;  1GK4 A;  2WPQ A;  2A45 H;  3HTK B;  3RK3 D;  1LWU A;  1NHL A;  4I6M C;  3TSI A;  1FZB A;  3UIA A;  3OA7 A;  3U1C A;  1S9K E;  1L4A A;  3HRN A;  3WMM 0;  1NTZ K;  1HJB A;  2C0X A;  3NMD A;  1HGZ A;  3L36 A;  2ZXE B;  1FZG A;  2W6B A;  1LTA C;  2CPB A;  2XV5 A;  3A7O A;  3B5N B;  1SQP K;  2HLO A;  2L5G B;  2O1J A;  2H43 A;  1JY2 O;  1NTM K;  5KJ7 D;  1RF1 C;  2N1T D;  4W7Z A;  3EFG A;  3E1I A;  3II6 A;  2Q9I A;  1NH4 A;  2QM8 A;  5CCH A;  1M1J B;  1CI6 A;  2KB7 P;  3IFM A;  3IR9 A;  2YKQ A;  1IO4 A;  2XNX A;  4GKG A;  1LWU C;  1J1D C;  1FJK A;  3M0D C;  1URQ C;  2WT7 A;  4AQR D;  3RK3 C;  1JTH B;  2YO2 A;  1A02 J;  1FBM A;  2JJL A;  1LTJ A;  5AW8 B;  1N7L A;  1IC2 A;  3H32 B;  3BVH A;  1SQB K;  5APW A;  4AUW A;  5APQ A;  1J2J B;  4JYB A;  2IX7 C;  5CCG C;  4EOT A;  1RF0 A;  3VN0 A;  3MIW A;  3P8C D;  2XU6 A;  2H8P D;  2N9B A;  1JY3 N;  1IFI A;  1IJD B;  2FYZ A;  1HGV A;  2FFD A;  1N7S B;  3CLQ A;  3H6P A;  3VP9 A;  2P1J A;  3B8E B;  2OYI A;  2WTY A;  1IFD A;  1GZL A;  2YKO A;  5APU A;  3VMY A;  5AW2 B;  1ZLL A;  2R5D A;  2N1T B;  3M9Q A;  1RE3 C;  1SFC B;  2NPS B;  1M7L A;  4C46 A;  1URQ D;  5AW4 B;  1FZF A;  2R5B A;  2FXM A;  1LT9 B;  3O8Z A;  4WY4 C;  2HOD A;  4IFF A;  3C9I A;  3HUS B;  2YNY A;  5CCG D;  1GW3 A;  2C9N Y;  2W27 A;  2M3B A;  5BVZ A;  2IFN A;  5AVW B;  1IFJ A;  1FOS F;  1MZ9 A;  1URQ A;  2O1K A;  2H7H A;  1CSB A;  1N73 A;  1FZE A;  1RE4 A;  3KDP B;  1HH0 A;  2KP8 A;  3LIE A;  4Y99 B;  2QM7 A;  1CW5 A;  1JCD A;  3HD7 C;  5AW9 B;  3HD7 B;  3NXS A;  5AVS B;  1H8A A;  2Z5I A;  1KIL D;  2GUS A;  1RF0 C;  2Q3I A;  4W80 A;  4KHX A;  1FZC C;  1JNM A;  1NO4 A;  2XKM A;  5AVT B;  1LTB C;  2FYU K;  5APT A;  1YTZ I;  1YYC A;  3MUD A;  2XDJ A;  3B5N A;  4XA4 A;  2YMY A;  1GL2 B;  1RF1 B;  3OAK A;  1FZA A;  1W2E A;  1LTG C;  3RK2 C;  1FOS E;  3R2P A;  5APY A;  5KTB A;  2HPC A;  2YKP A;  1SFC C;  4DOJ A;  3BAT A;  5AW7 B;  1RE4 C;  1LT9 C;  2ZFC A;  4IFD K;  5AW3 B;  4C7N B;  1GK6 A;  2Q5U A;  3GHG A;  2WSE H;  2JEE A;  5KJ7 A;  5AVQ B;  1X8Y A;  5AW5 B;  3HE5 B;  2IPP A;  3L4F A;  2FKW B;  4GIF A;  3V2N A;  1NTK K;  1NWQ A;  1GL2 C;  3V2R A;  1G2C B;  4DZO A;  1T8Z A;  3B5N D;  2E43 A;  1OWA A;  3V2P A;  1L4A D;  5AVY B;  1JMM A;  1FU1 A;  3TNU A;  1SVF A;  5AVU B;  1KFN A;  3HE4 A;  4HYT B;  3MTU E;  3BAS A;  5BU8 B;  4LC1 A;  4WY4 D;  2KOG A;  2VRS A;  1JO5 A;  2BAS A;  1T3J A;  1H89 A;  2WT7 B;  1KIL A;  2LKM A;  2A45 G;  4JF7 A;  1PFI A;  1NKN A;  1X9V A;  1T3U A;  1LT9 A;  3U1A A;  1HUC A;  1N7S D;  3RK2 B;  1XTC C;  3HUS A;  1A02 F;  1FZC B;  3RK2 D;  1M1J C;  5KLV K;  5APV A;  1ZR2 A;  1VDF A;  3KQG A;  4WBA A;  1L4A B;  1KZU B;  1YTZ T;  1J1E B;  1URQ B;  4LLH A;  1T2K C;  3A2A A;  3HTK A;  1LTJ C;  2WPS A;  1X79 B;  1N7S A;  2WZ7 A;  2KLV A;  5CCG A;  1SQX K;  3U59 A;  5AVX B;  2J58 A;  4ZKP A;  1AQ5 A;  1KFM A;  2WPR A;  4WY4 A;  3SWY A;  3N7N A;  2Q7C A;  3V4Q A;  2NPS A;  5AW6 B;  1QL2 A;  2WIT A;  1ZR4 A;  1N86 A;  1H88 A;  1KIL C;  2PP6 A;  3VMZ A;  5BU5 A;  2FFD B;  1JCC A;  1HBW A;  2I1K A;  2R3C A;  2C9L Y;  3MGN A;  4I2L C;  2N1T C;  1SQQ K;  1M1J A;  3OJA B;  1T2K D;  4O9B A;  1N7S C;  2HPC B;  1RE3 A;  3P8C E;  1VPC A;  1G1I A;  2KSJ A;  1WRG A;  3H32 A;  1GTW A;  1JUN A;  2YO3 A;  3M9H A;  1IFN A;  4HH2 A;  1LTT C;  2NPS C;  3EQ2 A;  3NTN A;  1N73 C;  2GUV A;  4RES B;  4N6J A;  2OYH B;  2OYI B;  5CJ0 A;  1J1E C;  5CCH D;  2W6A A;  4M3L A;  3TK1 A;  1CI6 B;  2O01 H;  1GDT A;  3VOP A;  5CHX A;  4JYC A;  3P8M C;  1NKZ B;  1J1D B;  1EQ7 A;  3M91 A;  3M9B A;  1JTH A;  4N78 E;  2P2U A;  2E42 A;  3TNU B;  3V2Q A;  1CZQ A;  3RK3 B;  3SWF A;  3VMX A;  1NAF A;  3LW5 H;  1LTJ B;  1FAV A;  2XZR A;  3M0D A;  1ZN5 A;  3CI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...