2R3CA

Structure of the gp41 n-peptide in complex with the hiv entry inhibitor pie1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent D-peptide inhibitors of HIV-1 entry
pubmed doi rcsb
molecule tags Viral protein/viral protein inhibitor
molecule keywords gp41 N-peptide
total genus 20
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r3cA00
2W27A 3LIDA 1FAVA 2WTYA 2P2UA 3L35A 1G2CB 2QM8A 1S9KE 1OXZA 1DH3A 4AUWA 3NTNA 3TYYA 1GK4A 3HE5A 2R3CA 1IO4A 1GD2E 2E42A 4EOTA 1A02F 2XV5A 2WPQA 4GT1A 1MV8A 1MUUA 4HYTB 5AVYB 5APQA 5APUA 1FOSF 2IPPA 1FOSE 5AW0B 5AW5B 3TNUB 2WPSA 2W6AA 3B8EB 1GU4A 5CMZA 2C9NY 1KQLA 4M3LA 1H8AA 2YNYA 3KQGA 3NXSA 4AQRD 5AVWB 3T97A 5AVZB 3V5BA 2WPRA 1HWTC 3P32A 3UIAA 4C7NA 3P7KA 3VTPC 3VN0A 3M9HA 2Q7CA 2ZXEB 4KHXA 1GK6A 1OWAA 4JYCA 1JNMA 3LIEA 3TNUA 4LC1A 4RESB 2P7JA 2WT7A 4DZOA 5AW7B 3A7OA 2R32A 2N9BA 5AW9B 1SLQA 1H88A 3HTKA 1JUNA 5APVA 3IR9A 5AW8B 3L37A 2R5BA 5APWA 3HE5B 3M9BA 2XU6A 3O8ZA 3OAKA 1J2JB 1SP4A 4I2LC 1CSBA 3M06A 4JYBA 2H7HA 2JJLA 2ZFCA 2BASA 2YO3A 1CI6A 3KDPB 5AVSB 1MFZA 3VYIA 3V4WA 3A2AA 4AYCA 2YO2A 1HJBA 3M0DA 1NWQA 2R5DA 5APXA 1HBWA 2Z5HA 2P67A 5AW3B 3NMDA 3P8MC 3VMZA 1T2KC 2WT7B 5APYA 1T2KD 1CZQA 2QM7A 3L36A 3VMXA 1GU5A 3MD0A 3HE4A 3I5CA 2XZRA 3A3YB 4XE5B 5AVUB 5AVTB 2Q5UA 5APSA 3A5TA 2KP8A 5AW2B 3V4QA 1X8YA 4GKGA 5AVVB 5APTA 5AVRB 1HUCA 4C46A 3M91A 1H89A 5AVQB 5AW6B 1GTWA 2E43A 3NFQA 2WWWA 5AW4B 3TK1A 3VMYA 1S9KD 3M0AA 1CI6B 2C9LY 4B86A 3HE4B 1YYCA 2Q3IA 2Z5IA 5AW1B 1A02J 4I6MC 2VRSA 3MGNA 4C7NB 3SWFA 1GZLA 5AVXB 1NAFA
chains in the Genus database with same CATH superfamily
1AA0A 1PP9J 1IZNB 1ZRTD 1AV1A 1NTZD 2KS1B 1T8ZA 4C7RA 1L4AB 2QJPB 1RH5B 2K3RA 1BE3E 2RN0A 4DJGA 1NTMK 3CC4P 2KS1A 2WPVB 3NTNA 4RO0A 1GK4A 5H2FE 3TYYA 3HE5A 2OYHC 1FDOA 1NAYA 3L72E 2HPCB 2B88A 3TGUJ 2M5AA 2CPBA 1XTGB 4Y99C 3Q5RA 1JCDA 3WMM0 3MZWB 3JSVC 5K5GB 2ITAA 1SQQD 1M57D 3V2NA 4WBAA 1BGYG 1JO5A 2YKQA 2M5AB 1S5LH 1MV8A 1MUUA 2RH0A 2H89C 4HYTB 3SFDC 1GL2D 2AEMA 2PRRA 3GMAA 2B87A 3A0BH 3MP7B 4JF7A 4U3FD 5TJHA 3K5BA 3H1KJ 1VF5C 5AW5B 1S1CX 1IFMA 2W6AA 2LXBA 2Y0DA 3B8EB 2OTJP 5CCGD 3EFFK 1X22A 2ZAEB 1H8AA 1L4AC 1OIPA 1FS0E 4N78D 1MKMA 2IFMA 1M1JA 3G3ZA 5CCHC 1LTJA 3AE3C 2KI7B 2NZ2A 1KV4A 1ZP0C 3SWYA 3PRJA 2HODA 2P58A 2WPRA 1PV3A 1NTKG 1FC2C 3S1KA 1Q90D 3UIAA 3VMAA 1K04A 3P7KA 2MJZA 1T3JA 2SPZA 3WU2H 1IFIA 1NTMD 3FWNA 4YXWH 1JY3P 3PP5A 2Q7CA 1JMBA 2JO1A 4KHXA 4L73A 3G4SP 3RK2B 4PV1C 2HYNA 1IFNA 3CL3D 4PV1D 1JNMA 2Q3EA 2J5UA 2OQQA 4Y99B 2OYIB 1KORA 2P7JA 2I8DA 3L74G 1N73A 1SQQK 2JWAA 3HTKB 4DZOA 5AW7B 2R32A 4PV1B 1S3JA 4NPDA 3L70G 1SLQA 1RF0A 3HTKA 5CBNA 3AE7C 3IR9A 1YTZI 3GW6A 3RK3B 1KQSO 1YJNP 2NRGA 2R5BA 4OGQD 2QG4A 3QWOC 1QEXA 2R44A 1G1IA 2HODB 2XU6A 1NTKK 1P84D 2K88A 3JCUH 3OAKA 2K9JA 2LR2A 3D6ZA 2Y9ZA 3CMAP 2FFDA 1CSBA 2WZ7A 3GHGC 3M06A 4IL6X 3CWBJ 2N1TB 2ZFCA 3V2RA 1M1JC 5CCHA 1LTJC 3EQ2A 3VYIA 3V4WA 2OYIC 2E74D 3BATA 2OYOA 2KNCA 1HJBA 2RKLA 3M0DA 2C0XA 5APXA 3MIWA 3CI9A 3RK2C 2N1TC 3BCCE 1G2CA 3VMZA 3VP8A 1SFCA 3CLQA 4D6TD 2ZT9D 2M3BA 3TGUG 2FKWB 4WY4A 3Q2YA 2FYUK 1SVFA 1VDFA 3MD0A 1N73B 1FZCA 5AVTB 1BGYJ 1JM0A 1FDIA 1IFDA 2KZJA 5KAIE 3H32B 3KZIE 2IX7C 1N7SD 2ZVNB 2BEQD 3V4QA 1X8YA 2C0WA 4YTPC 5KLIB 1L0LG 4GKGA 1EXJA 1VQ4P 1P84I 3L72G 1N73C 3AE1C 4W80A 4Z1MH 1VQOP 1H89A 4OGQB 1AVYA 4TT3H 2WWWA 1PGQA 5AW4B 1FDMA 1S9KD 3BRVB 1X9VA 3L74D 2L91A 1M90Q 2WQYC 4H13B 2K9JB 3HUSA 3CX5E 1LTJB 1JTHB 4RJTA 1KZUB 5KLVJ 1LWUC 3V6IA 3CCEP 4K3AA 5E79H 1GZLA 2NPSB 2KXPB 1Y47A 3KYQA 2IBZI 4YPCA 1LTSC 1PZQA 2W27A 2QRXA 2KUBA 4ZKPA 2WTYA 1EDLA 1AVOA 1G2CB 1S9KE 1OX3A 1WRGA 3Q5SA 3OA7A 3W67A 1FJPA 3AEBC 3L74J 5C39A 3CCLP 1IK9A 2KYVA 1JY2O 2FYZA 5EFWB 4ASVA 1GMJA 1NTME 4GOFA 4IL6E 3VP9A 1EDIA 3H32A 3L75J 1JB0J 2YXRB 1XTCC 2XV5A 4U7JA 5GTHE 1GL2C 1LWUB 1SQPK 4UB8E 5AVYB 3A0HH 5APQA 4BRYA 4YXDC 3O6QA 4H44B 1LNQA 1L4AD 3B5NB 2IPPA 4DOJA 1JCCA 1FOSE 1BGYD 1KB9H 2CPSA 4H13D 3H1JE 3MTUE 1SQBK 5CMZA 2V4HA 1EZVI 1URQC 2C9NY 1GDTA 3C1LA 5KJ7C 2IBZE 1ZW0A 2K9YA 3FXDA 3E1RA 1NU1J 3HUSB 3RK2D 2QJYC 2ZYAA 2D2CC 3GF3A 1QL1A 4AQRD 5CCGA 5KKZB 1SQBG 1AJYA 4UB8H 2WVRA 4Y28J 2D2CD 3H1HG 2NPSC 2O1JA 3RL0D 3H25A 1NKNA 1Q82Q 1HWTC 2KNCB 1WT6A 1EQ7A 1NVOA 1NTZK 3B5ND 1W2BO 2K1AA 1LTGC 3VTPC 1RHZB 1L0NK 3AE9C 2IZ1A 3CCRP 2FBWC 3M9HA 4I1LA 3GLMA 3EWKA 1N7LA 2E75B 1PIXA 2QE7H 1LTIC 5KAIH 1KN7A 4KJMA 1ZRTE 3CC7P 1BCCE 1L0LJ 3C8VA 1NHLA 1SS1A 3L72J 2P10A 3LIEA 4LC1A 1L0LK 1J1DC 4RESB 3TNUA 5BU8B 2E5YA 1KB9D 1OMIA 3H1IE 1GL2B 2R3SA 3A7OA 2BCCJ 1LWUA 1M56D 1RE4C 4BRYB 1H88A 3CD6P 1VPCA 2Z4EA 3AE8C 5AW8B 3S9OA 3L37A 5KLVG 2E5TA 3BCCD 1LGHB 3CX5H 3KXDA 1JY2P 3M9BA 1K05A 1BCCD 3O8ZA 2ZXXA 5KJ7D 1SP4A 1BGYE 1EC5A 2D2CB 2H7HA 1KILC 1RF1B 2I1JA 3E7KA 2N9YB 1H0TB 2YO3A 1DX7A 1HH0A 1LT1A 3CCMP 4HB1A 1L2PA 4WVZA 1J1DB 4GIFA 2WMMA 1VQMP 1SQXD 2W8ZA 2RMZA 3D6YA 1USDA 1HBWA 1YQ4C 2Y9YA 2P67A 5AW3B 5GTIE 1LT9C 4I7ZB 3NMDA 3P8MC 1T2KC 1Q86Q 1U7JA 4JBZA 1K73Q 4IL6H 1T2KD 1HJ0A 1CZQA 1PGJA 1W5CE 2FY8A 2QM7A 3L36A 3HE4A 2P1JA 3L74E 4JPZB 2IYOA 4O9BA 4XE5B 2Q6QA 1PL5A 3M9QA 2Q5UA 2ZJSE 3CX5D 3PLNA 4WB4A 5AVUB 3A5TA 1EZVE 1YQ3C 3TSIA 1ZXGA 2OYHB 4OH8B 3ABVC 1IJDB 3GG2A 3E1IA 5CCGC 5AVVB 3KPEA 1YJ9P 1SQXE 1IK7A 4PJ0H 5AVRB 5GTIH 1VF5D 1HUCA 2QJPC 3HD7A 1KB9E 3IFMA 5AW6B 4DCKA 1LTBC 1NO4A 3HD7D 3WUUA 1MZ9A 3KHUA 3BCCJ 2E75D 2B89A 1NU1G 1OVVA 1USEA 1E5WA 3B5NC 3VMYA 3CCUP 4PD4H 1JY3O 1SQBJ 1VF5B 3L71J 3M0AA 4WY4B 1NTKE 2WITA 3H1HJ 2QEXP 1RF1C 2C9LY 3PH0A 2O1KA 1NGMB 3SSUA 1NTZJ 5CJ0A 3JCUE 1PPJE 1A02J 4I6MC 1JY3N 1QGKB 3H6PA 1RF0C 2WSFH 3MGNA 1PP9D 3IAOA 4PJ0E 5CJ4A 1NOHA 2W6BA 1BCCG 2OTKE 1T3UA 1R5SA 1KYOI 2FYNC 4QMAA 1RQUA 4OGQC 3LIDA 1Y9BA 1JEKA 3PTZA 1URQB 3L35A 1K8AQ 1ZMEC 1RE4A 2O3JA 2QM8A 2WSFJ 4N3YB 1OFCX 1OW8A 3AE6C 3FXEA 3A0BE 1ZR4A 4D6TG 3RBZA 4AUWA 2FYNB 2Q9IA 1IO4A 2BCCG 2JDIH 2KOGA 3AE4C 1QVGO 4BXLA 3M0DC 1JMMA 1KQGB 4PD4I 3RL0C 1A02F 1ZLLA 2N1TA 1LTTC 2WPQA 4CPGA 1BE3G 5CCHD 1EZVD 1M1KQ 1HVVA 2OARA 3KZIH 3TF5A 2E74C 3BASA 1S72P 2M8RA 3CXHI 2J59M 4HH2A 5DJTB 4WY4C 5APUA 3HD7C 1VL2A 1AQ5A 2A45I 2KB7P 3CXHH 5AW0B 3CX5I 1FZFA 1KMIZ 3H1LD 3RK3C 1FZAA 1GW3A 3AECC 3GHGA 1EDKA 1KYOH 2XNDH 4DT0A 4M3LA 1N8RQ 1AFOA 2YNYA 4HJGH 3KQGA 1YBKA 3PJSK 2WSSH 1RF1A 1H0TA 2NPSD 2IYPA 2M3EA 5AVWB 3T97A 1NTKD 3W68A 2OYIA 3V5BA 3CMEP 1BSHA 2JKVA 2W83C 4IOIH 2K37A 3CXHD 4N6JA 4U3FG 4C7NA 3CCSP 3BVHA 1R5LA 4UB6E 3CCJP 4ASWA 2JP3A 2Q1KA 1VQ6P 2YMKA 2M0BA 1KYOE 1OVUA 2MKVA 4PD4D 2A06G 1KFNA 2ZXEB 3VN0A 1QL2A 4EDFA 3U1CA 1D7MA 3CCVP 3CC2P 2A06D 1RE3C 2KZIA 3B71A 1DEEG 1NU1E 4JYCA 3IN6A 2QJKB 1SQVK 1KQFB 2Y0CA 3RL0B 3N4XA 4ZMDA 1L0ND 2G3AA 1SQVJ 1QLED 2QIWA 1N7SB 4D6TE 3BCCG 1OW7A 1NYHA 3I55P 2GUVA 1SFCB 1SQXJ 2N9BA 1SQPE 4ZNCA 1Q81Q 1J1EC 3L73G 1JUNA 3N7NA 2YKPA 3GHGB 3L71G 4PD4E 5APVA 5B66H 1KTMA 1JY2N 4L75A 2HR3A 4NPEA 1GU4A 2H8PD 1NTZG 3AEFC 3OJAB 4WWIA 3HE5B 3HUSC 5APWA 5L8RJ 2IFNA 3L71E 2FXPA 5KKZC 1J2JB 1J1EB 4H0LD 1BCCJ 1WMKA 4LGDE 3P8CD 4H0LC 4NPFX 3IF4A 4L76A 1CI6A 1EDJA 3KDPB 1NKZB 1MFZA 4RKUJ 3SWKA 1QX8A 1SQPD 3Q5PA 3BRTB 1NTZE 1SQQG 2YKOA 2B87B 4AYCA 1KC8Q 2BCCD 1DD4A 1NWQA 2R5DA 1HGVA 1URQA 2FYUE 2JR8A 2Y0EA 1IFJA 1PPJD 3HRNA 1JTHA 2B9BA 4JQ0D 1SQPG 1URQD 5KLVK 1S4XA 3L72D 5APYA 3RK3E 1L0LD 1SFCD 3PHLA 1N86A 2AEJA 4GODA 1QVFO 1VQ9P 2NPSA 3H1IJ 3I5CA 3A3YB 1BDCA 2V7QH 1SQVD 3CPWO 1BE3J 5APSA 1RE3A 2LXCB 1S5LE 5AW2B 1VQPP 2KSJA 5CHXA 1AQTA 1N7SA 1BSNA 2IDBA 4OWFA 4TLFA 2CK3H 2BCCE 2POHA 1VQ8P 1UIXA 3CXHE 4H13C 3M91A 4C46A 2E43A 2ZT9C 3R4YA 2JWDA 3FGAD 2KSEA 4GOEA 3L73D 5TISH 1X0TA 2E76C 4XA4A 4BWNA 2OYHA 2XDJA 3G6EP 5KAFH 4GDOA 3TK1A 1FZBA 1KYOD 3I56P 1YIJP 1LJ2A 1CI6B 1NU1D 2YXQB 1L0NG 2FYUJ 3HE4B 1ZOYC 1OW6A 3F5HA 1YYCA 3L75E 1DEBA 4OVNF 3WUTA 3T97B 2A06E 1YI2P 3MUDA 3U1AA 1UIIA 2PFXA 1FJKA 3AE2C 2G8YA 2VRSA 2J58A 4UB6H 1GU5A 2FFDC 4C7NB 3SWFA 1HTLC 2QVAA 4R4MA 5TISE 1FZCB 2FFDB 1KD1Q 3RBXA 4EIJA 1NAFA 1YJWP 5KAFE 1ZR2A 3B4SA 5KLIC 1FAVA 1KB9I 1G1JA 2XKMA 2A45H 2HLOA 2P2UA 3Q1MA 3H1KE 4W7ZA 1OXZA 3L70E 5M1BA 1ZN5A 2FYUD 2O01J 1SFCC 1GW4A 1SQVG 2AEFA 2FXOA 2PAJA 2YIUB 3H1LE 2KIKA 5E79E 1VQLP 2R3CA 3AEGC 1U7MA 1MFTA 1SQXG 3ITKA 4EI2A 1LP1B 2GUSA 1YTZT 1LT9B 2N1TD 3L73J 3LW5H 2W6JH 4I7ZC 3S4RA 3AEAC 3H1LG 4EOTA 2E42A 1ZV8A 2L5GB 5B66E 3Q3DA 4GT1A 1LT9A 1SQXK 1BDDA 2O01H 4IFDK 1N7SC 2DW3A 2AXTE 1JOCA 1SQBE 1NJIQ 3II6A 3WUVA 2E76B 4EYYQ 5BU5A 1FOSF 1NH4A 1FE6A 1PGPA 1NTMG 1BE3D 3FX0A 1L0LE 3H1KD 3LW5J 3RK3D 4IFFA 3TNUB 1KILD 2WPSA 3H1ID 3OW2O 5KLVD 1Q2NA 1KQLA 1KILA 2PGDA 4HKZH 3CCQP 1N2DC 3NXSA 2A45G 1Q7YQ 4ZKUA 1SQQJ 3AEEC 2QA4P 1GD2E 1KILB 1M7LA 3L75D 5AVZB 1SQVE 3A0HE 3TGUD 2AXTH 1FZCC 1L0NE 2IBZG 3L75G 3P32A 4H44D 2H43A 3H1HD 1S2EA 1SQPJ 3H1JG 1SQBD 2HG5D 3G9RA 3L71D 3B5NA 3L73E 1PP9E 3O6QB 1X79B 2E74B 1VQKP 1FZGA 1RY3A 3H1IG 3HD7B 5BVZA 1IFPA 2KLUA 1LP1A 1GK6A 1OVRA 3RGUA 1PP9G 2I1KA 3USSA 1CW5A 3R2PA 1OWAA 2OGUA 2ZT9B 4MN4C 3TGUE 1HF9A 3P8CE 2WT7A 2QSIA 2WSEH 3V2QA 2V7QJ 1VQ5P 1Y8AA 3H1JD 3G71P 3MUDC 3GF7A 2GM4A 1TU3F 2IBZD 5AW9B 1E79H 4XFJA 2UWJE 1L0NJ 2FYUG 3AE5C 3L70D 3VOPA 1DD3A 2WSEJ 2QJYB 3CWBD 3TDKA 1PGOA 3L4FA 4W7YA 2H88C 1T6AA 4K35A 4I2LC 4JYBA 3H1KG 2JJLA 3FWLA 3MHVA 5KJ7A 3D71A 2QJKC 2BASA 1PFIA 2OTLP 4R4LA 3SFEC 1IC2A 5AVSB 1VQ7P 1HGZA 1FBMA 3JC22 2ZVOB 1LTAC 2O01N 3A2AA 2HFED 3C9IA 2KK7A 5B5EH 2YO2A 1S5LX 1EZVG 1NTKJ 2Z5HA 3H1HE 3D70A 2E76D 1GL2A 2E75C 1L4AA 4LLHA 3WU2E 2AXCA 1OZHA 2WT7B 4U3FE 3VMXA 3H1LJ 4D6TJ 2WSCH 1FU1A 2XZRA 4WY4D 5KLVE 1YHQP 1U57A 5GTHH 2YIUC 2HPCA 1DH3A 2KP8A 5B5EE 3RL0g 4A7PA 2LKMA 2W90A 5KTBA 1NTMJ 2YMYA 1P84E 1RQVA 1R8EA 1VQNP 2BEZF 2PP6A 4KT0J 5APTA 5AVQB 2WSCJ 1GTWA 2ZYDA 3V2PA 1FZEA 3EFGA 3NFQA 1KFMA 1DIPA 2KLVA 4H44C 4N78E 5CBOA 2FXMA 3F89A 3L70J 1PPJG 3ZDMA 2ZYGA 1K9MQ 4IFMA 4B86A 4H0LB 1YITP 1Z56A 5DJUB 2Q3IA 2Z5IA 1M1JB 2GA1A 3CWBE 5AW1B 3H1JJ 1P84H 4L74A 4U3FJ 1EXIA 3AEDC 5H2FH 2XNXA 3QH9A 2JEEA 1W2EA 1KILE 5AVXB 1M8OB 3U59A 2IZ0A 1SQQE 3CWBG 1NU1K
chains in the Genus database with same CATH topology
1T8ZA 4C7RA 1L4AB 1NTMK 3NTNA 3TYYA 1GK4A 3HE5A 2OYHC 2HPCB 2CPBA 1XTGB 4Y99C 1JCDA 3WMM0 2GM4A 3V2NA 1JO5A 4WBAA 2YKQA 1MV8A 1MUUA 4HYTB 1GL2D 4JF7A 5AW5B 1IFMA 2W6AA 3B8EB 5CCGD 1H8AA 1L4AC 4N78D 2IFMA 1M1JA 3G3ZA 5CCHC 1LTJA 3SWYA 2HODA 2WPRA 3UIAA 3P7KA 2MJZA 1T3JA 1IFIA 1JY3P 3PP5A 2Q7CA 4KHXA 3RK2B 2HYNA 1IFNA 3CL3D 1JNMA 2OYIB 4Y99B 2P7JA 1N73A 1SQQK 3HTKB 4DZOA 5AW7B 2R32A 1SLQA 1RF0A 3HTKA 3IR9A 1YTZI 3RK3B 2R5BA 1G1IA 2HODB 2XU6A 1NTKK 3OAKA 2FFDA 1CSBA 2WZ7A 3GHGC 3M06A 3V2RA 2N1TB 2ZFCA 1M1JC 5CCHA 1LTJC 3EQ2A 3VYIA 3V4WA 2OYIC 3BATA 1HJBA 3M0DA 2C0XA 5APXA 3MIWA 3CI9A 3RK2C 2N1TC 1G2CA 3VMZA 3VP8A 1SFCA 3CLQA 2M3BA 2FKWB 4WY4A 1N73B 2FYUK 1SVFA 1VDFA 3MD0A 1FZCA 5AVTB 1IFDA 3H32B 2IX7C 1N7SD 3V4QA 1X8YA 2C0WA 4GKGA 1N73C 4W80A 1H89A 2WWWA 5AW4B 1FDMA 1S9KD 3BRVB 1X9VA 3HUSA 1LTJB 1JTHB 1KZUB 1LWUC 1GZLA 2NPSB 3KYQA 1LTSC 2W27A 4ZKPA 2WTYA 1G2CB 1S9KE 1WRGA 3OA7A 1FJPA 1IK9A 2KYVA 1JY2O 2FYZA 3VP9A 3H32A 1XTCC 2XV5A 1GL2C 1LWUB 1SQPK 5AVYB 5APQA 1L4AD 3B5NB 2IPPA 4DOJA 1JCCA 1FOSE 2CPSA 3MTUE 1SQBK 5CMZA 2C9NY 1URQC 5KJ7C 3HUSB 3RK2D 5CCGA 4AQRD 1QL1A 2NPSC 2O1JA 3RL0D 1HWTC 1NKNA 3B5ND 1WT6A 1EQ7A 1NTZK 1LTGC 3VTPC 1L0NK 3M9HA 4I1LA 1N7LA 1LTIC 1NHLA 3LIEA 3TNUA 4LC1A 1L0LK 1J1DC 4RESB 5BU8B 1GL2B 3A7OA 1LWUA 1RE4C 1H88A 1VPCA 2Z4EA 5AW8B 3L37A 1LGHB 1JY2P 3M9BA 3O8ZA 5KJ7D 1SP4A 2H7HA 1KILC 1RF1B 2I1JA 2YO3A 1DX7A 1HH0A 1J1DB 4GIFA 1HBWA 2P67A 5AW3B 1LT9C 3NMDA 3P8MC 1T2KC 1T2KD 1CZQA 3L36A 2QM7A 4O9BA 1GU5A 2OYHA 3HE4A 2P1JA 4XE5B 4WB4A 5AVUB 3M9QA 2Q5UA 3A5TA 3TSIA 2OYHB 4OH8B 1IJDB 3E1IA 5CCGC 5AVVB 3KPEA 5AVRB 3HD7A 1HUCA 3IFMA 5AW6B 1LTBC 1NO4A 3HD7D 1MZ9A 1E5WA 3B5NC 3VMYA 1JY3O 1RF1C 3M0AA 4WY4B 2C9LY 2WITA 2O1KA 5CJ0A 1A02J 4I6MC 1JY3N 3MGNA 3H6PA 1RF0C 2WSFH 5CJ4A 1NOHA 2W6BA 1T3UA 3LIDA 1URQB 3L35A 1RE4A 2QM8A 4N3YB 1ZR4A 4AUWA 2Q9IA 1IO4A 2KOGA 3M0DC 1JMMA 3RL0C 1A02F 1ZLLA 2N1TA 1LTTC 2WPQA 5CCHD 1HVVA 2OARA 3BASA 2M8RA 4HH2A 2J59M 1AQ5A 4WY4C 5APUA 3HD7C 2A45I 2KB7P 5AW0B 1FZFA 1GU4A 3RK3C 1FZAA 1GW3A 3GHGA 4M3LA 1AFOA 2YNYA 1RF1A 3KQGA 2NPSD 5AVWB 3T97A 2OYIA 3V5BA 4N6JA 4C7NA 3BVHA 3VN0A 2FFDB 1KFNA 2ZXEB 3U1CA 1QL2A 1RE3C 3RL0B 4JYCA 1SQVK 3N4XA 1N7SB 2GUVA 1SFCB 2N9BA 1J1EC 1JUNA 3N7NA 2YKPA 3GHGB 5APVA 1JY2N 2H8PD 5APWA 3OJAB 3HE5B 3HUSC 2IFNA 1J2JB 1J1EB 4LGDE 3P8CD 1CI6A 3KDPB 1NKZB 1MFZA 3BRTB 2YKOA 4AYCA 1NWQA 2R5DA 1HGVA 1URQA 3HRNA 1GDTA 1IFJA 1JTHA 1URQD 5KLVK 5APYA 1SFCD 1N86A 2NPSA 3I5CA 3A3YB 5APSA 1RE3A 5AW2B 2KSJA 5CHXA 1N7SA 2POHA 4C46A 3M91A 2E43A 4XA4A 2XDJA 3TK1A 1FZBA 1CI6B 3HE4B 1YYCA 1DEBA 3MUDA 3U1AA 1FJKA 2FFDC 2VRSA 2J58A 4C7NB 3SWFA 1HTLC 1FZCB 4EIJA 1NAFA 1ZR2A 1FAVA 2XKMA 1G1JA 2A45H 2HLOA 2P2UA 4W7ZA 1OXZA 1ZN5A 1DH3A 1SFCC 1GW4A 2PAJA 2R3CA 2GUSA 1YTZT 1LT9B 2N1TD 3LW5H 4EOTA 1GD2E 2E42A 1ZV8A 2L5GB 4GT1A 1LT9A 1SQXK 2O01H 4IFDK 1N7SC 1JOCA 3II6A 5BU5A 1FOSF 1NH4A 3RK3D 4IFFA 3TNUB 1KILD 2WPSA 1KQLA 1KILA 1N2DC 3NXSA 2A45G 4ZKUA 1KILB 1M7LA 5AVZB 1FZCC 3P32A 2H43A 2HG5D 3B5NA 1X79B 1FZGA 1RY3A 3HD7B 5BVZA 1GK6A 2I1KA 1CW5A 3R2PA 1OWAA 3P8CE 2WT7A 2WSEH 3V2QA 5AW9B 3VOPA 3L4FA 4W7YA 4I2LC 4JYBA 2JJLA 5KJ7A 2BASA 1PFIA 1IC2A 5AVSB 1HGZA 1FBMA 1LTAC 3A2AA 2HFED 3C9IA 2YO2A 2Z5HA 1GL2A 1L4AA 4LLHA 2WT7B 3VMXA 2WSCH 1FU1A 2XZRA 4WY4D 2HPCA 2KP8A 2LKMA 5KTBA 2YMYA 2PP6A 5APTA 5AVQB 1GTWA 3V2PA 1FZEA 3EFGA 3NFQA 1KFMA 2KLVA 4N78E 2FXMA 4IFMA 4B86A 1Z56A 2Q3IA 2Z5IA 1M1JB 5AW1B 2XNXA 2JEEA 1W2EA 5AVXB 3U59A 1NU1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W27 A;  3LID A;  1FAV A;  2WTY A;  2P2U A;  3L35 A;  1G2C B;  2QM8 A;  1S9K E;  1OXZ A;  1DH3 A;  4AUW A;  3NTN A;  3TYY A;  1GK4 A;  3HE5 A;  2R3C A;  1IO4 A;  1GD2 E;  2E42 A;  4EOT A;  1A02 F;  2XV5 A;  2WPQ A;  4GT1 A;  1MV8 A;  1MUU A;  4HYT B;  5AVY B;  5APQ A;  5APU A;  1FOS F;  2IPP A;  1FOS E;  5AW0 B;  5AW5 B;  3TNU B;  2WPS A;  2W6A A;  3B8E B;  1GU4 A;  5CMZ A;  2C9N Y;  1KQL A;  4M3L A;  1H8A A;  2YNY A;  3KQG A;  3NXS A;  4AQR D;  5AVW B;  3T97 A;  5AVZ B;  3V5B A;  2WPR A;  1HWT C;  3P32 A;  3UIA A;  4C7N A;  3P7K A;  3VTP C;  3VN0 A;  3M9H A;  2Q7C A;  2ZXE B;  4KHX A;  1GK6 A;  1OWA A;  4JYC A;  1JNM A;  3LIE A;  3TNU A;  4LC1 A;  4RES B;  2P7J A;  2WT7 A;  4DZO A;  5AW7 B;  3A7O A;  2R32 A;  2N9B A;  5AW9 B;  1SLQ A;  1H88 A;  3HTK A;  1JUN A;  5APV A;  3IR9 A;  5AW8 B;  3L37 A;  2R5B A;  5APW A;  3HE5 B;  3M9B A;  2XU6 A;  3O8Z A;  3OAK A;  1J2J B;  1SP4 A;  4I2L C;  1CSB A;  3M06 A;  4JYB A;  2H7H A;  2JJL A;  2ZFC A;  2BAS A;  2YO3 A;  1CI6 A;  3KDP B;  5AVS B;  1MFZ A;  3VYI A;  3V4W A;  3A2A A;  4AYC A;  2YO2 A;  1HJB A;  3M0D A;  1NWQ A;  2R5D A;  5APX A;  1HBW A;  2Z5H A;  2P67 A;  5AW3 B;  3NMD A;  3P8M C;  3VMZ A;  1T2K C;  2WT7 B;  5APY A;  1T2K D;  1CZQ A;  2QM7 A;  3L36 A;  3VMX A;  1GU5 A;  3MD0 A;  3HE4 A;  3I5C A;  2XZR A;  3A3Y B;  4XE5 B;  5AVU B;  5AVT B;  2Q5U A;  5APS A;  3A5T A;  2KP8 A;  5AW2 B;  3V4Q A;  1X8Y A;  4GKG A;  5AVV B;  5APT A;  5AVR B;  1HUC A;  4C46 A;  3M91 A;  1H89 A;  5AVQ B;  5AW6 B;  1GTW A;  2E43 A;  3NFQ A;  2WWW A;  5AW4 B;  3TK1 A;  3VMY A;  1S9K D;  3M0A A;  1CI6 B;  2C9L Y;  4B86 A;  3HE4 B;  1YYC A;  2Q3I A;  2Z5I A;  5AW1 B;  1A02 J;  4I6M C;  2VRS A;  3MGN A;  4C7N B;  3SWF A;  1GZL A;  5AVX B;  1NAF A; 
#chains in the Genus database with same CATH topology
 1AA0 A;  1PP9 J;  1IZN B;  1ZRT D;  1AV1 A;  1NTZ D;  2KS1 B;  1T8Z A;  4C7R A;  1L4A B;  2QJP B;  1RH5 B;  2K3R A;  1BE3 E;  2RN0 A;  4DJG A;  1NTM K;  3CC4 P;  2KS1 A;  2WPV B;  3NTN A;  4RO0 A;  1GK4 A;  5H2F E;  3TYY A;  3HE5 A;  2OYH C;  1FDO A;  1NAY A;  3L72 E;  2HPC B;  2B88 A;  3TGU J;  2M5A A;  2CPB A;  1XTG B;  4Y99 C;  3Q5R A;  1JCD A;  3WMM 0;  3MZW B;  3JSV C;  5K5G B;  2ITA A;  1SQQ D;  1M57 D;  3V2N A;  4WBA A;  1BGY G;  1JO5 A;  2YKQ A;  2M5A B;  1S5L H;  1MV8 A;  1MUU A;  2RH0 A;  2H89 C;  4HYT B;  3SFD C;  1GL2 D;  2AEM A;  2PRR A;  3GMA A;  2B87 A;  3A0B H;  3MP7 B;  4JF7 A;  4U3F D;  5TJH A;  3K5B A;  3H1K J;  1VF5 C;  5AW5 B;  1S1C X;  1IFM A;  2W6A A;  2LXB A;  2Y0D A;  3B8E B;  2OTJ P;  5CCG D;  3EFF K;  1X22 A;  2ZAE B;  1H8A A;  1L4A C;  1OIP A;  1FS0 E;  4N78 D;  1MKM A;  2IFM A;  1M1J A;  3G3Z A;  5CCH C;  1LTJ A;  3AE3 C;  2KI7 B;  2NZ2 A;  1KV4 A;  1ZP0 C;  3SWY A;  3PRJ A;  2HOD A;  2P58 A;  2WPR A;  1PV3 A;  1NTK G;  1FC2 C;  3S1K A;  1Q90 D;  3UIA A;  3VMA A;  1K04 A;  3P7K A;  2MJZ A;  1T3J A;  2SPZ A;  3WU2 H;  1IFI A;  1NTM D;  3FWN A;  4YXW H;  1JY3 P;  3PP5 A;  2Q7C A;  1JMB A;  2JO1 A;  4KHX A;  4L73 A;  3G4S P;  3RK2 B;  4PV1 C;  2HYN A;  1IFN A;  3CL3 D;  4PV1 D;  1JNM A;  2Q3E A;  2J5U A;  2OQQ A;  4Y99 B;  2OYI B;  1KOR A;  2P7J A;  2I8D A;  3L74 G;  1N73 A;  1SQQ K;  2JWA A;  3HTK B;  4DZO A;  5AW7 B;  2R32 A;  4PV1 B;  1S3J A;  4NPD A;  3L70 G;  1SLQ A;  1RF0 A;  3HTK A;  5CBN A;  3AE7 C;  3IR9 A;  1YTZ I;  3GW6 A;  3RK3 B;  1KQS O;  1YJN P;  2NRG A;  2R5B A;  4OGQ D;  2QG4 A;  3QWO C;  1QEX A;  2R44 A;  1G1I A;  2HOD B;  2XU6 A;  1NTK K;  1P84 D;  2K88 A;  3JCU H;  3OAK A;  2K9J A;  2LR2 A;  3D6Z A;  2Y9Z A;  3CMA P;  2FFD A;  1CSB A;  2WZ7 A;  3GHG C;  3M06 A;  4IL6 X;  3CWB J;  2N1T B;  2ZFC A;  3V2R A;  1M1J C;  5CCH A;  1LTJ C;  3EQ2 A;  3VYI A;  3V4W A;  2OYI C;  2E74 D;  3BAT A;  2OYO A;  2KNC A;  1HJB A;  2RKL A;  3M0D A;  2C0X A;  5APX A;  3MIW A;  3CI9 A;  3RK2 C;  2N1T C;  3BCC E;  1G2C A;  3VMZ A;  3VP8 A;  1SFC A;  3CLQ A;  4D6T D;  2ZT9 D;  2M3B A;  3TGU G;  2FKW B;  4WY4 A;  3Q2Y A;  2FYU K;  1SVF A;  1VDF A;  3MD0 A;  1N73 B;  1FZC A;  5AVT B;  1BGY J;  1JM0 A;  1FDI A;  1IFD A;  2KZJ A;  5KAI E;  3H32 B;  3KZI E;  2IX7 C;  1N7S D;  2ZVN B;  2BEQ D;  3V4Q A;  1X8Y A;  2C0W A;  4YTP C;  5KLI B;  1L0L G;  4GKG A;  1EXJ A;  1VQ4 P;  1P84 I;  3L72 G;  1N73 C;  3AE1 C;  4W80 A;  4Z1M H;  1VQO P;  1H89 A;  4OGQ B;  1AVY A;  4TT3 H;  2WWW A;  1PGQ A;  5AW4 B;  1FDM A;  1S9K D;  3BRV B;  1X9V A;  3L74 D;  2L91 A;  1M90 Q;  2WQY C;  4H13 B;  2K9J B;  3HUS A;  3CX5 E;  1LTJ B;  1JTH B;  4RJT A;  1KZU B;  5KLV J;  1LWU C;  3V6I A;  3CCE P;  4K3A A;  5E79 H;  1GZL A;  2NPS B;  2KXP B;  1Y47 A;  3KYQ A;  2IBZ I;  4YPC A;  1LTS C;  1PZQ A;  2W27 A;  2QRX A;  2KUB A;  4ZKP A;  2WTY A;  1EDL A;  1AVO A;  1G2C B;  1S9K E;  1OX3 A;  1WRG A;  3Q5S A;  3OA7 A;  3W67 A;  1FJP A;  3AEB C;  3L74 J;  5C39 A;  3CCL P;  1IK9 A;  2KYV A;  1JY2 O;  2FYZ A;  5EFW B;  4ASV A;  1GMJ A;  1NTM E;  4GOF A;  4IL6 E;  3VP9 A;  1EDI A;  3H32 A;  3L75 J;  1JB0 J;  2YXR B;  1XTC C;  2XV5 A;  4U7J A;  5GTH E;  1GL2 C;  1LWU B;  1SQP K;  4UB8 E;  5AVY B;  3A0H H;  5APQ A;  4BRY A;  4YXD C;  3O6Q A;  4H44 B;  1LNQ A;  1L4A D;  3B5N B;  2IPP A;  4DOJ A;  1JCC A;  1FOS E;  1BGY D;  1KB9 H;  2CPS A;  4H13 D;  3H1J E;  3MTU E;  1SQB K;  5CMZ A;  2V4H A;  1EZV I;  1URQ C;  2C9N Y;  1GDT A;  3C1L A;  5KJ7 C;  2IBZ E;  1ZW0 A;  2K9Y A;  3FXD A;  3E1R A;  1NU1 J;  3HUS B;  3RK2 D;  2QJY C;  2ZYA A;  2D2C C;  3GF3 A;  1QL1 A;  4AQR D;  5CCG A;  5KKZ B;  1SQB G;  1AJY A;  4UB8 H;  2WVR A;  4Y28 J;  2D2C D;  3H1H G;  2NPS C;  2O1J A;  3RL0 D;  3H25 A;  1NKN A;  1Q82 Q;  1HWT C;  2KNC B;  1WT6 A;  1EQ7 A;  1NVO A;  1NTZ K;  3B5N D;  1W2B O;  2K1A A;  1LTG C;  3VTP C;  1RHZ B;  1L0N K;  3AE9 C;  2IZ1 A;  3CCR P;  2FBW C;  3M9H A;  4I1L A;  3GLM A;  3EWK A;  1N7L A;  2E75 B;  1PIX A;  2QE7 H;  1LTI C;  5KAI H;  1KN7 A;  4KJM A;  1ZRT E;  3CC7 P;  1BCC E;  1L0L J;  3C8V A;  1NHL A;  1SS1 A;  3L72 J;  2P10 A;  3LIE A;  4LC1 A;  1L0L K;  1J1D C;  4RES B;  3TNU A;  5BU8 B;  2E5Y A;  1KB9 D;  1OMI A;  3H1I E;  1GL2 B;  2R3S A;  3A7O A;  2BCC J;  1LWU A;  1M56 D;  1RE4 C;  4BRY B;  1H88 A;  3CD6 P;  1VPC A;  2Z4E A;  3AE8 C;  5AW8 B;  3S9O A;  3L37 A;  5KLV G;  2E5T A;  3BCC D;  1LGH B;  3CX5 H;  3KXD A;  1JY2 P;  3M9B A;  1K05 A;  1BCC D;  3O8Z A;  2ZXX A;  5KJ7 D;  1SP4 A;  1BGY E;  1EC5 A;  2D2C B;  2H7H A;  1KIL C;  1RF1 B;  2I1J A;  3E7K A;  2N9Y B;  1H0T B;  2YO3 A;  1DX7 A;  1HH0 A;  1LT1 A;  3CCM P;  4HB1 A;  1L2P A;  4WVZ A;  1J1D B;  4GIF A;  2WMM A;  1VQM P;  1SQX D;  2W8Z A;  2RMZ A;  3D6Y A;  1USD A;  1HBW A;  1YQ4 C;  2Y9Y A;  2P67 A;  5AW3 B;  5GTI E;  1LT9 C;  4I7Z B;  3NMD A;  3P8M C;  1T2K C;  1Q86 Q;  1U7J A;  4JBZ A;  1K73 Q;  4IL6 H;  1T2K D;  1HJ0 A;  1CZQ A;  1PGJ A;  1W5C E;  2FY8 A;  2QM7 A;  3L36 A;  3HE4 A;  2P1J A;  3L74 E;  4JPZ B;  2IYO A;  4O9B A;  4XE5 B;  2Q6Q A;  1PL5 A;  3M9Q A;  2Q5U A;  2ZJS E;  3CX5 D;  3PLN A;  4WB4 A;  5AVU B;  3A5T A;  1EZV E;  1YQ3 C;  3TSI A;  1ZXG A;  2OYH B;  4OH8 B;  3ABV C;  1IJD B;  3GG2 A;  3E1I A;  5CCG C;  5AVV B;  3KPE A;  1YJ9 P;  1SQX E;  1IK7 A;  4PJ0 H;  5AVR B;  5GTI H;  1VF5 D;  1HUC A;  2QJP C;  3HD7 A;  1KB9 E;  3IFM A;  5AW6 B;  4DCK A;  1LTB C;  1NO4 A;  3HD7 D;  3WUU A;  1MZ9 A;  3KHU A;  3BCC J;  2E75 D;  2B89 A;  1NU1 G;  1OVV A;  1USE A;  1E5W A;  3B5N C;  3VMY A;  3CCU P;  4PD4 H;  1JY3 O;  1SQB J;  1VF5 B;  3L71 J;  3M0A A;  4WY4 B;  1NTK E;  2WIT A;  3H1H J;  2QEX P;  1RF1 C;  2C9L Y;  3PH0 A;  2O1K A;  1NGM B;  3SSU A;  1NTZ J;  5CJ0 A;  3JCU E;  1PPJ E;  1A02 J;  4I6M C;  1JY3 N;  1QGK B;  3H6P A;  1RF0 C;  2WSF H;  3MGN A;  1PP9 D;  3IAO A;  4PJ0 E;  5CJ4 A;  1NOH A;  2W6B A;  1BCC G;  2OTK E;  1T3U A;  1R5S A;  1KYO I;  2FYN C;  4QMA A;  1RQU A;  4OGQ C;  3LID A;  1Y9B A;  1JEK A;  3PTZ A;  1URQ B;  3L35 A;  1K8A Q;  1ZME C;  1RE4 A;  2O3J A;  2QM8 A;  2WSF J;  4N3Y B;  1OFC X;  1OW8 A;  3AE6 C;  3FXE A;  3A0B E;  1ZR4 A;  4D6T G;  3RBZ A;  4AUW A;  2FYN B;  2Q9I A;  1IO4 A;  2BCC G;  2JDI H;  2KOG A;  3AE4 C;  1QVG O;  4BXL A;  3M0D C;  1JMM A;  1KQG B;  4PD4 I;  3RL0 C;  1A02 F;  1ZLL A;  2N1T A;  1LTT C;  2WPQ A;  4CPG A;  1BE3 G;  5CCH D;  1EZV D;  1M1K Q;  1HVV A;  2OAR A;  3KZI H;  3TF5 A;  2E74 C;  3BAS A;  1S72 P;  2M8R A;  3CXH I;  2J59 M;  4HH2 A;  5DJT B;  4WY4 C;  5APU A;  3HD7 C;  1VL2 A;  1AQ5 A;  2A45 I;  2KB7 P;  3CXH H;  5AW0 B;  3CX5 I;  1FZF A;  1KMI Z;  3H1L D;  3RK3 C;  1FZA A;  1GW3 A;  3AEC C;  3GHG A;  1EDK A;  1KYO H;  2XND H;  4DT0 A;  4M3L A;  1N8R Q;  1AFO A;  2YNY A;  4HJG H;  3KQG A;  1YBK A;  3PJS K;  2WSS H;  1RF1 A;  1H0T A;  2NPS D;  2IYP A;  2M3E A;  5AVW B;  3T97 A;  1NTK D;  3W68 A;  2OYI A;  3V5B A;  3CME P;  1BSH A;  2JKV A;  2W83 C;  4IOI H;  2K37 A;  3CXH D;  4N6J A;  4U3F G;  4C7N A;  3CCS P;  3BVH A;  1R5L A;  4UB6 E;  3CCJ P;  4ASW A;  2JP3 A;  2Q1K A;  1VQ6 P;  2YMK A;  2M0B A;  1KYO E;  1OVU A;  2MKV A;  4PD4 D;  2A06 G;  1KFN A;  2ZXE B;  3VN0 A;  1QL2 A;  4EDF A;  3U1C A;  1D7M A;  3CCV P;  3CC2 P;  2A06 D;  1RE3 C;  2KZI A;  3B71 A;  1DEE G;  1NU1 E;  4JYC A;  3IN6 A;  2QJK B;  1SQV K;  1KQF B;  2Y0C A;  3RL0 B;  3N4X A;  4ZMD A;  1L0N D;  2G3A A;  1SQV J;  1QLE D;  2QIW A;  1N7S B;  4D6T E;  3BCC G;  1OW7 A;  1NYH A;  3I55 P;  2GUV A;  1SFC B;  1SQX J;  2N9B A;  1SQP E;  4ZNC A;  1Q81 Q;  1J1E C;  3L73 G;  1JUN A;  3N7N A;  2YKP A;  3GHG B;  3L71 G;  4PD4 E;  5APV A;  5B66 H;  1KTM A;  1JY2 N;  4L75 A;  2HR3 A;  4NPE A;  1GU4 A;  2H8P D;  1NTZ G;  3AEF C;  3OJA B;  4WWI A;  3HE5 B;  3HUS C;  5APW A;  5L8R J;  2IFN A;  3L71 E;  2FXP A;  5KKZ C;  1J2J B;  1J1E B;  4H0L D;  1BCC J;  1WMK A;  4LGD E;  3P8C D;  4H0L C;  4NPF X;  3IF4 A;  4L76 A;  1CI6 A;  1EDJ A;  3KDP B;  1NKZ B;  1MFZ A;  4RKU J;  3SWK A;  1QX8 A;  1SQP D;  3Q5P A;  3BRT B;  1NTZ E;  1SQQ G;  2YKO A;  2B87 B;  4AYC A;  1KC8 Q;  2BCC D;  1DD4 A;  1NWQ A;  2R5D A;  1HGV A;  1URQ A;  2FYU E;  2JR8 A;  2Y0E A;  1IFJ A;  1PPJ D;  3HRN A;  1JTH A;  2B9B A;  4JQ0 D;  1SQP G;  1URQ D;  5KLV K;  1S4X A;  3L72 D;  5APY A;  3RK3 E;  1L0L D;  1SFC D;  3PHL A;  1N86 A;  2AEJ A;  4GOD A;  1QVF O;  1VQ9 P;  2NPS A;  3H1I J;  3I5C A;  3A3Y B;  1BDC A;  2V7Q H;  1SQV D;  3CPW O;  1BE3 J;  5APS A;  1RE3 A;  2LXC B;  1S5L E;  5AW2 B;  1VQP P;  2KSJ A;  5CHX A;  1AQT A;  1N7S A;  1BSN A;  2IDB A;  4OWF A;  4TLF A;  2CK3 H;  2BCC E;  2POH A;  1VQ8 P;  1UIX A;  3CXH E;  4H13 C;  3M91 A;  4C46 A;  2E43 A;  2ZT9 C;  3R4Y A;  2JWD A;  3FGA D;  2KSE A;  4GOE A;  3L73 D;  5TIS H;  1X0T A;  2E76 C;  4XA4 A;  4BWN A;  2OYH A;  2XDJ A;  3G6E P;  5KAF H;  4GDO A;  3TK1 A;  1FZB A;  1KYO D;  3I56 P;  1YIJ P;  1LJ2 A;  1CI6 B;  1NU1 D;  2YXQ B;  1L0N G;  2FYU J;  3HE4 B;  1ZOY C;  1OW6 A;  3F5H A;  1YYC A;  3L75 E;  1DEB A;  4OVN F;  3WUT A;  3T97 B;  2A06 E;  1YI2 P;  3MUD A;  3U1A A;  1UII A;  2PFX A;  1FJK A;  3AE2 C;  2G8Y A;  2VRS A;  2J58 A;  4UB6 H;  1GU5 A;  2FFD C;  4C7N B;  3SWF A;  1HTL C;  2QVA A;  4R4M A;  5TIS E;  1FZC B;  2FFD B;  1KD1 Q;  3RBX A;  4EIJ A;  1NAF A;  1YJW P;  5KAF E;  1ZR2 A;  3B4S A;  5KLI C;  1FAV A;  1KB9 I;  1G1J A;  2XKM A;  2A45 H;  2HLO A;  2P2U A;  3Q1M A;  3H1K E;  4W7Z A;  1OXZ A;  3L70 E;  5M1B A;  1ZN5 A;  2FYU D;  2O01 J;  1SFC C;  1GW4 A;  1SQV G;  2AEF A;  2FXO A;  2PAJ A;  2YIU B;  3H1L E;  2KIK A;  5E79 E;  1VQL P;  2R3C A;  3AEG C;  1U7M A;  1MFT A;  1SQX G;  3ITK A;  4EI2 A;  1LP1 B;  2GUS A;  1YTZ T;  1LT9 B;  2N1T D;  3L73 J;  3LW5 H;  2W6J H;  4I7Z C;  3S4R A;  3AEA C;  3H1L G;  4EOT A;  2E42 A;  1ZV8 A;  2L5G B;  5B66 E;  3Q3D A;  4GT1 A;  1LT9 A;  1SQX K;  1BDD A;  2O01 H;  4IFD K;  1N7S C;  2DW3 A;  2AXT E;  1JOC A;  1SQB E;  1NJI Q;  3II6 A;  3WUV A;  2E76 B;  4EYY Q;  5BU5 A;  1FOS F;  1NH4 A;  1FE6 A;  1PGP A;  1NTM G;  1BE3 D;  3FX0 A;  1L0L E;  3H1K D;  3LW5 J;  3RK3 D;  4IFF A;  3TNU B;  1KIL D;  2WPS A;  3H1I D;  3OW2 O;  5KLV D;  1Q2N A;  1KQL A;  1KIL A;  2PGD A;  4HKZ H;  3CCQ P;  1N2D C;  3NXS A;  2A45 G;  1Q7Y Q;  4ZKU A;  1SQQ J;  3AEE C;  2QA4 P;  1GD2 E;  1KIL B;  1M7L A;  3L75 D;  5AVZ B;  1SQV E;  3A0H E;  3TGU D;  2AXT H;  1FZC C;  1L0N E;  2IBZ G;  3L75 G;  3P32 A;  4H44 D;  2H43 A;  3H1H D;  1S2E A;  1SQP J;  3H1J G;  1SQB D;  2HG5 D;  3G9R A;  3L71 D;  3B5N A;  3L73 E;  1PP9 E;  3O6Q B;  1X79 B;  2E74 B;  1VQK P;  1FZG A;  1RY3 A;  3H1I G;  3HD7 B;  5BVZ A;  1IFP A;  2KLU A;  1LP1 A;  1GK6 A;  1OVR A;  3RGU A;  1PP9 G;  2I1K A;  3USS A;  1CW5 A;  3R2P A;  1OWA A;  2OGU A;  2ZT9 B;  4MN4 C;  3TGU E;  1HF9 A;  3P8C E;  2WT7 A;  2QSI A;  2WSE H;  3V2Q A;  2V7Q J;  1VQ5 P;  1Y8A A;  3H1J D;  3G71 P;  3MUD C;  3GF7 A;  2GM4 A;  1TU3 F;  2IBZ D;  5AW9 B;  1E79 H;  4XFJ A;  2UWJ E;  1L0N J;  2FYU G;  3AE5 C;  3L70 D;  3VOP A;  1DD3 A;  2WSE J;  2QJY B;  3CWB D;  3TDK A;  1PGO A;  3L4F A;  4W7Y A;  2H88 C;  1T6A A;  4K35 A;  4I2L C;  4JYB A;  3H1K G;  2JJL A;  3FWL A;  3MHV A;  5KJ7 A;  3D71 A;  2QJK C;  2BAS A;  1PFI A;  2OTL P;  4R4L A;  3SFE C;  1IC2 A;  5AVS B;  1VQ7 P;  1HGZ A;  1FBM A;  3JC2 2;  2ZVO B;  1LTA C;  2O01 N;  3A2A A;  2HFE D;  3C9I A;  2KK7 A;  5B5E H;  2YO2 A;  1S5L X;  1EZV G;  1NTK J;  2Z5H A;  3H1H E;  3D70 A;  2E76 D;  1GL2 A;  2E75 C;  1L4A A;  4LLH A;  3WU2 E;  2AXC A;  1OZH A;  2WT7 B;  4U3F E;  3VMX A;  3H1L J;  4D6T J;  2WSC H;  1FU1 A;  2XZR A;  4WY4 D;  5KLV E;  1YHQ P;  1U57 A;  5GTH H;  2YIU C;  2HPC A;  1DH3 A;  2KP8 A;  5B5E E;  3RL0 g;  4A7P A;  2LKM A;  2W90 A;  5KTB A;  1NTM J;  2YMY A;  1P84 E;  1RQV A;  1R8E A;  1VQN P;  2BEZ F;  2PP6 A;  4KT0 J;  5APT A;  5AVQ B;  2WSC J;  1GTW A;  2ZYD A;  3V2P A;  1FZE A;  3EFG A;  3NFQ A;  1KFM A;  1DIP A;  2KLV A;  4H44 C;  4N78 E;  5CBO A;  2FXM A;  3F89 A;  3L70 J;  1PPJ G;  3ZDM A;  2ZYG A;  1K9M Q;  4IFM A;  4B86 A;  4H0L B;  1YIT P;  1Z56 A;  5DJU B;  2Q3I A;  2Z5I A;  1M1J B;  2GA1 A;  3CWB E;  5AW1 B;  3H1J J;  1P84 H;  4L74 A;  4U3F J;  1EXI A;  3AED C;  5H2F H;  2XNX A;  3QH9 A;  2JEE A;  1W2E A;  1KIL E;  5AVX B;  1M8O B;  3U59 A;  2IZ0 A;  1SQQ E;  3CWB G;  1NU1 K; 
#chains in the Genus database with same CATH homology
 1T8Z A;  4C7R A;  1L4A B;  1NTM K;  3NTN A;  3TYY A;  1GK4 A;  3HE5 A;  2OYH C;  2HPC B;  2CPB A;  1XTG B;  4Y99 C;  1JCD A;  3WMM 0;  2GM4 A;  3V2N A;  1JO5 A;  4WBA A;  2YKQ A;  1MV8 A;  1MUU A;  4HYT B;  1GL2 D;  4JF7 A;  5AW5 B;  1IFM A;  2W6A A;  3B8E B;  5CCG D;  1H8A A;  1L4A C;  4N78 D;  2IFM A;  1M1J A;  3G3Z A;  5CCH C;  1LTJ A;  3SWY A;  2HOD A;  2WPR A;  3UIA A;  3P7K A;  2MJZ A;  1T3J A;  1IFI A;  1JY3 P;  3PP5 A;  2Q7C A;  4KHX A;  3RK2 B;  2HYN A;  1IFN A;  3CL3 D;  1JNM A;  2OYI B;  4Y99 B;  2P7J A;  1N73 A;  1SQQ K;  3HTK B;  4DZO A;  5AW7 B;  2R32 A;  1SLQ A;  1RF0 A;  3HTK A;  3IR9 A;  1YTZ I;  3RK3 B;  2R5B A;  1G1I A;  2HOD B;  2XU6 A;  1NTK K;  3OAK A;  2FFD A;  1CSB A;  2WZ7 A;  3GHG C;  3M06 A;  3V2R A;  2N1T B;  2ZFC A;  1M1J C;  5CCH A;  1LTJ C;  3EQ2 A;  3VYI A;  3V4W A;  2OYI C;  3BAT A;  1HJB A;  3M0D A;  2C0X A;  5APX A;  3MIW A;  3CI9 A;  3RK2 C;  2N1T C;  1G2C A;  3VMZ A;  3VP8 A;  1SFC A;  3CLQ A;  2M3B A;  2FKW B;  4WY4 A;  1N73 B;  2FYU K;  1SVF A;  1VDF A;  3MD0 A;  1FZC A;  5AVT B;  1IFD A;  3H32 B;  2IX7 C;  1N7S D;  3V4Q A;  1X8Y A;  2C0W A;  4GKG A;  1N73 C;  4W80 A;  1H89 A;  2WWW A;  5AW4 B;  1FDM A;  1S9K D;  3BRV B;  1X9V A;  3HUS A;  1LTJ B;  1JTH B;  1KZU B;  1LWU C;  1GZL A;  2NPS B;  3KYQ A;  1LTS C;  2W27 A;  4ZKP A;  2WTY A;  1G2C B;  1S9K E;  1WRG A;  3OA7 A;  1FJP A;  1IK9 A;  2KYV A;  1JY2 O;  2FYZ A;  3VP9 A;  3H32 A;  1XTC C;  2XV5 A;  1GL2 C;  1LWU B;  1SQP K;  5AVY B;  5APQ A;  1L4A D;  3B5N B;  2IPP A;  4DOJ A;  1JCC A;  1FOS E;  2CPS A;  3MTU E;  1SQB K;  5CMZ A;  2C9N Y;  1URQ C;  5KJ7 C;  3HUS B;  3RK2 D;  5CCG A;  4AQR D;  1QL1 A;  2NPS C;  2O1J A;  3RL0 D;  1HWT C;  1NKN A;  3B5N D;  1WT6 A;  1EQ7 A;  1NTZ K;  1LTG C;  3VTP C;  1L0N K;  3M9H A;  4I1L A;  1N7L A;  1LTI C;  1NHL A;  3LIE A;  3TNU A;  4LC1 A;  1L0L K;  1J1D C;  4RES B;  5BU8 B;  1GL2 B;  3A7O A;  1LWU A;  1RE4 C;  1H88 A;  1VPC A;  2Z4E A;  5AW8 B;  3L37 A;  1LGH B;  1JY2 P;  3M9B A;  3O8Z A;  5KJ7 D;  1SP4 A;  2H7H A;  1KIL C;  1RF1 B;  2I1J A;  2YO3 A;  1DX7 A;  1HH0 A;  1J1D B;  4GIF A;  1HBW A;  2P67 A;  5AW3 B;  1LT9 C;  3NMD A;  3P8M C;  1T2K C;  1T2K D;  1CZQ A;  3L36 A;  2QM7 A;  4O9B A;  1GU5 A;  2OYH A;  3HE4 A;  2P1J A;  4XE5 B;  4WB4 A;  5AVU B;  3M9Q A;  2Q5U A;  3A5T A;  3TSI A;  2OYH B;  4OH8 B;  1IJD B;  3E1I A;  5CCG C;  5AVV B;  3KPE A;  5AVR B;  3HD7 A;  1HUC A;  3IFM A;  5AW6 B;  1LTB C;  1NO4 A;  3HD7 D;  1MZ9 A;  1E5W A;  3B5N C;  3VMY A;  1JY3 O;  1RF1 C;  3M0A A;  4WY4 B;  2C9L Y;  2WIT A;  2O1K A;  5CJ0 A;  1A02 J;  4I6M C;  1JY3 N;  3MGN A;  3H6P A;  1RF0 C;  2WSF H;  5CJ4 A;  1NOH A;  2W6B A;  1T3U A;  3LID A;  1URQ B;  3L35 A;  1RE4 A;  2QM8 A;  4N3Y B;  1ZR4 A;  4AUW A;  2Q9I A;  1IO4 A;  2KOG A;  3M0D C;  1JMM A;  3RL0 C;  1A02 F;  1ZLL A;  2N1T A;  1LTT C;  2WPQ A;  5CCH D;  1HVV A;  2OAR A;  3BAS A;  2M8R A;  4HH2 A;  2J59 M;  1AQ5 A;  4WY4 C;  5APU A;  3HD7 C;  2A45 I;  2KB7 P;  5AW0 B;  1FZF A;  1GU4 A;  3RK3 C;  1FZA A;  1GW3 A;  3GHG A;  4M3L A;  1AFO A;  2YNY A;  1RF1 A;  3KQG A;  2NPS D;  5AVW B;  3T97 A;  2OYI A;  3V5B A;  4N6J A;  4C7N A;  3BVH A;  3VN0 A;  2FFD B;  1KFN A;  2ZXE B;  3U1C A;  1QL2 A;  1RE3 C;  3RL0 B;  4JYC A;  1SQV K;  3N4X A;  1N7S B;  2GUV A;  1SFC B;  2N9B A;  1J1E C;  1JUN A;  3N7N A;  2YKP A;  3GHG B;  5APV A;  1JY2 N;  2H8P D;  5APW A;  3OJA B;  3HE5 B;  3HUS C;  2IFN A;  1J2J B;  1J1E B;  4LGD E;  3P8C D;  1CI6 A;  3KDP B;  1NKZ B;  1MFZ A;  3BRT B;  2YKO A;  4AYC A;  1NWQ A;  2R5D A;  1HGV A;  1URQ A;  3HRN A;  1GDT A;  1IFJ A;  1JTH A;  1URQ D;  5KLV K;  5APY A;  1SFC D;  1N86 A;  2NPS A;  3I5C A;  3A3Y B;  5APS A;  1RE3 A;  5AW2 B;  2KSJ A;  5CHX A;  1N7S A;  2POH A;  4C46 A;  3M91 A;  2E43 A;  4XA4 A;  2XDJ A;  3TK1 A;  1FZB A;  1CI6 B;  3HE4 B;  1YYC A;  1DEB A;  3MUD A;  3U1A A;  1FJK A;  2FFD C;  2VRS A;  2J58 A;  4C7N B;  3SWF A;  1HTL C;  1FZC B;  4EIJ A;  1NAF A;  1ZR2 A;  1FAV A;  2XKM A;  1G1J A;  2A45 H;  2HLO A;  2P2U A;  4W7Z A;  1OXZ A;  1ZN5 A;  1DH3 A;  1SFC C;  1GW4 A;  2PAJ A;  2R3C A;  2GUS A;  1YTZ T;  1LT9 B;  2N1T D;  3LW5 H;  4EOT A;  1GD2 E;  2E42 A;  1ZV8 A;  2L5G B;  4GT1 A;  1LT9 A;  1SQX K;  2O01 H;  4IFD K;  1N7S C;  1JOC A;  3II6 A;  5BU5 A;  1FOS F;  1NH4 A;  3RK3 D;  4IFF A;  3TNU B;  1KIL D;  2WPS A;  1KQL A;  1KIL A;  1N2D C;  3NXS A;  2A45 G;  4ZKU A;  1KIL B;  1M7L A;  5AVZ B;  1FZC C;  3P32 A;  2H43 A;  2HG5 D;  3B5N A;  1X79 B;  1FZG A;  1RY3 A;  3HD7 B;  5BVZ A;  1GK6 A;  2I1K A;  1CW5 A;  3R2P A;  1OWA A;  3P8C E;  2WT7 A;  2WSE H;  3V2Q A;  5AW9 B;  3VOP A;  3L4F A;  4W7Y A;  4I2L C;  4JYB A;  2JJL A;  5KJ7 A;  2BAS A;  1PFI A;  1IC2 A;  5AVS B;  1HGZ A;  1FBM A;  1LTA C;  3A2A A;  2HFE D;  3C9I A;  2YO2 A;  2Z5H A;  1GL2 A;  1L4A A;  4LLH A;  2WT7 B;  3VMX A;  2WSC H;  1FU1 A;  2XZR A;  4WY4 D;  2HPC A;  2KP8 A;  2LKM A;  5KTB A;  2YMY A;  2PP6 A;  5APT A;  5AVQ B;  1GTW A;  3V2P A;  1FZE A;  3EFG A;  3NFQ A;  1KFM A;  2KLV A;  4N78 E;  2FXM A;  4IFM A;  4B86 A;  1Z56 A;  2Q3I A;  2Z5I A;  1M1J B;  5AW1 B;  2XNX A;  2JEE A;  1W2E A;  5AVX B;  3U59 A;  1NU1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...