2R3CA

Structure of the gp41 n-peptide in complex with the hiv entry inhibitor pie1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/viral protein inhibitor
molecule keywords gp41 N-peptide
publication title Potent D-peptide inhibitors of HIV-1 entry
pubmed doi rcsb
total genus 20
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2r3cA00
1T2KD 3L37A 3NXSA 4RESB 3NFQA 2WPRA 3VMYA 1A02F 1CZQA 2E42A 5AW9B 3A2AA 1A02J 3HTKA 5CMZA 3M9BA 5AW7B 4C46A 2WPSA 2Q3IA 5AVUB 3VMZA 4KHXA 2YO2A 1GK6A 2WPQA 4JYBA 3KQGA 5AVXB 5AW1B 1H88A 1HUCA 3M91A 2QM7A 4C7NB 3M0DA 2JJLA 2R5BA 3P32A 4B86A 3L36A 3IR9A 1SLQA 1CI6B 1G2CB 2C9LY 4GKGA 2ZFCA 2BASA 3NTNA 5APYA 3P7KA 2QM8A 5AVSB 5AW0B 1T2KC 2WWWA 1GTWA 1GU4A 3T97A 3V4WA 2WT7B 3OAKA 4M3LA 1H8AA 2C9NY 3TYYA 5AW3B 3M9HA 3UIAA 1NAFA 3HE5B 4DZOA 3HE5A 5APVA 1OWAA 3KDPB 5APSA 1S9KE 1FOSE 4I6MC 1FAVA 2H7HA 2Q7CA 3NMDA 5AVWB 1SP4A 2XV5A 4C7NA 3A3YB 3O8ZA 5AW5B 3MGNA 2XZRA 3M0AA 5AVQB 1CI6A 2YNYA 4EOTA 4AUWA 5AW4B 2Z5HA 2Q5UA 3LIEA 3V4QA 2XU6A 1GD2E 3VMXA 4XE5B 1HJBA 1HBWA 2W6AA 4I2LC 3A5TA 1OXZA 5APQA 5AW2B 1MUUA 2WT7A 2Z5IA 1S9KD 3V5BA 4JYCA 5AVVB 3TNUB 4HYTB 1IO4A 1KQLA 3TNUA 2R3CA 3A7OA 5AVZB 5APTA 5AVYB 2P2UA 1FOSF 1HWTC 1J2JB 1GU5A 3P8MC 5AVTB 1GK4A 4AQRD 4GT1A 3VYIA 2R5DA 3M06A 2P7JA 5AW8B 1NWQA 1CSBA 5APUA 3B8EB 3SWFA 1H89A 5APWA 5AW6B 1MV8A 3HE4B 3HE4A 1JNMA 4LC1A 1GZLA 2P67A 2VRSA 2R32A 5APXA 3TK1A 2WTYA 2ZXEB 3LIDA 1DH3A 2KP8A 3VN0A 5AVRB 2W27A 3VTPC 2IPPA 1MFZA 2N9BA 1X8YA 2E43A 1YYCA 3I5CA 3MD0A 3L35A 4AYCA 1JUNA 2YO3A
chains in the Genus database with same CATH superfamily
1SQBG 4KT0J 4ZKPA 2QG4A 3Q5RA 2FFDC 4N78D 3CWBG 2L91A 2RMZA 1X0TA 1IFIA 3VMZA 1YBKA 2QJKB 2YO2A 3L73J 1EDJA 3GHGA 2JKVA 3NTNA 2QM8A 3PP5A 1NTMK 2FYUE 2HPCA 2A06E 4OWFA 1PGQA 3RK3C 4WY4D 3FWNA 5APVA 1KB9E 1GL2D 2M3EA 3I55P 1BGYD 2H7HA 1PP9D 3A0BE 1VF5C 2B9BA 1L0LD 2XZRA 1KFMA 1SQPE 4RO0A 1GD2E 4NPFX 4PD4E 5BVZA 5C39A 1SQVJ 1USEA 5AVVB 1KQLA 5APTA 4R4MA 3IN6A 3H1JE 2MJZA 1RF1A 2Y0EA 1JMBA 3B71A 3CL3D 3G4SP 3WUUA 1L4AC 2Q3EA 2VRSA 3L73D 1BE3J 3AE6C 1ZLLA 2FYZA 2KUBA 3OA7A 5GTIE 1R5SA 3L75J 2PFXA 3HD7D 4RESB 3NFQA 3CX5H 1KYOI 1YJ9P 3FWLA 1P84H 2WPSA 2V7QJ 3CXHD 2IX7C 2Q1KA 3MP7B 2J59M 1JTHB 1AQ5A 1K73Q 5AVXB 2P58A 2W90A 3USSA 3V2QA 4IL6H 2JJLA 2QJYB 2WITA 1SQVD 1NKZB 1G1JA 1SQXK 4GKGA 3TF5A 1M90Q 2BASA 3Q1MA 1EDIA 5AVSB 3L72J 3SWKA 4M3LA 2JP3A 1H8AA 2E75D 1JEKA 3H1IE 3CI9A 2AXTH 5KLIC 4OGQD 1HTLC 1BE3D 2WSEJ 1T3UA 1S2EA 3EFFK 3FXEA 1VQLP 2AEMA 2IYOA 4IFMA 3L75D 3LW5H 1LWUC 3VP9A 2QIWA 1URQC 1L0NK 1KB9I 3H6PA 1BGYG 2UWJE 3M0DC 1PP9G 1M57D 1W2EA 2RKLA 1HGVA 3AE5C 3MZWB 2PP6A 1L0LG 2ZYGA 3HUSC 3L72D 3P8CD 4U3FE 1ZRTD 3CPWO 2HR3A 1KILD 4RKUJ 2ZT9B 3AEEC 1FZCA 1Y9BA 1U57A 3W67A 4Y28J 3S9OA 1YITP 4KHXA 3BCCJ 2I1KA 3F89A 5AW1B 2QSIA 2LR2A 3L73G 2W8ZA 2C9LY 1T2KC 3CX5E 3V4WA 1LTAC 1X22A 2H89C 1P84E 3D70A 2IBZD 4L76A 1J1EB 3IAOA 3C8VA 2FXMA 3AEFC 1PPJD 1NGMB 4IL6E 5AW5B 2KB7P 3RBZA 1HJ0A 2KI7B 1HBWA 1IK7A 3GHGC 4KJMA 2Z5IA 1SQVG 4H0LD 4D6TJ 2W6JH 5AVZB 1K9MQ 3CCQP 4H13B 2NRGA 2AXTE 3IF4A 3V2NA 1YQ3C 3BCCD 1IFJA 1JY3P 3S1KA 4Y99B 2K1AA 3L4FA 3W68A 5CCGC 1BE3G 2E76D 1QL1A 2KP8A 4HH2A 4NPEA 1N7SC 3L75G 1K8AQ 1EQ7A 1RE4A 2I1JA 3T97B 5AW9B 3HTKA 1LTJB 5KLVJ 2KSJA 5KLVK 1DEBA 1NU1J 1NU1K 2YIUC 1SQQK 2POHA 4Z1MH 2KOGA 4XA4A 4B86A 1SFCB 4D6TD 2KLUA 2I8DA 3L72G 2PAJA 2KSEA 1VQ7P 2R3SA 2D2CC 2A45H 4HJGH 3HE5A 1AVYA 1FZAA 3KDPB 4O9BA 2CPBA 3M0AA 3AEBC 5E79H 3VOPA 2J5UA 2WZ7A 2NPSD 2GM4A 1AJYA 3SFDC 1JY2O 1KMIZ 3R2PA 1JCCA 2FYUK 3IFMA 5KLVD 2QJKC 1P84I 2IBZG 1NU1D 2GA1A 1CSBA 3A0HH 3CC7P 3B8EB 3H32B 1PPJG 1SQPK 1VQMP 2P67A 3WU2H 3H25A 2G3AA 2IPPA 2K9JA 1X8YA 3H1HE 4OVNF 4AYCA 2OGUA 3L37A 3H1JJ 2FYNC 2MKVA 1OVVA 4OH8B 1A02F 1NH4A 2SPZA 3KYQA 3RK3D 2KIKA 3BCCG 2N1TB 2XKMA 3TGUJ 1S3JA 2K88A 1FZFA 3L74E 3M91A 1VL2A 2YMYA 3MUDC 2Y9YA 2QE7H 4YPCA 1YJWP 1M56D 3T97A 5L8RJ 1PGJA 2HPCB 1Y47A 4DJGA 1RF0A 1DD3A 1VQ5P 4XFJA 1S9KE 3K5BA 3HD7B 2QJPB 3GMAA 2KYVA 2Y0CA 4PD4D 2IZ1A 1L4AD 3LIEA 2PGDA 1L2PA 5APQA 5B66H 5AW2B 2KZIA 1ZN5A 1N86A 3H1JD 4D6TG 4JYCA 3Q2YA 1W5CE 2Q6QA 1FOSF 4JF7A 1N2DC 3AE9C 1FZBA 1M7LA 1R8EA 1RF1B 1GK4A 1FDIA 2YKOA 3TGUD 2QJYC 5E79E 1VQOP 1NJIQ 4QMAA 4N3YB 3LIDA 2RN0A 1NTKJ 5AVRB 2HG5D 2M5AA 3MD0A 3L35A 1JUNA 1NOHA 3E7KA 1N7LA 3AECC 3A0HE 5KLVG 3H32A 4WY4A 1KORA 1GL2A 1NU1G 3WU2E 3V6IA 2NPSC 1AQTA 4IOIH 2BCCJ 3CMAP 3CC4P 3PJSK 3N4XA 4K35A 2KZJA 2M3BA 3PLNA 3JC22 4PV1B 4WWIA 3PRJA 4L75A 2N1TA 4L74A 1T3JA 1SQBE 4WVZA 1URQD 3B4SA 4WBAA 3CWBE 1NTKD 3E1IA 2Z4EA 2Z5HA 4AUWA 3AEGC 4YXDC 1RQUA 2ZT9C 3CCEP 1NTMJ 2WSCH 3CLQA 1JY3N 1PV3A 1YJNP 1IO4A 3A7OA 2FKWB 3HD7A 4I7ZB 3MTUE 2RH0A 2KLVA 5KAFH 3U1AA 2BCCD 4LC1A 5B66E 1N73A 2FXOA 2WMMA 2P10A 3GF3A 1AV1A 1FZCB 1J1EC 1T2KD 3H1JG 2A45I 3O6QB 4H0LB 3GF7A 4WB4A 1S5LX 4GOFA 2C0WA 1GDTA 3TGUG 1N8RQ 1NTMD 4C7NB 3CX5D 1GW3A 1QVFO 2E76B 4H13C 5KJ7A 2C9NY 3H1KE 3M9HA 2B87A 4DT0A 1EC5A 4Y99C 2B89A 5CCHC 3NMDA 2LXBA 3B5NC 1SP4A 2WVRA 2H88C 3KXDA 1ZMEC 1RE3A 1SQXJ 1QL2A 1XTCC 2YNYA 3V4QA 2XU6A 5CCGD 5BU8B 4LLHA 3CXHH 1KILA 1N7SD 2JEEA 4ZMDA 1LTJC 1IFPA 4BRYB 1GU5A 2HYNA 2P7JA 5TJHA 3RK2B 3CCSP 3KHUA 1SFCC 3TK1A 4N78E 1EXIA 1NTKG 3V2RA 1FJPA 1KV4A 3G9RA 2OYIA 1ZW0A 1L0NJ 1DIPA 4GOEA 1VQNP 5KAFE 3HTKB 2D2CD 1Z56A 3FXDA 1WMKA 4I1LA 2ZJSE 1SQXD 1G1IA 3L70J 2L5GB 2BCCG 1LP1B 1BGYE 3QH9A 1PP9E 2V7QH 3AE1C 5AW0B 1PGPA 2WSFJ 1GTWA 1L0LE 3KZIH 2FXPA 3O6QA 5GTHH 1OZHA 3R4YA 3UIAA 3HE5B 3E1RA 2P1JA 4NPDA 1WT6A 1OVRA 1EZVD 3AE4C 4C7NA 4YXWH 3L74J 3RK3B 3CCMP 4EOTA 1E79H 2Y9ZA 1NTMG 1KD1Q 4BXLA 4I2LC 1VF5B 3CC2P 2JWDA 2H8PD 4RJTA 3V5BA 1L0ND 3RL0B 3RL0g 3TNUA 5AVYB 2E74B 2P2UA 1T8ZA 1J2JB 1BSNA 2KNCA 4GDOA 2YXRB 2R5DA 3V2PA 3L70D 1AA0A 1MV8A 1NYHA 1S72P 2YKPA 2OYHA 2ZXEB 3PTZA 2WPVB 1LT9B 1LTIC 3EQ2A 3CXHE 3VTPC 2K9JB 4BRYA 4H44B 3I5CA 2O1JA 1UIXA 2O01N 1OX3A 2WPRA 2AEFA 3VMYA 5CJ4A 1SQVE 3MIWA 1M1JA 1DX7A 1J1DC 1FZEA 3L74D 3OW2O 1JMMA 4N6JA 1FC2C 1H88A 1X79B 3D6ZA 1FE6A 1Q81Q 1KC8Q 4ZKUA 1KTMA 3L71J 1QGKB 1MKMA 3P7KA 4EDFA 4IFDK 1RF1C 1T6AA 1KN7A 1RY3A 4I6MC 1SQQJ 3L75E 2FFDA 1FZGA 2N9YB 1LP1A 1SQXG 3CCLP 1SS1A 3VMAA 4U7JA 1Q86Q 3KZIE 5GTHE 2R3CA 3AE2C 1VDFA 1GW4A 3L72E 4AQRD 1KZUB 1KILE 1BDDA 1SQBK 1QLED 3SWFA 1EZVG 1KYOD 3L71D 1URQB 2YMKA 1LTTC 2FYUJ 5TISH 1MFZA 1GMJA 2QA4P 2M5AB 1HF9A 2K9YA 1L0NG 4UB8H 2KS1A 1IFDA 1SQQD 1SQPJ 4WY4B 3BASA 1PGOA 3II6A 1GL2B 4LGDE 1M1KQ 1OMIA 1K05A 1QVGO 3ABVC 2O01H 3L70G 2V4HA 2WPQA 1LT9A 3P32A 2OTKE 2OTLP 1L4AA 1G2CA 1PPJE 1KFNA 2ZT9D 1OW8A 3CXHI 1FDOA 3AEAC 1JOCA 2WT7B 4I7ZC 1IZNB 1ZXGA 2E5TA 5CHXA 1IC2A 1YIJP 2XV5A 3L74G 2FYUD 2A06D 1FZCC 1KB9D 1OXZA 3Q3DA 3Q5PA 1U7JA 2XNXA 3C9IA 4K3AA 2XDJA 2E5YA 3H1KJ 1RHZB 1VQPP 1SQPD 3H1LE 1OW7A 3VYIA 2ITAA 1NWQA 1HGZA 5AW6B 5DJTB 2GUSA 2WTYA 1N73B 3G6EP 1YTZT 1HH0A 1NTZE 2E43A 3H1IJ 1E5WA 4H13D 1FU1A 3AE8C 1SVFA 2Q9IA 4PD4H 2E75B 1JB0J 4JPZB 1S4XA 5CMZA 4D6TE 1LWUA 1JM0A 4TLFA 1YQ4C 4OGQB 5CCHD 1HVVA 3PH0A 1URQA 2WSCJ 1PZQA 3KQGA 3B5ND 1Y8AA 5TISE 2IFNA 3M0DA 2WSSH 1SLQA 3SSUA 3L71G 1YI2P 4UB8E 3H1KD 4EIJA 2WWWA 3CCJP 1FJKA 3JSVC 3HUSA 3OAKA 2B87B 2ZXXA 1NAFA 5KAIH 2IFMA 1EZVI 1OWAA 1MFTA 2JDIH 1JY2P 3RK2C 1LGHB 1SQQG 2Y0DA 4U3FJ 3MGNA 1LTGC 4TT3H 2HLOA 2IBZI 3VMXA 1SFCD 1BCCE 2WT7A 1RE4C 3H1ID 4HKZH 4W7YA 1L0LK 1KILB 1OVUA 2HODB 1NVOA 5AW8B 1ZV8A 1FS0E 1H89A 1NKNA 1UIIA 1LNQA 1R5LA 1BDCA 2JWAA 3RK3E 1DH3A 1DD4A 2FYUG 2A06G 3VP8A 2OYIB 2WQYC 1SQPG 2QEXP 1XTGB 2ZYDA 4U3FD 2ZVNB 2FYNB 5M1BA 3PHLA 4IL6X 1HUCA 2QM7A 2R5BA 3L36A 1VQ8P 3HRNA 3RL0C 5CCGA 4JQ0D 2E74C 1GU4A 1JCDA 5KKZB 4ZNCA 1N7SA 1SQVK 2G8YA 1ZR4A 4HB1A 1FOSE 1OIPA 2N1TD 5AVWB 4CPGA 3LW5J 1LT9C 2FBWC 1D7MA 3F5HA 2BEZF 3ITKA 2H43A 1P84D 4H44C 1AVOA 2W6AA 1MUUA 3Q5SA 4MN4C 3TGUE 1W2BO 5KAIE 3TNUB 3H1KG 1NO4A 2W83C 1LJ2A 2KNCB 5AVTB 5EFWB 1TU3F 2IDBA 3CD6P 3BVHA 4ASVA 3HE4A 1JNMA 4A7PA 2OYHB 2R32A 1KQFB 2FY8A 3VN0A 2LXCB 1RF0C 3H1IG 5CBOA 2HODA 1JY3O 1CZQA 1M1JB 3BATA 4C46A 1CW5A 2M0BA 1FDMA 4R4LA 1S5LH 1GK6A 2B88A 3TDKA 3MHVA 3AE7C 2ZFCA 2CPSA 3U59A 5APYA 4EYYQ 2NPSB 2XNDH 3GLMA 3FGAD 1Q90D 1NTKE 1PFIA 2O1KA 5KJ7D 2FFDB 5B5EH 1LT1A 4U3FG 5AVQB 3H1HJ 2DW3A 1HJBA 1LTSC 1QX8A 1ZP0C 2BCCE 2C0XA 4PV1D 1YHQP 3MUDA 2YXQB 2PRRA 2HFED 4WY4C 2IZ0A 1GL2C 4PD4I 1VQ4P 3G3ZA 1HWTC 3I56P 1RH5B 5BU5A 4GT1A 1LTBC 3GW6A 2R44A 1FBMA 2ZAEB 5APXA 3JCUH 2WSEH 3L73E 2N9BA 1OFCX 1NTME 2KS1B 2N1TC 3H1LJ 1ZR2A 3OJAB 3A2AA 5CBNA 2OARA 1MZ9A 2Q3IA 5AVUB 3KPEA 3H1HD 1JTHA 4JYBA 2OQQA 3N7NA 1L4AB 1G2CB 1CI6B 1JY2N 4DOJA 1NTZJ 3EFGA 4GODA 1NTZK 3HD7C 5K5GB 1KQSO 4GIFA 2QJPC 2O3JA 1M8OB 3TYYA 1EXJA 4UB6H 1S5LE 2GUVA 1FAVA 2Q7CA 2WSFH 5H2FH 1N73C 3SWYA 2Q5UA 2M8RA 5CJ0A 2NPSA 1IJDB 1BE3E 4XE5B 3B5NB 1S9KD 1VQKP 2E75C 2BEQD 3H1LD 1NAYA 1VQ9P 4L73A 2O01J 5B5EE 4OGQC 4BWNA 3M06A 1Q7YQ 4W7ZA 3S4RA 1EDLA 4DCKA 5KLIB 1GZLA 1NTZD 1BCCJ 3BRTB 1QEXA 1H0TB 1VQ6P 3TSIA 5KJ7C 1SQXE 3SFEC 2JR8A 3P8CE 1ZRTE 3NXSA 1SQBJ 4YTPC 2YKQA 2E42A 1JO5A 1LWUB 3CWBJ 1A02J 1RE3C 3RK2D 4W80A 4ASWA 3JCUE 4PV1C 2AXCA 1U7MA 1KILC 3BRVB 5DJUB 1EZVE 4JBZA 1S1CX 3HUSB 4C7RA 1WRGA 1PIXA 1YTZI 4DZOA 2LKMA 1KYOH 2K3RA 2OTJP 5APSA 3CX5I 4IFFA 1L0NE 2IBZE 1K04A 3A3YB 2QRXA 4PJ0H 1BCCD 1CI6A 2J58A 3H1HG 5AW4B 2OYIC 4EI2A 3L70E 3A5TA 2JO1A 2OYOA 4UB6E 1SQBD 3CCUP 3CWBD 3CCRP 3P8MC 5H2FE 1Q82Q 3ZDMA 3G71P 3AEDC 3BCCE 3D71A 3WUTA 1NHLA 5CCHA 1PL5A 3B5NA 2NZ2A 1VF5D 4H0LC 3WUVA 2IYPA 2QVAA 3FX0A 1BSHA 3RL0D 5KKZC 1YYCA 2KXPB 3GHGB 2YO3A 3RBXA 2E74D 3RGUA 3H1LG 3CCVP 5AW7B 3M9BA 3QWOC 3GG2A 1AFOA 1LTJA 3CMEP 1KB9H 1ZOYC 2E76C 3A0BH 1H0TA 1IFMA 3WMM0 2A45G 1VPCA 3IR9A 1J1DB 1NTZG 1SFCA 4H44D 1N7SB 5AW3B 1DEEG 2OYHC 3M9QA 3O8ZA 1RQVA 2ZVOB 2KK7A 2YIUB 3U1CA 3AE3C 1M1JC 2W6BA 3C1LA 4HYTB 1NTKK 1KYOE 3D6YA 3L71E 1IK9A 5GTIH 3EWKA 2K37A 2D2CB 5KLVE 4PJ0E 2CK3H 5APUA 1Q2NA 1BGYJ 1PP9J 5APWA 1NU1E 1KQGB 3HE4B 1IFNA 1SQQE 1L0LJ 1BCCG 2ZYAA 1X9VA 1USDA 2W27A 2AEJA 1OW6A 1EDKA 5KTBA
chains in the Genus database with same CATH topology
2HODA 3L37A 1JY3O 4ZKPA 4OH8B 2WPRA 3VMYA 1A02F 1CZQA 2FFDC 1M1JB 5CJ4A 3MIWA 1M1JA 4N78D 1NH4A 3BATA 3KYQA 1DX7A 3RK3D 4C46A 1CW5A 1J1DC 1FZEA 1IFIA 1FDMA 3VMZA 2YO2A 1GK6A 2N1TB 1JMMA 4N6JA 2XKMA 1H88A 1X79B 1FZFA 3M91A 4ZKUA 2YMYA 3GHGA 2ZFCA 2CPSA 3U59A 3NTNA 5APYA 3P7KA 2QM8A 2NPSB 3PP5A 4IFDK 3T97A 1NTMK 1RF1C 2HPCB 1PFIA 2HPCA 2O1KA 3RK3C 1RF0A 5KJ7D 4WY4D 3N4XA 5APVA 1RY3A 1GL2D 1S9KE 4I6MC 3HD7B 2H7HA 2FFDB 2FFDA 1FZGA 2KYVA 2XZRA 1KFMA 5AVQB 1L4AD 3LIEA 1GD2E 1HJBA 1LTSC 5APQA 5BVZA 5AW2B 1ZN5A 1N86A 2C0XA 4JYCA 5AVVB 3MUDA 1KQLA 2HFED 4WY4C 2R3CA 5APTA 1FOSF 1GL2C 4JF7A 1N2DC 3G3ZA 1FZBA 1VDFA 1GW4A 1M7LA 2MJZA 1HWTC 1RF1B 1RF1A 4AQRD 1GK4A 5BU5A 1KZUB 4GT1A 3CL3D 1SQBK 1LTBC 2YKOA 3SWFA 1L4AC 1FBMA 2VRSA 4N3YB 5APXA 3LIDA 1URQB 1LTTC 1ZLLA 2FYZA 2WSEH 5AVRB 1MFZA 2N9BA 3OA7A 2HG5D 3MD0A 3L35A 1JUNA 1NOHA 3HD7D 2N1TC 4RESB 3NFQA 1N7LA 1ZR2A 1IFDA 3OJAB 3A2AA 4WY4B 3BASA 3H32A 4WY4A 2WPSA 2OARA 1GL2B 3II6A 4LGDE 1GL2A 1MZ9A 2Q3IA 2IX7C 5AVUB 3KPEA 2J59M 1JTHB 1AQ5A 2O01H 2NPSC 1JTHA 2WPQA 4JYBA 1LT9A 5AVXB 3V2QA 3P32A 2JJLA 3N7NA 1L4AB 2WITA 1G2CB 1L4AA 1CI6B 1JY2N 1G1JA 1NKZB 1G2CA 1SQXK 1KFNA 3EFGA 2BASA 4GKGA 4DOJA 1NTZK 2M3BA 5AVSB 3HD7C 1JOCA 2WT7B 4GIFA 4M3LA 1H8AA 3TYYA 5CHXA 3CI9A 2N1TA 2GUVA 1IC2A 1FAVA 1T3JA 2Q7CA 2WSFH 1HTLC 1URQD 2XV5A 4WBAA 1N73C 1T3UA 3SWYA 3E1IA 2Z4EA 2Z5HA 2Q5UA 4AUWA 2M8RA 5CJ0A 2NPSA 1IJDB 4XE5B 1FZCC 2WSCH 1OXZA 3CLQA 3B5NB 2XNXA 3C9IA 1JY3N 1S9KD 4IFMA 2XDJA 3LW5H 1IO4A 1LWUC 3A7OA 3VP9A 2FKWB 3HD7A 3MTUE 1URQC 3VYIA 3M06A 1L0NK 4W7ZA 1NWQA 2KLVA 3H6PA 1HGZA 3U1AA 3M0DC 1W2EA 5AW6B 1HGVA 4LC1A 1GZLA 2GUSA 2PP6A 2WTYA 3BRTB 1N73B 1N73A 3HUSC 3P8CD 3TSIA 1YTZT 1HH0A 5KJ7C 1KILD 2E43A 1FZCB 1FZCA 3P8CE 1J1EC 1T2KD 1E5WA 3NXSA 1FU1A 2A45I 1SVFA 2Q9IA 2YKQA 2E42A 1JO5A 1LWUB 1A02J 4WB4A 5CMZA 1LWUA 1RE3C 4KHXA 3RK2D 2C0WA 2I1KA 4W80A 5CCHD 1GDTA 1HVVA 1URQA 3KQGA 3B5ND 5AW1B 2IFNA 4C7NB 3M0DA 1KILC 1SLQA 2C9LY 3BRVB 1GW3A 4EIJA 2WWWA 1T2KC 1FJKA 3V4WA 3HUSB 4C7RA 1LTAC 1WRGA 3HUSA 3OAKA 5KJ7A 2C9NY 3M9HA 1YTZI 1NAFA 4DZOA 2IFMA 2LKMA 1OWAA 1J1EB 1JY2P 5APSA 4IFFA 4Y99C 3RK2C 1LGHB 2FXMA 5CCHC 3NMDA 3B5NC 1SP4A 3A3YB 5AW5B 1RE3A 3MGNA 1LTGC 1QL2A 1XTCC 1CI6A 2J58A 2YNYA 2KB7P 5AW4B 2HLOA 3V4QA 2XU6A 3VMXA 1SFCD 5CCGD 1HBWA 2OYIC 3GHGC 5BU8B 3A5TA 2WT7A 1RE4C 2Z5IA 4W7YA 1L0LK 4LLHA 1KILB 1KILA 1N7SD 2JEEA 1LTJC 5AVZB 2HODB 1GU5A 3P8MC 3V2NA 2HYNA 5AW8B 1IFJA 2P7JA 1JY3P 1ZV8A 1H89A 1NKNA 4Y99B 3RK2B 3L4FA 1SFCC 1NHLA 5CCGC 5CCHA 3TK1A 4N78E 1QL1A 3B5NA 1DH3A 2KP8A 3V2RA 4HH2A 1FJPA 1N7SC 3RL0D 3VP8A 1YYCA 2OYIB 3GHGB 2YO3A 2OYIA 1EQ7A 1RE4A 2I1JA 5AW9B 3HTKB 1Z56A 3HTKA 3M9BA 1LTJB 5AW7B 1AFOA 1LTJA 1XTGB 2KSJA 5KLVK 4I1LA 1DEBA 1G1IA 1NU1K 2L5GB 1SQQK 2POHA 1HUCA 1IFMA 3WMM0 2A45G 2KOGA 2QM7A 4XA4A 2R5BA 4B86A 1VPCA 3IR9A 3L36A 3HRNA 3RL0C 1J1DB 1SFCB 1SFCA 5CCGA 1GU4A 5AW0B 1GTWA 2PAJA 1JCDA 1N7SB 5AW3B 3UIAA 1N7SA 1SQVK 2A45H 3HE5B 3HE5A 2P1JA 1ZR4A 1FZAA 3KDPB 1FOSE 1WT6A 2OYHC 2N1TD 5AVWB 4O9BA 2CPBA 3M9QA 4C7NA 3O8ZA 1LT9C 3M0AA 3RK3B 4EOTA 2H43A 3VOPA 2WZ7A 2W6AA 3U1CA 4I2LC 2NPSD 1MUUA 2GM4A 2H8PD 3V5BA 1M1JC 2W6BA 3RL0B 1JY2O 3TNUB 3R2PA 4HYTB 1JCCA 1NTKK 3TNUA 2FYUK 1NO4A 5AVYB 2P2UA 1IK9A 3IFMA 1T8ZA 1J2JB 5AVTB 2R5DA 3V2PA 1CSBA 5APUA 3BVHA 3B8EB 3H32B 5APWA 1MV8A 3HE4B 1SQPK 3HE4A 1JNMA 2P67A 1IFNA 2OYHB 2R32A 2YKPA 2OYHA 2ZXEB 1LT9B 1LTIC 3EQ2A 1X9VA 3VN0A 3VTPC 2W27A 2IPPA 1X8YA 1RF0C 3I5CA 4AYCA 5KTBA 2O1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2K D;  3L37 A;  3NXS A;  4RES B;  3NFQ A;  2WPR A;  3VMY A;  1A02 F;  1CZQ A;  2E42 A;  5AW9 B;  3A2A A;  1A02 J;  3HTK A;  5CMZ A;  3M9B A;  5AW7 B;  4C46 A;  2WPS A;  2Q3I A;  5AVU B;  3VMZ A;  4KHX A;  2YO2 A;  1GK6 A;  2WPQ A;  4JYB A;  3KQG A;  5AVX B;  5AW1 B;  1H88 A;  1HUC A;  3M91 A;  2QM7 A;  4C7N B;  3M0D A;  2JJL A;  2R5B A;  3P32 A;  4B86 A;  3L36 A;  3IR9 A;  1SLQ A;  1CI6 B;  1G2C B;  2C9L Y;  4GKG A;  2ZFC A;  2BAS A;  3NTN A;  5APY A;  3P7K A;  2QM8 A;  5AVS B;  5AW0 B;  1T2K C;  2WWW A;  1GTW A;  1GU4 A;  3T97 A;  3V4W A;  2WT7 B;  3OAK A;  4M3L A;  1H8A A;  2C9N Y;  3TYY A;  5AW3 B;  3M9H A;  3UIA A;  1NAF A;  3HE5 B;  4DZO A;  3HE5 A;  5APV A;  1OWA A;  3KDP B;  5APS A;  1S9K E;  1FOS E;  4I6M C;  1FAV A;  2H7H A;  2Q7C A;  3NMD A;  5AVW B;  1SP4 A;  2XV5 A;  4C7N A;  3A3Y B;  3O8Z A;  5AW5 B;  3MGN A;  2XZR A;  3M0A A;  5AVQ B;  1CI6 A;  2YNY A;  4EOT A;  4AUW A;  5AW4 B;  2Z5H A;  2Q5U A;  3LIE A;  3V4Q A;  2XU6 A;  1GD2 E;  3VMX A;  4XE5 B;  1HJB A;  1HBW A;  2W6A A;  4I2L C;  3A5T A;  1OXZ A;  5APQ A;  5AW2 B;  1MUU A;  2WT7 A;  2Z5I A;  1S9K D;  3V5B A;  4JYC A;  5AVV B;  3TNU B;  4HYT B;  1IO4 A;  1KQL A;  3TNU A;  2R3C A;  3A7O A;  5AVZ B;  5APT A;  5AVY B;  2P2U A;  1FOS F;  1HWT C;  1J2J B;  1GU5 A;  3P8M C;  5AVT B;  1GK4 A;  4AQR D;  4GT1 A;  3VYI A;  2R5D A;  3M06 A;  2P7J A;  5AW8 B;  1NWQ A;  1CSB A;  5APU A;  3B8E B;  3SWF A;  1H89 A;  5APW A;  5AW6 B;  1MV8 A;  3HE4 B;  3HE4 A;  1JNM A;  4LC1 A;  1GZL A;  2P67 A;  2VRS A;  2R32 A;  5APX A;  3TK1 A;  2WTY A;  2ZXE B;  3LID A;  1DH3 A;  2KP8 A;  3VN0 A;  5AVR B;  2W27 A;  3VTP C;  2IPP A;  1MFZ A;  2N9B A;  1X8Y A;  2E43 A;  1YYC A;  3I5C A;  3MD0 A;  3L35 A;  4AYC A;  1JUN A;  2YO3 A; 
#chains in the Genus database with same CATH topology
 1SQB G;  4KT0 J;  4ZKP A;  2QG4 A;  3Q5R A;  2FFD C;  4N78 D;  3CWB G;  2L91 A;  2RMZ A;  1X0T A;  1IFI A;  3VMZ A;  1YBK A;  2QJK B;  2YO2 A;  3L73 J;  1EDJ A;  3GHG A;  2JKV A;  3NTN A;  2QM8 A;  3PP5 A;  1NTM K;  2FYU E;  2HPC A;  2A06 E;  4OWF A;  1PGQ A;  3RK3 C;  4WY4 D;  3FWN A;  5APV A;  1KB9 E;  1GL2 D;  2M3E A;  3I55 P;  1BGY D;  2H7H A;  1PP9 D;  3A0B E;  1VF5 C;  2B9B A;  1L0L D;  2XZR A;  1KFM A;  1SQP E;  4RO0 A;  1GD2 E;  4NPF X;  4PD4 E;  5BVZ A;  5C39 A;  1SQV J;  1USE A;  5AVV B;  1KQL A;  5APT A;  4R4M A;  3IN6 A;  3H1J E;  2MJZ A;  1RF1 A;  2Y0E A;  1JMB A;  3B71 A;  3CL3 D;  3G4S P;  3WUU A;  1L4A C;  2Q3E A;  2VRS A;  3L73 D;  1BE3 J;  3AE6 C;  1ZLL A;  2FYZ A;  2KUB A;  3OA7 A;  5GTI E;  1R5S A;  3L75 J;  2PFX A;  3HD7 D;  4RES B;  3NFQ A;  3CX5 H;  1KYO I;  1YJ9 P;  3FWL A;  1P84 H;  2WPS A;  2V7Q J;  3CXH D;  2IX7 C;  2Q1K A;  3MP7 B;  2J59 M;  1JTH B;  1AQ5 A;  1K73 Q;  5AVX B;  2P58 A;  2W90 A;  3USS A;  3V2Q A;  4IL6 H;  2JJL A;  2QJY B;  2WIT A;  1SQV D;  1NKZ B;  1G1J A;  1SQX K;  4GKG A;  3TF5 A;  1M90 Q;  2BAS A;  3Q1M A;  1EDI A;  5AVS B;  3L72 J;  3SWK A;  4M3L A;  2JP3 A;  1H8A A;  2E75 D;  1JEK A;  3H1I E;  3CI9 A;  2AXT H;  5KLI C;  4OGQ D;  1HTL C;  1BE3 D;  2WSE J;  1T3U A;  1S2E A;  3EFF K;  3FXE A;  1VQL P;  2AEM A;  2IYO A;  4IFM A;  3L75 D;  3LW5 H;  1LWU C;  3VP9 A;  2QIW A;  1URQ C;  1L0N K;  1KB9 I;  3H6P A;  1BGY G;  2UWJ E;  3M0D C;  1PP9 G;  1M57 D;  1W2E A;  2RKL A;  1HGV A;  3AE5 C;  3MZW B;  2PP6 A;  1L0L G;  2ZYG A;  3HUS C;  3L72 D;  3P8C D;  4U3F E;  1ZRT D;  3CPW O;  2HR3 A;  1KIL D;  4RKU J;  2ZT9 B;  3AEE C;  1FZC A;  1Y9B A;  1U57 A;  3W67 A;  4Y28 J;  3S9O A;  1YIT P;  4KHX A;  3BCC J;  2I1K A;  3F89 A;  5AW1 B;  2QSI A;  2LR2 A;  3L73 G;  2W8Z A;  2C9L Y;  1T2K C;  3CX5 E;  3V4W A;  1LTA C;  1X22 A;  2H89 C;  1P84 E;  3D70 A;  2IBZ D;  4L76 A;  1J1E B;  3IAO A;  3C8V A;  2FXM A;  3AEF C;  1PPJ D;  1NGM B;  4IL6 E;  5AW5 B;  2KB7 P;  3RBZ A;  1HJ0 A;  2KI7 B;  1HBW A;  1IK7 A;  3GHG C;  4KJM A;  2Z5I A;  1SQV G;  4H0L D;  4D6T J;  2W6J H;  5AVZ B;  1K9M Q;  3CCQ P;  4H13 B;  2NRG A;  2AXT E;  3IF4 A;  3V2N A;  1YQ3 C;  3BCC D;  1IFJ A;  1JY3 P;  3S1K A;  4Y99 B;  2K1A A;  3L4F A;  3W68 A;  5CCG C;  1BE3 G;  2E76 D;  1QL1 A;  2KP8 A;  4HH2 A;  4NPE A;  1N7S C;  3L75 G;  1K8A Q;  1EQ7 A;  1RE4 A;  2I1J A;  3T97 B;  5AW9 B;  3HTK A;  1LTJ B;  5KLV J;  2KSJ A;  5KLV K;  1DEB A;  1NU1 J;  1NU1 K;  2YIU C;  1SQQ K;  2POH A;  4Z1M H;  2KOG A;  4XA4 A;  4B86 A;  1SFC B;  4D6T D;  2KLU A;  2I8D A;  3L72 G;  2PAJ A;  2KSE A;  1VQ7 P;  2R3S A;  2D2C C;  2A45 H;  4HJG H;  3HE5 A;  1AVY A;  1FZA A;  3KDP B;  4O9B A;  2CPB A;  3M0A A;  3AEB C;  5E79 H;  3VOP A;  2J5U A;  2WZ7 A;  2NPS D;  2GM4 A;  1AJY A;  3SFD C;  1JY2 O;  1KMI Z;  3R2P A;  1JCC A;  2FYU K;  3IFM A;  5KLV D;  2QJK C;  1P84 I;  2IBZ G;  1NU1 D;  2GA1 A;  1CSB A;  3A0H H;  3CC7 P;  3B8E B;  3H32 B;  1PPJ G;  1SQP K;  1VQM P;  2P67 A;  3WU2 H;  3H25 A;  2G3A A;  2IPP A;  2K9J A;  1X8Y A;  3H1H E;  4OVN F;  4AYC A;  2OGU A;  3L37 A;  3H1J J;  2FYN C;  2MKV A;  1OVV A;  4OH8 B;  1A02 F;  1NH4 A;  2SPZ A;  3KYQ A;  3RK3 D;  2KIK A;  3BCC G;  2N1T B;  2XKM A;  3TGU J;  1S3J A;  2K88 A;  1FZF A;  3L74 E;  3M91 A;  1VL2 A;  2YMY A;  3MUD C;  2Y9Y A;  2QE7 H;  4YPC A;  1YJW P;  1M56 D;  3T97 A;  5L8R J;  1PGJ A;  2HPC B;  1Y47 A;  4DJG A;  1RF0 A;  1DD3 A;  1VQ5 P;  4XFJ A;  1S9K E;  3K5B A;  3HD7 B;  2QJP B;  3GMA A;  2KYV A;  2Y0C A;  4PD4 D;  2IZ1 A;  1L4A D;  3LIE A;  2PGD A;  1L2P A;  5APQ A;  5B66 H;  5AW2 B;  2KZI A;  1ZN5 A;  1N86 A;  3H1J D;  4D6T G;  4JYC A;  3Q2Y A;  1W5C E;  2Q6Q A;  1FOS F;  4JF7 A;  1N2D C;  3AE9 C;  1FZB A;  1M7L A;  1R8E A;  1RF1 B;  1GK4 A;  1FDI A;  2YKO A;  3TGU D;  2QJY C;  5E79 E;  1VQO P;  1NJI Q;  4QMA A;  4N3Y B;  3LID A;  2RN0 A;  1NTK J;  5AVR B;  2HG5 D;  2M5A A;  3MD0 A;  3L35 A;  1JUN A;  1NOH A;  3E7K A;  1N7L A;  3AEC C;  3A0H E;  5KLV G;  3H32 A;  4WY4 A;  1KOR A;  1GL2 A;  1NU1 G;  3WU2 E;  3V6I A;  2NPS C;  1AQT A;  4IOI H;  2BCC J;  3CMA P;  3CC4 P;  3PJS K;  3N4X A;  4K35 A;  2KZJ A;  2M3B A;  3PLN A;  3JC2 2;  4PV1 B;  4WWI A;  3PRJ A;  4L75 A;  2N1T A;  4L74 A;  1T3J A;  1SQB E;  4WVZ A;  1URQ D;  3B4S A;  4WBA A;  3CWB E;  1NTK D;  3E1I A;  2Z4E A;  2Z5H A;  4AUW A;  3AEG C;  4YXD C;  1RQU A;  2ZT9 C;  3CCE P;  1NTM J;  2WSC H;  3CLQ A;  1JY3 N;  1PV3 A;  1YJN P;  1IO4 A;  3A7O A;  2FKW B;  3HD7 A;  4I7Z B;  3MTU E;  2RH0 A;  2KLV A;  5KAF H;  3U1A A;  2BCC D;  4LC1 A;  5B66 E;  1N73 A;  2FXO A;  2WMM A;  2P10 A;  3GF3 A;  1AV1 A;  1FZC B;  1J1E C;  1T2K D;  3H1J G;  2A45 I;  3O6Q B;  4H0L B;  3GF7 A;  4WB4 A;  1S5L X;  4GOF A;  2C0W A;  1GDT A;  3TGU G;  1N8R Q;  1NTM D;  4C7N B;  3CX5 D;  1GW3 A;  1QVF O;  2E76 B;  4H13 C;  5KJ7 A;  2C9N Y;  3H1K E;  3M9H A;  2B87 A;  4DT0 A;  1EC5 A;  4Y99 C;  2B89 A;  5CCH C;  3NMD A;  2LXB A;  3B5N C;  1SP4 A;  2WVR A;  2H88 C;  3KXD A;  1ZME C;  1RE3 A;  1SQX J;  1QL2 A;  1XTC C;  2YNY A;  3V4Q A;  2XU6 A;  5CCG D;  5BU8 B;  4LLH A;  3CXH H;  1KIL A;  1N7S D;  2JEE A;  4ZMD A;  1LTJ C;  1IFP A;  4BRY B;  1GU5 A;  2HYN A;  2P7J A;  5TJH A;  3RK2 B;  3CCS P;  3KHU A;  1SFC C;  3TK1 A;  4N78 E;  1EXI A;  1NTK G;  3V2R A;  1FJP A;  1KV4 A;  3G9R A;  2OYI A;  1ZW0 A;  1L0N J;  1DIP A;  4GOE A;  1VQN P;  5KAF E;  3HTK B;  2D2C D;  1Z56 A;  3FXD A;  1WMK A;  4I1L A;  2ZJS E;  1SQX D;  1G1I A;  3L70 J;  2L5G B;  2BCC G;  1LP1 B;  1BGY E;  3QH9 A;  1PP9 E;  2V7Q H;  3AE1 C;  5AW0 B;  1PGP A;  2WSF J;  1GTW A;  1L0L E;  3KZI H;  2FXP A;  3O6Q A;  5GTH H;  1OZH A;  3R4Y A;  3UIA A;  3HE5 B;  3E1R A;  2P1J A;  4NPD A;  1WT6 A;  1OVR A;  1EZV D;  3AE4 C;  4C7N A;  4YXW H;  3L74 J;  3RK3 B;  3CCM P;  4EOT A;  1E79 H;  2Y9Z A;  1NTM G;  1KD1 Q;  4BXL A;  4I2L C;  1VF5 B;  3CC2 P;  2JWD A;  2H8P D;  4RJT A;  3V5B A;  1L0N D;  3RL0 B;  3RL0 g;  3TNU A;  5AVY B;  2E74 B;  2P2U A;  1T8Z A;  1J2J B;  1BSN A;  2KNC A;  4GDO A;  2YXR B;  2R5D A;  3V2P A;  3L70 D;  1AA0 A;  1MV8 A;  1NYH A;  1S72 P;  2YKP A;  2OYH A;  2ZXE B;  3PTZ A;  2WPV B;  1LT9 B;  1LTI C;  3EQ2 A;  3CXH E;  3VTP C;  2K9J B;  4BRY A;  4H44 B;  3I5C A;  2O1J A;  1UIX A;  2O01 N;  1OX3 A;  2WPR A;  2AEF A;  3VMY A;  5CJ4 A;  1SQV E;  3MIW A;  1M1J A;  1DX7 A;  1J1D C;  1FZE A;  3L74 D;  3OW2 O;  1JMM A;  4N6J A;  1FC2 C;  1H88 A;  1X79 B;  3D6Z A;  1FE6 A;  1Q81 Q;  1KC8 Q;  4ZKU A;  1KTM A;  3L71 J;  1QGK B;  1MKM A;  3P7K A;  4EDF A;  4IFD K;  1RF1 C;  1T6A A;  1KN7 A;  1RY3 A;  4I6M C;  1SQQ J;  3L75 E;  2FFD A;  1FZG A;  2N9Y B;  1LP1 A;  1SQX G;  3CCL P;  1SS1 A;  3VMA A;  4U7J A;  1Q86 Q;  3KZI E;  5GTH E;  2R3C A;  3AE2 C;  1VDF A;  1GW4 A;  3L72 E;  4AQR D;  1KZU B;  1KIL E;  1BDD A;  1SQB K;  1QLE D;  3SWF A;  1EZV G;  1KYO D;  3L71 D;  1URQ B;  2YMK A;  1LTT C;  2FYU J;  5TIS H;  1MFZ A;  1GMJ A;  2QA4 P;  2M5A B;  1HF9 A;  2K9Y A;  1L0N G;  4UB8 H;  2KS1 A;  1IFD A;  1SQQ D;  1SQP J;  4WY4 B;  3BAS A;  1PGO A;  3II6 A;  1GL2 B;  4LGD E;  1M1K Q;  1OMI A;  1K05 A;  1QVG O;  3ABV C;  2O01 H;  3L70 G;  2V4H A;  2WPQ A;  1LT9 A;  3P32 A;  2OTK E;  2OTL P;  1L4A A;  1G2C A;  1PPJ E;  1KFN A;  2ZT9 D;  1OW8 A;  3CXH I;  1FDO A;  3AEA C;  1JOC A;  2WT7 B;  4I7Z C;  1IZN B;  1ZXG A;  2E5T A;  5CHX A;  1IC2 A;  1YIJ P;  2XV5 A;  3L74 G;  2FYU D;  2A06 D;  1FZC C;  1KB9 D;  1OXZ A;  3Q3D A;  3Q5P A;  1U7J A;  2XNX A;  3C9I A;  4K3A A;  2XDJ A;  2E5Y A;  3H1K J;  1RHZ B;  1VQP P;  1SQP D;  3H1L E;  1OW7 A;  3VYI A;  2ITA A;  1NWQ A;  1HGZ A;  5AW6 B;  5DJT B;  2GUS A;  2WTY A;  1N73 B;  3G6E P;  1YTZ T;  1HH0 A;  1NTZ E;  2E43 A;  3H1I J;  1E5W A;  4H13 D;  1FU1 A;  3AE8 C;  1SVF A;  2Q9I A;  4PD4 H;  2E75 B;  1JB0 J;  4JPZ B;  1S4X A;  5CMZ A;  4D6T E;  1LWU A;  1JM0 A;  4TLF A;  1YQ4 C;  4OGQ B;  5CCH D;  1HVV A;  3PH0 A;  1URQ A;  2WSC J;  1PZQ A;  3KQG A;  3B5N D;  1Y8A A;  5TIS E;  2IFN A;  3M0D A;  2WSS H;  1SLQ A;  3SSU A;  3L71 G;  1YI2 P;  4UB8 E;  3H1K D;  4EIJ A;  2WWW A;  3CCJ P;  1FJK A;  3JSV C;  3HUS A;  3OAK A;  2B87 B;  2ZXX A;  1NAF A;  5KAI H;  2IFM A;  1EZV I;  1OWA A;  1MFT A;  2JDI H;  1JY2 P;  3RK2 C;  1LGH B;  1SQQ G;  2Y0D A;  4U3F J;  3MGN A;  1LTG C;  4TT3 H;  2HLO A;  2IBZ I;  3VMX A;  1SFC D;  1BCC E;  2WT7 A;  1RE4 C;  3H1I D;  4HKZ H;  4W7Y A;  1L0L K;  1KIL B;  1OVU A;  2HOD B;  1NVO A;  5AW8 B;  1ZV8 A;  1FS0 E;  1H89 A;  1NKN A;  1UII A;  1LNQ A;  1R5L A;  1BDC A;  2JWA A;  3RK3 E;  1DH3 A;  1DD4 A;  2FYU G;  2A06 G;  3VP8 A;  2OYI B;  2WQY C;  1SQP G;  2QEX P;  1XTG B;  2ZYD A;  4U3F D;  2ZVN B;  2FYN B;  5M1B A;  3PHL A;  4IL6 X;  1HUC A;  2QM7 A;  2R5B A;  3L36 A;  1VQ8 P;  3HRN A;  3RL0 C;  5CCG A;  4JQ0 D;  2E74 C;  1GU4 A;  1JCD A;  5KKZ B;  4ZNC A;  1N7S A;  1SQV K;  2G8Y A;  1ZR4 A;  4HB1 A;  1FOS E;  1OIP A;  2N1T D;  5AVW B;  4CPG A;  3LW5 J;  1LT9 C;  2FBW C;  1D7M A;  3F5H A;  2BEZ F;  3ITK A;  2H43 A;  1P84 D;  4H44 C;  1AVO A;  2W6A A;  1MUU A;  3Q5S A;  4MN4 C;  3TGU E;  1W2B O;  5KAI E;  3TNU B;  3H1K G;  1NO4 A;  2W83 C;  1LJ2 A;  2KNC B;  5AVT B;  5EFW B;  1TU3 F;  2IDB A;  3CD6 P;  3BVH A;  4ASV A;  3HE4 A;  1JNM A;  4A7P A;  2OYH B;  2R32 A;  1KQF B;  2FY8 A;  3VN0 A;  2LXC B;  1RF0 C;  3H1I G;  5CBO A;  2HOD A;  1JY3 O;  1CZQ A;  1M1J B;  3BAT A;  4C46 A;  1CW5 A;  2M0B A;  1FDM A;  4R4L A;  1S5L H;  1GK6 A;  2B88 A;  3TDK A;  3MHV A;  3AE7 C;  2ZFC A;  2CPS A;  3U59 A;  5APY A;  4EYY Q;  2NPS B;  2XND H;  3GLM A;  3FGA D;  1Q90 D;  1NTK E;  1PFI A;  2O1K A;  5KJ7 D;  2FFD B;  5B5E H;  1LT1 A;  4U3F G;  5AVQ B;  3H1H J;  2DW3 A;  1HJB A;  1LTS C;  1QX8 A;  1ZP0 C;  2BCC E;  2C0X A;  4PV1 D;  1YHQ P;  3MUD A;  2YXQ B;  2PRR A;  2HFE D;  4WY4 C;  2IZ0 A;  1GL2 C;  4PD4 I;  1VQ4 P;  3G3Z A;  1HWT C;  3I56 P;  1RH5 B;  5BU5 A;  4GT1 A;  1LTB C;  3GW6 A;  2R44 A;  1FBM A;  2ZAE B;  5APX A;  3JCU H;  2WSE H;  3L73 E;  2N9B A;  1OFC X;  1NTM E;  2KS1 B;  2N1T C;  3H1L J;  1ZR2 A;  3OJA B;  3A2A A;  5CBN A;  2OAR A;  1MZ9 A;  2Q3I A;  5AVU B;  3KPE A;  3H1H D;  1JTH A;  4JYB A;  2OQQ A;  3N7N A;  1L4A B;  1G2C B;  1CI6 B;  1JY2 N;  4DOJ A;  1NTZ J;  3EFG A;  4GOD A;  1NTZ K;  3HD7 C;  5K5G B;  1KQS O;  4GIF A;  2QJP C;  2O3J A;  1M8O B;  3TYY A;  1EXJ A;  4UB6 H;  1S5L E;  2GUV A;  1FAV A;  2Q7C A;  2WSF H;  5H2F H;  1N73 C;  3SWY A;  2Q5U A;  2M8R A;  5CJ0 A;  2NPS A;  1IJD B;  1BE3 E;  4XE5 B;  3B5N B;  1S9K D;  1VQK P;  2E75 C;  2BEQ D;  3H1L D;  1NAY A;  1VQ9 P;  4L73 A;  2O01 J;  5B5E E;  4OGQ C;  4BWN A;  3M06 A;  1Q7Y Q;  4W7Z A;  3S4R A;  1EDL A;  4DCK A;  5KLI B;  1GZL A;  1NTZ D;  1BCC J;  3BRT B;  1QEX A;  1H0T B;  1VQ6 P;  3TSI A;  5KJ7 C;  1SQX E;  3SFE C;  2JR8 A;  3P8C E;  1ZRT E;  3NXS A;  1SQB J;  4YTP C;  2YKQ A;  2E42 A;  1JO5 A;  1LWU B;  3CWB J;  1A02 J;  1RE3 C;  3RK2 D;  4W80 A;  4ASW A;  3JCU E;  4PV1 C;  2AXC A;  1U7M A;  1KIL C;  3BRV B;  5DJU B;  1EZV E;  4JBZ A;  1S1C X;  3HUS B;  4C7R A;  1WRG A;  1PIX A;  1YTZ I;  4DZO A;  2LKM A;  1KYO H;  2K3R A;  2OTJ P;  5APS A;  3CX5 I;  4IFF A;  1L0N E;  2IBZ E;  1K04 A;  3A3Y B;  2QRX A;  4PJ0 H;  1BCC D;  1CI6 A;  2J58 A;  3H1H G;  5AW4 B;  2OYI C;  4EI2 A;  3L70 E;  3A5T A;  2JO1 A;  2OYO A;  4UB6 E;  1SQB D;  3CCU P;  3CWB D;  3CCR P;  3P8M C;  5H2F E;  1Q82 Q;  3ZDM A;  3G71 P;  3AED C;  3BCC E;  3D71 A;  3WUT A;  1NHL A;  5CCH A;  1PL5 A;  3B5N A;  2NZ2 A;  1VF5 D;  4H0L C;  3WUV A;  2IYP A;  2QVA A;  3FX0 A;  1BSH A;  3RL0 D;  5KKZ C;  1YYC A;  2KXP B;  3GHG B;  2YO3 A;  3RBX A;  2E74 D;  3RGU A;  3H1L G;  3CCV P;  5AW7 B;  3M9B A;  3QWO C;  3GG2 A;  1AFO A;  1LTJ A;  3CME P;  1KB9 H;  1ZOY C;  2E76 C;  3A0B H;  1H0T A;  1IFM A;  3WMM 0;  2A45 G;  1VPC A;  3IR9 A;  1J1D B;  1NTZ G;  1SFC A;  4H44 D;  1N7S B;  5AW3 B;  1DEE G;  2OYH C;  3M9Q A;  3O8Z A;  1RQV A;  2ZVO B;  2KK7 A;  2YIU B;  3U1C A;  3AE3 C;  1M1J C;  2W6B A;  3C1L A;  4HYT B;  1NTK K;  1KYO E;  3D6Y A;  3L71 E;  1IK9 A;  5GTI H;  3EWK A;  2K37 A;  2D2C B;  5KLV E;  4PJ0 E;  2CK3 H;  5APU A;  1Q2N A;  1BGY J;  1PP9 J;  5APW A;  1NU1 E;  1KQG B;  3HE4 B;  1IFN A;  1SQQ E;  1L0L J;  1BCC G;  2ZYA A;  1X9V A;  1USD A;  2W27 A;  2AEJ A;  1OW6 A;  1EDK A;  5KTB A; 
#chains in the Genus database with same CATH homology
 2HOD A;  3L37 A;  1JY3 O;  4ZKP A;  4OH8 B;  2WPR A;  3VMY A;  1A02 F;  1CZQ A;  2FFD C;  1M1J B;  5CJ4 A;  3MIW A;  1M1J A;  4N78 D;  1NH4 A;  3BAT A;  3KYQ A;  1DX7 A;  3RK3 D;  4C46 A;  1CW5 A;  1J1D C;  1FZE A;  1IFI A;  1FDM A;  3VMZ A;  2YO2 A;  1GK6 A;  2N1T B;  1JMM A;  4N6J A;  2XKM A;  1H88 A;  1X79 B;  1FZF A;  3M91 A;  4ZKU A;  2YMY A;  3GHG A;  2ZFC A;  2CPS A;  3U59 A;  3NTN A;  5APY A;  3P7K A;  2QM8 A;  2NPS B;  3PP5 A;  4IFD K;  3T97 A;  1NTM K;  1RF1 C;  2HPC B;  1PFI A;  2HPC A;  2O1K A;  3RK3 C;  1RF0 A;  5KJ7 D;  4WY4 D;  3N4X A;  5APV A;  1RY3 A;  1GL2 D;  1S9K E;  4I6M C;  3HD7 B;  2H7H A;  2FFD B;  2FFD A;  1FZG A;  2KYV A;  2XZR A;  1KFM A;  5AVQ B;  1L4A D;  3LIE A;  1GD2 E;  1HJB A;  1LTS C;  5APQ A;  5BVZ A;  5AW2 B;  1ZN5 A;  1N86 A;  2C0X A;  4JYC A;  5AVV B;  3MUD A;  1KQL A;  2HFE D;  4WY4 C;  2R3C A;  5APT A;  1FOS F;  1GL2 C;  4JF7 A;  1N2D C;  3G3Z A;  1FZB A;  1VDF A;  1GW4 A;  1M7L A;  2MJZ A;  1HWT C;  1RF1 B;  1RF1 A;  4AQR D;  1GK4 A;  5BU5 A;  1KZU B;  4GT1 A;  3CL3 D;  1SQB K;  1LTB C;  2YKO A;  3SWF A;  1L4A C;  1FBM A;  2VRS A;  4N3Y B;  5APX A;  3LID A;  1URQ B;  1LTT C;  1ZLL A;  2FYZ A;  2WSE H;  5AVR B;  1MFZ A;  2N9B A;  3OA7 A;  2HG5 D;  3MD0 A;  3L35 A;  1JUN A;  1NOH A;  3HD7 D;  2N1T C;  4RES B;  3NFQ A;  1N7L A;  1ZR2 A;  1IFD A;  3OJA B;  3A2A A;  4WY4 B;  3BAS A;  3H32 A;  4WY4 A;  2WPS A;  2OAR A;  1GL2 B;  3II6 A;  4LGD E;  1GL2 A;  1MZ9 A;  2Q3I A;  2IX7 C;  5AVU B;  3KPE A;  2J59 M;  1JTH B;  1AQ5 A;  2O01 H;  2NPS C;  1JTH A;  2WPQ A;  4JYB A;  1LT9 A;  5AVX B;  3V2Q A;  3P32 A;  2JJL A;  3N7N A;  1L4A B;  2WIT A;  1G2C B;  1L4A A;  1CI6 B;  1JY2 N;  1G1J A;  1NKZ B;  1G2C A;  1SQX K;  1KFN A;  3EFG A;  2BAS A;  4GKG A;  4DOJ A;  1NTZ K;  2M3B A;  5AVS B;  3HD7 C;  1JOC A;  2WT7 B;  4GIF A;  4M3L A;  1H8A A;  3TYY A;  5CHX A;  3CI9 A;  2N1T A;  2GUV A;  1IC2 A;  1FAV A;  1T3J A;  2Q7C A;  2WSF H;  1HTL C;  1URQ D;  2XV5 A;  4WBA A;  1N73 C;  1T3U A;  3SWY A;  3E1I A;  2Z4E A;  2Z5H A;  2Q5U A;  4AUW A;  2M8R A;  5CJ0 A;  2NPS A;  1IJD B;  4XE5 B;  1FZC C;  2WSC H;  1OXZ A;  3CLQ A;  3B5N B;  2XNX A;  3C9I A;  1JY3 N;  1S9K D;  4IFM A;  2XDJ A;  3LW5 H;  1IO4 A;  1LWU C;  3A7O A;  3VP9 A;  2FKW B;  3HD7 A;  3MTU E;  1URQ C;  3VYI A;  3M06 A;  1L0N K;  4W7Z A;  1NWQ A;  2KLV A;  3H6P A;  1HGZ A;  3U1A A;  3M0D C;  1W2E A;  5AW6 B;  1HGV A;  4LC1 A;  1GZL A;  2GUS A;  2PP6 A;  2WTY A;  3BRT B;  1N73 B;  1N73 A;  3HUS C;  3P8C D;  3TSI A;  1YTZ T;  1HH0 A;  5KJ7 C;  1KIL D;  2E43 A;  1FZC B;  1FZC A;  3P8C E;  1J1E C;  1T2K D;  1E5W A;  3NXS A;  1FU1 A;  2A45 I;  1SVF A;  2Q9I A;  2YKQ A;  2E42 A;  1JO5 A;  1LWU B;  1A02 J;  4WB4 A;  5CMZ A;  1LWU A;  1RE3 C;  4KHX A;  3RK2 D;  2C0W A;  2I1K A;  4W80 A;  5CCH D;  1GDT A;  1HVV A;  1URQ A;  3KQG A;  3B5N D;  5AW1 B;  2IFN A;  4C7N B;  3M0D A;  1KIL C;  1SLQ A;  2C9L Y;  3BRV B;  1GW3 A;  4EIJ A;  2WWW A;  1T2K C;  1FJK A;  3V4W A;  3HUS B;  4C7R A;  1LTA C;  1WRG A;  3HUS A;  3OAK A;  5KJ7 A;  2C9N Y;  3M9H A;  1YTZ I;  1NAF A;  4DZO A;  2IFM A;  2LKM A;  1OWA A;  1J1E B;  1JY2 P;  5APS A;  4IFF A;  4Y99 C;  3RK2 C;  1LGH B;  2FXM A;  5CCH C;  3NMD A;  3B5N C;  1SP4 A;  3A3Y B;  5AW5 B;  1RE3 A;  3MGN A;  1LTG C;  1QL2 A;  1XTC C;  1CI6 A;  2J58 A;  2YNY A;  2KB7 P;  5AW4 B;  2HLO A;  3V4Q A;  2XU6 A;  3VMX A;  1SFC D;  5CCG D;  1HBW A;  2OYI C;  3GHG C;  5BU8 B;  3A5T A;  2WT7 A;  1RE4 C;  2Z5I A;  4W7Y A;  1L0L K;  4LLH A;  1KIL B;  1KIL A;  1N7S D;  2JEE A;  1LTJ C;  5AVZ B;  2HOD B;  1GU5 A;  3P8M C;  3V2N A;  2HYN A;  5AW8 B;  1IFJ A;  2P7J A;  1JY3 P;  1ZV8 A;  1H89 A;  1NKN A;  4Y99 B;  3RK2 B;  3L4F A;  1SFC C;  1NHL A;  5CCG C;  5CCH A;  3TK1 A;  4N78 E;  1QL1 A;  3B5N A;  1DH3 A;  2KP8 A;  3V2R A;  4HH2 A;  1FJP A;  1N7S C;  3RL0 D;  3VP8 A;  1YYC A;  2OYI B;  3GHG B;  2YO3 A;  2OYI A;  1EQ7 A;  1RE4 A;  2I1J A;  5AW9 B;  3HTK B;  1Z56 A;  3HTK A;  3M9B A;  1LTJ B;  5AW7 B;  1AFO A;  1LTJ A;  1XTG B;  2KSJ A;  5KLV K;  4I1L A;  1DEB A;  1G1I A;  1NU1 K;  2L5G B;  1SQQ K;  2POH A;  1HUC A;  1IFM A;  3WMM 0;  2A45 G;  2KOG A;  2QM7 A;  4XA4 A;  2R5B A;  4B86 A;  1VPC A;  3IR9 A;  3L36 A;  3HRN A;  3RL0 C;  1J1D B;  1SFC B;  1SFC A;  5CCG A;  1GU4 A;  5AW0 B;  1GTW A;  2PAJ A;  1JCD A;  1N7S B;  5AW3 B;  3UIA A;  1N7S A;  1SQV K;  2A45 H;  3HE5 B;  3HE5 A;  2P1J A;  1ZR4 A;  1FZA A;  3KDP B;  1FOS E;  1WT6 A;  2OYH C;  2N1T D;  5AVW B;  4O9B A;  2CPB A;  3M9Q A;  4C7N A;  3O8Z A;  1LT9 C;  3M0A A;  3RK3 B;  4EOT A;  2H43 A;  3VOP A;  2WZ7 A;  2W6A A;  3U1C A;  4I2L C;  2NPS D;  1MUU A;  2GM4 A;  2H8P D;  3V5B A;  1M1J C;  2W6B A;  3RL0 B;  1JY2 O;  3TNU B;  3R2P A;  4HYT B;  1JCC A;  1NTK K;  3TNU A;  2FYU K;  1NO4 A;  5AVY B;  2P2U A;  1IK9 A;  3IFM A;  1T8Z A;  1J2J B;  5AVT B;  2R5D A;  3V2P A;  1CSB A;  5APU A;  3BVH A;  3B8E B;  3H32 B;  5APW A;  1MV8 A;  3HE4 B;  1SQP K;  3HE4 A;  1JNM A;  2P67 A;  1IFN A;  2OYH B;  2R32 A;  2YKP A;  2OYH A;  2ZXE B;  1LT9 B;  1LTI C;  3EQ2 A;  1X9V A;  3VN0 A;  3VTP C;  2W27 A;  2IPP A;  1X8Y A;  1RF0 C;  3I5C A;  4AYC A;  5KTB A;  2O1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...