3HD7B

Helical extension of the neuronal snare complex into the membrane, spacegroup c 1 2 1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
98
structure length
98
Chain Sequence
b'KQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 2
molecule tags Exocytosis
source organism Rattus norvegicus
publication title Helical extension of the neuronal SNARE complex into the membrane
pubmed doi rcsb
total genus 42
structure length 98
sequence length 98
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05739 SNARE SNARE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3hd7B00
1KILB 2N1TD 1N7SD 1KILA 2N1TA 1L4AA 4OH8B 3RK3B 2HFED 2PP6A 4W7ZA 1L4AD 4LGDE 3RK2B 2NPSC 1KILD 2N1TB 2HG5D 1URQD 1URQA 4WY4C 1URQC 4WY4A 4WY4D 1N7SC 1GL2C 3RK3C 1XTGB 3P8CE 1GL2D 1L4AC 3RK3D 2NPSB 2KOGA 1KILC 1SFCD 5KJ7D 2H8PD 1N7SB 3RL0B 5CCHA 1GL2B 1JTHB 4JF7A 3HD7B 3HD7D 1SFCC 5KJ7C 3B5ND 5CCGD 4N78E 3RL0C 3M0DC 2M8RA 1T3JA 3RL0D 2WZ7A 3B5NA 3TSIA 1SFCB 4W80A 3B5NC 5CCGC 3HD7C 4W7YA 2XDJA 1SFCA 1GL2A 1NHLA 5CCHD 5CCHC 3KYQA 2NPSA 3VOPA 3B5NB 5KJ7A 2N1TC 2NPSD 3PP5A 3HD7A 5CCGA 4WY4B 1HVVA 1JTHA 3RK2C 1N7SA 2YMYA 3RK2D 3HTKB 1L4AB 1URQB
chains in the Genus database with same CATH superfamily
1JY2O 1M90Q 3M0DA 2YO3A 2BEQD 3FXDA 1NGMB 4H13D 5APQA 1L4AA 4JQ0D 4EI2A 3CWBJ 2HFED 3U1CA 4U3FE 1FJPA 3OA7A 2IYOA 5CHXA 2KUBA 1L0NG 1X9VA 1W5CE 3CI9A 1MZ9A 1SQPE 1SQQG 1IK9A 3CWBE 2QVAA 3L72G 1LJ2A 1FZEA 1NU1E 1JM0A 2FYUD 2K3RA 1YQ4C 2N1TB 3HE4A 3JSVC 3GHGC 3N7NA 1YJWP 2IBZE 1VQ5P 5KLVJ 3CCVP 4PD4H 5H2FH 2Z4EA 1KYOE 2Q3EA 1GK6A 3BVHA 2YXQB 4WY4A 2FYNC 1BE3G 3AEBC 1BSNA 1VDFA 3A2AA 4PV1D 5KAIH 1Q82Q 4WY4D 1M1JA 4AQRD 2FFDB 3LIDA 1EDJA 2JDIH 3VMAA 2E43A 1IJDB 1WMKA 1XTGB 2D2CB 1IFNA 3TGUG 2OYHB 2WPVB 2IYPA 4AUWA 3GMAA 3H25A 1VQMP 1K9MQ 2NPSB 1EZVE 4JBZA 5L8RJ 1ZW0A 3D6ZA 2FBWC 2FXPA 2KOGA 3MHVA 1GW3A 1SQQJ 1LT9B 3AEFC 2IBZD 5KJ7D 1NAYA 1SP4A 4HYTB 1PP9G 5AVRB 4K35A 3S1KA 1M57D 3P7KA 4GKGA 3SWYA 4UB8H 5AVUB 1KQSO 5APTA 1U7MA 3G6EP 1GK4A 3OJAB 3L73J 4IL6H 4U3FD 1NKZB 2Y0DA 5APYA 1JTHB 3RGUA 2WSFJ 1NU1G 1IO4A 5AW6B 1J1DC 3IF4A 3CMEP 1H0TB 2JR8A 3M06A 1KN7A 3CC7P 1NTZE 1LP1A 4WBAA 1H89A 2HR3A 5KLIB 1N2DC 1Y47A 1GMJA 3NFQA 4PD4I 5GTHH 2A45G 3CPWO 2FFDC 2KLUA 4GT1A 1P84D 1QGKB 3PHLA 2OARA 3B8EB 1Q90D 2HODB 1VF5C 2D2CC 5CJ0A 5AW8B 2H89C 2WTYA 2OYHC 1HF9A 1KB9I 4U7JA 1IZNB 3NTNA 1MKMA 1ZV8A 1J1EC 1AA0A 2QJYB 1GD2E 1KB9D 3KZIH 5M1BA 3RL0D 1SQVG 2K37A 2Y0CA 4GIFA 3CCUP 1S5LH 5C39A 3H1JE 2JEEA 2K1AA 4I7ZB 3V4QA 1ZLLA 3H32A 3CL3D 2C0WA 3FXEA 3HUSA 1VQPP 1SQXE 2ZVOB 1EDIA 1IFJA 1MUUA 2AEJA 2QIWA 4IOIH 4L74A 1Y8AA 2ZT9B 4NPFX 5AVYB 3B5NC 4Y28J 2HLOA 4C7NB 2CK3H 1NTZD 2P7JA 3L73G 1RE4C 2KSEA 2V7QJ 5AW7B 3H1KE 3U59A 4KJMA 3L71G 5BU8B 2ZJSE 1VF5B 1WT6A 1PGQA 2XDJA 3AECC 1PPJG 1NAFA 1SFCA 2OYOA 3L70D 4IFMA 4Y99C 2Q1KA 4BRYB 1ZXGA 4D6TD 1EXJA 3WUTA 1EZVI 1KQLA 1CZQA 4H13B 3RL0g 1NO4A 1CI6A 4R4MA 1USEA 3RBZA 1EZVD 3BRVB 3MP7B 5APVA 2B88A 1FZCA 3MUDC 3EQ2A 3E7KA 4EOTA 4D6TJ 1USDA 1M56D 1ZOYC 3R2PA 2E76C 1R8EA 1LNQA 1R5LA 1JMMA 2QJPC 1PP9D 3B5NB 3H1HJ 3TGUJ 5CJ4A 3LIEA 3HE5A 1S1CX 1Z56A 3HRNA 4EDFA 3TGUE 1PGJA 3CCQP 1KYOD 3CXHE 1GU4A 1CSBA 1H8AA 2OTJP 1IFMA 2UWJE 4L75A 2ZAEB 2KZJA 1LTTC 2FYUE 3AE1C 1NU1D 4PV1B 1NTZK 2A06G 2FXMA 3A0BH 1SQPD 2A06E 1BCCJ 4N78D 3TK1A 4CPGA 3CWBD 2G8YA 1VQ9P 2JWAA 1VQ6P 1N7SA 2YMKA 1G2CA 1NTKD 3L72J 1JY3O 3L75D 2O1JA 2W90A 3V2PA 3W68A 1TU3F 3WUUA 1FZGA 5AW5B 1YIJP 1LWUA 1N73A 2YXRB 1NU1J 3QWOC 1DH3A 3D70A 1URQB 1VQKP 1HBWA 1RF1B 2N1TD 1IC2A 1OW7A 1RF0A 2G3AA 3SFDC 1KILA 1QL1A 1KB9H 2QG4A 3HE4B 2N1TA 1NTKK 3L72D 2K9YA 1SQVE 3H1KJ 3HTKA 2E76B 3IR9A 3RK3B 2C9LY 4LGDE 1LTAC 1AQ5A 3K5BA 4HH2A 1G2CB 2NPSC 3E1RA 2KXPB 1KILD 3JCUE 3L35A 2W6BA 2YKPA 2AXTE 1X79B 3II6A 1KMIZ 1LT9C 1L0ND 2HPCB 1URQA 2BCCJ 3L75G 3CCJP 1GU5A 1LTJA 3RK3E 1N73B 4IFFA 5B66H 2QJKB 1KQFB 5KKZC 1BGYG 2FYZA 2WT7A 3H1JG 2LKMA 3HE5B 2WT7B 3LW5H 1GL2C 2BEZF 2KIKA 3A0HH 4JYCA 1NTMD 2WSSH 3P8CE 4ASVA 3WU2E 1SLQA 2KS1B 1GL2D 3I5CA 3G71P 1L4AC 1OFCX 2KP8A 2P58A 2WWWA 3BCCJ 4C7RA 2HPCA 2WSFH 3SFEC 3L70G 1LTBC 1OZHA 4JYBA 2Y9YA 3L74D 3BATA 5BU5A 1BGYE 5CBOA 3M9QA 5KAIE 1YTZI 4YXWH 2FYNB 4IL6X 3AE9C 1GW4A 1N86A 3IFMA 2P2UA 3V2QA 3I55P 1W2BO 4WVZA 4PJ0H 3RL0B 2WITA 2Q6QA 1Y9BA 3H1IJ 1SQQK 1YBKA 1NTMG 3HD7B 1RF1C 1LTIC 1OX3A 1OVVA 4PD4D 3H1LG 2WSEH 4NPDA 1YJNP 5EFWB 1T3UA 2JO1A 1A02F 2J59M 5AW3B 2H43A 2IX7C 3B5ND 4OGQD 4BXLA 3CCLP 3GF3A 1JCDA 3A3YB 1YITP 3CMAP 2XZRA 1PL5A 1LWUC 2BASA 2E75D 4L73A 1FOSF 2E75B 2KNCB 2V7QH 3H6PA 5GTHE 4IFDK 1DEBA 1QVGO 1OVRA 2FYUG 3V2NA 3VP8A 2LR2A 2KK7A 1LT1A 1NYHA 3H32B 1YQ3C 1SQBG 4H44D 1A02J 1JOCA 4W80A 1BCCD 1KZUB 5DJUB 1FAVA 1VF5D 4MN4C 3CWBG 1AQTA 4YXDC 3L71D 2BCCE 4W7YA 1K04A 1FOSE 2A45H 2WSCJ 4BRYA 1OMIA 5AVZB 1BE3E 2P1JA 2E74C 5KAFH 2R3CA 4GODA 1L0LJ 3AEEC 2KNCA 2MJZA 2R32A 4H44C 3VMZA 2QE7H 1K05A 1X8YA 1FU1A 1YTZT 2B87A 2IBZI 5KLVD 2YO2A 1VQLP 1NTZJ 1N7LA 3VP9A 4GOFA 4I2LC 2WSEJ 1D7MA 2WSCH 1BDDA 5CCHC 2W83C 2POHA 1PV3A 2OGUA 2QM7A 1DD3A 1NTKJ 1P84H 4I1LA 3USSA 2XNDH 1KFNA 1SVFA 3BCCE 3VOPA 5KJ7A 1OW8A 2OTLP 2PFXA 1BSHA 2FFDA 4UB6E 1RE4A 1M1JB 1RF0C 1S9KD 1AJYA 1NOHA 1RQVA 4HB1A 1VQ4P 1RE3C 1FJKA 1NTKG 2GA1A 4Z1MH 2W6JH 1GZLA 1JY2N 3M91A 4M3LA 5K5GB 3AE3C 3E1IA 3KDPB 2GM4A 2E74B 2FY8A 2IFNA 2W6AA 3L74G 2Q7CA 3RK2C 1FDMA 2WPQA 3L73D 3LW5J 1L0NK 1HTLC 1LTJC 1LP1B 2CPSA 1K8AQ 3RK2D 3H1HG 4RO0A 1NVOA 3P32A 3HTKB 1HJBA 1OIPA 1H0TA 2GUVA 1Q2NA 1OVUA 3TF5A 1KYOH 1ZRTD 1KILB 1LGHB 1M7LA 4QMAA 1PPJD 1T2KC 2QJKC 5KKZB 4DJGA 2ZYDA 1QVFO 4D6TG 1FDIA 5E79H 5AW1B 4OH8B 3EWKA 1KV4A 1QX8A 1JY3N 1SQVJ 1S72P 1SQPJ 4W7ZA 3AEAC 1EDKA 1L4AD 3H1LD 3N4XA 2J5UA 3H1IG 1L0LG 4EYYQ 2HG5D 1PZQA 1L0LE 1URQD 1ZP0C 3O6QB 4TLFA 2W8ZA 1RF1A 1PFIA 1SQBD 4WWIA 1URQC 2R44A 3VN0A 3H1HD 2H7HA 1U57A 1S4XA 1N7SC 3AE2C 1XTCC 2R5BA 5APUA 1SQXJ 1ZMEC 2K88A 1JY2P 3RK3C 1T8ZA 1RE3A 3S9OA 3CC4P 2AXTH 2AEFA 1NKNA 2QJYC 3H1HE 3CX5D 3P8MC 4XE5B 3SWKA 1T2KD 1KILC 1DIPA 1RY3A 1PGPA 2B9BA 4N3YB 3KQGA 1L0LD 3MTUE 1FDOA 3QH9A 5AW9B 5APXA 2JKVA 1KFMA 3PTZA 3A0HE 4O9BA 5CCHA 3V2RA 3A5TA 1GL2B 1OXZA 2ZVNB 2XKMA 3WU2H 1KYOI 1T6AA 2B89A 3GHGB 3H1IE 1HJ0A 4DT0A 5GTIE 1S3JA 3KZIE 2JJLA 1SQPG 1SQQE 1HUCA 3O8ZA 2L5GB 3SSUA 4A7PA 1S5LE 1ZN5A 1Q7YQ 3C9IA 3CCRP 2ITAA 2KYVA 3M0AA 5KJ7C 1L2PA 3L73E 4UB8E 1FZAA 4KT0J 4PJ0E 5AW4B 4IL6E 1N73C 1FZCC 2XV5A 2IFMA 2PGDA 3RL0C 4LC1A 1AVOA 2M8RA 1T3JA 2QM8A 3MUDA 3VYIA 3VTPC 3I56P 3Q3DA 4U3FG 3Q2YA 3U1AA 3B5NA 1S9KE 1EDLA 4RKUJ 2KI7B 1KD1Q 5CBNA 1EQ7A 1FE6A 2KB7P 4XA4A 3BCCD 4KHXA 3H1JJ 3FWNA 5AVSB 3TYYA 3UIAA 5TISH 1SFCB 3Q5SA 3T97B 1Q86Q 3OAKA 5B5EE 4RESB 1J2JB 1EZVG 2QJPB 2O1KA 2ZFCA 3PLNA 5CCGC 1KC8Q 1K73Q 1IFIA 2MKVA 1NU1K 1SQQD 1M8OB 4XFJA 2O01H 5KLVE 2QEXP 1FC2C 3H1ID 2N9YB 3MD0A 5KLIC 4ASWA 4C7NA 1S2EA 2E75C 1FZCB 2M3BA 1BE3D 3HUSB 3IN6A 4RJTA 1AFOA 1J1EB 1M1JC 1H88A 3BASA 5BVZA 2YIUC 1DD4A 1RHZB 1L0NJ 2RN0A 1X22A 1QLED 3RBXA 1G1JA 3CX5E 3TDKA 2BCCD 1LT9A 5CCHD 3GHGA 2E76D 3Q5RA 1YI2P 3AE4C 4DZOA 3A0BE 2FYUJ 3KYQA 4I6MC 1VQOP 2NPSA 3L70J 1L0LK 1SQVK 4HKZH 2YKQA 4LLHA 2HODA 1NJIQ 4OGQB 2ZT9C 1G1IA 3EFGA 1VL2A 2E74D 1HGZA 2D2CD 3MZWB 2VRSA 2ZYGA 3WUVA 1SQXG 5AW2B 3CCMP 1SQBE 2NPSD 3PP5A 2H88C 1QL2A 3HD7A 1CW5A 1VQNP 2A45I 4WB4A 4WY4B 1JCCA 1HVVA 4H0LD 3CC2P 3GLMA 3H1LE 4Y99B 5AVQB 4L76A 1EXIA 4YTPC 2YMYA 3H1LJ 1AV1A 1JO5A 2OYIB 3JCUH 1NWQA 1KQGB 2QA4P 2M5AB 1PPJE 1L4AB 2WVRA 1ZRTE 2I8DA 2O01J 3G9RA 4PD4E 5H2FE 2QRXA 2V4HA 1N7SD 4C46A 1HH0A 1M1KQ 2RMZA 2WPSA 2WQYC 4NPEA 2OYHA 1VPCA 3W67A 1IFPA 2M5AA 1E79H 1SS1A 2PP6A 3L36A 4ZKPA 2DW3A 2OYIA 1KORA 3RK2B 2L91A 1FZBA 3AE6C 1IK7A 1NTMK 1LTJB 1UIIA 2YNYA 4ZNCA 3CD6P 3D71A 5KTBA 2ZXXA 4EIJA 4H0LC 4WY4C 2Q9IA 1VQ7P 3D6YA 3KPEA 5APWA 4TT3H 1RH5B 1UIXA 3V5BA 2HYNA 3CLQA 1BGYJ 1JB0J 5E79E 3WMM0 5AVWB 2IZ0A 1NTME 2PAJA 3FWLA 2Y0EA 3EFFK 3IAOA 3C1LA 2FKWB 1J1DB 2KZIA 2IBZG 1Q81Q 3Q1MA 4N6JA 2E5YA 3RK3D 2RH0A 1KTMA 2IPPA 2SPZA 1RQUA 2ZT9D 1MV8A 2ZYAA 1QEXA 3ITKA 1YYCA 2K9JB 4HJGH 1NH4A 1SFCD 1L0NE 3CX5I 1VQ8P 5AVXB 1HGVA 1LWUB 3JC22 5AW0B 5B66E 1KILE 2NZ2A 2H8PD 3GW6A 2IDBA 1PGOA 2JP3A 3FGAD 3TNUA 2KLVA 1N7SB 1R5SA 2AXCA 1YJ9P 3L37A 4JF7A 1BDCA 1FBMA 3L72E 3FX0A 4GDOA 5AVVB 1FS0E 4H0LB 2B87B 3KHUA 3L71E 4B86A 2WPRA 2E42A 5DJTB 2OQQA 2R5DA 3HD7D 4I7ZC 1BCCE 3T97A 1OW6A 1JNMA 1BCCG 1FZFA 1SFCC 4GOEA 3AE8C 3L75E 4BWNA 1ZR2A 1NTKE 3AE7C 3CCEP 3PRJA 2LXCB 2R3SA 4U3FJ 5CMZA 1P84I 4OWFA 5CCGD 3OW2O 1LTSC 2A06D 4N78E 5GTIH 3AE5C 3M0DC 2PRRA 2AEMA 1W2EA 3BCCG 1MFTA 3M9HA 1X0TA 2Z5IA 2JWDA 1CI6B 2WZ7A 4ZKUA 3G3ZA 3CXHD 2J58A 2O01N 3NMDA 3NXSA 4OVNF 3TSIA 5AVTB 1PP9J 3TGUD 2C9NY 1PP9E 3V6IA 4DOJA 3HUSC 2IZ1A 1S5LX 3V4WA 2M3EA 1LTGC 5KAFE 3MGNA 1NTZG 1NTMJ 1BE3J 1MFZA 4DCKA 1SQXK 5APSA 2O3JA 1AVYA 1EC5A 2Q5UA 2LXBA 2YIUB 3M9BA 2GUSA 3HD7C 3AEDC 3L74J 2M0BA 3VMXA 2OTKE 3R4YA 1JMBA 3F5HA 1JUNA 2I1KA 5KLVK 2XNXA 3ZDMA 1N8RQ 2QSIA 2XU6A 3MIWA 5TISE 4OGQC 2ZXEB 4D6TE 3ABVC 4ZMDA 1IFDA 2E5TA 3L70E 1YHQP 1GL2A 1OWAA 2CPBA 1SQPK 3KXDA 1U7JA 5B5EH 1NHLA 2I1JA 1BGYD 1PIXA 2RKLA 2Z5HA 3AEGC 3H1KD 4UB6H 3L74E 3VMYA 2Q3IA 3CXHH 4PV1C 2KSJA 1SQBJ 2YKOA 2N9BA 2P67A 3P8CD 3PH0A 1SQXD 2C0XA 2BCCG 3L75J 3SWFA 2OYIC 1GDTA 1HWTC 1DX7A 4K3AA 3B71A 4YPCA 3B4SA 4R4LA 2Y9ZA 2N1TC 1SQBK 2NRGA 3H1JD 1JEKA 4AYCA 3GG2A 3CCSP 2W27A 3L4FA 5TJHA 1DEEG 1WRGA 2FYUK 1E5WA 3CX5H 4H13C 5CCGA 3PJSK 3S4RA 3Q5PA 1KB9E 3BRTB 1GTWA 2KS1A 3H1KG 1JTHA 2WMMA 5KLVG 1ZR4A 4JPZB 3TNUB 1SQVD 1P84E 3GF7A 2P10A 1JY3P 2FXOA 4H44B 3G4SP 3C8VA 3F89A 3CXHI 3A7OA 3L71J 2K9JA 3O6QA
chains in the Genus database with same CATH topology
1JY2O 3M0DA 2YO3A 5APQA 1FJPA 1L4AA 3U1CA 2HFED 3OA7A 5CHXA 1X9VA 3CI9A 1MZ9A 1IK9A 4I2LC 1FZEA 2N1TB 3HE4A 3N7NA 3GHGC 2Z4EA 1GK6A 3BVHA 4WY4A 3A2AA 1VDFA 4WY4D 1M1JA 4AQRD 2FFDB 3LIDA 2E43A 1IJDB 1XTGB 2OYHB 1IFNA 4AUWA 1RF1B 2NPSB 2KOGA 1GW3A 1LT9B 5KJ7D 4HYTB 1SP4A 5AVRB 3P7KA 4GKGA 3SWYA 5AVUB 5APTA 1GK4A 3OJAB 5APYA 1NKZB 1JTHB 5AW6B 1J1DC 3M06A 1H89A 4WBAA 1N2DC 3NFQA 2FFDC 2A45G 4GT1A 2OARA 3B8EB 5CJ0A 2HODB 5AW8B 2WTYA 2OYHC 3NTNA 1ZV8A 1J1EC 1GD2E 3RL0D 4GIFA 2JEEA 3V4QA 1ZLLA 3H32A 3CL3D 2C0WA 3HUSA 1IFJA 1MUUA 2Q9IA 5AVYB 3B5NC 2HLOA 4C7NB 2P7JA 1RE4C 5AW7B 3U59A 5BU8B 1WT6A 2XDJA 3T97A 1SFCA 1NAFA 4Y99C 4IFMA 1KQLA 1CZQA 1NO4A 1CI6A 3BRVB 5APVA 4EOTA 3EQ2A 3R2PA 1JMMA 3B5NB 5CJ4A 3LIEA 3HE5A 1Z56A 3HRNA 1GU4A 1H8AA 1CSBA 1IFMA 1LTTC 1NTZK 2FXMA 1N73C 4N78D 3TK1A 1N7SA 1G2CA 1JY3O 1FZGA 2O1JA 3V2PA 1N73A 5AW5B 1LWUA 1DH3A 1URQB 1HBWA 2N1TD 1IC2A 1RF0A 1KILA 1QL1A 3HE4B 2N1TA 1NTKK 3HTKA 3RK3B 2C9LY 4LGDE 1LTAC 1AQ5A 4HH2A 1G2CB 2NPSC 3L35A 1KILD 2W6BA 2YKPA 1X79B 3II6A 2HPCB 1LT9C 1URQA 1GU5A 1LTJA 1N73B 4IFFA 2FYZA 2WT7A 3HE5B 2LKMA 2WT7B 3LW5H 1GL2C 4JYCA 3P8CE 1SLQA 3I5CA 1GL2D 1IO4A 1L4AC 2KP8A 2WWWA 4C7RA 2E42A 2HPCA 2WSFH 1LTBC 4JYBA 3BATA 5BU5A 3M9QA 1YTZI 1GW4A 1N86A 3IFMA 2P2UA 3V2QA 3RL0B 2WITA 1SQQK 1RF1C 3HD7B 1LTIC 2WSEH 1T3UA 1A02F 2J59M 5AW3B 2H43A 2IX7C 3B5ND 1JCDA 3A3YB 2XZRA 1LWUC 2BASA 3H6PA 4IFDK 1DEBA 3VP8A 3V2NA 3H32B 1A02J 1JOCA 4W80A 1KZUB 1FAVA 4W7YA 1FOSE 2A45H 5AVZB 2P1JA 2R3CA 2MJZA 2R32A 3VMZA 1X8YA 1FU1A 1YTZT 2YO2A 1N7LA 3VP9A 2WSCH 5CCHC 2POHA 2QM7A 2OYHA 4I1LA 3VOPA 1KFNA 1SVFA 5KJ7A 2FFDA 1RE4A 1M1JB 1RF0C 1S9KD 1NOHA 1FJKA 1RE3C 1GZLA 1JY2N 3M91A 4M3LA 3E1IA 3KDPB 2GM4A 1FDMA 2IFNA 2W6AA 2Q7CA 3RK2C 2WPQA 1LTJC 1HTLC 1L0NK 2CPSA 3RK2D 1HJBA 3P32A 3HTKB 2GUVA 1KILB 1LGHB 1M7LA 1T2KC 1JO5A 5AW1B 4OH8B 1JY3N 4W7ZA 3N4XA 1L4AD 2HG5D 1URQD 1RF1A 1PFIA 1URQC 3VN0A 2H7HA 1N7SC 1XTCC 2R5BA 5APUA 1JY2P 3RK3C 1T8ZA 1RE3A 4XE5B 1NKNA 1T2KD 3P8MC 1KILC 1RY3A 4N3YB 3KQGA 3MTUE 5AW9B 5APXA 1KFMA 4O9BA 5CCHA 3V2RA 3A5TA 1GL2B 1OXZA 2XKMA 3GHGB 2JJLA 1HUCA 3O8ZA 2L5GB 1ZN5A 3C9IA 2KYVA 3M0AA 5KJ7C 1FZAA 5AW4B 1FZCC 2XV5A 2IFMA 3RL0C 4LC1A 3VYIA 2M8RA 1T3JA 2QM8A 3MUDA 3VTPC 3U1AA 3B5NA 1S9KE 1EQ7A 5AVSB 2KB7P 4XA4A 4KHXA 3UIAA 3TYYA 1SFCB 3OAKA 4RESB 1J2JB 2O1KA 2ZFCA 5CCGC 1IFIA 1NU1K 2O01H 3MD0A 4C7NA 1FZCB 2M3BA 3HUSB 1AFOA 1J1EB 1M1JC 1H88A 3BASA 5BVZA 1FOSF 5CCHD 1G1JA 1LT9A 3GHGA 4DZOA 3KYQA 4I6MC 2NPSA 1L0LK 1SQVK 2YKQA 4LLHA 2HODA 1G1IA 3EFGA 1HGZA 2VRSA 5AW2B 2NPSD 3PP5A 1CW5A 1QL2A 3HD7A 2A45I 4WB4A 4WY4B 1JCCA 1HVVA 4Y99B 5AVQB 2YMYA 2OYIB 1NWQA 1L4AB 1N7SD 4C46A 1HH0A 2WPSA 1VPCA 2PP6A 4ZKPA 3L36A 2OYIA 3RK2B 1FZBA 1NTMK 1LTJB 2YNYA 5KTBA 4EIJA 4WY4C 3KPEA 5APWA 3V5BA 2HYNA 3CLQA 3WMM0 5AVWB 2PAJA 2FKWB 1J1DB 4N6JA 3RK3D 2IPPA 1MV8A 1YYCA 1NH4A 1SFCD 5AVXB 1HGVA 1LWUB 5AW0B 2H8PD 3TNUA 2KLVA 1N7SB 3L37A 4JF7A 1FBMA 5AVVB 4B86A 2WPRA 2R5DA 3HD7D 1JNMA 1FZFA 1SFCC 1ZR2A 5CMZA 5CCGD 1LTSC 4N78E 3M0DC 1W2EA 3M9HA 2Z5IA 4ZKUA 1CI6B 2WZ7A 3G3ZA 3TSIA 2J58A 3NXSA 3NMDA 5AVTB 2C9NY 4DOJA 3HUSC 3V4WA 1LTGC 3MGNA 1MFZA 1SQXK 5APSA 2Q5UA 3M9BA 2GUSA 3HD7C 3VMXA 1JUNA 2I1KA 5KLVK 2XNXA 1FZCA 2XU6A 3MIWA 2ZXEB 1IFDA 1GL2A 1OWAA 2CPBA 1SQPK 1NHLA 2I1JA 2Z5HA 3VMYA 2Q3IA 2KSJA 2YKOA 2N9BA 2P67A 3P8CD 2C0XA 3SWFA 2OYIC 1GDTA 1HWTC 1DX7A 2N1TC 1SQBK 4AYCA 2W27A 3L4FA 1WRGA 2FYUK 1E5WA 5CCGA 1GTWA 3BRTB 1JTHA 1ZR4A 3TNUB 1JY3P 3IR9A 3A7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIL B;  2N1T D;  1N7S D;  1KIL A;  2N1T A;  1L4A A;  4OH8 B;  3RK3 B;  2HFE D;  2PP6 A;  4W7Z A;  1L4A D;  4LGD E;  3RK2 B;  2NPS C;  1KIL D;  2N1T B;  2HG5 D;  1URQ D;  1URQ A;  4WY4 C;  1URQ C;  4WY4 A;  4WY4 D;  1N7S C;  1GL2 C;  3RK3 C;  1XTG B;  3P8C E;  1GL2 D;  1L4A C;  3RK3 D;  2NPS B;  2KOG A;  1KIL C;  1SFC D;  5KJ7 D;  2H8P D;  1N7S B;  3RL0 B;  5CCH A;  1GL2 B;  1JTH B;  4JF7 A;  3HD7 B;  3HD7 D;  1SFC C;  5KJ7 C;  3B5N D;  5CCG D;  4N78 E;  3RL0 C;  3M0D C;  2M8R A;  1T3J A;  3RL0 D;  2WZ7 A;  3B5N A;  3TSI A;  1SFC B;  4W80 A;  3B5N C;  5CCG C;  3HD7 C;  4W7Y A;  2XDJ A;  1SFC A;  1GL2 A;  1NHL A;  5CCH D;  5CCH C;  3KYQ A;  2NPS A;  3VOP A;  3B5N B;  5KJ7 A;  2N1T C;  2NPS D;  3PP5 A;  3HD7 A;  5CCG A;  4WY4 B;  1HVV A;  1JTH A;  3RK2 C;  1N7S A;  2YMY A;  3RK2 D;  3HTK B;  1L4A B;  1URQ B; 
#chains in the Genus database with same CATH topology
 1JY2 O;  1M90 Q;  3M0D A;  2YO3 A;  2BEQ D;  3FXD A;  1NGM B;  4H13 D;  5APQ A;  1L4A A;  4JQ0 D;  4EI2 A;  3CWB J;  2HFE D;  3U1C A;  4U3F E;  1FJP A;  3OA7 A;  2IYO A;  5CHX A;  2KUB A;  1L0N G;  1X9V A;  1W5C E;  3CI9 A;  1MZ9 A;  1SQP E;  1SQQ G;  1IK9 A;  3CWB E;  2QVA A;  3L72 G;  1LJ2 A;  1FZE A;  1NU1 E;  1JM0 A;  2FYU D;  2K3R A;  1YQ4 C;  2N1T B;  3HE4 A;  3JSV C;  3GHG C;  3N7N A;  1YJW P;  2IBZ E;  1VQ5 P;  5KLV J;  3CCV P;  4PD4 H;  5H2F H;  2Z4E A;  1KYO E;  2Q3E A;  1GK6 A;  3BVH A;  2YXQ B;  4WY4 A;  2FYN C;  1BE3 G;  3AEB C;  1BSN A;  1VDF A;  3A2A A;  4PV1 D;  5KAI H;  1Q82 Q;  4WY4 D;  1M1J A;  4AQR D;  2FFD B;  3LID A;  1EDJ A;  2JDI H;  3VMA A;  2E43 A;  1IJD B;  1WMK A;  1XTG B;  2D2C B;  1IFN A;  3TGU G;  2OYH B;  2WPV B;  2IYP A;  4AUW A;  3GMA A;  3H25 A;  1VQM P;  1K9M Q;  2NPS B;  1EZV E;  4JBZ A;  5L8R J;  1ZW0 A;  3D6Z A;  2FBW C;  2FXP A;  2KOG A;  3MHV A;  1GW3 A;  1SQQ J;  1LT9 B;  3AEF C;  2IBZ D;  5KJ7 D;  1NAY A;  1SP4 A;  4HYT B;  1PP9 G;  5AVR B;  4K35 A;  3S1K A;  1M57 D;  3P7K A;  4GKG A;  3SWY A;  4UB8 H;  5AVU B;  1KQS O;  5APT A;  1U7M A;  3G6E P;  1GK4 A;  3OJA B;  3L73 J;  4IL6 H;  4U3F D;  1NKZ B;  2Y0D A;  5APY A;  1JTH B;  3RGU A;  2WSF J;  1NU1 G;  1IO4 A;  5AW6 B;  1J1D C;  3IF4 A;  3CME P;  1H0T B;  2JR8 A;  3M06 A;  1KN7 A;  3CC7 P;  1NTZ E;  1LP1 A;  4WBA A;  1H89 A;  2HR3 A;  5KLI B;  1N2D C;  1Y47 A;  1GMJ A;  3NFQ A;  4PD4 I;  5GTH H;  2A45 G;  3CPW O;  2FFD C;  2KLU A;  4GT1 A;  1P84 D;  1QGK B;  3PHL A;  2OAR A;  3B8E B;  1Q90 D;  2HOD B;  1VF5 C;  2D2C C;  5CJ0 A;  5AW8 B;  2H89 C;  2WTY A;  2OYH C;  1HF9 A;  1KB9 I;  4U7J A;  1IZN B;  3NTN A;  1MKM A;  1ZV8 A;  1J1E C;  1AA0 A;  2QJY B;  1GD2 E;  1KB9 D;  3KZI H;  5M1B A;  3RL0 D;  1SQV G;  2K37 A;  2Y0C A;  4GIF A;  3CCU P;  1S5L H;  5C39 A;  3H1J E;  2JEE A;  2K1A A;  4I7Z B;  3V4Q A;  1ZLL A;  3H32 A;  3CL3 D;  2C0W A;  3FXE A;  3HUS A;  1VQP P;  1SQX E;  2ZVO B;  1EDI A;  1IFJ A;  1MUU A;  2AEJ A;  2QIW A;  4IOI H;  4L74 A;  1Y8A A;  2ZT9 B;  4NPF X;  5AVY B;  3B5N C;  4Y28 J;  2HLO A;  4C7N B;  2CK3 H;  1NTZ D;  2P7J A;  3L73 G;  1RE4 C;  2KSE A;  2V7Q J;  5AW7 B;  3H1K E;  3U59 A;  4KJM A;  3L71 G;  5BU8 B;  2ZJS E;  1VF5 B;  1WT6 A;  1PGQ A;  2XDJ A;  3AEC C;  1PPJ G;  1NAF A;  1SFC A;  2OYO A;  3L70 D;  4IFM A;  4Y99 C;  2Q1K A;  4BRY B;  1ZXG A;  4D6T D;  1EXJ A;  3WUT A;  1EZV I;  1KQL A;  1CZQ A;  4H13 B;  3RL0 g;  1NO4 A;  1CI6 A;  4R4M A;  1USE A;  3RBZ A;  1EZV D;  3BRV B;  3MP7 B;  5APV A;  2B88 A;  1FZC A;  3MUD C;  3EQ2 A;  3E7K A;  4EOT A;  4D6T J;  1USD A;  1M56 D;  1ZOY C;  3R2P A;  2E76 C;  1R8E A;  1LNQ A;  1R5L A;  1JMM A;  2QJP C;  1PP9 D;  3B5N B;  3H1H J;  3TGU J;  5CJ4 A;  3LIE A;  3HE5 A;  1S1C X;  1Z56 A;  3HRN A;  4EDF A;  3TGU E;  1PGJ A;  3CCQ P;  1KYO D;  3CXH E;  1GU4 A;  1CSB A;  1H8A A;  2OTJ P;  1IFM A;  2UWJ E;  4L75 A;  2ZAE B;  2KZJ A;  1LTT C;  2FYU E;  3AE1 C;  1NU1 D;  4PV1 B;  1NTZ K;  2A06 G;  2FXM A;  3A0B H;  1SQP D;  2A06 E;  1BCC J;  4N78 D;  3TK1 A;  4CPG A;  3CWB D;  2G8Y A;  1VQ9 P;  2JWA A;  1VQ6 P;  1N7S A;  2YMK A;  1G2C A;  1NTK D;  3L72 J;  1JY3 O;  3L75 D;  2O1J A;  2W90 A;  3V2P A;  3W68 A;  1TU3 F;  3WUU A;  1FZG A;  5AW5 B;  1YIJ P;  1LWU A;  1N73 A;  2YXR B;  1NU1 J;  3QWO C;  1DH3 A;  3D70 A;  1URQ B;  1VQK P;  1HBW A;  1RF1 B;  2N1T D;  1IC2 A;  1OW7 A;  1RF0 A;  2G3A A;  3SFD C;  1KIL A;  1QL1 A;  1KB9 H;  2QG4 A;  3HE4 B;  2N1T A;  1NTK K;  3L72 D;  2K9Y A;  1SQV E;  3H1K J;  3HTK A;  2E76 B;  3IR9 A;  3RK3 B;  2C9L Y;  4LGD E;  1LTA C;  1AQ5 A;  3K5B A;  4HH2 A;  1G2C B;  2NPS C;  3E1R A;  2KXP B;  1KIL D;  3JCU E;  3L35 A;  2W6B A;  2YKP A;  2AXT E;  1X79 B;  3II6 A;  1KMI Z;  1LT9 C;  1L0N D;  2HPC B;  1URQ A;  2BCC J;  3L75 G;  3CCJ P;  1GU5 A;  1LTJ A;  3RK3 E;  1N73 B;  4IFF A;  5B66 H;  2QJK B;  1KQF B;  5KKZ C;  1BGY G;  2FYZ A;  2WT7 A;  3H1J G;  2LKM A;  3HE5 B;  2WT7 B;  3LW5 H;  1GL2 C;  2BEZ F;  2KIK A;  3A0H H;  4JYC A;  1NTM D;  2WSS H;  3P8C E;  4ASV A;  3WU2 E;  1SLQ A;  2KS1 B;  1GL2 D;  3I5C A;  3G71 P;  1L4A C;  1OFC X;  2KP8 A;  2P58 A;  2WWW A;  3BCC J;  4C7R A;  2HPC A;  2WSF H;  3SFE C;  3L70 G;  1LTB C;  1OZH A;  4JYB A;  2Y9Y A;  3L74 D;  3BAT A;  5BU5 A;  1BGY E;  5CBO A;  3M9Q A;  5KAI E;  1YTZ I;  4YXW H;  2FYN B;  4IL6 X;  3AE9 C;  1GW4 A;  1N86 A;  3IFM A;  2P2U A;  3V2Q A;  3I55 P;  1W2B O;  4WVZ A;  4PJ0 H;  3RL0 B;  2WIT A;  2Q6Q A;  1Y9B A;  3H1I J;  1SQQ K;  1YBK A;  1NTM G;  3HD7 B;  1RF1 C;  1LTI C;  1OX3 A;  1OVV A;  4PD4 D;  3H1L G;  2WSE H;  4NPD A;  1YJN P;  5EFW B;  1T3U A;  2JO1 A;  1A02 F;  2J59 M;  5AW3 B;  2H43 A;  2IX7 C;  3B5N D;  4OGQ D;  4BXL A;  3CCL P;  3GF3 A;  1JCD A;  3A3Y B;  1YIT P;  3CMA P;  2XZR A;  1PL5 A;  1LWU C;  2BAS A;  2E75 D;  4L73 A;  1FOS F;  2E75 B;  2KNC B;  2V7Q H;  3H6P A;  5GTH E;  4IFD K;  1DEB A;  1QVG O;  1OVR A;  2FYU G;  3V2N A;  3VP8 A;  2LR2 A;  2KK7 A;  1LT1 A;  1NYH A;  3H32 B;  1YQ3 C;  1SQB G;  4H44 D;  1A02 J;  1JOC A;  4W80 A;  1BCC D;  1KZU B;  5DJU B;  1FAV A;  1VF5 D;  4MN4 C;  3CWB G;  1AQT A;  4YXD C;  3L71 D;  2BCC E;  4W7Y A;  1K04 A;  1FOS E;  2A45 H;  2WSC J;  4BRY A;  1OMI A;  5AVZ B;  1BE3 E;  2P1J A;  2E74 C;  5KAF H;  2R3C A;  4GOD A;  1L0L J;  3AEE C;  2KNC A;  2MJZ A;  2R32 A;  4H44 C;  3VMZ A;  2QE7 H;  1K05 A;  1X8Y A;  1FU1 A;  1YTZ T;  2B87 A;  2IBZ I;  5KLV D;  2YO2 A;  1VQL P;  1NTZ J;  1N7L A;  3VP9 A;  4GOF A;  4I2L C;  2WSE J;  1D7M A;  2WSC H;  1BDD A;  5CCH C;  2W83 C;  2POH A;  1PV3 A;  2OGU A;  2QM7 A;  1DD3 A;  1NTK J;  1P84 H;  4I1L A;  3USS A;  2XND H;  1KFN A;  1SVF A;  3BCC E;  3VOP A;  5KJ7 A;  1OW8 A;  2OTL P;  2PFX A;  1BSH A;  2FFD A;  4UB6 E;  1RE4 A;  1M1J B;  1RF0 C;  1S9K D;  1AJY A;  1NOH A;  1RQV A;  4HB1 A;  1VQ4 P;  1RE3 C;  1FJK A;  1NTK G;  2GA1 A;  4Z1M H;  2W6J H;  1GZL A;  1JY2 N;  3M91 A;  4M3L A;  5K5G B;  3AE3 C;  3E1I A;  3KDP B;  2GM4 A;  2E74 B;  2FY8 A;  2IFN A;  2W6A A;  3L74 G;  2Q7C A;  3RK2 C;  1FDM A;  2WPQ A;  3L73 D;  3LW5 J;  1L0N K;  1HTL C;  1LTJ C;  1LP1 B;  2CPS A;  1K8A Q;  3RK2 D;  3H1H G;  4RO0 A;  1NVO A;  3P32 A;  3HTK B;  1HJB A;  1OIP A;  1H0T A;  2GUV A;  1Q2N A;  1OVU A;  3TF5 A;  1KYO H;  1ZRT D;  1KIL B;  1LGH B;  1M7L A;  4QMA A;  1PPJ D;  1T2K C;  2QJK C;  5KKZ B;  4DJG A;  2ZYD A;  1QVF O;  4D6T G;  1FDI A;  5E79 H;  5AW1 B;  4OH8 B;  3EWK A;  1KV4 A;  1QX8 A;  1JY3 N;  1SQV J;  1S72 P;  1SQP J;  4W7Z A;  3AEA C;  1EDK A;  1L4A D;  3H1L D;  3N4X A;  2J5U A;  3H1I G;  1L0L G;  4EYY Q;  2HG5 D;  1PZQ A;  1L0L E;  1URQ D;  1ZP0 C;  3O6Q B;  4TLF A;  2W8Z A;  1RF1 A;  1PFI A;  1SQB D;  4WWI A;  1URQ C;  2R44 A;  3VN0 A;  3H1H D;  2H7H A;  1U57 A;  1S4X A;  1N7S C;  3AE2 C;  1XTC C;  2R5B A;  5APU A;  1SQX J;  1ZME C;  2K88 A;  1JY2 P;  3RK3 C;  1T8Z A;  1RE3 A;  3S9O A;  3CC4 P;  2AXT H;  2AEF A;  1NKN A;  2QJY C;  3H1H E;  3CX5 D;  3P8M C;  4XE5 B;  3SWK A;  1T2K D;  1KIL C;  1DIP A;  1RY3 A;  1PGP A;  2B9B A;  4N3Y B;  3KQG A;  1L0L D;  3MTU E;  1FDO A;  3QH9 A;  5AW9 B;  5APX A;  2JKV A;  1KFM A;  3PTZ A;  3A0H E;  4O9B A;  5CCH A;  3V2R A;  3A5T A;  1GL2 B;  1OXZ A;  2ZVN B;  2XKM A;  3WU2 H;  1KYO I;  1T6A A;  2B89 A;  3GHG B;  3H1I E;  1HJ0 A;  4DT0 A;  5GTI E;  1S3J A;  3KZI E;  2JJL A;  1SQP G;  1SQQ E;  1HUC A;  3O8Z A;  2L5G B;  3SSU A;  4A7P A;  1S5L E;  1ZN5 A;  1Q7Y Q;  3C9I A;  3CCR P;  2ITA A;  2KYV A;  3M0A A;  5KJ7 C;  1L2P A;  3L73 E;  4UB8 E;  1FZA A;  4KT0 J;  4PJ0 E;  5AW4 B;  4IL6 E;  1N73 C;  1FZC C;  2XV5 A;  2IFM A;  2PGD A;  3RL0 C;  4LC1 A;  1AVO A;  2M8R A;  1T3J A;  2QM8 A;  3MUD A;  3VYI A;  3VTP C;  3I56 P;  3Q3D A;  4U3F G;  3Q2Y A;  3U1A A;  3B5N A;  1S9K E;  1EDL A;  4RKU J;  2KI7 B;  1KD1 Q;  5CBN A;  1EQ7 A;  1FE6 A;  2KB7 P;  4XA4 A;  3BCC D;  4KHX A;  3H1J J;  3FWN A;  5AVS B;  3TYY A;  3UIA A;  5TIS H;  1SFC B;  3Q5S A;  3T97 B;  1Q86 Q;  3OAK A;  5B5E E;  4RES B;  1J2J B;  1EZV G;  2QJP B;  2O1K A;  2ZFC A;  3PLN A;  5CCG C;  1KC8 Q;  1K73 Q;  1IFI A;  2MKV A;  1NU1 K;  1SQQ D;  1M8O B;  4XFJ A;  2O01 H;  5KLV E;  2QEX P;  1FC2 C;  3H1I D;  2N9Y B;  3MD0 A;  5KLI C;  4ASW A;  4C7N A;  1S2E A;  2E75 C;  1FZC B;  2M3B A;  1BE3 D;  3HUS B;  3IN6 A;  4RJT A;  1AFO A;  1J1E B;  1M1J C;  1H88 A;  3BAS A;  5BVZ A;  2YIU C;  1DD4 A;  1RHZ B;  1L0N J;  2RN0 A;  1X22 A;  1QLE D;  3RBX A;  1G1J A;  3CX5 E;  3TDK A;  2BCC D;  1LT9 A;  5CCH D;  3GHG A;  2E76 D;  3Q5R A;  1YI2 P;  3AE4 C;  4DZO A;  3A0B E;  2FYU J;  3KYQ A;  4I6M C;  1VQO P;  2NPS A;  3L70 J;  1L0L K;  1SQV K;  4HKZ H;  2YKQ A;  4LLH A;  2HOD A;  1NJI Q;  4OGQ B;  2ZT9 C;  1G1I A;  3EFG A;  1VL2 A;  2E74 D;  1HGZ A;  2D2C D;  3MZW B;  2VRS A;  2ZYG A;  3WUV A;  1SQX G;  5AW2 B;  3CCM P;  1SQB E;  2NPS D;  3PP5 A;  2H88 C;  1QL2 A;  3HD7 A;  1CW5 A;  1VQN P;  2A45 I;  4WB4 A;  4WY4 B;  1JCC A;  1HVV A;  4H0L D;  3CC2 P;  3GLM A;  3H1L E;  4Y99 B;  5AVQ B;  4L76 A;  1EXI A;  4YTP C;  2YMY A;  3H1L J;  1AV1 A;  1JO5 A;  2OYI B;  3JCU H;  1NWQ A;  1KQG B;  2QA4 P;  2M5A B;  1PPJ E;  1L4A B;  2WVR A;  1ZRT E;  2I8D A;  2O01 J;  3G9R A;  4PD4 E;  5H2F E;  2QRX A;  2V4H A;  1N7S D;  4C46 A;  1HH0 A;  1M1K Q;  2RMZ A;  2WPS A;  2WQY C;  4NPE A;  2OYH A;  1VPC A;  3W67 A;  1IFP A;  2M5A A;  1E79 H;  1SS1 A;  2PP6 A;  3L36 A;  4ZKP A;  2DW3 A;  2OYI A;  1KOR A;  3RK2 B;  2L91 A;  1FZB A;  3AE6 C;  1IK7 A;  1NTM K;  1LTJ B;  1UII A;  2YNY A;  4ZNC A;  3CD6 P;  3D71 A;  5KTB A;  2ZXX A;  4EIJ A;  4H0L C;  4WY4 C;  2Q9I A;  1VQ7 P;  3D6Y A;  3KPE A;  5APW A;  4TT3 H;  1RH5 B;  1UIX A;  3V5B A;  2HYN A;  3CLQ A;  1BGY J;  1JB0 J;  5E79 E;  3WMM 0;  5AVW B;  2IZ0 A;  1NTM E;  2PAJ A;  3FWL A;  2Y0E A;  3EFF K;  3IAO A;  3C1L A;  2FKW B;  1J1D B;  2KZI A;  2IBZ G;  1Q81 Q;  3Q1M A;  4N6J A;  2E5Y A;  3RK3 D;  2RH0 A;  1KTM A;  2IPP A;  2SPZ A;  1RQU A;  2ZT9 D;  1MV8 A;  2ZYA A;  1QEX A;  3ITK A;  1YYC A;  2K9J B;  4HJG H;  1NH4 A;  1SFC D;  1L0N E;  3CX5 I;  1VQ8 P;  5AVX B;  1HGV A;  1LWU B;  3JC2 2;  5AW0 B;  5B66 E;  1KIL E;  2NZ2 A;  2H8P D;  3GW6 A;  2IDB A;  1PGO A;  2JP3 A;  3FGA D;  3TNU A;  2KLV A;  1N7S B;  1R5S A;  2AXC A;  1YJ9 P;  3L37 A;  4JF7 A;  1BDC A;  1FBM A;  3L72 E;  3FX0 A;  4GDO A;  5AVV B;  1FS0 E;  4H0L B;  2B87 B;  3KHU A;  3L71 E;  4B86 A;  2WPR A;  2E42 A;  5DJT B;  2OQQ A;  2R5D A;  3HD7 D;  4I7Z C;  1BCC E;  3T97 A;  1OW6 A;  1JNM A;  1BCC G;  1FZF A;  1SFC C;  4GOE A;  3AE8 C;  3L75 E;  4BWN A;  1ZR2 A;  1NTK E;  3AE7 C;  3CCE P;  3PRJ A;  2LXC B;  2R3S A;  4U3F J;  5CMZ A;  1P84 I;  4OWF A;  5CCG D;  3OW2 O;  1LTS C;  2A06 D;  4N78 E;  5GTI H;  3AE5 C;  3M0D C;  2PRR A;  2AEM A;  1W2E A;  3BCC G;  1MFT A;  3M9H A;  1X0T A;  2Z5I A;  2JWD A;  1CI6 B;  2WZ7 A;  4ZKU A;  3G3Z A;  3CXH D;  2J58 A;  2O01 N;  3NMD A;  3NXS A;  4OVN F;  3TSI A;  5AVT B;  1PP9 J;  3TGU D;  2C9N Y;  1PP9 E;  3V6I A;  4DOJ A;  3HUS C;  2IZ1 A;  1S5L X;  3V4W A;  2M3E A;  1LTG C;  5KAF E;  3MGN A;  1NTZ G;  1NTM J;  1BE3 J;  1MFZ A;  4DCK A;  1SQX K;  5APS A;  2O3J A;  1AVY A;  1EC5 A;  2Q5U A;  2LXB A;  2YIU B;  3M9B A;  2GUS A;  3HD7 C;  3AED C;  3L74 J;  2M0B A;  3VMX A;  2OTK E;  3R4Y A;  1JMB A;  3F5H A;  1JUN A;  2I1K A;  5KLV K;  2XNX A;  3ZDM A;  1N8R Q;  2QSI A;  2XU6 A;  3MIW A;  5TIS E;  4OGQ C;  2ZXE B;  4D6T E;  3ABV C;  4ZMD A;  1IFD A;  2E5T A;  3L70 E;  1YHQ P;  1GL2 A;  1OWA A;  2CPB A;  1SQP K;  3KXD A;  1U7J A;  5B5E H;  1NHL A;  2I1J A;  1BGY D;  1PIX A;  2RKL A;  2Z5H A;  3AEG C;  3H1K D;  4UB6 H;  3L74 E;  3VMY A;  2Q3I A;  3CXH H;  4PV1 C;  2KSJ A;  1SQB J;  2YKO A;  2N9B A;  2P67 A;  3P8C D;  3PH0 A;  1SQX D;  2C0X A;  2BCC G;  3L75 J;  3SWF A;  2OYI C;  1GDT A;  1HWT C;  1DX7 A;  4K3A A;  3B71 A;  4YPC A;  3B4S A;  4R4L A;  2Y9Z A;  2N1T C;  1SQB K;  2NRG A;  3H1J D;  1JEK A;  4AYC A;  3GG2 A;  3CCS P;  2W27 A;  3L4F A;  5TJH A;  1DEE G;  1WRG A;  2FYU K;  1E5W A;  3CX5 H;  4H13 C;  5CCG A;  3PJS K;  3S4R A;  3Q5P A;  1KB9 E;  3BRT B;  1GTW A;  2KS1 A;  3H1K G;  1JTH A;  2WMM A;  5KLV G;  1ZR4 A;  4JPZ B;  3TNU B;  1SQV D;  1P84 E;  3GF7 A;  2P10 A;  1JY3 P;  2FXO A;  4H44 B;  3G4S P;  3C8V A;  3F89 A;  3CXH I;  3A7O A;  3L71 J;  2K9J A;  3O6Q A; 
#chains in the Genus database with same CATH homology
 1JY2 O;  3M0D A;  2YO3 A;  5APQ A;  1FJP A;  1L4A A;  3U1C A;  2HFE D;  3OA7 A;  5CHX A;  1X9V A;  3CI9 A;  1MZ9 A;  1IK9 A;  4I2L C;  1FZE A;  2N1T B;  3HE4 A;  3N7N A;  3GHG C;  2Z4E A;  1GK6 A;  3BVH A;  4WY4 A;  3A2A A;  1VDF A;  4WY4 D;  1M1J A;  4AQR D;  2FFD B;  3LID A;  2E43 A;  1IJD B;  1XTG B;  2OYH B;  1IFN A;  4AUW A;  1RF1 B;  2NPS B;  2KOG A;  1GW3 A;  1LT9 B;  5KJ7 D;  4HYT B;  1SP4 A;  5AVR B;  3P7K A;  4GKG A;  3SWY A;  5AVU B;  5APT A;  1GK4 A;  3OJA B;  5APY A;  1NKZ B;  1JTH B;  5AW6 B;  1J1D C;  3M06 A;  1H89 A;  4WBA A;  1N2D C;  3NFQ A;  2FFD C;  2A45 G;  4GT1 A;  2OAR A;  3B8E B;  5CJ0 A;  2HOD B;  5AW8 B;  2WTY A;  2OYH C;  3NTN A;  1ZV8 A;  1J1E C;  1GD2 E;  3RL0 D;  4GIF A;  2JEE A;  3V4Q A;  1ZLL A;  3H32 A;  3CL3 D;  2C0W A;  3HUS A;  1IFJ A;  1MUU A;  2Q9I A;  5AVY B;  3B5N C;  2HLO A;  4C7N B;  2P7J A;  1RE4 C;  5AW7 B;  3U59 A;  5BU8 B;  1WT6 A;  2XDJ A;  3T97 A;  1SFC A;  1NAF A;  4Y99 C;  4IFM A;  1KQL A;  1CZQ A;  1NO4 A;  1CI6 A;  3BRV B;  5APV A;  4EOT A;  3EQ2 A;  3R2P A;  1JMM A;  3B5N B;  5CJ4 A;  3LIE A;  3HE5 A;  1Z56 A;  3HRN A;  1GU4 A;  1H8A A;  1CSB A;  1IFM A;  1LTT C;  1NTZ K;  2FXM A;  1N73 C;  4N78 D;  3TK1 A;  1N7S A;  1G2C A;  1JY3 O;  1FZG A;  2O1J A;  3V2P A;  1N73 A;  5AW5 B;  1LWU A;  1DH3 A;  1URQ B;  1HBW A;  2N1T D;  1IC2 A;  1RF0 A;  1KIL A;  1QL1 A;  3HE4 B;  2N1T A;  1NTK K;  3HTK A;  3RK3 B;  2C9L Y;  4LGD E;  1LTA C;  1AQ5 A;  4HH2 A;  1G2C B;  2NPS C;  3L35 A;  1KIL D;  2W6B A;  2YKP A;  1X79 B;  3II6 A;  2HPC B;  1LT9 C;  1URQ A;  1GU5 A;  1LTJ A;  1N73 B;  4IFF A;  2FYZ A;  2WT7 A;  3HE5 B;  2LKM A;  2WT7 B;  3LW5 H;  1GL2 C;  4JYC A;  3P8C E;  1SLQ A;  3I5C A;  1GL2 D;  1IO4 A;  1L4A C;  2KP8 A;  2WWW A;  4C7R A;  2E42 A;  2HPC A;  2WSF H;  1LTB C;  4JYB A;  3BAT A;  5BU5 A;  3M9Q A;  1YTZ I;  1GW4 A;  1N86 A;  3IFM A;  2P2U A;  3V2Q A;  3RL0 B;  2WIT A;  1SQQ K;  1RF1 C;  3HD7 B;  1LTI C;  2WSE H;  1T3U A;  1A02 F;  2J59 M;  5AW3 B;  2H43 A;  2IX7 C;  3B5N D;  1JCD A;  3A3Y B;  2XZR A;  1LWU C;  2BAS A;  3H6P A;  4IFD K;  1DEB A;  3VP8 A;  3V2N A;  3H32 B;  1A02 J;  1JOC A;  4W80 A;  1KZU B;  1FAV A;  4W7Y A;  1FOS E;  2A45 H;  5AVZ B;  2P1J A;  2R3C A;  2MJZ A;  2R32 A;  3VMZ A;  1X8Y A;  1FU1 A;  1YTZ T;  2YO2 A;  1N7L A;  3VP9 A;  2WSC H;  5CCH C;  2POH A;  2QM7 A;  2OYH A;  4I1L A;  3VOP A;  1KFN A;  1SVF A;  5KJ7 A;  2FFD A;  1RE4 A;  1M1J B;  1RF0 C;  1S9K D;  1NOH A;  1FJK A;  1RE3 C;  1GZL A;  1JY2 N;  3M91 A;  4M3L A;  3E1I A;  3KDP B;  2GM4 A;  1FDM A;  2IFN A;  2W6A A;  2Q7C A;  3RK2 C;  2WPQ A;  1LTJ C;  1HTL C;  1L0N K;  2CPS A;  3RK2 D;  1HJB A;  3P32 A;  3HTK B;  2GUV A;  1KIL B;  1LGH B;  1M7L A;  1T2K C;  1JO5 A;  5AW1 B;  4OH8 B;  1JY3 N;  4W7Z A;  3N4X A;  1L4A D;  2HG5 D;  1URQ D;  1RF1 A;  1PFI A;  1URQ C;  3VN0 A;  2H7H A;  1N7S C;  1XTC C;  2R5B A;  5APU A;  1JY2 P;  3RK3 C;  1T8Z A;  1RE3 A;  4XE5 B;  1NKN A;  1T2K D;  3P8M C;  1KIL C;  1RY3 A;  4N3Y B;  3KQG A;  3MTU E;  5AW9 B;  5APX A;  1KFM A;  4O9B A;  5CCH A;  3V2R A;  3A5T A;  1GL2 B;  1OXZ A;  2XKM A;  3GHG B;  2JJL A;  1HUC A;  3O8Z A;  2L5G B;  1ZN5 A;  3C9I A;  2KYV A;  3M0A A;  5KJ7 C;  1FZA A;  5AW4 B;  1FZC C;  2XV5 A;  2IFM A;  3RL0 C;  4LC1 A;  3VYI A;  2M8R A;  1T3J A;  2QM8 A;  3MUD A;  3VTP C;  3U1A A;  3B5N A;  1S9K E;  1EQ7 A;  5AVS B;  2KB7 P;  4XA4 A;  4KHX A;  3UIA A;  3TYY A;  1SFC B;  3OAK A;  4RES B;  1J2J B;  2O1K A;  2ZFC A;  5CCG C;  1IFI A;  1NU1 K;  2O01 H;  3MD0 A;  4C7N A;  1FZC B;  2M3B A;  3HUS B;  1AFO A;  1J1E B;  1M1J C;  1H88 A;  3BAS A;  5BVZ A;  1FOS F;  5CCH D;  1G1J A;  1LT9 A;  3GHG A;  4DZO A;  3KYQ A;  4I6M C;  2NPS A;  1L0L K;  1SQV K;  2YKQ A;  4LLH A;  2HOD A;  1G1I A;  3EFG A;  1HGZ A;  2VRS A;  5AW2 B;  2NPS D;  3PP5 A;  1CW5 A;  1QL2 A;  3HD7 A;  2A45 I;  4WB4 A;  4WY4 B;  1JCC A;  1HVV A;  4Y99 B;  5AVQ B;  2YMY A;  2OYI B;  1NWQ A;  1L4A B;  1N7S D;  4C46 A;  1HH0 A;  2WPS A;  1VPC A;  2PP6 A;  4ZKP A;  3L36 A;  2OYI A;  3RK2 B;  1FZB A;  1NTM K;  1LTJ B;  2YNY A;  5KTB A;  4EIJ A;  4WY4 C;  3KPE A;  5APW A;  3V5B A;  2HYN A;  3CLQ A;  3WMM 0;  5AVW B;  2PAJ A;  2FKW B;  1J1D B;  4N6J A;  3RK3 D;  2IPP A;  1MV8 A;  1YYC A;  1NH4 A;  1SFC D;  5AVX B;  1HGV A;  1LWU B;  5AW0 B;  2H8P D;  3TNU A;  2KLV A;  1N7S B;  3L37 A;  4JF7 A;  1FBM A;  5AVV B;  4B86 A;  2WPR A;  2R5D A;  3HD7 D;  1JNM A;  1FZF A;  1SFC C;  1ZR2 A;  5CMZ A;  5CCG D;  1LTS C;  4N78 E;  3M0D C;  1W2E A;  3M9H A;  2Z5I A;  4ZKU A;  1CI6 B;  2WZ7 A;  3G3Z A;  3TSI A;  2J58 A;  3NXS A;  3NMD A;  5AVT B;  2C9N Y;  4DOJ A;  3HUS C;  3V4W A;  1LTG C;  3MGN A;  1MFZ A;  1SQX K;  5APS A;  2Q5U A;  3M9B A;  2GUS A;  3HD7 C;  3VMX A;  1JUN A;  2I1K A;  5KLV K;  2XNX A;  1FZC A;  2XU6 A;  3MIW A;  2ZXE B;  1IFD A;  1GL2 A;  1OWA A;  2CPB A;  1SQP K;  1NHL A;  2I1J A;  2Z5H A;  3VMY A;  2Q3I A;  2KSJ A;  2YKO A;  2N9B A;  2P67 A;  3P8C D;  2C0X A;  3SWF A;  2OYI C;  1GDT A;  1HWT C;  1DX7 A;  2N1T C;  1SQB K;  4AYC A;  2W27 A;  3L4F A;  1WRG A;  2FYU K;  1E5W A;  5CCG A;  1GTW A;  3BRT B;  1JTH A;  1ZR4 A;  3TNU B;  1JY3 P;  3IR9 A;  3A7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...