3HD7B

Helical extension of the neuronal snare complex into the membrane, spacegroup c 1 2 1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
98
structure length
98
Chain Sequence
KQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Helical extension of the neuronal SNARE complex into the membrane
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
molecule keywords Vesicle-associated membrane protein 2
total genus 42
structure length 98
sequence length 98
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05739 SNARE SNARE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3hd7B00
1JTHA 4WY4A 2N1TB 3VOPA 3RK2D 3RL0D 3RK3C 3HD7D 3B5NB 2N1TC 1KILA 4WY4C 2XDJA 1GL2D 5CCHD 4W7ZA 4WY4D 1URQD 3M0DC 3RK3D 5CCGC 5CCGA 1KILC 1GL2A 5CCHA 1HVVA 3RK3B 1KILD 3KYQA 4WY4B 2HFED 2NPSC 4N78E 2PP6A 3B5ND 2HG5D 3HD7B 1N7SC 1URQC 3RL0B 1L4AA 3HTKB 3RK2B 4W80A 1KILB 3TSIA 1SFCA 1GL2C 5CCHC 2M8RA 2NPSA 3HD7C 1URQB 5KJ7A 5KJ7C 3HD7A 4W7YA 5CCGD 5KJ7D 1GL2B 4OH8B 1XTGB 1SFCC 1JTHB 2KOGA 2N1TA 1NHLA 1SFCD 1L4AC 2NPSB 1URQA 1N7SA 1L4AD 3B5NA 3B5NC 1T3JA 2N1TD 3RL0C 1L4AB 3P8CE 2NPSD 1SFCB 1N7SB 3RK2C 1N7SD 4JF7A 2H8PD 2YMYA 3PP5A 4LGDE 2WZ7A
chains in the Genus database with same CATH superfamily
1LJ2A 3MZWB 1Z56A 4M3LA 3OJAB 3Q5RA 1RF0C 4OGQD 1ZN5A 4MN4C 1S5LH 1NTKJ 1OX3A 1E79H 1EDKA 1M1JC 2K9JB 3RK3E 1GW4A 3M9BA 4C7RA 1HGVA 4Y28J 1KQSO 2FFDB 2I1KA 1SQQG 1R8EA 3PHLA 4BWNA 2W90A 1VL2A 1JY2P 1E5WA 4I7ZB 4EIJA 1JY3N 3OW2O 1JCDA 1PPJE 2V4HA 3H1JG 3FXDA 3L72E 4AQRD 3GW6A 1M1JA 1MFTA 4JBZA 1YJNP 2HPCA 1G2CB 1SQPJ 3L4FA 4H13B 2IYPA 1ZOYC 3R2PA 4H44B 3S9OA 3D71A 3CCRP 1KB9E 1OMIA 2O01H 2WSCH 2KNCA 1NTMD 2IZ1A 3CWBD 3IR9A 2K88A 2XZRA 1MFZA 2KB7P 3H1LG 4A7PA 4R4MA 1LT9B 3H1HD 1FZFA 3CCUP 4H0LC 1PP9D 2YXQB 1AFOA 2A06E 2PRRA 5CCGA 2BEQD 1M57D 1GMJA 1MV8A 4Y99C 1GL2A 2Q6QA 2ZYAA 4B86A 1AVYA 1HVVA 3A2AA 3IF4A 3M9HA 5TISE 1OXZA 2OTLP 4BXLA 3L75E 1VQOP 1Q82Q 2Q9IA 1BCCJ 1FDOA 3VMYA 2ZAEB 1FZCC 1VQ6P 4OWFA 1GU5A 5AVVB 2L91A 2Y0CA 3HUSA 1OFCX 3KZIH 4GIFA 1KD1Q 3M06A 1HGZA 1RF1A 2E43A 1VQ9P 2W27A 5C39A 1NTMG 2YMYA 2Z5HA 1BE3D 2WSEJ 4K35A 2H88C 3VP8A 2OTJP 2HG5D 1L0LE 1ZLLA 2KI7B 3HD7B 5B66E 1DD3A 2QG4A 1GK6A 1IFPA 2FYUE 2KP8A 2WWWA 2Z5IA 1KILB 4U3FE 3RK2B 4R4LA 1KQLA 1SQBD 3L71J 5CBNA 3WUUA 3AE4C 1JCCA 1GL2C 1SFCA 1RF0A 3TGUE 3CCMP 4JQ0D 1NU1K 2KIKA 3BCCJ 3E1IA 4JYCA 2NPSA 2BCCJ 3HD7C 3GMAA 3PH0A 2BEZF 4C7NB 3VTPC 5KJ7A 3G4SP 4ASVA 4RO0A 1BE3J 1T3UA 3SFDC 2IFNA 5CCGD 1T8ZA 4YXDC 1QX8A 3CX5H 3PJSK 2AEMA 1NTKG 3QH9A 1LP1B 5AVRB 3V2RA 1CI6B 2KOGA 3EFFK 3CCQP 1S1CX 2A06D 2E5TA 4PD4E 1NTZG 1YQ4C 4EI2A 5AW3B 4GOFA 3F89A 3MGNA 3VMZA 1KILE 2B88A 1H8AA 2FFDC 4EDFA 2RMZA 3CXHH 1N73A 1SLQA 2SPZA 4IFDK 4EYYQ 4PD4I 1K8AQ 1P84D 4OVNF 5DJUB 2WSFH 3O6QB 4PD4H 1IFIA 1KMIZ 1NGMB 2H89C 3EFGA 1D7MA 3CWBJ 3L75G 1NAFA 1OW8A 3AE5C 2JP3A 3CI9A 3RL0g 2N9BA 4C46A 2ZYGA 2W8ZA 3VN0A 1VF5B 2OARA 3W68A 1SQXJ 1JEKA 3D70A 4WWIA 2KNCB 2P58A 4PJ0H 2R32A 3TNUA 1SQXE 3WU2E 4PV1D 3SWFA 1LT1A 3A5TA 3H1LJ 1YYCA 3CL3D 4I1LA 3RK2C 2G3AA 3L75D 4ZNCA 3M0DA 3GG2A 3CC2P 3AEBC 5KLVG 4JF7A 5CHXA 5KLVJ 1HF9A 1PGQA 1OZHA 1WMKA 4DT0A 3PP5A 2OYHA 4H0LD 4WB4A 1NH4A 3A0HE 2C0XA 3NFQA 1K04A 2VRSA 3PLNA 3B8EB 5AW4B 3R4YA 4D6TG 1PPJG 2BASA 2HYNA 4U3FG 2H43A 2CPSA 2IBZI 3II6A 5KTBA 1RF1B 2K9YA 1JO5A 2WMMA 1PGOA 3HE5B 3AE9C 4YPCA 1EDIA 3KZIE 4IFMA 1SVFA 5KLVD 3RK2D 5KAIH 4HJGH 1FU1A 4IL6X 3RL0D 3BVHA 2I8DA 2WSCJ 3AE6C 3HD7D 5AVZB 3A0BH 3H1LD 3W67A 3EWKA 4D6TE 3Q3DA 1SS1A 4DOJA 1JMBA 3N4XA 1EXJA 1HTLC 1KILA 1AQTA 1X0TA 3H1KD 5H2FH 1NO4A 3V2QA 1DH3A 3HRNA 1RF1C 1PGJA 1JY2N 2E76C 2ZVOB 1FZEA 3FWLA 1JOCA 3BRTB 4IFFA 4W7ZA 3V2NA 1IFMA 3VMAA 1K05A 3H32A 1JM0A 1N73C 1FS0E 3CMAP 4XA4A 3TGUJ 3N7NA 3P8MC 4BRYB 2FFDA 2M5AA 1KV4A 1N8RQ 1H0TA 1PFIA 3A0BE 2FKWB 3FX0A 5L8RJ 1VQNP 2IZ0A 1KB9H 2WT7A 5AW7B 5CCHA 1N7LA 1BE3G 4DCKA 1P84H 1FDIA 1SQVG 1ZRTE 2OTKE 3GF3A 5KLIB 3Q5PA 1M8OB 2NRGA 1IK7A 1CI6A 5KAIE 5CJ0A 1HBWA 4WVZA 4ZKUA 1YITP 3KYQA 1R5LA 4K3AA 1FC2C 3NXSA 4WY4B 3A0HH 2XNXA 2HFED 2HODA 1GZLA 1LWUA 2NPSC 2ZXEB 4KHXA 4ZMDA 1VQ7P 1DD4A 3H1HG 3CC4P 2YIUB 3IFMA 3V4WA 3CWBG 3L75J 3VMXA 1SQVD 4UB6H 3U1AA 4XE5B 2R44A 3M9QA 1YI2P 1FZCA 3S1KA 1DIPA 2A45G 2B89A 1N7SC 1SQPK 1URQC 3WU2H 3U59A 2QJPB 3FWNA 4PD4D 3RL0B 1NOHA 1YHQP 2OYIB 2MJZA 3OAKA 1YQ3C 3JCUH 4GOEA 2O1KA 1K73Q 1EDJA 3KDPB 1LGHB 1LNQA 5CCHC 4L76A 3JSVC 2AEJA 4OGQB 4UB6E 3CCVP 3PTZA 3TF5A 3AEFC 1RH5B 4PV1C 3M91A 3BCCE 4YTPC 3U1CA 1BCCG 1G1IA 1LTGC 2YO2A 3AEDC 5AVQB 4DZOA 2QJYC 1LT9A 1LTJA 2JDIH 3H1KG 1NU1G 3H1IE 2KSEA 3HD7A 3NTNA 5AVYB 3L71E 1JB0J 1YBKA 3O8ZA 3O6QA 4W7YA 1GK4A 3RBZA 4GODA 4H44D 1GL2B 2FXOA 4U3FJ 1RQVA 1QEXA 3H1IJ 1J1EB 1Y9BA 3G9RA 4H13D 4OH8B 1SFCC 2WQYC 1SQXK 3CLQA 1Y8AA 3BCCG 4L75A 5B5EE 2UWJE 1JNMA 2E75D 1UIIA 2N1TA 1NHLA 2C9NY 2P67A 2B9BA 2M3EA 2PGDA 2DW3A 4U3FD 1L4AC 4RJTA 1RE4A 3L71G 3TNUB 2ZT9C 2ZFCA 1KFMA 1ZV8A 4I6MC 2QIWA 1VF5C 2LXCB 3H1KE 3L70D 5BU5A 1SQPG 1CSBA 1IO4A 3C1LA 1S9KE 2D2CB 2O01N 3B5NA 3KHUA 1T3JA 1U7JA 2N1TD 3V5BA 3CX5I 3HUSC 1S9KD 5CBOA 1VQKP 1KYOE 1RQUA 1NTMK 2Q5UA 3RL0C 2WVRA 1L4AB 3BASA 2IPPA 4N3YB 4H0LB 1IJDB 3CCJP 2QA4P 2NPSD 1BSNA 3NMDA 3GHGB 4IOIH 1FBMA 3VP9A 5KAFH 1IFDA 1L0NE 1SFCB 3WMM0 3H1KJ 1MUUA 2GUSA 5KLVK 2RN0A 3AE3C 1MKMA 3AEGC 3G71P 3QWOC 4KJMA 1FDMA 1X9VA 1EZVI 1LTIC 1N7SD 4RESB 2CK3H 2Q3IA 4C7NA 4NPFX 1YJ9P 2M0BA 2W6AA 2Q1KA 1S4XA 3V4QA 5E79H 1OVUA 1Y47A 3L70E 1KB9D 1S5LX 2E76B 1L0LG 1KFNA 1PL5A 1OIPA 1UIXA 2B87B 2QM8A 2XKMA 2P1JA 5AVSB 5EFWB 2WZ7A 4EOTA 1NKZB 2POHA 1KTMA 3L72G 4WY4A 4KT0J 2D2CD 3LW5H 3TYYA 2CPBA 1HJBA 1NU1D 3H32B 2OQQA 1S2EA 2Y0EA 1NVOA 2A06G 2Q3EA 3MD0A 4YXWH 2E74B 2WPRA 3AE7C 1N73B 4PJ0E 2MKVA 2XU6A 2WPSA 3CCEP 1W2EA 3UIAA 3ABVC 2JWDA 1SQBG 1OWAA 4D6TJ 1EDLA 1ZR2A 1Q86Q 4WY4C 3L74D 2QVAA 2XDJA 2GA1A 1TU3F 3MUDC 4N78D 5AW0B 5CCHD 3CXHD 3Q5SA 3GHGC 2R5BA 2E74C 3C8VA 3H1ID 1GD2E 1L2PA 3V2PA 1HWTC 5TJHA 1LWUB 1SQQK 1FOSE 3AECC 3K5BA 1URQD 3GLMA 5GTIH 1AQ5A 1A02F 4TLFA 1DEBA 2AXTE 2W83C 3AEEC 3RK3D 1KB9I 5APYA 2QRXA 1AV1A 3KXDA 5CCGC 4WBAA 1KILC 2R3CA 1FZGA 1QLED 1FZAA 5KLVE 1BDDA 2GM4A 1NU1J 3H6PA 3RK3B 4ZKPA 1FAVA 1W2BO 1KILD 1S3JA 1S5LE 1XTCC 2WSSH 1ZR4A 2E75C 2FXPA 1SQQE 2H7HA 2C9LY 3CX5E 2KS1A 3L74J 1AVOA 1OVRA 2K1AA 2ZXXA 4H13C 3D6YA 2QJYB 2M5AB 1FE6A 2IDBA 1SP4A 2YKQA 3HE4B 1H0TB 1VPCA 3JCUE 1VQ4P 3HE5A 2P7JA 2PP6A 3G3ZA 3ITKA 4LC1A 1LWUC 2KUBA 4GT1A 4GKGA 5AVWB 2P2UA 1L0ND 3F5HA 1L4AA 1EXIA 3HTKB 3P32A 2FYNC 3T97B 4W80A 4Y99B 1KZUB 1NWQA 1EQ7A 2RKLA 2OYOA 3BRVB 3FGAD 1BGYD 2HODB 3CCLP 2Z4EA 2JO1A 2M8RA 1GDTA 1AJYA 1M56D 1ZMEC 3CMEP 2D2CC 3B4SA 1URQB 2IYOA 2K37A 2QSIA 4JYBA 1LT9C 1U7MA 2LR2A 1T2KC 3SFEC 3KQGA 1JUNA 2KZJA 2K3RA 5GTIE 3CPWO 1GU4A 2WT7B 1QVGO 2B87A 1IFJA 4TT3H 1VDFA 5M1BA 5KKZB 1BE3E 1WT6A 2KZIA 5TISH 5KLIC 1YIJP 1SQXD 2XV5A 1ZW0A 4QMAA 1H88A 1BCCD 2BCCE 2AEFA 3LW5J 4DJGA 1PPJD 3D6ZA 1VF5D 3TGUG 1KYOH 3H1LE 4D6TD 5AW5B 1ZRTD 1SQBE 1IC2A 4NPDA 2E74D 3L73E 3CCSP 2E5YA 1LTAC 2E42A 1L4AD 1DX7A 5KKZC 2FYUG 1J1EC 1S72P 1KORA 1N2DC 3AE2C 3JC22 3L36A 3IN6A 1RE3A 2KSJA 2ZVNB 1FZCB 5APXA 3CXHI 1NTKK 2QJPC 1KQGB 3I56P 3CWBE 1QGKB 1KYOI 3Q2YA 1GW3A 2E76D 1NKNA 1RE4C 3H1HE 2YXRB 3E7KA 2YNYA 1SQPD 2RH0A 5AW6B 2V7QJ 2FXMA 2YMKA 1BSHA 2HLOA 2FYUD 3L70G 1N7SB 2J59M 1NYHA 5E79E 2C0WA 3EQ2A 2Q7CA 3GF7A 2OYHB 1SQVJ 3MHVA 4AUWA 1FJPA 2L5GB 4GDOA 1LTJB 2KLVA 2O01J 3SWKA 3V6IA 3IAOA 3L73D 3LIDA 1DEEG 3BATA 1QL2A 1L0NK 3I5CA 3WUVA 2IBZE 2JEEA 4H44C 5BVZA 2Y9ZA 1VQMP 1J1DB 1NTKD 2HR3A 2HPCB 4LGDE 2W6BA 3GHGA 5KAFE 1JY3P 4LLHA 1JTHA 3TK1A 1RE3C 1SQBJ 2N1TB 3L71D 1NTZD 4IL6H 1JY3O 2J5UA 5CMZA 5AVUB 1HUCA 2W6JH 2QEXP 1IK9A 3VOPA 1WRGA 2KLUA 5APSA 1R5SA 3SWYA 1SQXG 2G8YA 1EZVD 5GTHH 2IBZG 5AW8B 3P7KA 3A7OA 4UB8E 4JPZB 3RBXA 1SQPE 1QVFO 1G1JA 1J2JB 3RK3C 2ITAA 3G6EP 3C9IA 2KYVA 3B5NB 5DJTB 1OW7A 2E75B 2N1TC 3L72J 4CPGA 2FYUJ 3TDKA 1LTTC 1YJWP 1KN7A 2V7QH 1CW5A 2OYIC 4AYCA 1GL2D 1L0LJ 2JWAA 4RKUJ 2IBZD 2IX7C 1EZVG 1USEA 1BGYG 1X79B 4OGQC 2K9JA 2QE7H 4WY4D 3USSA 1SQVE 3KPEA 3H25A 2AXTH 1U57A 2M3BA 3HUSB 2KK7A 2YKPA 3H1JD 2QJKB 1VQPP 1NTZE 3M0DC 2OYHC 1NAYA 1CZQA 3MP7B 3MUDA 2LKMA 1M90Q 1VQLP 1BCCE 2BCCD 3B71A 3H1HJ 1PZQA 2PAJA 1A02J 1YTZI 5BU8B 2Y0DA 5AW2B 3RGUA 1Q81Q 3L73G 1NJIQ 1KQFB 3TGUD 2ZJSE 1G2CA 1ZP0C 5APWA 4UB8H 4ASWA 1X22A 1Q2NA 3M0AA 3I55P 1H89A 2QJKC 2BCCG 3AE8C 5H2FE 2FY8A 5APUA 1PP9G 3L74E 4N78E 3L73J 2OYIA 1SQQJ 1JMMA 1KYOD 2AXCA 1IZNB 2GUVA 2O3JA 2WPQA 3E1RA 3P8CD 1VQ8P 3PRJA 4I7ZC 3B5ND 4HH2A 1NTME 5AVTB 2QM7A 5AW1B 5B66H 1X8YA 2R5DA 2JR8A 1LTSC 2LXBA 2JJLA 3ZDMA 1M1JB 2WPVB 2ZYDA 2FBWC 3MIWA 3OA7A 2R3SA 1BGYJ 1JY2O 3TSIA 2WSFJ 5K5GB 1IFNA 2OGUA 5AW9B 2XNDH 3LIEA 1PGPA 4L73A 2WSEH 1LTBC 1J1DC 1P84E 3S4RA 3CD6P 1M7LA 1L0NG 4I2LC 1NTKE 5KJ7C 3WUTA 1LTJC 2FYNB 2WTYA 3FXEA 2ZT9B 1SQVK 2YIUC 1RY3A 1AA0A 1P84I 3L37A 4N6JA 4Z1MH 5KJ7D 1MZ9A 3HTKA 1Q90D 3MTUE 1QL1A 2PFXA 1XTGB 1ZXGA 4HYTB 1T6AA 3Q1MA 1JTHB 1L0LD 1L0LK 2YKOA 3VYIA 5CJ4A 1HJ0A 3AE1C 2I1JA 1USDA 3AEAC 1SFCD 1BDCA 2FYUK 2JKVA 3A3YB 3L72D 2KS1B 2NPSB 1PIXA 1URQA 1N7SA 3HE4A 1K9MQ 5AVXB 1BGYE 1NTZK 1RHZB 2YO3A 1OW6A 1PP9J 4XFJA 3CXHE 1N86A 1FJKA 1Q7YQ 4O9BA 2N9YB 3B5NC 1W5CE 2NZ2A 3H1JJ 3L70J 5APVA 3SSUA 4L74A 1FZBA 1NTMJ 5B5EH 1GTWA 1LP1A 3P8CE 1SQBK 1EC5A 1NU1E 3H1IG 3T97A 1VQ5P 3H1JE 2P10A 1HH0A 1EZVE 3L35A 1PP9E 2A45I 3L74G 2IFMA 4BRYA 1T2KD 5APQA 1L0NJ 2KXPB 2FYZA 3CC7P 4PV1B 5GTHE 1M1KQ 1PV3A 1YTZT 1OVVA 1KC8Q 1FOSF 5APTA 2Y9YA 4HKZH 1SQQD 2ZT9D 2J58A 2WITA 3CX5D 2H8PD 2O1JA 4U7JA 2A45H 3BCCD 4HB1A 4IL6E 1NTZJ 4NPEA
chains in the Genus database with same CATH topology
4M3LA 1Z56A 3OJAB 1RF0C 1ZN5A 1M1JC 4C7RA 2OYIB 1GW4A 3M9BA 1HGVA 2FFDB 2I1KA 1JY2P 1E5WA 4EIJA 1JY3N 1JCDA 4AQRD 1M1JA 2HPCA 1G2CB 3L4FA 3R2PA 2WSCH 2O01H 3IR9A 2XZRA 1MFZA 2KB7P 1FZFA 1LT9B 1AFOA 5CCGA 4Y99C 4B86A 1MV8A 1GL2A 1HVVA 3A2AA 3M9HA 1OXZA 2Q9IA 1FZCC 1GU5A 5AVVB 3HUSA 4GIFA 3M06A 1HGZA 1RF1A 2E43A 2W27A 2Z5HA 3VP8A 2HG5D 1ZLLA 3HD7B 1GK6A 2WWWA 2KP8A 3RK2B 2Z5IA 1KILB 1KQLA 1JCCA 1GL2C 1SFCA 1RF0A 1NU1K 3E1IA 4JYCA 2NPSA 3HD7C 4C7NB 3VTPC 5KJ7A 1T3UA 2IFNA 5CCGD 1T8ZA 3V2RA 5AVRB 1CI6B 2KOGA 5AW3B 3MGNA 3VMZA 1H8AA 2FFDC 1N73A 1SLQA 4IFDK 2WSFH 1IFIA 3EFGA 1NAFA 3CI9A 2N9BA 4C46A 3VN0A 2OARA 3TNUA 2R32A 3SWFA 3A5TA 1YYCA 3CL3D 4I1LA 3RK2C 3M0DA 4JF7A 5CHXA 3PP5A 4WB4A 1NH4A 2C0XA 3NFQA 2VRSA 3B8EB 5AW4B 2BASA 2HYNA 2H43A 2CPSA 3II6A 5KTBA 1RF1B 1JO5A 3HE5B 4IFMA 1SVFA 3RK2D 3BVHA 3RL0D 1FU1A 3HD7D 5AVZB 4DOJA 3N4XA 1HTLC 1KILA 1DH3A 1NO4A 3HRNA 1RF1C 1JY2N 3V2NA 1FZEA 4W7ZA 1JOCA 3BRTB 4IFFA 1IFMA 1N73C 3H32A 4XA4A 3N7NA 3P8MC 2FFDA 1PFIA 2FKWB 2WT7A 5AW7B 5CCHA 1N7LA 1HBWA 1CI6A 5CJ0A 4ZKUA 3KYQA 3NXSA 4WY4B 2XNXA 2HFED 2HODA 1GZLA 1LWUA 2NPSC 2ZXEB 4KHXA 3IFMA 3V4WA 3VMXA 3U1AA 4XE5B 3M9QA 1FZCA 2A45G 1N7SC 1SQPK 1URQC 3U59A 3RL0B 1NOHA 2MJZA 3OAKA 2O1KA 3KDPB 1LGHB 5CCHC 2OYHA 3M91A 3U1CA 1ZR2A 1S9KE 1LTGC 1G1IA 2YO2A 5AVQB 4DZOA 1LT9A 1LTJA 3HD7A 3NTNA 5AVYB 3O8ZA 4W7YA 1GK4A 1GL2B 3VMYA 4OH8B 1J1EB 1SFCC 3CLQA 1SQXK 1JNMA 2N1TA 1NHLA 2C9NY 2P67A 1L4AC 1RE4A 3TNUB 2ZFCA 1KFMA 1ZV8A 4I6MC 5BU5A 1CSBA 1IO4A 3B5NA 1GD2E 1T3JA 2N1TD 3V5BA 3HUSC 1S9KD 2Q5UA 1NTMK 3RL0C 1L4AB 3BASA 2IPPA 4N3YB 1IJDB 2NPSD 3NMDA 3GHGB 3VP9A 1FBMA 1IFDA 1SFCB 3WMM0 1MUUA 2GUSA 5KLVK 1FDMA 1X9VA 1LTIC 1N7SD 4RESB 2Q3IA 4C7NA 2W6AA 3V4QA 2YMYA 1KFNA 2QM8A 5AVSB 2XKMA 2P1JA 2WZ7A 4EOTA 1NKZB 2POHA 4WY4A 3TYYA 3LW5H 2CPBA 1HJBA 3H32B 3MD0A 2WPRA 1N73B 2XU6A 2WPSA 1W2EA 3UIAA 1OWAA 4WY4C 4N78D 2XDJA 1NWQA 5AW0B 5CCHD 3GHGC 2R5BA 3V2PA 1HWTC 1LWUB 1SQQK 1URQD 1AQ5A 1A02F 1DEBA 3RK3D 5APYA 5CCGC 4WBAA 1KILC 2R3CA 1FZGA 2GM4A 1FZAA 3H6PA 3RK3B 4ZKPA 1FAVA 1KILD 1ZR4A 1XTCC 2H7HA 2C9LY 1SP4A 2YKQA 3HE4B 1VPCA 3HE5A 2P7JA 2PP6A 3G3ZA 4LC1A 1LWUC 4GT1A 4GKGA 5AVWB 2P2UA 1L4AA 3HTKB 3P32A 4W80A 4Y99B 1KZUB 1EQ7A 3BRVB 2HODB 2Z4EA 2M8RA 1GDTA 1URQB 4JYBA 1LT9C 1T2KC 3KQGA 1JUNA 1GU4A 2WT7B 1IFJA 1VDFA 1WT6A 2XV5A 1H88A 5AW5B 2E42A 1IC2A 1LTAC 1DX7A 1L4AD 1J1EC 1N2DC 3L36A 1RE3A 2KSJA 1FZCB 5APXA 1NTKK 1GW3A 1NKNA 1RE4C 2YNYA 5AW6B 2FXMA 2HLOA 1N7SB 2J59M 2C0WA 3EQ2A 2Q7CA 2OYHB 4AUWA 1FJPA 2L5GB 1LTJB 2KLVA 3LIDA 3BATA 1QL2A 1L0NK 3I5CA 2JEEA 5BVZA 1J1DB 2HPCB 4LGDE 2W6BA 3GHGA 3TK1A 1JY3P 4LLHA 1JTHA 1RE3C 2N1TB 1JY3O 5CMZA 5AVUB 1HUCA 1IK9A 3VOPA 1WRGA 5APSA 3SWYA 5AW8B 3P7KA 3A7OA 1G1JA 1J2JB 3RK3C 3C9IA 2KYVA 3B5NB 2N1TC 1LTTC 1CW5A 2OYIC 4AYCA 1GL2D 2IX7C 3V2QA 1X79B 4WY4D 3KPEA 2M3BA 3HUSB 2YKPA 3M0DC 2OYHC 1CZQA 3MUDA 2LKMA 1A02J 1FOSE 2PAJA 1YTZI 5BU8B 5AW2B 1G2CA 5APWA 3M0AA 1H89A 5APUA 4N78E 2OYIA 1JMMA 2WPQA 2GUVA 3P8CD 3B5ND 4HH2A 5AVTB 2QM7A 5AW1B 1X8YA 2R5DA 1LTSC 2JJLA 1M1JB 3MIWA 3OA7A 3TSIA 1JY2O 1IFNA 5AW9B 3LIEA 2WSEH 1LTBC 1J1DC 1M7LA 4I2LC 5KJ7C 1LTJC 2WTYA 3L37A 4N6JA 1SQVK 1RY3A 5KJ7D 1MZ9A 3HTKA 3MTUE 1QL1A 1XTGB 4HYTB 1JTHB 3VYIA 1L0LK 2YKOA 5CJ4A 2I1JA 1SFCD 2FYUK 3A3YB 2NPSB 1URQA 1N7SA 3HE4A 5AVXB 1NTZK 2YO3A 1N86A 1FJKA 4O9BA 3B5NC 5APVA 1FZBA 1GTWA 3P8CE 1SQBK 3T97A 1HH0A 3L35A 2A45I 2IFMA 1T2KD 5APQA 2FYZA 1YTZT 1FOSF 5APTA 2J58A 2WITA 2H8PD 2O1JA 2A45H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTH A;  4WY4 A;  2N1T B;  3VOP A;  3RK2 D;  3RL0 D;  3RK3 C;  3HD7 D;  3B5N B;  2N1T C;  1KIL A;  4WY4 C;  2XDJ A;  1GL2 D;  5CCH D;  4W7Z A;  4WY4 D;  1URQ D;  3M0D C;  3RK3 D;  5CCG C;  5CCG A;  1KIL C;  1GL2 A;  5CCH A;  1HVV A;  3RK3 B;  1KIL D;  3KYQ A;  4WY4 B;  2HFE D;  2NPS C;  4N78 E;  2PP6 A;  3B5N D;  2HG5 D;  3HD7 B;  1N7S C;  1URQ C;  3RL0 B;  1L4A A;  3HTK B;  3RK2 B;  4W80 A;  1KIL B;  3TSI A;  1SFC A;  1GL2 C;  5CCH C;  2M8R A;  2NPS A;  3HD7 C;  1URQ B;  5KJ7 A;  5KJ7 C;  3HD7 A;  4W7Y A;  5CCG D;  5KJ7 D;  1GL2 B;  4OH8 B;  1XTG B;  1SFC C;  1JTH B;  2KOG A;  2N1T A;  1NHL A;  1SFC D;  1L4A C;  2NPS B;  1URQ A;  1N7S A;  1L4A D;  3B5N A;  3B5N C;  1T3J A;  2N1T D;  3RL0 C;  1L4A B;  3P8C E;  2NPS D;  1SFC B;  1N7S B;  3RK2 C;  1N7S D;  4JF7 A;  2H8P D;  2YMY A;  3PP5 A;  4LGD E;  2WZ7 A; 
#chains in the Genus database with same CATH topology
 1LJ2 A;  3MZW B;  1Z56 A;  4M3L A;  3OJA B;  3Q5R A;  1RF0 C;  4OGQ D;  1ZN5 A;  4MN4 C;  1S5L H;  1NTK J;  1OX3 A;  1E79 H;  1EDK A;  1M1J C;  2K9J B;  3RK3 E;  1GW4 A;  3M9B A;  4C7R A;  1HGV A;  4Y28 J;  1KQS O;  2FFD B;  2I1K A;  1SQQ G;  1R8E A;  3PHL A;  4BWN A;  2W90 A;  1VL2 A;  1JY2 P;  1E5W A;  4I7Z B;  4EIJ A;  1JY3 N;  3OW2 O;  1JCD A;  1PPJ E;  2V4H A;  3H1J G;  3FXD A;  3L72 E;  4AQR D;  3GW6 A;  1M1J A;  1MFT A;  4JBZ A;  1YJN P;  2HPC A;  1G2C B;  1SQP J;  3L4F A;  4H13 B;  2IYP A;  1ZOY C;  3R2P A;  4H44 B;  3S9O A;  3D71 A;  3CCR P;  1KB9 E;  1OMI A;  2O01 H;  2WSC H;  2KNC A;  1NTM D;  2IZ1 A;  3CWB D;  3IR9 A;  2K88 A;  2XZR A;  1MFZ A;  2KB7 P;  3H1L G;  4A7P A;  4R4M A;  1LT9 B;  3H1H D;  1FZF A;  3CCU P;  4H0L C;  1PP9 D;  2YXQ B;  1AFO A;  2A06 E;  2PRR A;  5CCG A;  2BEQ D;  1M57 D;  1GMJ A;  1MV8 A;  4Y99 C;  1GL2 A;  2Q6Q A;  2ZYA A;  4B86 A;  1AVY A;  1HVV A;  3A2A A;  3IF4 A;  3M9H A;  5TIS E;  1OXZ A;  2OTL P;  4BXL A;  3L75 E;  1VQO P;  1Q82 Q;  2Q9I A;  1BCC J;  1FDO A;  3VMY A;  2ZAE B;  1FZC C;  1VQ6 P;  4OWF A;  1GU5 A;  5AVV B;  2L91 A;  2Y0C A;  3HUS A;  1OFC X;  3KZI H;  4GIF A;  1KD1 Q;  3M06 A;  1HGZ A;  1RF1 A;  2E43 A;  1VQ9 P;  2W27 A;  5C39 A;  1NTM G;  2YMY A;  2Z5H A;  1BE3 D;  2WSE J;  4K35 A;  2H88 C;  3VP8 A;  2OTJ P;  2HG5 D;  1L0L E;  1ZLL A;  2KI7 B;  3HD7 B;  5B66 E;  1DD3 A;  2QG4 A;  1GK6 A;  1IFP A;  2FYU E;  2KP8 A;  2WWW A;  2Z5I A;  1KIL B;  4U3F E;  3RK2 B;  4R4L A;  1KQL A;  1SQB D;  3L71 J;  5CBN A;  3WUU A;  3AE4 C;  1JCC A;  1GL2 C;  1SFC A;  1RF0 A;  3TGU E;  3CCM P;  4JQ0 D;  1NU1 K;  2KIK A;  3BCC J;  3E1I A;  4JYC A;  2NPS A;  2BCC J;  3HD7 C;  3GMA A;  3PH0 A;  2BEZ F;  4C7N B;  3VTP C;  5KJ7 A;  3G4S P;  4ASV A;  4RO0 A;  1BE3 J;  1T3U A;  3SFD C;  2IFN A;  5CCG D;  1T8Z A;  4YXD C;  1QX8 A;  3CX5 H;  3PJS K;  2AEM A;  1NTK G;  3QH9 A;  1LP1 B;  5AVR B;  3V2R A;  1CI6 B;  2KOG A;  3EFF K;  3CCQ P;  1S1C X;  2A06 D;  2E5T A;  4PD4 E;  1NTZ G;  1YQ4 C;  4EI2 A;  5AW3 B;  4GOF A;  3F89 A;  3MGN A;  3VMZ A;  1KIL E;  2B88 A;  1H8A A;  2FFD C;  4EDF A;  2RMZ A;  3CXH H;  1N73 A;  1SLQ A;  2SPZ A;  4IFD K;  4EYY Q;  4PD4 I;  1K8A Q;  1P84 D;  4OVN F;  5DJU B;  2WSF H;  3O6Q B;  4PD4 H;  1IFI A;  1KMI Z;  1NGM B;  2H89 C;  3EFG A;  1D7M A;  3CWB J;  3L75 G;  1NAF A;  1OW8 A;  3AE5 C;  2JP3 A;  3CI9 A;  3RL0 g;  2N9B A;  4C46 A;  2ZYG A;  2W8Z A;  3VN0 A;  1VF5 B;  2OAR A;  3W68 A;  1SQX J;  1JEK A;  3D70 A;  4WWI A;  2KNC B;  2P58 A;  4PJ0 H;  2R32 A;  3TNU A;  1SQX E;  3WU2 E;  4PV1 D;  3SWF A;  1LT1 A;  3A5T A;  3H1L J;  1YYC A;  3CL3 D;  4I1L A;  3RK2 C;  2G3A A;  3L75 D;  4ZNC A;  3M0D A;  3GG2 A;  3CC2 P;  3AEB C;  5KLV G;  4JF7 A;  5CHX A;  5KLV J;  1HF9 A;  1PGQ A;  1OZH A;  1WMK A;  4DT0 A;  3PP5 A;  2OYH A;  4H0L D;  4WB4 A;  1NH4 A;  3A0H E;  2C0X A;  3NFQ A;  1K04 A;  2VRS A;  3PLN A;  3B8E B;  5AW4 B;  3R4Y A;  4D6T G;  1PPJ G;  2BAS A;  2HYN A;  4U3F G;  2H43 A;  2CPS A;  2IBZ I;  3II6 A;  5KTB A;  1RF1 B;  2K9Y A;  1JO5 A;  2WMM A;  1PGO A;  3HE5 B;  3AE9 C;  4YPC A;  1EDI A;  3KZI E;  4IFM A;  1SVF A;  5KLV D;  3RK2 D;  5KAI H;  4HJG H;  1FU1 A;  4IL6 X;  3RL0 D;  3BVH A;  2I8D A;  2WSC J;  3AE6 C;  3HD7 D;  5AVZ B;  3A0B H;  3H1L D;  3W67 A;  3EWK A;  4D6T E;  3Q3D A;  1SS1 A;  4DOJ A;  1JMB A;  3N4X A;  1EXJ A;  1HTL C;  1KIL A;  1AQT A;  1X0T A;  3H1K D;  5H2F H;  1NO4 A;  3V2Q A;  1DH3 A;  3HRN A;  1RF1 C;  1PGJ A;  1JY2 N;  2E76 C;  2ZVO B;  1FZE A;  3FWL A;  1JOC A;  3BRT B;  4IFF A;  4W7Z A;  3V2N A;  1IFM A;  3VMA A;  1K05 A;  3H32 A;  1JM0 A;  1N73 C;  1FS0 E;  3CMA P;  4XA4 A;  3TGU J;  3N7N A;  3P8M C;  4BRY B;  2FFD A;  2M5A A;  1KV4 A;  1N8R Q;  1H0T A;  1PFI A;  3A0B E;  2FKW B;  3FX0 A;  5L8R J;  1VQN P;  2IZ0 A;  1KB9 H;  2WT7 A;  5AW7 B;  5CCH A;  1N7L A;  1BE3 G;  4DCK A;  1P84 H;  1FDI A;  1SQV G;  1ZRT E;  2OTK E;  3GF3 A;  5KLI B;  3Q5P A;  1M8O B;  2NRG A;  1IK7 A;  1CI6 A;  5KAI E;  5CJ0 A;  1HBW A;  4WVZ A;  4ZKU A;  1YIT P;  3KYQ A;  1R5L A;  4K3A A;  1FC2 C;  3NXS A;  4WY4 B;  3A0H H;  2XNX A;  2HFE D;  2HOD A;  1GZL A;  1LWU A;  2NPS C;  2ZXE B;  4KHX A;  4ZMD A;  1VQ7 P;  1DD4 A;  3H1H G;  3CC4 P;  2YIU B;  3IFM A;  3V4W A;  3CWB G;  3L75 J;  3VMX A;  1SQV D;  4UB6 H;  3U1A A;  4XE5 B;  2R44 A;  3M9Q A;  1YI2 P;  1FZC A;  3S1K A;  1DIP A;  2A45 G;  2B89 A;  1N7S C;  1SQP K;  1URQ C;  3WU2 H;  3U59 A;  2QJP B;  3FWN A;  4PD4 D;  3RL0 B;  1NOH A;  1YHQ P;  2OYI B;  2MJZ A;  3OAK A;  1YQ3 C;  3JCU H;  4GOE A;  2O1K A;  1K73 Q;  1EDJ A;  3KDP B;  1LGH B;  1LNQ A;  5CCH C;  4L76 A;  3JSV C;  2AEJ A;  4OGQ B;  4UB6 E;  3CCV P;  3PTZ A;  3TF5 A;  3AEF C;  1RH5 B;  4PV1 C;  3M91 A;  3BCC E;  4YTP C;  3U1C A;  1BCC G;  1G1I A;  1LTG C;  2YO2 A;  3AED C;  5AVQ B;  4DZO A;  2QJY C;  1LT9 A;  1LTJ A;  2JDI H;  3H1K G;  1NU1 G;  3H1I E;  2KSE A;  3HD7 A;  3NTN A;  5AVY B;  3L71 E;  1JB0 J;  1YBK A;  3O8Z A;  3O6Q A;  4W7Y A;  1GK4 A;  3RBZ A;  4GOD A;  4H44 D;  1GL2 B;  2FXO A;  4U3F J;  1RQV A;  1QEX A;  3H1I J;  1J1E B;  1Y9B A;  3G9R A;  4H13 D;  4OH8 B;  1SFC C;  2WQY C;  1SQX K;  3CLQ A;  1Y8A A;  3BCC G;  4L75 A;  5B5E E;  2UWJ E;  1JNM A;  2E75 D;  1UII A;  2N1T A;  1NHL A;  2C9N Y;  2P67 A;  2B9B A;  2M3E A;  2PGD A;  2DW3 A;  4U3F D;  1L4A C;  4RJT A;  1RE4 A;  3L71 G;  3TNU B;  2ZT9 C;  2ZFC A;  1KFM A;  1ZV8 A;  4I6M C;  2QIW A;  1VF5 C;  2LXC B;  3H1K E;  3L70 D;  5BU5 A;  1SQP G;  1CSB A;  1IO4 A;  3C1L A;  1S9K E;  2D2C B;  2O01 N;  3B5N A;  3KHU A;  1T3J A;  1U7J A;  2N1T D;  3V5B A;  3CX5 I;  3HUS C;  1S9K D;  5CBO A;  1VQK P;  1KYO E;  1RQU A;  1NTM K;  2Q5U A;  3RL0 C;  2WVR A;  1L4A B;  3BAS A;  2IPP A;  4N3Y B;  4H0L B;  1IJD B;  3CCJ P;  2QA4 P;  2NPS D;  1BSN A;  3NMD A;  3GHG B;  4IOI H;  1FBM A;  3VP9 A;  5KAF H;  1IFD A;  1L0N E;  1SFC B;  3WMM 0;  3H1K J;  1MUU A;  2GUS A;  5KLV K;  2RN0 A;  3AE3 C;  1MKM A;  3AEG C;  3G71 P;  3QWO C;  4KJM A;  1FDM A;  1X9V A;  1EZV I;  1LTI C;  1N7S D;  4RES B;  2CK3 H;  2Q3I A;  4C7N A;  4NPF X;  1YJ9 P;  2M0B A;  2W6A A;  2Q1K A;  1S4X A;  3V4Q A;  5E79 H;  1OVU A;  1Y47 A;  3L70 E;  1KB9 D;  1S5L X;  2E76 B;  1L0L G;  1KFN A;  1PL5 A;  1OIP A;  1UIX A;  2B87 B;  2QM8 A;  2XKM A;  2P1J A;  5AVS B;  5EFW B;  2WZ7 A;  4EOT A;  1NKZ B;  2POH A;  1KTM A;  3L72 G;  4WY4 A;  4KT0 J;  2D2C D;  3LW5 H;  3TYY A;  2CPB A;  1HJB A;  1NU1 D;  3H32 B;  2OQQ A;  1S2E A;  2Y0E A;  1NVO A;  2A06 G;  2Q3E A;  3MD0 A;  4YXW H;  2E74 B;  2WPR A;  3AE7 C;  1N73 B;  4PJ0 E;  2MKV A;  2XU6 A;  2WPS A;  3CCE P;  1W2E A;  3UIA A;  3ABV C;  2JWD A;  1SQB G;  1OWA A;  4D6T J;  1EDL A;  1ZR2 A;  1Q86 Q;  4WY4 C;  3L74 D;  2QVA A;  2XDJ A;  2GA1 A;  1TU3 F;  3MUD C;  4N78 D;  5AW0 B;  5CCH D;  3CXH D;  3Q5S A;  3GHG C;  2R5B A;  2E74 C;  3C8V A;  3H1I D;  1GD2 E;  1L2P A;  3V2P A;  1HWT C;  5TJH A;  1LWU B;  1SQQ K;  1FOS E;  3AEC C;  3K5B A;  1URQ D;  3GLM A;  5GTI H;  1AQ5 A;  1A02 F;  4TLF A;  1DEB A;  2AXT E;  2W83 C;  3AEE C;  3RK3 D;  1KB9 I;  5APY A;  2QRX A;  1AV1 A;  3KXD A;  5CCG C;  4WBA A;  1KIL C;  2R3C A;  1FZG A;  1QLE D;  1FZA A;  5KLV E;  1BDD A;  2GM4 A;  1NU1 J;  3H6P A;  3RK3 B;  4ZKP A;  1FAV A;  1W2B O;  1KIL D;  1S3J A;  1S5L E;  1XTC C;  2WSS H;  1ZR4 A;  2E75 C;  2FXP A;  1SQQ E;  2H7H A;  2C9L Y;  3CX5 E;  2KS1 A;  3L74 J;  1AVO A;  1OVR A;  2K1A A;  2ZXX A;  4H13 C;  3D6Y A;  2QJY B;  2M5A B;  1FE6 A;  2IDB A;  1SP4 A;  2YKQ A;  3HE4 B;  1H0T B;  1VPC A;  3JCU E;  1VQ4 P;  3HE5 A;  2P7J A;  2PP6 A;  3G3Z A;  3ITK A;  4LC1 A;  1LWU C;  2KUB A;  4GT1 A;  4GKG A;  5AVW B;  2P2U A;  1L0N D;  3F5H A;  1L4A A;  1EXI A;  3HTK B;  3P32 A;  2FYN C;  3T97 B;  4W80 A;  4Y99 B;  1KZU B;  1NWQ A;  1EQ7 A;  2RKL A;  2OYO A;  3BRV B;  3FGA D;  1BGY D;  2HOD B;  3CCL P;  2Z4E A;  2JO1 A;  2M8R A;  1GDT A;  1AJY A;  1M56 D;  1ZME C;  3CME P;  2D2C C;  3B4S A;  1URQ B;  2IYO A;  2K37 A;  2QSI A;  4JYB A;  1LT9 C;  1U7M A;  2LR2 A;  1T2K C;  3SFE C;  3KQG A;  1JUN A;  2KZJ A;  2K3R A;  5GTI E;  3CPW O;  1GU4 A;  2WT7 B;  1QVG O;  2B87 A;  1IFJ A;  4TT3 H;  1VDF A;  5M1B A;  5KKZ B;  1BE3 E;  1WT6 A;  2KZI A;  5TIS H;  5KLI C;  1YIJ P;  1SQX D;  2XV5 A;  1ZW0 A;  4QMA A;  1H88 A;  1BCC D;  2BCC E;  2AEF A;  3LW5 J;  4DJG A;  1PPJ D;  3D6Z A;  1VF5 D;  3TGU G;  1KYO H;  3H1L E;  4D6T D;  5AW5 B;  1ZRT D;  1SQB E;  1IC2 A;  4NPD A;  2E74 D;  3L73 E;  3CCS P;  2E5Y A;  1LTA C;  2E42 A;  1L4A D;  1DX7 A;  5KKZ C;  2FYU G;  1J1E C;  1S72 P;  1KOR A;  1N2D C;  3AE2 C;  3JC2 2;  3L36 A;  3IN6 A;  1RE3 A;  2KSJ A;  2ZVN B;  1FZC B;  5APX A;  3CXH I;  1NTK K;  2QJP C;  1KQG B;  3I56 P;  3CWB E;  1QGK B;  1KYO I;  3Q2Y A;  1GW3 A;  2E76 D;  1NKN A;  1RE4 C;  3H1H E;  2YXR B;  3E7K A;  2YNY A;  1SQP D;  2RH0 A;  5AW6 B;  2V7Q J;  2FXM A;  2YMK A;  1BSH A;  2HLO A;  2FYU D;  3L70 G;  1N7S B;  2J59 M;  1NYH A;  5E79 E;  2C0W A;  3EQ2 A;  2Q7C A;  3GF7 A;  2OYH B;  1SQV J;  3MHV A;  4AUW A;  1FJP A;  2L5G B;  4GDO A;  1LTJ B;  2KLV A;  2O01 J;  3SWK A;  3V6I A;  3IAO A;  3L73 D;  3LID A;  1DEE G;  3BAT A;  1QL2 A;  1L0N K;  3I5C A;  3WUV A;  2IBZ E;  2JEE A;  4H44 C;  5BVZ A;  2Y9Z A;  1VQM P;  1J1D B;  1NTK D;  2HR3 A;  2HPC B;  4LGD E;  2W6B A;  3GHG A;  5KAF E;  1JY3 P;  4LLH A;  1JTH A;  3TK1 A;  1RE3 C;  1SQB J;  2N1T B;  3L71 D;  1NTZ D;  4IL6 H;  1JY3 O;  2J5U A;  5CMZ A;  5AVU B;  1HUC A;  2W6J H;  2QEX P;  1IK9 A;  3VOP A;  1WRG A;  2KLU A;  5APS A;  1R5S A;  3SWY A;  1SQX G;  2G8Y A;  1EZV D;  5GTH H;  2IBZ G;  5AW8 B;  3P7K A;  3A7O A;  4UB8 E;  4JPZ B;  3RBX A;  1SQP E;  1QVF O;  1G1J A;  1J2J B;  3RK3 C;  2ITA A;  3G6E P;  3C9I A;  2KYV A;  3B5N B;  5DJT B;  1OW7 A;  2E75 B;  2N1T C;  3L72 J;  4CPG A;  2FYU J;  3TDK A;  1LTT C;  1YJW P;  1KN7 A;  2V7Q H;  1CW5 A;  2OYI C;  4AYC A;  1GL2 D;  1L0L J;  2JWA A;  4RKU J;  2IBZ D;  2IX7 C;  1EZV G;  1USE A;  1BGY G;  1X79 B;  4OGQ C;  2K9J A;  2QE7 H;  4WY4 D;  3USS A;  1SQV E;  3KPE A;  3H25 A;  2AXT H;  1U57 A;  2M3B A;  3HUS B;  2KK7 A;  2YKP A;  3H1J D;  2QJK B;  1VQP P;  1NTZ E;  3M0D C;  2OYH C;  1NAY A;  1CZQ A;  3MP7 B;  3MUD A;  2LKM A;  1M90 Q;  1VQL P;  1BCC E;  2BCC D;  3B71 A;  3H1H J;  1PZQ A;  2PAJ A;  1A02 J;  1YTZ I;  5BU8 B;  2Y0D A;  5AW2 B;  3RGU A;  1Q81 Q;  3L73 G;  1NJI Q;  1KQF B;  3TGU D;  2ZJS E;  1G2C A;  1ZP0 C;  5APW A;  4UB8 H;  4ASW A;  1X22 A;  1Q2N A;  3M0A A;  3I55 P;  1H89 A;  2QJK C;  2BCC G;  3AE8 C;  5H2F E;  2FY8 A;  5APU A;  1PP9 G;  3L74 E;  4N78 E;  3L73 J;  2OYI A;  1SQQ J;  1JMM A;  1KYO D;  2AXC A;  1IZN B;  2GUV A;  2O3J A;  2WPQ A;  3E1R A;  3P8C D;  1VQ8 P;  3PRJ A;  4I7Z C;  3B5N D;  4HH2 A;  1NTM E;  5AVT B;  2QM7 A;  5AW1 B;  5B66 H;  1X8Y A;  2R5D A;  2JR8 A;  1LTS C;  2LXB A;  2JJL A;  3ZDM A;  1M1J B;  2WPV B;  2ZYD A;  2FBW C;  3MIW A;  3OA7 A;  2R3S A;  1BGY J;  1JY2 O;  3TSI A;  2WSF J;  5K5G B;  1IFN A;  2OGU A;  5AW9 B;  2XND H;  3LIE A;  1PGP A;  4L73 A;  2WSE H;  1LTB C;  1J1D C;  1P84 E;  3S4R A;  3CD6 P;  1M7L A;  1L0N G;  4I2L C;  1NTK E;  5KJ7 C;  3WUT A;  1LTJ C;  2FYN B;  2WTY A;  3FXE A;  2ZT9 B;  1SQV K;  2YIU C;  1RY3 A;  1AA0 A;  1P84 I;  3L37 A;  4N6J A;  4Z1M H;  5KJ7 D;  1MZ9 A;  3HTK A;  1Q90 D;  3MTU E;  1QL1 A;  2PFX A;  1XTG B;  1ZXG A;  4HYT B;  1T6A A;  3Q1M A;  1JTH B;  1L0L D;  1L0L K;  2YKO A;  3VYI A;  5CJ4 A;  1HJ0 A;  3AE1 C;  2I1J A;  1USD A;  3AEA C;  1SFC D;  1BDC A;  2FYU K;  2JKV A;  3A3Y B;  3L72 D;  2KS1 B;  2NPS B;  1PIX A;  1URQ A;  1N7S A;  3HE4 A;  1K9M Q;  5AVX B;  1BGY E;  1NTZ K;  1RHZ B;  2YO3 A;  1OW6 A;  1PP9 J;  4XFJ A;  3CXH E;  1N86 A;  1FJK A;  1Q7Y Q;  4O9B A;  2N9Y B;  3B5N C;  1W5C E;  2NZ2 A;  3H1J J;  3L70 J;  5APV A;  3SSU A;  4L74 A;  1FZB A;  1NTM J;  5B5E H;  1GTW A;  1LP1 A;  3P8C E;  1SQB K;  1EC5 A;  1NU1 E;  3H1I G;  3T97 A;  1VQ5 P;  3H1J E;  2P10 A;  1HH0 A;  1EZV E;  3L35 A;  1PP9 E;  2A45 I;  3L74 G;  2IFM A;  4BRY A;  1T2K D;  5APQ A;  1L0N J;  2KXP B;  2FYZ A;  3CC7 P;  4PV1 B;  5GTH E;  1M1K Q;  1PV3 A;  1YTZ T;  1OVV A;  1KC8 Q;  1FOS F;  5APT A;  2Y9Y A;  4HKZ H;  1SQQ D;  2ZT9 D;  2J58 A;  2WIT A;  3CX5 D;  2H8P D;  2O1J A;  4U7J A;  2A45 H;  3BCC D;  4HB1 A;  4IL6 E;  1NTZ J;  4NPE A; 
#chains in the Genus database with same CATH homology
 4M3L A;  1Z56 A;  3OJA B;  1RF0 C;  1ZN5 A;  1M1J C;  4C7R A;  2OYI B;  1GW4 A;  3M9B A;  1HGV A;  2FFD B;  2I1K A;  1JY2 P;  1E5W A;  4EIJ A;  1JY3 N;  1JCD A;  4AQR D;  1M1J A;  2HPC A;  1G2C B;  3L4F A;  3R2P A;  2WSC H;  2O01 H;  3IR9 A;  2XZR A;  1MFZ A;  2KB7 P;  1FZF A;  1LT9 B;  1AFO A;  5CCG A;  4Y99 C;  4B86 A;  1MV8 A;  1GL2 A;  1HVV A;  3A2A A;  3M9H A;  1OXZ A;  2Q9I A;  1FZC C;  1GU5 A;  5AVV B;  3HUS A;  4GIF A;  3M06 A;  1HGZ A;  1RF1 A;  2E43 A;  2W27 A;  2Z5H A;  3VP8 A;  2HG5 D;  1ZLL A;  3HD7 B;  1GK6 A;  2WWW A;  2KP8 A;  3RK2 B;  2Z5I A;  1KIL B;  1KQL A;  1JCC A;  1GL2 C;  1SFC A;  1RF0 A;  1NU1 K;  3E1I A;  4JYC A;  2NPS A;  3HD7 C;  4C7N B;  3VTP C;  5KJ7 A;  1T3U A;  2IFN A;  5CCG D;  1T8Z A;  3V2R A;  5AVR B;  1CI6 B;  2KOG A;  5AW3 B;  3MGN A;  3VMZ A;  1H8A A;  2FFD C;  1N73 A;  1SLQ A;  4IFD K;  2WSF H;  1IFI A;  3EFG A;  1NAF A;  3CI9 A;  2N9B A;  4C46 A;  3VN0 A;  2OAR A;  3TNU A;  2R32 A;  3SWF A;  3A5T A;  1YYC A;  3CL3 D;  4I1L A;  3RK2 C;  3M0D A;  4JF7 A;  5CHX A;  3PP5 A;  4WB4 A;  1NH4 A;  2C0X A;  3NFQ A;  2VRS A;  3B8E B;  5AW4 B;  2BAS A;  2HYN A;  2H43 A;  2CPS A;  3II6 A;  5KTB A;  1RF1 B;  1JO5 A;  3HE5 B;  4IFM A;  1SVF A;  3RK2 D;  3BVH A;  3RL0 D;  1FU1 A;  3HD7 D;  5AVZ B;  4DOJ A;  3N4X A;  1HTL C;  1KIL A;  1DH3 A;  1NO4 A;  3HRN A;  1RF1 C;  1JY2 N;  3V2N A;  1FZE A;  4W7Z A;  1JOC A;  3BRT B;  4IFF A;  1IFM A;  1N73 C;  3H32 A;  4XA4 A;  3N7N A;  3P8M C;  2FFD A;  1PFI A;  2FKW B;  2WT7 A;  5AW7 B;  5CCH A;  1N7L A;  1HBW A;  1CI6 A;  5CJ0 A;  4ZKU A;  3KYQ A;  3NXS A;  4WY4 B;  2XNX A;  2HFE D;  2HOD A;  1GZL A;  1LWU A;  2NPS C;  2ZXE B;  4KHX A;  3IFM A;  3V4W A;  3VMX A;  3U1A A;  4XE5 B;  3M9Q A;  1FZC A;  2A45 G;  1N7S C;  1SQP K;  1URQ C;  3U59 A;  3RL0 B;  1NOH A;  2MJZ A;  3OAK A;  2O1K A;  3KDP B;  1LGH B;  5CCH C;  2OYH A;  3M91 A;  3U1C A;  1ZR2 A;  1S9K E;  1LTG C;  1G1I A;  2YO2 A;  5AVQ B;  4DZO A;  1LT9 A;  1LTJ A;  3HD7 A;  3NTN A;  5AVY B;  3O8Z A;  4W7Y A;  1GK4 A;  1GL2 B;  3VMY A;  4OH8 B;  1J1E B;  1SFC C;  3CLQ A;  1SQX K;  1JNM A;  2N1T A;  1NHL A;  2C9N Y;  2P67 A;  1L4A C;  1RE4 A;  3TNU B;  2ZFC A;  1KFM A;  1ZV8 A;  4I6M C;  5BU5 A;  1CSB A;  1IO4 A;  3B5N A;  1GD2 E;  1T3J A;  2N1T D;  3V5B A;  3HUS C;  1S9K D;  2Q5U A;  1NTM K;  3RL0 C;  1L4A B;  3BAS A;  2IPP A;  4N3Y B;  1IJD B;  2NPS D;  3NMD A;  3GHG B;  3VP9 A;  1FBM A;  1IFD A;  1SFC B;  3WMM 0;  1MUU A;  2GUS A;  5KLV K;  1FDM A;  1X9V A;  1LTI C;  1N7S D;  4RES B;  2Q3I A;  4C7N A;  2W6A A;  3V4Q A;  2YMY A;  1KFN A;  2QM8 A;  5AVS B;  2XKM A;  2P1J A;  2WZ7 A;  4EOT A;  1NKZ B;  2POH A;  4WY4 A;  3TYY A;  3LW5 H;  2CPB A;  1HJB A;  3H32 B;  3MD0 A;  2WPR A;  1N73 B;  2XU6 A;  2WPS A;  1W2E A;  3UIA A;  1OWA A;  4WY4 C;  4N78 D;  2XDJ A;  1NWQ A;  5AW0 B;  5CCH D;  3GHG C;  2R5B A;  3V2P A;  1HWT C;  1LWU B;  1SQQ K;  1URQ D;  1AQ5 A;  1A02 F;  1DEB A;  3RK3 D;  5APY A;  5CCG C;  4WBA A;  1KIL C;  2R3C A;  1FZG A;  2GM4 A;  1FZA A;  3H6P A;  3RK3 B;  4ZKP A;  1FAV A;  1KIL D;  1ZR4 A;  1XTC C;  2H7H A;  2C9L Y;  1SP4 A;  2YKQ A;  3HE4 B;  1VPC A;  3HE5 A;  2P7J A;  2PP6 A;  3G3Z A;  4LC1 A;  1LWU C;  4GT1 A;  4GKG A;  5AVW B;  2P2U A;  1L4A A;  3HTK B;  3P32 A;  4W80 A;  4Y99 B;  1KZU B;  1EQ7 A;  3BRV B;  2HOD B;  2Z4E A;  2M8R A;  1GDT A;  1URQ B;  4JYB A;  1LT9 C;  1T2K C;  3KQG A;  1JUN A;  1GU4 A;  2WT7 B;  1IFJ A;  1VDF A;  1WT6 A;  2XV5 A;  1H88 A;  5AW5 B;  2E42 A;  1IC2 A;  1LTA C;  1DX7 A;  1L4A D;  1J1E C;  1N2D C;  3L36 A;  1RE3 A;  2KSJ A;  1FZC B;  5APX A;  1NTK K;  1GW3 A;  1NKN A;  1RE4 C;  2YNY A;  5AW6 B;  2FXM A;  2HLO A;  1N7S B;  2J59 M;  2C0W A;  3EQ2 A;  2Q7C A;  2OYH B;  4AUW A;  1FJP A;  2L5G B;  1LTJ B;  2KLV A;  3LID A;  3BAT A;  1QL2 A;  1L0N K;  3I5C A;  2JEE A;  5BVZ A;  1J1D B;  2HPC B;  4LGD E;  2W6B A;  3GHG A;  3TK1 A;  1JY3 P;  4LLH A;  1JTH A;  1RE3 C;  2N1T B;  1JY3 O;  5CMZ A;  5AVU B;  1HUC A;  1IK9 A;  3VOP A;  1WRG A;  5APS A;  3SWY A;  5AW8 B;  3P7K A;  3A7O A;  1G1J A;  1J2J B;  3RK3 C;  3C9I A;  2KYV A;  3B5N B;  2N1T C;  1LTT C;  1CW5 A;  2OYI C;  4AYC A;  1GL2 D;  2IX7 C;  3V2Q A;  1X79 B;  4WY4 D;  3KPE A;  2M3B A;  3HUS B;  2YKP A;  3M0D C;  2OYH C;  1CZQ A;  3MUD A;  2LKM A;  1A02 J;  1FOS E;  2PAJ A;  1YTZ I;  5BU8 B;  5AW2 B;  1G2C A;  5APW A;  3M0A A;  1H89 A;  5APU A;  4N78 E;  2OYI A;  1JMM A;  2WPQ A;  2GUV A;  3P8C D;  3B5N D;  4HH2 A;  5AVT B;  2QM7 A;  5AW1 B;  1X8Y A;  2R5D A;  1LTS C;  2JJL A;  1M1J B;  3MIW A;  3OA7 A;  3TSI A;  1JY2 O;  1IFN A;  5AW9 B;  3LIE A;  2WSE H;  1LTB C;  1J1D C;  1M7L A;  4I2L C;  5KJ7 C;  1LTJ C;  2WTY A;  3L37 A;  4N6J A;  1SQV K;  1RY3 A;  5KJ7 D;  1MZ9 A;  3HTK A;  3MTU E;  1QL1 A;  1XTG B;  4HYT B;  1JTH B;  3VYI A;  1L0L K;  2YKO A;  5CJ4 A;  2I1J A;  1SFC D;  2FYU K;  3A3Y B;  2NPS B;  1URQ A;  1N7S A;  3HE4 A;  5AVX B;  1NTZ K;  2YO3 A;  1N86 A;  1FJK A;  4O9B A;  3B5N C;  5APV A;  1FZB A;  1GTW A;  3P8C E;  1SQB K;  3T97 A;  1HH0 A;  3L35 A;  2A45 I;  2IFM A;  1T2K D;  5APQ A;  2FYZ A;  1YTZ T;  1FOS F;  5APT A;  2J58 A;  2WIT A;  2H8P D;  2O1J A;  2A45 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...