3HD7B

Helical extension of the neuronal snare complex into the membrane, spacegroup c 1 2 1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
98
structure length
98
Chain Sequence
KQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 2
publication title Helical extension of the neuronal SNARE complex into the membrane
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
total genus 42
structure length 98
sequence length 98
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05739 SNARE SNARE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3hd7B00
5CCHD 4OH8B 1SFCB 3B5NC 2HG5D 3RL0D 1GL2D 1N7SB 3HTKB 3HD7D 3TSIA 3M0DC 3B5NB 2NPSC 2HFED 2N1TD 3RK3C 2XDJA 4JF7A 3RL0B 1N7SA 1URQA 3HD7B 5CCHA 1KILC 1JTHB 2M8RA 3P8CE 3B5ND 5KJ7C 1GL2A 1T3JA 1KILB 4WY4C 2N1TA 3RK3D 4WY4B 5CCGC 4W80A 3RK2C 1SFCA 1HVVA 2KOGA 2NPSB 3RK3B 3B5NA 1KILD 1NHLA 5KJ7D 1L4AC 1XTGB 4WY4D 1URQC 5CCHC 3HD7A 1L4AB 5CCGD 3PP5A 4W7YA 3KYQA 3RK2D 2NPSD 1GL2C 1JTHA 1KILA 5KJ7A 3VOPA 3RK2B 4WY4A 1L4AD 1SFCC 1URQD 2WZ7A 5CCGA 1N7SC 2NPSA 2YMYA 1URQB 4LGDE 3RL0C 2H8PD 2PP6A 3HD7C 1L4AA 4W7ZA 2N1TC 1GL2B 4N78E 1SFCD 2N1TB 1N7SD
chains in the Genus database with same CATH superfamily
3CC2P 4OH8B 4M3LA 3VP9A 4UB8H 3M06A 1HJ0A 1Z56A 2C9LY 1NO4A 1L2PA 4IFFA 4BXLA 1X8YA 1N73C 2JWAA 4IOIH 3L72G 2QEXP 3FWLA 1DEEG 3P8CE 4NPFX 1NKNA 2N1TA 2Z5HA 1YJ9P 4H0LC 1FZCB 1YHQP 4GT1A 2JO1A 1K04A 1M56D 2LR2A 1SQXG 2L5GB 1KILD 5B5EE 1EC5A 2O01N 1XTGB 4H13B 4GODA 3L4FA 2B88A 3V2PA 2KLUA 2QM7A 1LWUA 1VQLP 2POHA 3KHUA 1SQBD 5DJTB 4HB1A 3VOPA 1R5SA 5CBOA 1SQQG 3SFDC 1PGOA 2P58A 1IK9A 1KN7A 1JCDA 1KV4A 1NTKG 3AEDC 2A06G 1L0LJ 3IAOA 4LGDE 2O3JA 3HD7C 5BU5A 5H2FE 2KYVA 3CL3D 2WSEJ 3T97B 2QE7H 5B5EH 1MKMA 1VQ4P 1LJ2A 5AVXB 3A5TA 3FXEA 2JJLA 2Z4EA 2FYUG 4IFMA 3RGUA 1BGYG 2IZ0A 4BRYB 3ABVC 1GMJA 2QG4A 1N7SA 1Y8AA 2KZIA 2OYIA 1UIXA 3HE4B 1ZLLA 2KP8A 1FAVA 2O1JA 3LIEA 1YTZT 4L74A 2QA4P 2Q3EA 1NTMG 4W80A 4MN4C 3L71G 5H2FH 1GTWA 2NPSB 2WVRA 2OYHC 1QVFO 1QL1A 1NGMB 3CWBG 2IYPA 3M0DA 2OTLP 2Q6QA 1SQXK 4L73A 2BCCG 2QJYC 2ZYDA 1YQ3C 3MUDC 2A45G 3W68A 1MUUA 3CC7P 1FDIA 4JBZA 1OZHA 1NU1G 5BVZA 1A02F 4AUWA 1CW5A 3W67A 3A7OA 3D6ZA 1IJDB 3USSA 1MFTA 3A3YB 1OVVA 1UIIA 5AVSB 1FJPA 1VQPP 3L74E 4NPDA 1ZR2A 2ZVOB 2M3BA 3Q3DA 3FWNA 4GKGA 1S72P 2ZVNB 3B5NC 1SQVG 2FXMA 3LIDA 3G71P 1SQBJ 1KQFB 1SP4A 2OTJP 2M5AB 4ZNCA 2KSJA 3TGUG 2N1TD 3RK3C 1QEXA 1HH0A 1EDLA 1SQXD 2IDBA 3GHGB 5AVYB 2LXCB 5KLIC 4DZOA 1P84D 4WWIA 2P10A 2ZFCA 4WY4B 2W6BA 3HUSB 1OW8A 4U3FE 4U7JA 1NTMK 2E76C 2KNCA 2A06D 4PV1D 1N73A 5AW9B 4JYCA 3VMYA 1T3UA 2NRGA 1IFIA 1FE6A 3CLQA 4N6JA 2Q3IA 4D6TE 2JWDA 4Y99C 1RF0A 5BU8B 2WSCH 1NTZJ 1NU1K 5KLVK 3CCUP 2YMYA 1SQPE 2FYZA 1Q86Q 2W83C 1BGYD 3WUTA 2PP6A 2V7QH 1AA0A 3F89A 4K35A 1L0LG 1S3JA 3EFGA 3H1JE 2K9JB 4N3YB 1N7SD 3BASA 3KZIE 3TNUB 4B86A 1FC2C 1RE3A 1PP9E 3CMEP 3L71D 1X79B 4XA4A 2JKVA 2KSEA 4DT0A 4H44B 5CMZA 1N8RQ 4A7PA 2MKVA 5K5GB 1S5LE 4PD4D 1KILB 1RF1C 5AVRB 3L37A 5AVQB 4Y28J 2Y0DA 2FFDB 5AW5B 2HR3A 1NU1D 5KLVD 1G1IA 1K8AQ 1FZFA 3KZIH 3AEAC 3OAKA 1T8ZA 3RK2D 1OXZA 1DD3A 2UWJE 3H1HD 1SQXJ 3H32A 5GTIE 4I7ZC 1EQ7A 5M1BA 1KQLA 1NVOA 5APQA 1FDOA 1URQD 1K9MQ 1VQ7P 2P2UA 1BCCE 5KAIE 1S5LH 4HH2A 2QVAA 1LP1B 2Q5UA 3B4SA 2OYHA 2JR8A 3CD6P 3TGUD 2K1AA 3H1IE 3P7KA 3RK3E 1YJNP 3MUDA 1SFCB 1SLQA 1FZCC 1WMKA 4RKUJ 4OGQB 1SQBG 2O01H 5GTIH 1LTSC 2E75D 2ZT9D 4H13C 3CCSP 5KTBA 2AEFA 3L74D 5KAIH 2KLVA 2E74B 1BGYJ 4KHXA 5APXA 1EDJA 5CCGC 3AE2C 1GK6A 1H0TA 3B5NA 2IZ1A 1X0TA 4EI2A 4RJTA 1T2KD 4I1LA 1SQPK 1G2CB 1NTMJ 3PP5A 5APUA 3L71J 1ZOYC 4H0LD 1S9KE 1JTHA 3PHLA 3L73E 3RBZA 1RE4C 3IN6A 3O6QA 1AV1A 2BCCJ 2FYNB 4DOJA 4U3FD 1W5CE 1JOCA 4GOEA 5AW3B 1KC8Q 1YYCA 1HUCA 3CPWO 1ZW0A 1CZQA 1NU1J 3SFEC 1YITP 5KLVJ 2N1TB 1GK4A 1RY3A 2XNDH 2LKMA 1JNMA 4PJ0E 1Q7YQ 4D6TD 1AVOA 5APVA 3U59A 2HG5D 3H1HJ 2IBZD 3HD7D 3ZDMA 4WB4A 1YBKA 2NPSC 2XDJA 3H1LE 5AW6B 1JMBA 2E5TA 3RL0B 1SQPD 2QJPB 2BASA 1SQVJ 3CCQP 2K3RA 3V2RA 1J1DB 3TGUJ 3MIWA 4PV1B 5AVUB 2H43A 3HTKA 3CXHD 1L4AC 2R5DA 1AFOA 2ZAEB 5AW4B 4PJ0H 3V2NA 3GF3A 3AE9C 1L0NK 3CX5E 1VF5C 2L91A 3H1KE 1BE3E 1RF1A 3L74J 2PRRA 2XKMA 2XZRA 1FZAA 5APSA 3VMZA 4DJGA 2OYIB 4IL6E 3GHGC 3D71A 4O9BA 3MZWB 1HF9A 5AVTB 5C39A 4IFDK 2AEMA 3CCRP 1ZV8A 3VN0A 3HUSC 1XTCC 1MV8A 1N2DC 3V4QA 3AE4C 3CX5H 1NH4A 3BCCE 3AE1C 3R2PA 1J1EB 4ZKUA 1LT9C 3B5ND 3H1ID 1GL2A 1L0ND 3L36A 2W6AA 4UB6E 3CWBE 3H6PA 3RK3D 5KKZB 3KPEA 1H8AA 1KFNA 2C0XA 4IL6H 4RESB 1HVVA 2RN0A 3BVHA 1NWQA 2ZXXA 1NHLA 3L75E 1HBWA 1OVUA 1ZXGA 4AQRD 4D6TJ 2KS1A 1EZVE 2QJKC 1PV3A 1M1JA 3P32A 2H88C 3EQ2A 1JMMA 1PFIA 3QWOC 5GTHE 1M57D 2KK7A 2E76D 1WRGA 5CCGA 3MHVA 2XU6A 1H88A 2OARA 3CX5I 2GM4A 4UB6H 4H44C 3M9QA 5TISE 1K05A 1LTTC 3GMAA 5KLVG 2R3SA 1LTIC 2E75B 2ZT9B 1RE4A 2RH0A 1NKZB 2M0BA 2FFDC 3A0BE 5DJUB 2PFXA 4I2LC 2D2CB 3I56P 3H1HG 2KNCB 5GTHH 1URQA 1N7LA 5CCHA 1KTMA 1N73B 1JY3P 1JY3O 5AW8B 3RL0g 2B87A 1IFNA 1DH3A 1S2EA 1YTZI 2J58A 4L76A 1YI2P 2IPPA 1HJBA 3D6YA 5TISH 1FOSE 3H1LD 1JM0A 1M1KQ 3E1IA 1KYOE 1QLED 1S5LX 3A0BH 1MFZA 1IFJA 2H89C 2Z5IA 2WT7A 1EZVI 2LXBA 4XE5B 1KB9E 3H1IJ 1VPCA 1SFCC 1L0NJ 3U1CA 1L0LE 1DEBA 3TYYA 2HPCB 2WSFJ 4RO0A 3L74G 4OGQC 1KQGB 2KIKA 3AECC 2B9BA 3P8CD 1L4AA 3V4WA 1PPJE 3C9IA 1R5LA 1IC2A 3SWYA 2E74C 1GU4A 1NJIQ 2I8DA 5AW0B 3M9HA 3WU2E 2YMKA 3VTPC 5APYA 3E7KA 1BE3D 1GL2D 3CI9A 4TLFA 2AEJA 1KYOH 1LTJC 1H89A 3E1RA 1KB9H 3S9OA 2M8RA 4TT3H 4OVNF 3H32B 3G4SP 4U3FG 1LTGC 3KDPB 3IFMA 2Q7CA 3O8ZA 2WSEH 1OIPA 4GDOA 2KOGA 4H13D 3Q5SA 3L70E 2FYNC 2G3AA 4OWFA 2OYHB 2MJZA 3RBXA 4C7NA 1R8EA 1QX8A 2WITA 3PRJA 3WU2H 3HD7A 3U1AA 5CCGD 2FKWB 3BCCD 5L8RJ 3KYQA 4D6TG 2IBZG 1CI6A 1LT9A 3JSVC 3I55P 2OTKE 1KYOI 1VQ6P 1SQPG 2OYOA 1AQTA 1KILE 4YTPC 1KB9I 3RL0C 3H1JG 3AEGC 1QVGO 2QJPC 3PLNA 1ZMEC 1EZVD 1Y9BA 1SQBE 1J1DC 1PP9G 5CCHD 1H0TB 2J59M 3B5NB 3TNUA 4C46A 1KMIZ 2I1JA 2HYNA 4XFJA 2ITAA 1JTHB 2Q9IA 1GZLA 5KJ7C 5APTA 2JP3A 5KAFE 1T3JA 3V2QA 3TF5A 1BDDA 2NZ2A 5AW1B 1USDA 3C1LA 1D7MA 1RQVA 1IFPA 1FU1A 3LW5H 3WMM0 2PAJA 4ASVA 4EOTA 2FFDA 1BE3J 2E76B 3NXSA 4W7YA 5CBNA 3OW2O 3A0HE 1NOHA 1YQ4C 2FXPA 3FX0A 1BCCG 1U57A 1NTZE 5E79E 1U7MA 2IX7C 1L4AD 3NFQA 3AE5C 2WZ7A 2H7HA 1VQ5P 4KJMA 3H1IG 5KAFH 1L0NG 1K73Q 2BEQD 2WWWA 2KXPB 4YPCA 3I5CA 1VF5D 1LP1A 2GUVA 3TK1A 3FXDA 1PIXA 2KUBA 1W2BO 3MD0A 1YJWP 3BCCJ 4WVZA 4EYYQ 3GF7A 5CJ0A 3HTKB 3A0HH 4NPEA 2PGDA 1M8OB 5E79H 1LTBC 2HODA 1OX3A 5TJHA 1VQMP 2E42A 4AYCA 1PPJD 4I6MC 1BSHA 4ASWA 3L72E 1RF1B 2ZJSE 1JY2P 3Q5PA 1Q2NA 1JY2O 4LC1A 3AEFC 3GW6A 1LTAC 2FY8A 3AE7C 2QM8A 1HGVA 1LWUB 2YO3A 1T6AA 1LTJA 3L73G 1SQXE 3VYIA 1ZR4A 4L75A 2RMZA 3AE3C 3NMDA 3H1JD 1P84E 1GD2E 5APWA 2E43A 2W27A 3G6EP 1DX7A 3QH9A 2E75C 4EDFA 2P7JA 1PP9D 3Q2YA 3P8MC 2YIUB 3MTUE 3L70D 3G3ZA 1SQQE 2D2CC 2M3EA 1FDMA 1NTKE 2A06E 1GL2B 2P67A 2HLOA 3SWFA 2R32A 2QIWA 1MZ9A 1BSNA 2YKQA 1T2KC 3H1LG 1RF0C 1N7SB 4H44D 2HFED 1LNQA 1EDKA 1P84H 2DW3A 2KS1B 3AEEC 2FYUE 3AEBC 1OW6A 1DD4A 1M1JB 2KZJA 1ZN5A 1BGYE 1RHZB 1LGHB 2Y9YA 3WUVA 1SS1A 4WY4C 3Q1MA 2E5YA 2WSCJ 3HE5A 1OMIA 2CPBA 1BCCD 2G8YA 1NTZK 3TDKA 1RE3C 2IYOA 1KFMA 1DIPA 2V7QJ 1NTME 2JEEA 1VQ8P 3L71E 4U3FJ 3VP8A 1PGQA 5AVWB 1IK7A 2YXQB 5AVVB 3BATA 3JCUE 2QRXA 1U7JA 3H1KG 1BE3G 3M9BA 1IZNB 1VQOP 4PD4E 2BCCE 5KJ7A 3RK2B 3Q5RA 4EIJA 1M90Q 2SPZA 1FZCA 1FZEA 1VDFA 1EXIA 1P84I 1NU1E 2GA1A 5KLVE 1URQB 3AE6C 3VMXA 1QL2A 3NTNA 1SQPJ 2B87B 1SFCD 4N78E 3H1HE 1USEA 1YIJP 4JPZB 1S1CX 1PZQA 4OGQD 1NTZD 3H1JJ 2YKPA 1AQ5A 3JCUH 1M7LA 4CPGA 3BCCG 1HTLC 2IFNA 4HYTB 1FBMA 1SQVE 4PD4H 1JB0J 1PGJA 3F5HA 3B71A 1PP9J 2E74D 2A45H 3TGUE 1J2JB 1KILC 2BEZF 1S9KD 3GG2A 3M91A 2YNYA 3L70J 3L73D 1NYHA 2I1KA 2WT7B 5AW7B 1VQ9P 3T97A 2KI7B 1JY3N 3L75G 3M0AA 3CCEP 1ZP0C 1X22A 1AVYA 1EZVG 4BRYA 2Y0EA 2B89A 2YKOA 1SQQK 2R44A 1L4AB 3V6IA 3HE4A 1SVFA 1NTKK 1E5WA 1PGPA 4H0LB 1JCCA 3IF4A 3D70A 1VF5B 3L72D 2O01J 3LW5J 4PD4I 3AE8C 3GLMA 2NPSA 1X9VA 2Y9ZA 2A45I 1JEKA 2IFMA 1BCCJ 1Q81Q 5EFWB 1PL5A 2YO2A 2FYUK 3R4YA 3V5BA 1GU5A 4HJGH 3OA7A 2OGUA 5AW2B 3RL0D 2ZXEB 2WMMA 3S4RA 4C7NB 4JF7A 1WT6A 3HD7B 1RH5B 1SQQD 3PH0A 1OVRA 3H25A 2R3CA 2WQYC 2K9YA 3CMAP 1CI6B 1NTKD 4LLHA 3PJSK 3CX5D 1LT9B 1AJYA 3KXDA 1E79H 3H1KD 1CSBA 4DCKA 3K5BA 3N4XA 2IBZE 1N86A 1IFMA 2M5AA 2ZYAA 2WPVB 2QSIA 5KJ7D 2WTYA 2ZYGA 1ZRTE 3SWKA 2FYUD 2C9NY 3GHGA 2QJKB 3MGNA 5B66E 1FS0E 4WY4A 3L73J 1OFCX 3HUSA 3B8EB 2GUSA 1HWTC 4GOFA 1G1JA 3CXHE 1NTMD 1PPJG 2C0WA 2QJYB 1SQVK 1Y47A 2HPCA 2N1TC 2V4HA 4KT0J 2WSSH 3CWBD 3EWKA 2W6JH 2BCCD 1Q90D 1VL2A 3TSIA 1EXJA 2W90A 1IO4A 3L75D 3CCMP 4HKZH 4GIFA 5B66H 3WUUA 3L72J 1LWUC 3A2AA 2AXCA 2FBWC 3H1LJ 2JDIH 2YXRB 1HGZA 2KB7P 4N78D 1FZGA 2K9JA 2Y0CA 3L70G 3CCVP 3CXHH 1GW4A 4JQ0D 4PV1C 1S4XA 2W8ZA 3CC4P 3RK3B 4YXWH 3C8VA 2YIUC 3ITKA 3VMAA 1A02J 1W2EA 4R4LA 1SQVD 2IBZI 1GDTA 4BWNA 2NPSD 5KLIB 1GL2C 2N9YB 2J5UA 3O6QB 1FOSF 2XNXA 1L0NE 1KILA 3KQGA 1SQQJ 1GW3A 4ZKPA 1EDIA 1IFDA 2AXTE 1L0LK 1NTKJ 5CJ4A 1BDCA 3IR9A 1QGKB 1N7SC 2P1JA 1KQSO 2OQQA 2OYIC 3H1KJ 1FZBA 2HODB 2Q1KA 2XV5A 1M1JC 1VQKP 3CXHI 2K88A 3SSUA 1KD1Q 1RQUA 3BRVB 2FYUJ 3HRNA 4Y99B 2D2CD 5CHXA 3PTZA 1KORA 3M0DC 4ZMDA 3II6A 2CPSA 3CCLP 1NAYA 1JUNA 1LTJB 3N7NA 3FGAD 1J1EC 4QMAA 2WSFH 2R5BA 2CK3H 1KYOD 2AXTH 2N9BA 5KKZC 4JYBA 1KB9D 2WPQA 3RK2C 2O1KA 1L0LD 1SFCA 3S1KA 3CWBJ 1Q82Q 4Z1MH 3JC22 1TU3F 1KZUB 4YXDC 4IL6X 1JY2N 4WY4D 1URQC 1OW7A 5CCHC 3G9RA 4K3AA 4C7RA 2WPRA 4UB8E 1VQNP 3L75J 1LT1A 1NTZG 3UIAA 4WBAA 2VRSA 3EFFK 3BRTB 3OJAB 5AVZB 1OWAA 2WPSA 1NAFA 3L35A 2RKLA 3MP7B 4R4MA 2H8PD 1ZRTD 1G2CA 4W7ZA 1JO5A 1FJKA 1SQBK 3CCJP 4I7ZB 2K37A 2FXOA 2ZT9C 3HE5B
chains in the Genus database with same CATH topology
3MUDA 5AW0B 3M9HA 3VTPC 4OH8B 1SFCB 4M3LA 5APYA 1SLQA 2YKPA 1FZCC 1AQ5A 3VP9A 1GL2D 1M7LA 3CI9A 1Z56A 3M06A 2C9LY 1HTLC 2IFNA 4HYTB 1FBMA 1LTJC 1NO4A 4IFFA 2O01H 1X8YA 1H89A 1LTSC 1N73C 2A45H 1J2JB 5KTBA 1KILC 1S9KD 2M8RA 3M91A 3P8CE 2YNYA 3H32B 2KLVA 2I1KA 2WT7B 1NKNA 2N1TA 4KHXA 5AW7B 5APXA 3T97A 1LTGC 2Z5HA 3KDPB 5CCGC 3IFMA 2Q7CA 1JY3N 3O8ZA 1FZCB 2WSEH 4GT1A 3M0AA 2KOGA 1GK6A 2L5GB 3B5NA 1KILD 2OYHB 2MJZA 1XTGB 4C7NA 1T2KD 2WITA 2YKOA 4I1LA 3L4FA 3V2PA 1SQQK 1SQPK 3HD7A 1L4AB 1G2CB 3U1AA 3HE4A 3PP5A 5CCGD 5APUA 2FKWB 2QM7A 3KYQA 1LWUA 1S9KE 1JTHA 2POHA 1SVFA 1NTKK 1CI6A 1RE4C 1E5WA 1LT9A 3VOPA 1JCCA 4DOJA 1IK9A 2NPSA 1JOCA 1JCDA 1X9VA 2A45I 5AW3B 1YYCA 1HUCA 2IFMA 4LGDE 3RL0C 3HD7C 5BU5A 1CZQA 2YO2A 2FYUK 3V5BA 2N1TB 2KYVA 3CL3D 1GU5A 1GK4A 1J1DC 3OA7A 1RY3A 5CCHD 5AW2B 2LKMA 5AVXB 3A5TA 1JNMA 2JJLA 5APVA 3U59A 2HG5D 3RL0D 2Z4EA 2J59M 4IFMA 2ZXEB 3HD7D 3B5NB 4WB4A 2NPSC 3TNUA 4C46A 2I1JA 2XDJA 5AW6B 4C7NB 4JF7A 3RL0B 1N7SA 1WT6A 2HYNA 3HD7B 2OYIA 3HE4B 2BASA 2R3CA 1ZLLA 2KP8A 1JTHB 2Q9IA 1FAVA 1GZLA 5KJ7C 5APTA 1CI6B 2O1JA 4LLHA 1T3JA 3LIEA 3V2RA 3V2QA 1YTZT 1J1DB 1LT9B 4W80A 5AW1B 1CSBA 3MIWA 1FU1A 5AVUB 1GTWA 3LW5H 2NPSB 3N4XA 2OYHC 2H43A 3WMM0 3HTKA 1N86A 1IFMA 2PAJA 1QL1A 5KJ7D 4EOTA 1L4AC 2R5DA 3M0DA 2FFDA 1AFOA 2WTYA 1SQXK 5AW4B 2C9NY 3GHGA 3V2NA 3NXSA 4W7YA 2A45G 1NOHA 1L0NK 1MUUA 3MGNA 2IX7C 4WY4A 1RF1A 1L4AD 3HUSA 3NFQA 3B8EB 5BVZA 1A02F 4AUWA 1CW5A 2GUSA 2WZ7A 2XKMA 1HWTC 2XZRA 2H7HA 1FZAA 5APSA 3A7OA 1IJDB 1G1JA 2WWWA 3A3YB 3VMZA 2OYIB 2C0WA 1SQVK 3I5CA 5AVSB 2HPCA 1FJPA 3GHGC 2GUVA 3TK1A 2N1TC 4O9BA 1ZR2A 2M3BA 5AVTB 4IFDK 4GKGA 3MD0A 1ZV8A 3VN0A 3B5NC 2FXMA 3LIDA 3HUSC 1XTCC 5CJ0A 3HTKB 3TSIA 1MV8A 1N2DC 1SP4A 2KSJA 3V4QA 1IO4A 2N1TD 3RK3C 1HH0A 4GIFA 1LWUC 1NH4A 3A2AA 1LTBC 2HODA 3GHGB 3R2PA 1J1EB 5AVYB 4ZKUA 1LT9C 3B5ND 1GL2A 4DZOA 2E42A 3L36A 1HGZA 4AYCA 2KB7P 4I6MC 2W6AA 4N78D 1FZGA 2ZFCA 3H6PA 3RK3D 4WY4B 1GW4A 1RF1B 3KPEA 2W6BA 1H8AA 3HUSB 1JY2P 1KFNA 2C0XA 4RESB 1HVVA 1JY2O 4LC1A 1NTMK 3RK3B 3BVHA 1LTAC 1NWQA 1NHLA 2QM8A 1A02J 1HBWA 1HGVA 1LWUB 1W2EA 2YO3A 4AQRD 1LTJA 3VYIA 1M1JA 3P32A 1GDTA 1ZR4A 1N73A 2NPSD 5AW9B 4JYCA 1GL2C 1JMMA 3EQ2A 3NMDA 3VMYA 1T3UA 1FOSF 1PFIA 1IFIA 2XNXA 1GD2E 5APWA 1KILA 3KQGA 2E43A 2W27A 3CLQA 4N6JA 2Q3IA 1GW3A 1DX7A 4ZKPA 4Y99C 1IFDA 1WRGA 1L0LK 1RF0A 5CJ4A 2P7JA 3IR9A 5BU8B 5CCGA 2WSCH 2XU6A 1H88A 2OARA 3P8MC 1N7SC 2P1JA 2OYIC 1NU1K 3MTUE 5KLVK 3G3ZA 2GM4A 2YMYA 1FZBA 2FYZA 1FDMA 2HODB 2PP6A 2XV5A 1M1JC 1GL2B 2P67A 3M9QA 2HLOA 3SWFA 2R32A 1LTTC 3EFGA 4N3YB 1N7SD 3BRVB 3BASA 1LTIC 3HRNA 4Y99B 1MZ9A 3TNUB 4B86A 2YKQA 1T2KC 5CHXA 1RE4A 1RF0C 1NKZB 1N7SB 1RE3A 3M0DC 2FFDC 4I2LC 2HFED 1X79B 3II6A 4XA4A 2CPSA 1JUNA 1LTJB 3N7NA 1J1EC 1URQA 1M1JB 1N7LA 1ZN5A 2WSFH 2R5BA 5CCHA 5CMZA 1N73B 1JY3P 2N9BA 1LGHB 1JY3O 5AW8B 1KILB 4WY4C 1IFNA 1RF1C 4JYBA 5AVRB 3L37A 1DH3A 5AVQB 1YTZI 2WPQA 3HE5A 2CPBA 2J58A 2O1KA 3RK2C 1SFCA 2IPPA 1HJBA 1NTZK 2FFDB 5AW5B 1RE3C 2JEEA 1KZUB 3VP8A 5AVWB 1G1IA 1FZFA 1JY2N 4WY4D 1URQC 1FOSE 5AVVB 5CCHC 3BATA 4C7RA 3OAKA 2WPRA 1T8ZA 3E1IA 3RK2D 3UIAA 1OXZA 4WBAA 2VRSA 3M9BA 3H32A 1MFZA 1IFJA 2Z5IA 3BRTB 3OJAB 2WT7A 1EQ7A 5AVZB 1OWAA 5KJ7A 3RK2B 1KQLA 4XE5B 2WPSA 5APQA 4EIJA 1NAFA 3L35A 1VPCA 1SFCC 1URQD 3U1CA 1FZCA 1FZEA 1VDFA 2P2UA 1DEBA 3TYYA 4HH2A 2HPCB 2Q5UA 1URQB 3VMXA 2OYHA 1QL2A 2H8PD 3NTNA 3P8CD 1L4AA 1G2CA 4W7ZA 3V4WA 1JO5A 1FJKA 4N78E 1SFCD 3C9IA 3P7KA 1SQBK 1IC2A 3SWYA 1KFMA 1GU4A 3HE5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCH D;  4OH8 B;  1SFC B;  3B5N C;  2HG5 D;  3RL0 D;  1GL2 D;  1N7S B;  3HTK B;  3HD7 D;  3TSI A;  3M0D C;  3B5N B;  2NPS C;  2HFE D;  2N1T D;  3RK3 C;  2XDJ A;  4JF7 A;  3RL0 B;  1N7S A;  1URQ A;  3HD7 B;  5CCH A;  1KIL C;  1JTH B;  2M8R A;  3P8C E;  3B5N D;  5KJ7 C;  1GL2 A;  1T3J A;  1KIL B;  4WY4 C;  2N1T A;  3RK3 D;  4WY4 B;  5CCG C;  4W80 A;  3RK2 C;  1SFC A;  1HVV A;  2KOG A;  2NPS B;  3RK3 B;  3B5N A;  1KIL D;  1NHL A;  5KJ7 D;  1L4A C;  1XTG B;  4WY4 D;  1URQ C;  5CCH C;  3HD7 A;  1L4A B;  5CCG D;  3PP5 A;  4W7Y A;  3KYQ A;  3RK2 D;  2NPS D;  1GL2 C;  1JTH A;  1KIL A;  5KJ7 A;  3VOP A;  3RK2 B;  4WY4 A;  1L4A D;  1SFC C;  1URQ D;  2WZ7 A;  5CCG A;  1N7S C;  2NPS A;  2YMY A;  1URQ B;  4LGD E;  3RL0 C;  2H8P D;  2PP6 A;  3HD7 C;  1L4A A;  4W7Z A;  2N1T C;  1GL2 B;  4N78 E;  1SFC D;  2N1T B;  1N7S D; 
#chains in the Genus database with same CATH topology
 3CC2 P;  4OH8 B;  4M3L A;  3VP9 A;  4UB8 H;  3M06 A;  1HJ0 A;  1Z56 A;  2C9L Y;  1NO4 A;  1L2P A;  4IFF A;  4BXL A;  1X8Y A;  1N73 C;  2JWA A;  4IOI H;  3L72 G;  2QEX P;  3FWL A;  1DEE G;  3P8C E;  4NPF X;  1NKN A;  2N1T A;  2Z5H A;  1YJ9 P;  4H0L C;  1FZC B;  1YHQ P;  4GT1 A;  2JO1 A;  1K04 A;  1M56 D;  2LR2 A;  1SQX G;  2L5G B;  1KIL D;  5B5E E;  1EC5 A;  2O01 N;  1XTG B;  4H13 B;  4GOD A;  3L4F A;  2B88 A;  3V2P A;  2KLU A;  2QM7 A;  1LWU A;  1VQL P;  2POH A;  3KHU A;  1SQB D;  5DJT B;  4HB1 A;  3VOP A;  1R5S A;  5CBO A;  1SQQ G;  3SFD C;  1PGO A;  2P58 A;  1IK9 A;  1KN7 A;  1JCD A;  1KV4 A;  1NTK G;  3AED C;  2A06 G;  1L0L J;  3IAO A;  4LGD E;  2O3J A;  3HD7 C;  5BU5 A;  5H2F E;  2KYV A;  3CL3 D;  2WSE J;  3T97 B;  2QE7 H;  5B5E H;  1MKM A;  1VQ4 P;  1LJ2 A;  5AVX B;  3A5T A;  3FXE A;  2JJL A;  2Z4E A;  2FYU G;  4IFM A;  3RGU A;  1BGY G;  2IZ0 A;  4BRY B;  3ABV C;  1GMJ A;  2QG4 A;  1N7S A;  1Y8A A;  2KZI A;  2OYI A;  1UIX A;  3HE4 B;  1ZLL A;  2KP8 A;  1FAV A;  2O1J A;  3LIE A;  1YTZ T;  4L74 A;  2QA4 P;  2Q3E A;  1NTM G;  4W80 A;  4MN4 C;  3L71 G;  5H2F H;  1GTW A;  2NPS B;  2WVR A;  2OYH C;  1QVF O;  1QL1 A;  1NGM B;  3CWB G;  2IYP A;  3M0D A;  2OTL P;  2Q6Q A;  1SQX K;  4L73 A;  2BCC G;  2QJY C;  2ZYD A;  1YQ3 C;  3MUD C;  2A45 G;  3W68 A;  1MUU A;  3CC7 P;  1FDI A;  4JBZ A;  1OZH A;  1NU1 G;  5BVZ A;  1A02 F;  4AUW A;  1CW5 A;  3W67 A;  3A7O A;  3D6Z A;  1IJD B;  3USS A;  1MFT A;  3A3Y B;  1OVV A;  1UII A;  5AVS B;  1FJP A;  1VQP P;  3L74 E;  4NPD A;  1ZR2 A;  2ZVO B;  2M3B A;  3Q3D A;  3FWN A;  4GKG A;  1S72 P;  2ZVN B;  3B5N C;  1SQV G;  2FXM A;  3LID A;  3G71 P;  1SQB J;  1KQF B;  1SP4 A;  2OTJ P;  2M5A B;  4ZNC A;  2KSJ A;  3TGU G;  2N1T D;  3RK3 C;  1QEX A;  1HH0 A;  1EDL A;  1SQX D;  2IDB A;  3GHG B;  5AVY B;  2LXC B;  5KLI C;  4DZO A;  1P84 D;  4WWI A;  2P10 A;  2ZFC A;  4WY4 B;  2W6B A;  3HUS B;  1OW8 A;  4U3F E;  4U7J A;  1NTM K;  2E76 C;  2KNC A;  2A06 D;  4PV1 D;  1N73 A;  5AW9 B;  4JYC A;  3VMY A;  1T3U A;  2NRG A;  1IFI A;  1FE6 A;  3CLQ A;  4N6J A;  2Q3I A;  4D6T E;  2JWD A;  4Y99 C;  1RF0 A;  5BU8 B;  2WSC H;  1NTZ J;  1NU1 K;  5KLV K;  3CCU P;  2YMY A;  1SQP E;  2FYZ A;  1Q86 Q;  2W83 C;  1BGY D;  3WUT A;  2PP6 A;  2V7Q H;  1AA0 A;  3F89 A;  4K35 A;  1L0L G;  1S3J A;  3EFG A;  3H1J E;  2K9J B;  4N3Y B;  1N7S D;  3BAS A;  3KZI E;  3TNU B;  4B86 A;  1FC2 C;  1RE3 A;  1PP9 E;  3CME P;  3L71 D;  1X79 B;  4XA4 A;  2JKV A;  2KSE A;  4DT0 A;  4H44 B;  5CMZ A;  1N8R Q;  4A7P A;  2MKV A;  5K5G B;  1S5L E;  4PD4 D;  1KIL B;  1RF1 C;  5AVR B;  3L37 A;  5AVQ B;  4Y28 J;  2Y0D A;  2FFD B;  5AW5 B;  2HR3 A;  1NU1 D;  5KLV D;  1G1I A;  1K8A Q;  1FZF A;  3KZI H;  3AEA C;  3OAK A;  1T8Z A;  3RK2 D;  1OXZ A;  1DD3 A;  2UWJ E;  3H1H D;  1SQX J;  3H32 A;  5GTI E;  4I7Z C;  1EQ7 A;  5M1B A;  1KQL A;  1NVO A;  5APQ A;  1FDO A;  1URQ D;  1K9M Q;  1VQ7 P;  2P2U A;  1BCC E;  5KAI E;  1S5L H;  4HH2 A;  2QVA A;  1LP1 B;  2Q5U A;  3B4S A;  2OYH A;  2JR8 A;  3CD6 P;  3TGU D;  2K1A A;  3H1I E;  3P7K A;  3RK3 E;  1YJN P;  3MUD A;  1SFC B;  1SLQ A;  1FZC C;  1WMK A;  4RKU J;  4OGQ B;  1SQB G;  2O01 H;  5GTI H;  1LTS C;  2E75 D;  2ZT9 D;  4H13 C;  3CCS P;  5KTB A;  2AEF A;  3L74 D;  5KAI H;  2KLV A;  2E74 B;  1BGY J;  4KHX A;  5APX A;  1EDJ A;  5CCG C;  3AE2 C;  1GK6 A;  1H0T A;  3B5N A;  2IZ1 A;  1X0T A;  4EI2 A;  4RJT A;  1T2K D;  4I1L A;  1SQP K;  1G2C B;  1NTM J;  3PP5 A;  5APU A;  3L71 J;  1ZOY C;  4H0L D;  1S9K E;  1JTH A;  3PHL A;  3L73 E;  3RBZ A;  1RE4 C;  3IN6 A;  3O6Q A;  1AV1 A;  2BCC J;  2FYN B;  4DOJ A;  4U3F D;  1W5C E;  1JOC A;  4GOE A;  5AW3 B;  1KC8 Q;  1YYC A;  1HUC A;  3CPW O;  1ZW0 A;  1CZQ A;  1NU1 J;  3SFE C;  1YIT P;  5KLV J;  2N1T B;  1GK4 A;  1RY3 A;  2XND H;  2LKM A;  1JNM A;  4PJ0 E;  1Q7Y Q;  4D6T D;  1AVO A;  5APV A;  3U59 A;  2HG5 D;  3H1H J;  2IBZ D;  3HD7 D;  3ZDM A;  4WB4 A;  1YBK A;  2NPS C;  2XDJ A;  3H1L E;  5AW6 B;  1JMB A;  2E5T A;  3RL0 B;  1SQP D;  2QJP B;  2BAS A;  1SQV J;  3CCQ P;  2K3R A;  3V2R A;  1J1D B;  3TGU J;  3MIW A;  4PV1 B;  5AVU B;  2H43 A;  3HTK A;  3CXH D;  1L4A C;  2R5D A;  1AFO A;  2ZAE B;  5AW4 B;  4PJ0 H;  3V2N A;  3GF3 A;  3AE9 C;  1L0N K;  3CX5 E;  1VF5 C;  2L91 A;  3H1K E;  1BE3 E;  1RF1 A;  3L74 J;  2PRR A;  2XKM A;  2XZR A;  1FZA A;  5APS A;  3VMZ A;  4DJG A;  2OYI B;  4IL6 E;  3GHG C;  3D71 A;  4O9B A;  3MZW B;  1HF9 A;  5AVT B;  5C39 A;  4IFD K;  2AEM A;  3CCR P;  1ZV8 A;  3VN0 A;  3HUS C;  1XTC C;  1MV8 A;  1N2D C;  3V4Q A;  3AE4 C;  3CX5 H;  1NH4 A;  3BCC E;  3AE1 C;  3R2P A;  1J1E B;  4ZKU A;  1LT9 C;  3B5N D;  3H1I D;  1GL2 A;  1L0N D;  3L36 A;  2W6A A;  4UB6 E;  3CWB E;  3H6P A;  3RK3 D;  5KKZ B;  3KPE A;  1H8A A;  1KFN A;  2C0X A;  4IL6 H;  4RES B;  1HVV A;  2RN0 A;  3BVH A;  1NWQ A;  2ZXX A;  1NHL A;  3L75 E;  1HBW A;  1OVU A;  1ZXG A;  4AQR D;  4D6T J;  2KS1 A;  1EZV E;  2QJK C;  1PV3 A;  1M1J A;  3P32 A;  2H88 C;  3EQ2 A;  1JMM A;  1PFI A;  3QWO C;  5GTH E;  1M57 D;  2KK7 A;  2E76 D;  1WRG A;  5CCG A;  3MHV A;  2XU6 A;  1H88 A;  2OAR A;  3CX5 I;  2GM4 A;  4UB6 H;  4H44 C;  3M9Q A;  5TIS E;  1K05 A;  1LTT C;  3GMA A;  5KLV G;  2R3S A;  1LTI C;  2E75 B;  2ZT9 B;  1RE4 A;  2RH0 A;  1NKZ B;  2M0B A;  2FFD C;  3A0B E;  5DJU B;  2PFX A;  4I2L C;  2D2C B;  3I56 P;  3H1H G;  2KNC B;  5GTH H;  1URQ A;  1N7L A;  5CCH A;  1KTM A;  1N73 B;  1JY3 P;  1JY3 O;  5AW8 B;  3RL0 g;  2B87 A;  1IFN A;  1DH3 A;  1S2E A;  1YTZ I;  2J58 A;  4L76 A;  1YI2 P;  2IPP A;  1HJB A;  3D6Y A;  5TIS H;  1FOS E;  3H1L D;  1JM0 A;  1M1K Q;  3E1I A;  1KYO E;  1QLE D;  1S5L X;  3A0B H;  1MFZ A;  1IFJ A;  2H89 C;  2Z5I A;  2WT7 A;  1EZV I;  2LXB A;  4XE5 B;  1KB9 E;  3H1I J;  1VPC A;  1SFC C;  1L0N J;  3U1C A;  1L0L E;  1DEB A;  3TYY A;  2HPC B;  2WSF J;  4RO0 A;  3L74 G;  4OGQ C;  1KQG B;  2KIK A;  3AEC C;  2B9B A;  3P8C D;  1L4A A;  3V4W A;  1PPJ E;  3C9I A;  1R5L A;  1IC2 A;  3SWY A;  2E74 C;  1GU4 A;  1NJI Q;  2I8D A;  5AW0 B;  3M9H A;  3WU2 E;  2YMK A;  3VTP C;  5APY A;  3E7K A;  1BE3 D;  1GL2 D;  3CI9 A;  4TLF A;  2AEJ A;  1KYO H;  1LTJ C;  1H89 A;  3E1R A;  1KB9 H;  3S9O A;  2M8R A;  4TT3 H;  4OVN F;  3H32 B;  3G4S P;  4U3F G;  1LTG C;  3KDP B;  3IFM A;  2Q7C A;  3O8Z A;  2WSE H;  1OIP A;  4GDO A;  2KOG A;  4H13 D;  3Q5S A;  3L70 E;  2FYN C;  2G3A A;  4OWF A;  2OYH B;  2MJZ A;  3RBX A;  4C7N A;  1R8E A;  1QX8 A;  2WIT A;  3PRJ A;  3WU2 H;  3HD7 A;  3U1A A;  5CCG D;  2FKW B;  3BCC D;  5L8R J;  3KYQ A;  4D6T G;  2IBZ G;  1CI6 A;  1LT9 A;  3JSV C;  3I55 P;  2OTK E;  1KYO I;  1VQ6 P;  1SQP G;  2OYO A;  1AQT A;  1KIL E;  4YTP C;  1KB9 I;  3RL0 C;  3H1J G;  3AEG C;  1QVG O;  2QJP C;  3PLN A;  1ZME C;  1EZV D;  1Y9B A;  1SQB E;  1J1D C;  1PP9 G;  5CCH D;  1H0T B;  2J59 M;  3B5N B;  3TNU A;  4C46 A;  1KMI Z;  2I1J A;  2HYN A;  4XFJ A;  2ITA A;  1JTH B;  2Q9I A;  1GZL A;  5KJ7 C;  5APT A;  2JP3 A;  5KAF E;  1T3J A;  3V2Q A;  3TF5 A;  1BDD A;  2NZ2 A;  5AW1 B;  1USD A;  3C1L A;  1D7M A;  1RQV A;  1IFP A;  1FU1 A;  3LW5 H;  3WMM 0;  2PAJ A;  4ASV A;  4EOT A;  2FFD A;  1BE3 J;  2E76 B;  3NXS A;  4W7Y A;  5CBN A;  3OW2 O;  3A0H E;  1NOH A;  1YQ4 C;  2FXP A;  3FX0 A;  1BCC G;  1U57 A;  1NTZ E;  5E79 E;  1U7M A;  2IX7 C;  1L4A D;  3NFQ A;  3AE5 C;  2WZ7 A;  2H7H A;  1VQ5 P;  4KJM A;  3H1I G;  5KAF H;  1L0N G;  1K73 Q;  2BEQ D;  2WWW A;  2KXP B;  4YPC A;  3I5C A;  1VF5 D;  1LP1 A;  2GUV A;  3TK1 A;  3FXD A;  1PIX A;  2KUB A;  1W2B O;  3MD0 A;  1YJW P;  3BCC J;  4WVZ A;  4EYY Q;  3GF7 A;  5CJ0 A;  3HTK B;  3A0H H;  4NPE A;  2PGD A;  1M8O B;  5E79 H;  1LTB C;  2HOD A;  1OX3 A;  5TJH A;  1VQM P;  2E42 A;  4AYC A;  1PPJ D;  4I6M C;  1BSH A;  4ASW A;  3L72 E;  1RF1 B;  2ZJS E;  1JY2 P;  3Q5P A;  1Q2N A;  1JY2 O;  4LC1 A;  3AEF C;  3GW6 A;  1LTA C;  2FY8 A;  3AE7 C;  2QM8 A;  1HGV A;  1LWU B;  2YO3 A;  1T6A A;  1LTJ A;  3L73 G;  1SQX E;  3VYI A;  1ZR4 A;  4L75 A;  2RMZ A;  3AE3 C;  3NMD A;  3H1J D;  1P84 E;  1GD2 E;  5APW A;  2E43 A;  2W27 A;  3G6E P;  1DX7 A;  3QH9 A;  2E75 C;  4EDF A;  2P7J A;  1PP9 D;  3Q2Y A;  3P8M C;  2YIU B;  3MTU E;  3L70 D;  3G3Z A;  1SQQ E;  2D2C C;  2M3E A;  1FDM A;  1NTK E;  2A06 E;  1GL2 B;  2P67 A;  2HLO A;  3SWF A;  2R32 A;  2QIW A;  1MZ9 A;  1BSN A;  2YKQ A;  1T2K C;  3H1L G;  1RF0 C;  1N7S B;  4H44 D;  2HFE D;  1LNQ A;  1EDK A;  1P84 H;  2DW3 A;  2KS1 B;  3AEE C;  2FYU E;  3AEB C;  1OW6 A;  1DD4 A;  1M1J B;  2KZJ A;  1ZN5 A;  1BGY E;  1RHZ B;  1LGH B;  2Y9Y A;  3WUV A;  1SS1 A;  4WY4 C;  3Q1M A;  2E5Y A;  2WSC J;  3HE5 A;  1OMI A;  2CPB A;  1BCC D;  2G8Y A;  1NTZ K;  3TDK A;  1RE3 C;  2IYO A;  1KFM A;  1DIP A;  2V7Q J;  1NTM E;  2JEE A;  1VQ8 P;  3L71 E;  4U3F J;  3VP8 A;  1PGQ A;  5AVW B;  1IK7 A;  2YXQ B;  5AVV B;  3BAT A;  3JCU E;  2QRX A;  1U7J A;  3H1K G;  1BE3 G;  3M9B A;  1IZN B;  1VQO P;  4PD4 E;  2BCC E;  5KJ7 A;  3RK2 B;  3Q5R A;  4EIJ A;  1M90 Q;  2SPZ A;  1FZC A;  1FZE A;  1VDF A;  1EXI A;  1P84 I;  1NU1 E;  2GA1 A;  5KLV E;  1URQ B;  3AE6 C;  3VMX A;  1QL2 A;  3NTN A;  1SQP J;  2B87 B;  1SFC D;  4N78 E;  3H1H E;  1USE A;  1YIJ P;  4JPZ B;  1S1C X;  1PZQ A;  4OGQ D;  1NTZ D;  3H1J J;  2YKP A;  1AQ5 A;  3JCU H;  1M7L A;  4CPG A;  3BCC G;  1HTL C;  2IFN A;  4HYT B;  1FBM A;  1SQV E;  4PD4 H;  1JB0 J;  1PGJ A;  3F5H A;  3B71 A;  1PP9 J;  2E74 D;  2A45 H;  3TGU E;  1J2J B;  1KIL C;  2BEZ F;  1S9K D;  3GG2 A;  3M91 A;  2YNY A;  3L70 J;  3L73 D;  1NYH A;  2I1K A;  2WT7 B;  5AW7 B;  1VQ9 P;  3T97 A;  2KI7 B;  1JY3 N;  3L75 G;  3M0A A;  3CCE P;  1ZP0 C;  1X22 A;  1AVY A;  1EZV G;  4BRY A;  2Y0E A;  2B89 A;  2YKO A;  1SQQ K;  2R44 A;  1L4A B;  3V6I A;  3HE4 A;  1SVF A;  1NTK K;  1E5W A;  1PGP A;  4H0L B;  1JCC A;  3IF4 A;  3D70 A;  1VF5 B;  3L72 D;  2O01 J;  3LW5 J;  4PD4 I;  3AE8 C;  3GLM A;  2NPS A;  1X9V A;  2Y9Z A;  2A45 I;  1JEK A;  2IFM A;  1BCC J;  1Q81 Q;  5EFW B;  1PL5 A;  2YO2 A;  2FYU K;  3R4Y A;  3V5B A;  1GU5 A;  4HJG H;  3OA7 A;  2OGU A;  5AW2 B;  3RL0 D;  2ZXE B;  2WMM A;  3S4R A;  4C7N B;  4JF7 A;  1WT6 A;  3HD7 B;  1RH5 B;  1SQQ D;  3PH0 A;  1OVR A;  3H25 A;  2R3C A;  2WQY C;  2K9Y A;  3CMA P;  1CI6 B;  1NTK D;  4LLH A;  3PJS K;  3CX5 D;  1LT9 B;  1AJY A;  3KXD A;  1E79 H;  3H1K D;  1CSB A;  4DCK A;  3K5B A;  3N4X A;  2IBZ E;  1N86 A;  1IFM A;  2M5A A;  2ZYA A;  2WPV B;  2QSI A;  5KJ7 D;  2WTY A;  2ZYG A;  1ZRT E;  3SWK A;  2FYU D;  2C9N Y;  3GHG A;  2QJK B;  3MGN A;  5B66 E;  1FS0 E;  4WY4 A;  3L73 J;  1OFC X;  3HUS A;  3B8E B;  2GUS A;  1HWT C;  4GOF A;  1G1J A;  3CXH E;  1NTM D;  1PPJ G;  2C0W A;  2QJY B;  1SQV K;  1Y47 A;  2HPC A;  2N1T C;  2V4H A;  4KT0 J;  2WSS H;  3CWB D;  3EWK A;  2W6J H;  2BCC D;  1Q90 D;  1VL2 A;  3TSI A;  1EXJ A;  2W90 A;  1IO4 A;  3L75 D;  3CCM P;  4HKZ H;  4GIF A;  5B66 H;  3WUU A;  3L72 J;  1LWU C;  3A2A A;  2AXC A;  2FBW C;  3H1L J;  2JDI H;  2YXR B;  1HGZ A;  2KB7 P;  4N78 D;  1FZG A;  2K9J A;  2Y0C A;  3L70 G;  3CCV P;  3CXH H;  1GW4 A;  4JQ0 D;  4PV1 C;  1S4X A;  2W8Z A;  3CC4 P;  3RK3 B;  4YXW H;  3C8V A;  2YIU C;  3ITK A;  3VMA A;  1A02 J;  1W2E A;  4R4L A;  1SQV D;  2IBZ I;  1GDT A;  4BWN A;  2NPS D;  5KLI B;  1GL2 C;  2N9Y B;  2J5U A;  3O6Q B;  1FOS F;  2XNX A;  1L0N E;  1KIL A;  3KQG A;  1SQQ J;  1GW3 A;  4ZKP A;  1EDI A;  1IFD A;  2AXT E;  1L0L K;  1NTK J;  5CJ4 A;  1BDC A;  3IR9 A;  1QGK B;  1N7S C;  2P1J A;  1KQS O;  2OQQ A;  2OYI C;  3H1K J;  1FZB A;  2HOD B;  2Q1K A;  2XV5 A;  1M1J C;  1VQK P;  3CXH I;  2K88 A;  3SSU A;  1KD1 Q;  1RQU A;  3BRV B;  2FYU J;  3HRN A;  4Y99 B;  2D2C D;  5CHX A;  3PTZ A;  1KOR A;  3M0D C;  4ZMD A;  3II6 A;  2CPS A;  3CCL P;  1NAY A;  1JUN A;  1LTJ B;  3N7N A;  3FGA D;  1J1E C;  4QMA A;  2WSF H;  2R5B A;  2CK3 H;  1KYO D;  2AXT H;  2N9B A;  5KKZ C;  4JYB A;  1KB9 D;  2WPQ A;  3RK2 C;  2O1K A;  1L0L D;  1SFC A;  3S1K A;  3CWB J;  1Q82 Q;  4Z1M H;  3JC2 2;  1TU3 F;  1KZU B;  4YXD C;  4IL6 X;  1JY2 N;  4WY4 D;  1URQ C;  1OW7 A;  5CCH C;  3G9R A;  4K3A A;  4C7R A;  2WPR A;  4UB8 E;  1VQN P;  3L75 J;  1LT1 A;  1NTZ G;  3UIA A;  4WBA A;  2VRS A;  3EFF K;  3BRT B;  3OJA B;  5AVZ B;  1OWA A;  2WPS A;  1NAF A;  3L35 A;  2RKL A;  3MP7 B;  4R4M A;  2H8P D;  1ZRT D;  1G2C A;  4W7Z A;  1JO5 A;  1FJK A;  1SQB K;  3CCJ P;  4I7Z B;  2K37 A;  2FXO A;  2ZT9 C;  3HE5 B; 
#chains in the Genus database with same CATH homology
 3MUD A;  5AW0 B;  3M9H A;  3VTP C;  4OH8 B;  1SFC B;  4M3L A;  5APY A;  1SLQ A;  2YKP A;  1FZC C;  1AQ5 A;  3VP9 A;  1GL2 D;  1M7L A;  3CI9 A;  1Z56 A;  3M06 A;  2C9L Y;  1HTL C;  2IFN A;  4HYT B;  1FBM A;  1LTJ C;  1NO4 A;  4IFF A;  2O01 H;  1X8Y A;  1H89 A;  1LTS C;  1N73 C;  2A45 H;  1J2J B;  5KTB A;  1KIL C;  1S9K D;  2M8R A;  3M91 A;  3P8C E;  2YNY A;  3H32 B;  2KLV A;  2I1K A;  2WT7 B;  1NKN A;  2N1T A;  4KHX A;  5AW7 B;  5APX A;  3T97 A;  1LTG C;  2Z5H A;  3KDP B;  5CCG C;  3IFM A;  2Q7C A;  1JY3 N;  3O8Z A;  1FZC B;  2WSE H;  4GT1 A;  3M0A A;  2KOG A;  1GK6 A;  2L5G B;  3B5N A;  1KIL D;  2OYH B;  2MJZ A;  1XTG B;  4C7N A;  1T2K D;  2WIT A;  2YKO A;  4I1L A;  3L4F A;  3V2P A;  1SQQ K;  1SQP K;  3HD7 A;  1L4A B;  1G2C B;  3U1A A;  3HE4 A;  3PP5 A;  5CCG D;  5APU A;  2FKW B;  2QM7 A;  3KYQ A;  1LWU A;  1S9K E;  1JTH A;  2POH A;  1SVF A;  1NTK K;  1CI6 A;  1RE4 C;  1E5W A;  1LT9 A;  3VOP A;  1JCC A;  4DOJ A;  1IK9 A;  2NPS A;  1JOC A;  1JCD A;  1X9V A;  2A45 I;  5AW3 B;  1YYC A;  1HUC A;  2IFM A;  4LGD E;  3RL0 C;  3HD7 C;  5BU5 A;  1CZQ A;  2YO2 A;  2FYU K;  3V5B A;  2N1T B;  2KYV A;  3CL3 D;  1GU5 A;  1GK4 A;  1J1D C;  3OA7 A;  1RY3 A;  5CCH D;  5AW2 B;  2LKM A;  5AVX B;  3A5T A;  1JNM A;  2JJL A;  5APV A;  3U59 A;  2HG5 D;  3RL0 D;  2Z4E A;  2J59 M;  4IFM A;  2ZXE B;  3HD7 D;  3B5N B;  4WB4 A;  2NPS C;  3TNU A;  4C46 A;  2I1J A;  2XDJ A;  5AW6 B;  4C7N B;  4JF7 A;  3RL0 B;  1N7S A;  1WT6 A;  2HYN A;  3HD7 B;  2OYI A;  3HE4 B;  2BAS A;  2R3C A;  1ZLL A;  2KP8 A;  1JTH B;  2Q9I A;  1FAV A;  1GZL A;  5KJ7 C;  5APT A;  1CI6 B;  2O1J A;  4LLH A;  1T3J A;  3LIE A;  3V2R A;  3V2Q A;  1YTZ T;  1J1D B;  1LT9 B;  4W80 A;  5AW1 B;  1CSB A;  3MIW A;  1FU1 A;  5AVU B;  1GTW A;  3LW5 H;  2NPS B;  3N4X A;  2OYH C;  2H43 A;  3WMM 0;  3HTK A;  1N86 A;  1IFM A;  2PAJ A;  1QL1 A;  5KJ7 D;  4EOT A;  1L4A C;  2R5D A;  3M0D A;  2FFD A;  1AFO A;  2WTY A;  1SQX K;  5AW4 B;  2C9N Y;  3GHG A;  3V2N A;  3NXS A;  4W7Y A;  2A45 G;  1NOH A;  1L0N K;  1MUU A;  3MGN A;  2IX7 C;  4WY4 A;  1RF1 A;  1L4A D;  3HUS A;  3NFQ A;  3B8E B;  5BVZ A;  1A02 F;  4AUW A;  1CW5 A;  2GUS A;  2WZ7 A;  2XKM A;  1HWT C;  2XZR A;  2H7H A;  1FZA A;  5APS A;  3A7O A;  1IJD B;  1G1J A;  2WWW A;  3A3Y B;  3VMZ A;  2OYI B;  2C0W A;  1SQV K;  3I5C A;  5AVS B;  2HPC A;  1FJP A;  3GHG C;  2GUV A;  3TK1 A;  2N1T C;  4O9B A;  1ZR2 A;  2M3B A;  5AVT B;  4IFD K;  4GKG A;  3MD0 A;  1ZV8 A;  3VN0 A;  3B5N C;  2FXM A;  3LID A;  3HUS C;  1XTC C;  5CJ0 A;  3HTK B;  3TSI A;  1MV8 A;  1N2D C;  1SP4 A;  2KSJ A;  3V4Q A;  1IO4 A;  2N1T D;  3RK3 C;  1HH0 A;  4GIF A;  1LWU C;  1NH4 A;  3A2A A;  1LTB C;  2HOD A;  3GHG B;  3R2P A;  1J1E B;  5AVY B;  4ZKU A;  1LT9 C;  3B5N D;  1GL2 A;  4DZO A;  2E42 A;  3L36 A;  1HGZ A;  4AYC A;  2KB7 P;  4I6M C;  2W6A A;  4N78 D;  1FZG A;  2ZFC A;  3H6P A;  3RK3 D;  4WY4 B;  1GW4 A;  1RF1 B;  3KPE A;  2W6B A;  1H8A A;  3HUS B;  1JY2 P;  1KFN A;  2C0X A;  4RES B;  1HVV A;  1JY2 O;  4LC1 A;  1NTM K;  3RK3 B;  3BVH A;  1LTA C;  1NWQ A;  1NHL A;  2QM8 A;  1A02 J;  1HBW A;  1HGV A;  1LWU B;  1W2E A;  2YO3 A;  4AQR D;  1LTJ A;  3VYI A;  1M1J A;  3P32 A;  1GDT A;  1ZR4 A;  1N73 A;  2NPS D;  5AW9 B;  4JYC A;  1GL2 C;  1JMM A;  3EQ2 A;  3NMD A;  3VMY A;  1T3U A;  1FOS F;  1PFI A;  1IFI A;  2XNX A;  1GD2 E;  5APW A;  1KIL A;  3KQG A;  2E43 A;  2W27 A;  3CLQ A;  4N6J A;  2Q3I A;  1GW3 A;  1DX7 A;  4ZKP A;  4Y99 C;  1IFD A;  1WRG A;  1L0L K;  1RF0 A;  5CJ4 A;  2P7J A;  3IR9 A;  5BU8 B;  5CCG A;  2WSC H;  2XU6 A;  1H88 A;  2OAR A;  3P8M C;  1N7S C;  2P1J A;  2OYI C;  1NU1 K;  3MTU E;  5KLV K;  3G3Z A;  2GM4 A;  2YMY A;  1FZB A;  2FYZ A;  1FDM A;  2HOD B;  2PP6 A;  2XV5 A;  1M1J C;  1GL2 B;  2P67 A;  3M9Q A;  2HLO A;  3SWF A;  2R32 A;  1LTT C;  3EFG A;  4N3Y B;  1N7S D;  3BRV B;  3BAS A;  1LTI C;  3HRN A;  4Y99 B;  1MZ9 A;  3TNU B;  4B86 A;  2YKQ A;  1T2K C;  5CHX A;  1RE4 A;  1RF0 C;  1NKZ B;  1N7S B;  1RE3 A;  3M0D C;  2FFD C;  4I2L C;  2HFE D;  1X79 B;  3II6 A;  4XA4 A;  2CPS A;  1JUN A;  1LTJ B;  3N7N A;  1J1E C;  1URQ A;  1M1J B;  1N7L A;  1ZN5 A;  2WSF H;  2R5B A;  5CCH A;  5CMZ A;  1N73 B;  1JY3 P;  2N9B A;  1LGH B;  1JY3 O;  5AW8 B;  1KIL B;  4WY4 C;  1IFN A;  1RF1 C;  4JYB A;  5AVR B;  3L37 A;  1DH3 A;  5AVQ B;  1YTZ I;  2WPQ A;  3HE5 A;  2CPB A;  2J58 A;  2O1K A;  3RK2 C;  1SFC A;  2IPP A;  1HJB A;  1NTZ K;  2FFD B;  5AW5 B;  1RE3 C;  2JEE A;  1KZU B;  3VP8 A;  5AVW B;  1G1I A;  1FZF A;  1JY2 N;  4WY4 D;  1URQ C;  1FOS E;  5AVV B;  5CCH C;  3BAT A;  4C7R A;  3OAK A;  2WPR A;  1T8Z A;  3E1I A;  3RK2 D;  3UIA A;  1OXZ A;  4WBA A;  2VRS A;  3M9B A;  3H32 A;  1MFZ A;  1IFJ A;  2Z5I A;  3BRT B;  3OJA B;  2WT7 A;  1EQ7 A;  5AVZ B;  1OWA A;  5KJ7 A;  3RK2 B;  1KQL A;  4XE5 B;  2WPS A;  5APQ A;  4EIJ A;  1NAF A;  3L35 A;  1VPC A;  1SFC C;  1URQ D;  3U1C A;  1FZC A;  1FZE A;  1VDF A;  2P2U A;  1DEB A;  3TYY A;  4HH2 A;  2HPC B;  2Q5U A;  1URQ B;  3VMX A;  2OYH A;  1QL2 A;  2H8P D;  3NTN A;  3P8C D;  1L4A A;  1G2C A;  4W7Z A;  3V4W A;  1JO5 A;  1FJK A;  4N78 E;  1SFC D;  3C9I A;  3P7K A;  1SQB K;  1IC2 A;  3SWY A;  1KFM A;  1GU4 A;  3HE5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...