3HD7B

Helical extension of the neuronal snare complex into the membrane, spacegroup c 1 2 1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
98
structure length
98
Chain Sequence
KQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 2
publication title Helical extension of the neuronal SNARE complex into the membrane
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
total genus 42
structure length 98
sequence length 98
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05739 SNARE SNARE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3hd7B00
1GL2A 2N1TA 1KILB 1N7SD 2HG5D 1GL2B 3HD7A 2N1TB 4W7ZA 3HD7B 3HD7C 2YMYA 5KJ7D 4N78E 2NPSD 4WY4A 3B5NC 1URQA 1NHLA 4WY4B 1L4AA 2H8PD 4WY4C 5CCHD 4W7YA 1URQB 1URQC 3RK3D 2XDJA 1N7SA 4OH8B 1L4AC 3RL0D 1N7SB 1N7SC 1SFCD 3B5NA 1KILD 1XTGB 5CCGD 4W80A 5KJ7A 3TSIA 3P8CE 3B5NB 2WZ7A 2NPSA 5KJ7C 2NPSB 2KOGA 2NPSC 2PP6A 3RK2D 1L4AB 1HVVA 4JF7A 5CCHC 3RK3B 3RK3C 1SFCA 3RL0B 1GL2D 3RL0C 1KILA 5CCGA 2N1TD 1SFCB 1SFCC 3HTKB 3PP5A 1KILC 2M8RA 3HD7D 5CCGC 1GL2C 2N1TC 1L4AD 5CCHA 3B5ND 2HFED 3KYQA 1JTHA 4LGDE 3RK2B 4WY4D 3RK2C 1T3JA 1JTHB 1URQD 3VOPA 3M0DC
chains in the Genus database with same CATH superfamily
1FAVA 1FZBA 3SFEC 3KHUA 3Q5PA 2UWJE 4WVZA 2ZVNB 3HD7A 2H7HA 1BGYG 1PP9J 3RL0g 1QVGO 1X9VA 1H89A 1KB9H 2PRRA 3CWBD 1SP4A 3CC7P 3GHGC 1BE3J 2HLOA 4PD4D 5CCHD 3C8VA 1URQC 2P2UA 4Z1MH 1T8ZA 3N4XA 1KQLA 2XZRA 5K5GB 4HJGH 1DD3A 1X22A 2W27A 1GW4A 2FBWC 1T6AA 1ZW0A 3L75G 1N8RQ 2AEFA 3VMAA 1OWAA 3L36A 5KAIE 2OYIA 1H0TB 2CK3H 2V4HA 2HODA 5CCGA 1HJBA 4C7NA 5KAFE 4L76A 1LTAC 2WSEH 2M5AA 1KYOE 2ZYDA 3H1LJ 3RK2C 4EYYQ 1KYOI 1KQGB 2RH0A 1SLQA 3V5BA 4Y99C 2HG5D 2WVRA 2YNYA 1PPJG 1ZR4A 3H1HE 2C0WA 5AVTB 1GD2E 1VQ9P 1P84E 3B8EB 1ZR2A 1P84I 3H1JE 3Q5SA 4H13B 2IYPA 3TF5A 3CCLP 1IFPA 3TYYA 3Q3DA 2JJLA 1L4AA 2A06D 2B87A 2FYUD 3H1HJ 2OTLP 2GA1A 2XDJA 3O6QB 3A0HH 3VN0A 3L70E 1ZV8A 1EZVI 5BU5A 1SQBK 2KZIA 4ZKPA 3E1IA 3B5NB 1R5LA 4I6MC 4JYBA 3CWBJ 3S9OA 1YTZI 3M9BA 2QEXP 1U57A 2IYOA 4TT3H 4YXWH 1M1JB 3B5ND 3VMXA 3NTNA 3RBZA 2HPCA 1N73C 1FBMA 3A7OA 2P7JA 2E43A 2WWWA 1S1CX 1EDJA 2OTJP 3EWKA 1JY3N 3L75E 3ITKA 5AVVB 1L0NG 1SS1A 3H1IE 1IFDA 1K04A 2FFDB 3W68A 3KDPB 1VQNP 2BCCE 4ZNCA 1T2KD 1SQVD 3PLNA 4WY4A 2FYNB 2W6BA 3BRVB 4XE5B 5CJ0A 1YBKA 3VMYA 3L72G 2ZYAA 1N7SA 2ITAA 5KLVD 1KZUB 4DZOA 1SFCD 3IR9A 2Q3EA 2WZ7A 4IL6X 5KJ7C 2KYVA 5AVRB 1JY2N 2WSFH 2R3SA 4HYTB 1Q81Q 2P67A 1DD4A 1NTME 3RK3B 1JB0J 1L0LE 2FYUJ 4WBAA 1LTJB 1KILA 1Z56A 2PGDA 2N1TD 1MFZA 2WITA 1KB9I 4ASWA 5BVZA 5AW3B 4H44B 2YXQB 3MD0A 5CBOA 3P7KA 1JTHA 1KC8Q 4EI2A 2MKVA 3G4SP 3I56P 3PTZA 1IFJA 3FXEA 4N78D 4C46A 5AVZB 1VF5C 2P10A 3R4YA 1SQPD 5KKZB 5M1BA 2K3RA 1EC5A 4DT0A 3NMDA 1PGQA 3PH0A 1H88A 3NXSA 1GU5A 1MV8A 3G6EP 5AW6B 1OFCX 3T97A 1QL1A 4H13C 3RBXA 2H43A 3AEEC 1NAFA 4N6JA 3A5TA 1RQUA 1E79H 3A0BH 3W67A 5KAIH 1KFMA 3RL0D 3TNUA 1NTZK 4MN4C 1S2EA 1NOHA 1NU1K 5AW8B 1IZNB 1HBWA 1BCCD 4OWFA 1M7LA 3HE5B 3TSIA 3P8CE 2OYIC 2R5BA 3CX5D 1SQQD 5APUA 1YTZT 3H1KD 3GHGB 1JCCA 5KAFH 1XTCC 2N9YB 3Q2YA 1LT9C 4JPZB 5KLVE 2KNCA 1HGVA 1SQVJ 1A02J 1N2DC 1GMJA 1NYHA 2O1KA 2P58A 2WQYC 1PP9G 3VP9A 5AW9B 3AEAC 3CC2P 1Q82Q 1VQ4P 2WPVB 4LC1A 2Q9IA 1LWUA 1YIJP 3L71E 1NVOA 1FZCB 1URQD 3O8ZA 3HE4A 1GK6A 1Y8AA 5BU8B 3GW6A 1YYCA 3L37A 2J5UA 2FFDC 2WPRA 1PZQA 2A45H 1PV3A 1BE3D 4U7JA 4N78E 4PD4H 1Q7YQ 2OGUA 1SQPE 3E1RA 4ASVA 2FYZA 3L74J 4Y99B 2E75C 1Y9BA 2JDIH 2JP3A 1AVOA 3KXDA 2AEMA 1X8YA 4IL6E 3HUSA 2LXBA 1LTBC 5APXA 4B86A 1RE3A 2E76C 2NPSB 4A7PA 3RK2D 2WPQA 1HVVA 2ZT9D 2R44A 1NTKK 4JF7A 1ZRTD 2O01H 1JEKA 3RK3C 1GL2D 1RY3A 1OW8A 3M06A 4I1LA 1M90Q 4LLHA 3TGUD 3C9IA 4PV1B 1BCCJ 3WUVA 1GU4A 4BRYB 2ZXXA 3CCMP 2HFED 1SQQJ 3H1KJ 1KILE 1YI2P 1CI6A 3FWLA 3H1HG 2YO3A 3JC22 1KORA 1OW7A 3GF3A 4NPDA 5KKZC 3H1JG 2I1JA 1BDDA 1EDKA 3M91A 2Z5HA 4BWNA 3ABVC 4XA4A 1J2JB 2IBZD 3V2NA 1N73B 1HF9A 2HR3A 1Q86Q 3C1LA 3CPWO 3L70G 1S3JA 2Y0DA 1NTKJ 2IFNA 4R4MA 1Q90D 2K9YA 3RGUA 2A45G 1BE3E 1Q2NA 4KJMA 3AE2C 3AE8C 4PJ0H 5APTA 5L8RJ 1LP1B 1RE4A 5APVA 5GTHE 1GZLA 1KV4A 2KS1A 1SQXK 1EZVD 4GOFA 3MUDA 1FZGA 2KSEA 3IFMA 3WUTA 2QRXA 2QA4P 1NGMB 1AA0A 1BGYD 4M3LA 4ZMDA 2Q7CA 1SQBD 1CSBA 2FXMA 2XKMA 3H1IG 4LGDE 3A0BE 5AW1B 1GW3A 3MP7B 1FZCC 3MTUE 1RF0A 1OMIA 3FXDA 2PAJA 3H1LE 2QM8A 3Q5RA 2BCCG 4GDOA 2H89C 4RO0A 2WT7A 2QSIA 3OA7A 3HD7B 5KJ7D 3QWOC 2AXCA 3TGUJ 1CW5A 1VF5B 2YKPA 1DH3A 3TK1A 2H8PD 3Q1MA 2YKQA 1VQOP 2IPPA 2IBZE 3IN6A 3H6PA 4IFFA 1RH5B 2ZYGA 5APWA 3CCVP 1LGHB 2OYHA 2C0XA 2IZ0A 1OW6A 1NTMG 3SWKA 1L0LG 2NRGA 1NKZB 2NPSC 4D6TD 2YO2A 1JNMA 2JEEA 4U3FJ 2QJKB 3M9QA 3CLQA 1JO5A 1OX3A 4XFJA 3CWBE 1EDIA 1LWUC 1SFCA 2Y9ZA 5APSA 2OYIB 3AEFC 1W2BO 4PD4E 1JMMA 2HODB 2A45I 1LT9B 4KHXA 4PD4I 4PV1C 1RF1C 3MGNA 3CCSP 4H13D 3BCCJ 4C7NB 3FX0A 1YJ9P 1T3UA 1IK9A 3BATA 3L73D 1KB9D 2V7QJ 1MKMA 2N1TA 3I55P 5C39A 1FJPA 4DJGA 1AQ5A 2G3AA 2WSCJ 3B4SA 3CI9A 4IL6H 1VQKP 2YMYA 2AEJA 3V2PA 1BGYJ 2W8ZA 1JY3O 3H25A 2P1JA 1SQBJ 1SQVG 4JQ0D 2XU6A 5CMZA 3CMEP 4IFDK 1VQ5P 5AVSB 2J59M 3CX5H 1FE6A 5KLVG 3OAKA 1FJKA 2LR2A 1TU3F 3F89A 2D2CC 1EQ7A 2KLVA 4CPGA 1D7MA 4L74A 2E75B 2KLUA 4GIFA 1AVYA 2IFMA 4NPEA 5APQA 4YPCA 1KTMA 1L0ND 1NTMK 2A06E 1JY2O 3L71G 2FYUE 5AW7B 2E76B 2QM7A 3P32A 1LTGC 5B5EE 1NTZD 1R8EA 1NU1D 2L5GB 1FDOA 3FGAD 2JWAA 1OXZA 3M0DA 2GUSA 1HJ0A 1IJDB 2JO1A 4D6TJ 2E75D 2R32A 3L72D 4PJ0E 3D6YA 3E7KA 2H88C 3KZIE 2QJPB 1SQPG 1NH4A 3AE7C 1NJIQ 3HD7C 1LTTC 3L74D 3L73E 2E76D 1H8AA 2Z4EA 5GTHH 2PFXA 2KIKA 3GF7A 2POHA 1URQA 4L73A 4WY4B 3JSVC 2ZJSE 3RK3D 4AYCA 1M8OB 4OH8B 3SWYA 3L73J 1FZEA 3AE1C 2G8YA 1HGZA 1N7SB 3OW2O 1JY3P 3CD6P 4BXLA 2GUVA 4H44D 4W80A 1FOSE 1YQ3C 1LT1A 5AVYB 1PGPA 1L0NK 3U59A 3M0AA 3I5CA 1KMIZ 2QJKC 1USEA 3WUUA 3CXHD 1SQVE 2KB7P 2WSSH 3HTKA 1X79B 1G1JA 2KP8A 1YQ4C 2ZXEB 1ZXGA 2M8RA 5CCGC 4H0LB 2OQQA 1AQTA 3V4QA 3BASA 4OVNF 2QIWA 1GDTA 1WMKA 1JY2P 2N9BA 1JTHB 4GKGA 1GL2A 1NTZE 1BDCA 1J1DB 1PL5A 2YIUB 1NTKD 1W2EA 4W7ZA 1L0NJ 2E5TA 2WSEJ 4EDFA 1G2CA 2Q5UA 4O9BA 1BE3G 1NTZJ 3T97B 3CCJP 1NU1J 2K37A 3USSA 1EXJA 1VQLP 1USDA 1L4AC 3L74E 2HYNA 4EIJA 4N3YB 3H32A 3L72J 3TNUB 1S72P 1LNQA 5TISH 2OTKE 2V7QH 3VMZA 3NFQA 3A3YB 1LJ2A 3EFFK 2WSCH 2WMMA 2KNCB 3MHVA 5AW0B 1MFTA 3N7NA 1UIIA 1U7MA 3BVHA 1KQSO 2RN0A 3EQ2A 1J1EB 2ZFCA 4GOEA 5EFWB 1PIXA 1S5LX 2N1TC 2ZVOB 3H1LG 1UIXA 1X0TA 5CCHA 2WTYA 3CL3D 2OYOA 3KYQA 1BCCE 1IFMA 2K9JA 3VYIA 1LWUB 5H2FH 3V4WA 3CX5E 4NPFX 1SQQE 1T3JA 3H1KE 5TJHA 2OARA 3CX5I 1SQXD 1QX8A 3HE4B 4OGQC 3ZDMA 1RF1B 2QJPC 3P8MC 2E74C 2KI7B 1VQ7P 5CBNA 2CPSA 1IK7A 2LKMA 4QMAA 2NPSD 2IBZG 4GT1A 3SWFA 1DIPA 4GODA 4WY4C 1L2PA 4WB4A 1NTKE 4Y28J 1NKNA 1DEBA 2IX7C 3S1KA 1YJWP 1N7SC 1FDIA 5KJ7A 1KYOD 4PV1D 3CCRP 3AE5C 4U3FD 1IO4A 3CWBG 4UB8E 5B5EH 4DCKA 3D70A 2M3BA 1U7JA 2Q3IA 2KK7A 3AEBC 5AVXB 3U1AA 1H0TA 1IFNA 4IOIH 3G3ZA 1GTWA 1P84D 1FU1A 3KZIH 4RKUJ 3BCCD 3PHLA 5B66H 2D2CB 3PP5A 1KILC 2WSFJ 4H0LC 3LW5J 1QVFO 1QL2A 1SQBG 2RMZA 2QE7H 3L70D 1S4XA 4KT0J 3A2AA 1K8AQ 1CI6B 1N86A 3JCUH 2QJYB 1J1DC 3G9RA 1OVUA 2YIUC 1ZRTE 2D2CD 3U1CA 3EFGA 3PRJA 1SQXE 3TGUE 4YTPC 1DX7A 3O6QA 1VQMP 3D71A 2M0BA 2K1AA 1FC2C 1EDLA 1BSHA 1SQXJ 2DW3A 2I1KA 3B5NA 1OIPA 3QH9A 1K9MQ 1QLED 2Z5IA 1FDMA 1LT9A 3V2RA 2W90A 1VPCA 3CC4P 5GTIE 3L75D 2Y0CA 4RESB 2A06G 2KS1B 1WT6A 3H1ID 2FYUG 4D6TG 2SPZA 2BASA 4U3FE 2IBZI 2BCCD 4HH2A 1JCDA 1G1IA 2ZT9C 4R4LA 1JUNA 4ZKUA 1J1EC 3FWNA 1M1JA 3HD7D 1GL2C 1S5LE 4I7ZB 3WU2E 5KTBA 3AEDC 2FKWB 4YXDC 1VF5D 5AW5B 3G71P 3BCCE 3LIDA 1LTIC 2YKOA 2XNDH 5AVUB 3L73G 5E79E 3CCEP 5TISE 1PPJD 2FFDA 1EZVE 2YXRB 3H1JJ 1IFIA 5AVQB 2WT7B 1KFNA 2BEQD 1NTMD 5KLIB 1L0LD 1MUUA 2M5AB 4AUWA 1BGYE 3GMAA 2LXCB 3VP8A 3L70J 3AE6C 1SQBE 3LIEA 1YJNP 2IZ1A 2E42A 1ZOYC 1OVVA 1FS0E 3IAOA 5CCGD 1VQPP 2L91A 1YITP 3VTPC 1HWTC 2AXTH 2BEZF 2OYHB 5H2FE 5DJUB 2I8DA 3HUSC 3CXHH 2KOGA 1NO4A 3SFDC 1L4AB 2B87B 2XNXA 1RE3C 1DEEG 1W5CE 5CCHC 1LTJA 1N7LA 1S9KD 1GK4A 3AE4C 4C7RA 1SFCB 2KXPB 1M1KQ 2NZ2A 1SVFA 3V6IA 2FYUK 3UIAA 2GM4A 1NTZG 5AW2B 1NU1G 2O01J 3L75J 1L4AD 1AFOA 3H1IJ 2O3JA 3P8CD 1YHQP 1K73Q 1L0LK 4D6TE 2QJYC 3MZWB 2N1TB 4EOTA 1VDFA 2BCCJ 1NAYA 4L75A 2Y9YA 2W6AA 2JWDA 1HTLC 4UB8H 3L74G 3BRTB 3L35A 1ZLLA 2HPCB 1PPJE 4HKZH 2RKLA 1KQFB 1AJYA 1VL2A 2C9LY 4OGQB 1JM0A 2WPSA 5B66E 2E74B 3LW5H 2MJZA 4UB6H 1OZHA 3HE5A 1KB9E 3GHGA 2M3EA 3L71D 2R5DA 3WMM0 1RE4C 1NTMJ 1L0LJ 3JCUE 1IC2A 4RJTA 1M57D 4OGQD 3RL0B 3MUDC 1FOSF 2E74D 1BCCG 1SQVK 3GG2A 3B71A 1SQQG 3H1KG 3F5HA 2JKVA 1CZQA 4I7ZC 1PGJA 1RHZB 2JR8A 2ZAEB 2B88A 1FZCA 1S9KE 3AE3C 5KLVK 1A02F 1E5WA 4WY4D 1AV1A 2FXPA 2C9NY 1PGOA 1MZ9A 3AE9C 1RF0C 1KILB 1N7SD 3CCUP 1WRGA 1PFIA 2B9BA 1HH0A 4I2LC 3CMAP 1NTKG 3TDKA 2FY8A 1L0NE 4DOJA 1Y47A 1ZN5A 1JOCA 3B5NC 5KLIC 5GTIH 1BSNA 1NHLA 3R2PA 1URQB 5CJ4A 3KQGA 1KYOH 1NU1E 1M56D 2Q1KA 3AEGC 1KILD 3L72E 4H0LD 1S5LH 5KLVJ 2NPSA 3WU2H 2OYHC 1ZP0C 1P84H 1SQPK 1T2KC 2PP6A 1M1JC 4WWIA 1VQ8P 3AECC 1ZMEC 2K88A 3A0HE 3HRNA 5E79H 4HB1A 4AQRD 1PP9D 2B89A 1RF1A 1SFCC 2CPBA 3HTKB 2R3CA 3RK3E 4BRYA 1QEXA 3L71J 3S4RA 1FZFA 3RK2B 1KD1Q 3MIWA 3VOPA 2FYNC 4JBZA 2ZT9B 4K35A 3II6A 1SQQK 3IF4A 1GL2B 1SQXG 1VQ6P 5AVWB 2AXTE 5CHXA 3TGUG 2J58A 1N73A 2Y0EA 3CXHE 2QVAA 4JYCA 1SQPJ 2XV5A 2IDBA 1EXIA 2KSJA 2O01N 3CXHI 1NWQA 1FZAA 1G2CB 3M9HA 3CCQP 5AW4B 2KUBA 2O1JA 3PJSK 3K5BA 4W7YA 5APYA 2FXOA 2KZJA 3OJAB 3D6ZA 1LP1A 1XTGB 3H32B 3KPEA 1LTJC 4TLFA 3GLMA 4U3FG 2VRSA 4H44C 3H1LD 1JMBA 5DJTB 1OVRA 1R5SA 2W6JH 2W83C 4IFMA 3V2QA 3RL0C 1RQVA 3BCCG 3HUSB 1KN7A 2QG4A 1QGKB 2Q6QA 4K3AA 2E5YA 3H1HD 1EZVG 1HUCA 1PP9E 3L4FA 4UB6E 1LTSC 2YMKA 3SSUA 2K9JB 3M0DC 3H1JD 1K05A
chains in the Genus database with same CATH topology
5AVUB 1FAVA 1FZBA 5BU8B 1YYCA 2FFDA 1NH4A 3HD7A 2H7HA 3L37A 1X9VA 1H89A 2FFDC 2WPRA 2A45H 1IFIA 5AVQB 3HD7C 1LTTC 2WT7B 4N78E 1KFNA 1SP4A 1H8AA 2Z4EA 1MUUA 4AUWA 3GHGC 2POHA 1URQA 3VP8A 4WY4B 2FYZA 2HLOA 5CCHD 1LTIC 4Y99B 1URQC 3LIEA 3RK3D 4AYCA 4OH8B 3SWYA 2P2UA 1FZEA 1T8ZA 1HGZA 3N4XA 1N7SB 2E42A 1JY3P 1KQLA 1X8YA 2GUVA 5CCGD 2XZRA 4W80A 3HUSA 3VTPC 1LTBC 1HWTC 5APXA 1FOSE 2OYHB 2W27A 1GW4A 5AVYB 1RE3A 4B86A 3HUSC 1L0NK 3U59A 2NPSB 3M0AA 2KOGA 3RK2D 1NO4A 1L4AB 2XNXA 1RE3C 3I5CA 2WPQA 1HVVA 1OWAA 3L36A 1NTKK 4JF7A 5CCHC 1LTJA 1N7LA 2O01H 2OYIA 3RK3C 1S9KD 2KB7P 1GK4A 1GL2D 2HODA 4C7RA 3HTKA 1RY3A 5CCGA 1X79B 3M06A 4I1LA 1SFCB 1G1JA 4LLHA 2KP8A 2ZXEB 2M8RA 5CCGC 3C9IA 1HJBA 1SVFA 4C7NA 2FYUK 3UIAA 2GM4A 3V4QA 3BASA 1LTAC 1GU4A 2HFED 2WSEH 1GDTA 5AW2B 1CI6A 1JY2P 3RK2C 2N9BA 2YO3A 1JTHB 1L4AD 4GKGA 1AFOA 1GL2A 3P8CD 1SLQA 3V5BA 1L0LK 2I1JA 4Y99C 1J1DB 2HG5D 3M91A 2N1TB 2YNYA 2Z5HA 4EOTA 1ZR4A 1VDFA 1W2EA 2C0WA 5AVTB 1GD2E 4W7ZA 4XA4A 2W6AA 1J2JB 1HTLC 1G2CA 2Q5UA 4O9BA 3V2NA 1N73B 3B8EB 1ZR2A 3BRTB 3L35A 1ZLLA 2HPCB 3TYYA 2IFNA 2JJLA 1L4AA 2C9LY 2A45G 2WPSA 2XDJA 1L4AC 3LW5H 3VN0A 2MJZA 2HYNA 4EIJA 1ZV8A 4N3YB 3H32A 5BU5A 1SQBK 3HE5A 3TNUB 4ZKPA 3GHGA 5APTA 3E1IA 3B5NB 1RE4A 2R5DA 5APVA 3WMM0 3VMZA 1GZLA 4I6MC 3NFQA 1GK6A 3A3YB 1SQXK 1RE4C 4JYBA 2WSCH 3MUDA 1YTZI 5AW0B 1FZGA 1IC2A 3N7NA 3IFMA 3M9BA 3RL0B 3BVHA 1FOSF 3EQ2A 1J1EB 1SQVK 2ZFCA 4M3LA 1CZQA 2Q7CA 2N1TC 1M1JB 5CCHA 3B5ND 2WTYA 3CL3D 1CSBA 3KYQA 3VMXA 1S9KE 3NTNA 1FZCA 2FXMA 2XKMA 5KLVK 1A02F 1IFMA 4LGDE 1E5WA 5AW1B 2HPCA 1N73C 1FBMA 4WY4D 3VYIA 1GW3A 1LWUB 3V4WA 3A7OA 1FZCC 1T3JA 2P7JA 3MTUE 1RF0A 2OARA 2E43A 2WWWA 2PAJA 2C9NY 1JY3N 1MZ9A 2QM8A 5AVVB 1RF0C 1KILB 3HE4B 1N7SD 1RF1B 1WRGA 1IFDA 1PFIA 3P8MC 2WT7A 1HH0A 2FFDB 3OA7A 3HD7B 4I2LC 2CPSA 2LKMA 3KDPB 5KJ7D 4DOJA 1CW5A 1ZN5A 2NPSD 1T2KD 4GT1A 4WY4A 1JOCA 3B5NC 2W6BA 3SWFA 3BRVB 2YKPA 1DH3A 4XE5B 1NHLA 3TK1A 2H8PD 4WY4C 5CJ0A 3VMYA 3R2PA 1URQB 4WB4A 5CJ4A 2YKQA 1NKNA 3KQGA 1DEBA 1N7SA 2IX7C 2IPPA 1KZUB 3H6PA 4DZOA 4IFFA 1N7SC 1SFCD 1KILD 5APWA 5KJ7A 1LGHB 3IR9A 2OYHA 2C0XA 1IO4A 2WZ7A 2NPSA 5KJ7C 2OYHC 2KYVA 5AVRB 1JY2N 2M3BA 2Q3IA 2WSFH 1SQPK 1NKZB 2NPSC 1T2KC 2PP6A 5AVXB 2YO2A 1M1JC 1JNMA 2JEEA 4HYTB 3U1AA 1IFNA 3M9QA 2P67A 3CLQA 3G3ZA 1JO5A 1GTWA 3HRNA 3RK3B 1LWUC 4WBAA 1SFCA 4AQRD 1FU1A 1LTJB 1KILA 1Z56A 5APSA 2OYIB 2N1TD 1RF1A 1MFZA 2WITA 1JMMA 2HODB 2A45I 1SFCC 5BVZA 2CPBA 5AW3B 3HTKB 2R3CA 3PP5A 1KILC 1LT9B 4KHXA 1RF1C 3MGNA 4C7NB 3MD0A 1T3UA 3P7KA 1FZFA 1QL2A 1IK9A 1JTHA 3RK2B 1IFJA 3BATA 3A2AA 3MIWA 3VOPA 4N78D 1CI6B 4C46A 5AVZB 3II6A 1SQQK 1N86A 2N1TA 1GL2B 1J1DC 3NMDA 1FJPA 5AVWB 5CHXA 1AQ5A 1H88A 2J58A 1N73A 4JYCA 3NXSA 3CI9A 2XV5A 1GU5A 2YMYA 1MV8A 2KSJA 5AW6B 3U1CA 3EFGA 3V2PA 3T97A 1NWQA 1QL1A 1FZAA 1JY3O 1G2CB 3M9HA 2H43A 2P1JA 5AW4B 1NAFA 2O1JA 1DX7A 4N6JA 2XU6A 4W7YA 3A5TA 5APYA 3OJAB 5CMZA 4IFDK 1KFMA 5AVSB 3RL0D 2J59M 3TNUA 1NTZK 2I1KA 3OAKA 1NOHA 1NU1K 3B5NA 5AW8B 1XTGB 1HBWA 1FJKA 3H32B 3KPEA 1M7LA 3HE5B 2Z5IA 1LTJC 3TSIA 3P8CE 1FDMA 1LT9A 2R5BA 2OYIC 5APUA 1YTZT 3V2RA 3GHGB 1JCCA 2VRSA 1VPCA 1XTCC 1LT9C 1EQ7A 2KLVA 4RESB 1WT6A 1HGVA 4GIFA 1A02J 1N2DC 2IFMA 2BASA 5APQA 2O1KA 4IFMA 4HH2A 3V2QA 1JCDA 3RL0C 1G1IA 1NTMK 1JY2O 1JUNA 4ZKUA 1J1EC 5AW7B 1M1JA 3HD7D 3HUSB 2QM7A 1GL2C 3VP9A 5AW9B 3P32A 1LTGC 5KTBA 2FKWB 4LC1A 2Q9IA 2L5GB 1LWUA 3L4FA 1HUCA 5AW5B 1OXZA 3M0DA 2GUSA 3LIDA 1FZCB 1IJDB 1LTSC 1URQD 3O8ZA 2R32A 3HE4A 3M0DC 2YKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GL2 A;  2N1T A;  1KIL B;  1N7S D;  2HG5 D;  1GL2 B;  3HD7 A;  2N1T B;  4W7Z A;  3HD7 B;  3HD7 C;  2YMY A;  5KJ7 D;  4N78 E;  2NPS D;  4WY4 A;  3B5N C;  1URQ A;  1NHL A;  4WY4 B;  1L4A A;  2H8P D;  4WY4 C;  5CCH D;  4W7Y A;  1URQ B;  1URQ C;  3RK3 D;  2XDJ A;  1N7S A;  4OH8 B;  1L4A C;  3RL0 D;  1N7S B;  1N7S C;  1SFC D;  3B5N A;  1KIL D;  1XTG B;  5CCG D;  4W80 A;  5KJ7 A;  3TSI A;  3P8C E;  3B5N B;  2WZ7 A;  2NPS A;  5KJ7 C;  2NPS B;  2KOG A;  2NPS C;  2PP6 A;  3RK2 D;  1L4A B;  1HVV A;  4JF7 A;  5CCH C;  3RK3 B;  3RK3 C;  1SFC A;  3RL0 B;  1GL2 D;  3RL0 C;  1KIL A;  5CCG A;  2N1T D;  1SFC B;  1SFC C;  3HTK B;  3PP5 A;  1KIL C;  2M8R A;  3HD7 D;  5CCG C;  1GL2 C;  2N1T C;  1L4A D;  5CCH A;  3B5N D;  2HFE D;  3KYQ A;  1JTH A;  4LGD E;  3RK2 B;  4WY4 D;  3RK2 C;  1T3J A;  1JTH B;  1URQ D;  3VOP A;  3M0D C; 
#chains in the Genus database with same CATH topology
 1FAV A;  1FZB A;  3SFE C;  3KHU A;  3Q5P A;  2UWJ E;  4WVZ A;  2ZVN B;  3HD7 A;  2H7H A;  1BGY G;  1PP9 J;  3RL0 g;  1QVG O;  1X9V A;  1H89 A;  1KB9 H;  2PRR A;  3CWB D;  1SP4 A;  3CC7 P;  3GHG C;  1BE3 J;  2HLO A;  4PD4 D;  5CCH D;  3C8V A;  1URQ C;  2P2U A;  4Z1M H;  1T8Z A;  3N4X A;  1KQL A;  2XZR A;  5K5G B;  4HJG H;  1DD3 A;  1X22 A;  2W27 A;  1GW4 A;  2FBW C;  1T6A A;  1ZW0 A;  3L75 G;  1N8R Q;  2AEF A;  3VMA A;  1OWA A;  3L36 A;  5KAI E;  2OYI A;  1H0T B;  2CK3 H;  2V4H A;  2HOD A;  5CCG A;  1HJB A;  4C7N A;  5KAF E;  4L76 A;  1LTA C;  2WSE H;  2M5A A;  1KYO E;  2ZYD A;  3H1L J;  3RK2 C;  4EYY Q;  1KYO I;  1KQG B;  2RH0 A;  1SLQ A;  3V5B A;  4Y99 C;  2HG5 D;  2WVR A;  2YNY A;  1PPJ G;  1ZR4 A;  3H1H E;  2C0W A;  5AVT B;  1GD2 E;  1VQ9 P;  1P84 E;  3B8E B;  1ZR2 A;  1P84 I;  3H1J E;  3Q5S A;  4H13 B;  2IYP A;  3TF5 A;  3CCL P;  1IFP A;  3TYY A;  3Q3D A;  2JJL A;  1L4A A;  2A06 D;  2B87 A;  2FYU D;  3H1H J;  2OTL P;  2GA1 A;  2XDJ A;  3O6Q B;  3A0H H;  3VN0 A;  3L70 E;  1ZV8 A;  1EZV I;  5BU5 A;  1SQB K;  2KZI A;  4ZKP A;  3E1I A;  3B5N B;  1R5L A;  4I6M C;  4JYB A;  3CWB J;  3S9O A;  1YTZ I;  3M9B A;  2QEX P;  1U57 A;  2IYO A;  4TT3 H;  4YXW H;  1M1J B;  3B5N D;  3VMX A;  3NTN A;  3RBZ A;  2HPC A;  1N73 C;  1FBM A;  3A7O A;  2P7J A;  2E43 A;  2WWW A;  1S1C X;  1EDJ A;  2OTJ P;  3EWK A;  1JY3 N;  3L75 E;  3ITK A;  5AVV B;  1L0N G;  1SS1 A;  3H1I E;  1IFD A;  1K04 A;  2FFD B;  3W68 A;  3KDP B;  1VQN P;  2BCC E;  4ZNC A;  1T2K D;  1SQV D;  3PLN A;  4WY4 A;  2FYN B;  2W6B A;  3BRV B;  4XE5 B;  5CJ0 A;  1YBK A;  3VMY A;  3L72 G;  2ZYA A;  1N7S A;  2ITA A;  5KLV D;  1KZU B;  4DZO A;  1SFC D;  3IR9 A;  2Q3E A;  2WZ7 A;  4IL6 X;  5KJ7 C;  2KYV A;  5AVR B;  1JY2 N;  2WSF H;  2R3S A;  4HYT B;  1Q81 Q;  2P67 A;  1DD4 A;  1NTM E;  3RK3 B;  1JB0 J;  1L0L E;  2FYU J;  4WBA A;  1LTJ B;  1KIL A;  1Z56 A;  2PGD A;  2N1T D;  1MFZ A;  2WIT A;  1KB9 I;  4ASW A;  5BVZ A;  5AW3 B;  4H44 B;  2YXQ B;  3MD0 A;  5CBO A;  3P7K A;  1JTH A;  1KC8 Q;  4EI2 A;  2MKV A;  3G4S P;  3I56 P;  3PTZ A;  1IFJ A;  3FXE A;  4N78 D;  4C46 A;  5AVZ B;  1VF5 C;  2P10 A;  3R4Y A;  1SQP D;  5KKZ B;  5M1B A;  2K3R A;  1EC5 A;  4DT0 A;  3NMD A;  1PGQ A;  3PH0 A;  1H88 A;  3NXS A;  1GU5 A;  1MV8 A;  3G6E P;  5AW6 B;  1OFC X;  3T97 A;  1QL1 A;  4H13 C;  3RBX A;  2H43 A;  3AEE C;  1NAF A;  4N6J A;  3A5T A;  1RQU A;  1E79 H;  3A0B H;  3W67 A;  5KAI H;  1KFM A;  3RL0 D;  3TNU A;  1NTZ K;  4MN4 C;  1S2E A;  1NOH A;  1NU1 K;  5AW8 B;  1IZN B;  1HBW A;  1BCC D;  4OWF A;  1M7L A;  3HE5 B;  3TSI A;  3P8C E;  2OYI C;  2R5B A;  3CX5 D;  1SQQ D;  5APU A;  1YTZ T;  3H1K D;  3GHG B;  1JCC A;  5KAF H;  1XTC C;  2N9Y B;  3Q2Y A;  1LT9 C;  4JPZ B;  5KLV E;  2KNC A;  1HGV A;  1SQV J;  1A02 J;  1N2D C;  1GMJ A;  1NYH A;  2O1K A;  2P58 A;  2WQY C;  1PP9 G;  3VP9 A;  5AW9 B;  3AEA C;  3CC2 P;  1Q82 Q;  1VQ4 P;  2WPV B;  4LC1 A;  2Q9I A;  1LWU A;  1YIJ P;  3L71 E;  1NVO A;  1FZC B;  1URQ D;  3O8Z A;  3HE4 A;  1GK6 A;  1Y8A A;  5BU8 B;  3GW6 A;  1YYC A;  3L37 A;  2J5U A;  2FFD C;  2WPR A;  1PZQ A;  2A45 H;  1PV3 A;  1BE3 D;  4U7J A;  4N78 E;  4PD4 H;  1Q7Y Q;  2OGU A;  1SQP E;  3E1R A;  4ASV A;  2FYZ A;  3L74 J;  4Y99 B;  2E75 C;  1Y9B A;  2JDI H;  2JP3 A;  1AVO A;  3KXD A;  2AEM A;  1X8Y A;  4IL6 E;  3HUS A;  2LXB A;  1LTB C;  5APX A;  4B86 A;  1RE3 A;  2E76 C;  2NPS B;  4A7P A;  3RK2 D;  2WPQ A;  1HVV A;  2ZT9 D;  2R44 A;  1NTK K;  4JF7 A;  1ZRT D;  2O01 H;  1JEK A;  3RK3 C;  1GL2 D;  1RY3 A;  1OW8 A;  3M06 A;  4I1L A;  1M90 Q;  4LLH A;  3TGU D;  3C9I A;  4PV1 B;  1BCC J;  3WUV A;  1GU4 A;  4BRY B;  2ZXX A;  3CCM P;  2HFE D;  1SQQ J;  3H1K J;  1KIL E;  1YI2 P;  1CI6 A;  3FWL A;  3H1H G;  2YO3 A;  3JC2 2;  1KOR A;  1OW7 A;  3GF3 A;  4NPD A;  5KKZ C;  3H1J G;  2I1J A;  1BDD A;  1EDK A;  3M91 A;  2Z5H A;  4BWN A;  3ABV C;  4XA4 A;  1J2J B;  2IBZ D;  3V2N A;  1N73 B;  1HF9 A;  2HR3 A;  1Q86 Q;  3C1L A;  3CPW O;  3L70 G;  1S3J A;  2Y0D A;  1NTK J;  2IFN A;  4R4M A;  1Q90 D;  2K9Y A;  3RGU A;  2A45 G;  1BE3 E;  1Q2N A;  4KJM A;  3AE2 C;  3AE8 C;  4PJ0 H;  5APT A;  5L8R J;  1LP1 B;  1RE4 A;  5APV A;  5GTH E;  1GZL A;  1KV4 A;  2KS1 A;  1SQX K;  1EZV D;  4GOF A;  3MUD A;  1FZG A;  2KSE A;  3IFM A;  3WUT A;  2QRX A;  2QA4 P;  1NGM B;  1AA0 A;  1BGY D;  4M3L A;  4ZMD A;  2Q7C A;  1SQB D;  1CSB A;  2FXM A;  2XKM A;  3H1I G;  4LGD E;  3A0B E;  5AW1 B;  1GW3 A;  3MP7 B;  1FZC C;  3MTU E;  1RF0 A;  1OMI A;  3FXD A;  2PAJ A;  3H1L E;  2QM8 A;  3Q5R A;  2BCC G;  4GDO A;  2H89 C;  4RO0 A;  2WT7 A;  2QSI A;  3OA7 A;  3HD7 B;  5KJ7 D;  3QWO C;  2AXC A;  3TGU J;  1CW5 A;  1VF5 B;  2YKP A;  1DH3 A;  3TK1 A;  2H8P D;  3Q1M A;  2YKQ A;  1VQO P;  2IPP A;  2IBZ E;  3IN6 A;  3H6P A;  4IFF A;  1RH5 B;  2ZYG A;  5APW A;  3CCV P;  1LGH B;  2OYH A;  2C0X A;  2IZ0 A;  1OW6 A;  1NTM G;  3SWK A;  1L0L G;  2NRG A;  1NKZ B;  2NPS C;  4D6T D;  2YO2 A;  1JNM A;  2JEE A;  4U3F J;  2QJK B;  3M9Q A;  3CLQ A;  1JO5 A;  1OX3 A;  4XFJ A;  3CWB E;  1EDI A;  1LWU C;  1SFC A;  2Y9Z A;  5APS A;  2OYI B;  3AEF C;  1W2B O;  4PD4 E;  1JMM A;  2HOD B;  2A45 I;  1LT9 B;  4KHX A;  4PD4 I;  4PV1 C;  1RF1 C;  3MGN A;  3CCS P;  4H13 D;  3BCC J;  4C7N B;  3FX0 A;  1YJ9 P;  1T3U A;  1IK9 A;  3BAT A;  3L73 D;  1KB9 D;  2V7Q J;  1MKM A;  2N1T A;  3I55 P;  5C39 A;  1FJP A;  4DJG A;  1AQ5 A;  2G3A A;  2WSC J;  3B4S A;  3CI9 A;  4IL6 H;  1VQK P;  2YMY A;  2AEJ A;  3V2P A;  1BGY J;  2W8Z A;  1JY3 O;  3H25 A;  2P1J A;  1SQB J;  1SQV G;  4JQ0 D;  2XU6 A;  5CMZ A;  3CME P;  4IFD K;  1VQ5 P;  5AVS B;  2J59 M;  3CX5 H;  1FE6 A;  5KLV G;  3OAK A;  1FJK A;  2LR2 A;  1TU3 F;  3F89 A;  2D2C C;  1EQ7 A;  2KLV A;  4CPG A;  1D7M A;  4L74 A;  2E75 B;  2KLU A;  4GIF A;  1AVY A;  2IFM A;  4NPE A;  5APQ A;  4YPC A;  1KTM A;  1L0N D;  1NTM K;  2A06 E;  1JY2 O;  3L71 G;  2FYU E;  5AW7 B;  2E76 B;  2QM7 A;  3P32 A;  1LTG C;  5B5E E;  1NTZ D;  1R8E A;  1NU1 D;  2L5G B;  1FDO A;  3FGA D;  2JWA A;  1OXZ A;  3M0D A;  2GUS A;  1HJ0 A;  1IJD B;  2JO1 A;  4D6T J;  2E75 D;  2R32 A;  3L72 D;  4PJ0 E;  3D6Y A;  3E7K A;  2H88 C;  3KZI E;  2QJP B;  1SQP G;  1NH4 A;  3AE7 C;  1NJI Q;  3HD7 C;  1LTT C;  3L74 D;  3L73 E;  2E76 D;  1H8A A;  2Z4E A;  5GTH H;  2PFX A;  2KIK A;  3GF7 A;  2POH A;  1URQ A;  4L73 A;  4WY4 B;  3JSV C;  2ZJS E;  3RK3 D;  4AYC A;  1M8O B;  4OH8 B;  3SWY A;  3L73 J;  1FZE A;  3AE1 C;  2G8Y A;  1HGZ A;  1N7S B;  3OW2 O;  1JY3 P;  3CD6 P;  4BXL A;  2GUV A;  4H44 D;  4W80 A;  1FOS E;  1YQ3 C;  1LT1 A;  5AVY B;  1PGP A;  1L0N K;  3U59 A;  3M0A A;  3I5C A;  1KMI Z;  2QJK C;  1USE A;  3WUU A;  3CXH D;  1SQV E;  2KB7 P;  2WSS H;  3HTK A;  1X79 B;  1G1J A;  2KP8 A;  1YQ4 C;  2ZXE B;  1ZXG A;  2M8R A;  5CCG C;  4H0L B;  2OQQ A;  1AQT A;  3V4Q A;  3BAS A;  4OVN F;  2QIW A;  1GDT A;  1WMK A;  1JY2 P;  2N9B A;  1JTH B;  4GKG A;  1GL2 A;  1NTZ E;  1BDC A;  1J1D B;  1PL5 A;  2YIU B;  1NTK D;  1W2E A;  4W7Z A;  1L0N J;  2E5T A;  2WSE J;  4EDF A;  1G2C A;  2Q5U A;  4O9B A;  1BE3 G;  1NTZ J;  3T97 B;  3CCJ P;  1NU1 J;  2K37 A;  3USS A;  1EXJ A;  1VQL P;  1USD A;  1L4A C;  3L74 E;  2HYN A;  4EIJ A;  4N3Y B;  3H32 A;  3L72 J;  3TNU B;  1S72 P;  1LNQ A;  5TIS H;  2OTK E;  2V7Q H;  3VMZ A;  3NFQ A;  3A3Y B;  1LJ2 A;  3EFF K;  2WSC H;  2WMM A;  2KNC B;  3MHV A;  5AW0 B;  1MFT A;  3N7N A;  1UII A;  1U7M A;  3BVH A;  1KQS O;  2RN0 A;  3EQ2 A;  1J1E B;  2ZFC A;  4GOE A;  5EFW B;  1PIX A;  1S5L X;  2N1T C;  2ZVO B;  3H1L G;  1UIX A;  1X0T A;  5CCH A;  2WTY A;  3CL3 D;  2OYO A;  3KYQ A;  1BCC E;  1IFM A;  2K9J A;  3VYI A;  1LWU B;  5H2F H;  3V4W A;  3CX5 E;  4NPF X;  1SQQ E;  1T3J A;  3H1K E;  5TJH A;  2OAR A;  3CX5 I;  1SQX D;  1QX8 A;  3HE4 B;  4OGQ C;  3ZDM A;  1RF1 B;  2QJP C;  3P8M C;  2E74 C;  2KI7 B;  1VQ7 P;  5CBN A;  2CPS A;  1IK7 A;  2LKM A;  4QMA A;  2NPS D;  2IBZ G;  4GT1 A;  3SWF A;  1DIP A;  4GOD A;  4WY4 C;  1L2P A;  4WB4 A;  1NTK E;  4Y28 J;  1NKN A;  1DEB A;  2IX7 C;  3S1K A;  1YJW P;  1N7S C;  1FDI A;  5KJ7 A;  1KYO D;  4PV1 D;  3CCR P;  3AE5 C;  4U3F D;  1IO4 A;  3CWB G;  4UB8 E;  5B5E H;  4DCK A;  3D70 A;  2M3B A;  1U7J A;  2Q3I A;  2KK7 A;  3AEB C;  5AVX B;  3U1A A;  1H0T A;  1IFN A;  4IOI H;  3G3Z A;  1GTW A;  1P84 D;  1FU1 A;  3KZI H;  4RKU J;  3BCC D;  3PHL A;  5B66 H;  2D2C B;  3PP5 A;  1KIL C;  2WSF J;  4H0L C;  3LW5 J;  1QVF O;  1QL2 A;  1SQB G;  2RMZ A;  2QE7 H;  3L70 D;  1S4X A;  4KT0 J;  3A2A A;  1K8A Q;  1CI6 B;  1N86 A;  3JCU H;  2QJY B;  1J1D C;  3G9R A;  1OVU A;  2YIU C;  1ZRT E;  2D2C D;  3U1C A;  3EFG A;  3PRJ A;  1SQX E;  3TGU E;  4YTP C;  1DX7 A;  3O6Q A;  1VQM P;  3D71 A;  2M0B A;  2K1A A;  1FC2 C;  1EDL A;  1BSH A;  1SQX J;  2DW3 A;  2I1K A;  3B5N A;  1OIP A;  3QH9 A;  1K9M Q;  1QLE D;  2Z5I A;  1FDM A;  1LT9 A;  3V2R A;  2W90 A;  1VPC A;  3CC4 P;  5GTI E;  3L75 D;  2Y0C A;  4RES B;  2A06 G;  2KS1 B;  1WT6 A;  3H1I D;  2FYU G;  4D6T G;  2SPZ A;  2BAS A;  4U3F E;  2IBZ I;  2BCC D;  4HH2 A;  1JCD A;  1G1I A;  2ZT9 C;  4R4L A;  1JUN A;  4ZKU A;  1J1E C;  3FWN A;  1M1J A;  3HD7 D;  1GL2 C;  1S5L E;  4I7Z B;  3WU2 E;  5KTB A;  3AED C;  2FKW B;  4YXD C;  1VF5 D;  5AW5 B;  3G71 P;  3BCC E;  3LID A;  1LTI C;  2YKO A;  2XND H;  5AVU B;  3L73 G;  5E79 E;  3CCE P;  5TIS E;  1PPJ D;  2FFD A;  1EZV E;  2YXR B;  3H1J J;  1IFI A;  5AVQ B;  2WT7 B;  1KFN A;  2BEQ D;  1NTM D;  5KLI B;  1L0L D;  1MUU A;  2M5A B;  4AUW A;  1BGY E;  3GMA A;  2LXC B;  3VP8 A;  3L70 J;  3AE6 C;  1SQB E;  3LIE A;  1YJN P;  2IZ1 A;  2E42 A;  1ZOY C;  1OVV A;  1FS0 E;  3IAO A;  5CCG D;  1VQP P;  2L91 A;  1YIT P;  3VTP C;  1HWT C;  2AXT H;  2BEZ F;  2OYH B;  5H2F E;  5DJU B;  2I8D A;  3HUS C;  3CXH H;  2KOG A;  1NO4 A;  3SFD C;  1L4A B;  2B87 B;  2XNX A;  1RE3 C;  1DEE G;  1W5C E;  5CCH C;  1LTJ A;  1N7L A;  1S9K D;  1GK4 A;  3AE4 C;  4C7R A;  1SFC B;  2KXP B;  1M1K Q;  2NZ2 A;  1SVF A;  3V6I A;  2FYU K;  3UIA A;  2GM4 A;  1NTZ G;  5AW2 B;  1NU1 G;  2O01 J;  3L75 J;  1L4A D;  1AFO A;  3H1I J;  2O3J A;  3P8C D;  1YHQ P;  1K73 Q;  1L0L K;  4D6T E;  2QJY C;  3MZW B;  2N1T B;  4EOT A;  1VDF A;  2BCC J;  1NAY A;  4L75 A;  2Y9Y A;  2W6A A;  2JWD A;  1HTL C;  4UB8 H;  3L74 G;  3BRT B;  3L35 A;  1ZLL A;  2HPC B;  1PPJ E;  4HKZ H;  2RKL A;  1KQF B;  1AJY A;  1VL2 A;  2C9L Y;  4OGQ B;  1JM0 A;  2WPS A;  5B66 E;  2E74 B;  3LW5 H;  2MJZ A;  4UB6 H;  1OZH A;  3HE5 A;  1KB9 E;  3GHG A;  2M3E A;  3L71 D;  2R5D A;  3WMM 0;  1RE4 C;  1NTM J;  1L0L J;  3JCU E;  1IC2 A;  4RJT A;  1M57 D;  4OGQ D;  3RL0 B;  3MUD C;  1FOS F;  2E74 D;  1BCC G;  1SQV K;  3GG2 A;  3B71 A;  1SQQ G;  3H1K G;  3F5H A;  2JKV A;  1CZQ A;  4I7Z C;  1PGJ A;  1RHZ B;  2JR8 A;  2ZAE B;  2B88 A;  1FZC A;  1S9K E;  3AE3 C;  5KLV K;  1A02 F;  1E5W A;  4WY4 D;  1AV1 A;  2FXP A;  2C9N Y;  1PGO A;  1MZ9 A;  3AE9 C;  1RF0 C;  1KIL B;  1N7S D;  3CCU P;  1WRG A;  1PFI A;  2B9B A;  1HH0 A;  4I2L C;  3CMA P;  1NTK G;  3TDK A;  2FY8 A;  1L0N E;  4DOJ A;  1Y47 A;  1ZN5 A;  1JOC A;  3B5N C;  5KLI C;  5GTI H;  1BSN A;  1NHL A;  3R2P A;  1URQ B;  5CJ4 A;  3KQG A;  1KYO H;  1NU1 E;  1M56 D;  2Q1K A;  3AEG C;  1KIL D;  3L72 E;  4H0L D;  1S5L H;  5KLV J;  2NPS A;  3WU2 H;  2OYH C;  1ZP0 C;  1P84 H;  1SQP K;  1T2K C;  2PP6 A;  1M1J C;  4WWI A;  1VQ8 P;  3AEC C;  1ZME C;  2K88 A;  3A0H E;  3HRN A;  5E79 H;  4HB1 A;  4AQR D;  1PP9 D;  2B89 A;  1RF1 A;  1SFC C;  2CPB A;  3HTK B;  2R3C A;  3RK3 E;  4BRY A;  1QEX A;  3L71 J;  3S4R A;  1FZF A;  3RK2 B;  1KD1 Q;  3MIW A;  3VOP A;  2FYN C;  4JBZ A;  2ZT9 B;  4K35 A;  3II6 A;  1SQQ K;  3IF4 A;  1GL2 B;  1SQX G;  1VQ6 P;  5AVW B;  2AXT E;  5CHX A;  3TGU G;  2J58 A;  1N73 A;  2Y0E A;  3CXH E;  2QVA A;  4JYC A;  1SQP J;  2XV5 A;  2IDB A;  1EXI A;  2KSJ A;  2O01 N;  3CXH I;  1NWQ A;  1FZA A;  1G2C B;  3M9H A;  3CCQ P;  5AW4 B;  2KUB A;  2O1J A;  3PJS K;  3K5B A;  4W7Y A;  5APY A;  2FXO A;  2KZJ A;  3OJA B;  3D6Z A;  1LP1 A;  1XTG B;  3H32 B;  3KPE A;  1LTJ C;  4TLF A;  3GLM A;  4U3F G;  2VRS A;  4H44 C;  3H1L D;  1JMB A;  5DJT B;  1OVR A;  1R5S A;  2W6J H;  2W83 C;  4IFM A;  3V2Q A;  3RL0 C;  1RQV A;  3BCC G;  3HUS B;  1KN7 A;  2QG4 A;  1QGK B;  2Q6Q A;  4K3A A;  2E5Y A;  3H1H D;  1EZV G;  1HUC A;  1PP9 E;  3L4F A;  4UB6 E;  1LTS C;  2YMK A;  3SSU A;  2K9J B;  3M0D C;  3H1J D;  1K05 A; 
#chains in the Genus database with same CATH homology
 5AVU B;  1FAV A;  1FZB A;  5BU8 B;  1YYC A;  2FFD A;  1NH4 A;  3HD7 A;  2H7H A;  3L37 A;  1X9V A;  1H89 A;  2FFD C;  2WPR A;  2A45 H;  1IFI A;  5AVQ B;  3HD7 C;  1LTT C;  2WT7 B;  4N78 E;  1KFN A;  1SP4 A;  1H8A A;  2Z4E A;  1MUU A;  4AUW A;  3GHG C;  2POH A;  1URQ A;  3VP8 A;  4WY4 B;  2FYZ A;  2HLO A;  5CCH D;  1LTI C;  4Y99 B;  1URQ C;  3LIE A;  3RK3 D;  4AYC A;  4OH8 B;  3SWY A;  2P2U A;  1FZE A;  1T8Z A;  1HGZ A;  3N4X A;  1N7S B;  2E42 A;  1JY3 P;  1KQL A;  1X8Y A;  2GUV A;  5CCG D;  2XZR A;  4W80 A;  3HUS A;  3VTP C;  1LTB C;  1HWT C;  5APX A;  1FOS E;  2OYH B;  2W27 A;  1GW4 A;  5AVY B;  1RE3 A;  4B86 A;  3HUS C;  1L0N K;  3U59 A;  2NPS B;  3M0A A;  2KOG A;  3RK2 D;  1NO4 A;  1L4A B;  2XNX A;  1RE3 C;  3I5C A;  2WPQ A;  1HVV A;  1OWA A;  3L36 A;  1NTK K;  4JF7 A;  5CCH C;  1LTJ A;  1N7L A;  2O01 H;  2OYI A;  3RK3 C;  1S9K D;  2KB7 P;  1GK4 A;  1GL2 D;  2HOD A;  4C7R A;  3HTK A;  1RY3 A;  5CCG A;  1X79 B;  3M06 A;  4I1L A;  1SFC B;  1G1J A;  4LLH A;  2KP8 A;  2ZXE B;  2M8R A;  5CCG C;  3C9I A;  1HJB A;  1SVF A;  4C7N A;  2FYU K;  3UIA A;  2GM4 A;  3V4Q A;  3BAS A;  1LTA C;  1GU4 A;  2HFE D;  2WSE H;  1GDT A;  5AW2 B;  1CI6 A;  1JY2 P;  3RK2 C;  2N9B A;  2YO3 A;  1JTH B;  1L4A D;  4GKG A;  1AFO A;  1GL2 A;  3P8C D;  1SLQ A;  3V5B A;  1L0L K;  2I1J A;  4Y99 C;  1J1D B;  2HG5 D;  3M91 A;  2N1T B;  2YNY A;  2Z5H A;  4EOT A;  1ZR4 A;  1VDF A;  1W2E A;  2C0W A;  5AVT B;  1GD2 E;  4W7Z A;  4XA4 A;  2W6A A;  1J2J B;  1HTL C;  1G2C A;  2Q5U A;  4O9B A;  3V2N A;  1N73 B;  3B8E B;  1ZR2 A;  3BRT B;  3L35 A;  1ZLL A;  2HPC B;  3TYY A;  2IFN A;  2JJL A;  1L4A A;  2C9L Y;  2A45 G;  2WPS A;  2XDJ A;  1L4A C;  3LW5 H;  3VN0 A;  2MJZ A;  2HYN A;  4EIJ A;  1ZV8 A;  4N3Y B;  3H32 A;  5BU5 A;  1SQB K;  3HE5 A;  3TNU B;  4ZKP A;  3GHG A;  5APT A;  3E1I A;  3B5N B;  1RE4 A;  2R5D A;  5APV A;  3WMM 0;  3VMZ A;  1GZL A;  4I6M C;  3NFQ A;  1GK6 A;  3A3Y B;  1SQX K;  1RE4 C;  4JYB A;  2WSC H;  3MUD A;  1YTZ I;  5AW0 B;  1FZG A;  1IC2 A;  3N7N A;  3IFM A;  3M9B A;  3RL0 B;  3BVH A;  1FOS F;  3EQ2 A;  1J1E B;  1SQV K;  2ZFC A;  4M3L A;  1CZQ A;  2Q7C A;  2N1T C;  1M1J B;  5CCH A;  3B5N D;  2WTY A;  3CL3 D;  1CSB A;  3KYQ A;  3VMX A;  1S9K E;  3NTN A;  1FZC A;  2FXM A;  2XKM A;  5KLV K;  1A02 F;  1IFM A;  4LGD E;  1E5W A;  5AW1 B;  2HPC A;  1N73 C;  1FBM A;  4WY4 D;  3VYI A;  1GW3 A;  1LWU B;  3V4W A;  3A7O A;  1FZC C;  1T3J A;  2P7J A;  3MTU E;  1RF0 A;  2OAR A;  2E43 A;  2WWW A;  2PAJ A;  2C9N Y;  1JY3 N;  1MZ9 A;  2QM8 A;  5AVV B;  1RF0 C;  1KIL B;  3HE4 B;  1N7S D;  1RF1 B;  1WRG A;  1IFD A;  1PFI A;  3P8M C;  2WT7 A;  1HH0 A;  2FFD B;  3OA7 A;  3HD7 B;  4I2L C;  2CPS A;  2LKM A;  3KDP B;  5KJ7 D;  4DOJ A;  1CW5 A;  1ZN5 A;  2NPS D;  1T2K D;  4GT1 A;  4WY4 A;  1JOC A;  3B5N C;  2W6B A;  3SWF A;  3BRV B;  2YKP A;  1DH3 A;  4XE5 B;  1NHL A;  3TK1 A;  2H8P D;  4WY4 C;  5CJ0 A;  3VMY A;  3R2P A;  1URQ B;  4WB4 A;  5CJ4 A;  2YKQ A;  1NKN A;  3KQG A;  1DEB A;  1N7S A;  2IX7 C;  2IPP A;  1KZU B;  3H6P A;  4DZO A;  4IFF A;  1N7S C;  1SFC D;  1KIL D;  5APW A;  5KJ7 A;  1LGH B;  3IR9 A;  2OYH A;  2C0X A;  1IO4 A;  2WZ7 A;  2NPS A;  5KJ7 C;  2OYH C;  2KYV A;  5AVR B;  1JY2 N;  2M3B A;  2Q3I A;  2WSF H;  1SQP K;  1NKZ B;  2NPS C;  1T2K C;  2PP6 A;  5AVX B;  2YO2 A;  1M1J C;  1JNM A;  2JEE A;  4HYT B;  3U1A A;  1IFN A;  3M9Q A;  2P67 A;  3CLQ A;  3G3Z A;  1JO5 A;  1GTW A;  3HRN A;  3RK3 B;  1LWU C;  4WBA A;  1SFC A;  4AQR D;  1FU1 A;  1LTJ B;  1KIL A;  1Z56 A;  5APS A;  2OYI B;  2N1T D;  1RF1 A;  1MFZ A;  2WIT A;  1JMM A;  2HOD B;  2A45 I;  1SFC C;  5BVZ A;  2CPB A;  5AW3 B;  3HTK B;  2R3C A;  3PP5 A;  1KIL C;  1LT9 B;  4KHX A;  1RF1 C;  3MGN A;  4C7N B;  3MD0 A;  1T3U A;  3P7K A;  1FZF A;  1QL2 A;  1IK9 A;  1JTH A;  3RK2 B;  1IFJ A;  3BAT A;  3A2A A;  3MIW A;  3VOP A;  4N78 D;  1CI6 B;  4C46 A;  5AVZ B;  3II6 A;  1SQQ K;  1N86 A;  2N1T A;  1GL2 B;  1J1D C;  3NMD A;  1FJP A;  5AVW B;  5CHX A;  1AQ5 A;  1H88 A;  2J58 A;  1N73 A;  4JYC A;  3NXS A;  3CI9 A;  2XV5 A;  1GU5 A;  2YMY A;  1MV8 A;  2KSJ A;  5AW6 B;  3U1C A;  3EFG A;  3V2P A;  3T97 A;  1NWQ A;  1QL1 A;  1FZA A;  1JY3 O;  1G2C B;  3M9H A;  2H43 A;  2P1J A;  5AW4 B;  1NAF A;  2O1J A;  1DX7 A;  4N6J A;  2XU6 A;  4W7Y A;  3A5T A;  5APY A;  3OJA B;  5CMZ A;  4IFD K;  1KFM A;  5AVS B;  3RL0 D;  2J59 M;  3TNU A;  1NTZ K;  2I1K A;  3OAK A;  1NOH A;  1NU1 K;  3B5N A;  5AW8 B;  1XTG B;  1HBW A;  1FJK A;  3H32 B;  3KPE A;  1M7L A;  3HE5 B;  2Z5I A;  1LTJ C;  3TSI A;  3P8C E;  1FDM A;  1LT9 A;  2R5B A;  2OYI C;  5APU A;  1YTZ T;  3V2R A;  3GHG B;  1JCC A;  2VRS A;  1VPC A;  1XTC C;  1LT9 C;  1EQ7 A;  2KLV A;  4RES B;  1WT6 A;  1HGV A;  4GIF A;  1A02 J;  1N2D C;  2IFM A;  2BAS A;  5APQ A;  2O1K A;  4IFM A;  4HH2 A;  3V2Q A;  1JCD A;  3RL0 C;  1G1I A;  1NTM K;  1JY2 O;  1JUN A;  4ZKU A;  1J1E C;  5AW7 B;  1M1J A;  3HD7 D;  3HUS B;  2QM7 A;  1GL2 C;  3VP9 A;  5AW9 B;  3P32 A;  1LTG C;  5KTB A;  2FKW B;  4LC1 A;  2Q9I A;  2L5G B;  1LWU A;  3L4F A;  1HUC A;  5AW5 B;  1OXZ A;  3M0D A;  2GUS A;  3LID A;  1FZC B;  1IJD B;  1LTS C;  1URQ D;  3O8Z A;  2R32 A;  3HE4 A;  3M0D C;  2YKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...