3HD7B

Helical extension of the neuronal snare complex into the membrane, spacegroup c 1 2 1
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
98
structure length
98
Chain Sequence
KQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Exocytosis
molecule keywords Vesicle-associated membrane protein 2
publication title Helical extension of the neuronal SNARE complex into the membrane
pubmed doi rcsb
source organism Rattus norvegicus
total genus 42
structure length 98
sequence length 98
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05739 SNARE SNARE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3hd7B00
2HFED 2WZ7A 4LGDE 2HG5D 3RK3B 1N7SA 3KYQA 2N1TC 1KILC 3RK2C 2N1TB 1KILB 1URQD 3RK2B 1NHLA 1N7SC 1SFCD 1JTHA 1N7SB 4N78E 2NPSA 3HTKB 4W80A 3RK3D 1L4AA 4WY4A 5CCHD 4W7YA 1JTHB 2NPSC 2NPSB 2N1TD 5CCGD 5KJ7A 1L4AC 4WY4C 1L4AB 3B5NA 1N7SD 4WY4B 1T3JA 3PP5A 2H8PD 3VOPA 5KJ7C 3HD7A 1XTGB 1GL2A 3B5NC 4JF7A 1URQC 4OH8B 3B5NB 3RL0C 3M0DC 1SFCC 2NPSD 3RL0B 5CCHA 3HD7C 1KILD 3TSIA 3RK2D 3HD7B 1L4AD 1GL2C 2YMYA 2XDJA 4WY4D 1GL2B 2M8RA 1URQA 5CCHC 2KOGA 1SFCA 5KJ7D 1HVVA 5CCGC 4W7ZA 2PP6A 3B5ND 1URQB 3RL0D 1SFCB 3HD7D 3P8CE 2N1TA 5CCGA 1KILA 1GL2D 3RK3C
chains in the Genus database with same CATH superfamily
1IC2A 1Q81Q 4KHXA 1RE3C 3M9BA 2HODB 2P2UA 2W6AA 3PRJA 3H1LJ 3C8VA 3CC2P 2E76D 3IR9A 3HE5B 2B88A 4Y99C 2Z5HA 2KS1B 2GM4A 5CHXA 4WBAA 3L71E 1NTKK 4JYCA 2IBZE 1SQBK 4PD4E 1N7SD 3PP5A 3BRVB 1AJYA 3VN0A 1JY2O 3TGUD 2AEJA 2OYIB 1Z56A 3H1HD 3AEDC 2WT7A 2XNDH 2Q3IA 4EDFA 1YJNP 4KT0J 2NRGA 5EFWB 2WSEJ 1R8EA 2G8YA 1AVYA 3CXHI 2OYHA 2E75B 1GL2B 1JMMA 1X79B 4GOFA 1L0NG 1BE3J 5CJ0A 1SQBE 5KJ7D 3H32B 2JP3A 1DH3A 1IFPA 2M3EA 3CCMP 1ZV8A 3U59A 1RQVA 2PP6A 2WQYC 2JWDA 3R2PA 3E1RA 2R5BA 2ZYGA 4B86A 1P84H 2P58A 3P8CE 3GHGA 3L73E 2J5UA 5AW5B 2E76B 5DJUB 3SWYA 3WUTA 1PZQA 4HH2A 1U57A 1LTAC 4DT0A 5KLVD 4ZMDA 4AUWA 2FYUD 1SQXG 3L70E 2ZXEB 3RBZA 3OJAB 1N7SB 1JNMA 5AW4B 1YTZI 5AW9B 1Y8AA 5CJ4A 1BCCJ 5B66E 2Q5UA 2YXQB 5AVZB 1ZLLA 1FS0E 3A5TA 2WPVB 1SQQD 1RF0C 3L75G 2A06D 3V5BA 2OYIC 5KAFH 2V7QJ 5APYA 3CCLP 4IFFA 4K3AA 4JF7A 1FAVA 5CCHA 1Y47A 2E75C 1GL2C 3SWFA 1PGOA 2ZAEB 3Q2YA 1UIXA 2XU6A 2ITAA 2WSEH 3GHGC 5APTA 2YXRB 1OVUA 2K37A 1RE4A 2PAJA 4W7ZA 3LW5H 1OVVA 2R3CA 2OGUA 4GOEA 5CCGA 2E76C 1KB9I 2O1KA 3HTKA 3M0AA 3MGNA 3H1ID 1CI6A 1NU1D 2E43A 1N7SC 5BU8B 5B5EH 1YJWP 3H1LG 3L72E 1W2EA 1T3UA 4WY4A 3H1JJ 1KORA 3BCCE 3EQ2A 2Y0EA 2O01N 3VMAA 1OVRA 1J1EB 3AEEC 2W27A 1AA0A 4D6TD 1EZVE 2KSEA 1KD1Q 4BWNA 1FOSE 1JUNA 1YI2P 1K04A 1P84E 2I1KA 5KJ7C 2I1JA 2QRXA 4H0LD 1EDJA 1KFNA 1Q2NA 3M0DC 3CCUP 4EIJA 1KILD 3B8EB 3VP8A 3HE4B 2V7QH 4TT3H 1RE4C 1PIXA 4ASVA 2XDJA 3AE8C 4WWIA 2HPCA 4ASWA 2IDBA 1YQ3C 1BE3G 1EDIA 2IBZI 4PD4I 5CCGC 1NJIQ 2LXBA 2KXPB 2B9BA 2YMKA 1VQ8P 5KAIE 3L71J 1H88A 1OIPA 3FX0A 3WU2H 4I2LC 5AW3B 2HLOA 3KQGA 4YXDC 2KNCA 3RK2B 1WMKA 1EQ7A 1BSHA 2M5AA 1DEEG 2Q7CA 1A02F 3RK3D 1L0LD 4H0LB 1BCCG 1NTKJ 3CL3D 1SQBJ 1YTZT 3LIEA 3EFGA 1KQFB 4O9BA 2YKPA 2WPSA 3L73J 2C9NY 1JY2N 4OVNF 1K05A 2KZJA 1KMIZ 2XKMA 4ZKPA 1JY3P 2FYNB 1RF1A 2QJKB 2GA1A 2XZRA 4U3FJ 1VL2A 1XTCC 3TGUE 3QWOC 3L70J 1JO5A 4L76A 1FJPA 1VQ7P 1PPJD 3H1HE 3U1CA 1L0ND 1NTZK 5AW8B 1NYHA 2A45I 1M57D 1JCCA 2W6JH 3FXDA 1DX7A 4YTPC 3AEBC 2FYUK 1M1KQ 1FZCB 3L37A 4GKGA 2HFED 1M7LA 3CX5E 1VQNP 3RK3B 4N78D 1QX8A 3I56P 2M0BA 5APUA 3MIWA 3CMAP 3RK2C 1RY3A 1CSBA 1SQXD 3TNUA 3T97A 3VMYA 3A2AA 2QM7A 1SLQA 5KLVE 4H0LC 2FYUE 1U7MA 3VMZA 3G6EP 3H1JG 4KJMA 2N1TD 3QH9A 2KP8A 1KN7A 1LTJB 1SQPK 2H8PD 2O1JA 2Y0CA 1RF1C 3L75D 1G2CB 4IFDK 1VF5D 1A02J 3KZIE 2FYNC 2QJKC 1MZ9A 4H44D 1SQQE 3PLNA 2R32A 2A06E 2WSFJ 1VQPP 1LGHB 3M9QA 2QJPC 1M1JA 1UIIA 4PJ0H 5K5GB 4HKZH 1EZVI 5TJHA 1BDCA 1SQPE 3V6IA 4R4LA 1P84I 3MZWB 1FZCC 2L5GB 1LP1A 5DJTB 2IBZG 3RK3C 5B66H 1D7MA 2WZ7A 3USSA 1OWAA 4JQ0D 2P10A 2JWAA 5CBOA 3AE2C 5AVQB 2N1TB 4BRYB 1EDKA 1RQUA 2WSSH 1VQ9P 4YXWH 3MUDA 1FC2C 3H1LD 1PGJA 2P1JA 1S4XA 2E42A 1ZR2A 1VF5B 1LT9A 1NU1E 1NTKG 2CPSA 4XE5B 1MKMA 1SQBG 4H44B 3R4YA 1GDTA 2CPBA 1LTJC 1W2BO 1HTLC 4EYYQ 1S5LX 3FWLA 3A0BH 3D71A 1GK4A 2JO1A 3L73G 4IL6X 4D6TE 2AXCA 1VQLP 1M1JC 4C7NA 2K9JA 4U3FG 3TSIA 3N4XA 2OTJP 4NPEA 1IK7A 3VP9A 1Q7YQ 1QEXA 1YJ9P 1URQA 2HODA 4IOIH 2WT7B 3L35A 1CW5A 1IFNA 1USEA 1BE3D 1GW3A 1KILE 2WSFH 1JY3N 2OYHB 3CXHD 1T8ZA 3W68A 2QEXP 3V2RA 1RH5B 2ZFCA 3LW5J 5KTBA 1LWUA 1S3JA 1N73A 2A45G 5GTHE 2E5TA 2R5DA 2POHA 3PJSK 5AVYB 4GT1A 1PP9D 3O6QA 4L75A 2N1TC 1L0LK 3GHGB 1LTGC 4WVZA 3Q5PA 4MN4C 3OW2O 4RKUJ 3TGUJ 3A0HE 1VF5C 1AQTA 1BCCD 3AEGC 4PJ0E 4H44C 3FWNA 3NFQA 3H1KE 5L8RJ 3O8ZA 5CCGD 3CX5I 4OGQC 2MJZA 1L0LE 1QL2A 1VQ4P 2QSIA 1ZN5A 1JY2P 3GMAA 1SQVD 1L0NK 3CWBD 1URQC 2IFNA 4WB4A 3P8MC 1QVGO 5KAIH 3RGUA 1NAFA 1K8AQ 2NZ2A 3KHUA 1Q86Q 1NTZJ 2R3SA 1NKNA 4WY4D 2KB7P 1FZBA 2QIWA 2KIKA 2RN0A 5KLVJ 3VTPC 2OYHC 2FYUJ 4R4MA 1N73C 1IK9A 3Q5RA 3RL0D 1PPJE 2P67A 3H6PA 2CK3H 2KSJA 1L0NE 3WUUA 3FXEA 1U7JA 1EZVG 3A0BE 1M8OB 1CZQA 3VYIA 5M1BA 3SFEC 3GG2A 1JB0J 1BGYG 1IO4A 1NHLA 3MHVA 1AV1A 4XFJA 4ZKUA 4N78E 1JOCA 1KB9D 2NPSA 3HTKB 3CCEP 1LNQA 1OW6A 4W80A 4HB1A 1CI6B 3TK1A 2IZ1A 1L4AA 1GU4A 1GW4A 1SQXE 3SFDC 3H1JD 3FGAD 2FKWB 1SQPJ 2D2CD 1X9VA 2AXTE 4WY4B 3CCRP 1QVFO 2B87A 1S2EA 3HD7A 2BCCD 3JC22 1Q90D 3RL0B 3PTZA 1EDLA 3A3YB 1KC8Q 1VPCA 3RK2D 2M3BA 1NTMK 3C1LA 3CX5H 1PGPA 1DD3A 3EWKA 4JPZB 2Y9ZA 5CCHC 1ZP0C 1K73Q 3H25A 1NU1J 2PRRA 2GUVA 1Y9BA 3G71P 2HPCB 1FJKA 3M06A 5AVSB 2KZIA 3L74E 3CCQP 1VQ5P 3S4RA 4JBZA 2IBZD 4H13B 4PD4D 2PGDA 1NTME 3PH0A 2YKOA 3ITKA 3UIAA 1DIPA 1GZLA 2LKMA 1GTWA 2FY8A 2WSCH 4N6JA 2KLUA 4D6TJ 2AEFA 2D2CB 5AW7B 2BEQD 2K1AA 3CLQA 1KYOE 3TGUG 2JDIH 3KZIH 1N2DC 2KNCB 1HUCA 3CCJP 3NMDA 1NTKD 3U1AA 3K5BA 1SQBD 1ZRTD 2M5AB 3H1LE 3HUSA 3M91A 4WY4C 3B5NA 3KXDA 4AYCA 5E79E 1JCDA 3CCVP 1OXZA 3P8CD 4YPCA 1M56D 2FFDA 4QMAA 5KKZB 3RL0C 2H43A 2SPZA 4U3FD 4UB8E 3GW6A 1VDFA 3M9HA 2YMYA 1NTZG 1MV8A 1RF1B 1SFCA 2H88C 4JYBA 5APWA 3V4QA 5H2FE 1MFTA 2FYUG 5AVTB 3H1KJ 4HJGH 2FXOA 2N9YB 1BE3E 4H13C 1KILA 3AEAC 4IFMA 2Z4EA 1FOSF 2WPRA 2OYOA 1L0LJ 1S5LE 2R44A 1H0TA 2QJPB 5BVZA 3F5HA 3CXHE 3AE1C 3CPWO 3AEFC 3Q3DA 1AQ5A 4IL6E 2HYNA 5AW2B 2D2CC 1T6AA 4U7JA 3RBXA 5KLVK 3SWKA 5AVRB 1PP9E 1H8AA 3TNUB 1HGZA 3T97B 4K35A 1NAYA 5AVUB 1SQVK 1SQPG 3CD6P 5GTIE 1MUUA 2YO2A 3SSUA 1BCCE 1L0NJ 1YQ4C 3I5CA 3B71A 2YO3A 3D70A 3L36A 3AE6C 1SQQK 5KKZC 1SVFA 1XTGB 5APVA 3CI9A 4OWFA 1G1IA 4C7RA 1SFCC 1S9KD 3N7NA 5GTHH 1IZNB 2M8RA 1E5WA 1SQVE 3CWBE 2KOGA 3V2NA 1KQLA 3E1IA 5AVWB 2O3JA 2JKVA 1BDDA 1M1JB 3A0HH 2Q9IA 2YIUB 4OGQD 1JEKA 1EZVD 2HG5D 1RE3A 2KYVA 4UB6E 2ZXXA 3V2PA 3L72J 1P84D 1LP1B 3BCCJ 1BGYD 3AECC 1URQD 1JTHA 2DW3A 1NU1K 3KPEA 3JCUE 1JM0A 2JJLA 5TISE 2YKQA 3L71G 2IX7C 2K3RA 2C9LY 2OTLP 1KB9E 4DOJA 1KTMA 3HRNA 1WT6A 4RJTA 1LT9B 3L74J 3H1JE 3H1IE 4LLHA 2OQQA 4LC1A 1N8RQ 1NTMJ 2HR3A 1GD2E 1KYOI 4RO0A 4N3YB 1VQOP 1J1DB 1LTIC 2IZ0A 1QGKB 1N7LA 2WITA 4OGQB 1HWTC 2BCCE 1LTTC 1ZOYC 3Q5SA 4C7NB 2K9JB 2Q3EA 1USDA 1R5LA 2MKVA 3L4FA 1VQMP 3II6A 1T2KD 2RH0A 1URQB 3H1KG 2YIUC 1MFZA 1YITP 2FBWC 1TU3F 1X0TA 3L70G 2ZVNB 3BATA 1L0LG 1Q82Q 2WMMA 2AEMA 2G3AA 4GIFA 3G3ZA 3WMM0 3HE5A 2AXTH 1IFMA 1LWUB 1NO4A 1W5CE 1N73B 2KS1A 3CCSP 2FXPA 1YHQP 2H7HA 3F89A 1KQGB 4PV1D 5AVXB 3O6QB 1AVOA 2ZYDA 1NVOA 2IYPA 2XNXA 3OAKA 1PV3A 1PFIA 5CCHD 3MUDC 1RF0A 2QE7H 4NPDA 2W90A 2OYIA 2WPQA 1LT9C 5CBNA 1OMIA 4AQRD 4L74A 3B4SA 1PPJG 3VOPA 1NTKE 1ZRTE 3H1HJ 1E79H 2YNYA 3V4WA 4XA4A 1GL2A 2O01J 1HBWA 3CX5D 1ZW0A 4CPGA 1J1DC 2NPSD 2W83C 3H32A 1DD4A 1L4AD 1X8YA 3RK3E 1YYCA 1NTZD 2QM8A 2E74D 2Y0DA 1PP9J 4U3FE 3BASA 5AVVB 4HYTB 1HJ0A 2LR2A 1ZR4A 3A7OA 1KYOH 3HD7D 4PV1B 1ZMEC 2FYZA 2W8ZA 3S9OA 2BEZF 1EXIA 2L91A 4TLFA 1N7SA 3KYQA 1IFDA 3L72G 4GDOA 1LWUC 1OW7A 3BCCG 2Z5IA 5E79H 1HH0A 2IFMA 1SQXK 2WSCJ 1SQVJ 3CWBJ 3BRTB 3Q1MA 1ZXGA 2WWWA 1KFMA 4W7YA 5APXA 4UB8H 1X22A 5C39A 2NPSB 5KJ7A 1SQPD 2ZT9D 5APSA 4Z1MH 3IF4A 1SQQJ 4C46A 1KQSO 1GMJA 1L4AB 1K9MQ 3M0DA 2E74B 3L74G 5H2FH 4H13D 2K88A 1PL5A 2I8DA 3C9IA 3MTUE 1T2KC 3TYYA 1R5SA 5AW6B 1NTMG 1FDMA 3I55P 3PHLA 2Q1KA 2B87B 2QJYB 3NXSA 3HD7B 1NOHA 1OX3A 1IFJA 1S5LH 2O01H 3MP7B 2JEEA 1VQ6P 3CXHH 2RKLA 2FXMA 2KLVA 4IL6H 4EI2A 1WRGA 1S9KE 3CC7P 1HVVA 2N9BA 3ZDMA 2XV5A 3B5ND 3BVHA 4PV1C 3L75E 1EC5A 1EXJA 3KDPB 3P32A 4LGDE 2P7JA 3H1IJ 2K9YA 5GTIH 2ZT9B 4L73A 1N86A 1AFOA 1SFCD 5AW1B 2LXCB 3L71D 1NKZB 2BCCJ 4I1LA 1BGYE 1OZHA 1S72P 2NPSC 3AE7C 1L4AC 2B89A 1L2PA 1FU1A 2E74C 3JSVC 5AW0B 1IFIA 3G4SP 2J58A 3HE4A 2QG4A 1NGMB 3RL0g 3HUSB 1JY3O 3H1HG 1GK6A 3B5NB 2QA4P 2VRSA 2QJYC 3HD7C 3GF3A 3WUVA 2KK7A 2E5YA 2FFDB 4UB6H 2OTKE 4ZNCA 1PP9G 3L73D 5KAFE 2J59M 3W67A 3MD0A 2OARA 1KV4A 1G1JA 3JCUH 3D6ZA 5TISH 1SFCB 3H1KD 2H89C 1FBMA 3L70D 3AE4C 1H89A 1KB9H 1J1EC 5KLVG 2ZT9C 3LIDA 3P7KA 1HGVA 1KILB 1H0TB 5BU5A 2BASA 1SS1A 3IN6A 3TDKA 1HF9A 3G9RA 4A7PA 3AE9C 1SQVG 3IFMA 3CWBG 1LJ2A 2QVAA 1PGQA 1HJBA 1FZFA 1SQQG 4EOTA 2A06G 5B5EE 3EFFK 3HUSC 3AE5C 4GODA 1GU5A 4I7ZB 4DCKA 3B5NC 5APQA 2PFXA 3OA7A 3TF5A 2FFDC 5KLIB 1YIJP 1LT1A 1FDIA 1FZCA 3V2QA 4DZOA 1LTSC 2V4HA 4PD4H 1DEBA 1NTZE 1JMBA 1FDOA 4Y28J 3GF7A 3H1IG 3VMXA 3L72D 1KILC 3S1KA 1RHZB 1NU1G 1SQXJ 3IAOA 3BCCD 1FZEA 3CMEP 2ZVOB 2KUBA 4NPFX 3E7KA 4M3LA 2JR8A 3GLMA 3CC4P 2C0XA 2WTYA 2BCCG 3WU2E 1OFCX 1LTJA 1IJDB 1NWQA 2IPPA 1YBKA 4Y99B 1G2CA 1JTHB 1M90Q 1LTBC 4I6MC 2C0WA 1QLED 1FZGA 4D6TG 3NTNA 2WVRA 1FE6A 3ABVC 3L75J 1T3JA 3L74D 4I7ZC 4RESB 4DJGA 1S1CX 3AE3C 4OH8B 1NTMD 2W6BA 5KLIC 2KI7B 2IYOA 3D6YA 2UWJE 5CMZA 1KYOD 2ZJSE 1QL1A 1FZAA 1J2JB 1BGYJ 1BSNA 2Y9YA 1SP4A 2A45H 2RMZA 1NH4A 1VQKP 2ZYAA 1KZUB 1OW8A 2GUSA 4BXLA 2N1TA 2E75D 4BRYA 1GL2D 2Q6QA
chains in the Genus database with same CATH topology
2HFED 1M7LA 1IC2A 3RK3B 4N78D 1N7SA 3KYQA 2YKOA 3UIAA 1IFDA 1GZLA 2LKMA 5APUA 3MIWA 1GTWA 3RK2C 2WSCH 1LWUC 1RY3A 4N6JA 4KHXA 1RE3C 3M9BA 2HODB 1CSBA 5AW7B 2P2UA 3TNUA 2Z5IA 2W6AA 3T97A 3VMYA 1HH0A 2IFMA 3A2AA 2QM7A 1SQXK 3CLQA 1SLQA 3IR9A 1N2DC 3HE5B 4Y99C 3BRTB 3VMZA 1HUCA 2WWWA 1KFMA 2Z5HA 4W7YA 3NMDA 2GM4A 5APXA 5CHXA 3U1AA 2NPSB 2N1TD 5KJ7A 3HUSA 4WBAA 5APSA 1NTKK 3M91A 4JYCA 1SQBK 4WY4C 4C46A 1L4AB 2KP8A 1N7SD 3B5NA 1LTJB 3PP5A 1SQPK 2H8PD 3BRVB 2O1JA 1RF1C 3M0DA 1G2CB 4AYCA 3VN0A 1JCDA 1JY2O 1OXZA 3P8CD 4IFDK 2OYIB 1Z56A 1A02J 2FFDA 3C9IA 3MTUE 1T2KC 3TYYA 2WT7A 5AW6B 3RL0C 1MZ9A 1FDMA 2Q3IA 2R32A 2H43A 3NXSA 3HD7B 1NOHA 1IFJA 1LGHB 3M9QA 2OYHA 1VDFA 3M9HA 2YMYA 2O01H 1MV8A 1GL2B 2JEEA 1JMMA 1X79B 1M1JA 2FXMA 1RF1B 1SFCA 5CJ0A 2KLVA 4JYBA 1WRGA 3H32B 5KJ7D 1S9KE 1DH3A 1HVVA 5APWA 3V4QA 2N9BA 1ZV8A 3U59A 2PP6A 2XV5A 3B5ND 3BVHA 3R2PA 5AVTB 2R5BA 4B86A 1FZCC 2L5GB 3P8CE 3GHGA 3KDPB 1KILA 3P32A 4IFMA 5AW5B 2Z4EA 3RK3C 2WPRA 1FOSF 2WZ7A 4LGDE 2P7JA 3SWYA 1OWAA 5BVZA 4HH2A 1LTAC 1AQ5A 2HYNA 5AW2B 5AVQB 4AUWA 2N1TB 1N86A 2ZXEB 5KLVK 1AFOA 1SFCD 3OJAB 1N7SB 3MUDA 5AVRB 5AW1B 1JNMA 2P1JA 5AW4B 1YTZI 5AW9B 2E42A 1ZR2A 1NKZB 5CJ4A 1H8AA 1LT9A 4I1LA 2Q5UA 3TNUB 1HGZA 2CPSA 2NPSC 4XE5B 5AVUB 1GDTA 1SQVK 5AVZB 2CPBA 1ZLLA 1L4AC 1LTJC 3A5TA 1MUUA 2YO2A 1FU1A 1HTLC 1RF0C 3V5BA 3I5CA 5AW0B 2YO3A 1IFIA 2OYIC 1GK4A 3L36A 2J58A 3HE4A 1SQQK 5APYA 3HUSB 1SVFA 4IFFA 1JY3O 1XTGB 1GK6A 4JF7A 1FAVA 5APVA 3B5NB 3CI9A 1M1JC 1G1IA 2VRSA 4C7RA 4C7NA 1SFCC 5CCHA 3HD7C 1S9KD 3TSIA 3N4XA 3N7NA 1GL2C 3VP9A 3SWFA 2FFDB 1URQA 2HODA 2M8RA 1E5WA 2WT7B 3L35A 2KOGA 2XU6A 1CW5A 1IFNA 3V2NA 2WSEH 1KQLA 3E1IA 3GHGC 1GW3A 5APTA 2WSFH 2J59M 5AVWB 1RE4A 2PAJA 4W7ZA 1JY3N 3MD0A 2OYHB 2OARA 3LW5H 1G1JA 1T8ZA 2R3CA 1M1JB 1SFCB 3V2RA 2Q9IA 5CCGA 2ZFCA 5KTBA 1FBMA 1LWUA 1N73A 2A45G 2HG5D 1RE3A 2KYVA 2R5DA 2POHA 5AVYB 4GT1A 2O1KA 3V2PA 1H89A 3HTKA 3M0AA 3MGNA 1J1EC 2N1TC 1CI6A 1L0LK 3GHGB 3LIDA 3P7KA 1HGVA 1KILB 1LTGC 1URQD 2E43A 1N7SC 5BU8B 5BU5A 1JTHA 2BASA 1NU1K 3KPEA 2JJLA 2YKQA 1W2EA 1T3UA 2IX7C 4WY4A 3EQ2A 3IFMA 2C9LY 3NFQA 1J1EB 3O8ZA 5CCGD 2W27A 4DOJA 1HJBA 3HRNA 1WT6A 1FZFA 1LT9B 2MJZA 1FOSE 1QL2A 4EOTA 1ZN5A 1JUNA 2I1KA 5KJ7C 4LLHA 3HUSC 4LC1A 2I1JA 1GU5A 1JY2P 3B5NC 5APQA 1L0NK 1GD2E 1URQC 1KFNA 2IFNA 3M0DC 4WB4A 3P8MC 4N3YB 3OA7A 4EIJA 1J1DB 1KILD 1NAFA 1LTIC 3B8EB 3VP8A 3HE4B 2FFDC 1RE4C 1N7LA 2WITA 1NKNA 2XDJA 4WY4D 1HWTC 2KB7P 1LTTC 2HPCA 1FZBA 4C7NB 1FZCA 3VTPC 3V2QA 3L4FA 5CCGC 2OYHC 4DZOA 1LTSC 3II6A 1T2KD 1N73C 1IK9A 1DEBA 1URQB 3RL0D 2P67A 3H6PA 2KSJA 1MFZA 1H88A 3BATA 4I2LC 5AW3B 2HLOA 3KQGA 3VMXA 1CZQA 1KILC 3VYIA 4GIFA 3G3ZA 3WMM0 3HE5A 3RK2B 1IFMA 1LWUB 1FZEA 1NO4A 1IO4A 1NHLA 1N73B 1EQ7A 2H7HA 4ZKUA 4N78E 1JOCA 5AVXB 2NPSA 3HTKB 4M3LA 4W80A 1CI6B 3TK1A 2C0XA 2XNXA 2Q7CA 1A02F 3OAKA 3RK3D 1L4AA 2WTYA 1GU4A 1GW4A 1LTJA 1IJDB 1NWQA 1PFIA 2IPPA 5CCHD 3CL3D 4Y99B 2FKWB 1G2CA 1JTHB 1RF0A 1YTZT 1LTBC 3LIEA 4I6MC 2C0WA 1FZGA 2OYIA 3EFGA 2WPQA 1LT9C 3NTNA 1X9VA 4AQRD 4WY4B 1T3JA 4O9BA 2YKPA 3VOPA 2WPSA 3HD7A 2C9NY 1JY2N 4RESB 3V4WA 2YNYA 4XA4A 1GL2A 1HBWA 2XKMA 4ZKPA 4OH8B 1JY3P 1RF1A 2W6BA 1J1DC 2NPSD 2XZRA 3RL0B 3H32A 3A3YB 1VPCA 1XTCC 2M3BA 1NTMK 3RK2D 1L4AD 1X8YA 1JO5A 1FJPA 1YYCA 2QM8A 3U1CA 5CCHC 5CMZA 1NTZK 5AW8B 1QL1A 1FZAA 2A45I 3BASA 4HYTB 1J2JB 1JCCA 5AVVB 2GUVA 1DX7A 1SP4A 2A45H 1ZR4A 1NH4A 2HPCB 3A7OA 1FJKA 2FYUK 3HD7D 3M06A 5AVSB 1FZCB 2FYZA 3L37A 1KZUB 2GUSA 4GKGA 2N1TA 1GL2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFE D;  2WZ7 A;  4LGD E;  2HG5 D;  3RK3 B;  1N7S A;  3KYQ A;  2N1T C;  1KIL C;  3RK2 C;  2N1T B;  1KIL B;  1URQ D;  3RK2 B;  1NHL A;  1N7S C;  1SFC D;  1JTH A;  1N7S B;  4N78 E;  2NPS A;  3HTK B;  4W80 A;  3RK3 D;  1L4A A;  4WY4 A;  5CCH D;  4W7Y A;  1JTH B;  2NPS C;  2NPS B;  2N1T D;  5CCG D;  5KJ7 A;  1L4A C;  4WY4 C;  1L4A B;  3B5N A;  1N7S D;  4WY4 B;  1T3J A;  3PP5 A;  2H8P D;  3VOP A;  5KJ7 C;  3HD7 A;  1XTG B;  1GL2 A;  3B5N C;  4JF7 A;  1URQ C;  4OH8 B;  3B5N B;  3RL0 C;  3M0D C;  1SFC C;  2NPS D;  3RL0 B;  5CCH A;  3HD7 C;  1KIL D;  3TSI A;  3RK2 D;  3HD7 B;  1L4A D;  1GL2 C;  2YMY A;  2XDJ A;  4WY4 D;  1GL2 B;  2M8R A;  1URQ A;  5CCH C;  2KOG A;  1SFC A;  5KJ7 D;  1HVV A;  5CCG C;  4W7Z A;  2PP6 A;  3B5N D;  1URQ B;  3RL0 D;  1SFC B;  3HD7 D;  3P8C E;  2N1T A;  5CCG A;  1KIL A;  1GL2 D;  3RK3 C; 
#chains in the Genus database with same CATH topology
 1IC2 A;  1Q81 Q;  4KHX A;  1RE3 C;  3M9B A;  2HOD B;  2P2U A;  2W6A A;  3PRJ A;  3H1L J;  3C8V A;  3CC2 P;  2E76 D;  3IR9 A;  3HE5 B;  2B88 A;  4Y99 C;  2Z5H A;  2KS1 B;  2GM4 A;  5CHX A;  4WBA A;  3L71 E;  1NTK K;  4JYC A;  2IBZ E;  1SQB K;  4PD4 E;  1N7S D;  3PP5 A;  3BRV B;  1AJY A;  3VN0 A;  1JY2 O;  3TGU D;  2AEJ A;  2OYI B;  1Z56 A;  3H1H D;  3AED C;  2WT7 A;  2XND H;  2Q3I A;  4EDF A;  1YJN P;  4KT0 J;  2NRG A;  5EFW B;  2WSE J;  1R8E A;  2G8Y A;  1AVY A;  3CXH I;  2OYH A;  2E75 B;  1GL2 B;  1JMM A;  1X79 B;  4GOF A;  1L0N G;  1BE3 J;  5CJ0 A;  1SQB E;  5KJ7 D;  3H32 B;  2JP3 A;  1DH3 A;  1IFP A;  2M3E A;  3CCM P;  1ZV8 A;  3U59 A;  1RQV A;  2PP6 A;  2WQY C;  2JWD A;  3R2P A;  3E1R A;  2R5B A;  2ZYG A;  4B86 A;  1P84 H;  2P58 A;  3P8C E;  3GHG A;  3L73 E;  2J5U A;  5AW5 B;  2E76 B;  5DJU B;  3SWY A;  3WUT A;  1PZQ A;  4HH2 A;  1U57 A;  1LTA C;  4DT0 A;  5KLV D;  4ZMD A;  4AUW A;  2FYU D;  1SQX G;  3L70 E;  2ZXE B;  3RBZ A;  3OJA B;  1N7S B;  1JNM A;  5AW4 B;  1YTZ I;  5AW9 B;  1Y8A A;  5CJ4 A;  1BCC J;  5B66 E;  2Q5U A;  2YXQ B;  5AVZ B;  1ZLL A;  1FS0 E;  3A5T A;  2WPV B;  1SQQ D;  1RF0 C;  3L75 G;  2A06 D;  3V5B A;  2OYI C;  5KAF H;  2V7Q J;  5APY A;  3CCL P;  4IFF A;  4K3A A;  4JF7 A;  1FAV A;  5CCH A;  1Y47 A;  2E75 C;  1GL2 C;  3SWF A;  1PGO A;  2ZAE B;  3Q2Y A;  1UIX A;  2XU6 A;  2ITA A;  2WSE H;  3GHG C;  5APT A;  2YXR B;  1OVU A;  2K37 A;  1RE4 A;  2PAJ A;  4W7Z A;  3LW5 H;  1OVV A;  2R3C A;  2OGU A;  4GOE A;  5CCG A;  2E76 C;  1KB9 I;  2O1K A;  3HTK A;  3M0A A;  3MGN A;  3H1I D;  1CI6 A;  1NU1 D;  2E43 A;  1N7S C;  5BU8 B;  5B5E H;  1YJW P;  3H1L G;  3L72 E;  1W2E A;  1T3U A;  4WY4 A;  3H1J J;  1KOR A;  3BCC E;  3EQ2 A;  2Y0E A;  2O01 N;  3VMA A;  1OVR A;  1J1E B;  3AEE C;  2W27 A;  1AA0 A;  4D6T D;  1EZV E;  2KSE A;  1KD1 Q;  4BWN A;  1FOS E;  1JUN A;  1YI2 P;  1K04 A;  1P84 E;  2I1K A;  5KJ7 C;  2I1J A;  2QRX A;  4H0L D;  1EDJ A;  1KFN A;  1Q2N A;  3M0D C;  3CCU P;  4EIJ A;  1KIL D;  3B8E B;  3VP8 A;  3HE4 B;  2V7Q H;  4TT3 H;  1RE4 C;  1PIX A;  4ASV A;  2XDJ A;  3AE8 C;  4WWI A;  2HPC A;  4ASW A;  2IDB A;  1YQ3 C;  1BE3 G;  1EDI A;  2IBZ I;  4PD4 I;  5CCG C;  1NJI Q;  2LXB A;  2KXP B;  2B9B A;  2YMK A;  1VQ8 P;  5KAI E;  3L71 J;  1H88 A;  1OIP A;  3FX0 A;  3WU2 H;  4I2L C;  5AW3 B;  2HLO A;  3KQG A;  4YXD C;  2KNC A;  3RK2 B;  1WMK A;  1EQ7 A;  1BSH A;  2M5A A;  1DEE G;  2Q7C A;  1A02 F;  3RK3 D;  1L0L D;  4H0L B;  1BCC G;  1NTK J;  3CL3 D;  1SQB J;  1YTZ T;  3LIE A;  3EFG A;  1KQF B;  4O9B A;  2YKP A;  2WPS A;  3L73 J;  2C9N Y;  1JY2 N;  4OVN F;  1K05 A;  2KZJ A;  1KMI Z;  2XKM A;  4ZKP A;  1JY3 P;  2FYN B;  1RF1 A;  2QJK B;  2GA1 A;  2XZR A;  4U3F J;  1VL2 A;  1XTC C;  3TGU E;  3QWO C;  3L70 J;  1JO5 A;  4L76 A;  1FJP A;  1VQ7 P;  1PPJ D;  3H1H E;  3U1C A;  1L0N D;  1NTZ K;  5AW8 B;  1NYH A;  2A45 I;  1M57 D;  1JCC A;  2W6J H;  3FXD A;  1DX7 A;  4YTP C;  3AEB C;  2FYU K;  1M1K Q;  1FZC B;  3L37 A;  4GKG A;  2HFE D;  1M7L A;  3CX5 E;  1VQN P;  3RK3 B;  4N78 D;  1QX8 A;  3I56 P;  2M0B A;  5APU A;  3MIW A;  3CMA P;  3RK2 C;  1RY3 A;  1CSB A;  1SQX D;  3TNU A;  3T97 A;  3VMY A;  3A2A A;  2QM7 A;  1SLQ A;  5KLV E;  4H0L C;  2FYU E;  1U7M A;  3VMZ A;  3G6E P;  3H1J G;  4KJM A;  2N1T D;  3QH9 A;  2KP8 A;  1KN7 A;  1LTJ B;  1SQP K;  2H8P D;  2O1J A;  2Y0C A;  1RF1 C;  3L75 D;  1G2C B;  4IFD K;  1VF5 D;  1A02 J;  3KZI E;  2FYN C;  2QJK C;  1MZ9 A;  4H44 D;  1SQQ E;  3PLN A;  2R32 A;  2A06 E;  2WSF J;  1VQP P;  1LGH B;  3M9Q A;  2QJP C;  1M1J A;  1UII A;  4PJ0 H;  5K5G B;  4HKZ H;  1EZV I;  5TJH A;  1BDC A;  1SQP E;  3V6I A;  4R4L A;  1P84 I;  3MZW B;  1FZC C;  2L5G B;  1LP1 A;  5DJT B;  2IBZ G;  3RK3 C;  5B66 H;  1D7M A;  2WZ7 A;  3USS A;  1OWA A;  4JQ0 D;  2P10 A;  2JWA A;  5CBO A;  3AE2 C;  5AVQ B;  2N1T B;  4BRY B;  1EDK A;  1RQU A;  2WSS H;  1VQ9 P;  4YXW H;  3MUD A;  1FC2 C;  3H1L D;  1PGJ A;  2P1J A;  1S4X A;  2E42 A;  1ZR2 A;  1VF5 B;  1LT9 A;  1NU1 E;  1NTK G;  2CPS A;  4XE5 B;  1MKM A;  1SQB G;  4H44 B;  3R4Y A;  1GDT A;  2CPB A;  1LTJ C;  1W2B O;  1HTL C;  4EYY Q;  1S5L X;  3FWL A;  3A0B H;  3D71 A;  1GK4 A;  2JO1 A;  3L73 G;  4IL6 X;  4D6T E;  2AXC A;  1VQL P;  1M1J C;  4C7N A;  2K9J A;  4U3F G;  3TSI A;  3N4X A;  2OTJ P;  4NPE A;  1IK7 A;  3VP9 A;  1Q7Y Q;  1QEX A;  1YJ9 P;  1URQ A;  2HOD A;  4IOI H;  2WT7 B;  3L35 A;  1CW5 A;  1IFN A;  1USE A;  1BE3 D;  1GW3 A;  1KIL E;  2WSF H;  1JY3 N;  2OYH B;  3CXH D;  1T8Z A;  3W68 A;  2QEX P;  3V2R A;  1RH5 B;  2ZFC A;  3LW5 J;  5KTB A;  1LWU A;  1S3J A;  1N73 A;  2A45 G;  5GTH E;  2E5T A;  2R5D A;  2POH A;  3PJS K;  5AVY B;  4GT1 A;  1PP9 D;  3O6Q A;  4L75 A;  2N1T C;  1L0L K;  3GHG B;  1LTG C;  4WVZ A;  3Q5P A;  4MN4 C;  3OW2 O;  4RKU J;  3TGU J;  3A0H E;  1VF5 C;  1AQT A;  1BCC D;  3AEG C;  4PJ0 E;  4H44 C;  3FWN A;  3NFQ A;  3H1K E;  5L8R J;  3O8Z A;  5CCG D;  3CX5 I;  4OGQ C;  2MJZ A;  1L0L E;  1QL2 A;  1VQ4 P;  2QSI A;  1ZN5 A;  1JY2 P;  3GMA A;  1SQV D;  1L0N K;  3CWB D;  1URQ C;  2IFN A;  4WB4 A;  3P8M C;  1QVG O;  5KAI H;  3RGU A;  1NAF A;  1K8A Q;  2NZ2 A;  3KHU A;  1Q86 Q;  1NTZ J;  2R3S A;  1NKN A;  4WY4 D;  2KB7 P;  1FZB A;  2QIW A;  2KIK A;  2RN0 A;  5KLV J;  3VTP C;  2OYH C;  2FYU J;  4R4M A;  1N73 C;  1IK9 A;  3Q5R A;  3RL0 D;  1PPJ E;  2P67 A;  3H6P A;  2CK3 H;  2KSJ A;  1L0N E;  3WUU A;  3FXE A;  1U7J A;  1EZV G;  3A0B E;  1M8O B;  1CZQ A;  3VYI A;  5M1B A;  3SFE C;  3GG2 A;  1JB0 J;  1BGY G;  1IO4 A;  1NHL A;  3MHV A;  1AV1 A;  4XFJ A;  4ZKU A;  4N78 E;  1JOC A;  1KB9 D;  2NPS A;  3HTK B;  3CCE P;  1LNQ A;  1OW6 A;  4W80 A;  4HB1 A;  1CI6 B;  3TK1 A;  2IZ1 A;  1L4A A;  1GU4 A;  1GW4 A;  1SQX E;  3SFD C;  3H1J D;  3FGA D;  2FKW B;  1SQP J;  2D2C D;  1X9V A;  2AXT E;  4WY4 B;  3CCR P;  1QVF O;  2B87 A;  1S2E A;  3HD7 A;  2BCC D;  3JC2 2;  1Q90 D;  3RL0 B;  3PTZ A;  1EDL A;  3A3Y B;  1KC8 Q;  1VPC A;  3RK2 D;  2M3B A;  1NTM K;  3C1L A;  3CX5 H;  1PGP A;  1DD3 A;  3EWK A;  4JPZ B;  2Y9Z A;  5CCH C;  1ZP0 C;  1K73 Q;  3H25 A;  1NU1 J;  2PRR A;  2GUV A;  1Y9B A;  3G71 P;  2HPC B;  1FJK A;  3M06 A;  5AVS B;  2KZI A;  3L74 E;  3CCQ P;  1VQ5 P;  3S4R A;  4JBZ A;  2IBZ D;  4H13 B;  4PD4 D;  2PGD A;  1NTM E;  3PH0 A;  2YKO A;  3ITK A;  3UIA A;  1DIP A;  1GZL A;  2LKM A;  1GTW A;  2FY8 A;  2WSC H;  4N6J A;  2KLU A;  4D6T J;  2AEF A;  2D2C B;  5AW7 B;  2BEQ D;  2K1A A;  3CLQ A;  1KYO E;  3TGU G;  2JDI H;  3KZI H;  1N2D C;  2KNC B;  1HUC A;  3CCJ P;  3NMD A;  1NTK D;  3U1A A;  3K5B A;  1SQB D;  1ZRT D;  2M5A B;  3H1L E;  3HUS A;  3M91 A;  4WY4 C;  3B5N A;  3KXD A;  4AYC A;  5E79 E;  1JCD A;  3CCV P;  1OXZ A;  3P8C D;  4YPC A;  1M56 D;  2FFD A;  4QMA A;  5KKZ B;  3RL0 C;  2H43 A;  2SPZ A;  4U3F D;  4UB8 E;  3GW6 A;  1VDF A;  3M9H A;  2YMY A;  1NTZ G;  1MV8 A;  1RF1 B;  1SFC A;  2H88 C;  4JYB A;  5APW A;  3V4Q A;  5H2F E;  1MFT A;  2FYU G;  5AVT B;  3H1K J;  4HJG H;  2FXO A;  2N9Y B;  1BE3 E;  4H13 C;  1KIL A;  3AEA C;  4IFM A;  2Z4E A;  1FOS F;  2WPR A;  2OYO A;  1L0L J;  1S5L E;  2R44 A;  1H0T A;  2QJP B;  5BVZ A;  3F5H A;  3CXH E;  3AE1 C;  3CPW O;  3AEF C;  3Q3D A;  1AQ5 A;  4IL6 E;  2HYN A;  5AW2 B;  2D2C C;  1T6A A;  4U7J A;  3RBX A;  5KLV K;  3SWK A;  5AVR B;  1PP9 E;  1H8A A;  3TNU B;  1HGZ A;  3T97 B;  4K35 A;  1NAY A;  5AVU B;  1SQV K;  1SQP G;  3CD6 P;  5GTI E;  1MUU A;  2YO2 A;  3SSU A;  1BCC E;  1L0N J;  1YQ4 C;  3I5C A;  3B71 A;  2YO3 A;  3D70 A;  3L36 A;  3AE6 C;  1SQQ K;  5KKZ C;  1SVF A;  1XTG B;  5APV A;  3CI9 A;  4OWF A;  1G1I A;  4C7R A;  1SFC C;  1S9K D;  3N7N A;  5GTH H;  1IZN B;  2M8R A;  1E5W A;  1SQV E;  3CWB E;  2KOG A;  3V2N A;  1KQL A;  3E1I A;  5AVW B;  2O3J A;  2JKV A;  1BDD A;  1M1J B;  3A0H H;  2Q9I A;  2YIU B;  4OGQ D;  1JEK A;  1EZV D;  2HG5 D;  1RE3 A;  2KYV A;  4UB6 E;  2ZXX A;  3V2P A;  3L72 J;  1P84 D;  1LP1 B;  3BCC J;  1BGY D;  3AEC C;  1URQ D;  1JTH A;  2DW3 A;  1NU1 K;  3KPE A;  3JCU E;  1JM0 A;  2JJL A;  5TIS E;  2YKQ A;  3L71 G;  2IX7 C;  2K3R A;  2C9L Y;  2OTL P;  1KB9 E;  4DOJ A;  1KTM A;  3HRN A;  1WT6 A;  4RJT A;  1LT9 B;  3L74 J;  3H1J E;  3H1I E;  4LLH A;  2OQQ A;  4LC1 A;  1N8R Q;  1NTM J;  2HR3 A;  1GD2 E;  1KYO I;  4RO0 A;  4N3Y B;  1VQO P;  1J1D B;  1LTI C;  2IZ0 A;  1QGK B;  1N7L A;  2WIT A;  4OGQ B;  1HWT C;  2BCC E;  1LTT C;  1ZOY C;  3Q5S A;  4C7N B;  2K9J B;  2Q3E A;  1USD A;  1R5L A;  2MKV A;  3L4F A;  1VQM P;  3II6 A;  1T2K D;  2RH0 A;  1URQ B;  3H1K G;  2YIU C;  1MFZ A;  1YIT P;  2FBW C;  1TU3 F;  1X0T A;  3L70 G;  2ZVN B;  3BAT A;  1L0L G;  1Q82 Q;  2WMM A;  2AEM A;  2G3A A;  4GIF A;  3G3Z A;  3WMM 0;  3HE5 A;  2AXT H;  1IFM A;  1LWU B;  1NO4 A;  1W5C E;  1N73 B;  2KS1 A;  3CCS P;  2FXP A;  1YHQ P;  2H7H A;  3F89 A;  1KQG B;  4PV1 D;  5AVX B;  3O6Q B;  1AVO A;  2ZYD A;  1NVO A;  2IYP A;  2XNX A;  3OAK A;  1PV3 A;  1PFI A;  5CCH D;  3MUD C;  1RF0 A;  2QE7 H;  4NPD A;  2W90 A;  2OYI A;  2WPQ A;  1LT9 C;  5CBN A;  1OMI A;  4AQR D;  4L74 A;  3B4S A;  1PPJ G;  3VOP A;  1NTK E;  1ZRT E;  3H1H J;  1E79 H;  2YNY A;  3V4W A;  4XA4 A;  1GL2 A;  2O01 J;  1HBW A;  3CX5 D;  1ZW0 A;  4CPG A;  1J1D C;  2NPS D;  2W83 C;  3H32 A;  1DD4 A;  1L4A D;  1X8Y A;  3RK3 E;  1YYC A;  1NTZ D;  2QM8 A;  2E74 D;  2Y0D A;  1PP9 J;  4U3F E;  3BAS A;  5AVV B;  4HYT B;  1HJ0 A;  2LR2 A;  1ZR4 A;  3A7O A;  1KYO H;  3HD7 D;  4PV1 B;  1ZME C;  2FYZ A;  2W8Z A;  3S9O A;  2BEZ F;  1EXI A;  2L91 A;  4TLF A;  1N7S A;  3KYQ A;  1IFD A;  3L72 G;  4GDO A;  1LWU C;  1OW7 A;  3BCC G;  2Z5I A;  5E79 H;  1HH0 A;  2IFM A;  1SQX K;  2WSC J;  1SQV J;  3CWB J;  3BRT B;  3Q1M A;  1ZXG A;  2WWW A;  1KFM A;  4W7Y A;  5APX A;  4UB8 H;  1X22 A;  5C39 A;  2NPS B;  5KJ7 A;  1SQP D;  2ZT9 D;  5APS A;  4Z1M H;  3IF4 A;  1SQQ J;  4C46 A;  1KQS O;  1GMJ A;  1L4A B;  1K9M Q;  3M0D A;  2E74 B;  3L74 G;  5H2F H;  4H13 D;  2K88 A;  1PL5 A;  2I8D A;  3C9I A;  3MTU E;  1T2K C;  3TYY A;  1R5S A;  5AW6 B;  1NTM G;  1FDM A;  3I55 P;  3PHL A;  2Q1K A;  2B87 B;  2QJY B;  3NXS A;  3HD7 B;  1NOH A;  1OX3 A;  1IFJ A;  1S5L H;  2O01 H;  3MP7 B;  2JEE A;  1VQ6 P;  3CXH H;  2RKL A;  2FXM A;  2KLV A;  4IL6 H;  4EI2 A;  1WRG A;  1S9K E;  3CC7 P;  1HVV A;  2N9B A;  3ZDM A;  2XV5 A;  3B5N D;  3BVH A;  4PV1 C;  3L75 E;  1EC5 A;  1EXJ A;  3KDP B;  3P32 A;  4LGD E;  2P7J A;  3H1I J;  2K9Y A;  5GTI H;  2ZT9 B;  4L73 A;  1N86 A;  1AFO A;  1SFC D;  5AW1 B;  2LXC B;  3L71 D;  1NKZ B;  2BCC J;  4I1L A;  1BGY E;  1OZH A;  1S72 P;  2NPS C;  3AE7 C;  1L4A C;  2B89 A;  1L2P A;  1FU1 A;  2E74 C;  3JSV C;  5AW0 B;  1IFI A;  3G4S P;  2J58 A;  3HE4 A;  2QG4 A;  1NGM B;  3RL0 g;  3HUS B;  1JY3 O;  3H1H G;  1GK6 A;  3B5N B;  2QA4 P;  2VRS A;  2QJY C;  3HD7 C;  3GF3 A;  3WUV A;  2KK7 A;  2E5Y A;  2FFD B;  4UB6 H;  2OTK E;  4ZNC A;  1PP9 G;  3L73 D;  5KAF E;  2J59 M;  3W67 A;  3MD0 A;  2OAR A;  1KV4 A;  1G1J A;  3JCU H;  3D6Z A;  5TIS H;  1SFC B;  3H1K D;  2H89 C;  1FBM A;  3L70 D;  3AE4 C;  1H89 A;  1KB9 H;  1J1E C;  5KLV G;  2ZT9 C;  3LID A;  3P7K A;  1HGV A;  1KIL B;  1H0T B;  5BU5 A;  2BAS A;  1SS1 A;  3IN6 A;  3TDK A;  1HF9 A;  3G9R A;  4A7P A;  3AE9 C;  1SQV G;  3IFM A;  3CWB G;  1LJ2 A;  2QVA A;  1PGQ A;  1HJB A;  1FZF A;  1SQQ G;  4EOT A;  2A06 G;  5B5E E;  3EFF K;  3HUS C;  3AE5 C;  4GOD A;  1GU5 A;  4I7Z B;  4DCK A;  3B5N C;  5APQ A;  2PFX A;  3OA7 A;  3TF5 A;  2FFD C;  5KLI B;  1YIJ P;  1LT1 A;  1FDI A;  1FZC A;  3V2Q A;  4DZO A;  1LTS C;  2V4H A;  4PD4 H;  1DEB A;  1NTZ E;  1JMB A;  1FDO A;  4Y28 J;  3GF7 A;  3H1I G;  3VMX A;  3L72 D;  1KIL C;  3S1K A;  1RHZ B;  1NU1 G;  1SQX J;  3IAO A;  3BCC D;  1FZE A;  3CME P;  2ZVO B;  2KUB A;  4NPF X;  3E7K A;  4M3L A;  2JR8 A;  3GLM A;  3CC4 P;  2C0X A;  2WTY A;  2BCC G;  3WU2 E;  1OFC X;  1LTJ A;  1IJD B;  1NWQ A;  2IPP A;  1YBK A;  4Y99 B;  1G2C A;  1JTH B;  1M90 Q;  1LTB C;  4I6M C;  2C0W A;  1QLE D;  1FZG A;  4D6T G;  3NTN A;  2WVR A;  1FE6 A;  3ABV C;  3L75 J;  1T3J A;  3L74 D;  4I7Z C;  4RES B;  4DJG A;  1S1C X;  3AE3 C;  4OH8 B;  1NTM D;  2W6B A;  5KLI C;  2KI7 B;  2IYO A;  3D6Y A;  2UWJ E;  5CMZ A;  1KYO D;  2ZJS E;  1QL1 A;  1FZA A;  1J2J B;  1BGY J;  1BSN A;  2Y9Y A;  1SP4 A;  2A45 H;  2RMZ A;  1NH4 A;  1VQK P;  2ZYA A;  1KZU B;  1OW8 A;  2GUS A;  4BXL A;  2N1T A;  2E75 D;  4BRY A;  1GL2 D;  2Q6Q A; 
#chains in the Genus database with same CATH homology
 2HFE D;  1M7L A;  1IC2 A;  3RK3 B;  4N78 D;  1N7S A;  3KYQ A;  2YKO A;  3UIA A;  1IFD A;  1GZL A;  2LKM A;  5APU A;  3MIW A;  1GTW A;  3RK2 C;  2WSC H;  1LWU C;  1RY3 A;  4N6J A;  4KHX A;  1RE3 C;  3M9B A;  2HOD B;  1CSB A;  5AW7 B;  2P2U A;  3TNU A;  2Z5I A;  2W6A A;  3T97 A;  3VMY A;  1HH0 A;  2IFM A;  3A2A A;  2QM7 A;  1SQX K;  3CLQ A;  1SLQ A;  3IR9 A;  1N2D C;  3HE5 B;  4Y99 C;  3BRT B;  3VMZ A;  1HUC A;  2WWW A;  1KFM A;  2Z5H A;  4W7Y A;  3NMD A;  2GM4 A;  5APX A;  5CHX A;  3U1A A;  2NPS B;  2N1T D;  5KJ7 A;  3HUS A;  4WBA A;  5APS A;  1NTK K;  3M91 A;  4JYC A;  1SQB K;  4WY4 C;  4C46 A;  1L4A B;  2KP8 A;  1N7S D;  3B5N A;  1LTJ B;  3PP5 A;  1SQP K;  2H8P D;  3BRV B;  2O1J A;  1RF1 C;  3M0D A;  1G2C B;  4AYC A;  3VN0 A;  1JCD A;  1JY2 O;  1OXZ A;  3P8C D;  4IFD K;  2OYI B;  1Z56 A;  1A02 J;  2FFD A;  3C9I A;  3MTU E;  1T2K C;  3TYY A;  2WT7 A;  5AW6 B;  3RL0 C;  1MZ9 A;  1FDM A;  2Q3I A;  2R32 A;  2H43 A;  3NXS A;  3HD7 B;  1NOH A;  1IFJ A;  1LGH B;  3M9Q A;  2OYH A;  1VDF A;  3M9H A;  2YMY A;  2O01 H;  1MV8 A;  1GL2 B;  2JEE A;  1JMM A;  1X79 B;  1M1J A;  2FXM A;  1RF1 B;  1SFC A;  5CJ0 A;  2KLV A;  4JYB A;  1WRG A;  3H32 B;  5KJ7 D;  1S9K E;  1DH3 A;  1HVV A;  5APW A;  3V4Q A;  2N9B A;  1ZV8 A;  3U59 A;  2PP6 A;  2XV5 A;  3B5N D;  3BVH A;  3R2P A;  5AVT B;  2R5B A;  4B86 A;  1FZC C;  2L5G B;  3P8C E;  3GHG A;  3KDP B;  1KIL A;  3P32 A;  4IFM A;  5AW5 B;  2Z4E A;  3RK3 C;  2WPR A;  1FOS F;  2WZ7 A;  4LGD E;  2P7J A;  3SWY A;  1OWA A;  5BVZ A;  4HH2 A;  1LTA C;  1AQ5 A;  2HYN A;  5AW2 B;  5AVQ B;  4AUW A;  2N1T B;  1N86 A;  2ZXE B;  5KLV K;  1AFO A;  1SFC D;  3OJA B;  1N7S B;  3MUD A;  5AVR B;  5AW1 B;  1JNM A;  2P1J A;  5AW4 B;  1YTZ I;  5AW9 B;  2E42 A;  1ZR2 A;  1NKZ B;  5CJ4 A;  1H8A A;  1LT9 A;  4I1L A;  2Q5U A;  3TNU B;  1HGZ A;  2CPS A;  2NPS C;  4XE5 B;  5AVU B;  1GDT A;  1SQV K;  5AVZ B;  2CPB A;  1ZLL A;  1L4A C;  1LTJ C;  3A5T A;  1MUU A;  2YO2 A;  1FU1 A;  1HTL C;  1RF0 C;  3V5B A;  3I5C A;  5AW0 B;  2YO3 A;  1IFI A;  2OYI C;  1GK4 A;  3L36 A;  2J58 A;  3HE4 A;  1SQQ K;  5APY A;  3HUS B;  1SVF A;  4IFF A;  1JY3 O;  1XTG B;  1GK6 A;  4JF7 A;  1FAV A;  5APV A;  3B5N B;  3CI9 A;  1M1J C;  1G1I A;  2VRS A;  4C7R A;  4C7N A;  1SFC C;  5CCH A;  3HD7 C;  1S9K D;  3TSI A;  3N4X A;  3N7N A;  1GL2 C;  3VP9 A;  3SWF A;  2FFD B;  1URQ A;  2HOD A;  2M8R A;  1E5W A;  2WT7 B;  3L35 A;  2KOG A;  2XU6 A;  1CW5 A;  1IFN A;  3V2N A;  2WSE H;  1KQL A;  3E1I A;  3GHG C;  1GW3 A;  5APT A;  2WSF H;  2J59 M;  5AVW B;  1RE4 A;  2PAJ A;  4W7Z A;  1JY3 N;  3MD0 A;  2OYH B;  2OAR A;  3LW5 H;  1G1J A;  1T8Z A;  2R3C A;  1M1J B;  1SFC B;  3V2R A;  2Q9I A;  5CCG A;  2ZFC A;  5KTB A;  1FBM A;  1LWU A;  1N73 A;  2A45 G;  2HG5 D;  1RE3 A;  2KYV A;  2R5D A;  2POH A;  5AVY B;  4GT1 A;  2O1K A;  3V2P A;  1H89 A;  3HTK A;  3M0A A;  3MGN A;  1J1E C;  2N1T C;  1CI6 A;  1L0L K;  3GHG B;  3LID A;  3P7K A;  1HGV A;  1KIL B;  1LTG C;  1URQ D;  2E43 A;  1N7S C;  5BU8 B;  5BU5 A;  1JTH A;  2BAS A;  1NU1 K;  3KPE A;  2JJL A;  2YKQ A;  1W2E A;  1T3U A;  2IX7 C;  4WY4 A;  3EQ2 A;  3IFM A;  2C9L Y;  3NFQ A;  1J1E B;  3O8Z A;  5CCG D;  2W27 A;  4DOJ A;  1HJB A;  3HRN A;  1WT6 A;  1FZF A;  1LT9 B;  2MJZ A;  1FOS E;  1QL2 A;  4EOT A;  1ZN5 A;  1JUN A;  2I1K A;  5KJ7 C;  4LLH A;  3HUS C;  4LC1 A;  2I1J A;  1GU5 A;  1JY2 P;  3B5N C;  5APQ A;  1L0N K;  1GD2 E;  1URQ C;  1KFN A;  2IFN A;  3M0D C;  4WB4 A;  3P8M C;  4N3Y B;  3OA7 A;  4EIJ A;  1J1D B;  1KIL D;  1NAF A;  1LTI C;  3B8E B;  3VP8 A;  3HE4 B;  2FFD C;  1RE4 C;  1N7L A;  2WIT A;  1NKN A;  2XDJ A;  4WY4 D;  1HWT C;  2KB7 P;  1LTT C;  2HPC A;  1FZB A;  4C7N B;  1FZC A;  3VTP C;  3V2Q A;  3L4F A;  5CCG C;  2OYH C;  4DZO A;  1LTS C;  3II6 A;  1T2K D;  1N73 C;  1IK9 A;  1DEB A;  1URQ B;  3RL0 D;  2P67 A;  3H6P A;  2KSJ A;  1MFZ A;  1H88 A;  3BAT A;  4I2L C;  5AW3 B;  2HLO A;  3KQG A;  3VMX A;  1CZQ A;  1KIL C;  3VYI A;  4GIF A;  3G3Z A;  3WMM 0;  3HE5 A;  3RK2 B;  1IFM A;  1LWU B;  1FZE A;  1NO4 A;  1IO4 A;  1NHL A;  1N73 B;  1EQ7 A;  2H7H A;  4ZKU A;  4N78 E;  1JOC A;  5AVX B;  2NPS A;  3HTK B;  4M3L A;  4W80 A;  1CI6 B;  3TK1 A;  2C0X A;  2XNX A;  2Q7C A;  1A02 F;  3OAK A;  3RK3 D;  1L4A A;  2WTY A;  1GU4 A;  1GW4 A;  1LTJ A;  1IJD B;  1NWQ A;  1PFI A;  2IPP A;  5CCH D;  3CL3 D;  4Y99 B;  2FKW B;  1G2C A;  1JTH B;  1RF0 A;  1YTZ T;  1LTB C;  3LIE A;  4I6M C;  2C0W A;  1FZG A;  2OYI A;  3EFG A;  2WPQ A;  1LT9 C;  3NTN A;  1X9V A;  4AQR D;  4WY4 B;  1T3J A;  4O9B A;  2YKP A;  3VOP A;  2WPS A;  3HD7 A;  2C9N Y;  1JY2 N;  4RES B;  3V4W A;  2YNY A;  4XA4 A;  1GL2 A;  1HBW A;  2XKM A;  4ZKP A;  4OH8 B;  1JY3 P;  1RF1 A;  2W6B A;  1J1D C;  2NPS D;  2XZR A;  3RL0 B;  3H32 A;  3A3Y B;  1VPC A;  1XTC C;  2M3B A;  1NTM K;  3RK2 D;  1L4A D;  1X8Y A;  1JO5 A;  1FJP A;  1YYC A;  2QM8 A;  3U1C A;  5CCH C;  5CMZ A;  1NTZ K;  5AW8 B;  1QL1 A;  1FZA A;  2A45 I;  3BAS A;  4HYT B;  1J2J B;  1JCC A;  5AVV B;  2GUV A;  1DX7 A;  1SP4 A;  2A45 H;  1ZR4 A;  1NH4 A;  2HPC B;  3A7O A;  1FJK A;  2FYU K;  3HD7 D;  3M06 A;  5AVS B;  1FZC B;  2FYZ A;  3L37 A;  1KZU B;  2GUS A;  4GKG A;  2N1T A;  1GL2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...