1YYCA

Solution structure of a putative late embryogenesis abundant (lea) protein at2g46140.1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
174
structure length
174
Chain Sequence
GHHHHHHLEASADEKVVEEKASVISSLLDKAKGFFAEKLANIPTPEATVDDVDFKGVTRDGVDYHAKVSVKNPYSQSIPICQISYILKSATRTIASGTIPDPGSLVGSGTTVLDVPVKVAYSIAVSLMKDMCTDWDIDYQLDIGLTFDIPVVGDITIPVSTQGEIKLPSLRDFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative late embryogenesis abundant protein
publication title Solution Structure of a putative late embryogenesis abundant (LEA) protein At2g46140.1
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 31
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2005-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03168 LEA_2 Late embryogenesis abundant protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1yycA01
2.60.40.1820 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1yycA02
3NTNA 5AW4B 1SLQA 5AVTB 1HJBA 1YYCA 2WTYA 3NFQA 5AW0B 1A02J 5AVYB 2YO2A 5APXA 2W6AA 2WPSA 2WWWA 1GU4A 2YNYA 5APYA 2KP8A 3V4QA 3MGNA 2XV5A 2VRSA 2ZXEB 4RESB 3I5CA 2QM7A 3NXSA 5AW2B 5AW7B 3M91A 3NMDA 1IO4A 3L37A 5AVRB 3UIAA 4C7NA 2ZFCA 3HE4A 4GKGA 4I2LC 2P2UA 2P7JA 2WPQA 3HE5A 1HWTC 3O8ZA 4GT1A 3SWFA 3KDPB 3B8EB 4C46A 1CI6B 2WT7B 1H88A 2H7HA 2R5DA 1HBWA 3TNUB 1FOSF 3LIEA 4DZOA 5AVVB 2Z5HA 3KQGA 3A3YB 4M3LA 3VN0A 3M9BA 2R3CA 3M0AA 1KQLA 3L36A 4KHXA 5CMZA 1SP4A 2E43A 2Z5IA 2XU6A 3VMYA 3IR9A 5AW1B 1NAFA 5APUA 1MFZA 1X8YA 2E42A 2Q7CA 1OXZA 5AVXB 4EOTA 3HTKA 5AW3B 3VYIA 1GK6A 2QM8A 1GU5A 2Q3IA 2JJLA 1S9KD 1MUUA 2BASA 2Q5UA 4C7NB 3TK1A 3LIDA 5AW9B 2YO3A 2C9LY 4B86A 5APWA 5AVWB 1NWQA 5APSA 1T2KD 2R32A 5AVSB 3V5BA 5APVA 1GZLA 2WT7A 3M0DA 1H8AA 4HYTB 3P7KA 3MD0A 3A7OA 3L35A 1GTWA 1FOSE 3VMZA 1MV8A 5APQA 3V4WA 5AVUB 1OWAA 2XZRA 4I6MC 1J2JB 2WPRA 1CZQA 4AYCA 3M06A 3VTPC 1S9KE 2C9NY 1JUNA 1XO8A 1GD2E 1JNMA 2W27A 3T97A 3VMXA 3P8MC 5AW8B 4AUWA 3HE4B 1HUCA 3OAKA 3A5TA 1T2KC 3HE5B 5AW6B 1G2CB 1DH3A 3P32A 4JYBA 1A02F 2R5BA 4LC1A 5APTA 5AVZB 1FAVA 4XE5B 1CI6A 2P67A 2IPPA 3TYYA 5AW5B 3TNUA 1GK4A 1H89A 3M9HA 3A2AA 5AVQB 4AQRD 1CSBA 4JYCA 2N9BA
chains in the Genus database with same CATH superfamily
1DUZB 3ARFA 2G2RB 3AECC 4QTIH 1W0WA 2YD0A 4BKTC 4AITA 5EZIL 2PPDA 3ZE0E 3S37L 1KENL 3VXRE 1HVXA 3FSVA 2NX5D 2H41A 4R0LA 4S2SA 5J6GB 1QR4A 1CCZA 4XCEB 4Z7NF 1KILC 3CD6P 3LOWA 4PB9H 5F7MC 1NGMB 4ZPVB 1DSFL 2PYFA 3QSKB 2WSCH 2AXTE 4W9IC 3VG0L 4BQBA 3FWNA 4LMQI 2QTVA 1E30A 1SQXD 4CNIA 4NRZB 4YSUA 3WFDH 1E3XA 4NS0A 2C4FU 3R19A 2HTLD 1UD5A 3GI9L 5CUSL 4RISH 1JWMA 3C08H 2BERA 4F9LC 3PFUA 1IZJA 2CHWA 2FX7L 2CO6B 2H47C 1IGCL 1KC5L 5GGQH 1XGPB 5DJXB 4FNSA 4BZ1A 1BVKB 4DPRA 1MFCL 1JY3P 3LKQA 1URIA 1ED3B 3OAZH 4IK7A 3QCVH 3B71A 3ATBA 1RZIA 2K9JA 3IGLA 3QUMA 3EYUL 2EXYD 3ARTA 4LCCC 1CXFA 4K94L 1MQ8A 1IGYB 3T08A 2YKPA 2O72A 1N4XL 1RY3A 4RFEB 3QUXD 1IBDA 2FGWH 2G75A 3HE6B 4NZTL 1CURA 4J4PC 4Q52A 2QPFA 3UAFA 4N78E 4N3YB 3PJNA 1S78D 1P4BH 2B77A 3SE9L 4U33A 1HKLL 2BP0B 3NP3A 2WXNA 2PYEA 3L3HA 3FU9A 4AYSA 2NUPB 3P4OB 2YKLH 4RNRB 5CBNA 1JDCA 4L3FA 4UM8B 3QHZH 4HMCA 3EJUA 4Z7QB 4YGVB 5ENWB 4PD4E 3BAIA 2JJSC 4QY8B 3TNMB 3L75G 4YDMA 3ZE0F 5D7LB 4FQHB 1MFAH 4OCSL 2Y7MA 2H3NB 2JJUA 5ECJE 5KSAB 3ZR5A 3S35L 1A6UH 2AI0L 4LHJB 1G43A 3TURA 3NFPA 2WNGA 4NNXB 2FX9H 3WOVA 3ULUE 3TEWA 2JKTM 3WL9B 2X87A 1EEQA 2QGCA 5IV2A 5FCUL 4YIQA 3RWGB 5IHZB 4HUWB 3FSWA 2UVFA 3BP4A 1GY2A 4YHLH 3MRJA 3COOA 1QRND 2HFGH 1NCCH 1E7UA 3FO2A 4HJIA 3MHVA 4FG4A 4S1SL 1CS6A 1S7SA 4KQ3L 3KYOB 5A43C 1FCGA 1AE6H 3HE6C 2JFCA 1KFNA 5DJZB 2F53E 2ATPB 4JG5A 1RE3C 1BVNT 3MCLL 5SWSD 4JGUA 3CX5E 5FW6A 1MFUA 1G4MA 2JE8A 4PRID 3ELAT 5DRXA 4XAKD 3TO4B 3F7VB 3LDBB 1QFUH 2O5ZL 3MKKA 3MJGX 4N86A 1UA6H 5IVZB 3UC0H 3LH2L 4QOKD 4R3SA 1LQBC 2B0SH 2Y69B 3CDZB 3IMUA 5TF0A 2XG4B 4NWUL 3S2AA 4HWEL 5E51A 3SQBB 4QJ4B 1OGSA 4QAMB 2WWWA 3OB0K 5TE7H 1YUKB 2YMXL 1I8IA 2WKOF 1PPJE 3QJHA 4AUUA 3QAQA 3L3OB 5TH2A 2MHAA 3P73A 1OTTC 1T04B 3PABA 4H0LC 3U7AA 3S5LA 3HR5B 4G8FA 5KSAC 1V3JA 1GZHC 1SDDB 4QRFA 3UERA 4H13D 1WEJH 1AAJA 4M93B 2WZ0A 5EUKB 4I13B 1SDAB 1QKZH 3GNML 3ZSSA 4YFDB 3B83A 1FG2B 2Q3XA 3I6GB 3VWKC 1CB4A 3EHBC 3VMNA 3VWJD 2A6IB 2B16A 2IBZG 3B1TA 3CQFA 4F7MB 1DN0B 1HQ4B 1DQVA 3RVUC 2B20A 4UQDA 3C09C 3LRMA 3P0VH 2DQFA 4JQXA 3AEAC 3NDYE 1J1EB 3E6FB 4YSSA 3GO1H 1F58H 3CMAP 4DWHA 2VLKD 1NIDA 2HVKB 3BN3B 3SGDI 3TZVB 5L2JA 1A1NB 2YN3A 1DCLA 2P9RA 1R5WA 2ZF8A 3MRRA 1D6EA 4JY6B 1MHEB 2ADGA 2F5AL 4YHIB 1OP5H 3TO4C 2X6AA 1RERA 3LDBC 4XPGL 5DEGA 2PWGA 3LEYH 5INCB 1CJYA 2YZ1A 2CO4A 3FQNA 5D7SH 2XDJA 2RJMA 5JZ7D 2IOOA 4IU2B 1T1WB 1NBVL 4XP5H 5EF2A 4L4TE 5C6PB 4FS0A 4G3YL 5APWA 1DVSA 3CQQA 3KPPA 5D5ME 3TJEH 1NKNA 4CJ1A 3CHPA 3S5ZA 1XGTA 3BEWB 1PQZA 1X7QA 3EYOA 2E5TA 1QOKA 1KJMA 4Y1AA 4Y16C 3LS4L 2FJGB 2ENQA 3U7YL 1I9JH 2OYIA 3KZ8A 1WTLA 3E9UA 4IGBA 2QQLH 1OOWA 2JV6A 3ASWA 2WYTA 3CFBA 5GSVA 5ACZB 1U3JA 5D7JD 4M8UA 2O6FA 5HGGS 1IBBA 3CCQP 1QBMH 1MUJA 1AIZA 4HS8H 4DP1X 4X8CA 1GGBL 4I18B 4NQDD 1Y1DA 3O4LD 3SDYH 1CYWA 5M94B 3P8MC 3WIHH 3QQDB 3QUHA 4M7ZC 3STLB 2YBGA 5GSRB 1PTZA 1J1EC 2BRRL 2KS1B 4WK0B 4EN3B 3VI4E 3RI5K 3BSZL 2WBJD 1L9QA 3TZVC 2YAOA 5KSVB 1V3MA 1MPAH 1TEYA 3DXAE 3WY2A 2L7UA 5EUOB 2NX5A 5E8PA 5EU6B 1ZVSA 5GISL 3DMMD 4WWIA 1DBBL 4X9GA 3PXLA 4HZ1A 1HYSC 2DMGA 5DWUL 3ENEA 1J88A 3V0HA 1PP9D 3HZMB 1PGPA 3O2DL 4OF6A 2PXYB 2IC2A 5I5RA 4FP8H 4OQTA 3CI9A 1N12A 2EIJB 4PJFA 1WE5A 3GT6A 4MLIA 2IAAC 5CCHD 2R59A 3G08A 3ZZQA 3H1ID 5DSCB 2WKGA 1URQC 4PI2A 1LMIA 4HB1A 3LSOA 3V2PA 2X2HA 2B14A 1I8LA 5EFIA 4N8CL 4WDIA 4HC1H 1GZPB 3C8DA 3PGFL 5J12C 4N2LA 5EOCH 2X28A 2FL5B 5D5MF 5HYJE 3S34H 3B5GA 3TT3H 3VXSB 4CPGA 1L4AA 3S8FB 2O3JA 4TQIA 2HZHA 3L3JB 3TEXA 3BO8A 3K2UH 3IGFA 3KPRA 3O3AA 1G0YR 1MJ8L 4PVMA 5BXFA 4I18C 3SOBL 3D87B 4G5ZH 4M7JH 1X5AA 1L7IL 3VFMA 4M3LA 1TYRA 4L2LA 3J27A 1CR9H 2IGFH 2BS8A 4IBTA 1PNCA 5F1NA 1SQVE 5EG6C 1U3ZA 4DO4A 1NC2A 3F58H 2BMKB 5FFLA 4HIJB 1JD9A 2XY2A 3BIKB 4TMPA 1JZIA 2FSEB 2Y0CA 4P2OD 3CV5A 2VISB 4Y5XA 4H7VA 4YBLB 4A55A 8FABA 4NC1C 3VI4F 4PJHA 2A2QT 2EJ1A 5DMGC 3GJFK 2IAND 4N0FA 3RK3E 3VXMB 4NQCA 3REVA 3P9WB 3WNMA 3C9NA 4CILA 4N9OB 3ARGD 2BWDA 4RSVA 2YOAA 5FX3A 1BJ1H 5CHNA 3T0EC 4JO8A 4AJ0A 4N2KA 4N9GB 4Z77B 3H4HA 3OWRA 2Y9RT 4W81A 1XL6A 3IN2A 3HUSB 1KDJA 3ES6B 3ZTJH 1WZ1L 1SJHB 3F04A 4JKPH 4V11A 3W11D 4JUTA 4FG2A 3V4UH 4DP7X 3BP6A 1Q94A 1YEEL 3S9OA 5GPRA 4XCCH 1TVBA 1EBAA 1RE4A 3X3GH 1FVDA 1JZ7A 5IBUG 1EAJA 5SWSA 4N0YH 4AENB 4GAFB 4FJYA 4KK5D 3OX8A 4PRIA 3QNYA 3II1A 3HE4B 3MR9B 4HIEB 1DBMH 1XEUA 1KEML 1XTGB 2EDTA 1SBSH 3G5XA 2CPCA 4KVCH 4PWJA 5AZEL 3ZYZA 3BCCG 5I66B 4QOKA 1VGKA 4B9PA 2Y7LA 1NANI 4YBLC 1IVTA 1GK4A 1TR7A 4LLYA 5FLUA 5BUPA 4PGJA 3VFSB 4GRLA 4ZFOB 2HLOA 2PR4L 2IQAB 2J55A 2FUQA 1LT1A 1WZAA 4F33A 3EO1B 2J1KA 4ZUTA 4AV5A 3OC8A 1OT1A 2EYRA 1ES0B 2Z31A 3FFCD 1GC1L 1NGXB 4KZEL 2JXMB 5ES4B 1RZGB 2ZT9C 4EI0A 2J43A 1WAAE 3IDIA 3RWDB 1F90L 3G6JE 3VWJA 1SQPE 3KCWA 4OIBA 2HG5A 4JJ5B 2OSLA 2Y25A 5MI0B 3K71B 1W0VA 2V9RA 2B5IB 3WIFB 1ORSA 1TQTA 2FYYA 4GKLA 4XRCA 3KJ4C 4MMXB 1XD1A 2ZCKL 3QDMD 4XNZB 2CHXA 3DX8B 5HGHB 3LMJL 4NKMB 4UANA 2YKOA 1JI2A 1B0WA 5KKZB 2MFNA 3VRJA 5I1KL 2ZX6A 4XZUA 2WANA 2X09A 4PP2B 1UURA 4UAHA 1DBKH 4D0CA 4ZMYA 4DN4H 1SQVJ 2NY6B 4MRCA 2F1EA 2KQMA 2MQ0A 2X2JA 3LN9A 3RWFA 4HCIA 3ZSTA 2OCFD 3QA3B 1PG7L 4NO3A 4NZDA 1A14H 4AOFA 4PJBB 5BO0D 4GG8B 1T1YB 1G0DA 2IFFL 1PZUB 5IBLC 5E79E 2J58A 3X14A 4NN7B 1T5XB 3UL4A 4XVUD 3PLYA 3TYGL 2F8XC 3WD5L 5BV7L 4NENB 5C0CD 1UD2A 3CVHB 4ONHB 1RU9H 1GYWA 1DVFD 5F3BB 5JDJA 3PWJA 4P2AA 3MXWH 5D2NA 4OZIB 2CK2A 2K4WA 1UVQA 5AKRA 2A38A 4HSCX 3EFGA 1TYEB 5FHBL 3HG3A 3C60D 1FO0A 2A3TA 3FQYA 3GMQB 5MI0C 4NQDA 3L54A 1E5CA 1JGVH 2ARJA 4R0LB 2XPGB 2FZ3A 2Z93B 1WAAF 1P84I 1S7QA 3G6JF 2OQJA 4XNZC 1BGXH 2Z91A 3BQUD 4WY7H 4IDLA 2K8MA 1BFTA 2WP3O 3NSYA 3OKOB 3H85A 1CLYH 4HJJH 1T2QL 1MFNA 3OKNA 5H2FE 2BY2A 4J8RB 1JWMB 4HXAL 3SDDD 4CJ0A 1IC4L 3GSNB 1HAUA 1U8IB 3H42H 1E4HA 5FKPA 2YPVA 3TESA 2EH8L 1XCQA 2X6CA 3BASA 1D3CA 4CVZA 4D6TE 2HVBA 3BPCA 1OCWL 5ACMA 3T0BA 1JGEB 5CCHA 1YQVL 3V0FA 3OHXB 4LASL 1BG1A 3QUMB 2VN4A 1QABA 2FRGP 2PO6A 1Z5LA 4M8QB 1CLZH 4LP4A 2KUTA 5J1SC 1QFWI 2BVQA 4Z7WA 2OZ4H 5EB9A 4F2EA 4R2GD 1EQWA 1HXMA 3GTTA 4NBZB 2CGRL 3SPHA 1KB9J 5KYYA 2I60H 2V3EA 1BCCE 2NW2B 1LK2B 2VH5H 4I0KA 3ARFC 3LNDA 3QJUB 1MRFL 5E4EB 2Y5TB 2PYEB 3L3HB 2B9BA 1SQPJ 2UV3A 2NCMA 2KXPB 2JP3A 1F97A 1JNLL 3N43B 4IJ3C 4Z6AT 1DSYA 3D0VB 4R0LC 4ZI8A 3MUHL 2C1PA 5AVRB 2JELH 3PGCB 1E4WH 3GMMB 4QXUH 1DO6A 1NGPH 3BDYL 3Q13A 2IG2H 3GSQA 4X5WA 1GRWA 4AMKH 2ADFL 2JK5B 3WDIA 3H1KG 5L8JB 2AEMA 2KH2B 1IQWL 2AKRA 2XU9A 1IM3D 2WXRA 2XN2A 3U79A 1H88A 4OF8A 1F3JA 4I3RL 4ZMTA 1SVCP 4NZFA 2WSSH 4U1MA 5GGRY 4BD4A 5GS2H 3LRSB 3NFPB 5FFOA 1TFPA 3D4YA 1E9QA 5JOFB 4JRYE 3PPSA 5IV2B 1AZNA 5DUBA 1KXTA 4YIQB 4L3CA 3UTPE 4GW4A 1JDAA 3D3VE 3ZU8A 3BP4B 1JHKH 3MRJB 4POUB 1FGNH 4QHUA 1QVFO 3ARGA 3SJVE 1Z3RA 3FO2B 4G7YL 3T65A 3PAVA 2DQIH 4WQOA 3VXQA 4FFVD 2O1KA 1A1MA 1S7SB 2A9DA 5FGBA 5I76A 1KB3A 1JSYA 1SM3L 2IBGA 1I53A 3HLAB 4HOXA 2R69L 5HHXH 1AXSA 1CT8A 2GI0A 2FYUD 2ZG1A 5SX5H 5KVDE 2YXFA 4KROD 1GGIH 1BZ9A 3KCPB 1M7LA 4Q2ZA 2CPUA 5ISZE 4NPDA 3L5XL 4YLQT 5DRXB 5GS1A 3MJ9A 4BE5A 1NC4D 3H1HE 1BFVL 2ZXAA 1G7IB 3AE7C 2DIBA 1TMQA 3NZHH 5C3TA 3CD4A 3QWOA 1E2WA 3SEPA 3X1FA 3SO3C 3PJSB 1BZDA 4QCIA 2QGDA 1G7HB 1MCCA 5DEFB 3PWNA 1MJUL 1I8IB 1RFDL 4UINL 2X9YA 3O6QB 3DSFH 43C9A 4XMLH 2G0LA 5TH2B 1PCSA 3NVQA 1IAKA 3P73B 4LCIH 3BAEH 2P3YA 4QWWC 3RVWC 4AT6A 1XSOA 3S5LB 3EFDH 4G8FB 3WS6A 2P47B 1Q0YL 3GG2A 4OCXH 4F7CA 2CJUH 5T3ZE 2Z9TA 4HV8A 4K5MA 1RF0A 3AEFC 3F6JA 2R2EB 4MCZA 2QEXP 1BQLL 1NH4A 2V17L 5CLWA 1T2KC 5BOPA 1IV8A 3W39B 3QGVA 3QNFA 1BX2A 3P4NA 1N3NA 3DA0A 1S7TA 2F1AA 2OCCB 2XPZA 1IC7H 5MP6H 3QIUD 3QUYD 4PRBB 3RL2A 4LPXA 1CGXA 3OAUL 1NYHA 4LVOC 2DQFB 2N7AA 4MXWL 3MBEB 5JOPE 4PY7B 2JO1A 1OK0A 2DQJL 2ZYSA 1KGCD 3BUYB 1D5IL 2WWNA 1FSKB 3EFFA 4ZXBD 3PWVA 5L2JB 3QDGD 1X79B 2ZF9A 3NGBB 4DGUA 2VNCA 1HSAB 5B1AB 1AFVH 1VEOA 3X3FH 3FQUB 2ADGB 3CVHH 1KGWA 3MGNA 1U8JB 5K1NA 4KK8D 1LMKA 2QZQA 1NOFA 2W83C 2Q8AL 3MV7E 5BZXA 3UJIH 1PLGH 4Y5VA 3TLRA 4ZNEE 4L8CA 3OQ3B 1ZKAA 1QNZL 1ZRTE 1NLDH 1OWWA 5GIRA 3ZL1A 5I71B 1EWHA 5D1XE 3EYVA 5I8OL 1C5CL 1P53A 4KJYB 1SQVG 1N8OE 4MVBC 4PVLA 4HF5H 4JM2A 1PQZB 3DYPA 3EYOB 2UZPA 2DOCA 4WV1A 3JC22 1J9SA 1JNHA 2HUEA 2R1WA 4OLXH 4WWKD 4OLUL 5ID1A 5DO2D 1OSPL 4HGWA 5E08L 2Y0SA 3HHMA 5D2LA 4IGBB 5DUPH 5FA4A 4TQPA 2ZYGA 2ENPA 3C2SA 1TIUA 4I1RA 2E47A 2JJWA 3DGGA 1G7PB 3HHSA 5FV1L 3S8GB 2XY1A 2XKNA 4KX9A 4X6DE 1U9KA 4JAMA 3PU7A 4U4IA 1MUJB 2J1WA 1SJMA 3CPLB 4G70B 3FXEA 1EIBA 4AVJA 1P5VA 1JPFA 1NFIA 4WWOA 3U4EA 4BZ1H 5CKAA 3MBEC 1OP9A 1NCGA 1KLFB 4UCFA 1JZ8A 5MHSE 3GLDA 3WKML 3RUGA 1N5AB 2AXFA 3C60A 3QUMH 2YUWA 3WTXA 4E2OA 1D5XB 1WA0X 2P5WE 3NGBC 5DJCA 2XVLA 2NX5B 4P5KB 5E8PB 1EHLH 4C7NB 1OW6A 3TK1A 3LIDA 1ITCA 5IKCA 2P48B 4P3DA 3LQAC 4UT9L 4P5SA 1MDTA 3B2UD 4XO5A 2Y7NA 4K23L 3CLQA 5HHMB 3TEUA 4Q8BA 2WLKA 1FFQA 1J8SA 3CFIC 3KYKL 3ZX1A 4MRBA 2AZAA 3QYMA 4HLZG 4FYRA 1HH0A 2WLYA 2ZJSH 4PJFB 4X83A 1T6BX 5AB0A 5LQBH 3EKCA 5I71C 2DWDA 1NCJA 2VC2L 1QATA 1VL2A 3NCBB 4JPKH 4UV7H 3SKUD 2R56H 4J5VA 2I1JA 4AVIA 4FJ6A 1TTUA 3NYKA 3LSOB 5CWSA 2WPRA 2XWTB 4K55A 3SFEC 4XR8C 5SWQA 2XNXA 3K1DA 2XA8H 2H6PB 1RZKC 3CFJA 3C2AH 2OYIC 1JRHH 3MLZL 3P0GB 4IGBC 4O02L 4Z78A 4NRXA 5KYUA 4JPIA 3AZUA 3A5TA 1LK3L 4P2QE 2WO2B 4LXFA 3QUXB 3BO8B 2JEEA 3P4MB 4GSDL 4TTGA 1A8ZA 1Y47A 1YMHA 2MTAA 3D2UD 2DJSA 4RWYH 4MJJA 2ENSA 1T0NA 3UTTD 3HG2A 4XBMA 2VN3A 3ASOB 4J3XA 5LGJB 4XTRD 4QO1A 1T1XB 2OXGA 4JYCA 2AEQH 4X6DF 3UTZA 4OLEA 2WINA 1YYLL 5AD0B 1KIPA 1VQ9P 4Z7AA 1L0LE 5BVPH 4RAVA 2QELA 5L2KA 3IFOA 4UMSA 2ITCA 3KXDA 1RUQH 3VVWA 4O9HH 2H88C 4YPGA 2ADJA 4G6KH 3UO8B 3SPCA 5CGBA 1R0AL 1IM3A 2CR3A 5MEPA 2OK0L 3HC4H 4NQCB 3REVB 5B3NA 3SDCA 4LSQH 1XR8A 4OWFA 1ZP0C 1NGZB 1OTSC 4PJEE 1LT9A 1IBFA 2AQ1A 3PQYD 4JN1H 2YHGA 1MF2L 2GT9B 4OB5L 5DD0H 1MW3A 3BVUA 4N22A 4WI9A 3TWCL 1I8LC 5I1CH 2IXQA 5LWYH 2WHVA 2DPKA 4EEEA 2VOTA 4HKBA 1QRNB 3L9RA 3P77A 1ET7A 2FHBA 4LDLB 1QG3A 2ITAA 1IKNA 4LIQE 5ALBL 1NA8A 1NAKH 3BP6B 1L4AC 3QEQD 2AP2A 3RWHB 2YXQB 5F6IB 3UAEA 3D4ZA 5HSFA 1DQQA 1LNUB 2JB6A 5C0ND 1A7QL 1AHWB 1CK0L 1FVDB 1R3IH 3KBEA 2EABA 4RGND 5BMFL 5SWSB 2ZONA 3T4AB 4LSPH 4CVUA 4PRIB 4HMEA 3QNYB 4MN4C 2JTYA 1FLRL 4BFIA 5I73B 4J6RH 1MXGA 5CD5D 2Q87A 3G5XB 4EOTA 4IBWA 4Y9GA 4FQ1H 1EFQA 4KTDL 4V1DD 2JLPA 5FS5A 3RGUA 4QOKB 3N44F 3HZVA 3P8CD 2AGJL 4Y5XC 2WSPA 5DWPA 5FFGA 1ACZA 5FA3A 5E9DD 5CD3A 3PFQA 1GXEA 1QTSA 1QQDA 4JL2A 1FQ9C 2BINA 3IDMA 4OGYL 2BVYA 4Y4KD 4F33B 1HI6A 1S7UB 2J1YA 3LQAH 4E41E 2EYRB 1SEQH 3IVKA 1JNJA 4G42A 4H13B 4YHMH 1P4IH 3I2CH 4LLQB 4DKFH 1XAUA 2MWCA 2Y07H 3BE1H 3BXNA 4IKLA 2R4SH 1K8DB 1N0LA 1RJLA 1WG3A 2N4IA 4JDTL 4X2UA 4PJEF 3VWJB 1A6PA 4N0UE 2C9PA 2HG5B 4JQVA 3QIUA 1A7OL 1F11A 3ZZSA 4JCLA 1W0VB 2ZCHL 3ML9A 1Z5HA 4NKIH 1ORSB 2FYYB 4PCSA 4XRCB 3SQOH 5F6IC 3ZPDA 4G82A 2GSIB 1N73B 1RZKH 3K3QA 1RE4C 3FB7A 1U93A 2VLKB 2IQ9L 3FT1A 3FTGA 4JFEA 2QTEA 4DETA 4XZUB 1FDIA 1LLAA 4HUXB 5I9QC 1AZRA 2OSXA 4P59H 4D0CB 1B3IA 2EE0A 3WE6A 2O5NA 4ODHH 5I1DA 5IROD 4KU1A 2X1QA 1UXWB 2WTYA 1M7IB 2FE0A 2X6VA 1OAZH 1RUAH 4GIPD 4MDRA 3QWRD 3CMOL 3CU1A 4GRLC 2R0LH 1KZUB 3X14B 3B6SB 1WUNT 1YAIA 2E9GA 3Q8FA 3PREA 4RRPA 3BSZA 1T89A 4N0RA 4W68A 3HBGA 2Z31C 1C5BH 4WWKA 3RX5A 3FUHA 4HW6A 1OL0A 1SXCA 2YSSB 3PWJB 5D2NB 1UVQB 4O2FB 3MYZA 2X4QA 1WH0A 2WCPA 4OQTH 5D7JB 5A2FA 4YFLI 3VWJC 4DNLA 4AM0A 3EDKA 3UJTL 1ZT7A 1FO0B 1MFEH 5DZNA 5E8NA 5IFJB 5F96L 2FJHB 3DGCR 3LHAA 3O2DA 1T20B 4NQDB 3RZCA 1I7ZB 1GOGA 3L9BA 5AVVB 4KITB 4K4KA 4UZGA 3TVMA 5JHMA 1J8HD 1AZVA 2OQJB 5DT1H 1FZAA 1GGCH 3AE3C 3UJJH 2F8VA 2WBJB 2OAAA 1EC5A 1J7VR 5I1JH 2FEDC 5DJYB 1ZE3C 1MJ7L 3CFQA 3WMSA 4PJGB 4ZODA 3CMGA 4WHTA 1QFWL 2DL2A 2A7BA 4R26H 3DMMB 4JKLA 3CK0H 2Q20A 3E1F1 3QDJD 4PJ7A 4WU7A 1FN4B 3LS5L 4DCKA 4GMTL 5LAPA 2V5MA 2A9MH 2VUKA 4Z3FA 3MBXL 2IDBA 4M56A 3KE0A 5FUOH 2QL1A 5T3XL 1TPXB 1XCQB 2HX7A 4CVZB 1U8HA 5JZ7C 1JY3O 4LKXB 5DFWH 2KYVA 5A2AA 5KWYC 3GSUA 1WO2A 4U7SA 5KANI 5CCJA 4G8GA 1Z5LB 2EUZA 1BQUA 3M8OL 4RA0C 3T1FA 4AKQA 4U3FE 2AC0A 1EK3A 4Z7WB 2QPSA 1PX8A 4P2RD 1HXMB 3CN2A 2F2HA 4QPEA 2E56A 4R90H 4QRRE 4HG4J 5KYYB 3NJKA 3B2MA 5D2NC 4K5NA 3ZHNA 1QX1A 4NQXA 4ZSOE 1DVTA 4GOSA 4EDWL 1RULL 4NM4L 1J5HA 2YD5A 2LTQB 4QRPD 2BEZF 3VQMA 5B3JE 1IBGH 1J1DB 4XXDA 2GJJA 5KJ4A 4RAUA 1RUMH 1Z0MA 4NXKA 1MCEA 4K7PH 3BKCH 4KK9D 2V9UA 1HZHH 5AW8B 1ZLDA 3VFRA 3EJTA 4WRLA 4EVNB 4JPZB 1QASA 3CFUA 1YN6A 3N85L 2DLEA 1G2CB 2AKRB 2Z8WC 3LHPH 2UZIH 4P2OB 2YWZA 4PG2A 1Q9KA 3NRPA 4M1CD 4R4MA 2B59B 3BD3A 2H0EA 2JWAA 4TUKH 1C8QA 1FORH 1MH5B 4PS3A 4U1MB 3BRVB 4UQIM 1P6FA 1MVYA 1A6ZA 4J3UA 1E9QB 1I9IL 2VO8A 5FO9A 5DUBB 2IANB 1KXTB 1TPXC 2YAMA 5AW4B 3DJSA 3ZDYE 2E7MA 3AXIA 3GHBL 2OMWB 1NCDL 1Q7YQ 1GL4B 1DVUA 3DJRA 4FLSA 1CFMA 5CCHC 1EDQA 1M7DB 3ARGB 3PQYA 1RMFL 3TIDA 2PO6C 4NDMA 1PKQE 5FAAA 2XWEA 5F7DB 4DP0X 3KVQA 1LTIC 4JM0A 1G7LB 1CT8B 1X9LA 2ENYA 3SKNA 2ZG2A 2WNXA 4K3HA 1FBMA 3P3TA 3ABGA 3EJRA 4LNRB 3GXPA 4PYHA 3RG1C 3N40F 2VDLL 2K37A 1E3ZA 2Y6SC 3BPNC 3GD1C 5ICUA 2QVIA 1YY8A 2BNRA 4K7FA 1WCQA 3GSXA 5J56B 3O8ZA 1ETA1 3D5OF 4F5CE 2CDFA 4KJQC 4LHUG 3A23A 3MODL 4PGBB 2RAMA 5F9JA 1H6EA 1N7SD 1DQLH 3EXLA 1M7XA 2VDRL 2Q0ZX 3I3EA 4FEIA 2BCCE 4A1RA 4CMMA 4Z7QE 5B3JF 3NJMA 5C70A 2OPCA 4PWFA 2CRZA 1NPUA 3PDOA 4HIXL 4J3TA 3ITKA 3HS8A 4FXLA 4G71B 5FYJH 3CH1A 5IMLB 5D7LE 4HV8B 2WNWA 3CHRA 4XCNA 5ANHA 4LL9A 2OSWA 1T66D 2ZCLH 4MCZB 1ZE3H 3FQ4A 5E70A 4WKXA 4L29B 1PU0A 3KPSD 2BIQA 1JFQL 3W9EB 4WFHD 1CD9B 3P4NB 1N3NB 4R8WH 1S7TB 3VQ1C 1URLA 4JO1L 1UADC 2GTZA 1FVCB 1J8KA 3ARGC 3FFCB 2A9NH 3KL0A 3SPJA 4M48L 2IBZY 5B1CA 4NKQB 5TDPA 3ZDYF 1HIMH 5FGBC 1NDMA 3FU3A 3CSYA 4U3FJ 4OSUH 1BBJA 1PZ2A 4HK3N 4R5TA 4K3AA 3X1GA 3A21A 5HJ3A 3VH8A 3N50A 2PF6A 3NQKA 1EFXD 1B0GA 1B4TA 5GS1C 3QDMB 1MNNA 3RFZA 2BH0A 5H94A 3GLEA 4N1HB 2XT1B 3C12A 3QWOC 2DIJA 4PJ5D 3EFOB 1S3RA 4Y5VB 3OZKA 5IQMA 4L8CB 3CC1A 1T03H 1FO0H 5AOIA 2BWIA 5A2KH 2HJFA 3UBGA 3EYVB 5CCGD 1VGEL 3VFTA 3U9UB 4PTUA 3WS6C 4K8RL 5D1QA 2KB7P 3NBNA 4OFYA 4ZTOH 4KY2A 5L7XH 1L0NG 1IM9A 1RF0C 4XPAL 1TU2A 2R1WB 2DKSA 1A9VA 4Z7QF 4RBPH 5ID1B 1NCWH 4HGWB 5D2LB 1T21B 4H5SB 4PJDA 2D03H 3HR6A 3GPEA 1JV5B 2I9TA 3CC4P 3CFCH 3HHSB 3MRCB 4MHHI 5EBWA 1SQBD 4PJAB 3BP5A 5C0CB 2OTUA 1GVIA 1DVFB 2YPVH 1XGQB 3F7YA 4PB0H 4KTGA 4YBQD 3EO9H 5L4FA 3WFCL 4RQQA 3U4EB 3OG4B 4ZS7L 1PX3A 1ZTXL 2BNQD 3PIQA 4HHAB 1VJSA 4LPCA 4AQEB 3V4VB 4BQCA 1PFOA 3O2VL 5JQHC 3RUGB 3C60B 4PP1C 3L48A 1JGUL 3HJ0A 4GI6A 1JM0A 3AC0A 4NN5B 5INDB 4L1HA 4JHUA 3N2JA 3RGBA 2BJMH 4GAYB 4AEHL 3SSUA 3OKKA 2NYYD 5HI3D 3JXAA 5IKCB 1YNTA 4I87A 1J12A 1W0YT 1SMAA 1Q0XL 4WIQA 1GS8A 3NIGE 1H8LA 2QPUA 3DNKA 2N0KA 4ODTL 2MNWA 4WEEA 4X7TA 5LB1A 2WPQA 1MRDH 3HCVA 4BEIA 3TBVA 4NPFX 1YECL 4Y5VC 3NCJL 4BZ2L 1VKXB 1E4XL 3U1PA 2DWDB 4A2MA 4PGEA 2VDNL 1HWHB 3SDDB 5LN8A 3VGBA 1T8ZA 1WRFA 3M9BA 1Y0LB 4L05A 4NRYA 5B8CA 4JM2C 2ZYRA 1L9MA 3IDUA 4NKDA 4WV1C 5IB3B 5SWQB 1PMYA 3ZKQD 4ZX4A 1JPTH 3CFJB 1AGEA 1FL3B 4BH8B 3HNVH 1PAZA 4UIKH 4XP1H 1HL9A 4Z78B 4NRXB 4ETYA 5I15H 4JPIB 4BGDA 1AVYA 4XVUC 3K4ZA 4PPTA 1H6FA 4R2GB 2MNJB 4FD0A 4P2RA 4P0DA 5F6HI 4PJ9A 1OFCX 2XWCA 4TNGA 2YXRB 3IMWA 1VDGA 5HYSA 4YSOA 2WO3B 3UTZB 4X4ME 2E27H 5F88A 1EDLA 3MGOA 3C60C 4QRPA 4CL7A 1ZGLM 4O2CA 1Y6MR 4G9FA 3OA7A 4PWIA 3QJRB 5I8KH 1CWVA 3EH3B 1CXIA 2Z7ZA 3EADA 2Y2TA 4RAVB 1WISA 1U3YA 5H35A 5EUOE 3FNKA 3WEBA 1U8KB 5IHLB 1Q72H 2XZQL 5EU6E 3TL5A 1ZGLA 2BNUA 4A2DA 3FCTA 2ADJB 3BT0A 3MZTA 4NC1E 3FCBA 3NEOA 1D5MB 1GL2A 1IM3B 3DVNA 4K94C 1J1OH 3U6XS 1MCSA 1INEH 4N25A 3MJ9H 1RUKL 1XR8B 2M8RA 2YA0A 1I9RH 5AKVA 1WJ3A 1R33A 3KWVA 4M5ZH 4P3CH 5J1TC 3NIGF 4ONGH 1LT9B 3CN1A 3D06A 4NHCH 4K3JH 2ISDA 3VXOA 1MY7A 1XGZA 5DD5L 1MCBA 3R4RA 4N28A 2V2WA 5DF0A 5G55A 2I1KA 1F4XL 2Z4EA 4U6TA 1BXVA 4XWOC 2IXQB 4R4FH 3T0EE 1Z9SA 4HKBB 4KKBC 5TQ0H 3P77B 2OR8A 1KQGB 1MLCA 4JK0D 5DRNB 3TPUA 3A5VA 2HKAA 2G4EA 5L88H 4UDUA 5H37G 1DQQB 4H26A 1MNUH 2JB6B 2O30A 3QG7L 5F7EL 5IESH 2DQTL 5I0WA 1OM9A 1LHZA 1JGDA 4HXBL 3I3DA 1ODUA 2C9RA 1NC4B 5HVGB 4F7EA 2KK7A 4TLTA 1FUNA 4EUPG 5ITBH 4JG1H 2IPKA 2X4PA 1E79H 1KWGA 1JTOA 4ZKUA 4WAFA 1S9XA 5DQJA 3HZVB 1QNIA 5A2IH 1IO4A 4DTGL 3HFFA 1FI8C 4X5XA 5CD3B 3OGCA 1J1XL 5F0PB 1QQDB 4NGHH 2F7OA 1KB9K 3IDMB 4PVBA 4Y7MA 4D7BA 3MPCA 3VO0A 3SDCC 2X3CA 3QCTL 5EUOF 1CI6B 4HJGB 4G42B 3L1OH 4UAOC 3VXME 2XV3A 5DHXB 1LT9C 1NIBA 2XVKA 4XPHL 4OLYL 1DDHA 4C4UA 1ZJBA 3BXNB 2K6ZA 2K9UA 2WIIB 4KI1A 3M0AA 3KVDD 1SMOA 4KXAA 2J56A 2FYVA 3MO1A 4UILH 5IOPB 3MCKA 3QIUB 3K1KC 3QUYB 3CZFB 1NCAL 3DV6B 1BQHA 2YGVA 3NG5A 1PDKA 1IKNC 1Q0EA 4PRAA 5DGRA 2GKIA 4FFVC 1TZIA 4U3CA 3GMPB 3ECUA 1GGTA 3ALWA 5EZIH 3QC6X 3S37H 1EBPA 1T6WA 1KENH 2WAHA 5GRVL 2E7BA 4ZXBB 4ELMA 1HVVA 4MJIA 5BOZG 3VGEA 3QDGB 5DC4B 4BH7B 3FTGB 4NNYA 1MCLA 1UD6A 3QO1A 1HL8A 3BH9A 3PP3H 4J3WA 4NQVB 1DSFH 1UCTA 3UC2A 1NTZD 4P4KA 4QTFA 1JYXA 3VG0H 3WE6B 5AWNL 5I1DB 3GM8A 1JCKA 4U1LA 3WNJA 5JW5A 3GI9H 3H1JE 1OARL 4PJ5A 1I3GL 5CUSH 3KL5A 5IMKA 5K9KA 2D31A 4HJSA 1IFHL 4XMWA 2FX7H 4BXLA 2QQNL 4WHCA 1IGCH 2IPTL 3KEHA 5CCGA 2NTFB 1MFCH 3MV8D 4JKWA 2WLIB 4FL4B 3BX7C 4CC0A 1J2JB 5HVWA 4ZFZA 3EYUH 3M06A 2L4OA 1CO1A 3FCUB 4FNRA 4WWKB 4PLJD 2V2XA 4K94H 4R7NB 1LWJA 3MNVB 1N4XH 1VEMA 3WJMB 4UT9A 2HCZX 5IEKB 3A0OA 2FKWB 2XN9A 2F7IA 4NZTH 3UDWA 3EOTL 5GGUA 3OGOE 4JQVC 2FWUA 3QIUC 4RRPG 5TK4A 1WCBA 1BLNB 4N2FA 3SE9H 1HKLH 1BIHA 1KCUL 1UT1A 4RZCA 1G5AA 5IB1A 1IEHA 4PRHD 2AANA 2CU9A 2P24B 2PCXA 1U8PB 5FGCB 4LPVA 4YXLL 1Z32X 2X2YA 4B0MM 3SE4A 3TBTA 4NPJA 2AXCA 4YSAA 2NUTA 5KTEL 3BOVA 5IFHL 4U49A 1NMAL 2APFA 2GQHA 4N90E 4PJ7B 4KK8C 4OCSH 3IXAA 2VM4A 3KR3L 1TZOA 2ESVD 3QXDB 4IRSA 4O02A 2DYPD 4PWHA 3V6BR 1EZLA 1S4IA 3S35H 2AI0H 1AZBA 2Q3EA 4GAAA 3WLBA 1EPFA 5FK9A 5KBDA 1WFIA 5J06A 5FCUH 1F3DJ 1H3PH 1NL0H 1OP3H 4FOMA 1J10A 2E7DA 2EIMB 4PJBE 3T1FB 5J57B 4KJPC 5SWZD 4I2LC 1EXHA 3VA6A 3KYNA 1T89C 5EEYA 1GGYA 1NGQL 4JHBA 4W9HC 1RP8A 4WWKC 1SFCA 3VXNA 4Z3GA 4IHOA 4S1SH 4PRPD 4GUCA 4PYGA 4KQ3H 2V9QA 3PWUB 2Y6TE 3G6DL 5BJTA 1H3UA 4IMLB 4ZMNA 1HH6A 1W80A 2WUBL 3D2UB 1H15A 3NIFB 3C5XA 2FWOA 1FJKA 3RZCC 3UTTB 1EJFA 3KPOA 2B39A 2O5ZH 4WTZA 3TVMC 4AC4A 4LEXL 3AQYA 3LH2H 1OXZA 1FL5B 4HWEH 3L5HA 5CGTA 1DE4A 4A2FA 3K81A 1BFOA 2YMXH 3J8F7 3B2UC 4YDJB 3RNQB 3TPKA 1WIPA 4YHYB 4H8VA 4NLHA 4K7PX 4FN0A 2GM4A 3RX8A 5D4JA 1DZBA 5GTHH 1CDYA 3GJEB 2FBWC 2QMKA 4TNVF 3LQMA 4J1UA 1VQ8P 3NFSL 5DK2A 4ABUA 2NY1D 2WP3T 3GNMH 5DHYA 2EEBA 3PQYB 3ZMEA 3AE1C 5I1AB 3U1SL 2LFEA 3MLSL 2WJ5A 3NJHA 3DTXA 4W9EC 4QTHA 3MLTB 3I55P 1YJDH 1RQUA 2APTA 4YO0B 1THAA 4QGTA 2BOBA 3D8MA 4PJBF 5LBSA 4BCXA 4OCMC 3NZUA 2YPLD 2NNXA 2EC8A 3QEQB 3BWSA 2AVGA 2MCG1 2E76C 3BKML 1RP9A 1QSEA 2BNRB 4K7FB 3GSXB 1TXKA 3P32A 4RGNB 4FABL 3MP7B 2CDFB 2PYEE 3L7FB 4AC2A 2ZJSE 4OAWA 2F5AH 2ICWI 2MCMA 5DD3L 4GKSB 2AQPA 4N8PA 4XPGH 1VERA 4CMMB 5EEZA 4GW1B 2AXHA 4F37F 3PDOB 4Q4IA 5E03A 4QR7A 4V1DB 1NBVH 1HHJA 4PG2C 3KLDA 1KJVA 1FNEA 2DZEA 1ZK5A 2WIMA 3BFWA 1AYOA 4G3YH 3WSQL 4NSKB 1KTJA 4LP5A 2XZCL 3GZKA 2ODIA 5E9DB 4AQ1A 1MCWM 3CFKA 4NZJA 2WZPD 2HVJA 1NEZA 4Y4KB 3LS4H 1I8KB 3QRFM 1BIIA 3L4YA 4TF4A 3U7YH 3V9EA 4A7GA 1BYPA 2GTZB 1OOAA 4LSRL 4X6CA 3RNKA 1UEMA 2LAGB 1X44A 2Z0BA 5AYUL 4M3JA 5CEZD 3TBSB 5AOMA 2I9LB 4U0QB 3CSYB 3LPFA 5I6NA 4F7KA 5KLVE 3VYOA 2IEPA 1GGBH 5HHVL 5LBGA 4EIJA 1S3KL 5E6ID 5HJ3B 3I75A 1LP9A 4C46A 2H7HA 2YLHA 4GYBA 3A24A 2BSTA 2BRRH 2ZSWA 1B0GB 1NU1D 4FHKA 4UOW1 3BSZH 4WJ5A 2YEQA 4KKCD 5JHBA 5EO1A 4HUVA 2PPEA 4OIIL 3RFZB 5H94B 2VSKB 5C0NC 4WUUA 4FAAB 4RGNC 2YFNA 4NQQA 5HHOD 2WV3A 2DQGH 5GISH 3BGMB 1DBBH 4DVBA 1JI1A 5FYLD 2O1JA 2BY1A 1JN6B 5DWUH 1SEBA 5CD5C 1GC1C 2WOBA 2HJFB 2JIXA 3O2DH 4HAFA 3VFTB 5M1BA 4PTUB 4GLRI 3N43F 4RMRA 3I50L 5HI5C 3QT2A 5DMIL 1DEEG 4NJ9L 4P5TA 2JCCB 5BS0D 2QJYB 4PJDB 4P57A 2JKWA 4JF7A 2DWEB 5AVWB 2E74C 4N8CH 4KZDL 5EBWB 5EOQL 4B50A 5KAQF 3BP5B 4FLOA 2VQ4A 4XMKL 3IMSA 4MNQD 4L1BA 3M0DA 1A0QL 1PD1A 4KZ0A 3PIQB 1IL1B 4LQFL 4V2BA 1MJ8H 3RTLA 3VMZA 3SOBH 1IBZA 4KKRA 4AGMA 5EMYA 1OVZA 1L7IH 4D9RE 5J3HD 1DQKA 4U1HB 4LKCB 3T6ZA 4G83A 3OKKB 4AQ8A 3N7NA 1YNTB 2DQCL 1X9UA 3FTWA 3N55A 3L70D 4YXKL 1MI5D 1KTMA 1T83A 2MCPL 2IDFA 2RR3A 3KWWA 1FYTA 3E1IA 3H55A 3RFZC 2FBRA 1BMWA 4X7TB 2VLME 3FO9A 1DSWA 3TBVB 3HJEA 1WBYB 5BV7C 2WMPB 4FG0A 3QDJB 3RVVC 1FU1A 2OYLA 3TH4T 1FNAA 3M7FB 3WIIL 4LVNB 4YS4A 3I9IA 2DYPA 3X13B 2BXYA 2EXWC 2VDPB 4NRYB 3LRLA 5B8CB 5D1QC 2EEXA 3VXPA 4K2UL 1HJBA 1OGAD 1TNMA 5K69A 3HG1A 3EFFK 3LZNA 2IDCA 3HTLX 4Y1AE 2HKFL 4ASVA 5KSBA 3ZR6A 1ZGLP 1XCTA 3VE0B 1TYJA 3EZ8A 5SWZA 4XGZB 3R7QA 1SJXA 4D3CH 1UIXA 2IAMD 2WYHA 2Y7QA 1WZ1H 4P2RB 1ETZA 1KYOJ 5CJOL 5GGRB 2C7UA 3NQIA 1YEEH 3Q5OA 3ZO0A 5HYSB 2NYZA 4HFWB 4F7TA 2H7WA 1L0NK 5F89B 1HU8A 1UJ3A 2J4WH 3KNBB 2LHAA 4QRPB 3RDJA 4O2CB 1X3DA 3QEHA 3TIEA 4QKXB 1KEMH 1OWRM 25C8L 4NO0D 3B3IA 2NX5E 1KFMA 4B95C 1CE1H 3QE5A 5LXVA 3N1MC 5AZEH 3IMRA 4IYKA 1ZGLB 5C3IA 2XWJB 3NJJA 1FWXA 4UZUA 2D0HA 2POHA 5HHME 3AE6C 5FF6B 3IE4A 2OI9B 2BHFA 5GHWL 2OMYA 3FSAA 4DN3L 5IEHA 2X1WL 5APUA 3EJSA 2ZUXA 4PJFE 2KT6A 5B8CC 3ZL2A 2V2WB 5J4MA 3EXJA 2ILLA 5J6SA 1QI3A 3EJYD 1S4XA 3QFGA 2EICA 3WAKA 4AYDC 5TGBA 3U46A 2VSCA 5I23A 1MLCB 1HF9A 3BESR 3VXRD 2VABB 1F90H 4UDUB 5FUCE 3FKUS 4KNQA 1BPVA 3D4CA 4PJ9C 4LVEA 1M3IA 1AGCB 2D3VA 2O5YL 3PHAA 4JGMA 4X7DC 5FYKH 2VL5B 2GC7C 5MEQA 1TO5A 2DH2A 3KPRE 3NAAL 4KKLC 1L2PA 1JGDB 2ZCKH 4PHXA 4PV8A 3LCYA 4GP8B 3VCLA 2EDWA 4F7EB 1OVVA 3LMJH 2X7LA 3ZE1E 4X9FA 1JVLA 4MA1B 4XNYL 2IPKB 1FZCB 3MRGB 5I1KH 3OKLB 1ACYL 3A6BL 1RKRA 5TF1L 2YXWA 2Z4TA 4H20L 1X5ZA 1AJ7L 4X5XB 3P3SA 1JTHA 1QPXA 4A2EA 5EBMA 3QJVB 2KC0A 4KWUA 3OKEA 12E8L 1PG7H 1GL2C 3N5AA 4KHXL 5DZOA 4PJHE 4HG4K 1DH3A 5DTFA 4JFYB 5EA0L 2P80A 2OI9C 2IFFH 2QR0A 2NLJA 2GK0B 2WW8A 2YPKA 1CTOA 4FNQA 4NQCE 4HCGA 5JOEA 1DDHB 4N78D 3V0DA 5C7XL 3TYGH 3BQVA 3OAYK 3WD5H 5BV7H 3KPSB 1O6TA 1SNRA 1U2CA 3IFMA 4KUCD 5IW1A 3DETC 3ZIMA 3ARPA 2KKQA 2WK2A 3DIDA 4P2YA 4B5ZA 1OCRB 4HZLB 4OZ4B 4PJFF 1MAKA 2N0MA 3B3BA 2K7PA 1QRNE 5FHBH 2QVFB 4PD4D 3IWUA 1FJ1A 3MRDA 3FH7A 4Y2OB 3V6FB 4LGRB 1P4LB 3FUKA 2VDQL 4N2DA 4NNYB 1H0TA 4X99A 3QO1B 4QRQB 3VSTA 4LRNL 1EFXB 2AQNA 2FIRT 2HT3C 4U3HA 5SWSE 2JF1A 1EX0A 1FA4A 4L8SB 4PRIE 43CAA 3LN4B 4UQEA 4EDFA 4MA1C 1WDAA 4XAKE 3F7RA 5HHOA 1T2QH 1HCFX 5T33H 3SYQA 4PJ5B 4ZTPL 4NPEA 5IMKB 1NMBL 1TQBB 1TDQA 4HXAH 5BUAA 3DI3B 2NY0D 1IO4C 1IC4H 1XIWD 5FOBB 4QOKE 4U4BA 4HU2A 3ZE1F 2BSSA 6CGTA 2J8UA 4G7VL 2IFGA 3KQGA 2KMWA 2ZUVA 2R0KL 5LAXA 3S7GA 1TQWA 4U31A 2VQ1A 1JK9B 3BRTB 4ORGB 1OCWH 5HPOA 3HN5A 4Q0XL 2G4GA 5DVLA 1DBJL 4LASH 4TSBH 2HYNA 1SQXJ 1LXMA 3CZJA 5C71A 2V2XB 2YK1L 2PABA 5HYQA 2PAJA 3CX5D 1UUSA 2JJVA 2IH1B 1KXQA 4PH8A 4PJHF 1W72L 4CUCA 1M2OA 4PV1D 4BKLB 3AEDC 4GQPH 1AP2B 5BOJA 4XNMA 1MCRA 4LGSB 2CGRH 2RKLA 1NTKJ 1T2JA 1WCBB 3NFNB 4MNQA 1EGJL 2ZYIA 3V6ZB 2G8YA 5JIDA 1MRFH 2BC4A 2VLLA 1NKZB 1ETJA 4JG0L 4BZ2A 2BNQB 5KJRH 4WF7A 3H1LD 4RZCB 5DZVA 1LTBC 4CSSA 5C1MB 5IB1B 2CO7A 1JNLH 4F2FA 1PPJD 1ZT1A 4PS7A 5FYJE 4PREA 3WUWA 1BVOA 1AA0A 2IYOA 1OEZW 3BDYH 1V7NL 2VLKE 4U6XA 2KLTA 3VFUB 4TSAL 4P4KC 2ADFH 2OR9L 5C2UB 1IQWH 1QLRB 3GBML 4U05A 5DI8B 5DRZA 2OXHA 3QEUA 4KJWD 1JEKA 1MCPL 3AGVA 3WUUA 4I3RH 4B0MB 5APQA 5C7ZA 2C3HA 2RCSL 5F7FA 2YSTA 3UYPA 3WLBB 3ZJAA 3ZOAA 3US1A 5FK9B 3CMEP 2DQUL 1NPNA 2EYSB 4FQQA 4I4WB 2Q1EA 5CCGC 1I1FB 1L9NA 1OIOA 3HHRB 3HRZA 1BEYL 2ZXXA 1JK8A 3T4YA 3QQ3A 1KCVL 3CCEP 2CQVA 3KYNB 3W9DA 4G7YH 2K6WA 1X5GA 4U1GB 2DM7A 2XIBA 4IHOB 3POHA 3HN8A 1R47A 4JFFA 3O4OB 3T2OA 1SM3H 2IGTA 3NCYS 5BJTB 4G1MA 1SZNA 3UDWC 1VQ5P 5D2NE 9PCYA 3UAAA 4TNFA 3WENA 2PWHA 3R8QA 3W57A 1H15B 1BSNA 3L5XH 3Q2CA 3CHOA 2FWOB 4YOKA 5J89A 1NFDA 3D85A 2ZP0T 3MRIB 1BFVH 4NQDE 4L4TD 4W70A 4N2MA 1KUMA 2BP8B 3EOBB 3RIFF 3F00A 3NABL 5KVGL 3CCLP 3SE4C 2NYYC 3NPSC 3ETBF 1RL1A 2FBJL 1BFOB 3UZQB 1MJUH 4UINH 1LWUA 4NO0A 3FOLA 1CGSL 1M6OA 1HKFA 1KPVA 1OB0A 4BKSC 4IRSC 3D09A 3DVFA 4KQ4L 4UT6L 1Q0YH 4POZC 1OW7A 2ZKMX 3HNTH 2AMUA 4HAKA 4J1UB 2LV4A 5BO1H 4NWTL 1YNLL 2ZXBA 3GI8L 2XFXA 5F7UA 1IAIM 3FC8A 4JFTA 5CSZA 2V17H 1SFDA 5EIIG 5FUZH 3RVTC 1LEKA 4AXWA 4AEEA 3A3YB 1T6VN 4NFDA 5EBGA 5CCHE 3UYRL 4QTHB 1ZLVK 3K74B 3CXHD 4LLMB 4OZHB 3BGFB 3IGKA 2O6DA 2VZOA 3OAUH 2BOBB 1SFCC 4Z7WE 5JUEL 1RHZB 2GFBA 2IDSA 1OVUA 4MXWH 3WO3B 1MJJB 3O4OC 2DQJH 3U1QA 2WXQA 4E36A 1D5IH 3G3ZA 1SYSA 2H9GA 32C2B 2RA1A 2X88A 2XXFA 4XO8A 2BHUA 2OMVB 1G1KA 2ZICA 2W1NA 4PJIB 2G3NA 4JJOA 5J1AA 3GRGA 4NIKB 1CL7I 2CO1A 1Z0NA 1U8MB 1VFAB 3KPLA 3K7UA 3V8CA 2WB7A 3ETBJ 5C0EA 4HS3A 3RWEB 2Q8AH 4N6JA 2C9LY 4JQIL 4S1QL 2WN3A 2IBZI 1U8LA 1QNZH 2M83A 1VAHA 1FNEB 5AVSB 1UJTA 2SEBB 3ECBA 3P1VA 4WSJA 4D94A 3GWJA 1EERB 5I8OH 1C5CH 3FDWA 3E3QE 3CFKB 2QJKC 5KLIB 3HC0B 4H44B 1SOSA 4X4YB 5HYJD 1BYOA 2D8KA 2G5RA 2VXUL 3F84A 5EBLB 4FJZA 2R83A 1BIIB 2XZZA 1WZLA 1R3JA 4OLUH 2IANE 4GDOA 1OSPH 5E08H 4HJ0D 2V5YA 3I9AA 4X6CB 1HOCA 4U7MA 5CGYC 5BVJA 4NZ8A 2TAAA 3BVNA 3ZQXA 1L7TL 4MAYD 2W9LA 3V0EA 4YHOL 4HIPA 4BFKA 1FHNA 3TASA 2ZP9A 1ZV2A 5E8DL 5E0FA 3IM1A 5EF0A 2GTQA 1NTME 1MIML 2P8LA 2BSTB 2WWKO 3FN0L 4R97B 3IKCB 1MRCL 4I7ZB 1N59A 3J07A 5BZWA 3WKMH 3UROR 1ONQA 3CH8A 5EO1B 4HUVB 1I82A 1G9NL 2XTJC 3P3YA 1HT6A 4BUQA 4Z7WF 4PWGA 3L5IA 2TSAA 2WXGA 3AVEA 3WBDA 2MKLC 5FO8B 4UT9H 5DHVA 1EXIA 1EHAA 3DOSB 1NO4A 4G6MH 1DQDL 4K23H 4Z7OB 1PIFA 3KYKH 2YO2A 5DJ8A 5F7KC 2Y1AA 2NY4D 5A40E 3BUPA 1G7MA 2QLVB 5FDYA 3QJTB 3F85A 5J9PB 3L72G 1S7VA 2XV5A 1QGKB 2OL3L 1WAEA 1RJYA 2VC2H 2FQFA 3TGUD 1JD7A 1UT2A 4AQ1C 2ADIB 5KLIC 4H44C 1FE8H 1D7FA 3H56A 2NQCA 4BJLA 3MV8B 3FYIB 4DK3A 5FO2A 2VXSL 2F74B 3RPIB 3FJTA 3EJZD 3Q2NA 2N3JA 3MLZH 4O02H 3D2TA 1PP9J 5E4AA 1SQXG 2CUHA 1LK3H 5E00A 4JPWH 2DIAA 2K1MA 3MV11 3VW3L 3AG1B 4GSDH 3FFCE 1MLBA 4TTDD 3VACA 3H1IJ 4XBEL 4L4VA 5IBTH 3IDGA 1NTKG 2CA3A 4QXTA 2XI9A 1JMXA 4E9TA 1YYLH 2XC8A 3K0WA 4PRHB 3AXLA 3KWWB 4NT6B 2Q1KA 3S3BB 2ZXQA 5JDSA 4H4NA 3MRKA 2OW6A 2OQQA 3FO9B 5DVMA 5IVXB 1GW3A 3WAJA 3Q8CA 1TTRA 4J6IA 4QDGA 2EDFA 2DYRB 4OZFG 2QVAA 1NCNA 1R0AH 2ESVB 2GBTA 2OK0H 2DYPB 4UOJA 4Y19D 4OJEH 3FT2A 1DQML 4G8EA 3VXPB 1CXEA 3V7AG 2EE6A 4W93A 5C97A 5EHFA 4IU3B 3PUUA 1MF2H 3HG1B 4P5TC 4DEPB 1GA2A 1OALA 4OB5H 5KSBB 4WW1A 4OGQD 4JDVB 3TWCH 5F1IA 3FMGL 5SWZB 4E42A 1UATA 4FQJL 1AZCA 5D2LE 4XC3L 1E4KA 2Y7QB 3QO0B 1WK0A 1GW0A 4HUUA 3KLAB 4MFHA 3GHGA 2NPSD 2PW1A 5ALBH 4MZRA 3U2SA 5KVEL 1X9VA 1NANH 1S5HA 1K4DB 3FXIC 4PJAE 4PRPB 3X12A 5C0CE 3M0DC 3KBFA 3N4XA 5K1VA 1FP5A 2KDGA 1HXYB 1OANA 1CICD 1CK0H 4EKXA 3TCLB 1UJ3B 2YKLL 5BMFH 3UZVA 5IGXL 2EXTA 4HGMA 3L4ZA 3GUTB 2OGUA 1FLRH 3RUGE 4AQ8C 4M4PA 4ZUUA 1E2ZA 3P9LB 1G1IA 5LDSA 3B3IB 1X9QA 3S36L 2V0AA 1T83C 4RSYA 5IB5A 1CFBA 4KTDH 1VFMA 3MJ6A 2QE7H 5LBSH 2D2CD 2AGJH 3CUPB 3US0A 2H43A 4LT7A 3FQXB 3WHXB 1O9WA 2OMYB 1K04A 2BVPA 1ZIAA 4NKOA 5IEHB 4K9EL 4OGYH 2JKJA 1S2EA 1HINL 1PFIA 2I24N 1IC0A 1F8TH 2J1ZA 2VDLB 1ZLUH 3BCDA 2HFGL 4N3UA 2QA4P 1HJBC 1CF8L 4N8VB 2NY1B 3HC2A 3BISA 2HODA 3TBYB 2CKNA 4L18A 3H9HA 4A2GA 1B3JA 1MELA 2X9ZA 4JDTH 1JZDC 5EPMA 4ZMDA 3IDNB 2RTTA 3WJLA 1HC1A 2ZCHH 2WXMA 4HKXA 4MAUL 1KNOB 5MEQB 4PTTA 3OSKA 2WXHA 4KOCA 5DA0B 5EN2B 5D2LF 1QFUL 5JLZA 2IV9A 1P7QA 3VCLB 3KG5A 4AG4H 2IQ9H 1UA6L 1UJ3C 3HUJB 3UXFA 2V5SA 2ZCZA 4QAWA 4PJAF 5TJHA 3OKDA 4H1LA 1ZLWK 3VGAC 1XMEB 5IR1B 2CHZA 1SLUA 2VMCA 3VDCA 2WLMA 1CD1A 1NM9A 1E5WA 1JTHB 2FNWA 4GRMA 3OKEB 5AENA 3RUGF 3A47A 3CMOH 4N8UA 5DTFB 1WEJL 1JXFA 3BPLC 2QR0B 1F6AA 5IUCA 5KAIE 3L3DA 1E27A 1P84H 1BCCD 3TO2A 2VW7A 1U4FA 1IC1A 4K07A 3UGUA 3ATFA 4B86A 1OCOB 2GW5A 2IH3A 2IWFA 2FQDA 3T0AA 2M26A 3X17A 3P0VL 2BVOA 3KXFD 3WTSA 2I26N 3FQWB 2DJMA 3L2NA 4MAYA 1XF5A 2N01B 3LIUA 1FJ1B 3MRDB 3HMXA 5F96H 1K5NB 1KPRA 5E6IB 4DZBA 3HE7D 3JTSA 4WU5A 1DQJA 2FYUE 2IWGA 4JZJA 2WPGA 5LBVA 1E5YA 2OMBA 5FECA 5GTHE 1JNMA 2CIKA 1MJ7H 1LDPL 43CAB 2AJXL 4JRYD 2I7OA 3PL6D 4XX1G 1QFWH 5HHOB 3A6CL 1W6LA 4NC0B 1L3WA 5AKTA 1G5GA 4G72B 4B5EA 3LS5H 3KEDA 2HFED 2WLHA 4GMTH 5AVZB 1X9RA 3MBXH 3ZZLA 2BSSB 3QFJD 4MZ2A 3L73E 1F56A 5T3XH 1FNLA 5CHXA 1S3JA 1ZT4B 5E1HB 2VQ1B 4B96A 3ALXA 3ELQA 4WCYL 4DP5X 1SF5A 2P8PA 1GPOL 3Q9QA 5JW4N 3M8OH 1UC6A 2X70B 4QJ5B 5ISZD 1IK7A 2EO9A 1X4YA 3BGAA 3GDBA 3IAPA 2FO8A 4FQ2L 2XIIA 2GPZA 1V5JA 4FEMA 3GSRA 4MNQB 1PP9G 4EDWH 4EIZC 3L74G 1RULH 4NM4H 4OV5A 1E8WA 1D9KD 1N8ZB 3DRQA 3MREA 1L0QA 5DUML 3RB5A 3WEMA 2CGYA 3WE1A 3HZ3A 1XAKA 3H1IG 1A21A 1ZT1B 4PGDA 4AW7A 1HNGA 4KNTA 1KGCE 2WXPA 4K8RC 1CIDA 3H9SA 2N1TD 2K3RA 1NAML 1WV7T 4U6XB 4A68A 1JGIA 3QDGE 3IMTA 1TVDA 3N85H 4JFEE 4KKCC 2FBOJ 4EZKA 5T1MA 2FLRT 4B9ZA 3NCWA 3VFVA 2CCWA 4J2XA 4JFVA 1I1YA 4FQQB 5BZZA 3U0TA 4KO5A 1ZLSL 3GHBH 2R2HA 1TZAA 2IADB 2V7QJ 2VE6A 1JK8B 2YC1B 3T4YB 5GZOD 1U7JA 5DU7A 4Z7NB 1Y9BA 1OGAB 4KFZC 5EOCL 3GSVA 4MKTA 4B9IA 7TAAA 5CMAA 3I6LD 2H2SC 3N9GL 4TN9A 3S6CA 4PW9A 3KDMB 2IAMB 4WEBL 1J5CA 4QHNB 1P2CB 4QRUA 2EDMA 1ESOA 3ESOA 3ETTA 3U6RA 1S5LH 2XVGA 5JA9A 2VDLH 1DDTA 2R23B 1UD4A 3MUGA 1CR9L 3ULVL 2VIRA 2ZWZA 4XNQA 1CICA 4CN4A 2EO1A 2GVYA 4NHUB 1IBHA 1BD2D 2WVUA 3MODH 4QHKJ 4U3SB 5IF0A 3O3DB 4D2NA 2QSIA 1I31A 1TKWA 4YK4C 5FGCE 3WKNA 2VDRH 4EDXA 2FYUJ 1LWUB 4NO0B 2VSDA 3FOLB 4QHPA 4XP4L 3S3CB 4MX7B 1KPVB 1V27A 4ZT1A 5E95B 4PJ7E 2Y0DA 1K8IB 2Z7UA 1OF2B 2XFXB 1DANT 3S97C 5CSZB 4PJCA 5HYFA 2NY7L 1JFQH 3KHOA 3MRBA 1CL7L 1LEKB 4BK5A 4ILDA 3IE9A 1LP1A 5SX4I 3MJ7A 1G9EA 1EQ7A 4JO1H 4HKZA 4HH9A 5MHSD 4G8GE 4L8DA 1I4FB 4M48H 3V4UL 1WA2X 2FEEI 2GFBB 5D9SB 3VDAA 5I0XA 1IJ9A 4BDVB 3QJFA 4L0PB 1F42A 3GSWA 1SYSB 2WXJA 2JQMA 3TN0D 3V0AC 3FUFA 2EVJA 3C1LA 2KLSA 3L4UA 3VX1A 4L3AA 1FAKT 3UJJL 2QLYA 3ULAB 2AQ3A 3NIFE 2FIKA 5C0EB 2I8DA 4CMHB 1HQRA 3UTTE 3AAZB 1B9ZA 5AAMC 3MRLB 1AGBA 3CE1A 2B1HL 1X6LA 2A9CA 1LWUC 1KIQA 3DBXA 4LVHC 3ZTEA 1VGEH 4JFDA 5DJ6B 1KYOK 2PMZA 1OZUA 3OJDB 3PHLA 3EYFA 3K8KA 5J6HA 4K8RH 5J11B 2Q76B 3HPLB 4U0RB 5IK3B 4XPAH 3GB7A 1X0TA 1YHQP 5KYWA 5EU3A 3INUH 1D5ZA 4GQ9L 1F13A 1NJIQ 4UV4H 4F8QA 1HOCB 1NIEA 4ANUA 3O3BB 5BVJB 4PJ7F 2IH9A 4UNUA 2FCBA 4R9HA 3QR1A 3LKRA 3PQYE 4WFGD 3G6EP 2WUCL 2V9TA 2NZ1A 3WFCH 4D0BB 3KXFA 4ZS7H 1ZTXH 2P8LB 2BP5M 5BZWB 3SE8L 3ETSA 3O2VH 4Y4FA 3TX4A 4PV9A 1JGUH 4Y4HA 1HILB 1RK1B 1KXVA 3O6ML 3QEQE 3ZQ9A 4AEHH 4LBAA 2UWJE 1B88A 3PJSK 1Q8MA 4I85A 4BSVA 1Q0XH 2BNRE 5TQ2L 4RGNE 3QPXL 3ASNB 2F0CA 5C0BA 1EMTH 3O81A 2WTOA 5DJ8B 2VZTA 2ALAA 5HGBA 1G7MB 5LNGA 1EO5A 1YECH 2QJPB 3L35A 1T0MA 1W72A 3NCJH 3QZNA 1YRKA 4BZ2H 1S7VB 4YXWH 4ZQTA 1E4XH 1Q9LA 3NIFF 2HAZA 4M43L 3ZBMA 5DEJA 2VDNH 2NY0B 2R44A 4FTVD 4V1DE 2L8AA 3Q6FA 4JM4L 1C9SA 3NK4A 3QFJA 2C9NY 4ZX6A 1EGJA 3K4AA 2YD6A 4WGVB 3TNNA 3VD2A 3SY0A 3SN6N 4U0RC 1VF5D 5B5EH 3NACL 5E9DE 1RD6A 2VAAB 3JWNC 4PRDA 3THML 1WBXB 1M53A 1RF1B 1GYCA 1FG9C 1QBLL 3RA7L 2ICEB 1I7UB 2GJ6A 2X1XR 2K78A 3FU0A 1Q9OA 4PV1B 5KVFL 5K33A 4JCMA 4WGKA 3CCRP 1VQMP 1UZGA 1ZLUK 3CSBA 3WHE0 5IW3A 5CJBA 1CSBA 4FE9A 5JIHA 3IDGB 5LXGH 3Q9PA 2F6AA 5KANG 4XVJH 1A7PL 1J18A 3AB0C 3ZHFA 3NZSA 3FU7B 2MPVA 4I9WE 3VB9A 1R19A 3I3BA 5AW0B 5F6HJ 1JPST 4Y9FA 1ROWA 5GGRA 3SPVA 4X8GA 1UB5A 5JDSB 4DIXA 1N6VA 3WXVH 1NINA 2ITFA 1X5JA 2WZAA 1BZEA 2YMYA 1XGRA 2P44B 3QDHA 2QHLA 3SGJA 3VFPA 3ZTNL 1KCRH 2H45A 4RMUA 4YLCA 1U3HA 3U6XA 1ZMYA 1ORQA 3DWTA 4WNQB 2FATL 3WTTA 4ZO8A 4IKJA 4XOCA 3M86A 4XNDA 1RUKH 5I8CB 3QCUL 1OPOA 3ME0A 4Z1MH 3GBEA 2FO4A 1DJIA 1TU3F 2WXKA 1UASA 5D1QE 2L04A 5DD5H 4AQAA 4Z23A 3U7WL 1IAOA 5GGSB 1F4XH 1T1ZA 4WW1B 3HG0A 4CC1A 3QI9D 2V3FA 2Y0EA 4K35A 4NO2A 5ECGA 3MN8A 2JCCE 4MMYA 4E42B 1RF1C 5GZOA 1L9OA 4WJKB 4PJDE 5IT2L 3IEAA 4UT7L 4H0HB 1NQBA 3JTBA 4G1EB 1JO5A 2UXGA 5DJ2A 4F2MB 4WO0A 1LYQA 1DR9A 2BFVL 2UXTA 2V4LA 1S5HB 3X12B 3QC5X 1A3ZA 3KS0J 4PBVC 2D3LA 2YIUB 4PV1C 3QG7H 1TZHB 3QORA 3FFDA 3UZVB 1ACXA 2DQTH 4UT6A 4HXBH 4WEUD 1KQSO 2IG2L 4ZUUB 1IE5A 1JF6A 1VFBB 5G4OA 1EEUA 1IQDA 1XBDA 3DDGA 3OKMB 4P07A 3VMPA 3ARSA 2VLRA 3ZT5A 3L08A 2MTPA 3KJ6L 1SQXK 3HB3D 1J8RA 2GJPA 4HWZA 5D5MB 4HUCA 2QIWA 4DTGH 3S96B 4TNEA 1D5RA 1HWWA 1O6SB 3FUIA 4JZOB 3FBQA 1NTKK 4XN1A 3V2AR 3OKYA 2D7NA 1MFBL 1HXKA 4P5MB 4BGLA 2W91A 3O3EB 3QCTH 1WUZA 4U3XA 4OLYH 1VQPP 2HODB 1QACA 4AYCA 3KPTA 3PUCA 5A16A 1ID2A 5DK0A 2X41A 5EPMB 1E4KC 3AUWB 2O61B 3OW2O 2O01N 1NCAH 3QK0A 1OLZA 4EIGB 3GHGC 2XIDA 1ZAGA 3V2RA 2ZXCA 3L81A 4JQIA 1GGIL 3T71A 3U9PL 5FM5M 4BFNA 1KILD 3E6HA 1AY1L 3F12B 1YEHL 4P2RE 4PTTB 1DJXA 1E8ZA 3JWNH 1C7SA 4PUBL 2DBLL 5AYTA 2JCCF 4AUJA 5I17B 5E94A 3A4FA 4JB9H 2LLLA 4PJDF 5AW5B 3BT2L 3JCUE 1E6OL 2HX9A 1LEGA 4AEIL 1XF1A 1UKSA 3L95A 1WTGT 1G7JB 1INQB 1NJ9A 2YD4A 3KGUA 3NSJA 4QRPE 3GXUB 4Y2DA 1BYNA 2IV8A 4LK4A 2EUXA 4U1IA 3U2IA 3DSFL 5AWNH 1SOQA 4L37A 5T1LD 5CINL 4FZ8L 3CWBD 1H3WM 1WF5A 1HSBA 3A22A 1LJ2A 4GRMB 5GRXG 1IFHH 4FFTA 2QQNH 1UYWL 4ALAL 5FR3A 1J9QA 2O93L 4OM0H 1U36A 4NBYB 1YNTF 1T0OA 1ZSHA 3DJ9A 5DHVH 3TO2B 3ARXA 5HYJB 4P9ML 4JANA 3UIAA 3LD8C 2AHIA 1MCFA 3GJFA 1LJMA 2KLRA 1IC7L 3PJLA 3F5WA 4MBRA 3ZHLA 3VRIB 1OGPA 2AJUL 5CU9A 4Z76A 1ZVHA 3DECA 3RBXA 1OB1B 3JZ7A 3QPKA 3EOTH 4MAYB 3SQRA 3GGWA 4CVWA 3DTUB 1GKOA 3O3UN 5CU5A 3WJLC 3ULUL 1Y8AA 5IB4A 2C3XA 1KCUH 2OL3A 4FMVA 4XMUA 5D4IA 3RHWF 3AU0A 4JZJB 1USEA 4LOFA 2GSGA 2DAVA 3FCGA 5CFHA 4KXBA 4W9CC 5HYIA 4YXLH 4BHUI 2CIKB 4B3VA 2TRYA 2J6EL 3AS0A 4IBYA 3QULA 4WNSA 4Y2NA 4XC1L 2ZPKL 3GXTA 5H8DA 4ZK8A 2P8MB 3D51A 5KTEH 5IFHH 1KTKE 2AXGA 4WO4A 1NUNB 3KR3H 4M00A 5CO1A 3V8OA 3VFWB 2NY4B 2A45I 1OP4A 3MNZB 4IKKA 3AGWA 1HEZB 2UX6A 4BQ6A 2A9AA 1KXHA 4Q6IB 4U6YA 3DX9A 5B38A 1FPTL 1AKJA 4OLXL 5ELIA 3IGUA 2HJKA 2ZE0A 4FTVA 1K8AQ 3IYLW 1F0LA 1PLBA 1QZNA 2ZAIA 1EZUA 5AZ2L 3HE6D 2VR6A 5HDQL 4JY4A 1PIGA 5CEXA 2CHDA 3V79C 1NOHA 3ZDZB 1NGQH 2WSEH 1KJ2B 4DEUA 3TFBA 1EEZB 5B39A 1ZHKA 5I30L 1QLFA 1ND0A 3GSRB 1NAYA 3G6DH 3PXHA 4AK2A 1FZFA 4OV5B 3L75D 2AV7A 1TQCC 2ENJA 5IIEA 2VDOH 2A6DA 3DRQB 2VZSA 3MREB 4MAYC 5EU7C 4BXVA 1Q90D 2BCCD 4QHLA 3SDXA 2MPAL 4HPYL 2OLDA 3C6EA 1N6QL 4PGDB 2JWDA 1I1RA 4W9LC 2H6OA 3MUY1 4JZJC 5K93A 4ELME 4LEXH 3B1UA 4MJIE 4W9JC 2NMSA 4X5LA 4H0LD 1KTDB 3VD9A 5FC9A 5EU5B 4XNBA 1KTCA 3LNGA 3VD0A 3VFVB 4A7SA 3NTNA 3FT4B 1DTUA 2Z7WA 3TBCA 4JPKL 3IFPA 2OJZL 2R56L 1I1YB 4PJ5E 3DIVA 4WLCA 3VWKD 1AMXA 3EHBD 3H54A 4YX2L 3QISA 1HN1A 4ONOA 3G6AA 3GXFA 3IMVA 1X7TA 5T1DH 4Y19B 5IQ7H 3NFSH 2VE6B 5EIVA 2YNYA 4ODUA 4GO8A 5CCGE 3RVUD 1TTFA 3KBPA 5IMOA 1JRHL 4RESB 3GSVB 3AUVA 4XHQA 4PRNA 4RGOL 5CMAB 1A7NL 3U1SH 3WN6A 4AYFB 2A73A 4OGQB 1U3NA 2MQ3A 4QF1B 5I5JA 2P1YA 2XQ0A 3PWLA 3QEGL 1AO7A 1FZBA 1UXSB 3RIKA 3JV4B 2B1OA 3RTQA 1X7SA 1R3HA 1G6RB 3EGDA 4OF7A 2NPSB 3U6RB 2WLLA 4QYOB 2XN9E 1SQBE 2GITA 2ZSVA 5I5MA 2D0FA 3OXRB 1G94A 2DV6A 3MUGB 4UQBA 1VQNP 1H8NA 2VIRB 3BKMH 3NIDE 4XNQB 4TTDC 4AK1A 1CICB 2P42B 1FL6A 2BSBA 2DJUA 4FABH 3Q44A 4W4OA 2BNQE 3VGFA 4L1SA 2N9YB 2HRPL 5EC1A 5DD3H 4JRXA 4C56D 1TKWB 2CO3A 3D69A 1G7QA 1F18A 1RUQL 3ARDA 2VR3A 2ZWNA 2D4DA 4EDXB 2AJ3A 3TYFB 1S72P 1NFAA 4Y16D 2AZUA 1U2HA 2D2CB 2ICWJ 2E42A 3HC4L 2J57A 1YQ2A 3WSQH 4ELMF 3QZWB 1AQKL 2XZCH 4URTB 3IXTA 4ELKA 1ZVNA 4CKVX 5ID0A 1DANU 4B9KC 5I16B 4H1LH 1TETL 1C5DB 4X4ZA 1VSCA 2G9HA 4HH9B 4LSRH 3L13A 4L8DB 4X80L 4ZUSA 2G3AA 4WY4A 2FUTA 5JPMA 3DURB 2YXMA 4OGQC 3T1WA 2FT7A 3QJFB 1GZLA 2AV1A 1Z9PA 4PCYA 3GSWB 1MVFA 1WMKA 1DLHA 4GKOA 5HHVH 1GJIA 1S3KH 1R3IL 3EBHA 3EYQC 5BNXD 4YDVB 2BO0A 4UOW0 3MUJA 1ROCA 3ROOA 1HYSD 2W90A 3DGDA 5DLMH 5E1IA 2ITDB 3ZYOA 1J11A 3AABA 4OIIH 1IT9L 1B0RB 1YEKL 1CICC 2ED9A 4GKNA 4PR5A 3Q01A 5ICYB 2GJRA 4M7LL 5CM1A 4QI3A 4EBQL 1WIUA 3NIDF 1URQD 3HMXH 3FTXA 4LLUA 5T1LA 4EQ2A 2HX8A 5DJDA 1U8NB 2F1BA 3O6KL 4XOBA 3I50H 1AQDA 1MCDA 2B7DT 5DMIH 3V5HB 4OQ1A 3GB7B 3RL1A 2K3HA 2TRHA 4NJ9H 4DPCX 5KYWB 5EU3B 5HD8C 1A3LL 2Y07L 5JORB 5IJVA 2VDQB 3B2DC 2PCYA 4YEFA 1B4RA 4QD2E 3NJIA 1BJ8A 1FFPA 3CTTA 4AGQA 4ZMWA 4TUJA 3PH0A 1A02J 4BK5C 5EOQH 4KZDH 3LKRB 4XMKH 5JTWA 4ODXB 3EDFA 2Z0UA 4RH4A 4DKTA 2I69A 2OFQA 4J27A 3KXFB 3S3SA 3SKMB 3CSPA 3G3LA 4PJ8D 4LQFH 2X6MA 3SQOL 4D8PA 1LGHB 3CVIH 3TF7C 4GO6B 5LVEA 3QPQD 1E42A 3DRTA 2VQTA 5EU6D 1SY6L 5KN5B 4FXTA 1QPPA 1UWEL 3UGXA 2CLRB 2DQCH 3HE7B 4I9XA 2XTJE 1SQBJ 1QSEE 4BSVB 1IFGA 4P49A 4YXKH 4WB4A 1VQ7P 1WVZA 3CN4A 3AXHA 2C4FT 1ZXKA 3DX6A 5DRWB 2NDGA 2KLUA 1JZ5A 2IOMA 3CVBA 4JRYB 1R9FA 3PL6B 2DLGA 1W72B 1RUAL 4B3EA 2ZTBA 5J5EA 2RQEA 4ANKA 1Q9LB 3HNSL 2R0LL 4A6YB 1CE6B 3T0ED 1EZVX 1MWAL 2HFEB 3CFEA 3WIIH 1QVOA 3QFJB 1F2XK 3TNNB 4K2UH 4PRDB 1O7DC 3LEXA 1C5BL 2ZKHL 2Y72A 2HKFH 1M90Q 2YUXA 3QZBA 4JDEB 3MROA 4OJCA 3SE3A 4QRSA 1Q9OB 3MBWB 3ZQWA 5ISZB 1NAMA 8PAZA 1JVKA 1X5HA 2ZKYA 1CZ8L 1KY6A 1WFNA 1XGYL 4X6CE 4MQSB 3I9PA 1ZHNB 3Q8EA 4D0DA 4LL4A 4ANVA 2FD6L 4NCC2 1J0IA 1P1ZB 2C9VA 4JY5L 1D9KB 1IX2A 3EQ2A 5APVA 2KZWA 1LP9E 4OUUA 4Y4FC 4Y9BA 5DC2A 3G5ZA 3PF2A 4Y4HC 2FECI 5DVOA 3OR6B 5EOTA 4XE0A 5AAPA 1UB5B 4G5AA 1KXVC 4ZMQA 3FN9A 3MRFB 5DYFA 1FC1A 2O26U 3HE7C 4F58L 5I0ZA 25C8H 2N1TB 3FQRA 1JWSA 3BJLA 1IJDB 4E0RA 4MDJB 1P84E 1AXTH 2IVFC 4X9IA 3M17A 4FG6C 3ESMA 2NZIA 4Z7OE 1VRSA 2WWKT 3BH4A 1NTZE 4MJ6A 5IHBA 1N2DC 2PTTB 5GHWH 3UOAB 4UB0L 3CPUA 3ME0B 5HI4D 3Q5TA 3T77A 4YE4L 4AYEC 1A1OB 1V54B 4RDQF 4DN3H 4Z3IA 2ZT9D 1BM3L 2ZUUA 4XZ4A 1X5IA 3S3JA 4R4BB 2YRZA 1FFNA 1NKRA 3RFRA 4TL5A 4MMYB 4GP5B 4F80A 1IIKA 2I32A 4HALA 3WTYA 3DX4A 5ADOL 1JHTA 2GIYA 1XB6A 4AY0A 4J2QA 1BSHA 5LKNA 2GY5A 3PHOB 5GS2D 1I75A 4BXSV 1YAZA 4CRPA 5E9NA 3BCCD 5DK3A 5EORL 5GGTL 3IJSA 2PW2A 1RUML 5AG8A 5HDBB 4W7ZA 3BKCL 5CP7A 4D9QE 2NZ9C 1T7YA 4HKZH 2G3MA 2JQZA 4X6CF 2X4OB 4BIKA 4LEOA 2AK4D 5E5MB 5T3XE 3T97B 4XNYH 1TLKA 1BD2B 2UZIL 3F6LA 3KYQA 1ACYH 3A6BH 4PRHE 1SXSA 5TF1H 7FABH 1FORL 1FYTE 4H20H 4WI5A 4W9KC 2HRGA 1AJ7H 3SGJC 1LP9F 3DUHA 3T3PB 1U3HC 1CFSB 1JV2A 4YXHL 3WY4A 1R24A 5IVXE 5TE4H 3WUZA 1XR9B 3ZN6A 2H3KA 5EA0H 4KTYA 3VFGH 5F3HA 1AMYA 4BQ8A 1IGFL 3R2PA 1F45A 2OS7A 2P26A 3OBAA 1YEDA 3U0WL 3U36A 1QFOA 5C7XH 1JCVA 3R4YA 4Z7OF 1S7XA 3QRBA 5DK0B 4ADGA 3HG1E 2DQDL 3VTAA 5GZOC 2OMXA 2YKKA 5KSBE 1TCRA 2EIBA 4S1RL 5SWZE 1WHPA 2C3VB 3E6HB 3QUGA 1UKQA 3TN0B 2H89C 2W9DL 5L9DL 3QORC 4N90D 1BZ7B 1VFOA 2EAEA 2VDQH 1UWGL 2J6WA 5I1LA 4KRPC 4Y5YA 4LRNH 3HRPA 4HDIB 2Y3AA 1L5GA 3NZ8A 1EXJA 4AMXA 1CBVL 1N7ML 4U1IB 5FOBA 3WTUA 2OMZA 2VT0A 4N24A 3W67A 3G9AB 4ZTPH 4FLQA 1NMBH 1UD8A 2FAUA 4EIUA 2GAZB 1XV8A 2NDFA 4JLRB 4G7VH 3MXVL 4M5YL 3VU2A 2YAEA 2EDRA 2B89A 3DX7B 4X0KB 3TJHC 3UMNA 2C26A 4AH2B 4JDZA 5I6LA 3BSHA 3HOGA 3DUUA 1NSNL 4Q0XH 1NTZJ 2BK8A 3GJFB 5DJAA 4YWGL 1QEWA 3F5WB 1EJ6A 5HDOA 2YK1H 3ARFD 5IVXF 5AW6B 2VXVL 3D6YA 4QXVA 3FL7A 3G5VB 1W72H 1AOHA 1HIML 2ED7A 4WSGA 5I74C 2JKIS 3HAEB 1SQQG 2O01H 1EGJH 1OLLA 3OB0H 1AZUA 4LDOB 4JG0H 2OL3B 2FK9A 4PJ8A 2C34A 1MG2C 4IOFD 3MTUE 1NM4A 2GSGB 2L5GB 3B8SA 1GTFA 4HBQA 5KSBF 4ODWB 5J0BA 1KLUA 5FXCH 3MIWA 4OVNF 2CBPA 3O8XD 3QULB 3VM5A 1PNDA 5D55A 4CSTA 2CIIA 3HUJE 4Y2DC 4TSAH 2OR9H 4J3OC 1SQBG 3NEXA 1KV3A 2G5BA 5F71A 2EIDA 3GBMH 2NQDA 2VSMB 3K8LA 2D3JA 4A2HA 4E5XB 3NXSA 1ZHBA 5KVDL 3QH9A 5F72S 2RCSH 5E8OA 3MX0B 2A0LC 4U6YB 3DX9B 2W95A 2DQUH 3D7PA 1BV8A 4L9DA 4ACTA 4FTVB 1DEBA 5CLTA 1NH6A 1U91B 4X42A 3TP4A 2X38A 4OI7A 4X7SL 1BEYH 1XD0A 3LNFA 1VF5B 3MKGA 1KCVH 5FYJU 3FHAA 5B38G 5IVNA 1G9NC 5TDNA 3AE5C 1RH5B 3J2PA 1LO0L 1D7BA 2PYED 1U8OA 2OX5B 2AV7B 3H1KD 3JZYA 3MYJA 5IIEB 4UIMA 4XODA 1QBAA 3QHFH 1FV1B 4MLSA 1QI5A 4UOZA 4RX4A 4GUPB 4DO6A 1NAFA 3S9DB 3SDXB 4C4KO 5HXMA 1TEGA 4JMNA 1DP0A 3CHQA 1MREL 3P9MA 5DLLA 2OJEA 3BH8A 4R7DA 4WTWA 3RVWD 2ZIDA 4Y99C