1YYCA

Solution structure of a putative late embryogenesis abundant (lea) protein at2g46140.1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
174
structure length
174
Chain Sequence
GHHHHHHLEASADEKVVEEKASVISSLLDKAKGFFAEKLANIPTPEATVDDVDFKGVTRDGVDYHAKVSVKNPYSQSIPICQISYILKSATRTIASGTIPDPGSLVGSGTTVLDVPVKVAYSIAVSLMKDMCTDWDIDYQLDIGLTFDIPVVGDITIPVSTQGEIKLPSLRDFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative late embryogenesis abundant protein
publication title Solution Structure of a putative late embryogenesis abundant (LEA) protein At2g46140.1
rcsb
source organism Arabidopsis thaliana
total genus 31
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2005-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03168 LEA_2 Late embryogenesis abundant protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1yycA01
2.60.40.1820 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1yycA02
5AW5B 1GK4A 2YNYA 4I6MC 3LIEA 2Q3IA 1GK6A 1YYCA 5AW7B 5APYA 3M0DA 5AW1B 2E43A 3MGNA 3VYIA 4GT1A 4GKGA 3V4QA 5AVTB 1NAFA 2R3CA 3VMZA 2QM7A 3A7OA 4RESB 1G2CB 2P2UA 5AW6B 3VN0A 3L36A 1X8YA 3M0AA 1MFZA 3HE5B 3M06A 3P7KA 3OAKA 3L35A 3HE4B 1GU4A 3VMYA 5AW8B 1CI6B 5AVRB 5AW9B 1MUUA 5CMZA 1SP4A 5APXA 2WT7B 3NMDA 3VTPC 2Z5HA 4I2LC 3VMXA 4DZOA 1CSBA 4AYCA 1JUNA 5AVWB 2C9LY 3TYYA 5AVXB 1GTWA 1IO4A 2E42A 1XO8A 3KDPB 3I5CA 3M9HA 3A2AA 4JYBA 2KP8A 1GU5A 2BASA 2VRSA 3O8ZA 2WPQA 1H89A 4C46A 4HYTB 1T2KD 2JJLA 3SWFA 3M91A 2YO3A 4LC1A 1T2KC 1HUCA 1GZLA 1KQLA 2IPPA 4M3LA 3HE5A 5APUA 4C7NB 5AVYB 3HE4A 3TNUB 3T97A 1HBWA 3UIAA 3IR9A 1CI6A 5APTA 1CZQA 3KQGA 2R5DA 1FOSF 2Q7CA 2WT7A 1OWAA 2XZRA 3B8EB 1FAVA 5AW4B 4JYCA 5AVSB 1H88A 4AQRD 3NXSA 1FOSE 3P8MC 1S9KD 1SLQA 1MV8A 5AVVB 2R32A 1A02J 2W6AA 3MD0A 3LIDA 1OXZA 3M9BA 5AVUB 2WPSA 5AVQB 2WPRA 1NWQA 2Q5UA 2ZFCA 2WWWA 3L37A 5APSA 2Z5IA 5AW2B 2R5BA 2P7JA 3TK1A 4EOTA 1S9KE 1DH3A 1GD2E 3P32A 4C7NA 1A02F 2C9NY 3TNUA 1H8AA 5APWA 2XV5A 1HJBA 2XU6A 2ZXEB 4KHXA 3A5TA 4AUWA 2N9BA 2QM8A 2YO2A 5APVA 3V5BA 1JNMA 5AVZB 4B86A 3A3YB 2W27A 5APQA 5AW0B 2P67A 3V4WA 2H7HA 2WTYA 5AW3B 3NTNA 1J2JB 3HTKA 1HWTC 4XE5B 3NFQA
chains in the Genus database with same CATH superfamily
5I6MA 3PIQA 3WN5B 3A23A 1MFEH 3VXUD 5EG6C 4POUB 1BXXA 3C6LB 1MCBA 3MV8A 1BFTA 4XHJC 1UH3A 5J12B 2ATPA 3GINA 5E1IA 3DLQR 2GAZA 4FZEL 4F57L 4K94C 1VFUA 3QUYD 4NQUA 2JELH 2W07A 4JZNB 5DEGA 3TA3C 5IFAH 3L72D 1FE6A 2FYZA 3VFNA 3LKNA 4WTXA 3O45B 1HWGB 4ZS7L 3EOTL 2VERA 5GGVL 2F18A 5CWSA 2FXPA 4R8WH 1XGPB 4KTYA 4PUBL 4Z7WA 1OEZW 1L4AA 2FHCA 2ZUQB 1KB9D 2POHA 4WI2A 4XN1A 5IOKA 3KMDA 1CSBA 4R4LA 1E4WH 2D3LA 1UADC 3QIBB 4JAMA 4JFYB 2F08A 1SQMA 1IO4A 32C2A 4XPTL 2CBOA 5IESL 5GQBA 3FQWB 3VGAC 3TBSB 1E5WA 1KPUA 1JMZA 3D50A 4QHKJ 5ITFB 1LO2H 3C2AL 4R90H 4ZXBB 4OZFH 3TFKD 3FGAD 3EBHA 4HFUL 2ZPKL 2PW2B 3ULVL 1T4KB 1Q0YL 2ZG3A 4XBPB 3BP7B 4PJAF 3B2XA 4HGMA 3LSOB 2AANA 2ZCZA 4KUZL 2Q87A 2WANA 1CF8L 1DQLH 1N5AB 3UC0L 2B3RA 2E27L 2B59A 4OBSA 2VLKA 3FUHA 2YOAA 3KR3H 1IT9L 2GEEA 3H7BA 4NC2B 4DP2X 4AQRD 1DUZA 2WVTA 3VRJB 2EYTA 3CWGA 3RFZA 3P8MC 1T22A 3S4SB 2I25N 5F7HA 4XP4H 1CK0L 4AEHH 3TVMB 2HN7A 4EDWH 2HX7A 2Y07H 4PGBA 3R18A 4IBZA 1I3RB 2EDFA 2NZ9C 1S72P 3B7SA 3EZJB 4FLHA 3MLYL 2QQNH 3M9BA 2KK7A 1E42A 2F54E 4FQPA 2C4FT 2D7NA 4PIRF 3EFDH 4HIIB 1YYMH 2EC9U 3TLRA 3QARA 5C09A 4P9HL 3KPQA 1QA9A 2R5BA 1TR7A 1VGEH 3ARQA 1NBVH 3HB3B 3HVDA 4IRSD 3HLKA 4MAZA 4J3BA 4WI7A 2EVJA 2H4EA 1RZJL 2FJUB 5DURB 4GKSA 4EKJA 4QY8A 2C3WA 4IOIB 4LSVH 2HT2C 2D2OA 4GXVL 1XL4A 2FBWC 3T3PF 5DUML 1AP2B 3WAJA 2R27A 2JIXA 3EXJA 1RF1A 3AB0B 3RZCA 5E0FA 4XI5C 1KN4L 4YWGH 5HHOD 4R4FH 5I76A 2H45A 5T3XE 1ZXKA 3ML9A 1JXFA 2Z65C 4X7CC 1ZT1B 2X2UA 5B1JA 1AO7D 1ES0A 2OJEA 2EABA 4N0CC 1ADWA 5DZNA 2Q3EA 5J9PA 2E6JA 1H3PL 3BSZH 1T2QH 3UZVA 2EVIA 2X4SB 3GJFB 5GGSB 4M4RA 2XXFA 1HXYB 3IPEA 4V1DE 1P4LB 1AQTA 1S5LX 1MLBA 3MRDB 3EADA 3SQBA 4LK4A 2XTSA 3H1KE 4M48H 2OKMA 1S7UA 5HJBA 3ULVF 5JO5B 2X2HA 5C2UB 2NZ1A 3QNZB 3M06A 5E6ID 3KNBB 3VI3B 1IU1A 4N5UA 4Z3IA 3VD1A 1N73C 3RKDD 2N7SA 2J71A 3DIVA 4CSZA 4LSSL 4OGQD 4NJAL 5HJ3A 1ZV5A 2Y1YA 4ADJA 1MWAL 5D1XA 3SE8L 4IQHA 4F8OA 2A73B 4LEOA 5J5EA 4RWYL 2R4RL 2MQ0A 3VGBA 3GBEA 5D4HA 3ZMRA 1MCSA 3ABMB 4JO4H 5AVWB 2BSBA 1MFDH 2H9GA 3K5SA 4RMVA 2H3KA 3NPSB 5LBSH 1OP4A 4APXB 5BS0D 1JYNA 1AXSB 2P24A 5TQ0H 1FAIH 4MB5A 5JXAH 1K5WA 4G80A 3QWOC 5BO0D 1OO2A 1EZVX 1ZE3C 4AL8L 5I0XA 4JRXD 2GBAA 1RZGA 1M6OB 1Y6MR 2DQGH 1UB5B 3EJYC 3EYUL 4O2FB 5I19L 1A7PH 4N6RB 3DHPA 1MCCA 1DQJA 3PTZA 1FC2C 3WY4A 5BO1H 5KVFE 3U7YH 2HODB 1J8HE 1MRDL 2CIKB 4IOIH 3VTMA 2FATL 5MHSD 1NGQH 2HRGA 5FAAA 1BP3B 2E74B 1IE4A 3T08A 3A6CL 5DS1A 4L9LC 5DHXB 1JY3P 2AGJL 3O9WC 3TPUA 3FCTA 1PG7L 4NWTL 3CFIC 4JHVA 2IFMA 2C8NA 3EGDB 5IMLA 2FIKA 4OFQA 5FYKD 1LD9A 2D7PA 3H53A 3Q5TA 4NP4H 2VKXA 1PX3A 5E8EB 4QYAA 4YHNA 2Z31D 3S0PA 1JNLL 1XGTB 2APTA 2F8IA 2J6EL 3GJEA 1KWGA 4QKXB 2P8PA 4LCWD 3GJFH 4WJKB 2BDNH 2J57A 4U31A 4OZHE 1HS6A 3ARFC 5H37G 4JO3L 1GZQA 5C6TL 1N4XH 3LXBA 1KCRL 3AG3B 3B2UC 3MUUA 4M7JH 4Z3GA 4ZW5A 5F8RC 4AYFA 3C60B 4G6KL 4IIZA 3UTQA 1PZQA 2ZXEB 4KHXA 5SX5K 3V6OC 1GMJA 4GRLB 1ZVYA 2UV3A 2QM8A 5CJQH 1NGPL 5J0BA 2IFFL 1SS1A 3B5NB 1NCAH 3HG3A 5CEXB 2YKPA 3VXPA 2NOYA 5CHNB 5AAPA 3FCSA 2X41A 3WU1A 2ZT9B 1RKRA 2HLFC 4MAUH 4ZS6D 4XWGL 5EB9A 3LH9A 1RZ8A 1OZTG 3WIFB 3I56P 4A2LA 4KMTH 1XD1A 4DN4L 1LDPH 3ZHNA 2IH3A 1OB1A 1T1ZA 3HTKA 1D6EB 1ODAA 4KROD 3B1TA 3MHZA 1OCZB 1HAUA 1HWWA 3ME0B 2D2CC 2J5UA 1J88A 1PY9A 3R8BB 5EEWA 3PDOB 1XQ4A 3BFOA 4NIYE 1J0JA 1XBRA 1NFDB 1KILA 3LJ3A 4GW4A 3SBRA 3K1KC 5E00B 1D2PA 4Y1AD 4PJDA 4WF7A 1XCQA 3KXFD 4D9RD 3GFUA 4AXWA 4F7PA 5J1AA 4K9JA 1CO1A 5IBLC 4C55A 2CDEB 1LQBC 2UZXA 4DN3L 4MNQE 4C83B 5HGDA 2FGZA 3RVTC 3S5LG 3NCEB 3G5VB 2DWTA 2XWCA 1C08A 2V9UA 5JA9A 5B66H 2D0FA 2WZ6A 1PP9G 3TN0D 3DOSA 1F4XH 3FTVA 1QLEL 2R69A 4IBLT 4PJFB 1BWMA 2Y7QB 3GZQA 4NWUH 3H32B 4ELMB 1JZFA 5JR1L 1KYAA 1S5HB 3UG5A 3ARGA 5DWUH 4FABH 1H89A 3UTPE 5BRZD 1I1AB 4HIHB 3OAWA 2C34A 2MFNA 4I3RH 3V5KB 2VZ3A 3MVSA 3CH8A 4QHKI 3JWNH 1UD6A 5M1BA 4IOSA 5MEOA 1DEEA 3JWDC 3FQUA 4E5XA 4JFQB 1IZKA 4MMXC 4NUQA 1Q72H 4NO2B 2EDLA 3SCMC 3UOAB 2NNRA 4OZ4B 1OE1A 1JY2N 4AW4A 4IMKA 1N7SB 1WGOA 4LQ1A 4Q6IC 3VYOA 3EOYG 5SWQB 1JCDA 1KJMB 1D9KB 1IX2A 1MFCH 2OCCB 1VKXB 4JO8A 3IFOA 3N1PC 4CVWA 4I7ZB 2BRRH 1UGNA 3ZDZB 3H1JJ 2ESVE 2VMDA 2FY8A 3CXHH 5KSAA 1LK3L 1JVLA 5KJ4A 3QHFH 5EZJB 1MW0A 2AQ3A 5GGSY 1DJZA 1I7TB 2V9RA 5CO1A 5F21B 1INDH 1UXSA 2V3FA 3TK1A 2PWHA 3R19A 1SXSA 3F62A 3EOBA 1R5VB 3HUJA 4C56D 5KW9L 1BDDA 4L2LA 1HNYA 3ZZSA 4CDGC 3DTXA 1JZIA 4DGVH 1AE6L 5JMRA 4Z8FH 1WAEA 1JPGB 1SRDA 2ZUSA 3BJ91 4GKLA 4ALAH 2AJXH 4NPFX 2AJSL 4QYOA 4L1SA 5APQA 5LGHH 4DP5X 1V10A 2IAAC 3BZFB 1XF2A 3FC8A 4XAKD 2Y6TE 2BINA 3I84A 4HMDA 4Y16A 1IFPA 3GSQA 4I9XA 5C0CD 1OSEA 3O4LA 3VD5A 2X70B 4M8VA 3EYFB 3O6FD 4H0LC 2O1JA 1NIFA 1UCTA 1BGXH 5FM5O 1TSRA 3IXAA 4K3DL 4RFEA 3RL1A 4P8QA 2VLRB 1F4WH 2EDKA 1FFOA 3JWOH 3N7NA 4LHUG 2GB2A 3BPNB 5I6KA 5DHYB 2JLLA 2BZDA 3D0VA 3P9MB 3QHZH 3C75A 2RKLA 1A64A 1D5IL 2NY1C 2XBDA 4MA1B 4PRDB 2NW2A 4DK6A 1EXGA 4K3EL 3MROB 4HS8H 5BOZG 3L3IB 1NTZE 5JW3H 4UQ2B 5E2UH 1C16A 1SHXA 2XNAA 3V6OE 3L7EA 3VE0B 5B22A 4PBVC 3VQMA 2XA3A 1YJDL 4GG6B 1DVQA 4P46B 1AZRA 3RBSA 4GJTB 3SOTA 5I5JA 3BRTB 3L4FA 4FG2A 5D6CB 2Q10A 2VSKB 5DHDA 4CRPA 5B38B 1IBHA 4FXKA 4HWEH 3MRNB 3V5HB 1F0LA 1G7QB 4N8CH 4G7QB 4V2CB 1V7ML 5GJSL 5HYJB 5F3HB 5JNYB 2D7QA 4LEEA 1GGTA 3L54A 4KXZH 5FIEA 1SQVD 2PYFB 5KYWB 2ZE0A 2NT0A 4Z7UE 4LARL 3QNYA 4TUOB 3MRIA 4OV6F 1J12A 4X7DC 4KJWC 4N0UE 4UM8B 1X5GA 5FYJH 4WHTA 2V2XB 4HUVB 3OMNB 2IXQA 3H9YA 1JFQL 2ITCA 2B5IB 1YPZA 3TCTA 3UP1A 2AXFA 3DV6A 3RWEA 1CIDA 3K2UL 5A3ID 4FI6A 1KNOB 1WS7A 1U3HB 1GGCL 1SLXA 4PB9H 3GGWA 4NFDA 4MJHA 3O3AB 5B3JE 3MRHA 1N70A 2VITA 5I1EL 4OGYL 2OPCA 4PI2A 3TWYA 2FIRT 1FG9C 1IL1B 3GMMB 4HJGA 1IAOB 4LLYA 3RILA 1IC4L 3S3JA 4A2DA 1U8KA 1CICA 5DK0A 1FJ1A 2QPDB 1ZLUK 2M5AB 1AIZA 4XMUA 3RQ3A 3IJHA 4MJ5A 4CMMA 2F5AL 1BBDL 3UO8B 3MJ8B 5D7IE 3C09B 4PGCB 1OF2A 4IRJA 5APWA 2NY7L 2BP8A 3CC5A 8PAZA 1FZCB 1URQB 3LOWA 3NK4A 1XH3B 3A47A 4XT1C 3BRFA 3MV7D 4JFUA 4N1CA 3GKZA 5CCJA 4X9GA 2R29A 1XZ0A 4F8NA 4Q58C 1GL2B 4OLEA 1KTLB 2F8OA 4JKWA 1UENA 4NCDA 1LO5A 4FFWD 2K4WA 3PQYE 1FGVL 3II6A 2C4XA 3SBWA 2E5YA 3O3EB 2W5PA 3R4DA 1CGVA 4GEJA 4KAQL 5IFHH 1JHKL 2QL1A 3FB7A 1F3JA 4LVHC 4U3CA 4GBXC 3GQFA 5C0GB 3CK0H 1CDGA 3OSKA 4W9IC 2QJKC 2WW8A 3MIWA 3F12A 3HE7D 3UPCA 2Y9YA 4QCIB 4XO5A 4P2OC 4NI6A 5D5ME 4ZT1A 1THCA 4KKBD 4RETB 1YNLH 3TBCA 5HI3C 2E5TA 2CHNA 3L4ZA 4AZUA 2ZX5A 3QUZB 4PY8I 2WLIB 3I9PA 3O8XB 4G6ML 4QHLB 3QFDA 5C3LD 3LZFL 1E65A 1WITA 5ACMA 2H5UA 3MV9A 4RJTA 3AAZB 1NBQA 1W8OA 3TT3H 2J20A 1KDJA 3DUUB 4MSWB 5SWSA 3IDYC 3KGUA 5B1AB 9CGTA 5IIEB 1HL8A 2NY0D 4HPYH 3L3OB 1YMMB 4UIMA 2XC8A 1EZVD 2YSSB 4MXQD 2P80D 4U1LA 3EO0A 4G7SB 6FABH 4R0LB 5CLYA 4TQIA 1YJ9P 1EANA 1H8NA 1WWCA 2WY3B 4DCKA 1E9PA 5DR5L 2A6JB 3O4OC 4M7LH 3UBFA 1T04A 2IH1A 1KXTA 2CBTA 2XG4A 3ARDA 3QI9A 1EFXB 1I7UA 2X4QA 5F0JB 4KHXL 3HPJA 2RHEA 1OVUA 3LNDA 2PYEA 1SJXA 1ZS8B 5ANMB 2IPPA 1AQ8A 1W2KT 1EDQA 4FQHA 3TGXA 1P7HL 3QUGA 1OSYA 3CJJA 4RFNB 4R6UA 5CGBA 3V7AG 3AXLB 1CVRA 5A2KH 1A6ZB 3HC4L 2AABL 3QDGB 1XXFC 1CDYA 4MMZC 1U2HA 3MGTA 1F45A 1JMBA 2YJLA 1TJIH 2B2XH 4G9DB 3DMMB 4A63A 1AQKH 1I53A 5B1CA 4KK5C 3QH9A 5F9OL 2Q6WB 2IALA 2NQ3A 3ARXA 3BDXA 2W95A 1OOWA 1TMQA 4KO9A 3CVHA 4I5BA 2Z3FA 5EC1A 5E1QA 3IRPX 4I1PA 3IU4H 1A4JA 3GTNA 4F9LA 5JPMB 1HCVA 2N1TC 2FYYA 3UZQB 5KVEE 1MFBL 1Q9WA 1IE5A 3VWJC 4H88H 3E8UL 4HS6B 4TULH 4OY9A 4X98B 1N5YH 4NKIL 3C6LD 2BC4A 2ORBH 2UYLA 4M8QB 1GSKA 3LKPB 5D4JA 1ZS2A 2CUMA 5DFVC 2Z8VC 1NTKG 1RZKC 3WKYA 3ZQXA 3ZT7A 2ZWYA 4JPQA 2E47A 3OLEA 1QFPA 4HJUA 1R9FA 2HRHA 5IF0A 1TU3F 3HPLB 1RZQA 2HX9A 4MDIA 3M7OA 3ZE2B 1NFDF 1A6WH 2R69L 5E9DA 3X2QB 5LAXB 4S1RL 1A5FL 1MCHA 2QR0B 4U1SA 2A6IA 4KZDH 4MZIA 2EAEA 2GI0A 3ULUL 2VMFA 1K8DA 1UVQA 4DP4X 3KPRE 1KUMA 1AG6A 3LKSA 1F58H 2VERN 1YIJP 2K1AA 1KB5A 3QIBD 4AL8C 1KLFB 3PJSA 1WA0X 1NGMB 1FO0B 2ROYA 5ALBH 4NQQA 4NT6B 5TPWL 1CFQB 5FYJU 1UJ3C 4QHMA 3QYCA 3UBXI 3K8KA 5GS1B 4NM4L 4PS8A 4ZXBD 2CNYA 2GITA 4RMUA 4ELMF 3QNXB 5GS0L 2HPCA 3CSPA 1DFBL 2Q3ZA 1HXKA 5GSVA 1NTKE 2L4OA 2WB7A 1YRKA 2LGNA 2IBZX 1N8RQ 1ZTXE 4LNRB 1YTZT 2J12B 2D7TL 3KLHC 5CSBA 4B9CA 2C1PA 3BN9D 4FP8H 3ZT5A 1B0RA 3H1HJ 2EIEA 1R5LA 2UZYA 5JOFA 2F74B 4QTHA 1S7XA 5GRUH 3X1BA 1YQ3C 3OKMA 5CGYC 2WQUA 1M2VA 1MZYA 1I3GL 4J3UA 3TVMD 1H5BC 3O8ZA 1IGJB 1U7MA 3UYRL 4BXVA 2CPBA 3ZYIA 4RIRB 2XPZA 4GW1B 4YGAB 3ZDZF 3ZTCC 4Y4FB 1J1PL 2ZCHL 1MZZA 4QHPA 3IGAA 3HB3D 5D2LB 4APQC 1RK1B 2R0LH 2ZYAA 2X6VA 3RL0C 1QEWB 4H1LG 4A7TA 5EIVA 5DURD 1A3RH 3AU1A 2W0FB 5APTA 2CKBB 4TMPA 4U1JA 5KUKA 5M7QA 4YR6A 4FQLL 1YO4A 2FLMA 3CFNA 3O6KH 5DU7A 2PPAA 5I1IH 5AW4B 5AZUA 2YA2A 2OZNA 1WZ1H 3NAAL 4GAJL 4JG0L 4NPJA 1T3JA 4K9EH 1XAUA 1M53A 3T3MB 1CI3M 1R5SA 3PWVA 4WW2C 3OXSA 1SY6A 1IEAB 3P1VA 5KLVE 4ENED 3GSUB 4EIUA 1R3LA 3H9HB 2WINA 1KYFA 2UWEA 4BWTA 1K8IA 1NFAA 1Z5HA 1Z5LA 3N43B 4OQTH 3WFEH 3K81A 4GP8B 5DMKB 2ATAA 4KBPA 1D6VL 4PP1C 4PW9A 5I73B 1IQDA 1XBDA 2FEJA 2VUOA 2MTAA 1DEBA 2AJ3B 5D2NC 5IOPB 3EOAA 1DZ0A 2AK1L 1AY1L 3FU9A 4U3XA 3QDMB 1L0XA 1DANT 2XCMC 1CIUA 2WTYA 5FHBH 3NQIA 4MA3A 4JM4H 3AEAC 1JPFB 5D1QE 3SDAC 3RGVD 1EVTC 4ODXB 2IDUA 4JPKL 3RHWK 4IBVA 5ICZA 3QXDB 5KJ7A 3FHAA 4GG6F 4DVRH 2UVEA 2CLVA 3LS4L 4YK4B 4H13C 2YKKA 1CDUA 3Q5SA 2E7BA 3WLWD 1TEYA 1YYCA 5GGRY 3JXAA 3T4AA 3FHEA 3P3SA 1TETL 4MNGB 1RY7B 1JYVA 1XSKA 1BZ9A 3KH3A 4JFZL 3AE5C 1JV2B 3A4AA 3KGSA 4GLRH 2CKBH 2EDQA 2R1XA 2QFRA 4GSXA 4RGNC 4AJYV 4P2AA 3BYYA 3QXUA 3BUDA 4LSQL 4CILA 1U91B 5ABDE 5JHAA 3AT0A 1CL7H 1RLBA 3VMXA 1IGCH 4UOJA 1N0LA 1Q0XH 4JB9H 4ZYKB 4OZGE 4PRBB 2P43B 2A1WL 5CJOH 4BWNA 1GU5A 4X4ZA 3BE1H 3HZMA 1BMWA 2BNUB 3D69A 5AWNH 4CNIA 3GMNA 2HVBA 4Y4HB 5DTFB 3SYPA 4CW1A 4Z7NB 5HI5C 4KXZI 1L4AC 3BH9A 5AOMA 2YBRB 2VDLL 4YDKL 2FX9H 2R29L 4P4KA 1BVZA 1RJLA 4GSDH 2ARJB 3BLBA 4NQDA 5FGCE 3P9WB 1QG3A 5LKNA 4OVNF 3C60D 1MNUL 2EACA 1UOKA 4WI6A 4GRLD 5LJYH 1AVAA 3CUPA 4N2FA 1JUFB 5ADOL 2H41A 3B5ND 3VOPA 3P3RA 1RIUH 2YGQA 5IG7B 2BSTA 5HHME 3P2TA 4R5TA 5B4MD 4AKOA 2ZT9D 2CHZA 1U92B 2WIIA 3DOIA 2KIKA 1A02J 3CAFA 1AR1B 5L2KB 1BG9A 1E3FA 2BCCD 1OANA 3OQ3B 2FUQA 3LZOA 3QJFA 3IFLH 4MZ2A 4YDIL 2IOOA 2FT8A 4HPOL 1HIML 4WSJA 3MREA 4X42A 1F8TH 5HP5A 3MNWA 1EJOL 1RULL 4QRUA 2NX5E 3CNKA 4MCYB 4W6YB 4POZC 3GSXA 4X6BA 1KMIZ 3A67H 3M17B 5GGUA 1MG2C 5T1MB 5HYSG 5HD8D 2OYOA 5JA8B 4D8PB 5DJ2A 1SQPD 3ECBB 1X5IA 2DIAA 4L3EB 5DD5H 2YD0A 3BZ4B 3QO0B 2JSFA 5K39B 1RJZA 4XOCA 1J1OH 1I9IL 5K9KA 5AAMC 3MYJB 2JKJA 4JDTH 4IKJA 5TE7H 5MEPA 1TCRA 1FL5B 4UQ9A 3D51A 3DV4A 3L48A 3EWKA 4HMEA 4XBMA 3V2AR 3W3BA 2F15A 2J4WL 3WTUA 1I1AD 3GKWL 3ROOB 3SWYA 4PWKA 3F7PC 4D6TE 4M61B 5D93B 1GZPA 1KJ2B 3JSSA 1D7DA 2OP4H 4QRSB 4AJVA 4Z5RA 1U93A 1USEA 3P11H 4LPCA 2GUOA 3VX0A 5BZWB 2YGPA 2B39A 3CVHL 4PRHA 1G1JA 5JXEA 2H7WA 1K6QL 2V5YA 1UD5A 5F96H 5KSBB 3LX9A 4JFPB 3RRQA 4UNVA 1N7SD 1Q82Q 4KK6D 3FFCB 1KN7A 1JTPA 1QBMH 2IQ9H 3JV5A 1D9KD 3SDXA 4YMPA 3QBTB 4PRPB 5AYUH 1NDGA 1O9VA 2I32A 2ED7A 2B08A 4IW4C 1CW5A 3RWFB 1M7IB 1NLDH 4XO3A 1M90Q 3IDUA 4U0RB 1TZIA 1QUNA 3EO1B 4JFSA 1KB9K 2W0KA 4NQXB 3C5SA 2C3VB 3EXLA 1JYWA 1OCWL 1PZAA 3RJDA 1RIHL 1AACA 1ANUA 1ZLVK 3Q5YA 1U8CB 1KEMH 3GMPB 1D2OA 1LHZA 5FYJD 4MVBD 2DW3A 4WFHE 5KVDL 5HVGB 3QK0A 2OV0A 4P5MA 2OTLP 1ORQB 2K6WA 1ZDQA 5GRYA 3IJEA 1KB5L 3RX7A 4KKLC 2M26A 4K3HA 1O7DC 4A68A 1E5ZA 1ETJA 2JB6A 1Y0LB 2DMBA 3WE1A 3F05A 3MV8E 1JHLH 1Z56A 4HIJA 3ZE2F 2M8XA 1G9MC 2ZCKH 4IMLB 2QSQA 1NTMJ 1Q1PA 2BIQA 4C4BA 2BWQA 1OK8A 3WLBB 3OJAB 1I9JH 4QWWD 5FV1L 3KXDA 4FFYH 3RNQA 1NKZB 4M8UA 2QQLH 2VLRD 2VSDA 2QVTA 1WBYA 5FKAA 5E2WH 2KQMA 5FFOA 1A02F 1KJ2H 4LT7A 4PRIB 4Z7WE 2OMWB 1TO5A 3QXVA 1ZCRA 1I9RH 1DVFA 3RKPA 3RP1A 4RKUJ 3VDCA 5D96C 1DE4A 5DDHA 5KS9B 1MFAH 2KS1B 2MQGA 5FYLH 1X9RA 2YXRB 1CFBA 3II1A 3AREA 3BRVB 3UIYA 3SY0A 1W72A 1BJ1H 1QQDA 2HH0L 4ZMLA 1Y6NR 3X11A 1RPUA 2R2EB 2ZUWA 2Y9ZA 4MTMA 3PFQA 4P46D 1PFIA 4NRXB 4LVNB 3HAEG 4UT7L 1XIWA 3LN9A 1ZXQA 1FNAA 1TF4A 3PF2A 3EGXA 5LB1A 2X3BA 1YEDB 3PNWA 4FADA 3AU0A 1F6FB 2IBZD 2GSGB 4JRWA 5DLLA 3GTVA 4ODWA 3RUGA 3CXFA 4AQEB 5HYJD 2PPDA 3O6QA 4I1LA 4Z77B 2HT4C 1FNGA 2VLKE 2ROXA 3M0DA 1AQDA 1OW7A 4O02A 4W9KC 4YZWA 4WI4A 1OHZA 1UT2A 1DL7H 1XH0A 1F90L 3BVXA 4K5OA 1NPNA 1RU9L 2VTFA 2Y0CA 1E6JL 1XF3B 4WZ9A 4FZ8L 2XQ0A 1SEQL 5ENWB 4IBYA 1GU4A 3F7KA 2YJQA 3KAAA 1GJUA 5D2LF 2YKQA 2FO1A 2O26U 4XC1H 1ID2A 3UJTH 1O6VA 2K4AA 2IEPA 5AKRA 1SY6L 5LN8A 1U3HD 3HZVB 3DETD 1DDHA 2OR7A 4GODA 2FH8A 1WIPA 3ZO9A 1BVLA 5H2FE 1JE6A 4YGVA 2A38A 3FN0L 1X0TA 5TE6L 5BVPH 5JDJA 3BVNA 4NCC2 2QVAA 1YZZA 3SB3A 4YBQC 4Z76A 2F5BL 4XN8A 3L75D 4CC0A 4NJ9L 3M91A 1KOAA 5BVZA 2D7MA 5EOCH 3T1FB 4BHUA 4IBQA 5GTHH 2DWEB 1PY4A 3T3MF 1LK2A 4FLSA 4F7TB 5K1VA 1F4YH 5BW7C 5DUPH 4E2OA 4BZ1A 5GRJL 3B5GA 4WLCA 3VWKB 3WY2A 2FXOA 2EDTA 3L1FA 1URQD 3FONA 3RYMA 1H3VA 5FCUL 3OZLA 3N43F 2OYHA 3V8CA 2LLGA 1XR8B 1BEYH 4PTUB 2F58L 2OXHA 3PP4L 3C5JB 3T2OA 5GRWA 4JRLA 5L0QB 1GL2D 2RTTA 4CC4A 3L08A 1MQKH 4QRQA 5L6YL 5DJ0A 1SLQA 2JP3A 1MLCA 3SKOA 3ZPDA 2R32A 3CSYA 3JVGC 4XTRD 2YD7A 4P9ML 4WWIA 3KYOB 3LV3B 3T4YB 4DK3A 3LEVL 4LEXL 2NRGA 3L71E 3L72G 1CE1H 2VR8A 2VZOA 2WVVB 3DX6A 4OJDH 1SEBB 4EZJA 2VE6A 4OQ1A 2HWZL 4JG5A 5F7LB 5FO7B 4MBRA 4GT0A 4H8WL 1JGLL 2A06G 1NCBH 3CZNA 3U4BH 1S9KE 2QKIB 2V7NB 3FTSA 4HLZG 4FNQA 5D1XE 3VQ1C 4OUUB 2FT7A 3QUZD 3QWRA 3O8XD 1HF9A 4MLIA 2ZYIA 4LPUA 4TUJB 4G1EB 3CHRA 4G8IB 4IJ3B 1CJYA 1G7IA 3LDBC 1EDLA 4ZO6A 5CCGD 5A40E 3IU3A 4LAJH 4MD4B 4UQ3A 3VD3A 1BJ1J 3OKKA 4I18B 2ZKYA 1DSYA 1ZA3A 3QQXA 4OLWH 2ADYA 4CGTA 1MHCA 1YMMD 2VOTA 1N7MH 7FABH 1RJCA 3FO2B 3QUMA 1O7DE 2P42B 3ZL4L 3GYRA 5GGQH 3GMLA 2YEVB 4UDTA 5E1HB 4ZX3A 3O3DA 3ESUF 2PMZA 2JV6A 2EE6A 3TOPA 5CJ4A 4FQJL 1ZRTE 1CLCA 5CR8A 4HEMA 4L29A 2YXVA 2GCYB 1PZDA 1EFXD 1PD0A 3Q0HA 4KVNL 3WTXA 5AOLA 1EJ6A 2BP0A 1BQLH 1CFVH 4NQSB 4NZFA 2V7QH 4Y16C 2A06E 2OQJB 3QJHB 3ZQWA 4P5KA 2I24N 2NTFA 2YFNA 3USSA 2R59A 2WUCH 3CSGA 4Z7NF 4GKZA 5K59E 1FFPA 3QDGD 4HH8A 4ZFGL 5CFHA 4GLRI 3N2JA 2Y23A 3BSGA 1E4JA 4MWFB 1I4FA 3IJYB 3DMMD 3C8KA 5AQ0A 1HL5A 1X9LA 2BVEA 2DQJL 2FDBP 1OAZH 4JFDA 4ZDHA 1TTAA 4XRCB 5CZVL 4PJHA 2FB4L 2OMXA 1Y1DA 4EIGB 5BV7C 2RFXA 4KTEL 4L0YA 2G9HB 1L2PA 4LOUD 2A0LD 5EOCJ 3H1IG 4BFRA 4JPVL 3QFJA 1QRNA 3P0YL 3MNDA 2JE8A 2YO3A 2A9MH 2BCKB 4A67A 3QC5X 3I6LE 4FXKC 3LPPA 1EEZA 2RMNA 2Z7WA 1Q9OB 3WO4B 4AMKH 4BFIA 5EEUA 3HRZB 4YFEA 3V4VA 5KYYA 4DKTA 3B56A 4PMFA 2ZNXA 4AG4H 3STZB 4RDQG 1GVIA 2JKSA 4A2GA 1EXHA 2G75A 3H0TA 4ZKUA 2R15A 1FV1A 2YUZA 3PS6A 5CILH 2Q20A 5ERWB 1ECYA 5IBUG 4XP6L 3EHBB 3FF8A 4WWKA 4QRFA 3US1A 4GQPH 3ZBMA 1DEEG 1S9VA 4GXUN 3I9IA 4E5XG 4G6FB 1NIDA 3TBTA 2OMNA 1MQ8A 2ZXGA 5CN2A 1PZSA 2L91A 1P2CB 3CFTA 4PJDE 5JPNC 4NQCA 4P0DA 1PGJA 2LU5A 4FQCL 5ACZB 4OLZH 4OFVA 5AOIA 1EH9A 3H1IE 1RUMH 1TCMA 5F71A 3WS3B 4X0KB 4YL4A 1S7RB 4LVOB 4C7NA 3QZBA 2H1PH 2X9XA 3GSRB 3U1CA 3VUAA 1TVHA 1YEFL 2DBJA 5BZDA 3WUWA 2BVYA 4R7NB 3VP8A 3S3SA 2XV5A 1J9QA 3IFNL 1CICC 1IC0A 3D9AL 1YHQP 4PVNA 1IAKA 1HE7A 3NACH 3DHMA 6PCYA 1FLTX 2VLJE 4X5RA 5K69A 3ULUE 4E9YA 2R8SL 1FVDB 1I85C 4NSKB 1CGWA 4GSQA 4U1NB 1JXKA 5LO7A 5BQ7B 2P5EA 1MIML 1H15B 2VISB 1JY3N 2MTPA 3FQXA 1M57B 3QQNA 5DVKA 2MCAA 3SDDC 7PAZA 5FHAL 4NKQB 3W2DL 3B9EA 1KCUL 3C5ZB 5D7JA 1UKSA 3BPOB 5HHXL 4JCWA 3HI5H 3WL9A 5A2IH 5KSBF 2YLKA 4QXGH 4XCCL 5DQJA 4L1BA 5E1AB 4HW6A 3POHA 3IAOA 2OYLA 4PVMA 1TZGH 1U30A 4O2CA 2WMPA 2V7QJ 2DV6A 2GTWA 4Y4FD 4K8RC 4EZMA 3ARTA 5I5MA 2BS9A 2WXLA 4ZOAA 4LLVA 4E41B 2I9TB 2RACA 4Y4KC 2BVOA 2YMTA 2H0FA 3FKUS 3KBHE 4GYBA 3APFA 4H25A 1E5YA 1LTJA 2H6UA 5HPMB 3L3KA 1FC2D 4ODUB 2VR9A 4UZGA 2J21A 1R3IH 2J5LB 3CX5I 3ZTJH 3MLXH 4TRPL 2B1OA 4WW1A 5C0EA 4PJEB 1ORSA 2CDGB 2XV3A 4FL4B 1LT1A 1DBBH 3IDJB 2V3EA 2O4EA 2J88L 1NKGA 3M88A 4UT9A 1IIKA 3W9EA 2EUZA 1QGKB 3DO3A 2BZ7A 5C7ZA 1PAZA 2BIHA 2AJVH 2IIJA 3LPWA 1MAML 3K2KA 2WIMA 1TQWA 3TV3H 3Q48A 2L0DA 3LRKA 4PRAA 5D7HA 1U33A 2UX6A 1MJJA 3K6DA 2YA1A 2NSXA 4FE9A 3RVVC 3VMPA 4Z7OE 1SQVK 1W72L 3WJJC 1QFHA 2YPLA 4LF3A 2P28B 3A21A 1VDGA 2JTDA 43C9B 4U3FE 2HJFB 3O4LE 5FA3B 5CD3B 1BSHA 5DQ9A 3L74G 2P3YA 4HUXA 2SODB 3G5XB 3Q2NA 3N91A 4KJQC 3I50H 2AXGB 4LSDA 5AVSB 4HBCH 5CR1A 5BMFL 5K1NA 3V0VA 1YQ4C 5KS9F 5T1DH 2AV1A 3QDMD 5CCHD 1ZWIB 4H26B 1IGIH 1OVRA 3D3VA 2HLFD 3RDTA 3U30B 4P06A 3WFDH 1R24A 3ARBC 4O02L 3TNNB 3VFMB 5E70A 3ZDXE 5DD6B 1NTMD 3MA7B 1D5ZB 2MQ3A 1T6BX 2ZUUA 1K04A 4XPAL 5EO1A 3RTQC 1I7ZB 1ZEAH 3KM2A 1D5MB 1CQYA 3US9A 2AFNA 1RHFA 2EJ1A 2EYRA 5EWIL 4ZQKA 5T1KD 3VYPA 5I66B 2Z9TA 3CQPA 4F9LC 5CBAA 3ZL1A 2XV2A 3ZZ1A 1NOLA 3LH2H 1UD2A 5G4OA 4AY0A 4YFLI 3WNLA 1QEXA 4X6FB 3K5RA 3T65A 1QX8A 3FTGA 5ECJE 2HTKD 3FOLB 5F3BA 5IBLD 3RY6A 4P5TA 2R7EB 2RCSH 3CCHA 2EH8H 4HZAA 4N78E 3B6SB 3PABA 1EK3A 1T0NB 2YUVA 1LTGC 1MHPH 1LTSC 2IH8A 4XA4A 3S9OA 2CRIA 3EJJX 4R9HA 1UKQA 4CSSA 4YVUA 1W6LA 3VFRB 2F53A 2HAZA 5DVNA 5F89B 1GK4A 4AQ8C 4WSGA 4BZ1L 4D9QE 1S1CX 4MKTA 4I2XB 2WKLA 4Y2OA 1YPZE 4Y4HD 3RWIA 4PD4H 3NCYS 3IF4A 4XPGH 4P07A 4DP8X 3VMZA 1MH5A 3KYNB 1LEKB 1YEGL 4JPWH 1FLRH 2M3EA 5GJTH 3HBGA 4XNYH 5C3TA 1UWFA 4JFFE 1QSFA 2YAEA 4JKPL 5J6GA 1MEXL 2XWTB 5CSZB 4U7JA 1L0NE 3HD7C 1U2CA 3EW3B 2CAKA 4M3KB 2H2SC 2O61A 2WT7B 1KY6A 4UTCA 4BDVB 1KJVB 2BIPA 2FX8H 2OCJA 4Q89A 3CWBJ 3H9ZA 5GS3A 3HG5A 1YEJH 1YN6B 3U9UA 4LGSB 5HJDA 5HYEA 1AR1D 5HYQA 2ZCLL 4Z7QE 5L2KD 4PWHA 1C1EH 1MJUL 5AENA 4ZKPA 1D5BB 3NVQA 3CN4A 1A22B 3AFLA 2IQAB 1SPDA 4RSVA 3II2A 4BFGA 2E6PA 3KEDA 4HJ0D 3ZE0E 1FIEA 1MCEA 1PZUB 3N55A 1YEHL 5ADPH 3P4OA 1FS0E 3B9AA 3G9VA 1N8OE 3M6DA 3OKYA 2HA1A 1SUJA 3KYMA 2VMCA 2WLKA 2IF7A 1PPJG 4BELD 2E5EA 3QUML 1V3JA 3HG0A 2PKDA 3MUGA 5CAYB 1PL5A 4JHUA 2AJUL 2NXYB 2XIIA 1P4IL 1PQZB 4JY6A 4L3ED 5IEKA 2XV6B 4DQOL 1QWNA 4OLYH 5TISH 5I8CB 1HH6B 1FZBA 1FNSL 2XIDA 4NUGL 4EI6B 5FO8B 2C3HA 3RWJA 2PO6A 3TF7C 2XVLA 2DDQL 5C9JB 2OSWA 3RWHA 1XGZA 2CGRL 4O5LL 4MB1A 3G5WA 2YMXH 1RURL 3MV9E 1CS6A 4L8DB 1Q2NA 2DYPA 4FNRA 3PGCB 5I26A 3IWVA 5SWSE 2EXYD 3K72A 5F72S 3NP3A 5LBVA 4GW5B 4E68A 1W0YT 3VXRB 3G9RA 1HZHL 2MRYA 2C1OB 4WDIB 4JJHA 2NZ2A 3SE9H 4IIQC 4XMKH 3NZ8A 5DRXA 2IH9A 2X10A 1JMMA 2VM3A 3SE4A 1B0GB 5HHQB 1FBMA 3TIEA 3MBEC 3I9GL 2DKMA 5DUBA 3N06B 4EVNB 4Q4IA 1M05B 2Z7UA 4P2RE 4R96A 5AB9A 3S37H 4ABWA 3R1GH 4LCCB 3FFCD 5J11C 3VXUA 1FVCB 2XU9A 1I7RB 3ALPA 3L3HB 1XCWA 4KZCA 4PJCA 4PRPD 2XBTA 4PGDA 3U7WH 2PYEE 1FZKB 5DS2A 3P77A 1VQOP 4FQ1L 2JJTA 2ALWA 1W0VB 2ZKXA 3ATDA 4TNWF 1MI5B 2CDFA 3UMNA 5J06A 1MG3C 2XZQL 4PD4J 4X4YA 1AFVL 3V4VL 5EZIL 4JF7A 5F88A 3UYPB 5L4IA 2D0GA 3OKDB 2XA8H 3QO1A 5IB4A 4HIQA 2OZ4H 3MBXL 4NLHA 2ICWB 3N0AA 5E0QA 3BZEA 3B2VH 1MWOA 3CIAA 4FXGA 4ZW7A 3F58L 1JXDA 4J1UB 1YY8A 5EOTA 5HI4D 4H5SA 3RK3E 2EDOA 2IGLA 4FNSA 1L9PA 5KYNA 4BEIA 1FORL 1WA2X 2FL5A 1DFXA 5IM7B 4XXCA 3UAJA 4ZMAT 2VC2B 5KKZC 3ESNA 5I17A 3UDWC 1GTWA 5TGBA 1VPCA 3EUUA 1FZOB 4M5ZL 3GI9L 1XB3A 4N0YH 4XX5A 5E99H 1L0YA 4N1EA 2W60B 1XMEB 5E9DE 1YEIL 5EPMA 2P5WA 3S8GB 1HYSC 2CALA 2Z92A 3P4NB 1T0MB 3QEUB 2AK4B 3PCYA 3SPCA 3MLVL 1OAQH 3QSKB 1BQHA 2DJSA 5DJCA 5L4JA 4PRID 1OGPA 2WBJB 2QA4P 5DQDL 4XX1G 5KVDE 2VM9A 2GFBB 2NDGA 4JM0A 4UBDD 1DBML 3MKGA 1FH5H 1ED3B 4U1KB 4XPFH 1JZJA 4L0ZA 5DSCB 4JCLA 1S9YB 1TPXB 1XF5B 2ZOLA 2X3AA 1XGRA 1KZQA 3KZIE 1C7SA 1R3HB 2VRKA 3NQKA 4MJIB 2HFEB 2HJLA 5I18L 4U1HA 5DK3A 1QFUH 1FN4A 1VFMA 3QH3B 3L6FB 2JJWA 1NMAH 2J58A 4Y99B 1HFUA 4EMZA 4GXFA 1JS4A 3P40A 1AMXA 3FU7A 3RPIB 1AV1A 4WJ5B 3MRKA 3VRIA 4XR8C 3WFZA 5F1KC 3NA9L 4DP1X 5CZKA 4WY7L 4AQAB 5T5NG 3G08A 1HHGB 4B7LA 1B4JH 3E1F1 4X5LA 5E5UB 2GJZA 4NPKA 4Y19B 1WVZA 4JREC 1EZVG 2VO8A 2D9CA 3E0GA 4HBQA 3ZIYA 2F6AA 4XMLH 1AI1L 5HHOA 4Y9FA 4CJ0A 1KLUA 2KDGA 3GJFK 5KAFH 4ORGA 2Q7YB 4Y5YB 4XX1E 3A5TA 1B6UA 4AEIH 3MLWL 5F8QC 3N9GH 3SEPA 4NNPH 3M46A 5CU5A 2ZYRA 4FULA 3D06A 1JCKA 1UXLA 4UT9L 3J8F7 5IQLA 5IUCA 2F8VA 1SLWA 1PZCA 5ISZB 5DJYA 1F6AB 2VC2H 4FXTA 4OB5L 4PSRA 2Y9RT 3D1MC 1YNKL 3BIAX 4PJEF 3L9EA 1JZ6A 3UYOD 1NA8A 3FF7A 4KQ4H 2GKIA 5D7EA 4TT3H 3PGDB 3PWNA 2DLIA 3PNRB 4R26H 1K4DB 3P69A 3ZJAA 3S37X 4MMYB 4AX3A 4HHWA 1K4CA 1S7VB 2FWOA 1ZHKA 1LEGB 3UTSB 2VDNB 3CU7A 1Q1JL 2I60L 3ZE1E 3DX9A 4AUUA 3RX9A 3GF3A 4GAGL 5DVLA 1NVOA 2QADC 2YD9A 3VWKD 1PZ5A 4XC3H 3JYCA 5DMGC 3RAJH 1CGSL 1OPGH 1KTKE 1CQKA 2Y36L 4XPBH 1HKFA 25C8H 5TDPB 1CTOA 3EYVA 1RH5B 3MXWH 1YA5A 3TJEH 2PN5A 3WCYA 4JK0D 5CZXC 1IFJA 3TO2B 1A6UH 4JM2B 3FX0A 2OTWB 3TYYA 1DR9A 2XZCH 2IAMB 5JXEC 2PABA 1IB5A 3P4LA 1XSOA 1CU4L 3B5TA 1MIEH 1J8RA 1RUPH 3MMEA 1M2OA 1DBAL 4RZKA 4JQVA 3MODH 5SWZA 4GPVA 1AS8A 1UWYA 3NSFA 4XB7A 1HNGA 3RPBA 4OTXL 4W7ZA 3D6ZA 2J1ZA 4KQ3H 3RWDB 5I1JH 5BVJA 1FAKT 1G7PB 1X22A 2ZP9A 2H3NB 4XMXA 3TNUB 1DQDH 5DMJB 1VQMP 3HE6A 4Y1SA 2WCPA 3QG6B 3WJLA 2QZQA 3CC1A 1E50A 5I1DB 4X5QA 2EKSA 3TYFB 5TF0A 4TLSA 2DWXA 1HEHC 3B9VA 4WUUA 5KJ7E 1FNLA 5IR1B 4OI8A 2XWRA 1UOLA 2Z31A 3DVNB 3S3PA 1Z5YD 1XTLA 1I1YB 1UKTA 1GSMA 4H40A 4XN2A 5FV2A 2ITDA 3RL0g 4NZTL 1NEZA 2ED6A 3TZVB 2KHAA 1JWSA 4M6OL 3RL2B 2FH6A 1K5NB 2EDYA 4BSVA 2DBLH 3BHBB 3T6WA 1SQQJ 3GPSA 2AKRA 2OL3A 3MC0A 3VXTB 2KZKA 5DRNA 4BFBD 1QACA 3SKJL 3VO0A 3CXHK 4DETA 2VDNH 5F6IC 3IJSB 1NCDH 4S11A 1SLVA 3FOMB 2Q86B 1AG0A 2MCPL 2FQFA 2IVFC 3S6CA 4DZ8B 3H2QA 3IDIA 2VAAA 5EUKB 4YHML 1KY7A 1EZLA 1LE5A 1DN2A 2LE9A 1MHHA 3TGUE 4G8GA 2F54B 5H2BA 1WBXA 1EO8L 3BEWB 4IBTA 2DAVA 2X6BA 3AEDC 4PJ9C 2JO1A 3ARWA 3IRCA 2FTAA 2CJUL 1SQPK 1NCHA 2TSBA 4JS7A 4NQDE 4PY7B 1BX2A 2R0WH 3AREC 3PWUB 1JCCA 1SZNA 1ZVSA 2BWDA 3ARUA 5CP3A 3WGUB 3V4QA 3ECWA 1FQ9C 2AXJA 1GYAA 2ZKHH 1ZP0C 4J23A 2K7PA 3L9RA 2OYIA 4GQ9L 3HUSB 1G6RA 3Q5PA 1UEYA 2A2QT 3FNKA 1SFCB 4B53A 5FB8B 1KPVB 4UOW0 4YXKH 4TVPD 4G42A 1UM5H 2AQRA 2F9BT 4J4PC 2CCWA 2A6DB 4OBRA 1HCFX 4PJAA 2O5XH 3EHBD 3OR7A 4KI5F 1U95B 2IOMA 4OGXL 5D9SB 2VR3A 1YAZA 2I69A 2VL4A 3AWGA 2W65A 2WKOF 1JUNA 1WSST 1A6VH 3FRUA 4G6FD 4UV4H 2N0KA 5CEYA 2ZUTA 3RVWC 5IJBC 1HQRB 4X8JA 4LPXA 2G30A 4LFHD 1HSAB 4DTGL 4X7EC 4YDJB 4OJFL 4L4VA 3HRPA 3EZ8A 3AITA 4HFWB 2O01H 1P69B 4JR9H 4R97B 1LE9B 4NRZB 1ZY9A 1U41A 4LLDA 4HHGA 3MV01 2I7OA 3LZLA 4FLRA 3A6BL 1JFHA 2XIBA 3KJ4C 5C0NC 2DQCL 3DHUA 4KXCA 1A2YA 1QLRA 4U7SA 4UU9A 4R2GB 1CZQA 2GUSA 2XI9A 4FNLL 3DGDA 2V2WB 4TKWA 3OB8A 5HY9B 4KJYA 1VERA 1FAVA 1OGAA 2FXMA 4N22A 3IFMA 4LGDE 1RUKL 5E4OA 1ICTA 1ZLWK 3UCQA 4RNRB 1KXQA 3FTYA 1M1XA 3TDKA 1GAFH 3CMOL 4KHTH 1MV8A 1SYVA 1M57D 3KPOA 1BW8A 2ZX9A 3BKML 3C5ZD 2FAUA 1JZGA 4WO4A 1ONQA 2HVKA 2L7JA 3T8XA 1MCDA 5DMIL 1FNHA 2CLRA 3ZR6A 4PJGA 3NH7H 1ZK5A 4BFFA 2O5YH 2W9LA 3D05A 2RGSA 3D6GA 1INEL 3BWUC 2PTTA 2EO1A 2VQ4A 4R7VA 4E9RA 3DX7B 4TLFA 4F1SA 5T3XH 5C86A 1NLBL 5J89A 4XPHH 4JQIH 1PEZA 1CYGA 5C6PB 4E41D 4BK4A 4OW6A 1E28B 2Y1ZA 2XXMB 4R7XA 1KN2L 1A7QH 1U3YA 2BW5A 3F01A 5B1BB 2K70A 5TDOB 1JNMA 3G6AB 1JD9A 3UO1L 2D4FA 4DW2L 1CTNA 4X5WA 2HYMA 1JNHA 1J5DA 3CH1A 4ANWA 5F9JB 5I8KH 3NTNA 2J59M 5I24A 3ZDYE 1YN7A 1TJHL 3U0WL 2IDFA 5AZ2H 3T8MA 4JDZA 4K7PY 3QPXL 1OY3B 1OT1A 3V52H 3K80A 1CD0A 2KYVA 1NAKL 2VZUA 4MS8D 4YHPA 5T5FH 2BS71 2VN5A 4X8XA 3NA4A 4DEWA 4EBQL 4DJGA 4PD4D 5BNXD 1RK0A 3GNMH 3NTCH 3LQAH 4WK2B 5HI5D 3FL7A 4N85A 1FA4A 5CBEB 3HZYB 5D1ZC 1ULVA 1BBJB 3RWCB 4AUJA 3OAKA 2YMKA 4L4TA 1GC1C 4OZIA 3INUL 4MD5B 3WFBH 5JOPE 1OD7A 2DD8H 3FDWA 2NY4C 4GUOA 3LCYA 4IEFB 1MCRA 2NCEA 4TQ8A 3L13A 2DQHL 3IGLA 1VFBA 1PNDA 2DYSB 1HOCA 5KN5A 2WXHA 5EDSA 1G7JB 1HEZB 4XN9A 5DYOA 4U33A 2XFGB 2E75B 1KCVH 1QFOA 5CNHA 5KVFH 1S7SB 3K0WA 2DQDH 2KP8A 4FJYA 3CC4P 2ILLA 2O01J 4K94H 3EGSA 3OHXA 3JZ7A 4MNQB 4OIIL 1CFNB 2CO6A 1NMBH 4PJBF 3U0PA 4ZW6A 4OH8B 3K4AA 4RAUA 4L8SA 4M00A 5EA0H 3QNFA 2FQDA 1BCIA 1F41A 4W9ZA 4AGPA 5J1TC 4LVEA 3EJQA 4JLRA 1A4KA 4HC1A 1SN2A 3WKML 1MUJB 1RJYA 3FAWA 3UZEA 1KIRA 1A1MA 2BSED 3L73J 1QTPA 1KIPA 4OF7A 5FKPB 4FHJA 1T83C 3LKRB 5KG9B 3RUGE 1P84H 2G0KA 2VDRL 3CXDL 1T2JA 2O6CA 2Z7ZA 3PHOA 3NXSA 2XZAH 4HGWB 4WV1C 2AC0A 1U2YA 3KWTA 2ADJB 2IGFH 2V4LA 4WB4A 3DX8B 2AW2A 4HJSA 4BH8A 2Y5QA 1B4LA 5JHDD 1JNNL 1DVZA 3L4TA 3LRGA 3K5BA 5CINL 3TX4A 2Q7AA 1M8OB 1PG7W 2I5YH 4L5FL 2DQIL 2JK5B 4L18A 1ZHLB 5J56B 4X7SL 4HKZA 2H6PB 3KBEA 2C7UA 5L4FA 4UILL 5CCKH 3TEWA 1ZJAA 5LQBL 3L3JB 2QIWA 4NYLB 2X2IA 3S5LB 2W1NA 1WIUA 3DTUB 1AVOA 3HEIB 3D2UA 3LZQA 4AT6A 2YRZA 3MRBB 1J8KA 3LMJH 4UYPA 4LSTH 1U8PA 1DLHB 1E40A 1AHWA 3O2DH 4KRPB 3OJDB 4G6JH 4LSRL 2R2BA 3CN1A 4OCXH 3X12A 1WZMA 2LVEA 4HZLB 5MENA 1KGXA 3FT1A 3BIKB 3VXMA 4S1QH 3NIDE 4Y2DB 1HTYA 3QORC 5DD3H 5AALA 4HXAH 1GJIA 1BLNB 4IHBA 1DO6A 1ZR2A 3DPBA 2SPZA 5H37H 3JC22 3QRFM 3MRJA 3ABVC 1BM7A 4HPHA 2YIUB 4LCVA 4NRYA 1HGVA 3KLQA 2DEWX 4K15A 4YSAA 1E4XL 3H9SA 2A74B 2VRQA 1RPKA 4JQ0D 3HNTH 3L16A 4WY4A 2BNQA 1NZRA 3L3DA 1JN6A 4YPCA 3F7LA 1V7NH 3VFPA 2HXAA 2J7LA 3HR5B 5TFSL 3DNKA 4B9IA 3EJTA 3IMRA 2XWBA 3L7FA 5IMOA 4F15B 2P80A 1ACZA 1AZNA 5JYMA 4WUKL 2H0EA 2YPKB 4KI5D 3HN3A 1N7LA 4AQ1A 2ZAIA 1ZT4B 2VLME 2W9DL 2ENJA 2BMKA 2NXYD 5KLIB 3DSNB 2BEZF 5DO8A 2DPKA 1INQB 1UCBL 6PAZA 4RAHA 4XAWH 1KBVA 2OL3L 3NG5A 1EMTH 3OL2A 3Q2WA 4S2SA 1TTBA 4NPEA 4RISH 3AM8A 2Y4SA 3QISA 5MI0C 3K2IA 4BSWA 4ELKA 2WXGA 4LESA 5H8DA 4G8AC 4EF3A 4F7MA 4K07A 4B60A 3VG0H 2BOCB 3FO1B 4FG6C 2BERA 1NU1G 1T5WB 2J43A 5C0BA 3TH2T 4OV5B 3P9LA 5K93A 1CXHA 1TZAA 4S1SL 1MXDA 2N1KA 4N2KA 5DJXA 2VWEC 2ZG2A 3QZNA 4MCMA 1CBVL 4M3LA 3VXRD 3Q13A 1SQXE 5EBLA 1G0XA 3QIUC 4G6AD 5JW4N 3GUTA 5AB0A 4Y5VB 4ZSOA 1X9VA 1R75A 2EEBA 1N68A 1W6WA 3D25B 2WN3A 3QRBA 1O75A 3VSUA 5K9QG 4UV7L 4ERSH 1P84J 2YQGA 3GBNH 1S3KH 3OD3A 1T21B 1MFVA 3PUCA 4HEME 2WYZA 4W93A 5D72H 3CC2P 2AVFA 3S34H 5IVNA 5IROD 1YC8A 5EBWB 3V4UL 3CVIL 3LEXA 1DBJL 4LHUB 2HR3A 5HVHB 2C3XA 3QEGH 5ICXA 1WTLA 3MTRA 4UQBA 3IAGC 4NPYA 4RDBA 2F1AA 5LDSA 2LU7A 1MI5D 4RFOH 4KT0J 3B9DA 4NUPA 2NZIA 1MW3A 4OF0A 1CGTA 3FZUD 4D3CH 1SQQD 5ICYB 1SMAA 1G6RL 3EBAA 1V54B 2ZKWA 5E8NB 4XVUD 3T0DA 1NU1E 1RE4A 3O45A 3VM7A 3PWLA 1EIBA 2HT4D 2Z35B 2QHRH 4PG2A 2BIOA 1GH7A 3VQ2C 2EZ0D 3HI6H 1WWAX 3C08L 3HS0C 4JFDE 1E6OH 4LLMA 4ZG1A 1JWUB 5E8DH 4PJHE 4PREB 2E76B 1VACB 4GMSL 4HA1A 1HH9B 1JOIA 5C0RL 1PW3A 2DMCA 3DRQA 3QFJE 1HN1A 2JMRA 4TTGA 3KE0A 5D7IB 5GISL 1LJ2A 4RCAA 1T5XA 3W11D 5I15L 4CU6A 1TJMA 1FDMA 1VEPA 3WUWG 4DHLA 5IEHB 1M7XA 4OUOA 4TV3A 2YMYA 4ZTPH 2FYVA 2PW2A 3MCKB 1ASPA 1ET5A 4XBPA 3SGDH 3VRLE 1I1FB 2GY5A 3F5WB 3AS3A 3LSOA 3G5ZA 2IJ0C 4OD2A 3O2WH 3U82B 3VXOB 2DI7A 3MCYA 1ZK9A 2AK4D 4RGOH 5I16B 1IM3B 5C9KA 3AEEC 3ZKSD 1X5JA 4EN3C 1UA6H 2WBJD 4L23A 3ZR5A 1OAKL 3EFOB 3I9AA 4JN1H 5F9WC 1WRGA 3L35A 3VRJA 4WK4B 3S4SA 1EAPA 3IAQA 4GUPA 4NQCE 4XVJH 5AUMB 2X53A 3S3CB 5EU3B 1QSEE 5D5MB 3LKOB 4LSPH 2YFOA 4MJID 2HFED 4WKZA 3Q6FA 2N0MA 4MA7L 1DVUA 3TT1L 4PJ8B 5TF1L 4EUPA 3UTTA 3HA0A 3O6MH 4RZCB 3DVGA 1MRFL 4O9BA 4HIIA 3FU5A 1CGYA 5IB1B 4YO0A 5ALCL 4K23L 3STLA 3P2DA 1ROCA 1S46A 2BHFA 3KDMB 2YD2A 3JTSB 5EOQL 1DJYA 1S4XA 1PX4A 2WO2B 4YE4L 1WT5A 2VXUL 4LPYA 3HMWH 2E9BA 2KZIA 3NABH 4J5VA 3GRWA 4OAWB 3TO4A 1NCWL 3DBXB 2CHDA 2JJSC 4IOIA 2XYCA 3EKCA 1PP9J 5ETUB 5IQ7L 3L70G 1J1XL 3QVAA 4Y19D 5I5IA 1AXTL 3FB8B 1JV5B 2X3CA 1EUUA 1UWXH 5IT2L 5I1AB 1PLBA 2J8UA 5I8EA 1PLCA 2RIKA 3SYAA 1H3UA 4XGZA 1ZT1A 3C9NB 4J3OC 4EOWL 3J2PA 3TH3T 1FGNL 1QKZL 3F6JA 3A4DA 1XTGB 3O6LL 5LHDA 3VI4B 4LIQL 3AT9A 2KZJA 3FU3A 3BKJH 2X4SA 5ISZD 5GGSA 2VN7A 1HXYA 1YYLL 1AGBA 1P4LA 1JPTL 2R39A 4Y5XC 3GMOA 1MCLA 1UACL 2MPAH 3QDHA 2AEQH 3OLIA 3LRHA 5MEQB 2KMWA 3SWKA 3M8OH 5F9DC 2CHWA 2WWWA 1YCSA 4HF5H 4LRNH 3FULA 1LO0H 2CUAA 4KY1L 3UTSD 4FA6A 5I9QC 2Y06L 1Q0EA 2HVJB 1VCAA 2EUXA 1ECZA 4PS4L 5H35B 2ISDA 3CZJA 1W8EA 4KKCC 4MASA 1AIFB 2A73A 3IDXH 3UH8A 4F3FB 3QRGL 3QA3A 1UWEH 2WNKA 3RGVA 5I8OH 3DIFA 1FHNA 1LO3H 4APXA 1G7LA 2EE9A 3THMH 3G6DH 1JK9B 1JZ3A 1R0AH 3UBXA 1B9ZA 4HK3N 3EO9H 4WEUD 4JO5A 3CZLA 5F93C 3ZU8A 4CKQA 5T33L 3SE4C 1HU8A 5JIHA 4JM2D 4G7YL 1E9QB 1VQ5P 2IAMD 4O58L 3ZKND 3LPOA 2YPLE 5EZPA 4DK5A 4HC1L 4EI5B 3DX4A 1G7HB 1RZIA 1PJWA 4PLKD 3CLEL 4XH2A 2CIKA 4JUTA 3U1SL 2VT0A 1IBGL 1W16A 2JJTC 4TLKA 4CJ1A 3D39A 4DO5A 2X4UA 3QUYC 1ITBB 5L8KB 5E4EC 3D3VE 4F7EA 2IPKA 4MJ6B 5J6HB 3C12A 1TYJA 1U8OB 4E42A 3QAZB 3X13A 4N2IA 4X6DB 5FGSA 3TL5A 3UPRB 4AGLA 1RL1A 1FDLH 4LCYB 2R4SL 3PL6A 43CAB 5DRZA 2OMVB 2AJZA 3CDGB 5I28A 3JTTB 4R83A 4FCHA 1GDTA 4NQVB 3TZVD 1DN0A 1MXGA 2ADIB 3L5WB 3SO3C 1OPOA 1LVEA 4HIPA 1AZZC 1MPAH 2EDWA 2ICEA 1OALA 5TDNA 3DJ9A 1JJUA 3C60A 3MXVH 3FQYA 5HHNA 3RU8H 1UZ8B 4I13B 3TFKC 4F93B 1T7WA 4TUKH 4ELDA 1A7OH 1NCOA 3B5NA 1DVYA 4UINH 3MLTB 4PHXA 3U2SA 4KDTA 2ADGB 1JGEB 1QWUA 3UGEA 4HV8A 3HLAA 4OWFA 2WNWA 2FR4A 5I1HH 3WIFA 4KUCF 4W4OA 3Q5OA 1EHLH 5KVEH 1TJGL 2ZSWA 2OJ1A 4YDVB 2PCPA 4XBEH 2F53E 1GHFL 2WQYC 3B8EB 2F54D 2FWSA 3ZRSA 2GM4A 3B9KB 1P84I 5DC0A 1CTMA 1BSNA 4JANB 2Y7SA 5LGJB 1P4BL 4AIZB 1SDDA 1KPRB 4YZFF 3VSTA 3IAPA 3S88H 4GXUM 5IFAL 1ZLEA 1CYWA 3BH8A 3L4UA 3LYRA 5LG6A 1ILUA 2N3JA 1ODUA 5HGGS 4UDUA 1I8LA 4QRTA 1QSFE 4B95C 1PBYA 2CBPA 4NHUB 1MZ9A 3C87A 4ODVL 1X6LA 3BOVA 2BSRB 4BK8A 1NGZA 4GS7C 2LTQB 1LWJA 4OF6A 4IRSC 3FH5A 4C83A 1H9DA 4PJIA 5T3XD 3VU2A 4LAQL 2KL6A 1FNEB 1BSIA 3DK0A 3MUJA 3T77B 2IX7C 3LIZA 5ID0A 1ZDSA 4Z78B 2BNRA 3I55P 4O9HL 4R90L 1UOVA 1QPPA 2ZF9A 3K8MA 4P2QA 3RIKA 5JHLA 4W6XB 1SFCD 2B1HL 5GXBB 3H32A 4ELMA 4U6YA 2YSTA 1UYWL 1HEJC 4KX9A 5DHVB 1FSKB 2WXRA 1RVFL 4HKJB 4ETQA 2LAAA 4HCGA 3RIFF 1IKFH 4GAYA 2D7OA 5J3HD 4ZS7H 3EOTH 4H1LB 2XJLA 4JFQA 5G4NA 5GGVH 1WD9A 5B8CB 4NO2A 4O51B 3BT0A 2BJML 4PUBH 4DOHE 2VZ1A 1M56B 1QPKA 1RI8A 3EBGA 2AI0L 3DYMA 3IBOA 1E9OA 3F7VB 1ACYL 4HLEA 5IESH 5D1QB 1G9NC 4MAYB 4QXWA 4PHZA 4BWWA 4TL4A 3MJ9H 2FRGP 4Y9CA 3C2AH 5F7WC 3IMSA 1XF4B 1Z9SB 3QULA 4J12A 1RHHA 3QG7H 4R2GD 5E6IC 4CN1A 2YUXA 1F1DA 4HFUH 5G2NA 2ZPKH 3RKDC 2OQQA 3ULVH 1Q0YH 1VGEL 2GQHA 3WNPA 1SOQA 2G4GA 2I9LB 2J55A 5C0AB 1B4TA 3MOAL 1L3WA 2JQMA 3FQTA 3AG4B 3H3BC 2J8HA 4F91B 2NW3A 2FBRA 1I1CA 1PYWB 3FO9A 1LWRA 1CF8H 3UC0H 3OZKA 1KV4A 4HKXA 5C8JB 4GOEA 4B96A 1ZLUH 1IT9H 1SQBE 1MWAB 4YJZL 4JGNA 2CWRA 3ARBD 1NEPA 4ZPTB 1WLHA 1H0TB 2EILB 1Q7YQ 1UM4L 1E5UI 4R4FL 5E5MB 1JPGA 4N2MA 2AZUA 5KSVA 2RA1A 4NDMB 1A9VA 1GGIL 5E5LA 3VXUE 4E9QA 4PJCE 3QUXA 1QNZL 2DQEH 1MY5A 2GPZA 2NSMA 3HBPA 3MLYH 1M1JA 1KBBA 1CI6A 3GDBA 2EH7L 4P9HH 5TH2B 1HWHB 1RQ5A 1OSZA 1QO3B 2GK0A 5FUCC 2G2RA 5DJAB 1A25A 1P84D 1RZJH 1N2RB 3JV6B 5DHVH 3WY3A 1DZBA 2NYYD 4A7GF 5EUOF 1BQHG 1UASA 5DWPA 3ESPA 1HKLH 4FX5A 3WEXA 1TKWA 5FGCB 3KWWB 1IGYB 3A24A 4WNSA 3GK8L 4ZO7A 2YS4A 3MU3A 4OM1L 3TCXA 4CVXB 1NANH 3OAZK 4H1LH 4FQXA 4IGBB 5D7IF 5DUMH 5I0DA 1KN4H 2Z31C 4G8EA 1PLGH 3UABA 4P99A 2PP7A 5HHMB 4JL1A 3W57A 3E6HA 1H6FA 3L3IA 1UJTA 3F65A 3AGVA 4QO1B 1KYOE 1AR2A 1BECA 1KZUB 5KAQG 2JWAA 5TQ0L 4I48A 4GG6A 1QHQA 2YGNA 1H3PH 1IGFL 5EFIB 5KEZA 1IGML 1G7MB 3H55A 5IW6B 2QJPB 3LPFA 5B38A 1M4KA 2AQ2A 2VXVL 3MRNA 2EDXA 4MHHI 3EJUA 3QFGA 2FYUK 1A7PL 5HYJA 2NX5B 2CR0A 2JXMA 2P5WE 4Z3FA 1FBIL 1MVYA 4I89A 4AIEA 4LHQB 2XNDH 3KPMA 4JVUA 3V0JA 4N24A 2PYFA 1A8JH 3GRWL 3V2PA 1QL2A 2W38A 5D5MF 4C47A 2X89A 3BN3B 5JORB 5GHWH 1WCBA 2E75D 4LSSH 2HG5A 2AXHA 4KROC 2AF2A 4NJAH 1GTFA 5MP6L 3SHSA 1MWAH 4NC1E 4A55A 1DQML 3SE8H 1BPVA 2CBQA 4JBZA 4IOFD 2V2XA 5JHMA 3VVVA 5EIQA 4RWYH 5IJKC 4G5ZL 3PHLA 4P3CL 1DVTA 3ROLB 2X1XR 4GIAA 4HDIB 4KOCA 1TITA 2DQUL 1NAFA 1E43A 1LTXA 2FJGB 4HJJL 4AYSA 1NCCL 3I02B 1U3HA 3T0EA 1D5XB 3VXSA 4LCUA 3CCRP 4MX7A 1HNFA 3O3AA 1BGYG 1BOGA 3KLSA 1T7ZA 3UTPD 3EYUH 2RN0A 1F3RB 3GMMA 5I19H 1IAOA 1YEEL 1BZ7B 1CPUA 1VB9A 1NUNB 2E59A 3HIZA 3MBWB 5FUZL 1Z32X 3CCSP 2A9CA 4LRIC 4V1DA 3TN0C 5F7AA 2YZ1A 4YDLB 3RY5A 1A1OB 3DI2B 1MRDH 2FATH 5HHOE 1GL4B 3OVUB 1AD0A 3VI4F 5HYSB 1T1XB 5H94A 3MZWB 4FG4A 3A6CH 5BXFB 5KOVC 2AGJH 4EIZC 2YAFA 1PG7H 1QLEB 4NWTH 1JRHL 1PJ9A 5FUOL 4PS3A 2COVD 1T20B 1WT6A 4OCYH 4B0MM 1JZ7A 2OARA 3NFSL 4KUCD 2MOQA 5INCA 3L2LA 5IJVA 4WGWB 3IK2A 1CD9B 2C5DC 4CVZB 1PP9D 4D0CB 1GYWA 1HL9A 2VQUA 1O6TA 3UIAA 2WLJA 5IK3B 3TTYA 2J6EH 3V79C 2WSFH 1CXEA 4KRPD 4RQQB 2GT9A 4GQRA 4Z0XB 2UY6A 2Q76B 3AY4A 4UAOB 4B41A 5F7BA 1NC2B 4JO3H 5C6TH 2VXSL 1KCRH 3DXAB 4Y2DD 4NN5B 4PP2B 1GZHA 2RH0A 4QCIA 4G6KH 1ZV2A 2VIRB 2FFDC 1T66D 4IM8A 5DXWA 3MGOA 4XNBA 4WAFA 1DQIA 2VZVA 2WLIA 1LGVA 1LYQA 3FT2B 4UMGA 12E8L 1RUAL 1GW6A 3PIQB 4Z18A 4E9WA 5CCGA 1XVSA 3N3EA 4LDCA 4EOTA 3TA3A 3X3FL 2ATPB 2BVQA 2Z4QA 1H8AA 3IETA 5IIEA 1YJNP 4JMNA 3J07A 2GAZB 3L3OA 4CC1A 3HS9A 3X3GL 2YSSA 3MRRA 3V6FA 4JFHE 4JFEB 2YQ2A 5DEGB 3TURA 4FLQA 5HJGA 4OCWL 2NR6D 3CBRA 3OGOE 3VFNB 2HKAA 3MRFB 2AP2A 3ARPA 2P46B 1H8SA 1X7TA 2A7BA 5CWSB 3SGEI 1KTMA 5SWZE 3IGFA 3DYOA 2YR3A 5FUCE 4Z7WB 5MHSE 2C9PA 2B0SH 5GGRA 1N18A 4JAMB 5E51A 3D08A 5D7SL 1QATA 4X6DF 2X0UA 2WITA 1X4ZA 2BCMA 2P1YA 4OFKA 4DN3H 2J1YA 1TZHA 4L05A 3O6FC 3OG6B 1JF1A 2YXMA 1NTZD 1KPUB 1A6ZA 2HT3D 5IQNA 1QLEH 2OXGA 4WUUE 1KT2A 2JFCA 4R7DB 4I4WA 1SLUA 1ZGLB 4TYUA 3K74B 1IEBA 4YEEA 5JR1H 5HDBE 5HGBA 3Q9QA 3VGEA 5F7DA 2DY2A 3L95A 4GAAA 3P73A 4DVBA 3WTYA 3RG1C 2NQDA 2B59B 4GIFA 2IPUK 3GHGC 2HRLA 2DLFL 2VLKB 2R2HA 5EF3A 2WAHA 5JW5A 3MLRL 3H7BB 5C7XL 1DUZB 5DRWA 3RFZB 5B1KA 1ET8A 1T22B 1WBZB 4LHUD 4X98A 4JRYA 4ZMOA 3WIAA 5JIDA 3S36L 4KTDL 2WQ8A 1AQ5A 1G94A 2FYUG 1BXVA 3D5OF 2HN7B 1OP3K 4ECNA 1CB4A 2X40A 2F7QA 4M6NL 4B9PA 3LIZL 2FT6A 1KCSL 2KSJA 4G8GE 4GDOA 3NJHA 1EC5A 1W91A 1XH1A 2ID5A 4HKBA 5LCVA 3ZXAC 5JHLL 2QDWA 3MLPA 5C09B 1XH2A 1GS6X 1QA9B 3KPQB 2JWDA 3H6PA 2NYKA 4BFKA 2WSFJ 1LK3H 3WS6C 1AJ7L 3T97A 1QP1A 3APCA 3HAEB 1UUSA 1BZQK 3AS2A 1BFVL 3PHAA 5AFAA 5I6OA 1YHPA 2E76D 1BWWA 5DVMA 4QY8B 4I77L 1PG7X 1KDIA 7TAAA 1H9VA 4D9RE 1R3KB 1LWUB 1TDQA 1FO0A 3QXAA 4AVIA 5KW9H 5KYXA 3VGGA 4NT6A 1T1WA 2JIXB 1RF1B 1CR9L 1ZMEC 1AE6H 1LM8V 5E6ZA 3A6OA 3WMM0 3RZCB 5I76B 4J39A 1IBZA 4YPGB 1GW4A 1S5IL 4X6CF 3LKQB 1WFIA 3CVDA 3VDBA 5I0WA 2AJSH 2XWJA 1ES0B 4XNAA 2OJEB 3REVB 2X4RA 4AJ0A 2IC2A 1BCCG 2B4CL 5J9PB 1KCKA 1FFQA 1Y9BA 4M4RB 1N73A 1U9KA 3QGVA 2FJHA 4PJAE 5KVMC 2QFPA 4XMWA 1QVOA 3SQBB 2Y0DA 1IM3D 2ZXQA 3IEAA 2PPCA 1S7UB 1EDKA 4K3DH 9PCYA 1BAWA 2ESVA 3T2NH 2PFXA 1G1IA 2QV2A 2K3TA 1SXBA 5DMGD 2XWEA 1NSNL 4L4VE 4BYHA 1GS7A 5CM1A 5EMYA 3ELQA 4WSKA 1T6AA 2APFA 3G5YB 5D1XB 4PJ8D 4FFWC 2CO4A 4HAGA 4RIRA 1EVUA 1D5IH 4LEOB 3HC3L 3QWOA 2VDKL 4TQEL 2KLTA 4K3EH 3KPLB 2H9GB 4WWOA 5CZXD 5EU7C 5D2LA 3VFGL 2EDDA 4L9DA 1NDMA 1BG1A 3OJMB 3HE7C 4X2UA 1R46A 1YMHA 1GCFA 4QGTA 3Q8FA 4QMAA 1YJDH 4O4YL 4XZ4A 5DCCA 5IZ7A 4IK6A 1ZVHA 2OS7A 2ZWSA 4KKBC 1J9SA 1OGAE 2WB1A 1RZGB 4Y7MA 4GAFB 1LTBC 4ZFOA 1UM6L 1KXQE 1QFWL 1V7MH 5EORH 5GJSH 1DQJB 3MLZL 3ENEA 4NKMA 4PD4K 3HAEH 4WFFE 5E08L 3LY6A 2ITEA 4C56E 3O9WA 5CP7A 4LARH 3T3PE 3VTTA 2NY0C 3FQ4A 3SDCC 2XTJB 1A6TA 5ILTL 3BASA 4JMXA 3T6QC 1QSVA 4MXQC 1UTDA 3TPUB 3FCTB 3NRFA 3X1GA 1JFQH 3CDFA 5IMLB 5FOBB 3NIFB 3S9DB 1XGUA 3K2UH 4XAKE 1LD9B 1IAII 1P5UC 3F64A 4LLQA 1GGCH 4EYYQ 4HIXL 4FTVB 4YHNB 5C0CE 3GJEB 3W5MA 1UIIA 2P8PB 1KC8Q 2WP3O 2FLBT 5I1EH 4JVPA 4OGYH 3AM8C 1GZQB 1HBWA 2VW6A 4Q52A 1UXWA 2QMKA 5KYUA 1EBPA 4AYFB 2O5ZL 3UTQB 1N19A 4X0NA 3KQGA 1WUNT 1IV8A 2PF6A 1NO4A 1YNLL 2H26A 3ULSA 2F5AH 4LIQE 1BBDH 3QXDA 1USZA 3JV4B 4ZUUB 2NY7H 2R1WA 3FCSB 4K4KA 1P4UA 4UIKL 3NJIA 4IK7A 4Z7UA 1MRCH 4PJ9D 1RZ8B 3BZDA 5T1KA 3MQIA 4N0UA 2OR9L 2IH3B 1OB1B 1T1ZB 3HTKB 2KBGA 4P5RA 3IJ9A 4G43B 4L4TE 4OZIE 2EO7A 4F33B 1JV2A 5IVXA 3WN5C 1VEMA 4A2EA 4EI5D 4L8CA 1XFPA 1MVFA 3N6YA 4KAQH 1JHKH 1M71A 3C6LC 4U6VL 2W59A 5J12C 3PAUA 1KILB 3QWNA 4GW4B 1ZIAA 1M42A 4D0BA 2OSYA 4GO6B 3SFEC 1NAYA 1FZAA 2NY3B 1XCQB 2YC1A 4F7PB 2B9BA 4X80H 5J1AB 4D7PA 2YPVA 2FO4A 3JQOB 3H3KA 4Q6KA 2UZXB 4G6MH 5HGDB 4PJ7B 2L3BA 4X4XB 5AW0B 3LZFH 2BNUA 2XDJA 5FEBA 1C08B 4BSJA 4J4PD 1OLLA 2C0WA 4A7SA 2ZUQC 4HLZH 2YBRA 1OMIA 1NTKD 4XE5B 2OJZL 3QIBC 3US0A 1NUDA 1Y7VA 4G9FA 4C57C 5I1LA 4WTQA 1EBAA 3LIEA 3ARGB 4MMXA 1NUFA 1G5AA 1ZLVH 3SCMA 4ZXBC 5IBUB 3RZWA 5DR5H 3GMAA 3WGVB 4RESB 3IU4L 1DEEB 3Q01A 3FQUB 3GZPA 3TEXA 4Q6IA 4E5XB 5IG7A 1J86A 4JN2B 4RRPA 1T1YA 5LLIC 3LN5A 1N10A 1FZJA 1JZHA 2V5MA 4KHXH 5JUEL 1P9MC 2OMYA 3EF4A 2WJ7A 3ULVD 3BN9C 4QHUA 3MV7E 3SPJA 3B9KD 1TNNA 1U8NA 3DX0A 2H6OA 3HC4H 2AABH 3IFOB 5IJDC 1PGPA 2WVUA 2X2YA 2WTOA 3ETSA 3MYZA 4QGYA 1WA1X 3TVMC 4KZDL 5F9OH 4YBLB 3CDZA 3RFRA 5MENE 3M17A 3SWFA 3CFJA 3VACA 3OC5A 2BEQD 2YXQB 1HQ4B 1UXSB 3IFPB 4GRWF 4KO7A 4L3EA 3HB3C 4OI9A 4Y0GA 2BFGA 3EOBB 5ALBL 2WSPA 3BZ4A 3HUJB 4C54A 1MFBH 1QSZA 3FQRA 1KELL 2K7QA 1W2BO 3DTXB 3E8UH 1X5KA 3L9YA 2WWMD 3TNMA 1FL5A 1ZHNA 4NKIH 4MCNA 5CGMA 3H9SE 1L0LK 2HYNA 2G3ZA 4KGJA 3RA7H 3E9UA 4BUHA 4QYOB 5LNEA 2QLYA 2EIJB 2DIEA 3AB0C 4M3HA 1DCEA 1GOGA 1XF2B 4Z7OB 1C12A 2DN7A 4QJ5B 1WK0A 4ANUA 2P7TB 2R69H 3WHE1 4S1RH 4WU7A 1A5FH 3GSQB 5IB3A 3O4LB 4BUQA 1R5IA 1J48A 4Z7WF 5AVUB 3ULUH 3R7RA 2VR6A 3QQ9D 3IXAB 4ENEC 3EJRA 3Q8CA 3QXTA 4FRWA 4RFEB 3RL1B 1M56D 2YAOA 4QNPE 4QTFA 1A9BA 1FFOB 1R3JB 2UXVA 4YVNA 5KSBA 2Z4TA 3L4YA 5F0LB 4XMPL 1U8JA 2WZPD 2F7OA 2Y2TA 3FFCA 2Y25A 4TNFA 5D1QD 4OT1L 5TPWH 3CMAP 4MAYD 3S35L 2WUBL 1X6NA 4NM4H 3L72J 2WZAA 1UZ6F 3P4MA 1M7IA 3V4PA 5GS0H 3TF5A 1NWPA 2XNAB 4BFJA 3L7EB 1DFBH 5C0AD 1KFNA 3LW5H 5I1GL 2R0LL 2H7HA 4GUCA 2H0JA 5KANG 5L8JB 2D7TH 3S98A 2YWYA 4XO8A 4FKEA 3GLDA 3ZDMA 1LWHA 3FCUB 5LCVL 3E1IA 3FSZA 4WFED 1RLWA 1VZGA 4J28A 3NPSC 4ZSOE 4ACPA 2C9SA 4FMFA 3HZ3A 5BRQA 2NNXA 4FF9A 2ZOWA 3QDJB 3GD1C 1ZANL 3WLWC 4PRNA 3RNKA 3D4YA 1RZ7L 4AGMA 3I74A 3H54A 3K8LA 5KZCD 2Y5TA 3NJVA 4MRCA 1AC6A 1KWKA 3T0WA 1JIBA 1V27A 3BAYA 1I3GH 2Q9IA 1A0QL 1FO0L 3UYRH 1MJ8L 3KPRA 1Y0LA 4GMTL 3SKNA 2GABA 4WHTB 3FWLA 4NKDA 1LTTC 4IMLA 2IXQB 1J1PH 3F85A 2ZCHH 1Y18A 5F7FA 2ITCB 2W9EH 5BU8B 5JQIB 4ZX4A 2NY6B 3FCBA 3DV6B 5F3FA 3RWEB 4YFDB 2E74C 1I8AA 5F70A 3QC6X 3ILDA 4FD0A 2YBGA 4M93B 2QE7H 2FSDA 2VDOB 3MRHB 4MB4A 3JCUE 2VLLB 2VITB 5B39A 4RMRA 4ABVA 2VW4A 4PRIA 3UTZA 4HQQL 4L3AA 3NGBB 4HJGB 4LLYB 4YSSA 4IGBD 3NAAH 1U8KB 2E9WA 4GAJH 4JKMA 2NY5H 1FJ1B 3GBML 5DK0B 2JI1A 3KLAA 4JG0H 3W56A 4A1RA 4NEHB 4EUPG 1A7BA 4A04A 4B97A 1OW0C 5HHMD 2K8QA 1A9EA 2LKMA 3JWNC 3LRSA 3KLKA 4MJ5B 2NUTA 4CDHA 3HE5A 4CMMB 4TM9A 4YSQA 3DUSB 4IRJB 2IV8A 4UT6A 2AAAA 4YIQA 2BP8B 3CC5B 4IFDK 3C60C 4DCQA 3O81A 2AERT 2VDLB 4GRLC 1E5CA 2QGEA 4TVUA 2QJYB 1XZ0B 1R6VA 5J57B 3B5NC 1IJ9A 3V0IA 4GBXA 2PP9A 3ZE0B 2DJUA 3TIDA 1D6VH 2NX5D 1F2QA 1LO5B 3EJZD 5AVVB 4AQEA 4F5CA 5B4MC 2ZT9C 3HNSL 4ZZKA 2DJMA 3GB7A 3FB7B 4AYBA 4DKFL 5GZND 2VW7A 4ZFOL 1MAKA 1XF3A 2WXIA 3CPLA 3QJSB 4QRRB 1AVYA 3H1JG 1CE6A 2ZP0T 1Q0XL 5DK2A 3UTTE 2KPWA 3C1LA 1S9WA 3U9PL 1T3UA 1IKOP 1WFUA 4PB0L 1I8LC 3QFDB 3LS4H 2JI3A 3MV9B 4MJ2A 5HD8C 3PWPA 4PH8A 3WMSA 1JYXA 1NBYA 2PUQT 4ALAC 4XVSL 2CK0L 1TETH 1LP9A 4QR7A 3WUZA 4N2LA 4D6TD 4UIMB 4JFZH 4R7LA 1LP1A 4NENA 4U1LB 4XMZA 2J1KA 1CGUA 3EO0B 2WWKO 4KKPA 4U6HA 3BRDA 2VDOH 3V0WL 4PV1B 3PLNA 2EXWD 1L0LG 2KI6A 3MRQA 4BRYA 1T04B 4LSQH 1G1CA 4HJGH 3FQNB 2Q7NA 2IH1B 1KXTB 2XVBA 2XG4B 5IMKB 1I1AC 4OCRL 3QI9B 5K59F 1QLED 1I7UB 1HI6A 2X4QB 5ESAA 1GKOA 3NIFF 3H1JE 3UBXG 5AVTB 2QT6A 3HPJB 3JWOC 1BVOA 3U4EA 2A1WH 2CGZA 2N56A 4NN6B 5CJ0A 3K6IA 4W4NA 1SXNA 3ITKA 5IFJA 3EDKA 1BE3G 2JKIS 2VDLH 4YDKH 3MGTB 1F8TL 1WZKA 1AHMA 4X4ME 2KUBA 2DL2A 2R29H 2VXTL 3KYOA 4LKCB 2Y7NA 3SFDC 1NC2D 1N7SC 3G7TA 1NAMA 3DXAD 2N1TA 2WVVA 2IALB 1D9KC 2IO5A 5EO9A 3A67L 1MNUH 3CVHB 3FSWA 4I5BB 1LT9B 4CSPA 5KAIE 3VNZA 2AZAA 4OFYD 4L4JA 2QKIA 2DQ6A 5ADOH 3EH2A 1A4JB 3VD7A 2FYYB 3NSXA 3PGFL 3LAFA 3RK3B 1U21A 1Q9WB 2DH2A 3NJMA 3PHQB 4MQ7B 1SHWA 2LT9A 5TE7L 1JEKA 3H8NA 5CJXC 1SJHA 2UX7A 4LKXA 1BVKA 4MD4A 2YPVL 4DGYL 2BC4B