1YYCA

Solution structure of a putative late embryogenesis abundant (lea) protein at2g46140.1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
174
structure length
174
Chain Sequence
GHHHHHHLEASADEKVVEEKASVISSLLDKAKGFFAEKLANIPTPEATVDDVDFKGVTRDGVDYHAKVSVKNPYSQSIPICQISYILKSATRTIASGTIPDPGSLVGSGTTVLDVPVKVAYSIAVSLMKDMCTDWDIDYQLDIGLTFDIPVVGDITIPVSTQGEIKLPSLRDFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of a putative late embryogenesis abundant (LEA) protein At2g46140.1
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords putative late embryogenesis abundant protein
total genus 31
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2005-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03168 LEA_2 Late embryogenesis abundant protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1yycA01
2.60.40.1820 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1yycA02
1HUCA 5AVSB 1GK6A 1H8AA 5APSA 2WWWA 3LIDA 1HJBA 2QM8A 3LIEA 1FAVA 5AW0B 5AW7B 3VMXA 1S9KD 1H88A 5AW2B 3KDPB 1MFZA 5AVTB 1JUNA 2P7JA 3HE5B 5AW4B 1HBWA 1NAFA 2KP8A 1DH3A 3UIAA 3V5BA 4C7NA 5AVVB 3HTKA 1X8YA 1CSBA 2JJLA 2XZRA 3HE5A 5AW9B 4JYCA 5AW5B 2YNYA 1GTWA 1YYCA 3NMDA 2WPSA 4C7NB 2Q5UA 3KQGA 2Q7CA 2Q3IA 1J2JB 1GU4A 3B8EB 3M9HA 5CMZA 1H89A 2H7HA 3A5TA 4I6MC 3L37A 3TNUB 3VMZA 1IO4A 4M3LA 2QM7A 2WPRA 3V4WA 1SP4A 2WT7A 1G2CB 2R5BA 2XV5A 5AVUB 5APWA 3A2AA 3MGNA 2XU6A 4EOTA 2N9BA 2R32A 5APXA 5AVXB 3M0DA 3M9BA 3O8ZA 1A02J 1MV8A 1SLQA 3NXSA 1KQLA 3P32A 3TYYA 1CI6B 2BASA 5APTA 5AVQB 2E42A 3IR9A 2YO3A 3I5CA 3TNUA 3VN0A 1MUUA 4RESB 4C46A 1FOSF 2YO2A 3OAKA 5AVWB 1JNMA 2Z5IA 1GU5A 4KHXA 4JYBA 5AVZB 2WT7B 2W27A 5APUA 3M06A 4XE5B 3SWFA 4AUWA 3TK1A 5APYA 1GK4A 5APQA 2Z5HA 2C9LY 3P8MC 4GT1A 2P67A 4HYTB 4I2LC 3M0AA 2R5DA 3HE4A 1OWAA 2R3CA 4AYCA 2P2UA 3HE4B 2WTYA 1S9KE 1T2KD 3T97A 5AW3B 1GD2E 2WPQA 1HWTC 4B86A 1XO8A 1NWQA 4DZOA 3NTNA 2VRSA 1CI6A 3L35A 5AW6B 1T2KC 3VYIA 1OXZA 4LC1A 3P7KA 1A02F 5AVYB 4AQRD 2ZXEB 2E43A 3V4QA 2IPPA 1GZLA 5AVRB 4GKGA 1FOSE 3L36A 3VTPC 2C9NY 1CZQA 3M91A 2ZFCA 5AW1B 5AW8B 3MD0A 3A7OA 3A3YB 2W6AA 3VMYA 3NFQA 5APVA
chains in the Genus database with same CATH superfamily
3FMGH 5IHHA 4B9YA 1XCTA 3SQOH 3CPUA 4M7ZB 1GR7A 2NPSD 5F7YC 1DJYA 4LCIL 1IIKA 3AUVA 1UUSA 1T4KB 1HSBA 2CHXA 4JFUA 2XN9B 4E41A 1N6QH 3UAJD 4ODUA 1CQKA 2CGZA 1LO5B 5EEUA 1WD8A 4OGYL 1GGTA 4RA0C 3WDHA 4CU8A 5D2NB 2IBBA 3QDJD 5F1IB 3WUWG 4N2KA 2HTLD 4I4WA 4OLUL 1JFHA 3MV8D 4PLNC 2W80C 1M7IB 3TYGH 2OR8A 5CGBA 4LQ1A 5ESVB 1NBVH 3EGXB 1NMBL 4FEMA 4FF9A 4YGVB 1QQDB 4R4MA 4FI7A 1IFHH 2D3LA 2WPSA 1FZGA 2OMVA 2GSMB 3BZ4B 2V8MA 4PLKC 5DT1H 5EU6D 1ESOA 3S37H 1Y1UA 2F5AL 3IDXH 4YLCA 1MCNA 3WCYA 5B1AB 4A7GF 5C09D 1XGUB 1XGQB 2K1AA 1YYLH 3U1QA 3IXTA 4TOYH 3IMTA 1BE3D 5KJ7C 4IBVA 4OI9A 3UIYA 3IDJB 1KJVA 1BVLB 3MLWL 4UF7C 3MCG1 3FU5A 4AE1A 1F4WL 3H9YA 5BOZG 1E67A 3DYMA 4MDIB 3ML8A 1J8HB 1X5HA 4L3EB 1HGVA 2R32A 1CDGA 3L4TA 4PGCA 4OGXH 1DLHB 4YS4A 1VQPP 2X4PA 3EDJA 3MBEA 2V2TA 2CIIB 1FYHB 1AKJA 1PIGA 3DJTA 1TPXB 4M29A 1GZPA 5ALCH 1NWPA 2V33A 4FXGC 4PRIA 3UTTB 4FQIL 5E24E 5CEZL 1T1YB 2FX8H 2P45B 4BZ1H 5JTWA 1F5WA 2AVFA 4RZCB 5F21B 3FQWB 5SWSA 1D7DA 2H6PA 4LVEA 4DETA 5HDBE 5L0QC 4E41D 4FQ1L 4BYHA 1E4WL 1JL8A 4WI0B 2XFXB 3RPKA 4M5YL 3VXME 2PWHA 1KELL 3FU0A 3KWWA 4OF7A 5LN4A 4G6FB 4K3DL 1RLBA 2W6BA 3K81A 1MJ8L 1QATA 3H7BA 5E51A 4D0CB 4P4KD 4DWHA 4D8PA 2P67A 4L73A 2BP5M 1FBIH 3RY6A 5CLZA 2C26A 3ZYIA 1EVTC 2XZZA 1ZHKA 4JFTA 4JFWA 5E8NA 4X6CA 1SXCA 2GK2A 4YDVA 4YWGH 3RWGB 1XDTT 1XCWA 4G3YL 2IJ0C 4YBQD 1KGXA 3M8OH 2V17H 5F7HA 4Y4HA 1LP9B 4LFHD 1H3XA 4G7QB 3VRJB 3CFKA 3KPPB 2FVNA 5DMYA 2ERJC 2XYBA 3CCHA 5ADOH 5IV2A 1ZDQA 5LN8A 4WEBL 1FL5A 1EANA 4KQ3L 5F1NA 5JQIB 1LE9B 1LTJA 5FHAL 3UAJC 7FABL 1FVCA 2VL5B 5KLVK 4HKJB 3FXDA 2DLFH 2WXRA 3BUYB 4M02A 2C9PA 3AU1A 3ARRA 4FNLL 1BD2A 1BWMA 3NT0A 2GA1A 1CDHA 1WFUA 4EPSA 2JFCA 2TSAA 4MNQD 2ITCA 1EHXA 1S5LX 4HWEL 5CLYA 1LO2L 4PY8I 1QBML 3FUEA 3MOAH 4JHAH 5AW0B 1H88A 2A74C 1W2KT 2UZYB 2NR6D 4Q6YA 4AL8H 1MCCA 3KVQA 1VQ4P 3BW9A 4Y5YB 1BF2A 1IILE 1EEUA 2Y7NA 3ZDXE 3DVGB 4AYBA 3NA9L 2VM4A 4CW1A 2PPDA 3WL9B 4BH8A 5A2KH 3KPLB 1R3JA 1KJ2H 1LO4H 2IV8A 4G6MH 3F65A 4G8GB 1MFDL 3IJ9A 1OCZB 3TBTA 1FLRH 3ZQXA 4WW2F 2P5PA 3D48R 3CVDA 4LIQL 2CG9X 5DCCA 5DO8A 35C8H 1KTMA 4GAJL 1E4HA 1G4RA 2VZVA 5B66H 1BJMA 1OGAA 2YKLL 2BVEA 3L1FA 4R97B 3KPMA 3EFFK 4ZG1A 2ESVD 3N85L 1CB4A 1FZJB 2Z35B 2EIJB 2QQQA 1CJYA 5JMRA 4HIXL 3SD5A 5EZLA 3R06B 3NN8B 4KITB 1ZW0A 2NXZC 1S6NA 2DH2A 3FHQA 3LRGA 3OXSB 4JVWA 1TU2A 4U1IB 1E5AA 3QNYA 5KJ4A 5C0FA 2XQ0A 2J44A 3QZOA 5FX3A 2YA2A 5ILTL 3NCFB 3P8CD 3Q5PA 3R1GH 3CDCA 3B8SA 5D71H 5TE4L 2HPTA 4XX1E 4JDTH 3EFOB 2FB4L 3D85D 3FUJA 4RSVA 3SPIA 4H0LB 1JGLL 2QJPB 4HOZA 1XVSA 4GINA 3SKJL 3O6KH 5L7XL 1MFEH 4CVZB 4ANKA 4DCQB 2ZCKH 5AVZB 1E28A 2XDHA 4GAYA 4J6RL 3BRFA 1KJ2A 2XXFA 4L8SA 2ARJB 4TTGA 3LPOA 1MVFA 4BFFA 3INUH 4W9FC 3V9CA 1O0VA 4OZFG 2LU4A 4PJDF 4D3CH 2QSVA 1R3JB 2FH8A 5E1QA 3T08A 1ROCA 3HD7C 4FTVE 3VG0L 4HIJB 1AQTA 3PYCA 5EC1A 1XX9C 2BCKB 3NCMA 4DK6A 2BX5A 5B38A 3NCXA 5GTIE 4KXZH 2FUQA 1SQVJ 3ALXA 3RDTC 4AG4L 2K8MA 1ECYA 5TDPB 2P47B 3BJLA 5IIEA 3EBAA 2VN5A 2FKWB 2DEWX 2KNCB 1AD9B 4F58H 3E1RA 1ETB1 3LIZH 3NRFA 2VR8A 4N0YH 1MFEL 2ICWJ 5IFHH 1SQPE 1KB9D 2K9UA 2RFXB 1WK0A 4WCYH 4F9LA 5J1AB 1KLFA 2WQXA 4EI6A 2IYOA 3UTSA 4U3FG 4ZI8A 5L2KB 1JOIA 1U42A 4ODTH 1DBKL 3AG4B 1Q81Q 2WIIA 1CDUA 1KFNA 2YD5A 3GXIA 5C3LD 1S7SB 4J12A 2WBWB 4IMKA 4XN8A 3F7PC 3K6FA 2Z93B 5H4YA 1RIUH 5H94A 5CEYB 1U57A 5AW7B 4K9EC 1NSNH 3WUWB 1F4YH 2X4NB 1P2CB 1P7HL 3RDTA 1I7RA 4GLRH 1NLBH 4Q7DA 4TSCH 4NXKA 4E5XA 4P46D 4HJJH 1NCAL 3EYFA 1QLED 1MFBH 4D8PB 1L5GB 5C0DB 1A6TA 3WFCH 2VR4A 3VXSD 3MNMA 5E95B 2HFEB 3ARBB 3TNNB 4NO3B 2UY6B 1K8DB 2FJUB 4ALAC 1A6VH 1SJXA 4PAZA 3SDAC 1O6TA 2YK1H 3ZBMA 3PL6D 3KVPA 4JFEE 3FFCD 4KK5D 2Z4QB 4X6DF 2ZCHL 1L7TL 1RHHB 4PTUA 3KLHD 1CI3M 3IWVA 3QQ3B 1G2CB 4YLQT 2R7EB 3U7AA 1SLWA 4MMZC 4J3WA 3PU7A 3T3MB 4B3EA 1BQUA 1HK6A 3FUMA 3VMPA 3NEOA 1KUMA 3M0DA 3O8ZA 2A45I 2HLFD 4CSSA 1BOGA 5EO1A 3RRQA 2WPGA 4DZBB 1F90H 5CWSA 3L1OL 5CP7A 4Q97A 4LLYA 3UJTH 2XC8A 3FOMA 5CP3A 2FBJL 5H37H 4FMKA 4IGBA 1L9OA 4GP4B 1LWUA 1FIEA 4LAJH 1KJ3H 3DX4A 1DE4B 1FP5A 4KTGA 3AMKA 3MRCB 2RD0A 3FC8A 3KWUA 1MHPH 4P46A 2DIAA 5I1CL 3FO2B 4ZTOL 5IW3A 1OQOA 2ZKWA 5GGUB 1K4CA 2IBZI 5JW4N 2YPVA 3ARVA 4M5ZH 3IXAB 4CADB 1MZYA 5HDOA 1HWTC 3GBNH 3PWPE 4X6BB 5KG9A 1KJMB 1LP9F 2UYLB 4LOFA 1UWEH 3UGXA 1YJ9P 1QLRA 2FLMA 1UJ3B 5IFAH 3ERXA 2IANE 4G5ZH 5FK9B 3ATAA 1A6ZA 5DK0A 4M8RA 5CHNB 3VGGA 5FCUH 7CGTA 1H15A 2EECA 4XPFH 4MZ3A 5AFAA 2VXUL 1HHGA 4RMVA 1BLIA 4GOFA 1RPUA 4WHYH 2KZ1B 3L36A 4UNUA 5D2LF 5IB1A 3S97C 1K3ZA 2G2RA 1CL7I 1D6VL 2G9KA 1INQA 3JWOC 4JQIL 5CZVL 4O58L 2OYMA 4YH6A 5IBLD 2Z7UA 1CBVH 2YMXL 4HIQA 2HLOA 1VPCA 5E6YA 2DL9A 3OLGA 4H44D 2EXYD 1VA9A 4XOEA 4XR8C 1EJOH 1L0LE 1IT9H 1DQKA 3MN8A 5IVZB 2BVOB 3ZQ9A 4M8QB 3TTYA 3LZFL 2WVRA 4XNZB 5GS0D 4DZ8B 2OMTA 2X2YA 2HB0A 2F54D 1D5BB 3LKSB 3QFJB 1LP9E 2HRLA 3FJTA 3DIVA 5DRXA 4U1JB 1YNKL 4XBGB 2XICA 5FB8A 5KSUB 1NIBA 1UXMA 2AMGA 4YL9A 3FFCE 1QG3A 2OMWB 3VG9C 4NKOA 2UWJE 2CXKA 5BV7L 4WFGD 3ZL2A 3UZVA 2R2HA 1SFCA 2CRIA 4IFDK 4X8CA 5BRQA 4AEEA 4EI5C 4LF3A 2OW7A 2JKJA 2MCAA 4Z7QE 3BXNB 2VC2H 1EZLA 4GAYB 2RMNA 4AIXA 5L9DL 2HT3C 3RE0A 1JPEA 3BO8B 3PNWA 2H7HA 1SVBA 1MCLA 5I71C 5F9AC 2H89C 1DQLL 1HKLL 1KFMA 1U33A 3OKNA 4YHOL 1LQSR 4NQDB 4QRBA 2XTJB 2ZNWA 3ZDXF 4L1SA 3V4WA 3BE1H 1WBXB 3DVFA 4S1SH 2XV5A 4KO9A 5DXWA 3TVMD 1V27A 4MJJA 4RFNC 2W5PA 2A6DB 3N1FC 4QRRE 2IOMA 2HPOA 2QVIA 2JSFA 3HB3D 3DTXA 2VDNH 3IPBA 4M6NH 3V5KA 3DOSA 3ESPA 3SSUA 2V7NA 3EO1A 4EZLA 1OOWA 2Y25A 3AS0A 1RQVA 1QEXA 1YEGH 4UTBH 1ONQB 5I71B 2NSQA 2X2IA 5EO1B 1WT6A 4PRHD 5APTA 1CD1B 4XTRC 1G6RB 1FFQA 3H1JE 4P2QB 2GC7C 2M5AA 1FL3B 1ZJBA 2NTFA 4IDJL 5CJOH 3M1CA 2W9LA 1IAKB 2PTTA 2VDPB 5IG7B 1MFVA 4OZHB 4F57L 4TLKA 4ZFGH 2IWGA 1LL1A 3CD4A 1IAIL 4V1DE 4Y0GA 3OMNB 5HYFA 1Z5LB 2CK3H 4PB0H 1CR9H 2XUWA 3ECBA 1KB9J 2P80D 3EF7A 25C8H 3KYAA 2EVIA 3RGUA 1QRND 3WKPA 4K9EL 2ZWYA 5FYLE 3FU9A 1KCSL 1LK2A 4J3BA 3RL0C 4GBXB 2WC7A 1V05A 4PJGB 4NQCD 1GZHC 1SMDA 4QNPE 1C12B 2SEBB 1NWQA 1D9KB 1NBYB 5C07D 4H13C 1IQWH 2YD8A 3H2WA 4P5SA 2E6PA 2WSEH 1AC0A 3MV7D 5IESH 4AUYA 4LC1A 3CH8A 2HJKB 4Z7NF 2XZQH 5J3HD 3PWUB 3EXJA 3CSFA 2FR4A 4OUOA 4ELMF 1RZ7L 1BD2B 4G7SB 5FKPA 2VMDA 2VLJB 3PP3K 1F4HA 1DL7H 1J05A 1D5XA 2HT2D 3V5DA 2HODA 4RGOH 1RP9A 5IEKB 3RIAK 2DQMA 4BWWA 3WO4B 4FQXB 3CCHB 5LKNA 2FD6L 1YRKA 4KKAD 3JT2A 4HZLA 1AD0A 1I8KB 2R0KH 2B2XH 3BQUA 3E9TA 4Z0XA 4KZEH 3MRBA 4NO0A 3MUDC 1I1YA 3QCVL 4P49A 4DKFH 4BH7A 2PO6D 2FT6A 1BJ1H 1FCGA 1HU8A 1H8NA 4XOBA 4P57B 4BUQA 2P7TB 1Y1DA 4J6IA 2XWJB 5JW3H 4MJID 3GLMA 1FQ9C 3ISYA 5BRPA 4TXVB 4ZODA 5AL8A 4MJ2A 3ZHDA 3ARWA 1A9VA 1SMOA 1FRGL 3KWWB 1L0ND 3S5ZA 4D9QD 3MRQA 2QVAA 2C5DC 1KACB 4XH2B 4XVSH 3WFDH 3ZL4H 3DGGA 3NDZE 5F6IB 5I75C 2EE2A 3MLZL 1ACYH 5K9QG 2VAJA 2E7DA 3AREA 2W90A 5DJ6B 5GJTL 3CDZA 4PCYA 4PJEA 2YKKA 2QM7A 3E0GA 4Y8AA 4P2OA 2FZ3B 2HH0L 2VSCA 2F61A 3HCVB 2A99A 1AFVL 2D73A 2HTKC 1ZS8A 2M3EA 4WNQA 4A67A 5E5LA 5EUOA 4ISVA 1NIEA 3QO1B 3C08L 3M9BA 3OHXB 1VADA 3ARFD 2X0VA 4U2YA 1SLQA 3KW7A 4GQRA 2EACA 2ZD0A 3KPOB 4H8PA 1N7LA 3V4PL 2HFFB 1PD6A 4PI0A 5AAWC 4OFYD 2M26A 3EHBB 2I8DA 1CICC 3QIWC 4IIQC 2YD2A 4ZFFB 3MBXH 1EK3A 3BOVA 3ZKMD 4MNGA 4GXVH 4HKBB 5CN3A 4FZ8L 3WEAA 3WNKA 1CURA 1IL1B 1IGYB 4PRBA 3VXSB 3QEQD 4GSRA 4X5WB 5EEWA 3CHRA 3NJJA 4UIKH 1NU1E 3HS8A 4GSXA 3NCWA 3QJHB 4GT1A 2YPLE 1MPAH 2CKBH 3WIHL 1JAEA 5D93C 1FE8H 1SQPK 3QUXB 5CMAB 3RL2A 3X14B 1O6SA 1J0ZA 3MRNA 4Q4EA 5ITFB 4G8GA 4UIMB 1O7DE 1F42A 4L74A 3OAUH 2FQEA 2NZ1A 4BRJA 4R0LA 4U3SA 2HKHH 2XTLA 5FR3A 2FB4H 3T4AB 5JHDA 3MBXL 1GYWA 4TM9A 3RVTC 1OWRM 4QHNB 4I48A 3NPZB 4K7FB 2ZUYA 5D93B 4WLCA 3MACL 4APXB 3CCVP 4JNXA 3JT0A 1A7RH 1QMUA 3KYNA 3BCFA 3QWOA 5EOTB 4Y4FC 3WN5B 5DC2A 1EWHA 3D39E 3LQZB 3AG3B 2APWA 1BBJB 2WBKA 4PJ7E 2ZSWB 3LDBC 4X98B 4EBQH 3RVVD 3SGDH 3LV3B 3BP5B 3HC4L 5A40E 5ITBH 3QDMA 3MBWB 1KCUH 3GMOB 2F8XC 1TU3F 5EDXA 4EZJA 1ZS2A 1FAKT 2PXYD 1HXKA 3ABVC 4KJWD 3FGAD 4I3RL 4JFZL 1LDPL 5DQJB 5T1LD 1RUPH 2NNAA 3HE6B 4BDVA 4EN3C 1AO7A 4IOIA 3O45B 4NQDE 5CCKL 3JYCA 4UV7L 3VUAA 2XBZA 2B20A 4H25A 2IAND 4HPYL 2APFA 4YDVB 3IKCA 3QS3A 3DTUB 2H2PC 2V3FA 1NCCH 2RGSA 1DIPA 2ZZUT 3GFUA 1USEA 4KJYB 4FXKA 5F3BB 4YSDA 1KBVA 3NIDF 4QRPD 5CMZA 1X0TA 1VQMP 4KH2A 3BAEL 4MAUH 5MP6L 4LXFA 5CUSH 4RGNB 3KEHA 5I1GH 3JZYA 1JDCA 3SYQA 5B3SB 4RNRA 1SP4A 3H1KE 1A7PH 2UXTA 3P0YH 3LKRA 1QO3B 4XXWC 4Y19E 1WF5A 3FT1A 5H35B 5ALCL 4ZFOB 1YVLA 3X11A 1R9FA 3TVMC 2AJYH 2ZSWA 3FCSA 4LKXB 1ZANL 5C8JA 1BBJA 2PWFA 4U31A 1NH6A 3WKYA 5D1ZB 4R4BA 1MFBL 1DVFD 4KXBA 2X4PB 3A24A 2WQUA 3DUUB 3HNTL 2NYZA 3QUZC 4YQXL 2K1MA 3JV6B 12E8H 2Y4SA 3MI6A 4W9KC 2NMSA 4L3EA 1JPSH 1T6VN 4FGMA 5HSFA 3N44B 1VCAA 5E9AA 4N5EC 1KTRL 3TVMB 1IM9B 1HESA 4HWNA 4BFBD 3S4RA 2Y06L 3UO8B 3DROB 4LCCB 5BO0D 4X6DA 5I1AB 2MPAH 2NPSA 4H25B 2HJLA 3NJHA 1U92B 1WWBX 4GLRI 4WUUA 2HMID 3FNKA 3E1ZA 3QUZB 5T1KD 3RX9A 3O6LL 4OGZA 1VACA 1E2ZA 3IMSA 5DHVB 2A1WH 2BWDA 2PYFB 5K5GB 5FGRA 4YDZA 3VI4E 1F11B 5DRNB 2H1XA 5LGYA 4UINH 4L9LA 1EEZB 1MSPA 5DFVD 5AAWA 2WCPA 1XF3B 2WZ5A 1DUYB 5H2BB 4JFYB 2I5YL 4JY5H 4PREB 4BWTA 3CI9A 1YPZB 1PU0A 4R7VA 4XP6L 3DV6B 4JAMB 2XN9A 1RUAH 3S9OA 1UQSA 3SQBB 5IREA 3F12B 4MNHA 2VB5A 5SWQB 2ADFH 3OAZH 2DQHH 4IRSA 3Q44A 5CINL 5DC0A 4FA6A 5AB0A 3BKMH 1NC2B 3C5SB 3UBXI 4EKJA 1W6LA 1WIPA 5CZKA 4KK8D 4R83A 1PY4A 1LYQA 4ENZA 4WFFE 2I60H 1COBA 5GGSY 1NJIQ 3P9LB 2O01N 3MRRB 1JXFA 3FQ1A 2H1PH 4TMPA 5F7BA 3T2OA 3G6AA 5SWZA 3SPJA 1KB9K 3LB6C 3ULAB 1WQVT 2XJKA 2O3JA 1H3TA 3BPOC 3IJHB 2DIJA 3WS3A 5G4MA 1USDA 3H2QA 2PLTA 4MXWL 3ARBD 2ZWNA 3VXOA 5KAIE 4YXKL 3A47A 3VXRA 3U0PA 4XP9L 1X79B 2LOEA 4NPDA 3P4NB 2YQ2A 3WTWA 3TA4D 1TEGA 3FAWA 3F7LA 3UXFA 3LZRA 4KU1A 3KQGA 1TTCA 3G9VA 3OGOE 3WDJA 1UA3A 1ORQA 4ZPTB 2OMYB 4NNPL 3HMWL 5TE7H 2Y9YA 2FYYB 1IJ9A 1IZNB 3D7PA 1CPUA 2BSRA 3FPXA 5F7NC 2FX9H 3QJFB 2CRMA 3IDIB 3TBWB 2OCCB 3WG7B 1KFAH 4P2QD 4Z5RA 1HS6A 1XEDA 2E7MA 4R7XA 5C1MB 3INOA 1CK0H 4FLQA 4DPRA 4QI3A 1T7ZA 4TQEH 4ISVB 3AS1A 4JO4L 2FYUJ 1SNRA 4UM8B 2DM3A 5E2WH 5EBWB 4HQQH 3T09A 5EBLA 4R4NC 4OGQB 4Y28J 2DTML 4TV3A 3EOAB 2JJTA 5GRWA 2UVFA 3EFFA 5HY9B 1TEFA 3BRDA 3RI5F 2V2XB 2R29L 3BDXA 2CO2A 3I9AA 4WNSA 3U1PA 1AMYA 4F7MA 1N70A 1G4MA 1KCBA 4AYGA 4DK5A 3LD8B 2EEXA 2RH0A 3UROR 3ZE2E 4HUXB 1PP9G 5I5IA 4G82A 4DGVH 1XMEB 1JN6A 1Z3GL 3OHMB 3MV7B 4NT6A 2DI8A 2KL6A 3CSTA 3N1PC 5GS2D 3S6CA 3T6ZA 2DIBA 4CBZA 5IBUB 3HI5H 5HYQA 3HUSB 1WDAA 1W2EA 2BJMH 2WN3A 3L3IB 2VC2B 3C6LD 3HR5B 5CLWA 3F6LA 2QVMA 4GI9A 3CK0L 3EF4A 3UFIA 1GXEA 1JXGA 3KWXA 1WC7B 3IKKA 2FHBA 3Q1SL 3O4OB 3LH2L 4DTGL 5DVMA 3ARFC 1Q9KB 3GM0A 4OZHA 3G6JF 5GGTA 3VA2C 3VD9A 3US1A 5GRVL 3VFSB 4KKLC 4UNIA 1ED3A 2A9NH 2M83A 2C7FA 1CQYA 4ALAL 2OJZH 4KOBA 4AYID 5HYSA 4H0LD 5AYQA 1PZBA 4AVJA 2L7EA 4XVOA 2PETA 1S9VB 3V6OC 5KSVA 1U8LB 1HH6A 4FMVA 4L1TA 4F8OA 2OR9L 3A6CL 5JXAL 3GNML 4POZD 4JB9L 2YARA 1L4AB 1P84H 1AGFB 2CM6A 4YE4L 3V9EA 1EZVX 3WHE1 4FCHA 4H7VA 5C7XL 5I19H 3JYBA 4GO9A 4PG2A 5C08D 1P7KB 1VF5C 4AEFA 5BS0A 5L2JB 3A67H 4KTDH 1AGBB 4WKZB 3N43B 3F01A 3EZ8A 5GGTH 2IX7C 2LKMA 3D51A 2BCMA 1QR1B 4U33A 2I9LA 4UILH 4TUKL 1M1JA 4RGMB 1JHKH 4LSTL 5ACMA 1NDTA 3MP7B 5IMMA 3U6XA 2YSSA 1IKFL 4IKJA 4ZW8A 4PCKA 3UZVB 1W72H 1GJUA 5KYUB 3BUDA 4GXFA 3DIDA 4FKHA 4HX1A 2P5WD 2H5UA 3TN0D 3OJ2C 4HJTA 3ZX1A 4QKTA 4YX2H 1VF5B 2AXTE 2AXHA 4BWUA 3H9HA 1TJIH 1Q9LA 3DRQA 4X0NA 5F97E 1CTMA 2ADJB 2Q8BH 2CPCA 3HRNA 3OAWA 4LEOA 1SEBB 1KGCD 3RWHA 3OKEA 3QPXL 3KL3A 4JHAL 2OSLA 2VZ1A 2F5BL 4N22A 2XI9A 3H0TA 3JTTA 2CMRL 1WAAA 2IWKA 2V7QJ 3SO3B 4CBPA 2MWCA 1BSNA 3L4CA 1DQTA 3WO3B 1X4XA 4YXHH 4WI7A 2BCCE 2WSKA 1P69B 3FU8A 2A6DA 2DQUH 3O41B 4OLZL 1DJGA 4JR9L 5BZDA 4P3DB 3F7QA 3RX7A 3GSOA 2ZX9A 2KOGA 3FFCB 3GT6A 5HHPB 3KNBA 1GVIA 3G5WA 2GJRA 1CFSB 3CC1A 2YMYA 1INDL 1UENA 2YAMA 4KPHH 5LGJA 2Y7QB 2ZTBA 1I85C 5LGKA 3B5HA 5HGHA 3PCYA 2J8UE 3M17A 3MV7E 1ES0B 3G9AB 4YHNA 3V0EA 3QUYC 3JXAA 5KSBB 5MEND 2FDBP 2VISA 1NOLA 3D0VA 4P59L 2QADC 2BIHA 1CU4L 3D4YA 4NWTH 5T1KA 4PRDA 5JNYA 5M95B 3LQAH 3M17B 2JXMB 3EDEA 1JF1A 2N0KA 4YBQC 3MX0B 4AQ1A 3QFJD 3O9WD 1WVZA 4OIBA 1EBAA 4MYWB 1KMIZ 3DPBB 5FEBA 3ZK0A 5BUAA 2D3JA 4JUSA 2ZCZA 4BIKA 1NBQA 1F86A 3VMNA 2IH1A 2JCCA 5DHMC 1BCCJ 3T6VA 1W6WA 4XWOD 1CLYH 5IGXL 1FGNL 2DQ6A 1ZTXE 3DVNA 3QJVB 1GZLA 4KMLB 2FWOB 2CK0H 2YEVB 3QH3B 3GBML 3OD3A 5GZOA 1ZWIA 4CMMA 2DKUA 1QOKA 4KROD 2VWEE 1GW0A 1KB5H 3PUUA 3PABB 1CFTA 2E27H 1NL0H 2NLJB 1AKJD 1IGCL 4PJ5B 3VWKA 1GZHA 1JZFA 4F8TA 4U6VH 3KMDA 2CLVA 1XGTA 3SDXB 4UM9B 5IJKC 5HVFB 1OIPA 3CVIH 1XHHA 4OLUH 4L3EE 4XMUA 5CBAA 2BZDA 4PRAA 4RMQA 3V52L 3WJMA 2NQ3A 4CL7A 1QBLL 5AENA 4L29A 4HLEA 2R2BB 4I0PD 2D2CD 2E4FA 3EUDA 3HD7A 2JF1A 3QUHA 1S78D 2G75A 1AYRA 4PP1C 1M6OA 1VEOA 4PB9H 4WKZA 3PQYB 2O1KA 1JZ8A 5I5MA 1UUNA 4GEJA 3RBSA 4B9KC 5M7QA 3CBJB 4IHOA 1JNLL 1NDMB 4L29B 4LSQH 2AV1B 1FZOB 2WO4A 3H55A 5I6XB 1BZ8A 2Q20A 4M3LA 4M6NL 3F85A 4YEEA 2P5WA 4MWFA 3MLUH 1JY3N 4W9EC 1XGRB 4PJ8B 3DSNB 2ZG2A 3WU2H 3JWNH 3APDA 1OCWL 2W0FB 5D7KE 3E7KA 1UD4A 4XMZA 1ZJAA 2EDYA 3BVUA 4QAMB 3S3DB 4CU7A 3V2AR 2NLJA 3OXRB 4J8QA 1RURH 5TQ0L 1WBYA 3EJZD 4LHUD 3KLHC 1KQSO 4WNJA 4NO2B 1UFUA 2B5IB 3B83A 3CCEP 3AC0A 4XPBL 2A74B 3N2JA 5BRZB 3R0MA 1T5KA 1CLVA 1J1EC 1ZMEC 1G9NH 3VMAA 4QWWD 3OKDB 4U1HB 1HDMA 3DX8A 5DEFB 2NY6D 4B9FA 1Y07A 2YBRB 3UIZA 5DDHA 2HUEA 3QCTL 4JFHD 2HFEA 5ICZB 1I3RB 4TQHA 4FZEL 1N10A 3G5YB 4YWGL 1BCIA 1MCHA 3HPJA 5C92A 4NT6B 2I27N 5HGAA 3Q2NA 3EIFA 1PG7W 2YXQB 3FRPG 1TQWA 1JWSA 1A64A 3QZBA 3K2UH 5AW3B 5JZ7C 1LNUA 1RAMA 2F0CA 1IAMA 3JSVC 3RJQB 3VH8G 3TBSA 4WI5A 1LTBC 4TTDC 4ZMDA 4OD3H 1BM3L 2PO6B 3PDGA 4IBYA 1FUNA 3D2UA 4JDZB 4UB6E 4ZZFA 1E28B 4OZHF 1L0LK 2QQKL 3CAFA 4FQ1H 1N3NA 3FSOA 5IMKA 3ULVD 1AQHA 3PDOB 4XP5L 1SYSB 4HUWB 5JUEH 1USZA 1WTLA 4KHXH 2OAAA 2ZFCA 3TV3L 2OXHB 3V0AC 2V9UA 3KXFE 4WIQA 3VXTA 2R9HC 2KLVA 1X8YA 4YFEA 3PGDA 2GUOA 2Q0ZX 2QJPC 2CIKB 2JELL 3BESR 2VXQA 5C6TH 4AYFB 4JK0D 3GD1C 1QSFA 2KNCA 2LV4A 2Q9OA 1AO7D 1U91B 3FQXA 4ECNA 1GJIA 2PCPB 1EXHA 4GUPA 4PJXE 4J23A 4O2CB 1P84E 5D1ZI 3RX5A 2VOTA 4RRPA 2WHVA 4HEME 4WW1A 3CJJA 4P46C 4JO8A 2VMFA 5C0BB 3SDDC 1I3VA 2VDLH 1PP9E 4XOAA 3WS3B 2XQYG 5JLZA 2FIKB 5I6KA 3T0XA 1NCHA 4GOEA 2NUPA 1UZ6E 4H13D 2AK1H 2EVGA 4G7VL 5C0BE 3FSZA 4PCSA 2Q5UA 3HG1A 4W80A 1MJJB 4KJPC 2ZP8A 5EOQL 1SQBE 4RZKA 3L5WA 2CU9A 2I9LB 4CVZA 4DCQA 1V3MA 1V3KA 1R8EA 1MEXH 3LKQB 4M6AA 3NIDB 3EFOA 3IU3A 5TDNB 1XL6A 1HYSD 1E5WA 4OV6F 4Q8BA 2L7QA 2WANA 5E70A 1N2RB 3MLYH 1JTPA 1D5ZA 4RVBA 1EXUB 4UDTA 4F8QA 4UOZA 2X1QA 1JZ2A 3HAEH 1EO7A 3A4AA 4YN3A 1AJYA 1BFVL 1DVZA 2XV0A 3ARDC 4BELD 3UEZA 4JJHA 1RPKA 3UTSD 2UUDH 3BHBB 3L9YA 2QLVB 3ZTJG 1KXHA 2J71A 1CBJA 2XBTA 3O6MH 5GGQL 5F9DC 2BASA 4AW4A 2ZJSL 5F93C 4OZIA 4DUXA 5F1NB 2LFEA 2NW2B 4UT9H 5JYMA 3JV4B 3O8XA 4P5KA 4P23C 4NFBA 1I1AC 3W9DB 3VRJA 4CC4A 3UBXB 3NJLA 1XIWD 4MA1B 4WGVB 2QGBA 4WAFA 3GSQB 4D0BB 3UYPB 5APYA 1UYWL 5E79H 1KZQA 5I1AA 4UDUA 4LSRH 2CDGA 3HR5A 3L72E 9CGTA 3AM8C 5FM4A 2OYKA 1K05A 4GT0A 5GZND 5A2CA 5HYQB 3S98A 4IJTA 2WLIA 2COQA 1E6JH 2FLRT 4J3TA 5GGRA 3HI6L 4Y5YA 3H1LG 4Y2DC 4E9XA 3PWLA 1A7NL 1SQPG 3L73D 2P5EA 1TO4A 1I1AA 5JPMB 2D7QA 5IW6B 3L75G 4P2OD 4D9RD 3ULUD 1OVRA 4D8OA 2HAZA 3RWJB 1YMHB 1KNOB 3C5XA 4BINA 5B3NA 2CE6A 4IRZA 4NERA 2Y0DA 2VDML 4HUMB 3WTTA 1SOXA 2AXGB 4U1MA 1U8NA 3O4LB 4QMEA 4RFOL 4HSCX 1U8IA 2G3NA 4CKQA 4EIUA 5KLVG 4I5BA 4DQOL 5LGHH 5BMFL 4RGND 5CHXA 1HFUA 4G83A 2WBJC 4Y16C 3BSZL 3FTWA 2F74A 1KN2L 1MCBA 1RUPL 3CXHH 5J12B 3BLKA 3KPPA 2FXMA 4GPVA 2I9TB 2ZKYA 5HDBB 2K88A 3HE5B 4X42A 4XNUH 3WJJC 3CZSA 1YSOA 1WZLA 2B1OA 2JMRA 2NY2B 4NGHH 2QSTA 2OMVB 4WEBH 4AQAA 1SF3A 1DVSA 1S4XA 2EH7H 1OP4A 3AWFA 4HHAA 4FL4B 2J43A 4JPIA 3AE4C 4J3UA 3ELAT 4PGDA 4X9FA 5LBVA 3MZTA 5L88L 2CZNA 1QSVA 3BI9X 1TJMA 3WN6A 3WTUA 4WO4B 3KLLA 3MKKA 4LCUB 2GSIA 3QUKB 2H3XC 4GS7B 1E40A 4PJBF 3LV3A 5E2JA 2W38A 1J18A 1HSBB 3QIBC 3H9SA 4UU9A 1AR1D 3DETC 2FLBT 5AVUB 3C60A 5K9QI 1JP5A 5PAZA 3L4YA 2P8PA 3Q2LA 2AW2A 4ELKA 1DLHA 4IL6E 4LLUA 4ZTPL 2ORBL 2ZUQB 2GBTA 3GRWH 3SCMB 1CUOA 3KYKL 3C2AH 1JHTB 5J11C 3H32B 1HCYA 4M6OH 2O6PA 2GCYA 1OF0A 1NCWH 2OYIC 1F4WH 1BYNA 3TYYA 2VDRB 4LIQH 1Y6KR 2J21A 2YO3A 1AI1L 1XGQA 1YPZA 3MRNB 3ZDMA 4IS6A 2C4XA 2YPLB 1HL5A 4JFYA 3VGAC 2SODB 3UJJH 4IRJD 3APCA 1KFGA 1D9KD 4OJYA 5J11B 1ZGLA 1H5BC 3QVAA 2FYNC 1MFTA 3O3DA 5D7IF 1D7FA 3SYOA 4D6TD 1JWMA 3O6FC 4QTHA 2V3EA 3TPUB 1T5XA 1XR9B 3JZ7A 5F9JA 43C9B 3WY1A 1HHHA 2NQCA 1SQBJ 4DPAX 4CU6A 3VXUA 2QSCH 5KSBA 2R0LH 4X6DB 4ZFFA 4S1RL 4AGNA 3RZCA 4MA3A 4HBCL 4RMTA 4AZ8B 4LSVL 1QPXA 2APSA 1AFOA 5DHDA 1LJMA 1RF1B 2DQCH 2IANA 1YY9D 1SGKA 2RN0A 3GSXB 43CAA 5DI8A 2DQHL 5CINH 1H5BB 1UM4H 2YC1B 3QPQC 2WKOA 4L2LA 1ZTXH 1KN4L 3NP3A 1BQHG 1XCTB 3O6FB 4IW4C 1AGEB 1KB3A 3QG6B 1J86A 3VFPB 1MFCH 2BIPA 2GTZA 3OPUA 4G7YH 1NGMB 4ZOBA 4PJ6A 3KXFB 1FFNA 5C08A 3WSQH 4DOJA 1G5AA 2VQTA 2AZAA 2FJHA 1DVFA 4GMSH 1J8KA 5EFWB 1AZCA 5APVA 1ZVYA 1GK6A 3CXDH 5EF1A 5DZLA 2LU3A 4N2CA 1VFBA 5T5FH 4ERSL 5GTHE 1QYGH 1KCRL 5EZJA 3IDMA 5GJSH 1JUFB 5F9OH 5H35A 4JLRB 4OGYH 2C0WA 4FQLH 1A1NB 4AEHH 4Z7QB 3MJ8B 3QORA 1PG7X 5EUKA 3BGAA 1Q72L 4FJ6A 1ZA3B 2VKWA 3V4PA 3GUTB 3KPRB 4I13B 4N3UA 3BFWA 4W7YA 3NFSL 5AAMA 2WWOA 4YHPA 3DLQR 1JCDA 5D9SA 4HOXA 4YHIA 3ARZA 1FO0H 3MROB 4HCIA 5GS1A 5AVVB 1AJ7H 3KE0A 1IC5L 1YEDB 2O61A 1MH5B 2CR3A 2VXSH 2XKNB 3TYFB 1FZCB 1GKOA 1HOCB 5DJXB 3FTUA 5E6ID 1HGZA 1FH5H 2Z64C 4FFZA 3RZCD 3EXLA 2HX7A 4Z8FL 1IGIL 3IFLL 2EEBA 3AACA 3IFOB 3RVWD 2KZJA 3PPEA 2YEQA 4M8VA 4XCFH 5JZ7D 3PRJA 1J5IA 4LDOB 4JO4H 3HBQA 1FJ1A 3CSYA 1PP9D 4UMSA 4Y4FA 1FC2C 2E5YA 1K8IB 3EHBD 4JJ5B 4PQXA 1M9SA 4G8IB 3VRIB 1URQB 4GIPD 4LE8A 1ILSA 1QLEL 4PVBA 3MR9B 1HZHH 4Z3JA 1YMHA 4JO2H 1GPOH 1HH6B 1BLNA 5HYIA 5AAMC 1SRDA 3TLRA 1JTOA 1BMZA 3QQXA 2BZCA 4CC4C 4UAOC 1IAIH 3L74E 1OD7A 3CVBA 5KZCB 4OJEH 1BXAA 1L3NA 3HC0A 5K93A 3NIGB 3P30L 1DYZA 4A2HA 4OLXH 5F8QC 2ZSVA 3WUTA 2HKFL 3MHVA 2KS0A 2CLRB 4AIZB 1OB1B 2ZCHH 4A55A 1Q2NA 1JGUL 3CFDA 2YD1A 3BE1L 2CUMA 3S36X 3UTSE 3GBDA 4BFJA 4MCZB 3UYPA 1MY5A 3D3VA 4ODXB 3RZWA 3HTKB 3ARXA 4B9PA 4Z7VA 1F45A 5HDQH 3B3IB 3CC5A 1EEYB 5C0EB 5F6IC 3T97A 5I75B 3PFQA 3ZRFC 5FOJA 1WEJL 3UBGA 3C9IA 4WY4C 1X9QA 1NC4B 3N3EA 3OG6B 3PAVA 5GRVK 3U36B 3WUVA 5GIRA 1OIOA 3F8UB 4AVKA 3HNSL 5KS9E 3KL5A 4ZUUB 4AGOA 3Q6GL 2CCLA 5I6OA 5KBMA 3MR9A 2V2XA 4JCLA 3D71A 1FOSE 5C3IA 4JRLA 2XG4B 3GMLB 4DP1X 1K5NA 2AJUH 2DB8A 3CLWA 2BNQB 5I1LB 3SFDC 2XJLA 3BP6B 3HN8A 3ZE0E 1BZ7B 3MRHB 2NY4B 2N1TA 3E2HC 3NFQA 4YSUA 4Z76A 2N1TB 3SBRA 2XQBL 4XAKD 1R3LA 4XCNB 1LK3H 1MCOH 5ID1B 3OV6A 2XPYA 5I1JH 3NZUA 3KJ6L 5I23A 4PD4E 4QXGH 4J1UA 1YJDC 4KAQL 2I5YH 2W8ZA 4NUMA 4QJ3B 3KLSA 1JTTA 2WZPD 4YTPC 1Q0EA 4FFZH 5E4AA 4KDVA 2BH0A 2BY2A 2G5UA 4B53A 2XWRA 3ECUA 2IOOA 5E00A 1R17A 4JQIH 5EBMB 1I1AD 2V5MA 3MV11 4QJ4B 2QV2A 1IFJA 5GGSA 1L9RA 5FO9B 3C1LA 4FG0A 3QYMA 3B6SB 3B3IA 3CC5B 4GUPB 1SVFA 5C0EA 4P9HH 4UTAL 3PWVA 2OYHC 1I31A 2R0ZL 3AREC 4GG6B 4NN5B 2ZX6A 4Z0XB 4R8WH 4UQEA 5IK3B 4WWKD 2DICA 3I6GA 4OD1L 1MAKA 4IRJC 4XHQA 2L8AA 3KXDA 1SXBA 4JFXA 3K8KA 4WEUD 5MERB 3VFPA 1KXQE 4Z76B 4MASA 5DQ9B 3U0WL 3L3DA 2OYHB 2EYTA 1JZEA 2ETWA 1N3NB 5IMKB 4PWKA 5L2KD 3ILQC 1UWXH 1ZSDB 3GXMA 5DEGB 1TVHB 4KY1H 5HHOE 1M8OB 1FZMB 3GMLA 1CICA 3O6QA 2LAGB 3P32A 2GUVA 2UX7A 4MCNA 5DEZA 1PQZA 3U1SL 4LGDE 1FRGH 1FAIL 1KILB 4Y2DA 5CJQH 3RVVC 3X1EA 5I1KL 2HVBA 3CPWO 5KVGE 2XN2A 1GL2C 1L6ZA 2A9AA 2DPKA 5DD1L 4H8VA 4B7LA 1TF4A 3MCLL 1NU1J 3MLZH 2E6QA 5CZXD 4KVCH 3RB7A 3V2QA 1GIGH 5K9OB 4KZDH 4X0KB 3CFBB 4OH2A 3B2XA 3LXCA 3M06A 2QQNL 2FBJH 1F11A 5DRNA 4HIXH 3TK1A 5KSUA 4Z23A 3KBFA 3G5YA 3HG5A 1WRGA 2ZOWA 1OANA 3BVHA 2VZ3A 5DLMH 5AYTA 3UCRA 1NPJA 4XX5A 1FG2B 1SEQL 3CC2P 1LP1A 1G7HB 3FXIC 5D2LA 4PSRA 1T2KD 1BFVH 3L5HA 1NAKL 1FZCA 3KPNA 4MCZA 3VYOA 2CKBB 3B7UX 4APQB 2AXTH 4QKXB 3ZN6A 2GW5A 1E3XA 3T71A 4AKPA 5A1AA 3LCYA 1KBKA 3JWOH 1E6OL 3MROA 3AQYA 4YVUA 5HDWA 3ASNB 5TFSH 3STBA 2MHAB 4JKKA 4YC2B 3VJ6B 1YEJH 3AXHA 2ZX7A 3BEWB 1OPGL 3BH8A 2E43A 3TX4A 5CR8A 3FHAA 3NMEA 4X5XA 4MXQD 3OXRA 5D1ZC 5FW6A 3D05A 3CFQA 3WLWC 1G7PA 1YYMH 2EKSA 3RWFA 1L0LG 1OW7A 1XBDA 4N0UE 1OARH 1CXLA 2E74B 1XGRA 3RGBA 2OFQA 3MNWB 4WGKA 2HJFA 1UXWA 4JBSA 1DUZA 3EGDB 4NWUH 4IOSA 1ACCA 2RQEA 5DVNA 3BH4A 3QAQA 5I76B 5D4QA 2XZAL 3KDMA 4UZSA 1K6QH 2BSTA 3D25A 4XNMA 1TTUA 5BW7A 2WPVB 4DCKA 5KOVC 5T3XE 4G8GE 5AW4B 3U7YL 5C0DA 3VI4B 4WI3A 5MENA 1SLXA 2IO5A 2FWLB 2E74C 2RACA 4N0YL 3RNQB 1ZR4A 3Q5SA 4OIIH 3BMVA 1KXQA 1PG7H 3HKFA 3NOIA 4PRNB 5EO9A 4WCYL 3HE5A 3P4MB 1NGPL 5PCYA 2O61B 4N6QA 4JG0H 4P06A 4MD0A 4A68A 2A6KA 4MNGE 2ED9A 5K69A 3VWKB 2C1OA 1BGYG 2XWCA 4YNYA 4HKXA 3QFJA 5DUPH 1NFDF 5C09E 1JY3P 3MHZA 5L4IA 3BN9D 3FH5A 1D6EB 3F7YA 2B2XL 3ES6B 2DKMA 3ZY7A 5FUZH 5C0GB 3BSHA 4JF7A 4R96A 3GHGB 4FJZA 5EUOE 2IH3B 5A16B 1R75A 3E3QC 3KGSA 1RZQA 3RBGA 5JA8B 3H32A 3VWJC 5J56B 3QG6A 3ZMNA 4ZRGA 1Y6MR 3UJIL 5L88H 2OQQA 3WY3A 4QYAA 3ZQWA 4I48B 4CA4A 3ARDD 1A9EB 2CO6B 1IVLA 1MHPL 2NY0D 2Y5QA 1J0JA 3CFIC 1YNLH 3N1GC 2OGUA 4WDIA 1MNUH 4H1LG 1WFMA 5ADPH 5J57B 3D4CA 4WTZA 3NSCA 5JHDB 2C9RA 1DBMH 4R0LB 4U3SB 3TOPA 3WE1A 1Z7JA 4NQTA 4BUGA 3E38A 3KW8A 4DJMA 1UJ3A 3VD0A 3UOAB 1T03H 2ZYAA 2R2CA 3CXHK 4XC3H 2DQDH 4PIBA 3QE5A 5KG9B 2I1KA 3QR1A 1BQLL 3IXAA 2OL3H 2VLRB 2AJYL 2HG5B 5EU3B 2YGNA 3MLTA 3RGVD 2VLRD 4LEXL 2QQKH 5B4MD 4LLQA 3ZTDC 5HD8C 2MKWA 3KNBB 2YMTA 3ZJAA 4OCWH 4WVRA 3BGFC 1KV7A 4U1NA 1NGWA 3DURA 2EDKA 3V5HA 3VH8B 3JV5A 1GKEA 4L3CA 1OM9A 2BFVL 3WAKA 4N6RA 5C0FB 2AK4E 3BN9C 1N67A 2AXJA 1AKPA 2IBZG 3SO5A 5J4MA 4IU3B 4KOCA 3Q8FA 2C9NY 1PKQB 2RTTA 4OLVH 5DJYA 2A3TA 3PUCA 2WXOA 4PGBB 3W57A 4XN7A 2DQTL 3A0HE 1CFBA 2JJUA 3SCMA 2EDJA 2XKMA 2J1ZA 4K7PX 2EVHA 1NKOA 1L0NG 3KR3H 1EHNA 3BGFB 1ZD6A 3WE6A 3KCPB 1IBHA 3NJGA 1UWGH 4NKQB 1FDLH 3C6LB 3H85A 5IHBA 5FIEA 3D69A 4HDIA 2FAUA 2JH2A 1KBWA 2EH8H 1R24B 2E6JA 2OI9B 2H8PB 1KCLA 3VB9A 4TNEA 3VD5A 2ATPA 4ZPVA 4W1TA 5F88A 1U8OB 4C7RA 2W88A 5J1TC 1OQXA 1U58B 4OR1A 3HTLX 3N42B 3DDGA 4JM2B 2WLZA 5C0BA 5L9DH 3GHPA 1XIWB 1PV3A 2KDYA 2MQGA 5GGRB 4EUPH 4OQTA 2VO5A 2HFED 5C0AD 4WUKL 4QJ5B 3MLPA 1UD3A 3S88H 1P53A 1SY6A 1A6AB 3SYCA 2FX7L 2WVUA 1P7KA 4HF5L 5L2JA 1GJWA 3RBXA 2A73A 1HVXA 1KYFA 3BCCG 1R5IA 3CVHA 4JFFB 3U79A 1A4CA 2GKIA 3MNDA 1AGFA 1XB6A 1PD1A 4D0BA 1QASA 1SBSH 3BQUB 2HRPL 5C09A 5I30H 5JHLA 3TH2T 5JIPA 1IK9A 1MAMH 1RJZA 3ML9A 1MREH 5EU4A 3W9DA 3AU1B 3L5IA 2KC0A 4BKLA 1CGSH 2R69A 1I8IA 5GISH 3QYCA 5KBDA 2BSBA 1BMWA 2RB8A 5LLIC 1EGJH 1CXHA 3NGBC 5K1JA 3ZT7A 5LBSL 1MW0A 5KLIB 1MF2L 3QWOC 1U8IB 5IB2B 1B2WH 1MLCA 1I8LA 2YS4A 2CDEA 2IPTH 2D7OA 1S7WA 4TTDD 5FA3A 4POZC 5KSAA 5AVQB 2QZQA 2HLFC 3L73G 1U41A 5BV7B 3FT9A 3Q1MA 2FJGA 3TBSB 1FOSF 1DHKA 4UOQA 5F9WB 2AV7A 3Q8CA 3UADA 3QI9A 4BFNA 4ZX6A 3U9PH 1ZHKB 1X5IA 4IBZA 1NOFA 3WMPA 4YDIH 4YSSA 3FL7A 4BJLA 5JYLA 2DWDA 1NFDA 2DWDB 1LTIC 1QKZH 4DTGH 2F08A 2IIJA 2P24A 4U6HB 3MRLA 1ZANH 2P52A 2KT6A 2DQEL 4OGXL 4L9DA 1I1FA 3NYKA 4IM8A 1KYUA 3ILQD 4BCXA 1R24A 4XO3A 3GSQA 3DHPA 1AQ8A 5GTIH 1N2DC 3LW5J 2UWEA 4DP7X 4WU7A 5I28A 2WKOF 1XEUA 3GF8A 1A4JB 4ORGB 3FO0H 3HZKA 4PJ5D 4TPRL 5E0QA 3SDYH 4CN1A 2F53A 3IJEB 4LVOB 1IGTA 3VXUE 1U3HB 3V4QA 1JPST 3PHAA 3KZ8A 2ZPKH 2XN9D 5GRUH 4MDIA 5I8CB 2A9DA 4M93C 1NBVL 3LJ3A 1MG3C 3D33A 3E8UH 4C4KT 3O3AA 2JJSA 3BISA 4MMZB 5D1XC 5D2LE 5EU4B 3V6OA 25C8L 2FJFB 4ZTEA 3AJ7A 4D7BA 3UAJA 1M56B 1E7VA 1NGQH 1ITCA 3GI9L 4LSSL 4OCNC 3SDCD 1XMWA 3UBXG 1MCDA 3GC3A 1F4AA 1V7MH 2OJ1A 5KVEH 3FFOA 4UDTB 4K7PH 5TQ2L 5J8OA 2ATKA 1BAFL 3H56A 4GI8A 1QI3A 3FUNA 2VE6A 1MFDH 3DTDA 5IVXE 3KH4A 4Z7IA 1XSOA 3HC4H 1JRHH 4GSUA 3FTYA 1PDKA 1DQQA 2W95A 1YCSA 3FQTB 2IXQA 4WKXA 4ZNCA 3K5SA 5F0MB 2VN7A 5F1IA 2K9FB 1XXFC 4EE2A 3BIBX 4ZPVB 1OAXL 1ID2A 4G1MB 4IGBC 5FUOL 3PJSK 1BZOA 4S1QL 4C4BA 2SPZA 3D69B 3PQYD 5E6UB 1YI2P 1OLZA 1VQOP 1T4KA 3WFHB 3ZSTA 5GRJL 4NIYE 3VXSE 1S7RA 3OC5A 2K78A 1KT2B 3ITKA 2RCSL 2XQBH 1E4WH 4LSUL 1A8ZA 1NUFA 2AANA 4AEIL 4MYPA 1EDQA 2QEJA 4PMFA 4DEWA 1BQSA 2VR5A 5JA9A 4LLWB 3E6FA 1MW3A 4IL6X 4B0MB 1YMMA 4BZYA 1JERA 1I1RA 2BVOA 2XG5B 2YBRA 2R4SL 5D5MB 4DEUA 4DOHB 4BE6A 4OCYL 2F9BT 3PTZA 4PJXB 2N9BA 1UACH 2C7UB 2GFBA 4ZQKB 1AI1H 2QGEA 2GABA 4N6RB 1JVOA 3L70G 3ETBJ 2NW3B 5JW3L 1Y0LA 3GHEL 3ES6A 1BBDL 4XPHH 2CRYA 5T3XD 3K6SB 4N9GA 2XTJE 1I8IB 4UQCA 2X1XR 3UTZB 1BEYL 4TT3H 2W0FA 2YZ1A 5DGQA 4HS6B 4RFNB 4U6YA 1L0NE 3CVHH 3EO9L 5IR1B 4HUVA 2H0EA 3TC9A 5HPOA 3QEUB 1GAFH 3UC0L 3LNFA 4QDGA 4AGLA 4NZRH 1U92A 1HJCA 3LN4B 1ASQA 2X4QA 4LBEA 3RU8H 5E8NB 5ESQA 1DANU 4YHLL 3UP1A 2LR2A 1J9CT 2Y22A 4LCWD 1BAWA 4UT7L 5J1SC 3D0LA 4OAWB 3V79C 1RULH 3WMSA 3P40A 3H7BB 4PCTA 4ZUVA 1CFSA 1QFUH 3SGKC 3AEFC 1KLGA 3NTNA 4TLSA 5I16A 2J8UA 4GJTB 3T1WA 1XH3B 1U8JB 3PWNB 4Z78A 4JDTL 4ZAKB 4GG6E 3AQXA 1LWUB 1MCEA 2ATPB 2ZKHL 4R4BB 1MVUA 5JIDA 4PRAB 1QFOA 1HCFX 2G3MA 2R44A 3RKDC 3WIHA 3FCSB 3FUFA 3DX9A 1A3ZA 4FAAB 2EXWC 3M91A 3EGSA 1KC5H 3QFGA 1SQXD 2V2TB 2RA1A 4QHUB 5C0CA 4WO0A 1U8KB 2VZUA 4PGCB 5E8PB 1IBFA 3WNIA 1BGYJ 3H3KA 3BVXA 4E42B 5JOPE 1JNHA 3OKLB 4PJ9B 4K94L 5E2VH 1T7YA 2APXA 3C09B 1EMTH 3EDKA 4AM0B 1Q9LB 1DZ0A 1I9JH 3L48A 3QH3A 4PG9A 1AS8A 4CNIB 4OWFA 1G9ML 3MFFB 1Q1PA 5D1QD 3U4EA 5CCGE 4CSZA 3GDCA 1JMBA 1YQ3C 2E76D 4ZD3L 4Q9CA 1JK8B 1ZLVH 4RCAA 1FG2A 4U3FE 3K8MA 1GS8A 2OL3A 5DRZA 4ZUVB 3TEZA 4O5LH 2B4CC 1NKGA 2J88H 4TF4A 3LNIA 4HVBA 3GJFH 4U1SA 3MLTB 1E8YA 1NTZG 3OVUB 1KEMH 1NL0L 5BS0B 3PHOB 4PJFB 4ZMAT 4E9VA 4HFUL 2VSDA 1UHVA 4N8UA 2BSED 3L37A 2W94A 4ES9A 2YRZA 4XVJL 4X98A 2AQTA 1NO4A 1U21A 1T20B 2WB1A 3RY6C 4BK5A 4LP5A 4XBPB 1I4FB 4PH8A 1T1WA 1DVQA 1L0LJ 1KPUB 1F3RB 2R56H 1JZ5A 1L0NJ 2BY0A 3DBXB 5I8OH 3ILPA 4LU5L 2AI0L 1NPUA 2B1AL 3DJRA 4WI8A 4R9HA 4CN4A 4HPHA 3UTSB 4RAVA 3OTTA 2C3VA 4HC1A 4WU5B 4JFXB 4NUJB 5LAPA 1O5PA 1NGXB 5I6MA 4WFHD 4ZQKA 3CMAP 3D18A 4PJXA 2EEAA 1PJ9A 1VEPA 4ADJA 2VERA 2GBUA 3O2DL 3FOLB 2EJ1A 3TO2B 1QSFE 3CN0A 4NI6A 3PG2A 3GLAA 3QDGD 4MAUL 1HJBC 5HJGA 3HPLB 2P1JA 4PJ8D 1XCXA 4MJ6A 3LIZA 1PZAA 3I55P 1TTGA 4NPYB 3QJHA 3MV8A 4XCYB 5CN2A 1OWWA 4ONOA 5KVFL 4EN2A 2GI7A 5CZXC 1UT2A 1CG9A 2XY2A 2AJVL 1ACXA 3GRWL 3DUSB 2K45A 1ZV2A 2ALAA 2Z92B 3JSSA 5FXCH 3TIDB 3SDCC 4E9RA 1UOVA 4KJPD 1MQKH 1NGYB 4OJAA 3U2SB 4DZOA 1SQ2N 3TZVB 2CBOA 2D3NA 1P7QB 2XBDA 4R7NA 3T3MF 5D4JA 2C4FT 2VABA 4XMPL 1NMCC 2O26U 3RHWF 1AGBA 2P43B 3LH2H 1JMMA 4JZOA 3KEDA 1B4LA 3U1AA 2BY1A 5KAFH 3GEFA 4OUUA 1JI2A 2GQHA 5TH2B 4F1ZA 2BHYA 1SQXK 1LO2H 1EAJA 2IV9A 3MGOA 1IFPA 1HEHC 3MBED 4H1LH 3MRKB 4HJEA 1BQLH 3QNYB 2Q8AH 2FJFA 3OXSA 3SKOB 5A3IC 5IOPA 1A4AA 4AUJA 4U1KA 2YZ8A 1CZ8L 1Z32X 2Y07L 2XWBA 1SMAA 1UWEL 2BNRB 4YJZL 1YPZF 2D7TL 4OCSL 3ZT6A 3WS6A 4DGYL 4XMTA 4DKAA 4A66A 2C1PB 3WEXB 3A67L 5L4FA 3ZL4L 3X3GL 5DFTA 2OMXB 4KTEH 1XF5B 3WSQL 1KTJA 2WBJD 4Y16D 3KPLA 3K1DA 4JDVB 4NDMA 2ZSVB 3SBWA 3ME0A 4WRLA 4OSUL 3GIZL 5KLVE 1HI6A 2XRAL 1CZ8H 3A5TA 1R3LB 3VYNA 2CUAA 3GZQA 2KUBA 2BNRE 2PABA 1JE6A 3B37A 3L71D 1FORL 3HRPA 1S9WA 3BSGA 5HHOA 2R83A 1RF0C 2FBOJ 4YMPA 4NZFA 3ELQA 4OCXH 5DVOA 2XNAA 4NC2B 5KN5B 1VL2A 4Z1PA 3QNXB 2Q1EA 3KGUA 2YFNA 2AEWA 1VKXA 3GIVA 5LDUA 2JCCF 4WW2C 1S7WB 3ARGA 3EFFB 4YXKH 3N06B 4S11A 4K0OA 1ZRTD 1QFWM 1FVCB 2VL5A 1SXZA 4RGNC 1GTFA 4UTAA 4E5XG 1YITP 2XZCH 4JFEB 1FL5B 3P0VL 4FYQA 1PZ5A 5BS0E 2PTUA 4MTMA 3K0WA 3MUGA 4YK4C 2BDNH 4BQBA 1H3UA 2EP6A 3AE3C 5TE4H 1MOEA 2MNWA 3VFRB 2K4WA 4EIBA 4HSAC 3CK0H 1GK4A 2AQRA 1RK1B 1L0LD 1IC7H 3PGCA 1ORQB 4LK4A 3I2CL 2Z1PA 1IGJB 3L3IA 3HE6C 3ROLA 4ZYKA 1OAKL 3ARED 1A6AA 1LVEA 1QPPA 2CCWA 1BQ5A 2IPKB 3G6DL 3WDIA 3PXJA 2WMPB 5KTBA 4DHLA 3VX1A 2JCCE 4JX0A 3O6ML 1JM0A 3PHSA 2VRKA 2Y1AA 2BP8A 4LLAA 1ET5A 1ONQA 4PS8A 4H1LA 1JXJA 2Y72A 3NTCL 1A02F 1ULVA 2G9HA 1JCKA 3CXHD 3ESVF 2V7NB 3EO1B 3SCMD 5EU5B 4OZ4A 3MJWA 1ZHLA 3OAYH 3P9LA 4JFDD 4QT5B 3U2JA 3WFEL 1KELH 1NFIA 1CZQA 2HKHL 4JN1H 5JPNA 1AKJB 4OIAA 3TFKD 1J8HE 5EPMA 2W07A 1JFQL 4BZ1A 4NBYB 5TH2A 1IBBA 3FQUB 3K4AA 2KQMA 1LMIA 3JTSB 4OJFH 4Y5VC 2YD4A 1DJXA 4OTXH 3EYQC 1XF2A 1J10A 4PWEA 3UBFA 3GSXA 1KBGH 1MHEB 4PJIE 2N7SA 4GKNA 1VDFA 5TDOA 4HJJL 5J9PB 1UM5H 1VZGA 1G0DA 3GM8A 3PAZA 5EEXA 2OYLA 1RXLA 3IFMA 1A7OL 1GGBL 5T3XL 3FTGB 3L2LA 3C9NB 2OKMA 5T5NF 4PD4I 3O11B 5JOPD 1IUZA 1QVGO 4MMXA 1OX3A 4MJ6B 3F5HA 3PHQB 1NLBL 2YD9A 1W0YT 1OGTB 3MJ8A 3KWTA 3HPLA 1JYWA 1GY1A 3ZR6A 4YDLB 1UZ8A 4MQ7B 2BS71 4C58B 3SBQA 5IVXB 4FQQB 4IDJH 5CJOL 3DGCR 3VMZA 3ZE0B 4K2UH 5K9KB 5IT2H 3FH8A 3NBNA 1EXGA 3VWJA 3AE9C 4Y5XC 1XB8A 1WHOA 4L76A 4Y1AA 3UTTE 3HVNA 4P05A 2E76C 1X5FA 3MOQA 1HN1A 1YN7A 1FNSL 5I1GL 3QGVA 1KCKA 4R84A 1KILD 5GGVY 3DBXA 5CU5A 4MMXC 4MXVE 1MZ9A 3QEGL 4QRUA 4ANXA 1RZ8A 5E6IC 3I50L 4NZTH 2ZT9C 2KYIA 2JQAA 3L5JA 1BSIA 1T20A 1YUKB 5B8CC 5ECGA 1LO3L 1SQQJ 4Y5XB 4C46A 3BT0A 1L3WA 1H0DB 3FWNA 1N73B 3EDFA 3H1ZA 3BVDB 3P9WB 4HEMA 1YEHL 1TFPA 1KPRB 4HKXB 1EEZA 3VWKD 1JF5A 2Q3XA 3EDDA 5D6DC 2F5BH 4NQVA 4MMXB 3T2NL 5DSCA 3IJYA 4FYRA 1CDIA 4PS7A 3VGDA 3NG5A 2PPCA 2XV6B 3FTGA 3LZNA 4QRSA 3MRCA 3A4DA 5CCHD 4B6ZA 3ZKXC 2EICA 1B4RA 3MV9D 2P44B 2YPLA 1F0LA 2MIZA 4MGXA 4WZ9A 1S9XB 5DYOA 5CGMA 4GW4B 5J89A 2FFDC 4Z3HA 5FKAA 4XC1H 4Q6IB 2P5ED 5DZAA 1GHFH 5KKZB 3WNOA 1UFGA 4FQXD 3HN5A 2E3VA 4HIHA 1JGLH 1QFHA 1MAJA 4ETQA 1J1DB 4WV1A 3VQ1C 5EORL 1Z5HA 3M8OL 5KAQF 2X6VA 2IPPA 1T0OA 3I9GL 1R1CA 2R0WH 1FLRL 4P4RA 3UPCA 2OYOA 1PAZA 1PL5A 2ZOKA 3EGSB 3EADA 3CHSA 1NFIB 1T2QL 3N04A 3WIAA 2NY5L 4AQ8C 1UT1A 1ZHLB 2FFDB 3L3GB 4XP5H 1E8ZA 3LQAL 4POYA 5AOIA 2N0MA 5KKZC 4M00A 3EYUL 1JNNL 2H88C 1JGDA 1ZA6B 5A3ID 5IW6A 4WO4A 2G5BA 3MJ7A 3K72B 2VIRA 1O9ZA 1IFMA 4WHTB 1UXSB 1XGZA 1E4KA 1YECH 2H3NB 2HFGH 3BH8B 3V0FA 3ZE0F 2F54E 1J8SA 2A77L 4BGLA 2WZPA 2ITAA 5DI8B 2XWJA 3LIZL 3DX2A 2VLLA 5F3BA 1WIUA 2QFPA 4WFGE 1UWFA 5EWIL 2AC0A 1S9XA 5DYOB 5DJTB 1UEMA 4L5FE 1L7IH 2NY6C 1RQUA 4LPUA 3RL2B 4YLBA 3X14A 1GYAA 1S3KL 4HHWA 2NXYC 1M1XA 4XB7A 5C2UB 3UBXA 5JW4Q 2I9TA 4W4NA 2WSCH 3L45A 5K39A 1QEWB 2R9HD 5HI3C 1M7DA 2EDMA 2V8LA 1YPZE 3MUJA 2FYVA 1CTNA 4J4PA 4RGMC 4IRSD 1FNEB 2ID5A 3T0VA 5KBPA 4XVTL 4Q9QH 3TU6A 4FXTA 4AMXA 1I8LC 2J73A 4IIZA 2X6AA 5LNEA 4X6FB 1PLCA 3X12B 4JCMA 3QG7L 3R19A 2E0PA 1FA4A 4OD2B 3VYPA 2DJ4A 3V0WL 1X6LA 4Y2DD 3QO1A 5D7JC 1SQPD 2ZKXA 1YAZA 1OPOA 5C0ND 1SFCC 3KBEA 3LKOB 3N5AA 5CD5C 2D7NA 1ZY9A 5DJZB 2K3RA 5AZUA 3L75D 1OT2A 4S1DC 1FBIL 1HKFA 2EEDA 3U82B 2YAOA 3HG0A 3FT3B 5CEZH 2DH3A 3CZLA 5GPRA 1AHWC 5KVGL 2OX5A 1KMGA 3LHPL 4LL1A 1X9VA 1PBYA 1AH1A 4FA8A 1R47A 3OR6A 4OCRL 4FP8L 1F8TL 2P2UA 3WY4A 4NQCE 3ALPA 4F7PA 2V4HA 5K9JL 1DQQB 3FQTA 1FDIA 4HJSA 4Y19D 2BFGA 2A9NL 3K3QA 2VJXA 3RG1C 3INUL 2WUBH 1ZLVK 1JZIA 4QRTA 3FAXA 2NW2A 3CWGA 1W0WA 4MS8D 1EXJA 2P7TA 5AZ2H 3V0JA 4D3CL 5D6CB 4FD0A 4Y4KD 5D1XA 4IRJB 1TCRB 2ENQA 4N2AA 3VXQB 2WBXA 3K5RA 5I6PA 2IMNA 4WHYG 4WWKA 1BVNT 4IMKC 3VI3E 1VFUA 1TZIA 3L4XA 2JLLA 3BD3A 2WAHA 5CS7A 3TZVD 3ZE1B 1P0SE 3ABGA 4PD4J 5HDLA 1CL7L 4RA3A 1KYDA 3KPSA 1XTCC 3KYMB 4GT7A 4XGZA 5MHSD 2RR3A 2W6AA 1M7XA 4S2SB 1H6UA 2EUXA 2KERA 3FB5B 4IRZH 1ZS8B 5A43C 2VABB 1TIUA 2GB2A 1VAHA 2EVFA 1A4JA 3EYQD 4X9YA 3TA3B 2XG4A 4L48A 2KLTA 4EIGB 3CVCA 1S9KD 4QT5A 1IM3B 5C0JB 3N7NA 4KRPD 5AB2A 4M7LT 1N6UA 2NUPB 5CZRA 3AUWB 1CF8L 4KI5D 3FB7B 3TF5A 5DUBB 2V37A 3X13A 4X4YA 2KP8A 2GIMA 1H6TA 2LT9A 4K3HA 5MI0B 4UV4H 5I19L 1SHMA 2EIZA 2GIXA 1EZVY 2BHFA 1QRNA 2QTEA 4PJ7B 2WZ0A 2KHAA 4LSUH 2GHZA 4OVVA 3ULVE 3UO1L 3GK8H 1B0GA 3ZVVA 3QUYA 4PMEA 1WITA 5EIVA 4ELMB 4JW3A 4P57A 4NYLB 3HZMB 3IPFA 5BRZE 4YPJA 4XVUC 4LOUC 1GU4A 2JIXB 3ZZLA 5EEZA 2JE8A 2CIKA 2X9XA 3CZGA 5MI0C 2CLRA 4KMTL 2HMIC 1HTYA 2ZAIA 1WV7T 3O4LE 3QCUL 1MLBB 5MEOA 5EU6A 2VQ1A 4U4IA 1ET8A 4R7LA 2X3CA 2F54B 2DM7A 1ZEAL 3P73A 1VQ7P 1G1JA 4R5VA 4GXUN 3B2MA 5APXA 1OAQL 3DOIA 3FRPA 4TSBH 3T0WA 3DXAA 1GZQA 1EZVI 2COVD 1AO7E 3P2DA 5A2IH 4H44B 2KSEA 3H1JJ 2X0UA 3AE6C 3G71P 1SHXA 1BEXA 3P1VA 4POUB 3UGEA 4G71B 3TFKC 1PFCA 3V5KB 4E36A 1JZ4A 1URQA 1U7MA 1JHLH 2AEPH 2E9WA 5CSBA 3RWGA 2XNAB 1OGSA 2F6AA 1VFAB 3HG1E 1DQLH 1HKLH 5E9DD 4BK5C 5B5EE 1NU1D 1TJGL 2R15A 1M6OB 3VCLB 1KB9I 4MQTB 1AR2A 2M8XA 1SQXG 3LW5H 1HILB 2VTFA 2BS9A 2V7HB 2WXNA 4PHXA 2OARA 3D5OF 5FO2A 1HXYB 3B9KC 5EN3A 4BSJA 4TQEL 5GGVL 4AENB 3FUKA 4A2FA 1IT9L 3VWJD 3SGKA 4F58L 5ALBL 1YJDH 4LP4A 3SKMB 1I1CA 3FQWA 3MFFA 1I8AA 3NJKA 2YGOA 2VDMH 4X99B 4R5XA 2POHA 5FF6B 1C5BH 1PPIA 2PW2A 3ZMEA 1L0XA 1NEZG 3J27A 4AM0A 1FVEA 4DQOH 1EHAA 1RD6A 1TZOA 1E9PA 1SYVB 1QFWI 3B1UA 4Y89A 3WJLA 4BE5A 3R18A 4OZHE 2H26B 3QXVA 1ZVNA 4PWGA 2GJ6D 3B9KB 2PCPA 5I15L 4WI9A 4H20L 4Y5YC 1A2YB 3CZFA 1T3UA 4MB4A 2WQWA 1ZTXL 2IMMA 3O3EB 1TR7A 1F4YL 2ADGA 4J3SA 1AHKA 1OW8A 3BUQA 2JIXD 4XNUL 3G6DH 1NU1K 1SN2A 2WVTA 4U1NB 4ZAKA 3VU1A 1FDOA 4YHOH 2A6JA 4OUUB 4W9JC 3VMXA 1BD2D 2GITB 4DJGA 4N0RA 4MLIA 4BUHA 1UOWA 1XF4B 1MRFH 3SE4A 3ZUCA 1AVAA 3DPBA 4O9HH 4K73A 5E1AA 1NAFA 4PLOB 2DLGA 1JV2B 3CZEA 3PXHA 5JW5B 1P84I 1L9PA 4WJ5A 5ESAA 4GYBA 5EBGA 2WITA 2F19H 2CQVA 4H20H 3FB8B 3CXHJ 1GGCH 4NN6C 3GKWL 4X6BA 2OTKE 1GTWA 2VDOH 4XZUB 2I07A 2OR9H 3A6CH 4CADA 1QW9A 1IBGH 4D9RE 3ULUE 4HUVB 2FE0A 3CX5E 1J2JB 3Q06A 2ED7A 4ENED 1IVTA 4NPYA 4WY7L 2JI2A 4JFPB 2EC8A 1AGDB 1K2DA 2L3BA 3H1KD 3SE8H 1V3LA 3C2AL 4RLDA 5IUCA 1UM5L 2WW8A 1NOHA 4U1LB 2F7RA 1JIBA 1RMFH 5E7FA 1PNCA 4M56A 4QF1A 3K6IA 2G2NA 2HSIA 2ZVNB 2X40A 4LLYB 1TQSA 3UAAA 2BNQE 4KPHL 4OF3A 5CWSB 4BFEA 4F8LA 1NUNB 2BOCB 5IB1B 1I9IL 3SY0B 2IEPA 2OXGB 1PGOA 5DD6A 2Y06H 3AVEA 2OTWB 1F4XL 1N8RQ 2VQ4A 1GPOL 1G7MA 4U6TA 4ZTOH 1DFBL 3KLAA 5JXED 4XBPA 4K23H 1M57B 1RI8A 1YEKH 5FM8A 2P5WB 4MWFB 4F91B 2FX8L 4BZ1L 1ZKAA 3NRQA 4HX1B 1KDJA 2OYIA 1WG3A 3D0VB 4X8GA 5JHBA 2CMRH 1DBBL 4KX7A 3V2PA 2BIMA 3G7TA 1FJKA 2GSIB 4JPVL 1Z9NA 3OLEA 2C9UA 4OI7A 2Z4TA 3HHSB 3C6SA 3TGXA 3M7OA 4PJCF 1AQDB 2WPQA 2ZWSA 4DUVA 4HHAB 1CR9L 1CLYL 1YNTF 4ZDHA 5A7BA 1QLFA 1E3FA 3HRZB 1G1OA 4GQZA 5GGTL 3U1SH 1KD1Q 1DE4A 1E4XH 4ZMTA 3KDMB 2ADFL 2QJDA 2EDXA 1ZV8A 5DK3A 1PCSA 1ZCRA 2B9AA 1L4AA 1LTJC 2X4NA 4NQED 1D3CA 2R1XA 1KJ2L 1LO4L 1B3IA 5B21A 3VE0A 4YFLI 1SQBK 4XNQA 1UURA 4GO8A 2V0AA 5IW1A 1S9VA 3I3DA 1PTZA 3DXAB 3B9KA 4PGZA 2DAVA 2JKSA 1YO4A 4Z77A 3AG2B 2MJZA 3K6OA 3II3A 4XVUD 2CHZA 4HS3A 5EU6B 4LASH 1E4JA 3PQYE 1DL7L 5DHEA 3RVXC 1G84A 2ALWA 1LHZA 1FF5A 1SN5A 2E7CA 2IGFH 1LWJA 2Z4QA 3L95A 4FTVD 1B4JL 3QFJE 1N18A 2LTQB 3MNVA 2BVYA 2OMZA 3ZUNC 3P8CE 2YSSB 4LP8A 1I1AB 4G7VH 2F7OA 2J8UB 1IAOA 3DXAE 3NP4A 4XNAA 3QULA 4XRCB 2MTPA 1U95A 1LNQA 3PH0A 3K0YA 1QR1A 2WB7A 1G6VK 5HYSG 4GP8B 3MV7A 1WA0X 2ENJA 2NY1C 4KBPA 3VDAA 3MX0A 1JN6B 4URTB 4AQ1B 1DQJA 1RL1A 5CSZB 2JKNA 3IBEA 3QUZD 3LKPA 1UCBL 5T1KB 4EBQL 1CFNB 2WXKA 1U30A 4XMVA 2R8SH 2FXPA 3IFNL 5CJ4A 4J6RH 3Q13A 3V4VA 4YFLF 1BE3J 3W9EA 3J2PA 1KILA 4H5SB 4ICXA 4Y2DB 1YMMD 4ES8A 4M93B 1YDPB 1DEEG 3EWKA 2X4SB 2G3XA 1W15A 3RTQC 3QPQD 4L8DB 1KY6A 1TZGL 3ARGC 2P8LA 1WUZA 3N9GL 3OKKB 4JRYA 4R8WL 5CGYC 4GUQA 5HHPA 3P73B 4L0PB 1KYAA 3IRPX 1AJ7L 3FFCA 4I3GA 2E75D 2X05A 3VNZA 5HYSB 3PV6B 1KB9E 1SLVA 3B2PA 4WJKB 5KBLA 1LP9A 2HVJB 2X3AA 4QHMA 3RAJL 5KS9B 2X9ZA 3HLKA 2DWEA 2UV3A 2WBJB 4Y16B 5AVWB 4WFEE 1VQ8P 4XMXA 1HF9A 4JANB 4JFFA 5D5MA 5DMIH 1NBZB 2XG5A 4KK9D 1LEIA 2BCCG 2DRUA 3PWVB 4ZW3A 5A6LA 2XWDA 2FHCA 3T5WA 2A2QT 1RP8A 3NACL 3CQFA 3BGMA 4IQHA 3SKJH 1PZSA 3O6KL 1A0QH 5L7XH 3D07A 3W2DH 4PJ7A 4FZ8H 2QT6A 1NTDA 1FPTL 3N9GH 4MRCA 3OR6B 3ZE1E 3HIZA 5AZEH 3SDAD 1TYRA 5F7AA 2H8PA 2XPGA 5C07E 2ARJA 4RZCA 3VGAB 1P7BA 2EE3A 3MGTA 5IMMB 5IBLC 1AXSA 5I1HH 3AS3A 4AQEA 5I8KH 1CE6B 1TZHA 4W9GC 4X80H 1N5AB 2YXVA 1MWAB 4PJ9D 4XCEB 3HE7D 2IC2A 3TURA 5AWNH 3CZJA 2E74D 2ICES 3WFBH 2CSPA 3LMJL 3ZMRA 3VTPC 2HX9A 4HWEH 3CPLB 1K9TA 1QSFB 4HC1H 5SWQA 3TNMA 3MTXA 1FYTB 1OPGH 2W65A 3TBWA 5DS1A 1HXMA 5CSGA 3L74J 1TZ8A 1TZIB 5KJ7E 2MNJB 4FP8H 4JAMA 5LNGA 2FYYA 4MNQA 2NYYD 3W5MA 1A5FL 4FFTA 1F3DH 4NCC1 1X7SA 3PJSB 4PPTA 1MQ8A 2L7JA 3RIAF 1PAMA 2FT8A 5BMFH 5LGHL 1L9QA 5AOMA 3G3LA 3DO7A 3QQ9D 1IGTB 3QXDA 4P2RD 3G5VB 5BCAA 2VN4A 2CUIA 3NSDA 4JDEB 3OX8A 3F7KA 4LCWB 4ZJ9A 3VFVB 1P1ZA 3CE1A 3LB6D 4QGTA 3PXLA 1KG0A 4IBLT 4DO4A 3MVSA 2ZVOB 5BVPH 2WLMA 1SF5A 1LNUB 2OX5B 4XXWA 4ASWA 2RMZA 4XA4A 4N3YB 1R3KB 4E41B 3RA7L 1BPLB 4PJ0H 2BOBA 5I18H 4KNUA 2Q3IA 1NGQL 1JGIA 4G72B 2EH7L 2Z31B 4MMYA 5I2IB 3B1TA 1Z5YD 4UQAA 1FI8C 1KLUB 2VDOB 2HUHA 4ORZC 1QA9B 2KI6A 1TKWB 4UUJA 1DBAH 3SN6N 1JK9B 2CJUL 1I85A 1S7VB 4WK2B 4JMXA 3VVVA 4WBAA 2AJ3A 3BRGC 3M0DC 1M05B 3HI1B 5I66B 3GHGA 1UQSB 3KLKA 1TSRA 4TVPD 3L3GA 3MLXL 4KFZC 5B1JC 4FLRA 3KLDA 4UT9L 9PCYA 2ZOKB 2BC4B 1Q1JL 1CFMA 5DK2A 2J1XA 4YE0A 2EO9A 2H6OA 1WAPA 3BP7B 2H6UA 2PP8A 2E9JA 4R4ND 3UGUA 1Z9MA 1E8XA 4UIKL 5GQBA 1CMOA 2BEZF 3PP3H 4J3OD 3T2NH 5IKCA 1OT4A 3BUPA 1HWWA 4F3FA 4HZ1A 3CZNA 3EJQA 3UJTL 3NVQA 2Q7YB 1SXNA 5CKGA 3MSPA 5F70A 2HG5D 2WSEJ 3FH7A 1QSEB 4K3AA 3VXRE 3BKML 4HJIA 1R5IB 3GSUB 3B7RL 1NCNA 3N55A 4LPCA 4NZJA 4A7VA 3NZ8A 4HG4J 1MIMH 2ROXA 3MLSL 2CA3A 3RDTD 5L8JB 2F7IA 4GKSB 4NOBA 4HQQL 1CFQA 2RJMA 3RGVC 1ITBB 1M7IA 2CDFA 2IPTL 1NYHA 3S34L 1J12A 4A2DA 4NNXA 1VPOL 2YGQA 1RCYA 2XFXA 2J4WH 3BKYH 4HJGB 4YDNA 3SE6A 1VFMA 1ZV5A 1INEH 2R2EA 1DUZB 4ZUTA 5IB5A 2H8PD 2CR0A 3MNWA 4M4RB 2CKNA 1A6UH 4LKXA 4G6ML 2DJUA 3GQFA 4DGVL 1GGIL 2ARJQ 4LARH 4BFIB 3WN5A 3KCPA 1QO3A 1TOXA 2ZWLT 2X89A 4UOJA 4H8WL 4OGQD 1JK9A 3G9RA 1N12A 3S37L 2C8NA 4V1DD 1MCFA 4CGTA 3TEWA 2NX5E 3FU6A 1RULL 4MBOA 3T4AA 4NUQA 4PY8J 1KJVB 5A7EA 4ELDA 6CGTA 4K15A 4LCVA 1RZIB 2YXFA 1RPQA 1ZGLP 1XGUA 4JREB 3KR3L 3VH8A 4F7CA 4JN2B 5HP5A 3VXUB 4BQ9A 1E50A 4YSAA 2HRGA 4RISL 4RAUA 2NY4C 3TJPA 3R4RA 2PAJA 3UEQA 2DJSA 4XCFL 3V52H 4P5MA 2JTDA 3BAEH 5MP6H 3JWDH 3MJ9A 3AB0C 4P5MB 3IAOA 5LWYH 1IL1A 5F72S 1X5ZA 3LS4L 4ZMXA 4UBDC 5JNYB 1WSST 2EDNA 4F9PA 1ZRTE 1NAML 2UUDK 3W82A 4ODUB 3WYRA 2LGNA 3HFMH 3L72D 1CS6A 1FIGL 1IAIM 3PP4H 5J9PA 2M0BA 1YQVH 2Y2WA 4JO2L 4JL1A 5I0ZA 3EOTH 3HUJE 1OMIA 3W0WA 2GCYB 3QG7H 5DD0L 3SDDD 3ULVC 3C60D 4NNPH 4DUWA 3A0BH 5EOCH 1UD5A 4K7PY 2XWXA 5DQ9A 3N91A 1KYOH 1JMXA 1BDYA 2QZ5A 3FUDA 4P3CL 4R4LA 1U8CA 4JPQA 4P3DA 4NN5C 4NQXA 4DF9A 5BZDB 3BYYA 4JPWH 2IZ1A 5D1QE 3NRPA 3HG2A 5HHNA 4W81A 2FGWL 3QUXC 4ZUTB 1F58L 1Q0YH 2N1TC 1TJIL 3BPCA 5IB5B 1ZOYC 5ITFA 2J8UF 3SOBL 4M7ZC 4DK3A 5IVXA 2OBGA 4DVRL 2B1HH 1OGTA 3BZ5A 1AXIB 1FO0B 3VSQA 4I2XB 5INCA 3ZGHA 2VGLM 1O7SA 2EYRB 5FO9A 4AUWA 4X7TB 3MCKA 1K73Q 4KJWC 4AXWA 4WO4D 1D5MB 1P5VA 2KB7P 1UA6H 1QVOA 1KGCE 1LQBC 4JM2D 1SFCD 2AAAA 3FW6A 4X5WA 1OWAA 3TN0B 1DO6A 5AEAA 5CEXA 5GS0C 4WENB 4MA7H 4MNGB 2IOIA 5KYUA 1JGUH 3AT0A 3SYPA 4G80A 3PRZA 5JDSB 1N26A 1A65A 4QXTB 4PLKD 1I8KA 4KTDL 4IBTA 4L1DA 2R0KL 3NSXA 2ZOLB 2HYNA 3LVEA 4M7LH 4D9QE 5B7FA 4AX3A 4F1SA 2VLJE 2YGVA 2E75B 2HLAA 4HKZB 4TSCL 2M8RA 3ZRCC 3KS0H 4PTTA 3HE7C 3MA9H 4IRZL 1K4DB 5JIKA 5L8LB 2XWTA 1JV5A 2FBRA 4L8DA 1HYRC 1MWAH 5KYYB 5I5JA 5IQ7H 1LT1A 1NTMG 4KKCC 4MX7A 5C3TA 4ZFQA 3BIAX 4APQC 1IQDA 1B6UA 3PWUA 1X3DA 2O93L 4PM1A 2ZUSA 4HK0B 2E86A 1N7SC 2LXBA 1ZVSB 4ZMYA 4LCCC 3HE7B 4RAHA 4G6JL 3HAEA 1NEZA 1Q9OA 4QHNA 5AOJA 2J5LB 4GRLA 1DLFL 4OB5H 3T65B 2A4ZA 4NZUL 1N64L 4TVUA 3C5ZD 4Y4KB 1ETZB 3OZKA 5DD5L 1EEYA 1DH3A 2LR4A 4E68A 1FGNH 1X4YA 3NCCB 4TNVK 2CKBA 3EYOB 4EUPA 3O8XC 4B50A 2R23B 4I9WD 2CO3A 1YJWP 1RK7A 1Q7YQ 3HVDA 3QQ4A 3WEXA 5DFWH 5D7JD 5IG7A 1EFXB 1NFAA 2J55A 1R5WB 3MLYL 4Y4KA 5D1XD 2QA4P 4KROC 3VX0A 3G04A 4IBUA 1HVVA 2X5PA 1W16A 4JFEA 1CD1A