1YYCA

Solution structure of a putative late embryogenesis abundant (lea) protein at2g46140.1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
174
structure length
174
Chain Sequence
b'GHHHHHHLEASADEKVVEEKASVISSLLDKAKGFFAEKLANIPTPEATVDDVDFKGVTRDGVDYHAKVSVKNPYSQSIPICQISYILKSATRTIASGTIPDPGSLVGSGTTVLDVPVKVAYSIAVSLMKDMCTDWDIDYQLDIGLTFDIPVVGDITIPVSTQGEIKLPSLRDFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative late embryogenesis abundant protein
publication title Solution Structure of a putative late embryogenesis abundant (LEA) protein At2g46140.1
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 31
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2005-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03168 LEA_2 Late embryogenesis abundant protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1yycA01
2.60.40.1820 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1yycA02
3NFQA 2Q7CA 1FAVA 1HUCA 2IPPA 5APUA 5APQA 5AW3B 1T2KD 2H7HA 3V4WA 2WPSA 2C9NY 4C7NB 1DH3A 2KP8A 3P7KA 5AW8B 5AVZB 3VYIA 2R5DA 2Z5IA 4DZOA 3L35A 5AW0B 3TYYA 1H89A 2E42A 3O8ZA 1T2KC 1JUNA 2ZFCA 3I5CA 5AW1B 5AVTB 1GU4A 5AVVB 3NXSA 1A02F 1YYCA 3M91A 2WPQA 1OXZA 4EOTA 3IR9A 4KHXA 3M9HA 3SWFA 1FOSE 2WT7B 2Q3IA 4AQRD 3B8EB 1X8YA 4B86A 3NMDA 1OWAA 4AYCA 4RESB 3A5TA 2WPRA 1HWTC 2W27A 3M0AA 3OAKA 3HE4B 4AUWA 3TNUA 2VRSA 3LIDA 1S9KE 1J2JB 4M3LA 5AW6B 1S9KD 2P7JA 2XZRA 5AW7B 1CI6B 1MFZA 3HE5A 2ZXEB 3L37A 5AVQB 2XV5A 1FOSF 1JNMA 5AVRB 5APYA 3P8MC 3KDPB 5APSA 2YNYA 4LC1A 3VN0A 4JYCA 2Z5HA 5AW5B 2JJLA 5AW4B 5APXA 3T97A 3VMYA 1KQLA 2Q5UA 3M9BA 5APVA 3VTPC 2YO3A 4JYBA 5AVUB 3A3YB 5AVSB 1SP4A 5AVYB 1HBWA 4HYTB 2YO2A 1MV8A 1GK4A 1MUUA 1GD2E 2WT7A 1GK6A 3A7OA 1H8AA 3KQGA 3HTKA 1CZQA 4GKGA 4XE5B 2QM8A 2BASA 5AVWB 2E43A 4I2LC 2R32A 3LIEA 1G2CB 2N9BA 1HJBA 1XO8A 4C7NA 3L36A 1H88A 1IO4A 1NWQA 3A2AA 3UIAA 1GZLA 3P32A 1CI6A 4GT1A 3V5BA 1NAFA 2WWWA 2W6AA 1CSBA 1A02J 3V4QA 2XU6A 5APTA 3MGNA 2C9LY 1SLQA 5AW2B 4C46A 5AW9B 3TNUB 2WTYA 2QM7A 3M06A 2P67A 5CMZA 1GU5A 3TK1A 2R5BA 2P2UA 3M0DA 2R3CA 5APWA 3VMXA 5AVXB 3VMZA 1GTWA 3HE5B 3HE4A 3MD0A 4I6MC 3NTNA
chains in the Genus database with same CATH superfamily
4LLWA 2IH1B 2BWQA 1L4AD 1LM8V 2X40A 3B2UD 3CSGA 4NB7A 2DZEA 2WSEH 3N40P 1XBDA 3P69A 1B4TA 4OD3H 3ULUF 3MBWB 1MUJB 2CJSA 4WWIA 2YHGA 4G8IB 3WIFB 4PW9A 5KS9A 4K3AA 4K94H 5BV7B 2A1WL 5EUOE 4Y1SA 4HH2A 3O6FD 4WCYH 3HKFA 3T3PE 2O5XH 2R2HB 4KRPD 5TQ2L 5KAQG 2DWEA 4G5ZH 1I7ZA 1YMHA 1E67A 2UXGA 1GZPB 1M57B 5FHAL 4FZ8H 5T3ZL 1BWWA 1N7MH 4JFED 4U3FG 4YK4B 5A3IC 3ZTNL 1MCSA 2JQZA 5I6KA 5JHMA 2WPRA 5DJAB 3E3QE 3F7PC 2ITFA 1O75A 1EJFA 2XIDA 3IJEA 4J8RB 3WNPA 5GGRB 3BO8B 1MCWM 4P5RA 1F3JB 1F18A 1Z3GL 2I9TA 4E9LA 2E5YA 4TUKH 1KBKA 3RZCB 1FSKC 2AJZB 2P52A 1PX8A 1FNSH 2IPTH 1BZ7B 1ZCRA 3N41B 2AQRA 3BKML 3RIKA 2CUAA 2G4EA 3TBSB 2G3NA 4GOEA 2IAMB 4AE0A 1CF1A 4GP8B 2O1AA 1HCYA 5DA4A 5HHMD 2HLOA 1E6OL 3ZDXB 2WPVB 3CZNA 1YMME 4I48A 4KVCH 4G8GB 4N8VG 1QQDA 3MQIA 5DJYA 1VERA 2CXGA 5I1IL 1HH9A 1X0TA 2DB8A 1SDYA 1Y8AA 3CUPB 12E8L 4PJXE 2XWDA 4KJQC 3AEFC 3LCYA 2EDYA 5I19H 3L5WA 1GK6A 3IXAA 1BCCG 5L2KA 4EBQL 4OBSA 1WZMA 1NC4B 2RCSL 4B9PA 1MCQA 3R1GL 5C7XL 2R29L 1FYHB 2KC0A 4Z3FA 1LEGB 1T04B 2OZ4H 3SJVB 1IGYA 2OMYA 3B9EA 3BH8A 1IFGA 4RZKA 3U36A 3UC0L 1A14H 1Q9WB 4QJ3B 3EO0A 1U58B 1XSKA 4PD4K 2L8AA 4EI5C 4UV7L 1DQKA 3VM5A 2V7NB 4Y5XC 1JXJA 1HZLA 1D3CA 2DW5A 3K3QA 1RP8A 4G1EA 4TL4A 4CPGA 2QJDA 4GAJH 1B0WA 3FFDB 5LDSA 1MWAL 1NPJA 4LRNH 3VGBA 4HK0B 3O2VL 3GMMA 5FOBA 3RAJL 5MENB 2G60H 1YCSA 1MPAL 3F12A 3IDNA 2Y06H 1KQSO 4LOEA 4Z7WE 3QIUB 5DC0A 3P3YA 4KKNA 1GH7A 1NAKH 4UB8E 2GW5A 3UDWC 4X6FA 3QUGA 2VR5A 5DFVC 1WK0A 2LU4A 4IRSA 2UZYA 1LWUC 1KLUA 5INDB 5HGDB 4MNHB 32C2A 3H9SD 1RZQA 1ESOA 3VA2C 3WJJC 5JORB 4PJHA 4EE2A 1DHKA 2VZSA 5HVFB 1FZMB 4TOYH 3UO8B 5B8CA 4PS7A 3GSUB 3P3SA 3PF2A 3TGUD 3QFDB 4HFWA 1HL9A 5G55A 3CWBE 1SOXA 2A9AA 3SODB 3VUAA 4PRDB 2ICWB 1J8KA 3GXNA 1JN6B 5IBUG 1T1XB 3MTRA 1MRCH 5IQ7H 1A6UH 4IMLA 4IMKA 2GIYA 2CRZA 4N2FA 3ZE0F 4DESA 3MLWL 4GG6F 3BDYH 2WIIB 5IHBA 2HFFA 3TO4A 5GS0D 4QYAA 2M2DA 3WTVA 4FNSA 5D1XB 3D70A 3SDCA 4NKQB 4JJOA 3PHOA 3VWKD 3OF6D 3GLZA 1KT2B 2N1TE 5TE4H 2H0EA 4W9IC 2NY1C 2HPCA 4GAYA 2KIKA 4KVNH 3ZDYB 1JF5A 1ZD6A 4HIIA 3D33A 4H44B 3ZZSA 5AAMC 1YPZB 4L8SC 1EHNA 2JQAA 3GRGA 1Q8MA 5E6ZA 2WXMA 5F93C 4FLRA 2G5BA 4D9QE 3L08A 5I1EL 4HUUA 1K8DA 1RZJH 1N7SB 2XWZA 2IADB 5CZVL 5L6YH 2B39A 2DMKA 4FQPA 1GW4A 5CCGE 2UWEA 2TSAA 4FQXA 4LDOB 4NQXB 3FRPA 3WN5A 3SPVB 2AVGA 3UJJH 4E42B 5JIQA 4PJIB 1E4JA 2JIXA 5MI0B 2BNRB 5LXVA 4W9JC 2FYUD 3H1LG 3PAUA 3O8XD 4LBEA 5E99L 4H13B 1RLWA 2D4DA 2O5ZH 3ZTJH 2O30A 1KTBA 3DNKA 2BJMH 3S3BB 5IMOB 3C60D 4E5XA 1NGXB 3CDGA 2GITA 1ZV2A 4Y99C 3Q2WA 1KZYA 4OB5L 5E8OA 1L0NJ 3PL6D 4QT5B 3TSIA 2B59B 2NLJA 2OYIC 3S5ZA 3HAEH 4WTWA 5BU5A 3TZVC 3C6EA 2YAQA 1RV6X 4JZOA 4XCCH 5F9WC 3QG6B 2AABH 3QIBA 1DBBH 2CDFA 4CNIB 4MCYA 3CD6P 4CU7A 3VFMB 3VXRD 1S9KC 4QHNB 2JJSA 1M1SA 4JG1L 5EUOA 4IOSD 1WIUA 5DHVH 1WGOA 3FB6A 5D7KE 2JJWA 5GGTA 3WJLA 1AC6A 1CBJA 5DMGC 4RBPH 4HVBA 4XNUL 3L7EB 1E4XH 3FHEA 2E76C 3JWOL 2KKQA 4ISVB 5JHLA 4ZKPA 1P4UA 3RVUC 1ZSDB 4D9RD 1YN6B 1KB9J 3FCSB 1NU1J 1SFCC 3H85A 3U1PA 1KV7A 2R4SH 2UZXB 5IM7A 1PP9D 2ADIA 3TJHC 3ZIMA 2XZQH 4UYPA 5IVXF 4PBDA 3BRVB 2VO5A 2C7FA 5D6CB 5IBTL 3T04D 3U4EA 3KW8A 1KXVA 1NFDE 1PPIA 1VGKA 5AW3B 1JOCA 4GMTH 3QUYD 5J6GA 2J43A 3QZBA 5LAXA 1BOGB 2J44A 2LFEA 4G71B 1EJOL 4HV8A 4DCQA 4QRPB 2R5DA 1EV2E 1U8PB 3C9NA 5GGRY 1YQ4C 1MCPL 1S5IL 4NN5B 4F8LA 3BE1L 5BS0E 3T3MF 5LNDA 4NRXA 4U1GB 5FHBH 1YMMA 2WLMA 1DZ0A 3CQFA 3E7KA 2K9JA 1OK8A 1NUGA 5HSFA 4MMXC 2X6UA 3V4UL 3HR5A 2JCWA 2PP6A 3PJSB 1FFPB 2P5WA 5DGRA 1XTGB 3H32A 1R6VA 2GTZB 3GBEA 5IB2A 1J1DC 1KENH 3CVHA 3FMGH 4MNGB 4YH6A 4E9SA 1MFEL 5GGSY 3EYQC 3LZLA 3RDTA 4YHYB 1GMEA 1URIA 2HYMA 1FLRL 3PP5A 2ZSWB 1GL2D 1KTCA 3Q5OA 3U1QA 4HIEA 1PLGH 1NIDA 2ZCKL 4NXKA 3SDXA 4JFHD 2XI9A 3GQFA 1AA0A 4N0CD 3TXAA 3HG2A 1AQKL 2HTLC 3B71A 4U33A 4MAZA 2WAHA 2E5TA 4FOMA 5CU5A 4ZFOA 4YPGA 2CO7B 4HT1L 2PABA 3VI3B 3EJUA 3GMPA 4XMUA 2YR3A 2XETA 3L74G 1RK0B 5LBVA 1SJMA 3GXTA 4XNZB 1JAEA 2ZJSH 4PGDB 2CMRH 4JBZA 3GXDA 3IFNH 5DJ8A 2XZCH 1A7QL 1L9PA 4PGEB 1D5XA 1WYJA 2O72A 2H6PB 5HI3D 2CGYA 2A9CA 2F19H 5IQ9B 2WUCL 1EZVY 5D70L 2AK4A 1JZ3A 3VWJD 3GRWA 3VXOB 4X9HA 1V10A 2AXHA 2H3NB 3D39B 1UXWA 4PTUB 3NFSL 4Y5XB 4JM2F 3NSDA 1KY7A 4N2DA 1GW6A 1IAOA 1U8CA 1SQBD 2JF1A 5AALA 3U0TA 1XO8A 2WWKT 2FYYA 3OAUL 4GSXA 5HD8D 4GSQA 1FL5B 1WVZA 3ZDZE 4CC1A 3ZHLA 1MCLA 3L4CA 5JW4N 4NBXB 1MFBL 5E7FA 2ETWA 3L3DB 5DWPA 2WVVB 1V7NH 1MAKA 4QF1A 3ZE1E 1HHHB 4MFHA 3TBCA 1LTGC 5KOVC 5ESAA 4ZFFA 5D7SL 2A1WH 5EFIB 5HHOD 2R0KL 3JWOC 5TQ2H 3POHA 2W0LA 3B9VA 4OF6A 3NTNA 4M7LT 4WU5B 5FHAH 5T3ZH 3DWTA 1EEZB 4DW2H 4TLFA 4R90H 3ZTNH 5EEVA 4TNVF 1XV8A 1AHKA 1VCAA 5AVZB 3HBQA 3TEWA 1RMFL 3DJSA 4JR9L 3WL9B 3SPGA 2V5SA 4JZJA 4PJAE 4YDJB 3V6OC 2QJYC 1HI6A 3SO3C 2O6DA 1SYSB 1Z3GH 4WFEE 1BGXH 2FJUB 2FIRT 4YR6A 3MA7B 3QO1A 4F9LA 3DOSA 4MZRA 5B39G 2XPYA 3BKMH 2XWBA 4KX7A 1RY7B 3D07A 1B4JL 2XTJE 3LKRA 4LCWD 2QQQA 1KYOJ 1NZRA 5IB4B 5IJVB 1E6OH 4DIXA 2X2YA 5F7EL 3TNNA 3DV6A 5E1IA 3V6BR 3RK3C 1KYUA 1V27A 3U2SA 1P84K 2B1AL 3E6HB 3U4BL 2W90A 5I1IH 4PV9A 1VF5D 5C3LD 4U31A 3VCLA 3RTQB 12E8H 3H42H 2V9TA 2YN5A 2Y7QA 4PP1D 3H1IG 1DBAL 5IWLC 2V3DA 4Y99B 4NEHB 4J12A 2JTDA 3EF7A 5DJDB 4AQ8C 4EBQH 1UJ3C 3BP4A 5AKRA 1QI5A 4DZ8A 4QTHA 1NCTA 2PTTA 4YFEA 1F02I 3OGCB 4M8RA 5CGMA 4NQSA 4OIIL 2NUTA 2OYIB 2RCSH 2H1PH 3TWYA 4Y1AD 3R1GH 1PY9A 2R29H 1FZEA 4ANVA 4WDIB 3ARDD 1QZNA 2F53D 3UC0H 1JHLL 1YTZI 2Z7YA 5F7LB 4JPIA 1SUHA 1VEOA 2MKVA 3QCVH 4WHYG 5JHDE 1N67A 3TOPA 4HOZA 2FYNC 4UV7H 3SGKC 1MDAA 4JCWA 1W0WB 5K1JA 3L17A 5AENA 2Y1ZA 5KG9A 1RSYA 1C5BL 4YUEL 4I77H 4FGMA 1MHPL 2LV4A 2Z34A 2A9NL 1MWAH 4HSCX 3RAJH 1XEUA 2Q7NA 1MPAH 1JGIA 2ZCLL 2AHIA 5GRXG 1QEXA 1QL1A 5AYUL 4P4KA 5ECJE 4N0UB 2QGDA 3VXUB 3V2PA 3BEWB 3W5NA 3FO9B 3ME0A 5IESH 5H94B 4Z0BL 4UQAA 1SFCB 1YN7B 1VL2A 3IRCA 4NZDA 1NFAA 2FWOB 2XFXB 2DH3A 1ZIAA 2A73A 2E9IA 5KANI 1U8OB 2J71A 2NYZA 4N8VB 1QW9A 1IM3D 4AGLA 3CC1A 1VACB 4OGAC 5T33H 5L2JA 1O5PA 4MNQB 1CTMA 3GS4A 2BSRA 1N2DC 1EZUA 4M5ZL 4OZIA 1EX0A 1T7VA 3K46A 1LEIB 4XPAL 1NGYB 1PQZB 2JKLA 2R3CA 4LSSL 1UD5A 4LHUD 5E5UB 5EO9B 4BGDA 2EDHA 1NCCH 4XNAA 3GXIA 4AQEA 4Y19D 1AP2B 4H1LG 1CURA 1V7ML 2BVUA 1H5BC 5DJ6B 5BRZE 3BZDA 4NPYA 3QWRA 2EDLA 2KLRA 3KYNB 3HZVB 1U8LB 2A74C 3ZE2E 5DD3H 4RQQB 2X10A 4MJ5A 2KS0A 5FFLA 4LQ1A 1OXZA 3CN1A 3L70J 3OB0K 1L0QA 1L7TL 3KLSA 3TCXA 1CVSC 2E27L 1BSIA 3MRCA 4AQRD 5CZVH 1JG9A 1HWWA 4ANWA 2GIMA 3EWKA 2HSIA 4IYKA 3KEDA 3VGHA 4BFRA 1SZNA 3HS0C 1JPEA 2SEBB 1PBYA 2ZTBA 3EFOB 1QBAA 4LCYA 4MD5A 3L75G 5EU7C 4W1TA 3HG1D 2DH2A 2YLKA 2QMJA 5F1IB 5I75C 2DMGA 3L7FB 4AYID 1ACXA 5IBUB 1FFTB 3GSRB 1HIMH 5B7MA 4UF7C 4DCKA 1SBBA 4WUUD 2FJHA 5FKPA 1X9LA 3PPEA 1LXMA 5TFSL 3BOVA 4Z7OE 3OAZH 5C6WH 3ZKXC 5KSAA 1U8QB 2VWEC 4PJFF 5AW4B 3FB8B 4GQZA 5DRZA 3UACA 3HI5L 2NY3D 2Q5UA 4L2YA 5E0QA 5C0NC 2WWKO 4JG1H 3NQIA 2WSCJ 1AGEA 3WELA 3KPEA 1XIWD 2NX5A 4JFXB 3AG1B 1J9RA 3VFTA 4F33A 4HEPA 2YKPA 1DEDA 1FVDA 4RWHA 3B5NA 2HT3D 3O6QA 4XNUH 5T3ZE 1E7VA 1KB9I 2EDJA 2VQ4A 2W1NA 3OXSA 3NQKA 2Q2LA 5EU6B 3H56A 2NW2B 1OXYA 3KAAA 1AR1B 5C0CB 1HHGA 4MMYA 4LMQE 4PJGB 4FF9A 2W59A 4RX4A 1B2YA 3UIYA 4GAAA 5JYMA 5ISZD 2ICEC 2HG5A 5IBTH 1XR8B 2P5EB 4NKDA 3DO4A 5C6TL 2BSCA 1ZK5A 4G9DB 1QVFO 2GTWB 1R5SA 1EJOH 2WMPB 5IMLB 4M8VA 5TF0A 1L0LJ 1XXDC 2BOLA 4H0IA 5HHXL 4Z7IA 1MCPH 3DJ9A 4FXKC 3BE1H 3U7YL 4Z7AA 1E6JL 3HAEA 1I1AA 3V7AG 2OI9B 3GBLA 3BCCJ 3CZUB 2ZOLB 4OJEH 3T0ED 2BCCE 4PJDB 2RQEA 3Q01A 3DLQR 3FFCB 4PB9H 4Z77B 2XG4A 2EXWD 1JUFA 5DZAA 5E00B 3ZYIA 2D03L 2JFCA 4N87A 2BEQD 5HYEA 1Y0LB 2G5UA 1XGPB 2CIKB 2GUOA 5KBKA 1MFEH 3BSZL 4MZ3A 5C9JA 4KHXL 2E42A 4WI2A 1CLZL 4BSVB 3Q06A 1FLRH 2H6UA 4TUUA 3W81A 2HFED 2ZCKH 2G8YA 5HBBA 2RBLA 2FSDA 1AQKH 4NLHA 1SF3A 4EN3D 3M1OA 1J1XL 4G80A 4D0CA 3KM2A 4IBQA 3BESR 4L8DB 4AH2A 2IBZD 4BV1A 3P1VA 5KYXB 2WANA 4ZAKA 4HKJB 4PJEE 2HTKC 1HDMB 1UJ3B 3JVGC 4PCSA 1NGQL 1PNDA 2BVOA 4R0LB 2IG2H 1SJVA 1A7QH 4AVJA 4AC2A 3QG7H 3LZRA 3LZQA 3Q3DA 1HZHH 3CVDA 4GAFB 2VLRB 4HOXA 2WUCH 1XL4A 3CBJB 5D70H 1AQDA 4UANA 1DJZA 1YNTA 2R0ZH 2JLPA 4PJ0E 1I1FB 2V9RA 3EYOB 1AAJA 1ZLDA 2I26N 2YRZA 4LVOC 4XNQA 1QACA 5AWNL 2FYNB 1RZGA 1YEFL 4BUQA 1USZA 1HK6A 2Z93B 2DIEA 1WMKA 3K6SB 2K8QA 3MRGB 2VDRL 1UATA 3S35H 3OAUH 3LQAC 5IFAL 1I1RA 4JO8A 2A45G 2VDQL 4PWJA 5B3JE 3M9BA 1MFBH 3L13A 4XP4L 1NGWA 2CU9A 3TBBA 5KBPA 1I7TA 5FUZL 5CGYC 1JM0A 3CG8A 2E9BA 3ZKND 3RWDB 2WSFJ 1FDLH 3FH8A 3M86A 1OY3B 4LQFL 3SBRA 3RE0A 3SQRA 1AZRA 3CVIH 5DJTB 2NDFA 4U4BA 2WO2B 3Q6FA 2EDMA 3KE0A 1EH9A 1IM9D 5HGAB 3AQXA 5A7BA 1FZCC 3AEBC 2R0KH 1KF9B 1FFOB 2M5AA 3PHLA 5HJDA 5J11B 5TD4A 5EEXA 4PJXF 2BMKA 1Q90D 1TJHL 1FVEA 1FYTE 1NANH 2YARA 2BVPA 4IHBA 2F2HA 5I5IA 1YUKB 5K33A 3GJEB 2OYKA 4IRJB 2OZNA 1OAJA 3AC0A 3ARBC 4G6FD 1FJKA 1RMFH 3CFDB 4JR9H 1F3DH 1CDBA 3U4KA 5FIEA 2E74C 3UEQA 3ASWA 3WIHH 3TNUB 1H5BB 2F7RA 2QGBA 3HZMA 4DFIA 3ZKSD 1VADA 4CA4A 5DUBA 4UQBA 2A74B 4NAQA 1LWUA 2FBWC 2Y6TE 1JWMA 5ANMB 2BVTA 5I1HL 2VXQL 1JPGB 3WJJA 4GT7A 5T1LB 2P8PB 1KYOI 1T2KD 1B4JH 2HT2C 3L4TA 1KTMA 5B21A 4E0RA 3TIDA 4XNMB 4HH9B 2RIKA 5F7EH 3T0BA 3ULVC 3MLYL 1MRFH 2A2QT 3DX9A 3AEGC 4AM0A 4Z7WF 5D7IE 3U4BH 4OGQC 2E5EA 2EE0A 5C09D 3ILQD 1U30A 5F1SA 4YIQB 4ZX4A 3HNTH 2LHAA 3FU7B 2HRGA 1I3RB 1T4WA 1WV7T 2GYSA 2RMNA 1S7QA 1HH6A 2QVFB 5BVZA 3NESA 3GFUA 4FLOA 3WFCL 1DBAH 4LLQA 1E28A 2WOYA 3V4VB 1KNOB 2BOBB 2H32H 4NFCA 5LJYH 2UZIL 3F00A 3KPRE 1ED3B 1OWAA 3UP1A 2DS4A 3D18A 1U92A 4ZMLA 3L3IA 3EUUA 2E75D 2YXQB 1F6AA 4PRPE 5AAMA 4JDVB 4L8SA 1JHLH 3EFFB 2X5PA 3FHQA 4H8HA 4HJ0D 2YSSA 4RGND 3MMEA 3H9ZA 5D6DC 5EOTA 3HCVB 1SQQE 3SDDA 4RIRB 1KFMA 2FLMA 2AVFA 2VUKA 5BO1L 4F8PA 1N2RA 3HE5A 1BPVA 2CE6A 3EDDA 2VLKD 2GG1A 4FA7B 1EA9C 4YUEH 3TIEA 2WNGA 1YJWP 3Q8EA 3OTTA 5FWRA 2EH7L 2A9NH 3KZIH 3ZO9A 3IEAA 1CDYA 1IU1A 5BQDA 2ZCLH 2CGZA 1NBVH 3EJZC 5B39B 2Z4QB 4S1QH 3PH0A 1JNHA 2X4UA 3VMYA 4BK8A 4PD4H 4RA3A 1BVLB 4PSRA 4ATWA 4Z0BH 1G1KA 3BGAA 1SHWA 3MRBA 5D1QC 2JKIS 2Q86B 4N90D 4PR5B 4HHAB 5FGBC 2FAUA 3P0GB 2NPSC 4ZFGH 4ES9A 1YUHA 2ZWLT 4NN7C 3H1HE 4YDZA 3TVMB 4YAQA 3A7OA 2GJPA 3C6SB 3MOQA 4LU5H 4PRID 3EBIA 3P9MA 4GBXD 4XAKE 3WENA 2Z1PA 4M5ZH 4RISL 3S4SG 1U41A 4Q0XL 3RL1A 4LKCA 1A4AA 4GLRI 4XPAH 4X6CB 4LSSH 4FXKB 3KVQA 4XHJD 2DQIL 4NQEB 3SY6A 1NKOA 2R29A 4ZG1A 2NQ3A 2XIIA 1ACZA 4MLSA 1V7MH 2D7PA 4CDGC 3DIFB 4JFQB 3QQ3A 4PBWD 4I2XE 1XZ0A 5JQ6L 2X9YA 4NSKA 4L3FA 1G7IA 4FS0A 5J7CC 4ASWA 2ZG2A 3PJSK 4KUZH 4HUVB 1FWXA 3N0AA 5E1AA 5M1BA 2J8HA 4M5TA 3M06A 4F3FB 1IKNC 3B7RL 3SGEH 3MSPA 1MWAA 4WKZB 1QBLL 4PI0A 5APWA 1KIUB 3CFEA 4HJJH 3SCMA 4MDJB 5JOFA 3PJNA 5DFWH 2LR4A 1L7TH 2WKGA 3FOMB 5DJ2A 2CHXA 4GP4B 3IFLL 4Z7NF 2E27H 3PTZA 1YTZT 4FI8A 1ZLUK 2A7BA 1LP9E 3A21A 3EHBC 4F80A 4PRNA 1IJDB 1GAFH 1BE3J 1I8IB 4PJ5D 4IIZA 3ZGHA 5I6LA 1VZGA 2AFNA 3PY9A 4H0LD 3T97B 1KPUB 4EIZC 5C0FA 5IG7A 1DO6A 5H35B 2FT6A 3JUYA 1NTMJ 1YEJH 4Y89A 4QLRA 4PJ8B 2ADGB 1IEAB 1KYAA 3SWFA 3FU5A 4KI5C 1NFDF 1UM4L 2BIHA 1K72A 4X4XB 4XP9L 3BATA 3RK2D 2ZOTA 1JTHA 3GMNB 4XBGB 2BHYA 4OGXL 1HNGA 2ZP9A 3MYJA 3U2JA 3ILPA 4AX3A 4Z78A 3CFKB 5AAWC 3VU1A 1X5JA 4H1LB 2Y0DA 3QRGL 3OMAB 3QZOA 3MJ9L 4U2YA 3IDMA 1XH0A 3M45A 1SQPK 4KO5A 2NUPB 1UH2A 1G9HA 3PE9A 1NVOA 3M07A 5MHSD 4UIMA 5KVDL 2VLJE 4R7VA 4N0YL 1XGQB 3UZQA 1TEFA 3B37A 4TVSa 3KGRA 4XVJH 3WFEL 1TEYA 4U1LA 1KPVB 2HN7A 4PJ7A 5A40E 1ZR4A 1U3HC 3X17A 1WBXB 3PU7A 4BQCA 1XH3A 4AVKA 4LAQL 3PWVB 1AH1A 4OLXL 3II3A 5IMKB 1M8OB 2ERJC 5EBLB 1FZCB 1X5HA 3H53A 1BQKA 3E6FB 1TENA 5C6TH 3RVXC 1AD0A 2I8DA 1K85A 3APFA 3E9TA 4UM9A 5DA0B 1YNKL 1UKSA 4WWKC 2OTLP 3IDGB 1P7QA 3KPNB 1HX0A 2QKIC 1MG2C 2RD0A 2QT6A 3U7YH 4OCWL 3TGUG 3ARBB 1E6JH 4O2FB 2NZ9C 3H2PA 4XO3A 4MJID 1EXUA 2ZAEB 2BX5A 1QX1A 1A1OA 1FV1A 4GNKB 1BG1A 1VQ5P 3MP7B 3MV9B 4NERA 1NLBL 2HVKA 3H3BC 2YEZA 4ODXB 1M90Q 2IANA 3TBWA 1KILC 1CDIA 2A6JB 2Q20A 2D03H 5JA9A 4WW2F 4JM0A 1O9WA 1MJJB 1VENA 3KPRA 2PYEA 2YD4A 3BSZH 1MEXL 2X9ZA 4KHXH 1GGCL 4FTDA 3QWNA 4KKBD 1CLZH 1AZBA 1W2EA 5L4IA 4NX0A 3LS5L 4RDQF 4UU9B 4HIXL 2X1PA 4IGBA 1UD2A 2IQAB 2G3AA 4Q4EA 1OQOA 5HYJE 4XXWC 3EBGA 2UXFA 3SFDC 2R1YA 2FIKA 2WPSA 3ZMNA 1Y18B 2O3JA 1C8PA 2WJ7A 3B3BA 4PCYA 3NK3A 4YHKL 1IBHA 2CLZB 3KZIE 1L4AC 3B2UC 4WFFD 2DDQL 1NGQH 4PJ9D 3V6OA 1XEDA 4BQ9A 3S8GB 4WI6A 2DBLL 3OJAB 2FX8L 3BW9A 1U6AL 4P5TD 1X5YA 4NQCA 3W9DB 5DHXB 3M91A 4KFMA 5JW4R 4WY4A 2YGOA 3D2TA 4PD4E 2PCYA 2J5LC 3IR9A 4K7PX 3OPUA 2IDQA 4QCIB 2D3JA 4EI2A 1QEWB 1JV2A 2APBA 3BVNB 3O6FC 3D3VE 5AWNH 1YEFH 1MIEL 3F2LA 1EZSA 3CWBJ 1IVTA 1VIWA 4M02A 2HRLA 2VDRH 5E2JA 4PJAF 3WKML 4H26A 4QJ5B 5IFAH 2E9JA 1LLAA 1AZUA 1R5VA 2VDQH 1J0ZA 2GC4C 1NDMA 4XP4H 4OV5B 3LHPH 1WFNA 4QXGL 5FUZH 5KJRL 1P2CA 1U3YA 2CKBL 4YZFE 2L0DA 4RVBA 5ICXB 5IWLA 4A55A 4LQFH 5D1QB 1JGUL 3IJYB 3MJ6A 5FXCH 5KYUA 4R9HA 3GDCA 5SWZA 3S5LG 3SKOB 5FWQA 3TJEL 3ESNA 4G8AC 5IOPA 1WRGA 2NPSB 4QHMB 4I2XA 2R7EA 4Q9CA 3VGFA 3IFOA 2BIMA 5D7LE 3JTSA 5GJSL 1SVCP 2ZYDA 1TJGL 4PTTA 1N3NB 4IBLT 2P24B 4P2CG 3OKEB 3BYTA 2YMXL 4S10A 1NLDL 4HQQL 1BWMA 1GXEA 4S1RL 1PP9G 1QUNB 1ZLVH 1OTSC 1TJHH 3ISWA 2QQLH 1TVBB 3NZUA 4UQ3A 3U6RA 4NC1E 2YQBA 4K15A 4XZ4A 1HH0A 1CI5A 2ZAHA 2GI0A 3O3EA 3ZRSA 1JVKA 3OQRA 1LP9A 3HE7A 5IMMA 1IC0A 1OSEA 3LPOA 1MELA 4ODHH 1CXFA 4QRRB 3V0DA 4AW4A 2DICA 1CI3M 2FZ3B 3QK0A 1Z1WA 4C7NA 4NPJA 4A38A 2GJRA 3L36A 3BRGC 4FXTA 1W72B 1E30A 3KLAB 4PAZA 5I1HH 2VXQH 3L4VA 5I1KL 1EANA 3FQNA 4JMXA 4J3OC 3UGXA 2GSGA 3GUFA 4JDEA 1I8MB 2WSEJ 4N8CL 4WTQA 4L5FL 4W4OC 5BZDA 5ESVA 3R7QA 2OSWA 3EDJA 3MLYH 4OM1L 4YJZL 4X5XB 3PWLB 3ARSA 3EHBB 5KKZC 1JXDA 3ORJA 2XVLA 1AVAA 1D5BA 3P9LB 2A9BA 4L3EE 3L45A 1ET7A 1WO2A 3Q2NA 2G3ZA 3SD2A 5KN5A 3UYPB 3WFCH 4ZMQA 4E9WA 1ZA3A 4UUJA 2WOBA 3RP1A 1SOQA 3KH3A 2HG0A 2UZIH 3DIDA 3L5JA 1ZEAL 3L48A 3U30C 5JLZB 1P84H 2CJUL 4S0TD 3O9WB 2XV3A 1S78D 4OZGF 1S8DA 3L9RB 1MVYA 3WKNA 5E6SB 2G2RA 2Y7NA 3M1BB 4MX7A 2JWAA 2ED6A 5KVEL 2JQMA 3L4YA 3WG7B 1ZHNA 1EJ8A 1LTTC 2E56A 1X5MA 5B5EE 5BO1H 3VYOA 1MCKA 3W5MA 2J58A 2BSED 3L1OL 3ARFC 1FOSE 2HAZA 1URQD 4IKKA 4J6IA 3TF7C 2EH7H 3THMH 4PRBB 3QUZA 1SDDA 3VRLE 4YLQT 2W27A 4R3SB 5GS0C 3JZYA 4PW3A 2F58L 2SODB 3N42F 3QJSB 2W0KA 3ZE2F 3HS0A 4HGKC 4YDVA 4AC4A 4WFGE 4WFHD 3V6ZB 1SQBG 3BZ5A 3VWKC 5T5FL 3AUVA 3RWHA 1PAMA 4ZX6A 1SJHA 1U3HB 4FFZL 3TT1L 2MQCA 2XYBA 1F8TH 4KY1L 4RMRA 1FNGB 3JQOB 4KKAD 3REVB 3TFKC 2ERJB 5I9QB 3DHJA 3EDKA 3Q2CA 3DX6A 4MHHI 1DSFL 2E6PA 7PAZA 2ZUVA 4IBWA 4RISH 1M1XA 1FH2A 1CE1L 3IN2A 1VQ6P 2H32A 2JI3A 3NA9L 2L7JA 1WDAA 3DTXA 5EIQA 2WD0A 1VQPP 2DQIH 2EO9A 4GW1B 2CNZA 5LLIC 1BQHA 1DQML 4JPSA 3VXQB 5BCAA 1DZBA 1JPSL 4UMGA 2M8RA 1TVHB 3L3GB 5JQ6H 4W9DC 3C60C 5LBGA 5HYJA 2WBKA 3EBAA 3LPPA 2ITDB 4X5WB 2O5NA 2YAHA 1BYOA 4AQ1A 2H1LM 4X4ZA 4YBQD 4Z7OF 1ZMEC 1MF2L 1A1MA 4TQ8A 3GHEL 1FRGL 1Q4NX 3WUVA 1QBLH 3D08A 1HXMA 1G7LA 1L0XA 1K2DA 1PZ5B 2E4FA 2E6JA 2P47B 3M88A 3QDMA 1CCZA 4WGKA 4ADJA 3ABVC 2J88L 4X6BA 2ICEA 5IR1B 3W9EB 4MXWL 4GQRA 3C9IA 2CO1A 4XN7A 1CSBA 1AS6A 3C8KB 3RNKA 2R2BB 2K70A 4X4KA 5APTA 3GBML 2MCAA 5MEOB 1OF0A 3DRTA 2WO4A 4MRBA 3UTZA 2BVQA 4P04A 2OW6A 4JE4B 2ADYA 3FUHA 4AYSA 5EA0L 1JRHI 1A9BA 1BREA 3OB0H 5FOJA 1KJMA 4I1PA 1NPUA 1L4AB 1ANUA 5FYJU 4ZI8A 1QSED 2GHZA 4D6TG 1CTNA 3Q8CA 5EC1A 2MOGA 4ODBD 1IQWL 1JP5A 3OMNB 3QWOB 4TLSA 3S4SB 1KB9D 4IS6A 5FM5O 3UOAB 1TSRA 1UM4H 3WOVA 4ZO6A 4XP9H 1MZYA 3I9AA 3F04A 2PP8A 2UX6A 4LSTH 3O6FB 4M3KB 4OGXH 1JD7A 2I07B 1T1ZB 4KRPB 3H7BB 1OCWH 4G9FB 1XF2A 1BD2D 3QRGH 5E8EB 1M7IA 3MJ7A 5A6LA 3B2VL 3KDMB 1AO7D 2ZICA 3FQ4A 3MJ9H 3JV4B 4GO6B 4R5XA 4JFEB 5E5MA 4M93C 2GEQA 2J5WA 2ED9A 3AT9A 2OX5A 1EAQA 2YUWA 3MV8A 5H4ZA 5KVDH 1GGTA 1CFNA 4GRMA 4F1SA 2EIDA 4HGMA 2I69A 3OR6B 1RULL 4N0YH 4XWGL 5IVOA 3WFEH 3QNZA 1OALA 1XHHA 3QPXL 2VUOA 2Q6WB 2F1EA 3L3OC 1HWGB 3TJPA 2E8ZA 4J28A 1B4RA 4OLXH 3QDGA 3DXAD 2PCPA 3ATFA 1AOHA 1H0TA 3KR3L 5EZOH 2PTVA 4PG9B 5HHMB 4LCCC 1E5WA 2PYFB 3IB4A 1GL2C 5DQJB 1YNKH 3MUY1 4ESKA 4CGUB 1L3WA 4OF8A 4N0CC 4XH2B 4YGVA 2WSDA 4GUPB 4OCWH 2K0RA 1J1OL 4PJEF 3KPLB 2H0JA 4WK2B 3OKOB 2JKTM 5D7JC 3APCA 2J1WA 2H4EA 1R3JA 3L9EA 4LHUG 1HBWA 1SP4A 1NLBH 1D5ZB 3II2A 1FGVL 4CAGA 3L72J 3STBA 2IPUG 3FQ1A 5F1NA 1IGJB 1XQ4A 5E1GA 3LQZA 5K9OB 3D6GA 3FTVA 4NO3A 5HI3C 3AT0A 4WI4A 3VNYA 2GKIA 3JWNH 3VD5A 3VWJC 4BK5A 1MEXH 2QQKL 2V2WA 3F7VA 1GGCH 1P84E 1DQLL 3C5ZD 1NC2D 3AQDA 3LS5H 4QOKD 5E9DE 3T6QC 4HIXH 3CX5K 2NY5C 5B3JF 1UM6L 3H0TA 2X6VA 3QZWG 3RHWK 2GUSA 3V5BA 4I18B 4MSWB 3K4DA 3ETTA 1PPJD 5HD8C 1KBGL 2NY0D 4JHZA 1S7WB 1ZS8A 2P80D 4KGJA 1Q72L 3O45A 1W16A 4YHKH 2IDCA 2X4NA 5HJGA 1RZIB 2BZ7A 2DDQH 2R51A 4FKKA 3Q9QA 4FQJL 4UNVA 2ZXXA 3CCLP 3QDJE 4F24A 1AQTA 1U6AH 2Z92A 3B1UA 3H9SB 4LPVA 4ZUUA 1DLHA 3PDOA 3FT3A 3EFFK 2MHAB 4AYCA 3K4AA 2D3NA 5F9JB 1E4WL 4WJKB 4L29A 4XMPH 1SS1A 1OV8A 1KCKA 1MIEH 2VIRA 4BZ1H 1KC5L 1OWWA 2E7BA 5DS8B 1E3FA 3SDAC 3VFPB 1UXMA 2D31A 4G6KL 5KSBB 4P23D 5IW3A 2VERA 3WKMH 2V17L 2IEPA 4F7PA 4HIJA 3OL2A 1A25A 3RNQB 2WK2A 3W0WB 5C08E 1N8ZB 2CO2A 1E4KC 1MNUL 3CH1B 2AJUH 2X4TA 1M9WA 2Z7UA 3HNSL 4S2SB 5EH1A 4QXGH 4LCUB 1LILA 3BSZA 2BLFA 5KJRH 4KHXA 3QEHA 2Y3AA 1BF5A 3G6JA 1IV8A 2VB5A 4K5MA 2WTRB 1JGUH 3CPLB 2VW4A 3HUJE 2HT4D 4OIBA 4OLUL 3TJEH 4CVUA 1WGVA 4PYHA 4RESB 2FQFA 4FCAA 4NNXA 2HKHH 3IETA 1UZ8B 1UHVA 2CO4A 3AREA 4UBDC 3PRZA 5AUMA 1TJGH 4AUJA 2G30A 5D7IF 4OQTL 1NLDH 4K9EH 4HQQH 2X2IA 3U59A 2VITA 4LP5A 1AIFB 1KYOD 5CINL 2HKFL 3ABZA 3QJVB 2CWRA 1C5DA 2IOIA 4KMTL 4WSKA 1BQSA 3RWEB 1KMGA 1VF5C 1H9DA 2YOCA 4WKXA 2MCPL 4WAFA 4BRYB 1X44A 4BINA 3G7TA 2OQJB 5I18L 3O8XB 1SQVG 1UWXK 1RPQA 5ECGA 4DO5A 2EEBA 1L9SA 1Z32X 5IW6A 4K7FB 4PP1C 3QQ4A 2ZUXA 1C12B 4AM0Q 3JUZA 1TYEB 5T1MA 3OKLB 2L7UA 4XMVA 2YGVA 1U33A 3V5HA 3PL6B 2D0GA 4LLVB 5I1KH 3WO4C 5LGJB 3BH9B 5FGBA 4L4VA 3ARDC 3V2AR 3EOAB 3BZEA 4Y8DC 4N8CH 3DV4A 4FL4C 4L5FH 3W39B 2YQ3A 4M5YL 3SIKA 3H1KE 1NJ9A 4BKLA 3VXRB 2VUYA 1WIOA 4OM1H 4QMAA 4I2LC 4CMHC 3ULSB 4NT6A 2MQGA 4FG0A 5H37G 3QNXA 5EUKB 3MGOB 2CK0L 1FDMA 2XA8L 3S5LB 5FF6B 3UTPD 5FM4A 4BFIB 3WJMA 4F7TB 4FYSA 1SQXJ 2ZXQA 3C2SA 4OFDA 5GGVH 1BZOA 5TPWL 3VFRB 3GS7A 3GSVA 4EZKA 2XN9E 2DLFL 1ZEAH 4POYA 1B3JA 4I4WB 2CJUH 3KXFB 5KVDE 3JT2A 4FYRA 2FH8A 2IBZG 4C46A 1T6AA 1J9QA 3VAEA 1QKZL 5KVEH 1IKNA 2Z8WC 3FCBA 4MXQD 5F0PB 4J6RL 3D87B 4BH8A 1UD6A 4L1LA 4LO9A 5AKVA 3SQOL 4D8OA 3VD4A 1Z56A 3OKYA 3QUYB 3VXPA 1RJCA 2QEXP 4K7PY 3L1OH 3BGMA 4JPQA 4ZD3H 2WXQA 1AVOA 1BJMA 2DTML 3N43F 2YD9A 4JFDD 2QSIA 2HODA 1PS3A 4M93B 5KTEL 1E8YA 2XYCA 1A22B 1AS7A 2VXQA 5JXED 3EDEA 5I8KL 5KJ4A 3COOA 4P46A 1H89A 4P2QD 3HPJA 1K4CB 1KGCE 4Y1TA 1TZHB 2YD7A 4CL7A 1YBKA 5D5MB 1RIVL 1P53A 5T5FH 5I1GL 3NJXA 1FU1A 2FKWB 2V2TA 3KL5A 4FFZH 4C58B 4W6XB 1NEPA 2EIKB 2G0LA 4XO4A 1OSZA 5E24E 2OXGB 1FZOA 4JPWL 4NJAL 5FGSA 2W0PA 1WAAA 2MNWA 5DR5L 1H6FA 1BFOB 1NSNL 5IEKA 5E79E 4ZO7A 4JRYD 1BXXA 1NKRA 4MB1A 2GT9B 2CCWA 1DSFH 4LCCB 5DHEA 3L71G 5K39A 2Y5TB 3L70D 1GL2B 3QH3A 3SKNA 1JV5B 3EJYD 5AAWA 1S7SB 3NA9H 4ZMTA 1JWUB 3GK8L 5DDHB 1TQCC 4HUXA 3ARGD 2Q7YA 2IF7A 3FN9A 4U3SB 4W6YB 2LR2A 1UT1A 2NSMA 4IHOB 5E9DA 4P2RA 1QFOA 1WG3A 4EOWL 4KPHL 3BX7C 1Q9KB 2EC9T 2G75A 1DO5A 1DQMH 1QUPA 1GA2A 1JPSH 4AENA 3HBGA 2Q1EA 2VL5B 3RIAK 1OVVA 1OCOB 3NFNB 4LL4A 2C9QA 2W07B 4JY4A 1IC7L 5I5JA 3LMJL 3BHBB 3FSZA 3H25A 1BMZA 2Z1KA 3NCXA 2VABA 3PV6A 4KQ3L 4GKSA 3RUGB 1IAIL 4ALAC 1MF2H 2HR3A 1U3JA 2NY6D 1FRGH 3GHEH 3RVVC 3FQRB 3G3LA 2OCJA 3ZDXE 2OXHB 2WLIB 4HBCL 4APQA 4ZW3A 1RU9L 4G8GE 3QDJA 2R9HD 3DOHA 1KTLA 4MXWH 1TNMA 2FHBA 3KJ4C 4X50A 3UAJA 4A04A 3K6OA 2J73A 4F93B 1X7QB 2NY3C 4IOIB 4PREB 5ICZB 3GBMH 1R17A 1KTDA 3FTGA 1IIKA 1HXYA 4FQHA 3UEZA 1XIWC 4KO6A 5CMAB 5DC9B 2QKIA 1CS6A 2ZOOA 2BP8A 1F0LA 1AJYA 5ES4B 5EA0H 3BVVA 3IJ9A 4ATTA 4G6ML 1OGAD 3TX4A 1IO4C 3SJVE 4B9YA 4C56D 3HEIB 4LNRA 3ECBA 4GT1A 3DO3A 3FN3A 1KILA 1BIIA 4IU2A 2HVJA 4XXCC 1U8KB 1U4FA 4Q2ZA 4PGBB 2AXGB 3CFCL 3LKNA 2BNUB 3HUJA 5LB1A 3S97C 1V8HA 5HHOB 1O9ZA 2Q0ZX 4XA4A 2W9DL 2OLDA 5MENE 4G42B 5A2BA 2GUVA 1NFKA 2CHDA 1AZZC 1EJ6A 1L0LD 3FTZA 3I6KB 1MH5B 4JFYB 3SWYA 4XXWA 2B88A 2K78A 3BFWA 3QAZB 3DI3B 1RULH 3BCCD 3L73E 4OJCA 5I1JL 3S3CB 3T0EC 4K35A 1TJIL 3QPXH 1XMEB 4JG0H 5FYJE 2JR8A 2GI7A 1M7DB 4FTVD 2EXWC 2OSLB 2M0BA 2Z9TA 4B0MM 4FULA 2MKLC 5FYKU 2Y36H 3VJ6A 1CLYL 2IPKB 4PJBB 4CDHA 4JJ5B 4LCWB 3KR3H 3ABKB 3AE6C 3PP3K 3F5WA 4MMZA 4QHLA 3OV6A 4U1IB 3VSTA 5BZWA 2JV6A 2W65A 5IHUL 4LIQE 5D1XE 3TCTA 3EXJA 4L74A 2C4FU 3MGTA 1GOFA 5G5DA 4L5FE 4QTIL 1INDL 4EN3C 1T0MA 3FQXB 3OKKB 4RGOH 2L5GB 3ZDYE 5C0GA 5JQIB 4LLUB 1YPZE 3WN6A 3ZR5A 4C4UA 1G9ML 4XGZA 4GRWB 1JCDA 3WFDH 4U1MB 4AQOA 1FGVH 1O6VA 4CC4C 2CM6A 4ZUSB 3EIFA 3P0VH 3CDZA 1E4XI 2BH0A 3GG2A 5TK4A 4F7MA 3MJ9A 2BIOA 4NKMA 3SN6N 1SLXA 1DTUA 3II6A 2WCGA 5IHHA 1MLCA 3QISA 2OTKE 3ARDB 2X6BA 3JVFC 1LE5B 4FL4B 3LNHA 2QQKH 1S9YB 2MRYA 4OW6A 1DQLH 2KSEA 1MCBA 5F7NC 1FIGL 4PJIE 3JYBA 4XX1E 2BNRE 4CMHB 4D0BA 4E41D 3NAAL 1UM6H 1N59A 2KERA 3BMVA 1NMAL 3MFGB 2A83B 4MJ6B 1UM5L 3D06A 2FQDA 4YZFF 1KBGH 1B90A 2YWYA 1G0XA 1Q72H 4QRSA 1HYSD 3BVWA 5KLVJ 4WV1A 1AD9A 3IBOA 5AL8A 4MQSB 3BRTB 3B8SA 4XX5A 4HU2A 4FQJH 3ZKNC 3CCQP 4KUCD 1NEZG 4ICWA 4OJYA 4NO2B 1RH8A 4WWID 3EGSB 1MUJA 4OD1L 1ZHLA 2H8PA 5DMJB 3S48A 2YPLD 2RQ8A 1MZZA 2OMUB 2PW1B 4Y7MA 4BYHA 4ZMAT 1YECL 1BBJB 1E4WH 1M2VB 2NSQA 3DECA 1IM3B 4DPCX 1TVDA 3G3ZA 3H1HJ 1RHFA 1YDPA 4ODSH 2R2HA 1MCWW 4K2UL 4WHTA 1XZWA 3CHPA 3EGDB 1KC5H 4BRVA 1HNYA 2QVTA 3WTTA 5DJ0B 2FEEL 2ZOWA 4LHUB 4I7ZC 3HPLB 4RAVA 1O6TA 2V17H 1XB8A 3CQPA 4HWUA 3LV3B 2BNQB 1JGEB 5DK2B 3TEXA 1WA2X 3NN8B 1MNUH 1IFDA 1ZAGA 1NDGB 2DQ6A 1N0LB 3NFPA 4LOUD 5DJAA 3SE4C 1Q0YL 4U1JA 4J8RA 2X1WL 4PJFB 2EDFA 3DGCR 1AE6L 1CXLA 4OLUH 5D7HA 5GSVA 2H7HA 5D4IA 2AXWA 5JO5A 5CSZB 1RK1B 4HFUL 3U6XS 3V8CA 4APXA 4M8UA 2VZ3A 3G5VB 3BN9D 3QZWB 3BD4A 4QRPE 4XPHL 5DVMA 5TH2B 1T2KC 4RDQG 5DZLA 2Y1AA 2ZX8A 1UZ6E 3SDYH 4OQTH 4G82A 5KVGE 4GG8A 3DX8B 5CINH 4LLMA 2YGPA 1N4XL 3CZFB 1MRDL 3UBFA 1LGHB 4KMTH 2ILLA 5KS9F 3V2NA 3ARFA 4HWBL 5GGSA 2EUVA 1UXLA 1W91A 3GIVA 2MCPH 4M3HA 3CFIC 5I18H 1GOGA 2X44D 4M4RB 3IAGC 4FFWD 5L2KD 3BUYA 3T6ZA 1KEGL 1UG9A 1T21A 3HG1B 4AUWA 5J13B 5L4JA 3O4OB 2GAZA 3VU2A 4MNGE 4V1DD 1BFSA 1SN2A 3VWKA 2H7WA 3TN0C 3DROA 3NJIA 4FQQB 3MRIB 2E75C 1JGLL 5IHLB 4W9GC 4NDMB 3BUIA 4BWTA 4RGNC 5FGRA 1AY1L 1FOSF 2XKNA 3DMMC 3PIQB 4M5YH 4DP5X 2W81C 1PD1A 5L4FA 2CKBA 3VYPA 3VRLF 3BPCB 2NY3B 2WZ6A 2AQ2A 3ECUA 1TEGA 4R8WL 5SWSA 3UTQB 2IC2A 3ZPDA 2BW5A 1XIWB 4MBRA 2N7AA 3ZY7A 2CK0H 4X5LA 1EHKB 3BDXA 1CYWA 3CPUA 4OJFL 1VFAA 1M4KA 3NRFA 3HUSA 3GD1C 5SX5K 2G9HB 2DLFH 4MAUL 2Y9RT 2C1OA 3C60A 5DVOA 3UX9B 3D39E 1DANT 4JRXA 2JKXA 4LMQI 1XL6A 5IB5B 1QKZH 4POZC 3WNJA 1PKQB 5CJ0A 2VN6A 2XXCB 4J6RH 1MHCA 3QQDB 4NUGL 1KG0A 1QO3B 3JTTA 3SQOH 1SQPE 2PR4L 4LSUH 4GBXC 1JN6A 5E51A 5G4OA 2DTMH 2OYLA 3L3HA 4UDUB 4CN1A 1T1WB 5BOZG 2KNCB 1MJUH 3TO4D 5KTEH 2IV8A 2HCZX 3HS9A 1CGWA 2J57A 1W8OA 3RL0D 4UT9L 4PHZA 4XHJC 3SDCD 3BUPA 3FN0L 4LPUA 5I74C 5I8KH 3N44B 3LIZL 3FSVA 3LEYL 2CPSA 1GGYA 4FLHA 4F9PC 3AEEC 3VDBA 1RIVH 5I1GH 1KT2A 1OOWA 4KX9A 5GRVK 3U0PB 1COBA 1XT5A 3N1MC 4JPWH 4NIYE 2YMTA 3OJDB 2V2XA 4NJAH 5DR5H 3L5IA 1T3FB 3BZFB 3DJZA 4LL9A 3CCMP 5C71A 4AJYV 5KSUA 3MLSH 1WD8A 3SPIA 4XRCA 1S2EA 1F1AA 2WKOA 5HY9B 3LEXB 1FL3B 2IADA 3SYAA 3TC9A 4U1KB 5TISH 3GK8H 2A0LD 1X3DA 2KZKA 4XVTL 3FQYA 1S9XB 2JIXD 4ONHB 5BU8B 2QZ5A 4PJIA 1YEDB 4EOWH 4XNYL 1BE3D 1E8XA 2LAAA 3VTMA 1I8LC 2D9CA 1ZT7B 4OF7A 4KZCA 1WA0X 1WWAX 2NNCA 1ES0A 3EYFA 3FO2A 3CWGA 1NTMD 1ZVSB 1WWBX 3LMJH 5ETUB 3MRDB 4KQ3H 2VRAA 3HI6H 1IAIH 3L3OA 4LRIA 2E7MA 3QIBD 2DYRB 1WH0A 4HBCH 1AI1L 4PD4J 4J3XA 2AJXL 4O2CB 3NOIA 4YQXH 2O1KA 2R2EB 1P4LB 2C9UA 4QHNA 2R8SL 1W0VB 2AJSL 1QA9A 3PGCA 4NHUB 5T5FA 4WB4A 1KJVB 4J1UA 5FK9B 1JNMA 1NGMB 5D2NB 4F2MB 4FFZA 1NL0L 1YEHH 2FATL 2H3XC 3WE1A 4IU3A 2EXTA 3QI9A 4HLZH 5APXA 2J1ZA 4JL2A 2WQRA 5CLZA 3QUXC 4G6MH 4PGJA 5I23A 1BHGA 1OP9A 4O02B 1CZ8L 5D7JA 4BIKA 2AS5M 1ZSDA 3MUGB 1YN6A 1SYVB 4U3FE 1MW3A 1BGYJ 1E9OA 4B60A 5IGXL 1LJ2A 4XAWH 5CCHA 4PEEA 2R4RH 4I3SH 4HG4K 1IM9B 4X4ME 1HSAA 1TTBA 2V7HB 3TF5A 1CJYA 1RZ8A 2LABA 1YJDH 3DPBB 2NW3A 4AIOA 3LKOB 3K71A 3CXDL 3LRSB 2NNAB 1EHLH 1U36A 4N0UE 4PP2A 3A2AA 4PV1B 4PRAB 2WC7A 1FG9C 1YMMD 3Q6GL 2QELA 1CXKA 5FR3A 4G6FB 4JLRB 5CEZL 1CDJA 4X0NA 3MRLB 5ACZA 5I1JH 2AANA 2F5AL 4RJTA 3A0HH 2H0PA 2P5WD 3NSFA 3IDIA 1AKPA 2CJTA 4KXDA 4MNQE 4F8QA 2QPSA 2GTZA 3VGDA 1KN7A 3KBFA 3WY2A 1BLNA 1CLYH 1IC2A 3RDTD 3MJ8B 3K2MC 1GYUA 1OQXA 3O41A 1LDPL 1BCCE 2HJKB 2PPFA 3OR7B 4KKBC 1KV4A 3VX1A 1JIBA 1GY2A 4EYYQ 1S7RA 4HWNA 5IHUH 5CEYB 4AGMA 2H9GA 3DBSA 4UZGA 3QZPA 3SDAA 4QTIH 5C09B 1INDH 4JN1L 1QRNA 4NRYA 4EKXA 1UENA 3PUUA 3TLRA 2CO7A 2IWKA 3BDBA 3F83A 3V9EA 4P2OA 2F8VA 1E4KA 1RK0A 3LN5A 3NK4A 4PGDA 1G9MH 1ILUA 2UYLA 5I8EB 1IEBB 4LGPB 1PL5A 4PJ9C 1NJIQ 1UOLA 4ZZFA 2AK4D 4JF7A 4P9HH 4RFEA 4P5TC 2E75B 1N6UA 2K3RA 2N59A 1LO4L 2AMUA 3RU8H 3DGGB 3D0LA 3QNYA 5FYKE 1G94A 2NOYA 2JKJA 1G7JA 1FIGH 3E8UL 3K74B 2ZOKA 4PTUA 5J9PB 2XQYA 3F64A 2EDDA 2O6PA 2VLKB 3NAAH 4ZMNA 5IIEB 5HVHB 1NMAH 3CWBD 4P8QA 2J8UB 1CI6B 2J20A 1FUNA 1N86A 3O6KL 1UM5H 3L4FA 8FABA 2K45A 1FL5A 3PFUA 4JE0A 4MJJA 4OCRL 5DLLA 5T3XL 4ELMF 1NINA 4LVHB 2OL3B 3VD0A 3QEQA 4GKLA 2BY0A 3JWDC 1FJPA 1KJ2A 4GO8A 4C47A 2ZYIA 3FRUB 1GYCA 4Z7NB 3B5GA 5E56A 3Q1EA 1U2HA 3H4FA 4OD1H 3I2CL 3M9QA 2DY2A 4MYWB 2A4ZA 4EXKA 2QSQA 4YHIB 3K2KA 1YECH 1Y1UA 3QS2A 5IW1B 4YS4A 5IV2A 1NAMB 3MNDA 3E38A 3HZYB 3FTWA 4W81A 5CO1A 1AZVA 4ZUVB 2F53A 4GBXB 4K2UH 1IL1B 2XY1A 4HF5L 4FXGB 4IJTA 3L3JB 3HTKA 3ZJAA 4D9QD 1ZLSL 1NM9A 4F7KA 3F3HA 3CC5B 3GJFB 4OLWL 1Q9OB 5EU6E 5AAPA 1X9VA 4OH2A 5C0CE 5TISE 2VGLM 4FERA 3Q2VA 5DUML 2G0KA 1GS8A 4FP8L 4PJGE 2O01N 4AL8L 1KOAA 1GHFL 2F15A 3GHGC 1AE6H 1XF5A 1D7CA 3MA7A 4CU6A 1T3UA 1G0DA 4XNBA 2P5EE 5FCUL 1N8RQ 5ID1B 5JOEA 4HFUH 3OAYK 4N6RB 3H1LE 1JWSB 3PABA 3PDGA 3TBYB 3MRRB 4LGRB 4R4LA 1KLFB 1ZIBA 2APWA 3I3EA 5EU4B 4XPHH 2K6WA 2QM7A 5CMZA 4PWKA 3C09B 2C9VA 2YBGA 2OBGA 1IAKA 1AQ5A 2O61B 1M3IA 1ZA6A 1NMCB 3EJTA 1X9UA 1NBZA 3NABL 1IK9A 2VRKA 4OQ1A 1VLXA 3OC8A 1VZIA 4HWBH 1ZW0A 1NEZB 4PJDE 1CDCA 2BIPA 1J8HA 3P40A 3RTQA 5GS2H 3FFCE 4H0LB 1ROCA 4XN4A 4DNLA 1UUSA 4Y19A 4JM4L 3SBQA 1FZGA 4GI8A 3FB5A 3VRIB 3IGAB 1B9ZA 5DJDA 3ULUL 1LNUA 4A2GA 3GSXA 2OMVA 2E7CA 3J07A 3V0HA 1HOCA 3UH8A 1IGCH 4UNIA 2K7QA 2H88C 2YPKB 4W9LC 1FA4A 1S78C 4RKUJ 4TNVK 1JGLH 5DJZB 3RK2B 1QFPA 1B0GA 3EOTL 1AZNA 1AY1H 1CQKA 4XC1L 4MQXD 4W9CC 1RP9A 3A4FA 4XNXL 1N5AB 2ATKB 1S9VA 2VZOA 3FT9A 3KPMA 1A7NH 1Q94B 4KH2A 4U6TA 5H4YA 5BRQA 5HGHA 1SQBK 2E7DA 2Z91B 4R8WH 4YBHA 1LT9C 1URQC 1NH4A 3EDFA 4D0DB 1EXJA 1HE8A 4LCIL 4P4KD 4OJFH 2AKRA 2H1XA 2VLRE 4N0UA 4CILA 3BEWA 4HWZB 4OQTA 3UAFA 5EORL 3HMWL 4MAUH 3RY5A 1BZEA 4L4TA 1NO4A 4AKOA 3DYOA 2ITEA 3SFEC 1WA1X 1DUYB 4ZUWA 4XZUA 4P2YA 3I75A 4GKZA 4XCNB 5J1AB 5B3SB 4KKAC 3CHXA 4W7ZA 2VZUA 4LLDA 4NUGH 4Q14A 4WUUA 1USQA 2X0VA 5C3TA 5FA3B 1S46A 1WLHA 1NQBA 1EGJH 5IFJB 1PZUB 1PQZA 3BH4A 1M1JC 3KD4A 5D4JA 3WE6A 1N18A 4QXTA 1U8MB 1E8WA 4LHQB 1S3JA 3GGWB 1K6QL 3N41F 3ZO0A 5M95B 4UT9H 5F7YC 3QUKB 3FN0H 2R1XB 2MOVA 2PXYC 1A02N 3R7RA 2JSFA 1AGDB 3LIZH 3DK0A 1OW6A 3BT0A 3LEYH 4KKCD 4RNRA 2EKSA 1T20A 1CFTB 2LW3A 3CCHB 1MIML 2FBOJ 3DC0A 4JQIL 2WMMA 1DLFL 1H88A 1IO4A 5DJ6A 3ZDXF 1OE2A 4RMTA 1SJXA 1U8LA 3OXRA 2ZAIA 3GLEA 5AZ2L 4J2XA 5JPNC 1JGVH 2D2OA 2CBMA 3L74E 3AE8C 1DDHB 3M1CA 4I85A 4KXBA 1XCQB 1XCTB 5GS1A 3KYQA 1P84J 2Z35A 4Y28J 3QRFM 1Z66A 3K7UA 2ZKWA 1GMIA 3H1JG 1PAZA 1VFUA 1JCKA 5L88L 1RIUL 3VRJA 3FXDA 2KZ1B 2CPBA 1BVOA 2XBZA 5DURD 1CGSL 5ITFB 4MBOA 4OZIF 5ANME 1Z0NA 3POCA 3PDDA 4DEWA 4GRLA 3OHXC 1OLZA 4JQXC 4PJ9B 1FLTX 1ETJA 3T2LA 3ESPA 4J39A 4P5TB 1ML0A 1I3GL 1PZ3A 3ZQXA 4PD4I 2CIIB 4HDIA 5HJ3B 1AI1H 5KSAD 3CX5E 1XB6A 2YGNA 3IE9A 2WN3A 4MB5A 3FQUB 2R8SH 1A8JH 2AJSH 2UY7A 2GK0B 2NX5D 2CPUA 5B66H 2HFEA 1NL0H 3NCJL 2EIBA 1NMBL 1TO4A 4XN1A 2AEFA 1TSHA 2FATH 3MUHL 3B5ND 3M17B 1L7IL 4EN3A 2OV0A 1X5XA 4UDTB 3N3EA 4YFDB 5I71C 2B9AA 2ITAA 3U9UB 1CZ8H 4KT0J 2Z0UA 3MUDC 5D8JL 5EU6A 4BQ8A 3U7WL 5AW7B 1OCRB 1M6OB 4TNFA 4RX4D 3WGUB 1SVFA 3V9CA 3DVNA 4EDXB 2WBJD 4FI7A 1T4KB 4K8RL 4X9GA 2HG5D 1BZ9B 1H3GA 3QA3B 4AEEA 3LXBA 4WHCA 3PCYA 3RWJB 3MI6A 4WY7L 1Q0XH 5FUOL 4ZUTA 2EKJA 3WNLA 4B53A 1O9VA 4FQIL 1YY8B 2IALB 2KS1B 5I2IA 2YN3A 1WPCA 4K3EL 4YHLL 2M83A 3ZMRA 3K2UH 3CXDH 3RGBA 1C08B 2CGRL 3LRGA 3ZDYF 3P4OA 4OZGB 2IPUK 2EVGA 1YPZF 1M7LA 4D8PB 2I7OA 2JELL 3Q6GH 1K4DB 2FFDC 5CEZH 4NUJB 3L16A 2CR3A 2OMTB 3GHGB 2MQ3A 1KXQA 2F5AH 3QPQD 4MCMA 1I7UA 3QFJB 4PJDA 1KSRA 5AVWB 2JXMB 4WHDA 4HZLA 3DVIA 3ZHNA 2CG9X 5CJXA 3K72B 3Q1SL 5D96B 2BOCA 1PGQA 3L72D 1F2XK 4TV3A 4YSUA 3MUUA 2VZTA 4AEHL 3BKYL 1CTOA 4RFNC 3QJHB 1I53A 1OVZA 3H1IE 4X6CE 4A6YB 2OW7A 1W0YT 3NZHH 1LDPH 2FDBP 1RJZA 5AB1A 1O7SA 5GTHH 4C7RA 4NQEE 1T3JA 3T4AC 3H1KJ 1B4LA 1IGTB 2ARJB 4XB8A 3CSYB 4BSWB 5K5YA 1JO5A 3WUTA 4JN1H 3MR9B 5DRXB 1FFQA 1NOFA 4LF3B 4HK3J 4GFTB 3UZVB 2WLZA 4EPSA 2DQCL 4ZAKD 3L70G 4Z3TA 1KTKE 3PP3H 4F7EB 1E90A 3V2RA 1WSST 1USEA 1YEGL 3NFQA 3UBXA 4WVZA 3V0JA 2QHLA 4L9LB 4JREC 1FJ1A 2R0LL 2WXOA 1NIAA 5BZZA 3PWPB 3MFFB 4HLJA 1EWHA 4HIHA 2RH0A 1JYVA 2P48B 2IWEA 2ZQKA 4TLKA 1ZRTE 1NFIB 4HKXA 3E8UH 3WY3A 5B8CB 1U8IA 3FUMA 3K6SA 1W9XA 4JGUA 3HC4L 4XFJA 1URQB 1I1YB 3O6KH 4IW4C 3WS3B 3QIWB 1T5XB 3FL7A 4P23C 4TMPA 5INCB 4OCRH 5E70A 5EEZA 1K8IB 5T3XH 1E2WA 3DA0A 1JZ8A 1I8AA 3RWIB 4N9GB 2H3KA 2VM9A 3I9PA 1WC7A 5GSRB 4XWOD 1B0RA 2WN2A 3DETD 3L6FA 4J7RA 1A3LH 1Q86Q 1GYVA 1EIBA 1RUAH 2HT4C 3IMTA 3AG2B 5KZCD 5BRZD 1NOHA 1UZ6F 4TVPL 1FH5H 2OMZA 3NA4A 4AG4L 3TN0A 5HPOA 3SBWC 5IQNA 5HGAA 3AW5A 3D25B 3ECWA 3UMTA 1FFOA 1SQVK 3DMMA 4XP5L 1A47A 5JDSA 4JAMA 4ZDHB 5A2IH 5APSA 1ECZA 3PNWA 4LSVL 3TDKA 4D9LL 1SUJA 3VN0A 1H8OA 2BS9A 3C1LA 3KYOB 2PCFB 4OLWH 5ESQB 1THCA 1DEEA 1P1ZA 3GJEA 4ENED 3MNZB 4YHNB 1OOAA 5SWQB 3NZ8B 1S7UA 4KNUA 4Z76A 3JV6B 4N8PA 5DUMH 3FT2B 5LBSH 1I4FB 4FP8H 3EFGA 4U1NA 4AL8H 2C7UB 2ZF8A 1GHFH 4R7XA 4X8JA 1TU3F 1ZT1A 1CT8B 3IN6A 3TF4A 5FCUH 3SYCA 2APXA 4Y2OA 5JPNB 5DGQA 3LN9A 1S5HA 4JVPA 1PG7X 5DHMC 1JPGA 2FUQA 2LVCA 5KLIC 2XWTB 3L75E 4DPBX 5HDLA 3BCCG 1AHWB 1IGIL 3IGUA 5B1AB 3VI3F 2QKSA 1UIXA 2YUVA 2VSKB 5MEPA 4DGWC 1Q7YQ 2VDOB 4A67A 4A2LA 1BMWA 4N1HB 2Y07L 3GEWB 5DCCA 3LKPB 1TXKA 5ANHA 4JZNA 3NABH 4WZ9A 4N24A 5AB2A 1GZQB 4KI1A 3MV9E 5D93B 3KMDA 2CDEA 3HMXL 3VB8A 2XNDH 2HRHA 1KBBA 4AYGA 2HRPH 2PMZA 3VI4A 4ELDA 1SQXD 4JM4H 1IZKA 3CZEA 4IJ3C 5CU9A 3ULUH 5JIKA 3ZHKA 5T3ZD 3CE1A 2CO6A 1WFMA 1XD1A 2OS7A 4OZHF 4ZTOL 4WNQB 1WZAA 3GSWB 1RJYA 1JJUA 1CL7L 2KH2B 3SDDD 1F2QA 3ILEA 4XC1H 3HCVA 3MBEB 4Z3HA 4MXQC 4XNXH 5C0JA 1X5ZA 4RMQA 5J6HB 1L5GA 3P7KA 4UQ2B 1QYGL 1BD2B 4P3DA 4CSTA 1RJLA 3KWWB 2WP3T 1AO7B 1CC3A 4CVZA 3RVWC 2AXTE 3O3AB 3Q0HA 4LCIH 4X98A 3TBVB 4X9IA 2QADC 4PJ5A 5JXEC 1KORA 1DJIA 3D71A 2ZP8A 1U93B 5EZJA 4KAQL 4QXUH 5CCJA 5EORH 1MFMA 3GF7A 3HMWH 3I56P 1AG0A 5E2UL 5CEZE 3QXUA 5CD5D 5HHNA 3V7AE 1OZUA 3ZUNC 4HWBA 1PZSA 2NXYD 4TSAL 2E7LC 1S9KD 2P7JA 3FONA 1NBQA 1FZKB 5SX5H 2GJZA 3CC4P 4NRZB 4OLYL 2CLVB 3EJYC 4PVNA 1JFHA 3U0WL 5DI8A 1RURL 5CHXA 3G6AA 4NKIH 4W6WB 1K6QH 1ZWIA 5GTHE 1MVFA 3ARGC 4NQEA 3HD7B 4HAKA 5D1QE 2N56A 3UADA 2N7BA 2E76D 3RFRA 4JFQA 2B0SL 3O2DH 3QUXA 1DLFH 4JQIH 4JGJA 5EO0B 2ZKXA 3PS6A 4F91B 3KYKL 4JKPH 3WKYA 4HUVA 3TO2B 1MW0A 3D85D 4W9ZA 4JYBA 5IY5B 4WGVB 5AVSB 1ZLEA 3TJHD 5EU5A 1KBPA 1E42A 1MG3C 2P46B 3SCMD 2OTJP 4K7PH 2NY6C 4ODWB 1KIUA 2D7TL 1H0DA 1P84I 3MOBL 5K9QI 5JPMB 5J1SC 3C5ZB 2R9HC 4GT0A 1NC2B 1JOIA 3FOMA 5BVPH 2ZWSA 4QOKB 2WVSA 4N0FB 5F3HB 2YXFA 2ZPKL 1LO2H 4LVNB 1OT4A 4G6JL 4QRRE 2BO0A 1RI8A 1YHPA 3D2UA 2V33A 3PQYA 2VW6A 4ELKB 4ZMXA 2Y5EA 3CCJP 1I8IA 1KCBA 4Y16B 2NY0B 4NO5B 3R06B 1CGSH 4ANXA 5DO2D 4G1MB 1M7UA 1DQJB 3C87A 5H35A 3DBXB 4GMSL 4JM2C 3EFDL 4Z0XA 5T3XE 3CDFA 3CMEP 2HJFB 3EOBA 4PJ8A 1IEAA 1SEBA 1I3GH 3DKHA 3L3KB 1K9TA 1CR9L 1KUMA 4PJ6A 3KBPA 3ZX1A 2NPLX 1SOKA 2X1QA 4UT9A 2F54A 5DFTA 3CN4A 5FO7B 3UC2A 3LIZA 3V0IA 1EMTL 3VGAB 5E8DL 4BE5A 1IKOP 5I24A 1OO2A 1FDIA 1QLEL 1XGUA 4JUSA 3VG0L 1EXIA 1CQYA 5DD6A 3NCJH 3WI9A 5MEQA 1NMBH 4NPEA 4NFBA 4G6AD 3HLAA 3BP7A 1L7IH 1KPRB 3D4CA 3GXPA 5T1JA 4HX1A 3V9FA 3PAZA 3SQBB 3VW3L 5ID0A 1MFCL 2YA2A 2WSKA 3QW9A 2J6EL 3GYRA 4M1DL 1KPVA 1NKGA 1RZ7L 3MO1A 5AZEL 4K8RH 4WUKH 3TWCL 4YHPA 4WY7H 4JDTL 1V5JA 4BCXA 2ALAA 2VQTA 3BPLC 2GVYA 3E6FA 4TTDD 4UM9D 1AYRA 2GJ6B 4FQIH 3T5WA 1HTLC 3QHZL 4ZNCA 1P7QD 4JY6B 4K3EH 5GZND 2VXVL 3IDGA 1LL1A 2CGRH 1ASQA 2IH8A 3GM0A 4ZNEE 5JA8B 4I9WE 3HC3L 3P4MB 2X70A 1ONQB 1A7PL 3MROB 1DR9A 4ZSOB 2R69L 3EADA 3ARPA 4AT6A 4MHHG 1M05B 1QABA 5TGBB 4ODXA 4Z23A 1A6ZA 1RSFA 3DX1A 3OJMB 2PPDA 2Q9IA 1VFBB 4KV5F 4NUQA 4PVBA 1ID2A 5SX4H 2R39A 4OH8B 3KPRD 4AEHH 3BKYH 1GIGL 3HW7A 4UTAL 3AAZB 3ULUE 5KAFH 2YEQA 1KULA 2AEJA 1I9RL 1QHQA 1JZIA 4MASA 1JYNA 4JNXA 1S4IA 3WMPA 5IUCA 1AGCB 4ZT1A 5HGBB 5EZPA 1PDKA 2XN1A 3X14B 4UU9A 1X5KA 4IGBD 5D2LB 3P8CE 3B4SA 1MHEB 5JR1L 4J8QA 3QO0B 3F89A 1QSFB 3LIEA 1G2CB 4NS0A 4YSPA 4M6ML 3EO1B 5DC2A 1G1OA 1Y18A 3FRPG 3QR0A 1HYSC 1YEGH 4NLAA 5DZPA 5KLVD 1RD6A 4LSQL 5F72S 3T9WA 4NQCD 3MAWA 3ZL4H 1TTUA 3WIIL 4WY4D 1L9MA 3CVBA 3MV7B 3W9DA 2W6AA 4B97A 1JK9A 1BE3G 2BSTA 2R0LH 3EG9A 3FYIB 3NYKA 4M62H 1KQFB 3WGVB 3L4WA 4E5XG 1JL8A 1AQMA 1YQVL 3QUMB 4AYBA 1D5MB 5TE7L 1AV1A 1NTMG 3ATAA 3AXLB 3H1HD 2VW7A 2WP3O 1DSWA 4Z7UB 1X4XA 2FL5A 3VXTA 3H9HB 2EUXA 1T0PB 4JFDB 3UPCA 4XAKD 4ADIA 4N2NA 1UA6L 3CZLA 3O0RL 3T77A 4PJGF 4NGHH 4DSYA 2E59A 3BIKB 4ZFQA 3UBHA 2UY6A 3CHRA 3OKMB 1N10A 4LOUC 1G9NL 2EABA 4K3DL 1JPFA 4S1DD 5SWZD 1VEMA 2ZWNA 1BAFH 3I85A 3CZGA 3WEOA 1BVKB 3JTBA 2FJGA 3MRNA 1K9MQ 4MCZB 4TVPH 1LWRA 4AG4H 2H0FA 4G9FE 1FNEA 1DN0B 1OFCX 1G4RA 5ABZA 3BN9C 4JRYB 3G4SP 2B15A 2QJPB 5EULV 5M94B 3V4PL 3CU1A 5C0AA 4JFEE 2E9GA 5D71H 2Q3IA 5GRWA 3JSSA 1EAPA 3EYVB 4L9DA 1QUNA 4LSVH 4D9LH 3OKDA 5ICYA 2EINB 5GZOA 3S37L 3ARGB 3LKSA 1LT9A 2OK0L 1TU2A 2OSXA 3HE7D 3ML8A 4BD4A 2GM4A 1RHHB 5IZ7A 5HHQB 1OMIA 3I55P 2X09A 3V4LA 4U1SA 3U46A 3P73A 2L7QA 4FFWC 1RERA 3GKWL 2FD6L 3ARQA 2C1PA 5C3IA 5B4MD 1LD9B 1R5IB 3DVFA 2GY5A 2FO4B 2F1BA 3VFWA 5HHME 5I28A 2G4GA 3Q9PA 1S5LX 4F2FA 4LESA 3H1ZA 5AW5B 5CNHA 5D72L 3FQTB 4NNPL 4QYOA 2FQEA 2Y07H 3T0VA 4HGWB 2APFA 3OAYH 1M1JA 1IFRA 2BINA 3HJ0A 3DVGA 3HMXH 5C07B 4HKBA 2IFFL 1BJ1H 2W0FA 3GWJA 3NSYA 5KJ7A 4PN6A 2PXYA 4QRTA 1DQQB 3E7JA 1OGAB 3WNIA 4ERSH 2JKSA 2HP4A 3FW6A 1JDAA 5LCVL 5IB3A 2AEOA 4C56B 1USDA 4EKJA 2VLJD 4J3WA 4RAUA 3O9WA 3SY0B 1NGZB 4NENB 4ZTOH 3QDHA 3L9RA 1EZVI 4AJVA 4EIBA 43CAB 3IVKA 5JW3L 1CL7H 4A7GA 5F6HI 3TBTB 2PF6A 4GY4A 3MTXA 2O1JA 2J2ZB 3ZL1A 2JCCB 4Z7VA 1JHTA 1QYGH 4AMKL 3TA3A 4PWEA 3RI5K 3VFOA 3V6FA 7PCYA 3QUZD 2DD8L 4NHCL 5HYSG 2XN0A 2UV3A 3TO4C 5I1LA 2WWOA 5CKAA 4J2QA 3SDCC 4R3SA 2EVFA 3H9SE 4XBEL 4NQDA 1R24B 2IXQA 2B3RA 4KAQH 4YNYB 4ZNEA 2YD8A 1TYRA 3B9DA 4PRHA 3S3PA 1A8ZA 4IOIH 1WICA 1XR9A 1SN0A 3OHXA 2EE6A 4JQXA 4CSSA 1QSEA 4N26A 5E2UH 5CJ4A 1VQKP 3EYUH 4FTVB 1IIIA 1G7PB 1O6SA 2VDPB 3C6LB 3IPBA 5EBMA 4DT0A 4OVUA 5GRJL 1GDTA 3W68A 4ZTPL 2X7LB 4R97B 5KSBE 1T5WB 4V33A 1G9NC 4OUUB 4BZ2L 3KLHD 4TSAH 4O02L 2JK5B 1BCCJ 3QP3A 3CJJA 1KB5B 3W0WE 1JBJA 4ZZKA 2CHNA 4OLYH 2KMWA 3G5ZB 1Z6JT 3TEYA 5KAFE 3U0WH 3D8MA 1QFWL 4YGAB 1RURH 2A0LC 3AACA 2PWDA 5IF0B 4FFVD 4JN2B 4C54A 1JCVA 2ZT9D 1CFMA 3N55A 1N5YL 3RA7L 5CEXB 2AZAA 1F4WL 5HYJD 2B0SH 1QGKB 1NTZJ 2KSJA 4I0PD 4ZFZB 1OAKL 2GFBB 3HZKA 3KYKH 1KGIA 2ITDA 5CZXD 1YO4A 1G4MA 3MUDA 1LEKB 3B7UX 5DTFA 3HR6A 1INQB 4PJCB 3QDMD 2LXCB 3RHWF 1HHIA 2I25N 4QHKJ 1TCRB 1J1EB 3QIBC 2B87A 2D7TH 4QI3A 4LXFA 2Y25A 4UNTA 3LH8A 3MOBH 4M00A 5FKAB 4PD4D 1GR7A 1S1CX 3IAQA 2H2PD 3SOTA 3VSVA 5I66A 2ZPKH 3CPWO 2AF2A 3F7LA 4BELD 4G6JH 3UTTA 3L4ZA 2L91A 3WJLC 1KMIZ 4L1TA 1T03L 5I73C 2V8LA 1SPDA 4I5BA 4LLWB 2YIHA 5B1KA 1D6VH 4AKPA 4W4NA 2RN0A 4OZFH 4NO0B 1JF6A 1LJMA 3EFDH 3LNFA 4PS4L 2Q3XA 4GOFA 4EI0A 3E3QC 1F6LL 3QWOA 4U1HA 2IMMA 5KS9B 3QDAA 4GW5A 1BGYD 3VXRE 1CR9H 3LN4A 2IYOA 4PH8A 1OF2A 4UTBL 4YBLC 2W38A 2DWEB 4A7UA 1I7ZB 1EMTH 4AXWA 1KFNA 1DL7L 2IFGA 3H7BA 3IDYB 3NCWA 4G9FA 5E8DH 4Y2NA 3UROR 2Z0BA 4JQIA 3WDJA 4OFYD 3KDMA 3T4AA 1QLEH 3VG0H 4OBRA 1LK2A 1B2WL 2O5YL 3MV8D 3TT3L 4BSJA 3Q8BA 2Z6FA 4D9RE 3IJEB 2QPEB 4FLSA 4KZ0A 2WTYA 3KXFE 2I9TB 2OSYA 1PP9E 1UOVA 2P80A 1V3LA 1LO0L 3WHE0 1MFCH 1PG7W 4L8BA 1IBZA 2J6EH 4M1DH 4DGIL 1GYAA 1RZ7H 4X6CF 4I6MC 4AIZA 1FCCA 4LOVA 5AZEH 3ALWA 3QDGD 4J5VA 1IE5A 1OIPA 3TPKA 3TWCH 1ORSB 4H8UA 4R2GD 2A6IA 4GSUA 4JDTH 5F7KC 3TH2T 4WI9A 1G84A 4PG9A 1UASA 3K91A 3L35A 2O5XL 5CXPA 3QHZH 1KYDA 3HI1A 1QQDB 2CBPA 3CZKA 5DJYB 4AQAA 5J89A 1GU4A 1HH9B 2VXVH 2ZUQC 4ZPVA 3ZSTA 4FZ8L 4HC1L 1N7ML 1S7VA 3HC3H 3MCG1 5D5ME 3B6SB 1A7PH 5F7AA 2XXMB 4DEUA 3KPLA 2OGUA 2R69H 3BPNB 4I3RL 1MI5A 3IXAB 3L5WB 5A2FA 1MXGA 1FNHA 1OW0A 4GEIA 1EO8L 2OAAA 2AZUA 2TAAA 2XZZA 1UZGA 1IGJA 3T1WA 3FWNA 4GG6A 3FCGA 3MV01 1IGYB 1FS0E 2OMYB 4FKEA 4L0PB 4OFIA 3U36B 5HYIA 1GIGH 1UWYA 3F6LA 4Z3JA 3X12A 5K9KA 1I9RH 2K6YA 4KDWA 1L6XA 1G7HA 2DYSB 3E1F1 3G5XA 3QVAA 1I85A 2O01H 2PNDA 3AZUA 1OX3A 4J3SA 4OF3A 4P3CL 2DQMA 4G1EB 5JHBA 1HHJA 1LQSR 4JFFB 2XX1A 4YOKA 1AFVL 2F74A 1DJHA 2ZYRA 2E7HA 5JR1H 4G83A 2BS71 4Y7OC 3GMMB 2BCMA 3LD8C 5FOBB 3S2CA 1PEWA 3IDNB 2VC2B 3IF4A 4Y4HA 5BQ7A 6CGTA 3CZSA 4M6MH 1S7WA 3JCUE 2X4PA 4H8WC 5DQ9A 3RUGE 2VMCA 4X6FB 2E74D 2VR4A 4IRSB 2UZYB 1KLUB 3MBXH 4DPAX 2ZKYA 5I19L 32C2B 3WIIH 2Z3FA 3QJFA 4PJHB 1KB9K 3VG9C 2IGTA 3L2NA 1A9EA 2XA3A 3T65B 2OKMA 1E5BA 2NTFA 3IFPA 2N1TC 1AGFB 1YQVH 2OZ4L 4HFWB 3SKJL 3GKZA 5J57B 5EEWA 3D34A 1Z5LB 5F9OL 1SQBE 5TE7H 2A3TA 4NI6A 1Z3RA 1N73C 4GS7C 4M6OH 4F5CA 5I6MA 5DEGB 2IOOA 5AOZA 3VSUA 7FABH 2QTVA 5L8LB 2HFFB 2HYNA 1X6NA 3TO4B 3O0RH 1DVZA 4YVUA 1D7MA 4LRNL 3W0WA 5JQHC 3SDCB 3RL0B 3BSHA 4FN0A 1KWKA 5A6MA 3PHOB 1G9NH 1TPXB 1ZJBA 4LAJH 3S96A 2IH9A 4K3DH 2XNAA 4LSDA 3I50H 5I1CL 3R8QA 3CPLA 4HIIB 3Q2YA 4NN6C 1HL5A 4HEPG 5CJ8A 3TURA 5HHOE 2GUYA 3ARED 1IFNA 2G5BB 2R3SA 4CMMB 1EVTC 4HUUB 4TOYL 2C34A 1G1IA 5H2FE 1T1YA 2UWEB 1X6LA 4FQXB 3WN5B 3FRPB 4FMVA 5FPIA 1ZT4A 5CBOA 1PV3A 1CD1A 4H4NA 1G1YA 2JIXB 3IJHB 4L37A 3RX7A 3VNZA 4LBEB 1D7DA 1X5IA 4BDVA 3MHZA 5BMFL 4R4ND 5AOIA 2BSSA 4K94C 5IVXA 1PEZA 3L2LA 1U91A 4K5NA 4E5XB 4N2EA 1E9PB 2GITB 1YHQP 4L2LA 4P0DA 3ULVF 3MRMA 2FD6H 4M7LH 5E8OB 4YMPA 2FTAA 3HAEG 3N40F 4KTEH 4PJBE 2AJ3A 4WI0A 2WHVA 1FN4A 4LCWE 1I9JH 3MGAA 3TONA 2MCMA 1FP5A 2BP3A 4JZOB 2FLRT 4L4VD 4YWGL 2VR8A 3PREA 1FDOA 2XC8A 3W39A 5IQMA 4D6TE 1VQMP 3CFNA 4NNPH 5E2TL 1O7DE 1RZJL 2FJFB 3L72G 2WITA 3ULSA 3QBTB 1EFXB 3OJVC 4N22A 2QSTA 1E5YA 3FB6B 4YXLL 2V0AA 2KL6A 3GDBA 5EUKA 4FABL 4GRWE 2EYSA 5H37H 2FR4A 2IOMA 4NP4H 2E9WA 3GI8L 5FF6A 5E4EB 3IDJA 4ZS6D 1RCYA 2BIQA 2IFFH 4P4KC 4KWUA 2BVEA 3EH3B 5IREA 4YXWH 4XOAA 3BIAX 5IM7B 2ADIB 2QFPA 3KXFA 1ZGLM 3RFZA 1DUZA 4YC2B 4MWFA 2YKKA 3O4LA 5F97E 4DH2A 4YBLB 5JW3H 5KYWA 3U4EB 1T0OA 1ZP0C 4LFHG 1VGKB 2Y24A 2AABL 1MUUA 5J6GB 5LAXB 1YEKL 1PU0A 2DL2A 2X89D 4HV8B 4XCEA 5IVZA 4N86A 1VEPA 1SOSA 4AMKH 4DCQB 1FGNL 1D5IH 3C9NB 5FV2A 5EOQL 1ERNA 4BWNA 1Y07A 1PFIA 4OJAA 4P46D 1R5LA 1PD6A 3FX0A 4PM1A 2K9JB 4ACTA 2YBRA 1OT1A 4XBEH 3EJRA 4TPRL 4KKCC 4PMEA 4LSPH 3HR5B 2F5BL 3FB7A 2P5WB 4JM2A 1LE9A 3H32B 1X5GA 4NZUL 3MLUH 5IB2B 4A2EA 2QQNL 4BUHA 3CVHB 5GRJH 3VXSA 4AK1A 1FZJB 4ELMB 4HJEA 4ZTPH 2WCSA 3DSNB 3QR1A 3RDTB 2AEMA 2XU9A 3HMXA