3I5CA

Crystal structure of a fusion protein containing the leucine zipper of gcn4 and the ggdef domain of wspr from pseudomonas aeruginosa
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
196
structure length
196
Chain Sequence
RMKQLEDKVEELLSKNYHLENEVARLKKLVNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPGGGGQTFRVLIEMADQALYQAKNNGRNQVGLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determinants for the activation and autoinhibition of the diguanylate cyclase response regulator WspR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Fusion of General control protein GCN4 and WSPR response reg
total genus 68
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3i5cA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i5cA02
5HBMB 2GC8A 2ZE2B 1UWBA 1N6QB 4NLWA 5L1LA 4F50A 2R8JA 5KFQA 3DLEA 1FOSE 2OPSA 4IG0A 4NCGB 2R5BA 2D3UA 1NHUA 2WTFA 1LW0B 1S4FA 1TVRB 1G2CB 1JLBA 4IR9A 4G3IA 1RTDA 2GIQA 5DLGA 3TYYA 1BQNB 1IO4A 3T5KA 2C9LY 3V4IA 4NRUA 3M0DA 4K4YA 4URGA 4ZP6A 2W8LA 1S1XA 3OSPA 3SWFA 2FVSA 4KV8A 4I7FB 4MK8A 4RW9A 2R8GA 1HQUB 3PHEA 4O3OA 4TYAA 3UQSA 2XGPA 1OXZA 2YO2A 1SV5B 5KT2A 3QLHA 3DOLB 4ECYA 1EP4A 3M8PB 2I5JA 1DTTB 1TV6A 2BANA 3BSAA 5KFUA 4PWDA 3HVTA 1RT7A 2ZKUA 5KFSA 4IFYB 2WONB 4ZPAA 5I3UA 4J9SA 1JLCA 4RW7A 4IRKA 1U09A 2E9ZA 4DL7A 3VMZA 2B6AA 5EUHA 2JEFA 3NBPB 3H5YA 1FAVA 1SLQA 3BGRA 4IOBA 2JEJA 5AW6B 2ASDA 3LALA 3DRSA 2VA3A 1SUQB 3VYIA 2VG7B 3C6TB 4KAIA 4TY8A 1N4LA 2I1RA 4RUAA 3V4QA 2VRSA 4MFBA 1T2KD 2V0NA 5KFDA 4NLDA 4KKOB 3GYNA 3RB3A 4NLGA 5F9LA 2CJQA 1XR7A 2AX0A 2O5DA 3SFUA 3NAHA 4YR0A 3IR9A 3CJ2A 4RW6A 4RNNA 4IRCA 4K4UA 3N6NA 5AVZB 3HE4A 4Q8EA 1LWFB 1RTHB 3HHKA 3BR9A 1R0AA 4HYTB 3MF5A 2VG7A 5KFNA 3KHLA 1RT6A 2YNFA 3DLGA 1CI6B 3E01A 1C1BB 4O44A 4ZP7A 2W8KA 3TQ1A 5HROA 1EETB 5HP1A 2C22A 5J2QB 3CDWA 3MFHA 4RZRA 4Q44A 2XC9A 2BQ3A 2B43A 2HWHA 3FRZA 2W9BA 5CYMA 2XGQA 1GU4A 5F9NA 3I5CA 4ZVEA 5KG1A 3V6HA 4MH8A 1S0OA 2BRLA 3KK1A 4EOTA 1JUNA 1RTHA 2RKIA 4IKAA 5KG6A 5KFBA 5T14A 4F4YA 2OPRA 5KG7A 2FLPA 2IMWP 1W25A 1LWCA 4J9LA 5AVSB 4JYCA 3LP1A 4ZP8A 2E9TA 3IG1B 3KHRA 3V6DB 5F8LA 3MEDB 1VRTB 1EP4B 3M8PA 4NLYA 3NAIA 4H4MA 4WE1A 3M9HA 1DTTA 1SH3A 3JYTA 4J9NA 4Q0BA 5KT6A 1JLGB 4IFVB 2WT7B 1HPZA 1LWEB 4K4XA 1S6PB 2V4QA 3HE5B 1FKPA 4YQWA 2C28A 1J2JB 2R8HA 3HTKA 1S9GB 1RDRA 2IM2A 3HKWA 3KLIB 2R8IA 4PUOB 5HLFB 1LW0A 1RA7A 5EWEA 3MGNA 3DLKB 3G6XA 2V4RA 3JSMA 1BQNA 4ICLA 1RT3A 5KFYA 5KT5A 4B3OB 1JLFA 2J6SA 5I42B 4WXOA 5KFTA 3KLHB 1ZETA 3DI6A 1TL3B 1HARA 2JC1A 1MU2B 2AWZA 3MR6A 4F4XA 3GV8B 3G86A 2AU0A 3MEGA 2BE2A 3NL0A 3KJVB 4M3LA 1JLQB 3KK2B 3DOLA 2FVPA 2YO3A 2BANB 2UUTA 3BSNA 1DH3A 1IKVA 3Q8RB 1OWAA 2JJLA 5APTA 2ILYA 5F8GA 3GIKA 4LSLB 3IS9A 4TY9A 2OPQA 5DGBA 1S9KD 3H98A 4NLRA 2BR0A 1JLFB 3H4DA 3NMAA 2UVUA 2R3CA 1YYCA 3V6JA 1SH2A 3TNUB 2HNDB 4LQ9A 4WXWA 3KHGA 1IM4A 1C0TB 1EETA 4RNHA 4RU9A 3BGRB 4XO0A 4KO0A 4ZPBA 5J2QA 2YNGB 4QWEA 1S9KE 1ZTWA 1C0UA 3LIEA 3IN5A 1D0EA 5HBMA 5KFWA 4ECSA 5KG3A 5KFEA 4ZVGA 3VQSA 4JYBA 4LSLA 4DG1B 5J2PA 1RAJA 3LP0B 4OL8A 2XV5A 1S9FA 2JEGA 4H54A 4IH6A 1SV5A 5KFAA 3VN0A 4H4OB 5L1KA 4FBTA 4R0EA 4WYLA 1MMLA 1S6QB 5APSA 3V5BA 3I0RA 4URQU 1S1XB 3NFQA 1HWTC 4KE5A 2HAIA 2IC3B 3LAKA 4TQSA 5J2MA 2Q5UA 4WZMA 2FVCA 3H5XA 3B8EB 5KFIA 5KFMA 5KFPA 3Q8QB 4O3SA 4U6PA 3P8MC 4YP3A 3CO9A 5F8NA 2VG6A 4TYBA 5HLFA 3NBPA 2WPQA 3IRXA 3DLKA 2YNIA 3G6YA 3I0SA 1KLMB 5AW8B 3T97A 4IR1A 2HNZA 2H7HA 1IKWA 4J9PA 4WFYA 4YR2A 2IC3A 1H8AA 1RYSA 2BQUA 5AVRB 5KFGA 2ZE2A 5C42B 2RF2B 3IG1A 3KLFA 4NLXA 2BE2B 4YR3A 4LQ3A 4KBIA 3FDSA 3MEDA 1A02J 3FQKA 1N56A 5DG7A 5AVUB 2WRMA 3O8ZA 2XCPA 4RW4B 3RB6A 4ED6A 4DL2A 5F8JA 5KFFA 3N6MA 4IH5A 5C24A 4ZHRB 4EEYA 4TLRA 2ASJA 2J6UA 2VA2A 2F8EX 1S1TA 3BQ0A 2R5DA 2WCXA 3HVWA 1S97A 3KLIA 4GT1A 5C25B 4PUOA 1CI6A 1GTWA 3PJWA 4RUCA 4O3RA 4O4GB 5HROB 1HYSB 3DMJA 5EWFA 4GKGA 3MR5A 3TAMA 4O3PA 5DQIA 2WOMB 1RTJA 3VTPC 3KQGA 3LANA 3V81B 5DG9A 3RBDA 1R0AB 2P67A 1BQMB 3DYAA 1RT6B 2YNFB 1T94A 3DLGB 5CYQA 1CSBA 4WFXA 3MR2A 1UWBB 2C2RA 1S1VB 1JLCB 1TKXA 5KFKA 2W6AA 3KJVA 1YVFA 2AX1A 4EBEA 1T05B 4J9MA 5KT4A 2ASLA 1MFZA 4EBCA 3FQLA 3GV5B 1RTIB 1C1CB 4C7NB 4QWBA 3Q8SB 4IG3B 3KLGA 3PZPA 2IA6A 3TAMB 4ZVHA 2IAJA 2HMIA 3ITHB 3V4IB 2WOMA 3C6UA 3KLEA 2FJWA 3OL8A 2C9NY 3L36A 4KV8B 4RW9B 3KOAA 1HQUA 4JV0A 1JLEB 3H5UA 3OHBA 3MFIA 1OS5A 4ECRA 5F8HA 2AGPA 4F4ZA 2WPSA 3I5BA 1JXLA 1J5OB 3ISND 2R2TA 1VRUB 1CZQA 2YNGA 3SI8A 1HNIB 4QPXA 1JNMA 4K4ZA 2WTYA 2JC0A 5APUA 1HPZB 4KB7A 1NWQA 3H5SA 2YKNA 1S6PA 1HQEA 4EBDA 1N5YA 2BQRA 3GIJA 4ED2A 1GD2E 3C6UB 1S1UA 4NZ0A 4G1QB 3QZ7A 4RW7B 3KLEB 4JV2A 2KP8A 4NLTA 1JKHA 2OPPA 3KNAA 4IQXA 4PQUA 1HNVB 5C42A 4EYIB 3KMSA 2BASA 3FFIB 1T3NA 3M91A 3DOKA 4MIBA 4HKQA 2B5JB 1GK4A 3L37A 3DM2A 3QGHA 5DLFA 3RAQA 3TVKA 4B3OA 3LP2B 1RT1A 4IH7A 3UPFA 3KLHA 3DRSB 2C2DA 1TL3A 4ZVFA 4J9KA 4WZQA 3G6VA 4TY8B 1RT5B 2RKIB 3IGNA 1IKXA 3TK1A 2HWIA 2R2SA 4J9QA 2OPSB 4IG0B 5KT7A 3ISNC 4K4WA 2VG6B 5KFCA 3CWJA 3TNUA 1HMVA 1FK9A 1JLBB 1RT2B 4RESB 1C0TA 1TKZB 3CJ4A 4O3QA 3T5HA 2OPQB 5L1IA 2WB4A 4WYWA 3BSOA 3JYTB 4Q0BB 2W7PA 2AGQA 4X2BA 4LSNB 1JLGA 3PW2A 1LWEA 2YNHA 1RT7B 3PW4A 2AGOA 1I6JA 3V6KA 1REVA 2ZXEB 2XI2A 4IFYA 5AW7B 3A5TA 5J1EA 3KLFB 3LIDA 5KFZA 3CJ0A 2GIRA 3QGIA 1T05A 4DEZA 1RT4A 2VG5A 5AW1B 4QW9A 1T03A 1HMVB 3BREA 4KSEB 1GX5A 1TKZA 1MV8A 4C46A 2IM3A 4DG1A 3GQCA 2C2EA 1RT3B 2J6TA 4R5PB 5AVYB 4DL5A 1TL1A 5L1JA 4ECXA 3LAMA 4ED1A 1HUCA 3MR3A 3KDPB 3PVXA 3VMXA 2WPRA 2N9BA 2QM7A 4RNOA 3RB0A 3OAKA 3DLEB 5J2NB 4I2PB 4EO8A 1QUVA 4KHRA 3KLVA 2FVQA 2VG5B 3OLAA 3OL6A 4AYCA 1K1QA 1MUUA 1A02F 2JEIA 3D28A 4J9RA 1FOSF 5KFXA 4Y2AA 5APQA 4AQRD 4I2LC 4R8UA 2FVRA 1ZTTA 4G1QA 4NLQA 3IGVA 4KHXA 1FKOA 1S0MA 2Q7CA 2YKMB 3KHHA 3PW0A 4ECWA 3CJ3A 2XI3A 4ED7A 5J2NA 1IKYB 3QLHB 4TN2A 2V9WA 4I2PA 1XR6A 1IKWB 1JLAB 1H89A 1C0UB 2W9AA 4ED8A 3SFGA 3A7OA 3DI6B 3MECB 4ECQA 3E51A 1RT5A 5DGAA 4K50A 1TKTA 5D3GB 3PJXA 1J5OA 1N48A 5APXA 3N6LA 2D3ZA 2FLNA 4NCGA 5F8MA 5AW0B 3UIAA 2FJXA 1XR5A 1IKVB 2WHOA 5C24B 1IKYA 4XPCA 2QM8A 1VRTA 3V4WA 3IS9B 3I0RB 5KFLA 2IJFA 2YNHB 3DRRA 2WT7A 1JKHB 4TXSA 1REVB 2Z5IA 3DYAB 4K4TA 4M94A 5J1EB 4PQUB 5CYQB 3OHAA 3V6DA 2IJNA 1S1VA 1TKXB 2R32A 4NLSA 4Y34A 2ALZA 4NYZA 4MFBB 1S9EB 5KT3A 2E42A 3BQ1A 1QE1B 5AW2B 3DDKA 1NNDA 2YNIB 1KLMA 5K14A 3T5LA 4B86A 2AQ4A 2WWWA 4ICLB 4R5PA 4K4VA 3DRPB 5CMZA 2QE5A 4ZPDA 4XPEA 4ZPCA 3CVKA 1Z4UA 1JLEA 2JLEA 1TP7A 3UR0A 5KFVA 5F8IA 1C1CA 2IM1A 4RNMA 3PR5B 2ZD1B 3KK3B 1N6QA 3M9OB 2DPJA 2XWYA 4EO6A 3EZUA 3ITHA 4ZP9A 1S6QA 4EYHB 4K4SA 5AVVB 3NGDA 3A2AA 3BJYA 2HNYB 4I2QA 3H4BA 1CSJA 1GX6A 4YMEA 2RDJA 1S1UB 3KMQA 4QWAA 2OH2A 1TQLA 5EDWA 4ECUA 4I7FA 2OPPB 3LP1B 3QIDA 3IRXB 3KK3A 4LC1A 4O4GA 1HQEB 5JUMA 3I0SB 2ZD1A 3OL7A 2R8KA 5AVXB 4KO0B 4RW8A 4ED0A 2HNZB 4KFBA 3NMDA 3M8QB 5DQHA 5APYA 2D7SA 4FBUA 4TQRA 4Q8FA 3EPGA 1NAFA 2UVVA 4Q43A 2P7JA 2D41A 3T1AA 3PW5A 3E01B 5KFHA 5AVTB 5HP1B 1S0NA 1IKXB 4MK9A 1HJBA 3MTKA 3LP2A 2B6AB 5KFOA 3HVTB 2R2UA 3RB4A 3OSNA 4RW4A 4GC7A 1T2KC 4C7NA 2ATLA 4H4OA 5KG4A 4ZHRA 5I3UB 4RNFA 2HMIB 5AW3B 1DTQB 2UUWA 4J9OA 4MKAA 1QAIA 3T19A 2W9CA 5EWGA 2UVRA 4LSNA 4ECZA 2E9RX 1GU5A 2OPRB 3NXSA 5APVA 3DRRB 1RA6A 4ZMMA 4GC6A 4ED3A 5AW4B 2XU6A 4MIAA 1DLOB 3QO9B 2UVWA 3DMJB 2Q3IA 2WK4A 1VRUA 1RYRA 2P2UA 1HBWA 5DQGA 1RTJB 3P32A 4I6MC 1SUQA 4MK7A 1N5YB 4O3NA 3MECA 3C6TA 3VMYA 4IDKB 3EPIA 5KFRA 3M9BA 1K1SA 5J2MB 1S1WB 2XCAA 4ECVA 3PW7A 2EC0A 3HE5A 1S49A 1TKTB 5D3GA 2YNYA 3I5AA 2E43A 5AVWB 2Z5HA 1TL1B 3GILA 1S9GA 4MKBA 2W27A 3H40A 4HYKA 1D1UA 4JV1A 3M0AA 3NKYA 4NLVA 1X8YA 3CDEA 3MEEB 3FFIA 4ID5B 1C1BA 4O44B 1DLOA 3QO9A 2B5JA 3DM2B 4O4RA 4IG3A 5AW5B 1C2PA 1SP4A 3L35A 4DL6A 2IAJB 1LWFA 1GZLA 1H88A 1RT1B 4DL4A 1TV6B 4PWDB 3ICLA 4NLOA 1LW2A 3M06A 4NLUA 1MU2A 4U7CA 3Q8PB 4FS1A 5AW9B 2RF2A 4R8UB 5FDLB 5J2PB 2FLLA 3KK1B 3MEGB 1NHVA 3HVAA 3LP0A 1S10A 1QAJA 1JLQA 1GK6A 3H59A 3KK2A 1S48A 4DZOA 2RDIA 1LWCB 5L9XA 3RBEA 3UDLA 5C25A 1KQLA 1KHVA 3MEEA 1TVRA 4ID5A 2YKNB 5CYMB 5KG2A 2IBKA 1RTDB 1HYSA 5K14B 4JUZA 2DPIA 4RW8B 5JXSA 2R2RA 1S1TB 3M8QA 3DRPA 4Q45A 3CIZA 5C5JA 2QV6A 3QGGA 4QWDA 5AVQB 2ZFCA 2BRKA 5DG8A 2HNDA 5FDLA 3RAXA 4AUWA 1FKPB 3D5MA 3NTNA 3DOKB 4NLPA 2FJVA 1JLAA 4NRTA 4URSA 5APWA 1SH0A 2I5JB 4KKOA 4IFVA 5KG5A 1T03B 4QW8A 3BSCA 1JIHA 1RTIA 2HNYA 4I2QB 4RW6B 2WONA 3PR4A 3KLGB 1WNEA 4DL3A 3M9NB 3H2LA 5KFJA 5I42A 3M9MB 1JX4A 3QIPA 4ECTA 4IRDA 3CJ5A 3GV7B 1FK9B 1RT2A 3QYYA 3BQ2A 3JSMB 3T5JA 4M95A 1HNIA 3P7KA 3CDUA 4KFBB 4Y2CA 4XE5B 3QZ8A 2W9BB 5KG0A 4IDKA 4WFZA 3OLBA 3MD0A 1S1WA 3FSIA 4FS2A 4QWCA 2W7OA 3GIIA 2CKWA 1S9EA 1RT4B 3QIPB 1KHWA 1FKOB 1QE1A 4KHMA 3GIMA 3A3YB 2YKMA 2XZRA 1HNVA 4Y3CA 2IPPA 1DTQA 4H4MB 2IM0A 4WE1B 3HE4B 2W9CB 2ILZA 3OL9A 3V81A 1LW2B 4F4WA 1BQMA
chains in the Genus database with same CATH superfamily
4TLQA 2KTQA 3DNCA 1PGQA 1WG5A 1CULB 2ZBCA 2Z4EA 5U47A 1O5JA 2UU9J 4PV1C 1S4FA 2FYZA 1XN9A 4NRUA 2CPXA 3OSPA 4DPOA 5HMZA 1GMWD 2XGPA 1L5UA 2DIVA 4JI6F 1QUPA 2CJKA 3DOLB 1S7HA 4A8XA 3QFWA 1URQD 3R2PA 5I3UA 1SQPK 2HHHJ 1I3OB 2B6AA 5CHXA 1WSRA 5AW6B 2DT9A 1VGYA 2VBZA 3K5MA 2LXFA 2DGWA 1HI0P 3V4QA 1M90T 1ZOYC 5KFDA 3GYNA 3A8KA 2JWAA 2AX0A 2CPFA 4RNNA 1P84E 2MY8A 3HHKA 2BCCG 1R0AA 4B02A 3VAGA 2YNFA 5H9FJ 4A47A 3FWNA 1RLDA 3AE7C 1CBKA 1IWAA 1GAOA 3MD1A 4F4YA 4QCLA 4JYCA 4B3TJ 3ET6B 3OVBA 2QRRA 3NAIA 3CCWA 4K4XA 3TX8A 2QA4P 2CQDA 2J0WA 1LK5A 2VL1A 3FZ2A 5HLFB 3JSMA 3X3UA 4C8LA 2NR0A 4CRJA 3C19A 3DI6A 3BYPA 3TX0A 4NOHA 4ZLPA 3ONQA 3H1LG 3OTDA 3MOJB 1VQKP 2PSZA 1Q4RA 1DEBA 1FNXH 2HNDB 1XMQJ 3E8OA 4ZPBA 3HFVA 3EYZA 3G8SA 3VQSA 4OIXA 4DQIA 2VQEF 3OR1A 1RWXB 3M2UB 2G0IA 4JI4F 4CLFA 2Y0EA 2DGQA 4KE5A 3UN2A 5CAAA 3P8MC 1UEKA 2MJZA 3I0SA 3T97A 1SKWA 3MUTP 1D9DA 4J9PA 1M0SA 1WC5A 3AA8A 2MSSA 2RF2B 3OJAB 3R3TA 2QL7B 1R89A 1LQ9A 4CNYA 2O66A 2FJAB 2D69A 2UUAF 4Z7YA 1MZ9A 1K47A 5D8HB 2XS2A 3D1HA 3NGRA 3JC22 1VK3A 5C25B 1YZ7A 5HROB 1VOMA 4YDXA 3TAMA 2Q43A 1HBNB 1RTJA 1AFOA 1V3ZA 2CZVC 1RF0A 3DYAA 3USSA 4TKTA 2M8RA 5KT4A 2VFVA 2OEJA 4OYAA 4QWBA 3M6UA 2IAJA 2OUGA 2HQDA 3BKTA 3ISND 3KHUA 3CCRP 5L46A 1HQEA 5D6GA 4PRFA 3MPWA 4NZ0A 1NTMD 3KLEB 2LEPA 4DV3J 3A0BH 4EYIB 3QSYB 1R8AA 3HHLB 3OVSA 4PD4H 1NHLA 2ADCA 2CQHA 2HFNA 4IFDK 1RT2B 1JLBB 4ZVUB 2KT5A 2ZM6J 4H13D 3KLFB 4K8RA 2HURA 2ACYA 4M5DA 1L4AA 4KSEB 2PE8A 5A2QU 5LMNF 4WKYA 1OVRA 4PPZA 4DBQA 4DDFA 4CNZA 3D28A 1FOSF 5CYJA 4R8UA 4G1QA 2J0QD 2RMLA 4OI4A 1H2UX 1X4DA 4W98A 1T11A 1LGHB 3QLHB 4PG6A 4KT0C 2W9AA 1U1QA 4RUHA 3MECB 3JCUE 4USUA 3W9HA 4IQMA 1J5OA 1N48A 3GF7A 1T0TV 5F8MA 1XR5A 4QIVA 2IJFA 4CM2A 1TUGB 4NPEA 3EMTA 3OHAA 2OHDA 1Q16B 4Y34A 4F7VA 2F65A 3HF5A 4OX8A 2D2CC 1S9EB 3O8WA 2ATCB 5CCHC 1NSAA 1NTKK 4ICLB 3SEOA 1AFIA 2V67A 3MURP 3OW2O 1WKLA 2VFTA 4ZPCA 1JLEA 5LSLA 4L73A 4ZP9A 2IPOB 3WX4A 3G6EP 1S1UB 1VC0A 2BXJA 4LC1A 1ICEB 3OL7A 4DJBA 1UEVA 1ZOTA 3GYGA 3BZQA 5HP1B 5AVTB 1K73T 1RHQB 4OGQC 1JY3P 1OFCX 1QY7A 3RAMA 2JVRA 4OZ2A 4ANDA 5HK4A 4ECZA 2UVWA 2W01A 3DMJB 3NS6A 2P2UA 5DS7A 5KFRA 4CO5A 3NRBA 3CDAA 2PRRA 1TKTB 1GTHA 3GILA 1ZBTA 2KKHA 1DLOA 2CQ2A 4KHPF 3D3CJ 2E5LF 3AE4C 1QAJA 1YLXA 1SQXE 5KOWA 3TUZC 2B0GA 2YWKA 4YXDC 4IL6E 5K14B 1LK7A 3RW6A 3CIZA 2LQ8A 3I55P 2XYHB 1MWZA 1GXLA 2UV8G 2GUVA 1FA0A 2BV3A 1JLAA 5B66H 4QW8A 3RG6A 2HNYA 2IFMA 3M9NB 4ECTA 4IRDA 3IFMA 3FCVA 3O2IA 2QLXA 1MMDA 2XG8A 1KSPA 4IDKA 4WFZA 3MD0A 3OPKA 1S1WA 5DJTB 2W7OA 1PYOB 3VVUA 3P96A 5E3QA 3A3YB 3Q1MA 1N34F 3L71G 3IWXA 4UT4A 4DV6J 1PV3A 1Q90D 1ZPVA 2VASA 3B4MA 3DXBA 4M5JA 4IR9A 3TYYA 1BQNB 1IO4A 1S1CX 2UXCF 3C16A 1IBLJ 4QR1A 1OXZA 3U7JA 1QGKB 5B0AA 1V5IB 1KOOA 2EFQA 1SFCD 1UVMA 4G1IA 4BC9A 3H5YA 4IOBA 2CPHA 4EGLA 2OO4A 2VA3A 1SUQB 3KUHA 4KAIA 3W1YC 3F5HA 2Z2MA 3L74E 1X9WA 3ISZA 1L0LE 4C3MA 2QJ3A 3VAIA 2XMKA 1ZXGA 1URNA 3CD5A 2Q66A 1R7IA 1L0ND 2M5YA 3C14A 3QPIA 2JOQA 4OYZA 1JUNA 3MMJA 4IKAA 5T14A 4JI0F 2ZFHA 1RHRB 4YFUA 1WHXA 3H1JE 1NH8A 4YHHF 3D70A 3IC1A 2IM2A 4I68A 1M1JA 4DR5F 1WOSA 1KQSO 1BUXA 1IR0A 3QT6A 1NU1K 2LP4A 1VHIA 2KL8A 4DFKA 3ILIA 2KVIA 1HWUA 2FFDB 4HH2A 1DH3A 5APTA 1RGVA 1SQBE 4I69A 2XS5A 4LSLB 2EWHA 1USEA 4FXWA 3H4DA 2E5LJ 1SL0A 3V6JA 2FYXA 3KNGA 1N0VC 1R0CB 1OPIA 2A0FB 4ZVGA 1RHJB 2K9JA 3LP0B 1VQOS 3M6VA 2XMVA 2FKWB 4FBTA 3CJRA 5APSA 4UUWA 1FVSA 3ZZUA 3PP5A 3D7SB 4U6PA 2P9CA 4TU7A 1KFDA 2X3DA 2WPQA 2F4VF 1NM2A 3W64A 2H7HA 1DJ0A 2ZITA 3IF4A 4O23A 2Q3EA 4KHPJ 4NLXA 1ZMEC 1YITS 4EEYA 5C24A 1R31A 3BO4A 2D3O1 2E75C 3DXSX 3QT7A 2FLOA 2D3OR 2N3LA 1R8HA 5DQIA 2PEBA 3O3LA 1BQMB 1K9MQ 4E8UA 1IFIA 5ETOA 5LXYA 2DO0A 1K9MT 3W9IA 1NH7A 1NMEB 5B0BA 3CCUP 2HMIA 1Q7LB 1NKNA 3K89A 3V4MA 1TUVA 1H7WA 3CXHI 2H4WB 2JC0A 5H9EK 3ZC4A 3FBBA 3ZZOA 1DQ9A 2DGUA 1NB2A 2ZWPA 5C42A 1GK4A 4B3OA 2HBZB 4Y65A 4EI2A 1RQVA 2MQQA 4PG7A 1IKXA 2AEMA 2HWIA 2VJUA 3O1LA 2F1FA 4YB7A 2HVDA 4Y99C 2RH0A 3KZIH 4U96A 2PI5A 1U0HA 5CCHA 1RT7B 1CS4A 2I6WA 3PFOA 1RT4A 1PSDA 5AW1B 2MGZA 1N73C 5KKZB 4YXWH 4DL5A 5L1JA 2AYBA 2E1PA 3LAMA 1VI7A 4CLKA 4RNOA 1N88A 2R7SA 5L39A 2FVRA 1USDA 2F5GA 1FJEB 5E5NA 2G4BA 1BE3G 1ZAXA 1J5EJ 2Z2YB 4ZVTB 1IKWB 3BCCE 5E2QA 3DI6B 2KXFA 1SQPJ 3PO5A 1B7FA 1C4CA 4NXMJ 2FB0A 3V4WA 3IS9B 2IZ0A 4C97A 1QLNA 2H5IB 2HZVA 2XNRA 2IJNA 4JI4J 1N54B 4B86A 3CCEP 4NA3A 3CVKA 4RNMA 3PR5B 3OFHA 5F8IA 3CXCR 1LTJA 1Y3KA 2MXYA 3V2QA 5G0RB 1XMOJ 1RWWB 2Z58B 3H4BA 4UUXA 3V5RA 1QSYA 4ECUA 3KKFA 3I0SB 2R8KA 3FK4A 1JTHA 1KOHA 3NMDA 2D7SA 2LA6A 2PT0A 1JJ2R 4QR0A 4Q8FA 4JI8J 3PW5A 3MR7A 3MXHP 3HSDA 4CWBA 5E0OA 4RW4A 1Y8AA 2OEKA 2KI7B 3GR1A 2W9CA 4ZK7M 1U57A 1EDJA 2HGMA 2ZNZA 3DRRB 1VQYA 4WU3A 2YX1A 3QO9B 4YS2A 1O51A 4F2RA 2FIUA 1RE1B 2OYHA 2YNYA 2E43A 2F4VJ 4TLFA 1D1UA 3P5BP 1HTLC 5GAGI 2E29A 3PIPQ 2QMXA 5KLVK 5AW5B 4PR6A 1EARA 1JY2O 2IAJB 5EN1A 5B0CA 3QT8A 3RBEA 2QSFA 3EZOA 2M8HA 2OSRA 3CCJS 2OTLP 2QV6A 4F36A 3PCOB 1ZZFA 5CCMA 4P2XA 3NTNA 1BCCE 2O3DA 4DL3A 2BDPA 1B7YB 2QEXP 1SJ4P 5DZ6A 4PV1D 3QZ8A 2AYGA 3UNGC 4CQ1A 2GHWA 1QEXA 2AF6A 2YKMA 2IPPA 2DRAA 2C3OA 3SCLE 2D3UA 2IVMA 4G3IA 5CA5A 2CJXB 3FRYA 1WSVA 4ZP6A 3MMAB 2ZC4A 4TYAA 1UP1A 4UQTA 3WC2A 3T1HF 1VQMS 2ACMA 3TZZA 1DARA 1RT7A 1YRXA 2OLWA 4IUFA 2QLFB 4OZJA 5IXUA 4L6V3 3RK2C 3GP9A 2NPSB 3Q5RA 4TY8A 1N4LA 2XY5A 3NNHA 3B54A 1FZCA 4DU8A 4JI6J 4HT7A 3CJ2A 1IJFB 3DN9A 1RT6A 1CI6B 3GG0A 2HPCB 4RZRA 2HWHA 4DSJA 1UL3A 3IXQA 4DZDA 2ZOMA 3C15A 4BRYB 5KFBA 2H54B 1TL5A 3TWZA 3M2RA 3PKMA 3HCXA 4F25A 4DV5J 2MTLA 1S57A 2HFZA 3AE1C 1Y7PA 4F8RA 3MCMA 2FZKB 2MQ8A 1XERA 3L09A 4FYXB 3BCCD 2E1CA 3C2PA 3D6ZA 2BE2A 3NL0A 3KJVB 3DOLA 2H5EA 2YXRB 1KYOE 2N1TB 1BHNA 1GQEA 1EB0A 1K0TA 2UVUA 2IDLA 2HGNA 4NXNJ 3CIMA 1UJ4A 1ZTWA 4ECSA 1L0LD 2P6SA 5J2PA 2SPZA 3EGZA 2WW8A 5IQQA 2C0WA 1TU0B 2UUCJ 2WSFH 3B5NC 2KYZA 2FVCA 2WSFC 5IS2A 4UW2A 5AW8B 5ETMA 1NU1G 5ADZA 3BDPA 2I2YA 1MSWD 3FQKA 1S76D 3CD6P 2WRMA 1NTMJ 4HB1A 1DX7A 4TLRA 4DUZJ 2QZ8A 4CT8A 1V6HA 1CI6A 3PJWA 2CADA 5DZ7A 1JTHB 4BBYA 4AL7A 2EFNA 5DG9A 1LNQA 3CI9A 4BS2A 1AV1A 1F2HA 5KAIE 3D68A 3ITHB 3Q5SA 2CQCA 3P8CD 3MFIA 2WPSA 1V3RA 4O0IA 2WTYA 1T9YA 1HPZB 1AFJA 3H5SA 3D1OA 1SQXG 1SQXD 4IOAQ 2KP8A 4OV6A 3I56P 3J7ZT 1BGYE 1AROP 4MIBA 4HT5A 1OW8A 3BF4A 4IH7A 1X9SA 3SQGB 3ETMA 3O6QA 3DDNA 4N78D 2QE7H 2V68A 1EDKA 1B64A 3TUIC 2RN0A 3CJ4A 1TKZB 2WB4A 1JCDA 1FFWB 3L74J 2AGOA 4DCKA 2CQGA 3L72E 3A5TA 1YWXA 1V5VA 2KHCA 2WZ1A 5AE1A 1M5OC 3BREA 4CCHA 1WF2A 4A46A 4EO8A 1X4EA 1EKRA 4AYCA 1I5OB 4Y2AA 3E1RA 1LOUA 3AOAA 4X4SA 2M7SA 2XI3A 1F0XA 1CJVA 4I2PA 2BKPA 3W5XA 1N73B 2BJ9A 2VD3A 3THVA 1RISA 1UVJA 4QIWD 1M90Q 1Q7YQ 3DGPB 1P9QC 2O1KA 1FERA 3HJVA 4PD4E 2BJ1A 2MLYA 4XPCA 3QJLA 3ET6A 2Z4PA 4WP8A 5L8RC 2GW8A 1KLMA 5IT0A 3RZAA 2ZYGA 4NXMF 3C9IA 1DRZA 1NTKG 2ZD1B 4EO6A 1VQPS 2FBWC 1GX6A 4YMEA 2YKAA 2CRLA 1VHFA 4NEZA 2FYUG 5GTHH 3KK3A 5JUMA 3Q89A 4RPFA 3UD4P 2YXLA 5IT9Y 5IM0A 5KFHA 2RH3A 1BSHA 3LQVA 3PKYA 1DTQB 3T19A 2UUCF 3OTOF 1BWEA 1SFCA 4N77A 1F2GA 1RYRA 4K2JA 2V4JB 3MECA 2E7WA 1X31C 2K3IA 3E3XA 4MKBA 3LPEA 3RW7A 3P49B 2Y9ZA 3II6A 3CDEA 3FBFA 3MEEB 3IM8A 1GMVA 3UE2A 1P9YA 4DPXA 1PKUA 4YTPC 3M06A 4NLUA 1MG7A 5D77A 2RF2A 2AJ4A 1WG1A 1RWMB 1RCXB 3TAQA 3RK3C 1I51B 1TVRA 2E44A 5B0FA 4B9VA 5AVQB 2KU7A 3RAXA 3OR2B 2OI2A 1L3VA 1O8BA 5KTBA 2GVZB 4UZCA 3CC7S 5KG5A 1YJVA 1IBCB 1IK7A 5HANA 1IBKF 4IFFA 2JHEA 3M2VA 2Y9HA 2R42A 1HBMA 2GAGC 2W9BB 1YHQP 3OLBA 1U45A 4YOEA 2F9DA 3IA0A 1HR0F 1RT4B 1U49A 1FKOB 4ZCMA 3CCMS 1KS2A 2APOA 1Z56A 4OLOA 1GK8A 5L1LA 1FOSE 1KV4A 4B3SF 2DHAA 1YX2A 1ZV8A 2X7IA 4JOUA 1RWVB 4P10A 2JFDA 1X5PA 2DRDA 3UQSA 3T6BA 5KT2A 3WIVA 5CJ0A 1S59A 4J9SA 1MLAA 1GH8A 4IRKA 4K0KF 2NZ4A 3MM7A 1M8OB 1JMBA 1U6ZA 5M1BA 2JEFA 2B4VA 2QO3A 3K5BA 4DPWA 1YQ3C 1G6BA 3VR1A 2VG7B 4UB6H 2A45H 4M5HA 3T1HJ 1UPPA 4RX6A 1ZA1B 5B0GA 1SB6A 2F7VA 2GCFA 1XR7A 4BWMA 5AVZB 4X4QA 3TQ1A 3VWSA 1PC4A 3EM1A 1ZLLA 5A8KA 1NSKL 1HD1A 4A8WA 1JMMA 4ZVEA 3V6HA 3EFGA 1L3TA 4OLPA 3BYRA 3W2VB 1LT9C 4P7TA 1FWKA 5CD4H 3HMJG 2M0BA 3H1IE 5DJUB 1HNXJ 4ELUA 1NDPA 1DZ5A 3THTA 4FF3A 1BGYG 1OVVA 2HFVA 2L41A 4W80A 2AWZA 3MR6A 5D0RA 1IFPA 2L3MA 2FJEB 2AU0A 2BCCE 1RAFB 1JLQB 2HG5D 1UW4A 2V34A 3BSNA 1CJKA 1LTIC 4NLRA 1YHQS 1SC1B 4KPYA 2ZHOA 1IR2A 1Y4ZB 1FZBA 4RU9A 2QJYB 5J2QA 4DXLA 5KG3A 2WVRA 1Q2NA 3MEKA 4RKUC 4OL8A 3R1HA 4DQRA 1WHWA 2J7WA 2PN6A 2JRSA 3OFGA 1SQVJ 2YIUB 3HSZA 1Q8KA 2O3JA 1URQA 1Q95G 2MHNA 5IV4A 3CDBA 4YR2A 2BQUA 2QJPC 2Y0DA 3F56A 5DG7A 3I4HX 1CJTA 4ZHRB 1VBYA 3Q8UA 4Z7CA 4DPYA 2B9WA 2HQFA 2QL9B 1SCJB 1T9TA 1XNRF 3P5TL 4GO5X 4R0JA 2ZYDA 3VTPC 4ERDA 3KQGA 3LANA 2NRGA 2P67A 4YUDA 2HZCA 3DLGB 4NMLA 2CG4A 2W6AA 1B0VA 4PXBA 1EC5A 1MFZA 5A2QY 2NSBA 3GV5B 2RUGA 3L36A 5LT5A 4DSEA 3KG4A 4WKRA 3OT9A 5F8HA 4F4ZA 1U0SA 3FSYA 1RHMB 1OZHA 2IX7C 3M7VA 3C3LA 1GD2E 3HKZD 4DR6F 1LXNA 2Y8WA 4KGZB 3KNAA 2NREA 1TFYA 2M88A 3TZXA 3DM2A 3L37A 3UPFA 1SJ1A 3J7YI 1M1HA 2BW2A 2HFED 4J9QA 1M5SA 2N82B 4K4WA 2COLA 3ISNC 3KDNA 1W2BR 1NTZJ 2NXEA 5F3TA 2OMOA 3T3FA 1N33F 1C0TA 4O3QA 1I6JA 1YBAA 5AW7B 2WSCC 1T05A 2XZWA 3ZZYA 2CG8A 2CZ9A 2G1DA 1KB9E 4O9BA 4D6TJ 1HUCA 2ZH3A 3PH0A 3DLEB 1XWLA 4ZLNA 1QUVA 3M0DC 3OLAA 5AE3A 1D7MA 3G82B 2L5GB 1JLAB 3G87A 3FKBA 2XKMA 5DGAA 3L7UA 5A8RB 2D3ZA 5AW0B 5C2GA 2J7KA 3IP0A 2KUBA 1LWUC 3QRQA 3W65A 5CYQB 1U1LA 4CLSA 3PEHA 4IOCQ 3UO0A 3WUUA 1R8EA 1WDDA 2QE5A 4ZPDA 4DUYF 1U26A 1WC1A 1C1CA 3B8HA 3OUYB 1EQ0A 3AEGC 3NGDA 1PZQA 2L48A 2R3VA 3BJYA 3B4SA 1T3UA 1VQPP 1PO6A 3H1HE 3W8GA 1LP1B 2OMLA 2OH2A 1EKSA 1IFNA 2DW3A 1L0NK 3H1HJ 1UAWA 4O4GA 4CDIA 4ZN1A 1U6FA 1JWWA 4TQRA 5EHHA 2P7JA 1REGX 1H2TZ 1HJBA 2ZWOA 2XHWA 3PYEA 3N4XA 4RNFA 1YKWA 4J9OA 4ENOA 4WCEQ 2FFDC 4PXCA 4CH7A 2YPYA 1K1SA 3VGSA 4FYDA 1DD4A 4ID5B 4OGQD 2FYUE 1SP4A 2CQIA 3WIUA 4X65J 1PCAA 2RQ4A 1IJDB 3HVAA 3MEGB 1JLQA 3IR5B 4OI3A 4HH1A 2JR8A 4JUZA 1HKAA 1ITPA 3VHQA 1U1PA 3L70E 3EGNA 2K2PA 3DOKB 2QA2A 4D6TE 2YPZA 4DR7J 4Y00A 4Z1MH 2GJ2A 2CVEA 3CW2C 3GV7B 2B7BB 2F8HA 1HGZA 4XE5B 3LW5C 4ZOSA 2YMYA 1E6YA 3BATA 3MMCA 1S9EA 3G3ZA 2I8EA 1RAAB 1NBEB 1YTZI 3M2RB 5L8RJ 2UUAJ 3V81A 1WUUA 4KH1B 3HT0A 1NTKE 3KDOA 3F0NA 1NHUA 4B3SJ 2WTFA 1JLBA 1PP9J 1HR0J 1RTDA 2ZHBA 1GL2B 3V4IA 4KV8A 4MK8A 1NB7A 1S5LX 2FGCA 3G6ES 2DNRA 2H3EB 4A8SA 1CJVB 3M8PB 3SCKE 1CLFA 2YWFA 1S6UA 4DQSA 1M1GA 3AAWB 1EZZB 2MZTA 4LF1A 3M4XA 4ZVQB 4QJVA 2JEEA 1UEUA 4OI2A 5DM6Q 1WTFA 1RWUA 2Y0CA 4TVAB 4X4OA 1PPJD 4NLDA 1FTRA 3ILJA 2CK3H 1HBUA 1TK8A 1YJWS 4KGXB 2VG7A 4IL6H 5IM0B 2GZOA 2PI4A 4P2FA 3TYTA 2WVEA 5CYMA 2ZBIA 1ZM2A 5THWA 4EBCA 5KLIB 3JQMA 5AVSB 4QYZK 3CJKA 3MEDB 1PYSB 1DTTA 1KTVA 3CPWR 4MTPA 2RJZA 1TAQA 1RA7A 3TSIA 5CCLA 1G1JA 2VPZB 2PAJA 4M5MA 1X4AA 5IT9U 1ZPWX 1OWAA 2JJLA 4M8LA 1A9NB 2VIHA 3NMAA 2R3CA 4LF2A 1U1OA 2KNCA 4XO0A 2E5IA 2P9GA 4JF7A 1KD1Q 2W83C 3E2EA 1YI2P 4LLHA 1KVKA 1FDNA 2BW7A 4H54A 2B4UA 3HVRA 2V7QH 3V5BA 3IM9A 3ZZTA 1N36F 1DY3A 4ANCA 3H25A 3DLKA 1FJGF 4GVLA 1IKWA 3MGJA 1YJNP 4WFYA 4HH0A 3RL0g 4OHXA 4X64F 3M2VB 3CX5I 5H1SV 4N47A 1Y10A 1TZ0A 4GVBA 2AEFA 4ZVOB 1K73Q 1QJHA 4O4GB 5LMUJ 4Z2XA 3EICA 3LWLA 4MAKA 2LLZA 1T9WA 4HR2A 3KJVA 2K1AA 3FVYA 1B70B 3EQ2A 2EFGA 1VLOA 1LTJB 2EK1A 2WOMA 3H1IG 1WC3A 3HO1A 3CMAS 1XTZA 5KJ7D 1HQUA 1OS5A 3L3CA 1JXLA 1HQ2A 4AYBD 2R2TA 1LFWA 3DHWC 2HHXA 1N5YA 5TISE 1U4BA 4W90B 2FXPA 5K8MA 1JJCB 2UP1A 5DLFA 4X4UA 1X4CA 1AVYA 2RS8A 2C2DA 2CPZA 3H1JG 2VB6A 3SMZA 2MB0B 3RR8A 5KFCA 4RESB 2KNCB 5M2RA 3U1MA 2LXIA 3LH2S 2W7PA 4LSNB 2XZDB 2QFIA 1N34J 2KIKA 4DMZA 1T9VA 2O67A 3QGIA 4DG1A 4I6YA 2V8GA 1VQ4P 4ECXA 1N33J 1L0NE 1S4XA 2N9BA 2QM7A 1SQBJ 1L0LG 5CCGA 4AXIA 1B4SA 3US5A 4OI1A 4DS4A 1Q86T 2JZ5A 2VV5A 2OP5A 1WHVA 2FJBB 3F44A 3GLJA 3SFGA 1RT5A 1U24A 5H2FH 1TKTA 2W6BA 3MUVP 1J27A 3L75D 2A1BA 1IKYA 4OZ1A 4EZ6A 2XZTB 2R32A 2E42A 3D6YA 2WSCJ 2K1RB 5K14A 2AQ4A 1VQLS 4HEA9 1P84D 5K8OA 1NKCA 1UTAA 4PV1B 2WSEC 3M9OB 3DRXA 2B9EA 3TGUD 3PJ9A 1H7XA 1AW0A 1GMWA 3KMQA 3RUBL 4HTJA 3L73J 2ZBRA 1VQ9P 4M5GA 1YQ4C 5HSPA 3A13A 3LP2A 1BMQB 3DRYA 4H4OA 4ZHRA 1NJWA 2R7VA 1K44A 4ZMMA 2E74C 4J91A 4V19J 2HQIA 4DSKA 4AQYJ 2H8PD 3A3OB 2MKKA 4JB8B 2EC0A 1FZCC 3MIWA 1YITP 5D3GA 1S3JA 3VV2B 2KK7A 2G2YA 4Y2IA 5DDOC 3FFIA 3G71S 3UVJB 1MNEA 3F41A 1IR1A 5T7LB 2FVSA 1GK6A 3MP7B 3GCWP 4L3KA 4P52A 2R2RA 3WZ0A 3B5NB 3MPYA 2I1KA 2HNDA 1FKPB 4M63A 2PEHA 4NRTA 5FLXU 3EWGA 4RW6B 2WONA 1U7MA 1PP9D 1SQPE 3NNCA 1RJJA 3Q83A 1HBOB 1PIEA 2GQCA 3N4WA 4Y2CA 3C14B 1X4HA 2UUBJ 4H13B 4QU6A 1L3SA 5HMWA 4J5OA 4WE1B 1TUWA 1RQ0A 3VALA 1VC6A 3OL9A 2OGUA 4F50A 2R8JA 1MN7A 3TW0A 4WY4B 2E74B 2XULA 3Q23A 3KG0A 2VKRA 3C1LA 2DGTA 3PHEA 2IBZE 4OYXA 2ZH2A 1S77D 2I5JA 1TFWA 4ZPAA 1KKHA 2E9ZA 4A7PA 2AEJA 3EXYA 5A76A 1WT6A 5IT4A 2KZZA 2W2PP 1W26A 3QJPA 2ZDOA 3NWGA 4G65A 3MWBA 1L0NJ 4DV0F 2V0NA 5MLCV 3HUSB 4Q5VA 1IXKA 3WDOA 1NTME 3LW5J 3N6NA 3ILLA 4WU2A 9RUBA 3VGTA 1JJ4A 2FDNA 1YI2S 3E01A 2XY7A 2ZYAA 3K57A 1JCCA 2XMMA 4XA4A 3RU0A 3FRZA 2R7OA 4YB1P 2CPBA 3MDFA 1S0OA 4C48A 2IMWP 2BCCJ 3LP1A 3KHRA 4NPFX 3M9HA 5KT6A 1WF0A 1QTNB 1UA1A 2W25A 2C28A 3P8CE 2ZJSE 1LJ2A 3P45B 2JNJA 4DR4J 1ZETA 2JC1A 3DU6A 1N7SD 1XNQF 3MPVA 3TARA 1Q0NA 3PRDA 2FVPA 2EK6A 1RKIA 2D1CA 3N5BA 2JDIH 2HQCA 4M5KA 1S9KD 1F3VA 4OHVA 3U27A 3RBZA 4JI8F 4TU8A 2V5HG 2LYVA 4CO0A 1MKMA 1K05A 4WP3A 3SYZA 1VJQA 4OMFG 5HO4A 4C8MA 4H4OB 5IZHA 1FU1A 2Q9IA 2KXHA 1S1XB 2CA9A 2NPIA 2IC3B 2Q5UA 3MMCB 5ETSA 2ZJRQ 2OYHB 2ZEJA 2AJQA 1NTMG 4YP3A 3FEZA 1VQNP 5HVHA 4F0MA 1UFWA 4IR1A 5H9FK 4RBUA 2DCUB 1EZVI 1SC4B 1UMJA 4N3YB 3MM9B 2EBGA 2QYGA 3O8ZA 2IIHA 5F8JA 4DR7F 2E5YA 4OZ0A 2J6UA 1RF0C 1N5QA 1S1TA 4RJVA 1Z2LA 3EUNA 3M8ZA 2MDAA 4PUOA 3DMJA 3HDSA 3FSXA 2YWEA 3DC2A 3U1CA 1RE4A 2I38A 3D9BA 2ZBQA 3CJSA 1VQ6P 1S1VB 3PYGA 2NZCA 3PZPA 5HQ8A 2IA6A 4FYYB 2MZSA 3KLEA 2NXNA 3OL8A 4BWNA 4UB6E 2R7RA 2OQQA 3CMAP 1NAYA 1PGJA 2H1YA 1HBMB 2O01C 5KLVG 2GAHC 2DEIA 4IO9Q 3OW2R 5KAFH 2OPPA 3MMBB 3D6HB 3OBIA 4HKQA 1KQKA 2HFSA 3A0HH 4XIUA 3A1YG 4YB5A 1LTJC 1HWLA 1OSCA 2OPQB 4KC5A 1YTZT 2O1PA 4WK3A 1RF1A 4QW9A 1Q82T 4C46A 2BYCA 2J6TA 4I7ZB 1EZVG 7FDRA 4ELVA 1BE3E 5M2PA 3ENAA 2JO1A 3K5PA 1GMJA 3OA7A 1E6VA 1KEKA 2XSJB 1MUUA 4EYYQ 4NLQA 5J1PA 3D0HE 1XK8A 2RRBA 1C0UB 3JXOA 4UOCA 1ZAWA 2V69A 4K50A 4BWJA 3PJXA 3T9ZA 4GDOA 3GW6A 4U8VA 1NPRA 2WHOA 3Q3DA 4E0DA 5BYRA 2J58A 2RD5C 1RE4C 3DRRA 1NTKJ 1KD1T 1CVJA 1BSNA 5J1EB 2HYIB 2V8VA 1S1VA 1B0PA 2I1JA 3ETOA 5LMNJ 3L74D 2QC3A 2BEZF 5D0HA 4H0LB 3D1QA 3CL3D 3EFFK 2B56A 2ZOFA 2YWGA 1QVGR 4WJBA 5CHCB 4Y2MA 4Z37A 2QN6B 3L71E 1YJNS 1DURA 3VTIA 3PIOQ 2Z57B 3GSDA 1VS3A 2FYUK 2E5JA 1Y9BA 3DOMA 3PYFA 1NK7A 4PWWA 2EFPA 1IKXB 4QR2A 4Y28C 2XY6A 1T2KC 5D4NA 4NPOA 1F5BA 4UY85 3AFGA 3AD7C 4B3MJ 4ED3A 4DV4J 5EFWB 1J2VA 3PRVA 3W7BA 2VFUA 4ZN3A 3CMES 4U95A 1N5YB 4N41A 1GL2A 4GKJF 5K5MA 5HJXA 2KG0A 4O44B 2VQFF 2B5JA 4EUVA 2UV8A 1KILB 3S1TA 3CD7A 4ID8A 4NLOA 2XSJA 3OR2A 3LP0A 4U67Q 4DZOA 2GVZA 2K37A 3RL0C 1KQLA 3W63A 1KQFB 2V50A 4H4KA 3I55S 1SJQA 5AT1B 3QGGA 3W9JA 4P7VA 3SDEB 3PX0A 4URSA 1IK9A 4LF8J 3W60A 1YQHA 4B3RF 2BM0A 1JX4A 4JI1J 4OWFA 1RT2A 1BD6A 3D6MB 1Q53A 3MD3A 3JSMB 3P7KA 4KFBB 1KBRA 2MKJA 4LBHA 1WACA 2L9NA 2CKWA 3Q24A 4Y3CA 4F0HA 4QMAA 3AE6C 2FHJA 4ES1A 4NLWA 2B87A 1IFMA 2R5BA 1G2CB 4BLGA 4URGA 2V7QJ 3MUDA 3QLHA 1FDAA 3OXFA 4JV5F 5KFUA 2JLGA 3MPUB 4NEYA 1AZSB 3RGUA 2GJIA 4RW7A 3TJAA 5F3ZA 1P6TA 3BGRA 1D8YA 2KXPB 1IZNB 1W5CE 1N7LA 1SQPD 3SFUA 4YR0A 5RUBA 1S5LE 5BU8B 3BV8A 1RTHB 3V2NA 3DLGA 5HP1A 1C1BB 1ZAVA 2ROEA 3FNNA 1NRKA 3R1LA 2RQKA 2VPYB 3IG1B 3M8PA 4DV0J 4NLYA 3H1KG 3NMRA 3GPAA 3AE2C 3ZZZA 3S8SA 1S6PB 4M5NA 1M5HA 9ATCB 3M8SA 4E98A 4MJKA 2EKYA 3MGNA 1H74A 1TL7B 2IBZD 2WMMA 2ROPA 4H44D 4WFAQ 2MLXA 3QWPA 1NSQA 2R7UA 3G86A 5T7LA 2VU5A 1YGYA 4J9VA 3TA2A 3Q8RB 3Q22A 2ILYA 4TY9A 3IS9A 4JBCA 1SQQD 2GA1A 4B9MA 1NHKL 2Q1LA 1C0UA 3TVYA 5AJ3F 4EFAC 3CGIA 1KYOH 3ABVC 2XNXA 2E1MC 4R0EA 3BB5A 4C11A 5CZXA 3I0RA 5BYSA 2HBQB 3LAKA 4CLWA 4CLLA 2HRTA 3H1KD 1VCTA 4O3SA 4W7ZA 4OI0A 2R44A 1RBLA 1H8AA 2IC3A 3AXKA 1BDDA 1R8CA 3FDSA 1VF5D 1VK8A 1NK0A 4ED6A 2DIUA 3L72J 4I67A 1KR4A 1L3KA 2R5DA 2DGOA 5HVGA 2KT2A 4M1KA 2HQ3A 2VONA 3MM9A 3RBDA 3AB4B 4LF8F 5C39A 1TKXA 4DCJB 2AKWB 4JI1F 1BGYJ 4IG3B 1OY8A 2DNQA 2HAFA 3S7RA 5BXIA 4Y99B 8RUCA 2OELA 1JLEB 1CZQA 3Q5PA 3HRNA 1HVVA 2MKVA 1LKZA 2I8DA 1NWQA 4OYBA 2UXDJ 2IVFB 1EJ7L 3HD1A 1S1UA 1NTZG 1JK9B 1RUSA 2QA4S 2IY5B 2BASA 4WY4C 4DFPA 1F9HA 2B5JB 1PBUA 2RU9A 3RAQA 3TVKA 3KYLA 4KR0B 2H4YB 1KC8T 1TK0A 4ETZA 1NZAA 2GV1A 4ILRA 1IC2A 3CWJA 4FF2A 3T5HA 1EZVE 1Q78A 1N32J 4DX6A 2AGQA 3JCUH 1REVA 2RB7A 5CBOA 4N7TA 3OTBA 3GQCA 1TAUA 1RT3B 4RR5A 1FRMA 4QYZJ 3AE8C 2DGVA 4YDDB 4U3FE 1UZDA 4NCAA 1A02F 4LF6F 3MUMP 3LF0A 2OJ3A 2V9WA 5CCHD 3UFCX 4MN4C 3MTJA 2V2QA 1NJXA 2RU3A 3DLLQ 1IFDA 1IKVB 4L72B 4WFBQ 1NJZA 2DBBA 3DYAB 3S9OA 2JL9A 4C3KA 3IFEA 3BQ1A 2QJYC 3TRGA 3EVOA 1HGVA 3PNIA 3C8VA 2WWWA 4K4VA 2LFVA 1SQQK 3AJDA 1X5TA 1N6QA 3RR7A 2YH1A 5E3AA 2O1JA 1YIJP 2KT3A 1YSJA 2DGSA 4U9RA 2FC9A 1R0BG 1WEYA 1P1LA 4W92B 3EE3A 1RE3A 2Z2ZA 3K7RA 1JY2N 3BCCJ 3M8QB 1H2VZ 1BE4A 3Q86A 3BBCA 3SIPB 2KM8B 4NWBA 2B6AB 4F2SA 2E76B 3D0GE 3D66A 2FYNC 2LEBA 2OPRB 3QGPA 3OR1B 4MT1A 3G4SP 3ZNUA 2Q3IA 1HBWA 1GXUA 3P32A 1SUQA 3IO1A 2XCAA 3PW7A 2LQBA 2IHR1 1J1EB 1NJYA 5JVHQ 3VAHA 2V8HA 1G7CB 2KDOA 1YZ6A 2OARA 4I7ZC 4R8UB 5J2PB 3KK2A 2DR5A 1KYOD 2V94A 1KHVA 1HYSA 1N36J 1QAXA 3L73E 1N7SB 2MJNA 3G4SS 1N7SC 4IFVA 1NKBA 1NCLA 2YWHA 2AYMA 3AD8C 1FNOA 3C66A 1FK9B 1M1JB 2PGCA 2G9OA 2HS3A 1U0HB 2EG1A 5GMEA 4QIGA 2Z0GA 1LT1A 2AJFE 1QSSA 5LMUF 1RAEB 2MGZB 3PFEA 3QT5A 5GADU 3HE4B 2X1AA 2J59M 1LTAC 1OWXA 3R7BB 4DV1F 4UB8E 3GG1A 2OPSA 4C8YA 3JS9A 2MQNA 3T5KA 2FGOA 3M0DA 3GFYA 3HHNB 2B8PA 2DXFA 1PYTA 2X1BA 3VVTA 1VQSA 5E3RA 4X62J 3O44A 2XMUA 1XJWB 4DN0A 4OHZA 2AZ1A 2HR3A 2IBZG 5EUHA 4NXNF 1VQ5S 4PJ0H 3LALA 4CIOA 2BABA 3DRSA 4RWWA 3W5ZA 1AUDA 1IQZA 2FZGB 4F67A 3N0VA 1RHZB 2CJQA 1OJ4A 3NAHA 4K4UA 2WZ7A 5IFMA 2ZJPQ 2VC0A 5KFNA 3Q0AA 2ZH1A 2WQYC 4Q2MA 2B88A 3WU2E 2KG1A 1RTHA 4J9LA 2E1AA 4ZP8A 1SJFA 1SVDA 1WEXA 3TJ8A 1ZM3A 4WE1A 3RYLA 4Q0BA 4IFVB 2WT7B 4OYOA 2V4QA 3HE5B 5KLVJ 3HKWA 5EWEA 2K1RA 4CZCA 3QFHA 4ICLA 1Y47A 1DBDA 3R6LB 3QAUA 1TL3B 1RABB 3NCPA 4EZ9A 1ZW0A 1JLFB 3HULA 2J0XA 4ETXA 1NSPA 3OTEA 1SH2A 4QYRA 3CC2S 2XNDH 3CCVS 5HBMA 1S2EA 3CLQA 4DG1B 4GKJJ 3TQEA 2FXOA 1CULA 4FPIA 4HI2A 3E1IA 3WQPA 2LQJA 4CLUA 3D0IE 4MYTA 3B4DA 3WC0A 2XB2D 3BO2A 3ZTRA 1KLMB 2E7XA 2DHSA 4D6TD 1RYSA 1VQOP 4FP9A 4RBVA 1Z1ZA 2ZH8A 2WSFJ 3BM7A 3QRRA 1YJ9P 5J1NA 3GFZA 3KLIA 4ZJOA 2K9YA 1O6XA 3LPYA 2IFXA 2C2RA 8ATCB 1FX4A 4WIIA 1YVFA 2M5AA 3R7NB 4J9MA 3R5JB 4LF4F 4WY4D 2HS4A 5GTIH 5FD1A 3TAMB 5LXRA 4OYPA 2OTKE 3BO3A 4LF5F 1X0FA 8AT1B 4KGMA 2DH9A 2W4PA 3H5UA 3W62A 3W66A 4FYWB 3NWRA 4I1LA 3BPSP 3AT1B 2YNGA 5B7WA 4QPXA 4PYAA 2NXJA 2MQOA 4DX7A 4KB7A 3K5NA 2DNZA 1PBAA 3Q8VA 2Q3PA 2DXEA 1JM0A 4PQUA 5AXLA 4OQJA 2IBZI 2HSEB 2QFJA 3D6TB 4TY8B 3J7Z5 3J7YU 2RKIB 2G13A 1N5VA 1N2DC 3FC9A 4LJMA 2DCLA 4OZ3A 5L1IA 2MSTA 2IYOA 3PW4A 1PPJE 1RTZA 2G0JA 3LIDA 4DL0C 1U7LA 4KGVB 4NE9C 1M57D 4BRYA 4USIA 4C8OA 1NPPA 3KDPB 2GFFA 1BQXA 4I2PB 4CLYA 4M5DB 4KHRA 1V9OA 2MKSA 2JEIA 4J9RA 2VDIA 1AQTA 2ZOGA 1FKOA 4ECWA 1IKYB 1HA1A 2C2ZB 2LVWA 1LTGC 2LMIA 1T02A 3E51A 3L4FA 2W4CA 1WG4A 2FQQB 5APXA 2FLNA 3PJSK 4OX7A 4JP8A 3CJTA 1AVOA 1VRTA 3I0RB 1FEEA 1NU4A 1KRPA 2H51B 1YJWP 2DR6A 1Q7YT 3A0BE 4A8QA 4M5LA 5BJRA 3HUSC 2YNIB 1KFNA 3KG1A 3M32A 3AEDC 1Y5IB 4XPEA 1Z4UA 3IRWP 4C9DA 2P8IA 2R9LA 2DPJA 2GM4A 3L70G 4WFNQ 5KJ7A 2HBYB 4LVOP 3AE3C 2R7QA 5B5EH 4WF9Q 2V8DA 1U7JA 3UNYA 3NEKA 2G2ZA 1EDLA 1U02A 3IRXB 1HQEB 4RW8A 1W2EA 2A6OA 2A2DA 3S6EA 5KKZC 3T1AA 3BVHA 1FS0E 3HVTB 2IFNA 1U25A 2FYUJ 4MKAA 1WRGA 2HHWA 1TKDA 3RK3D 1L0LJ 2W90A 1RTJB 2BEFA 2R7XA 2HHVA 1PGZA 4HYKA 1NDCA 1RKJA 3M0AA 1L4AB 3L35A 1S99A 1AZSA 4K2XA 4FS1A 5AW9B 3KK1B 3A8EA 4B9TA 2M70A 1RTDB 1S1TB 3ZNJ1 2KYVA 2DNHA 4ZITA 1VIOA 1SC6A 4NLPA 3GE9A 3H1KJ 4DU7A 1WNEA 4ZDNA 3H2LA 1NO8A 4ZJQA 2VPXB 3OQ2A 1X60A 4ZIWA 1PFIA 4M95A 1FJGJ 3W8PA 3NXZA 1QDUB 3EXCX 1NTZE 3OFEA 4GMKA 3N7NA 2VICA 4PG5A 2CQPA 2Y0BB 1KILA 2M9KA 3GIRA 4CO4A 1X5OA 2KZIA 3IBWA 4K59A 1AA0A 4NCGB 1SXLA 2OSQA 1GNKA 2FC8A 2NZ2A 2C9LY 3FWLA 3NY0A 5E3CA 5DDPC 2R8GA 1AB8A 3U02A 1RI7A 4Y6IA 1SV5B 4ECYA 1EP4A 4FVMA 2HLOA 3HVTA 2J76E 5KFSA 2OD6A 3GONA 3G2XA 4DR1F 3FEYB 3H32A 2RRAA 4DS5A 3OJUA 2P58A 4I4BA 5A8WB 3DGPA 1YRTA 4HJGH 1XQIA 1S72S 2LA4A 1E79H 1GL2D 4USJC 1H73A 2BKNA 2O5DA 3MPDA 4DT0A 2ASYA 4LFBF 2L9DA 1NTZK 3R5DA 4DN9A 4DLEA 2OIHA 2C22A 3JSVC 2HEKA 3CDWA 2VFRA 3MFHA 2ZH4A 3S01A 1GU4A 5KG1A 2Q6CA 1RWNB 2OPRA 4A8KA 1LWCA 1ZP0C 2E9TA 2ZAEB 1VRTB 1ZZNA 3N79A 2BJDA 3CCLS 3DKDA 3CJQA 4P71A 1KN7A 4LR8A 1D09B 1F3FA 2R8IA 1AT1B 2WVCA 3DLKB 2YXQB 4TNOA 4USWA 2NPSA 2ZZTA 3H7HB 3I31A 4USMA 3FZBA 1HBOA 1H0TA 3CCTA 3GV8B 3GCXP 3KK2B 5MAOA 4KT0J 2YO3A 1M1JC 3PHTA 4LGDE 2K88A 5DGBA 2I9SA 3FX0A 4UQGA 1YYCA 3CTRA 4RU2A 5CD4A 4QWEA 3KTQA 4JYAF 2MKCA 3CCUS 3M1VA 2QRXA 2DHHA 1HWJA 4DPTA 1S9FA 4N78E 1MMLA 2YBVA 2G8YA 3B8EB 3A4TA 2DK2A 3H1HD 5HLFA 4ZLJA 2KHDA 2QLWA 3MHYA 3BH7B 3BN4A 3LGMA 2BE2B 1SQBK 1DFDA 2W8ZA 2VOOA 1U47A 3B5ND 3UDEA 5L38A 3HFKA 3HZEA 4GKGA 2KZMA 3JB9k 4OX9J 2QTWA 2B51A 2ZHAA 3RK3E 1CJUA 5T41A 2DNNA 2J7UA 4NA1A 2J5AA 3FQLA 1Q81Q 1Y11A 5GVQA 4QU7A 1LV5A 1APSA 1HFEL 2PC6A 2RAQA 1FBMA 3SI8A 3AJ2A 1W7WA 1PP9G 3HP6A 4NLTA 1FI4A 4XAKA 3M2UA 3DOKA 3QGHA 4I6WA 1WOOA 3ITKA 3RTVA 1FKAF 1RT5B 5EX0A 5F0UA 3JSBA 2DD8S 2VG6B 2MZQA 3T6JA 2EPIA 1MFTA 4QZVB 3W61A 2HIYA 4Q0BB 4FXVA 7FD1A 2JWNA 4HI1A 1SBRA 3CJ0A 1Q81T 1GX5A 3OD2A 4GOFA 4ZVSB 4ILLA 2WB1D 5D4LA 1H3DA 2HWTA 1TL1A 3KUGA 2MZJA 2Z56B 1XC9A 3MM6B 1LWUB 2WITA 5DO2A 1K1QA 1FE0A 3BKFA 4DSIA 5APQA 4AQRD 3C46A 4S0MA 4WWSA 4KHXA 3NP5A 2C2OB 1S0MA 3CJ3A 1S6OA 1D9FA 4ED8A 1ZR2A 1NTKD 4DLGA 5D3GB 2HPCA 5BR8J 4NCGA 2C2KB 2DKOB 3UIAA 4OV1A 2NYHA 2M0GB 4WPAA 2V6AA 5C24B 2X1GA 2QM8A 1UVLA 4X65F 2F8MA 4C7QA 1REVB 6AT1B 1VFJA 4NL5A 2LECA 5A6WA 2GGPB 1NNDA 1F9EB 1XMQF 1SL2A 1DQ8A 2VHGA 1WC4A 2F3JA 4CLPA 1T7PA 5B08A 4OYMA 2KZJA 4NPDA 4LBIA 1U2CA 1SQXK 4AUKA 4ZCKA 1G4CA 3CCLP 3ZFVA 1HHTP 2OYIC 2SXLA 2CZ4A 2BEQD 1ZA2B 3RK2D 3B5NA 5BR8F 2HODA 4DR5J 4WP9A 3PX6A 2Q1KA 2KLUA 2NSCA 2BJ3A 3EX7B 2UWJE 1FRXA 4CTAA 1HLWA 4LVNP 3AE5C 2EXUA 5JJBA 5DQGA 3H2VE 4MK7A 2HHHF 5FLXY 1M1KQ 4HDHA 1TL1B 1FVQA 3NKYA 1C1BA 3DM2B 4O4RA 3FEXB 2XS7A 1G1IA 1LWFA 4N5SA 1TV6B 5E33A 2OTJP 3ZZRA 3PHLA 3P4UB 1S48A 2CWKA 1C4AA 3BKUA 2IBKA 2YKNB 3CWBG 1P8GA 3K8WA 3M8QA 4Q45A 1CEZA 1SQVK 3GHGA 3D5MA 1PJ5A 2OKQA 5IWAJ 4I6AA 3PR4A 4PZVA 3M1VB 1ULRA 2KH9A 1HD0A 1OQ6A 4AT1B 4GKKJ 3H2UB 3CDUA 2V2VA 1UIIA 2U2FA 1NDKA 1WWHA 5LSOA 1KHWA 1QE1A 3GIMA 1HNVA 2AW0A 2PFFB 1XBWA 4DOZA 1X9MA 3GTYX 4JV5J 1UWBA 2CYYA 2YY3A 5KFQA 1NK4A 2XSFA 1SKUB 4K7QA 1PGPA 5DLGA 3TNVA 2GUSA 2CUYA 3K5LA 1HQUB 5SZTA 3LGHA 2KRBA 3TF5A 3G82A 2YO2A 3R5AA 1UW9A 3PO4A 1RF1B 5KOXA 5KLIC 2FFDA 2VBWA 5ETQA 1U09A 5E79H 2HQGA 2RQMA 1URQB 1LTTC 2K7JA 2JEJA 1Y3JA 3O5TB 3RK3B 4ED4A 4RUAA 2DVIA 3EJMA 1NKEA 1CG2A 2E7VA 3I9ZA 5CZVA 4H0LC 3EDRB 4L3NA 3TGUJ 4O44A 2FY8A 3BS9A 1EETB 1UCNA 3UD5A 2YQ3A 3D67A 1QLED 3EWKA 3CCES 4L75A 2XO6A 4KGKA 1JLGB 4LR7A 1JMTA 1MWQA 2BM1A 1J2JB 3SCIE 3L75J 1UJ5A 4PUOB 1RWPB 2HK3A 3TUPA 3NNAA 2CJBA 5ETKA 3VGVA 2DNGA 2B9YA 1L3UA 4M5IA 3NCQA 2BANB 1NK5A 1MROA 1HNXF 4FVCA 3V2UC 2PDAA 3CX5D 1S9KE 3LIEA 3SWKA 2AV5A 4X66J 2E5HA 1RAJA 2WAQD 4W4MA 2XHCA 2DRBA 2PFDA 1S6QB 4URQU 4DV4F 1E6YB 3IWNC 5ETVA 1FWLA 1SS1A 3ZTSA 5F8NA 2XO7A 2DY1A 2NPSD 5DDRC 2KM8C 1SQBG 5C42B 2MKIA 5B0DA 4WBFA 3UWTA 4IH5A 2AJ1A 3BQ0A 4U7UK 3KPEA 4ZCIA 4A8FA 3M6WA 1HYSB 2KOGA 1FXDA 2WOMB 2F9JA 2W1BA 2YNFB 2OD4A 1T94A 2KXNB 5CYQA 2Z30B 3A3PB 1B99A 1J1EC 1RTIB 3KLGA 4C7NB 2CJ9A 2BCCD 2ZT9B 3G9RA 2H89C 2FYUD 4EDFA 2EW9A 5DRKA 1DEEG 2HLUA 2AGPA 2V9KA 2FVQA 3SSQA 5I3QA 4R4LA 1S6PA 4ER8A 3PTWA 1WI6A 3H32B 1S7IA 4IQXA 5KAIH 3FFIB 4B3RJ 3HM9A 2A06G 2IJRA 1OYDA 4FXDA 3MM8B 1FF2A 2N1TA 3SFEC 4X2BA 3K58A 3QRPA 3V6KA 2ZXEB 2XI2A 3PG9A 1XEZA 2POKA 2O01J 3GF3A 3B6BA 1U8SA 4EIJA 3JTOA 4R5PB 3UCUP 3MR3A 4OH8B 2XMTA 3PLNA 5GTIE 2WPRA 5HMYA 3RB0A 1YJ7A 2VG5B 4A48A 2GIFA 1ZTTA 3POTA 1K04A 4ZPVR 2MLZA 3AEAC 3KHHA 3QSIA 3CCRS 1FZGA 3F73A 1XR6A 1GW4A 3DOMB 2KSEA 3J80Y 4JI7J 2CQ3A 3TAPA 2F40A 3BH6B 2FJDB 1BC6A 2FJXA 2VC1A 2K3RA 3S4RA 1ZR4A 4AE5A 3V6DA 1HNWF 2D9PA 1FJKA 4PJ0E 6FD1A 5GMDA 2UXBF 4O0NA 2FPHX 1SQQG 3NS7B 1TP7A 2IM1A 2VODA 3ITHA 4K4SA 5AVVB 4A8MP 3WBZA 2RDJA 2V2ZA 2LXCB 5K9FA 3NGUA 3BRVB 1WOPA 3TUJC 1VQMP 3N01A 2W24A 4KFBA 1JJHA 5DQHA 3H1KE 2IA0A 1VDHA 3BBFA 4FBUA 2ZT9D 1NAFA 4Q43A 3E01B 3CXHH 4MK9A 1N52B 1KB9D 2ATLA 4DR6J 2CPEA 3PRBA 1ROFA 5AW3B 1Y9OA 5EWGA 1Q5YA 4CI0B 1RAOA 3NXSA 4CH0S 3CWBD 2WK4A 1YK9A 1U8WA 4C6AA 1T9XA 1KTQA 4JV1A 2W27A 2AHOB 4H13C 4P6QA 2FD2A 4U7CA 1R6VA 1I1GA 1W2IA 3LW5H 1UFKA 5C25A 5KG2A 4LT6A 3HPOA 4RW8B 5JXSA 1HBNA 4GRSA 3G8TA 3J81j 2MZRA 1T95A 2ZFCA 2KI2A 3MM5B 1NJIT 3HJFA 2A10A 4KKOA 3BSCA 1YJ9S 1EQMA 1SQEA 2JX2A 1PJ6A 2NCKL 2J9DE 1KONA 3MM6A 2GO9A 3I9V9 1PILA 2AD9A 1HNIA 5KG0A 2ZH6A 2RUSA 2HGLA 3FSIA 1ZH5A 3QIPB 2QX0A 2XZRA 3H1LJ 1MMNA 1CC8A 1SI9A 4DR3F 4PAAA 3FCWA 3BCCG 5BYQA 1N6QB 1OO0B 4IG0A 1FRHA 1RBAA 3FMWA 4V19X 4LBPA 2YKOA 3BSAA 1D8ZA 2ZKUA 2QA1A 1YDLA 2J9EA 1VQ7P 3MAHA 1JLCA 2MQMA 1BGXT 3NBPB 2MZ1A 2H88C 3VF0B 4CH1A 1VC5A 2I1RA 1AQ5A 4CYUB 2JDJA 3VOPA 1IBKJ 3BR9A 4N6JA 3EGWB 3JAMY 3IR7B 2W8KA 1T8ZA 5HROA 4U7UD 4LFAJ 1HHSA 3I5CA 2HHUA 4UZBA 2NUUG 3A8JA 1EQ7A 3PRJA 1TTHB 3MOZA 1XMOF 1EP4B 2ZVOB 4NMXA 1KILD 1Y5NB 1NUEA 1KN6A 3HD7C 2HODB 2XLKA 4R4MA 1RDRA 3FUYA 5A8WA 1I94J 1NKZB 3DDIA 5IV3A 1EIYB 1JLFA 2LDYA 2LKMA 2DR8A 3IBCB 5KAKA 1SFCB 1FZFA 2VQEJ 3KJQB 1E6VB 2JP3A 1VJWA 5LJ5Y 3GIKA 3SV3A 4B9NA 3ENVA 2BR0A 1VQLP 2KSJA 3UDCA 1HL6A 3EDQB 1S4EA 2AYEA 4B9UA 3IN5A 3M9QA 1VLYA 4JYBA 3AB2B 3WMM0 2VFSA 4ATNA 1S12A 2KLVA 2P9EA 1IUJA 4PABA 2FUG9 3HZGA 2ITAA 5KFPA 4PPDA 3UCGA 3NGSA 3H6PA 4NYPA 5E3PA 1NVOA 3SQOP 1RU2A 3UI3A 2RDDA 5AVRB 4YR3A 1J5EF 3K59A 1URQC 5AVUB 3OTOJ 4RW4B 5AXMA 3N6MA 4WWIA 2X1FA 2N7CA 4DR3J 5F41A 1OMIA 1V3SA 4GKKF 3HD7B 4LRBA 4O3PA 1VBZA 3MR2A 1H0HB 1P27B 3M6XA 3BPDA 4J7CA 1LWXA 4PG4A 4AD6A 3H42A 2FJWA 4D3HA 3AQPA 3C6UA 3W2VA 2HRYA 1GT8A 3HXMA 1NOHA 2EG2A 2P10A 1JNMA 1NK8A 4OX9F 4ZKPA 1RAGB 2BQRA 1HF9A 2QIFA 2EI5A 3M91A 3CD0A 1RT1A 3AEBC 1EX8A 1FDBA 1KP6A 1TL3A 3CUNA 4WZQA 1WEZA 4HACA 2R2SA 4IG0B 1XIQA 1UVKA 4CO1A 2FXMA 1JLGA 1OMSA 1UVIA 3TO8A 2AMCB 1U1MA 1EXIA 2HHPA 2JLFA 4HL9A 3HD2A 1QVFR 4OGQB 5J2NB 1NZ8A 3RK2B 5DM7Q 1KLNA 3OL6A 2ERRA 5KFXA 2ZC3A 1URRA 1WC0A 2Q7CA 3PW0A 3MCSA 4F4KA 2DXDA 2H65B 3KZIE 2Y1JA 2OEMA 2X51A 5HVFA 1CQMA 3PEJA 1CJTB 3IBFB 3EZ5A 1CJKB 1PL5A 3AEEC 2YNHB 2WT7A 4J37A 4K4TA 2JWDA 2ALZA 4NYZA 2KJWA 2RE1A 1MN9A 5I4MA 1YBUA 2QGFB 3ZZPA 1DD3A 4K3AA 3P6YC 2KN4A 2QL5B 2JLEA 2MJUA 4PD4I 1S6QA 5E79E 2RS2A 4LFCJ 3IAOA 2E74D 2PP6A 4DF8A 4I7FA 3U1NA 4OVNF 2PGDA 3AECC 4KO0B 4ED0A 3N5FA 3ZTOA 5TJHA 2D41A 3R5BA 4IYQA 5KFOA 5KLVD 2CQ1A 4ASVA 1GU5A 4GC6A 1SQFA 1YTYA 4OJHA 1FZCB 4A4JA 3JTPA 5KAFE 3C6TA 3M9BA 1S1WB 1VQ9S 2ZZNA 1U2RA 4UF4A 1HHQA 2YWWA 2ZNYA 1AA1B 5I3PA 3R6GB 4B17A 1SC3B 1UWAA 1MU2A 2IZ1A 2RDIA 1LWCB 4MKYA 3BDEA 2ZVNB 3DRPA 1FRJA 3IWLA 3L9ZA 4UOHA 2D74B 1XNQJ 5APWA 3LWMA 4LRDA 1JIHA 4I2QB 4U7JA 1R27B 3ZTPA 2HW3A 1PGOA 3H8YA 2AZ3A 1IQTA 3CCJP 5GAHI 1RU1A 5AE2A 4AL6A 2GNKA 4N76A 3SFDC 2K8GA 3JAMU 4X4TA 2QA4G 1NTMK 2XMWA 1UFLA 3Q2SC 3B82A 3MHVA 2DNYA 2IM0A 4DV5F 2WBRA 3CCZA 5HAOA 3OUYA 3DLEA 5DJBA 1TVRB 4XDCA 3DHXA 4GOEA 4RW9A 2Y8YA 3HFZB 3HK2A 1OX3A 2KVQE 3NOGA 1TV6A 2BANA 5GADI 1FD8A 3VGUA 1AXQA 3KFWX 3VMZA 2CJYB 3AODA 1PC5A 3AH6A 1YBKA 3B78A 4USVA 2IDBA 3HHLA 3VYIA 3C6TB 2C2MB 4GODA 3AEFC 4ZPWR 3RB3A 1N0UA 4YY3J 2PA8D 1RK8A 3UVJA 1T9UA 4Q8EA 5CH7B 2F4FA 4ZIVA 4HYTB 3U1LA 2OYIA 1VQ5P 3TDKA 1GFWB 1SJRA 2I0XA 2RHQB 4OZLA 2XC9A 2QIWA 2W9BA 4HACB 4MH8A 3GJQB 3KK1A 2CVIA 4B3TF 3IMQJ 2QMWA 4X62F 3JYTA 1S5ZA 3ELHA 4H0LD 3ZZ0A 4QPTA 4H4KC 2PMWA 4F4AA 3QJJA 1VQ8P 4DF4A 1RT3A 5KFYA 4WXOA 4QOTA 3RRHA 2OFHX 1GEHA 3J81Y 1F60B 2VKZG 1VBXA 2FZCB 3HI9A 2ZKTA 2BMBA 1WC6A 3MM5A 1EETA 4KO0A 2YNGB 5DETA 3V6IA 2WW4A 3SCJE 1R6YA 1YJRA 2JJ4D 2M5AB 2XV5A 4HKZH 2LEAA 1M5PC 2LXBA 3GLMA 4KPCA 5CQGA 1Z2ZA 1FO1A 5TISH 2N1TD 3MM8A 2E75D 5KFIA 3D2WA 4FPRA 5CCGC 1U6BA 4TYBA 1VQNS 4RJTA 4JI3F 2PMHA 1ACMB 2LKZA 1PAEX 3W2WB 3LUYA 4KBIA 3V2RA 2UZAA 1QM9A 1L0NG 4BCAA 2CPJA 1IBMF 1JEKA 3CXHE 4DQPA 3T97B 2BZ2A 5KLVE 4EMDA 2XNQA 2MQLA 1JB0J 2E5TA 4AQYF 2AP6A 1S97A 4F3QA 2NYIA 4ED5A 3HHLC 2XQCA 1SQVD 2FHOB 3MR5A 3J7A1 2LCWA 2EBEA 1FJPA 3V81B 1X4BA 4KTQA 1JLCB 3L72G 3WUTA 1RHKB 4DX5A 2ASLA 2JKVA 2CPYA 2HG4A 3C15B 2P5VA 4KV8B 3KOAA 4JV0A 4Y2KA 4KJIA 2WPVB 3LA0A 2QYCA 5CBNA 2QG4A 3QZ7A 3C6UB 2DO4A 4C0HA 4RW7B 1JKHA 5AXNA 2A18A 1T3NA 2E76C 4CLTA 1LXJA 3LP2B 2RQCA 2GVDB 4J9KA 5JMNA 1F1BB 5F0WA 2B9XA 7AT1B 3I32A 3CD6S 3L71D 3MAAA 1VR6A 4MMOA 1VQKS 5KFZA 3R2CJ 2GIRA 3KXDA 2Q79A 2LU1A 1RWKB 1IWGA 2IM3A 5AVYB 4ED1A 3PVXA 2ZH7A 3VMXA 2UXDF 4C4WA 5HQLA 5ETNA 1IFJA 2L08A 2CQBA 3A8IA 1NK9A 1SKSA 5AXKA 3VMAA 4I2LC 1LTSC 3W5YA 1UPMB 4KYZA 2NLWA 1X79B 4PKDB 5J2NA 3LOUA 4LREA 3KJNB 1FNMA 4WK1A 3K8VA 4QQBA 3TA1A 2HIQA 3CJ8A 1SPBP 5LOQA 1VF5C 1NO4A 1X8DA 2DJWA 4NLSA 3R7SB 2YKQA 2ADBA 2LXUA 3QWUA 2IRXA 1VF5B 4JPZB 3NLCA 4R5PA 2GA7A 1G1XA 3KK3B 4JV2A 4EYHB 2BKOA 3TR5A 1R5SA 3A2AA 4HVZA 3GMAA 1A7GE 4DV1J 3POTB 5M2UA 5EDWA 4LR9A 2OPPB 3H20A 2JH3A 2EVZA 1GW3A 1X0TA 2GS8A 5H2FE 1FESA 4N8NA 2VPWB 2XLJA 3D6FB 3TOQA 4NA2A 2C3MA 1KYOI 5IC4B 5I3UB 3DGVA 3L72D 2NQPA 2UVRA 4ZKUA 1X22A 2ZVIA 3MAAB 4LIWA 2ZM6F 4MIAA 1GXTA 5D0EA 3H1ID 3G96A 4RL1A 3EPIA 2KRRA 1AUSL 3HE5A 2RHSB 2HHSA 3R8YA 3ILOA 3AHPA 4FZVA 4HHHA 4IFMA 1Q86Q 4ALZA 4W7YA 1QAYA 2G1HA 1CC7A 3H1LE 1FDDA 4LF9F 1RT1B 4F04B 1LW2A 4ZPTR 3RL0B 3JSYA 4KRWA 5FDLB 3H1LD 4C8NA 5H9EJ 5L9XA 1AYEA 3IAS9 2DPIA 2E1RA 3ULHA 1N8RQ 1UKUA 4X4VA 2CXEA 1SH0A 4X64J 1T03B 1BCCJ 2WSEH 2V2KA 3AD9C 4OX6A 3SSSA 1JXEA 5KFJA 3M9MB 1TMMA 3L71J 3TA0A 3M8WA 1KZUB 2J8SA 4JQ0D 1SL1A 3GJTB 4QBUA 2VUGA 5HI7A 1FCAA 3U59A 3QBCA 3CCSP 4U8YA 3PACA 4C3LA 1KQSR 2CNNB 4IL6X 2QSIA 2A2CA 2ILZA 4GIFA 2K7KA 1BQMA 4FDFA 3ENWA 3VP8A 2RIJA 4X4NA 4N56A 1NEEA 3MZIA 2GIQA 4HDGA 3AOCA 4K4YA 4O3OA 4CLZA 2FHMA 2MY7A 1VBKA 1RE3C 4C11B 3UN5A 1DTTB 4K5SA 4P75A 5D4OA 3W67A 2VJVA 4N8OA 3C16B 2WSEJ 1O0PA 1SLQA 1RLCL 2ASDA 2J8AA 4PG8A 2KFYA 3Q2YA 3T41A 1BLUA 2CNOB 1T2KD 4KKOB 4CP5A 2CJAA 4PWUA 3IR9A 4AFFA 3CB4A 1KB9I 3MF5A 3KHLA 3RJMB 1BWVA 4RWXA 4RO0A 3TVZA 2BQ3A 4U3FJ 3AE9C 1JY3O 2RKIA 4WIQA 2OYIB 1B0TA 4DSLA 1P84I 4H4MA 4G6VB 1FDMA 3RBXA 3R5CA 1WTBA 3AY0A 3GHGB 1JNZB 2B4OA 3HTKA 2IMOA 1JXVA 1LW0A 1Q8IA 1RCOB 2J6SA 3KLHB 1MU2B 4XTTA 5HL7Q 4M3LA 2HPUA 4JI5J 2KO1A 3VAMA 4TU9A 1KILC 2OPQA 4WVZA 3L7PA 4JI7F 2J9CA 2N1TC 4WXWA 4LUBA 1NK6A 1RADB 1D0EA 1M56D 1RAIB 5KFEA 5ETLA 4LSLA 4XDDA 3VN0A 3I96A 1BCCD 1F9FA 1N5TA 3W3SA 3R9LA 2VG6A 1SIZA 3IRXA 2YNIA 1R3NA 4GO7X 1QVFO 1TU3F 3QH9A 2N7YA 4QIEA 3MAQA 4LQ3A 1GTEA 3MEDA 1N56A 3OTCA 1XTGB 1N5SA 1NPKA 3CF5Q 3QAEA 3KUEA 3ENQA 2ASJA 2JFKA 3HVWA 4GT1A 4E2FB 1H98A 4DOJA 2BVZA 4JBZA 1D9AA 2RILA 5KFKA 2AX1A 1QL1A 2BJEA 1C1CB 4UOGA 4F26A 2M3EA 2ZDPA 3FGAD 3P3DA 4RW9B 2N3OA 4LF5J 5ETTA 1VRUB 1HNIB 2G3AA 3TANA 4PXDA 3GIJA 2QSWA 3L73D 2DGXA 1UIXA 1LTBC 3L70J 4F02A 2E75B 4ZVFA 4LF7J 3G6VA 2UU9F 3GFHA 4I0WA 2NXCA 3IGNA 3TK1A 1L4AD 4X66F 2H48B 1FRIA 5IWAF 4PXEA 1JB0C 3BSOA 3JYTB 4LF4J 1LWEA 2RVJA 4IFYA 2RKLA 3G71P 3CXHD 3ZXWA 1ZM4A 4HLBA 2VG5A 1YJTA 1HMVB 1T03A 2C2EA 1RHUB 1VQ4S 2M2BA 3PDNA 3HD7A 1WDTA 3OAKA 4L74A 3H1JD 3KLVA 3QNWB 2MQPA 5ETRA 1KFSA 2AJ0A 2YKMB 3I4PA 1ZRTD 4TN2A 3VP9A 2VOPA 4RKUJ 2IYPA 1KFMA 3T1YJ 2DR7A 4ITSA 2ZUAA 5KFLA 1SQQJ 3I87A 2Z5IA 4JI2F 4M94A 4KJMA 1TKXB 1AJYA 4MFBB 4OJ3A 3DDKA 5A0YA 3NCRA 1R8BA 5C7PA 2DNMA 3ZDMA 2B87B 2HKEA 2GMLA 1KORA 4JI5F 1MROB 4I2QA 4F0KA 1TR0A 3U1AA 4NX9A 1CPZA 3WHIA 2MKYA 2DEJA 2UVVA 3T1YF 4HHJA 2K3KA 1RB0A 2R2UA 3RB4A 3OV7A 2HMIB 2LU2A 4U3FD 4D3GA 2QLBB 3GU0A 4EWTA 3IN6A 3CC2P 1IBMJ 4ECVA 1JOCA 2Y1IA 3I5AA 3BRTB 2Z5HA 5AVWB 3PYDA 1R8PA 4ES3A 4C8KA 1X8YA 1GMUA 4DL6A 4I64A 2LR2A 1H88A 4PWDB 3ICLA 2KJVA 1Q8BA 3Q8PB 4DWIA 4QIFA 1NHVA 3H59A 3KJFB 5HJYA 1IM6A 4QWDA 3UD3P 2ZH9A 2PO4A 5FDLA 4AUWA 1HNZJ 5B0EA 2I5JB 4MYUA 1RTIA 3KLGB 1QSLA 2EKNA 2YIUC 3QIPA 3I56S 2CAJA 3CJ5A 1BE3D 2UXBJ 2KFNA 3RL0D 3IAM9 1T8EA 1X0PA 1HI1A 2JSXA 1OYEA 1LT9B 3FXDA 1Y00A 2BOAA 4I1TA 2CQ4A 3JTNA 2VZ9A 3GWC<