3I5CA

Crystal structure of a fusion protein containing the leucine zipper of gcn4 and the ggdef domain of wspr from pseudomonas aeruginosa
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
196
structure length
196
Chain Sequence
b'RMKQLEDKVEELLSKNYHLENEVARLKKLVNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPGGGGQTFRVLIEMADQALYQAKNNGRNQVGLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion of General control protein GCN4 and WSPR response reg
publication title Determinants for the activation and autoinhibition of the diguanylate cyclase response regulator WspR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 68
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3i5cA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i5cA02
1JUNA 3IS9A 3T5JA 4RW6A 2QV6A 2IM2A 3SWFA 4KKOB 4LSNA 3PVXA 5APSA 1KLMA 3V81A 3FRZA 3ISNC 4ECVA 3RB4A 3FDSA 5HLFB 1LWEA 1REVB 3ISND 1NHUA 4O4GA 4I7FB 3NXSA 2E9RX 3H4BA 3T97A 4C46A 2JLEA 1S1WB 3N6LA 1TP7A 2C28A 4FS1A 2W7OA 3LAKA 2B6AB 2DPJA 3SFUA 2GIRA 5L1KA 4PQUA 1HNIB 3M0DA 3OLAA 1EP4A 1QE1A 1LWFB 3SI8A 2W9CA 1LWCB 3TK1A 4K4YA 3BGRA 4RW4A 2D3UA 4K4SA 3D28A 3NBPA 3IGVA 2FVSA 2WT7B 2E9ZA 1JLQB 2OPQB 1RTDA 4G3IA 4J9LA 1BQNB 3UR0A 5F8NA 1C0TA 2B43A 4F50A 2C9LY 4IR1A 3E51A 4Y2CA 2AGPA 4NLQA 4ZPBA 2XU6A 4WXWA 1TKTB 1Z4UA 2C2RA 4NLTA 5KG3A 5KFRA 1A02J 2AX1A 4I2PB 2D41A 2VG5B 4YMEA 3DLEB 2Z5HA 2WOMB 4MKAA 2AGQA 2WRMA 3VQSA 2VRSA 2AX0A 4RW8A 4ZP9A 3DOLB 5C24A 3JSMB 2FJVA 4O4RA 5KFPA 3G6XA 3CJ5A 2OPPB 2ZE2A 1LW0B 1TL3A 4RW7A 3C6UB 4NLGA 5J1EA 1MUUA 5APYA 3DMJA 2BE2A 3LANA 5DLFA 5J2QB 2OPSB 3OL7A 3OAKA 4MK7A 1SV5A 2FLNA 3I5BA 1C1BA 3CVKA 4Q43A 4ZVGA 3IRXB 4IG3A 3KHGA 1S1TB 2ASJA 5K14A 3M9NB 3HE4A 1GD2E 3GIMA 1RYRA 2WPQA 2WPRA 3T19A 2YKNB 4IQXA 2BANB 3PW2A 3ICLA 2N9BA 3RB6A 3QGHA 1S9GB 5C25B 3P8MC 3V4IA 4K4WA 3IGNA 2IAJB 4EO8A 3B8EB 3KLEB 4H4MA 4NCGA 1S1UB 3BSCA 4J9MA 1JLAB 2IC3B 1T05A 3BSOA 3I0SB 4LSLA 4J9RA 1I6JA 4IR9A 4IRDA 2OPRB 2R5BA 1T03A 1SH3A 1S9EB 2W6AA 3VYIA 3DI6B 5KT5A 3N6NA 1IKYB 3JSMA 2R8IA 1TV6B 2YKMB 1HUCA 5KFYA 4NRTA 2W9AA 3VN0A 2VA3A 3HVAA 3DRPB 4O3QA 3DYAA 1JLEA 1C1CB 1RT5B 3KJVB 4ZPAA 4O3OA 5APUA 5KT7A 1H8AA 4WZQA 4ZHRB 1BQMA 1TKZA 3HVTB 3T5HA 2YNHA 1TVRB 3CJ3A 3KK3B 3MECA 4NLSA 5J2NB 3QGIA 3Q8RB 1S1XA 4IG0B 5KFTA 5KFCA 1ZETA 4ECYA 1RT2A 1GK6A 4Q44A 1S9GA 1SLQA 1R0AB 1YVFA 1SH2A 1U09A 2IAJA 5C42B 3KLEA 2R8KA 4C7NB 4J9NA 1GZLA 4ZVHA 5KFOA 1FKPB 1IKVA 1JXLA 3TQ1A 3JYTB 4O3NA 3BJYA 4MFBA 1S49A 1JLBB 3I0SA 1RT3A 1H88A 1QAIA 4HYKA 3KLFB 3GILA 5I3UA 2UVRA 4R5PA 1NAFA 3TAMA 5I42B 3BSAA 1JKHA 3EPIA 1IKWA 2P7JA 5KG1A 4ID5A 2ATLA 3SFGA 2W8LA 1HQEB 5KFXA 5KFWA 4ZVEA 4ECXA 3M9OB 3GV7B 3CDEA 1S6PA 3KQGA 3V6JA 3M8QA 5HBMB 4EO6A 4MIAA 1HPZB 1GU4A 3KLGA 3IS9B 4RW6B 2WK4A 1N6QA 4LSNB 1KHVA 3H40A 4M95A 1CI6A 2UVVA 3MEEA 3V81B 4KFBA 1TQLA 1LWEB 1QUVA 5DGAA 2ZKUA 4O4GB 3H59A 1GK4A 5AW2B 1XR7A 4RZRA 2IM0A 2J6UA 4DL5A 3C6TA 3T1AA 2W9BB 1J5OA 2ILZA 4J9QA 4TLRA 3L35A 3QO9A 4WE1A 3DLGA 4QWDA 2D7SA 4PQUB 4NLYA 1S0NA 1RTJA 2R8JA 3DOKA 4QPXA 1EP4B 1QE1B 5KT2A 4QWEA 2W9CB 5F8MA 4I2QA 4IFVA 3BGRB 4RW4B 5AVXB 3BREA 4TQRA 3A5TA 3NBPB 3BQ1A 1VRUA 3PW0A 4RW9A 3DLKA 1RTDB 5DG8A 2GIQA 1C0TB 2BRLA 1ZTTA 3MEGA 3HVWA 1RT4B 3PW4A 3M9MB 3LP0A 3L37A 4Q0BA 4RESB 3G86A 4KO0B 4J9PA 4F4XA 5AVWB 2YO3A 4ICLA 3CDUA 5DG7A 1GX5A 3Q8SB 3UDLA 1FK9A 5L1IA 1S97A 1EETA 2V4QA 2WWWA 1TL1A 4RW8B 5C24B 4MIBA 4WFYA 5FDLA 2VA2A 4IRCA 2W7PA 3NAIA 4IDKA 3PZPA 4Q45A 2W9BA 2HWHA 3E01A 5C5JA 2ZE2B 5KG0A 4XE5B 1RDRA 1TL3B 4RW7B 5AW3B 2CJQA 4KV8A 5J1EB 4KHXA 4PUOA 4ZP6A 4NLXA 2QM8A 3DMJB 2BE2B 1S48A 2YNFA 3FSIA 5AVTB 3QLHA 2JEFA 1SV5B 5KT4A 2QM7A 3IG1A 1C1BB 4M94A 4IG3B 1LW2A 4ZP8A 4IH7A 5K14B 4R0EA 4JV1A 2I5JA 1RT4A 3HE4B 3VMXA 3GIKA 3A3YB 3KHRA 1N56A 4EYIB 3UQSA 4FS2A 1JIHA 3MFHA 3KDPB 4JV0A 2WTYA 3KK1B 3V4IB 4KO0A 3LP1A 3L36A 4XPEA 3D5MA 4H4MB 1WNEA 4NCGB 4K4ZA 3CWJA 5KFMA 4NLWA 2BASA 5J2PB 1HYSA 4DL7A 1T05B 5KG4A 4LSLB 3G6VA 3NMDA 2R8HA 3DM2A 2R2RA 4DEZA 5KFFA 2BRKA 1T03B 4ED0A 1A02F 3KLIB 3MGNA 5KFJA 5KFHA 1DH3A 1K1SA 3CDWA 1S4FA 5APXA 3TVKA 4U6PA 3DYAB 1JLEB 2JC1A 2RF2B 4ED1A 3IN5A 3A7OA 3PW7A 4GT1A 1DTQA 4WZMA 1MU2B 5L1LA 1BQMB 1TKZB 4I2LC 3BSNA 3T5LA 2YNHB 4F4WA 4KE5A 4WYWA 2HNYA 3MECB 1J2JB 1S1XB 5KFAA 2ALZA 1C0UA 2ZXEB 3M8PA 3O8ZA 1RT2B 2HWIA 1GX6A 1S10A 4ZVFA 3T5KA 3KK1A 4JUZA 5KFLA 1JLGA 1T2KC 5KFIA 3QIPA 4O3PA 3MR2A 1IKVB 2FVQA 5HP1A 3VTPC 5J2PA 1T2KD 4MFBB 3H5YA 2FLLA 1HARA 4H4OA 1RT3B 1HMVA 2E42A 5AVSB 3CJ4A 4Q8FA 5F9LA 4KAIA 5I3UB 4R5PB 3TAMB 4RNMA 2XZRA 2J6SA 3I5AA 1RYSA 3KLIA 1JKHB 5EUHA 1IKWB 3PHEA 3RBDA 2JJLA 1D1UA 3NAHA 4DL4A 4ID5B 3M06A 4YP3A 4G1QA 4AYCA 4B86A 4QW9A 2RF2A 3M9HA 3H5SA 5F9NA 1S6PB 1S0MA 5JXSA 4LQ9A 3M8QB 5APQA 1SP4A 4NLRA 3Q8PB 3KLGB 1JNMA 2HNZA 1MU2A 3GQCA 1N6QB 5AVQB 1SUQA 1SH0A 4O3SA 1CI6B 3MEEB 2Q5UA 3BQ2A 4KFBB 4RNNA 1N48A 1YYCA 3KLHA 5KG5A 2AQ4A 4YQWA 3NFQA 2R8GA 4TN2A 2VG6A 5EWFA 3P7KA 4TXSA 3C6TB 4HYTB 5KFQA 5DLGA 1IO4A 4U7CA 3MD0A 5KFUA 2RDJA 1J5OB 3QO9B 4ECUA 5KFSA 2XGPA 1OXZA 4WE1B 3DLGB 5KFVA 3OL9A 1RTJB 3DOKB 3PW5A 4O44A 4ZPDA 3KK2A 4ED7A 4I2QB 4MK9A 2WONA 1RT7A 1S9FA 4R8UA 4IFVB 3MR6A 3RAXA 2IA6A 2HAIA 1VRUB 4F4YA 4RW9B 3DLKB 1OWAA 5KFBA 4B3OA 4M3LA 4NYZA 1JX4A 1CSBA 3MEGB 3LAMA 1QAJA 3V6DA 4RUAA 1JLFB 3LP0B 4Q0BB 3CO9A 3FFIB 5KFDA 1TKXA 4QW8A 2XCAA 2WPSA 4URQU 4ICLB 2IJNA 4ZMMA 1FK9B 3OSPA 2P67A 2RKIA 1S1VA 3QIDA 1DTTA 4KHMA 5KG7A 1EETB 3H5XA 1TL1B 1RT1A 2YNIA 4J9SA 4ED8A 4Y34A 5FDLB 1S6QA 3QZ8A 4ECSA 4IDKB 4TYBA 3E01B 4QWAA 2V9WA 1RTHB 1FKOA 5KFKA 2AU0A 3TYYA 4KV8B 3OL6A 1RTIA 2FJXA 4YR0A 4PUOB 3MEDA 1UWBB 2YNFB 1C2PA 1OS5A 5AVZB 5AVYB 4NLPA 3QLHB 4TYAA 4PWDA 3DRRA 3IG1B 4LC1A 2O5DA 4EYHB 5DQIA 1LW2B 1G2CB 5L9XA 1VRTB 2I5JB 3UPFA 4WXOA 1JLFA 2IBKA 3FFIA 2FVPA 2OH2A 5CMZA 5D3GB 2JEGA 2ZD1A 3CIZA 4WFZA 3LP1B 1GU5A 3OHAA 4EBDA 2HMIA 5APTA 2AGOA 4EBCA 2B5JA 4RU9A 4RNOA 2XV5A 1HYSB 2BQ3A 5HROA 3LIEA 5KFNA 4DG1A 2FVRA 3DM2B 3V6HA 3I0RB 4ZP7A 2HNDA 3EPGA 1GTWA 3V4WA 5CYMA 2J6TA 1X8YA 3HHKA 2WCXA 4K4TA 2VG7A 5AW8B 3HE5A 4K50A 1RTHA 3A2AA 3LP2A 4NLDA 5CYQA 4Y3CA 2UVUA 1IKXA 4AQRD 1HNVA 4H54A 4QWCA 1UWBA 1HQUA 4IFYA 4TQSA 3GV8B 2R2UA 2XWYA 2V4RA 1DTQB 1NNDA 4YR3A 3KLVA 3MF5A 1KQLA 3RB0A 3OHBA 5KG2A 1DLOA 5AW9B 3RBEA 2HNYB 4TY9A 4O3RA 4JYBA 4IOBA 1VRTA 3H2LA 5AW4B 2JC0A 2C2EA 1FOSF 4Y2AA 1C0UB 2YNGA 3VMZA 3IR9A 5KFGA 3GV5B 5D3GA 1N5YA 3M8PB 1FAVA 4JV2A 4TY8A 3OLBA 2QE5A 1KHWA 1RT6A 3G6YA 2R32A 3BQ0A 4RUCA 3PJWA 1JLGB 3QIPB 5DG9A 5J2MA 2E9TA 4RNHA 4URGA 3V4QA 5HP1B 2H7HA 4IH6A 4MH8A 4H4OB 1HMVB 1XR5A 3BR9A 4F4ZA 2R2TA 3I0RA 1JLCB 1T3NA 4KKOA 4MKBA 3RB3A 4MK8A 1FOSE 5HLFA 5APWA 1REVA 4XO0A 4I7FA 2ZFCA 4G1QB 1RA6A 5AW7B 1S1WA 1N4LA 1S9KE 4ZPCA 3KMQA 2YO2A 5T14A 2R5DA 5EWGA 4EEYA 3EZUA 5DQHA 2IMWP 3QZ7A 4NLVA 2B6AA 2HNZB 3VMYA 2C9NY 1HNIA 2IM3A 1SUQB 4KBIA 1LWFA 2ASDA 3CJ2A 3MR5A 3M0AA 2FVCA 1MV8A 1LWCA 2IM1A 2ASLA 3P32A 4ECZA 3KLHB 2WT7A 1JLQA 4KHRA 2OPQA 4IRKA 1BQNA 2VG6B 5L1JA 5DQGA 5F8HA 2UUTA 1S0OA 2FLPA 4NLUA 3DRSB 2CKWA 3PR4A 2WHOA 5AW0B 2Z5IA 3Q8QB 1TKTA 4ECTA 4O44B 4I2PA 2W8KA 1JLCA 3KK2B 2XC9A 2RDIA 2VG5A 2WONB 4J9KA 1RT7B 3DLEA 2FJWA 4R8UB 3I5CA 2WOMA 3ITHB 3NGDA 4KSEB 5DGBA 4Q8EA 4LQ3A 4B3OB 1HJBA 4NLOA 4WYLA 3N6MA 3DOLA 3V6DB 4ED2A 2OPPA 5F8JA 5AVUB 4IKAA 1HBWA 1TKXB 1LW0A 4FBUA 3NMAA 4EBEA 3C6UA 4I6MC 2DPIA 1S9KD 2BQUA 1K1QA 3KNAA 4QWBA 2BR0A 2E43A 2XCPA 5J2QA 4XPCA 3H5UA 2OPSA 2JEJA 2RKIB 1S1VB 1DTTB 3OSNA 5KFZA 5KT3A 2JEIA 4URSA 1NHVA 1IM4A 3MTKA 3IRXA 1RT1B 1HWTC 1S1TA 2YNIB 3LALA 4DL3A 2XI2A 1CZQA 1S6QB 2YNYA 3DDKA 2WTFA 2YKNA 3DRSA 4WFXA 2BANA 2P2UA 1FKOB 5JUMA 5AVVB 2XI3A 5C25A 1RTIB 5EDWA 3CJ0A 2W27A 3MEDB 3QGGA 4GKGA 1S1UA 3KHLA 4DL2A 1JLAA 4X2BA 2IC3A 3RAQA 4PWDB 3DRRB 3ITHA 4RNFA 2Q7CA 4NRUA 3TNUB 3FQKA 2OPRA 1MMLA 2BQRA 1S9EA 4FBTA 3KMSA 3DI6A 4ED3A 2UUWA 1IKYA 3KOAA 4K4UA 3KHHA 3MFIA 3NKYA 1TV6A 2YKMA 3PJXA 3LIDA 3OL8A 2ZD1B 4JYCA 1W25A 3DRPA 4KB7A 1D0EA 2R2SA 2UVWA 2HMIB 1C1CA 4ECRA 2I1RA 1RT5A 4ECQA 2B5JB 1MFZA 3KJVA 3M9BA 5F8LA 5HROB 4GC6A 3GIIA 1NWQA 4DG1B 3M91A 4K4XA 3HKWA 1RAJA 3V5BA 4ZHRA 2ILYA 4DZOA 2HNDB 5F8GA 4YR2A 4DL6A 1CSJA 2IJFA 3HVTA 1KLMB 1TVRA 5CYMB 3FQLA 5KT6A 3GYNA 5KFEA 3KK3A 5J2NA 4EOTA 2C2DA 4IG0A 3NTNA 4GC7A 3HTKA 2VG7B 2IPPA 4IH5A 3HE5B 2Q3IA 3LP2B 2WB4A 3MR3A 5EWEA 5CYQB 2KP8A 3UIAA 1R0AA 1IKXB 2F8EX 1HNVB 5C42A 3H98A 1T94A 3V6KA 1RA7A 2XGQA 4C7NA 1HQUB 4IFYB 2C22A 1FKPA 5AW6B 1ZTWA 3JYTA 3PR5B 5APVA 1JLBA 4HKQA 3TNUA 4J9OA 1DLOB 2R3CA 1XR6A 3KLFA 3GIJA 4AUWA 5I42A 3QYYA 5AVRB 2YNGB 4ECWA 1N5YB 2V0NA 4TY8B 2EC0A 1RT6B 4OL8A 2AWZA 1HQEA 3NL0A 4ED6A 1H89A 2D3ZA 5F8IA 3H4DA 5J2MB 5AW1B 4K4VA 5AW5B 4NZ0A 5HBMA 1HPZA 5KG6A 2GC8A
chains in the Genus database with same CATH superfamily
1WOPA 2CFXA 2KYVA 1PV3A 4P71A 3KXDA 1YJNP 3CD6S 3V81A 5AXKA 3FRZA 4GODA 3H1IE 2Q9IA 3Q23A 4ECVA 5KTQA 4FYXB 3FDSA 1TL7A 2FGCA 5B0CA 2DNGA 1REVB 3KJNB 1NHUA 3GSDA 4Y00A 3U1MA 2BCCG 4FPRA 1VRQC 2BBEA 3NXSA 3M6VA 4OH8B 4BC9A 3H4BA 1HVVA 3T97A 1HD0A 3D4JA 4OYPA 4W80A 2W2NP 4M5JA 1VBKA 2DIVA 1RE3A 3ZTSA 2FLOA 1QAXA 2C28A 3TX0A 1QVFO 3EXCX 3OUYA 4K0KJ 3BKFA 2B6AB 2DPJA 3SFUA 4JYAJ 1HNIB 3M0DA 2ZVNB 3OLAA 1SQXG 4EK2A 1GQEA 2W9CA 5KOXA 3TK1A 2I1JA 1TKDA 3POTA 4LFBJ 1R8HA 3HF5A 4RW4A 3D28A 1X9WA 2WT7B 1JNZB 1Q5VA 1YK9A 2ERRA 3DLBA 1BQNB 4UUXA 3UR0A 1KYOD 4DPTA 4C8NA 2LQ9A 2O66A 1KNZA 3E51A 2CG8A 4F67A 2ABYA 2AGPA 4DN9A 1HL6A 3G8SA 2M52A 3IA0A 5KG3A 3MPUB 1A02J 4I2PB 5EHHA 3MPWA 2J9EA 2CZ9A 4H4KA 1LFPA 2Z58B 4JBZA 3DLEB 2H4WB 1VPCA 1RI7A 4Q2LA 1MSWD 2VC0A 2HKEA 4DXLA 1MKMA 2ADBA 1REGX 4OGQC 3VQSA 2AX0A 2J7KA 2CJ9A 2VBYA 5C24A 3CT9A 1QVFR 4OGQD 4LF9J 4GKKJ 3HO1A 3K5BA 3CLQA 1DZ5A 3M8ZA 1T9XA 1NK8A 3VVUA 1HGZA 4X4RA 3G6XA 2VH7A 3NNCA 4C9DA 1SB6A 3CF5Q 1XNQJ 2OYOA 1LW0B 3MUVP 3Q22A 1TL3A 2YY3A 4RW7A 3C6UB 5K5MA 1EXJA 5ETLA 4A8OA 1S77D 3RUBL 4YB1P 1AVOA 3AT1B 3GB0A 2BE2A 4WU2A 3MMBB 3LANA 3FX0A 2HGMA 5J2QB 1KMIZ 2MJZA 1GFWB 3EVOA 1WF1A 4DUTA 4HT7A 4E0DA 2QLBB 4Q43A 3HI9A 2APOA 4E8UA 2W8ZA 1H38A 1S1TB 2XZTB 4IOIH 5K14A 3M9NB 2ZOMA 3W2VA 2JR8A 2WPQA 4OHXA 1RAGB 1N7SC 4V19X 3MMCB 1TUVA 1D8ZA 3QGHA 3AE4C 3RZAA 1HBMB 1VS3A 1N7SD 4D6TG 4NPOA 4RUHA 1NTZE 4EO8A 2V68A 3B54A 1PP9G 1R8PA 4J9MA 4LRCA 4HJGH 3L74J 3GJTB 1X5PA 2N4CA 2M4MA 1Q16B 5F41A 1L5UA 2HZVA 2OPRB 2CIMA 4GOEA 3WUVA 4FXVA 2VQEF 3N6NA 3VAHA 3B82A 2CPXA 1HUCA 4X64F 3HVAA 4PXBA 2FD2A 2PFDA 3P4UB 4O3QA 3DYAA 3FMWA 2QJ3A 4ZKAA 4C3MA 1FCAA 1NJZA 1FJPA 1S4EA 2DXEA 3CW2C 5B0FA 1FTRA 5KT7A 1URRA 4WZQA 3MAAB 5H9FK 2HVHA 1LTSC 1TKZA 5CAAA 4DR5F 1K73T 3HVTB 3T5HA 3AD9C 4DHVA 3G2XA 2B9YA 1OSCA 4L73A 3QPIA 5H2FH 3PIOQ 3HTKB 4CQ1A 2C3UA 5HQ8A 1ICEB 3EGNA 2Q1KA 3GJSB 4KGMA 1RT2A 5M2UA 1UVNA 4PV1C 4DQIA 1S9GA 2F8HA 2CRLA 4Z2XA 1U09A 1SIZA 2IAJA 1NK4A 3JQMA 4PV1D 4X65F 1AUSL 4ZVHA 1FKPB 5KFOA 1JY2P 4DDFA 4DBQA 1DFDA 1Q7LB 4F36A 3CC4P 2CZVC 1BCCG 3TA1A 2E29A 4PJ0E 1GK8A 1S5LE 2E74C 2HIQA 3M2UB 2UVRA 4R5PA 1RWUA 3TAMA 1R8AA 4CYUB 5A6PA 1NZAA 2NS1B 3EPIA 2P7JA 3RGUA 2VFVA 2JRSA 2ATLA 2E1RA 2E1MC 3UR3C 1PYTA 4XK8C 3R97A 2JOQA 1HQEB 1VQ5P 3CD0A 3D1HA 3M9OB 1S7IA 3CMQA 1FZCC 2XHCA 4ZCMA 9RUBA 3PFEA 3V6JA 1VBYA 2YWFA 3RRGA 1GMVA 1T02A 1U0SA 4F2SA 1GU4A 2KI2A 1G3OA 3GLMA 1H73A 4RW6B 4HTIA 1M5SA 4QR1A 1RF1A 2N7YA 2UVVA 1DQAA 5AXMA 3C19A 4N3YB 5E3CA 2ZOGA 5A8WA 1TQLA 3W65A 3U1NA 1QUVA 1FRMA 2ZKUA 2GHPA 2DGTA 2K3KA 1KC8T 1WTFA 3X3UA 3H59A 1KYOH 2J8SA 4KPCA 2OAUA 3K8WA 8ATCB 2XBPA 3MURP 3GMAA 3VCDA 2CVEA 1R0CB 1AA0A 3B5NB 1VK3A 3VAKA 3BCCE 6FDRA 2XMVA 1RWNB 1WDDA 2ILZA 2ZC3A 4AL6A 1M5VC 3RGIA 1FFWB 1S0NA 1RTJA 4UB6H 2WB1D 2W7AA 4IUFA 3K5NA 1L4AA 5KT2A 1NB7A 3MM9A 4I6YA 2NPSA 4QWEA 3D6FB 2AIRB 5F8MA 3AQPA 2I8DA 4YPCA 3BGRB 1YRUA 2OI2A 4WY4C 4DCJB 3BREA 2B87B 3NBPB 2YPYA 2OSRA 3R8YA 3PW0A 4RW9A 4B3SF 4WY4D 1RTDB 1QGKB 1TU0B 2GIQA 5D4NA 3HVWA 1H2VZ 2M88A 3PW4A 2QJPC 2RHSB 2MLYA 3HHDA 2ZZTA 3EGVA 5E3QA 4RESB 3GZ7A 4DPOA 5HJYA 2G1HA 3J7YI 3AH6A 3R2CJ 1S12A 4KO0B 1NEEA 2LYVA 4J9PA 2YVSA 4MYTA 2YO3A 2Q66A 1LP1A 4K35A 2R7OA 5I3PA 2FHJA 2WW8A 2L9DA 1J27A 1UJ4A 1KFMA 3OTOJ 3CCSS 3CXCR 3HPOA 4W4MA 1EETA 2WWWA 4RW8B 1WUUA 1UEKA 3TUZC 4M1KA 2W1BA 4F8RA 1KTQA 4DWIA 5FDLA 1RUSA 3LTOA 1MN7A 3NAIA 2GZOA 1X0PA 3E01A 5C5JA 3F41A 2W01A 5KG0A 1RDRA 3CCVS 3TZZA 5AW3B 3FK4A 4P72A 1N32J 5J1EB 2QX0A 4ASVA 4OI0A 3N5FA 2QM8A 1OY6A 2B9WA 3DMJB 3N4XA 1S48A 3J81U 2GGPB 2DY9A 3OFGA 3QFHA 4QIGA 1FHTA 2OP5A 3VGVA 3PX0A 1TK5A 2W2MP 3FSIA 4AQYF 3QLHA 1SV5B 5D0GA 3W9HA 2QM7A 3IG1A 2H54B 1TK0A 4OI6A 3VALA 1VQ6P 1NK9A 3I31A 2J0XA 3L74G 2Y0DA 2DK2A 1IR0A 4QOTA 5IT0A 4IH7A 2WQYC 4Y99B 1YRTA 4ZVOB 2X1GA 4R0EA 1RT4A 3HE4B 4JOUA 5F3ZA 1YRXA 3CCRP 4WKYA 3A0HH 4FS2A 3O44A 1J1DC 1URQB 3HUSB 1UVMA 2N1TA 1J5EJ 3V4IB 1QSSA 3RW7A 4YUDA 5AT1B 2YWKA 1NU1D 3IM8A 1WNEA 4ELUA 1ZAXA 2QO3A 2J59M 1I94F 1NJWA 3H1HE 2R7QA 2L9WA 2DEIA 1DEBA 1HYSA 1T05B 1D8YA 2WZ1A 3AEFC 4IL6X 2F3JA 1ITPA 2ZVOB 4DQRA 2R8HA 4ELTA 1HWIA 4LF7F 4DEZA 2EW9A 3H8YA 1F9HA 1OO0B 4FF3A 3KLIB 1IBMJ 3KJQB 2JEEA 4CLWA 1WEXA 4HI2A 2OEJA 2NR0A 2ZHAA 1K1SA 2JFDA 2IRXA 4PWWA 1Y8AA 2XO6A 1NO8A 1X7VA 1R3NA 2Q3EA 1JLEB 2JC1A 2F63A 3GG1A 1FDBA 5H9FJ 1OY9A 2HFNA 4ED1A 3IN5A 1SQVE 3V2QA 1T3UA 4GOFA 2KVIA 5LOQA 2QL7B 4DR4F 1KN6A 2KS1A 2LKZA 3RK3B 3RL0g 5HJXA 2D2CC 2V8DA 4DOZA 4KY3A 1N5TA 3MOZA 4JI1J 3NMRA 1QLED 2HNYA 2AEFA 1U47A 1W26A 3Q83A 2D2CD 1D7MA 3R5CA 2ALZA 2E5HA 3PJSK 1BQXA 1SJQA 5D15A 1C0UA 4DV7F 2A6OA 3KUHA 2LEBA 3GCWP 3G8QA 1OX3A 2H9ZA 1GX6A 3AAWB 1T9YA 1S10A 4ZVFA 5M1BA 3T5KA 1FA0A 1IR2A 3J7ZT 3BN7A 4BWMA 1JLGA 1T2KC 2E75B 2JHEA 4QYZJ 4O0NA 1R5LA 3VTPC 3Q89A 1T2KD 4MFBB 3M8YA 3H5YA 4C8OA 2GV1A 2HBZB 4O0IA 1RT3B 2ZYAA 2KSEA 3H32B 5HSPA 2GM4A 3JXOA 4Q8FA 1KSPA 2IYOA 4RNMA 2XZRA 4C7RA 2J6SA 1NTMK 2KOGA 1N34J 5K8NA 5EUHA 3PHEA 1RAEB 2KG0A 4HHHA 1HR0J 2E5GA 3M06A 4JI6F 2GA7A 1IUJA 5B5EH 1DD3A 3CC2P 4C3LA 4DPXA 5L38A 4AYCA 4B86A 2V7QJ 1XK8A 1WDTA 3TI0A 1F5CA 3H5SA 1LT1A 1SFCC 3BPSP 2FYUE 3K0JA 2ZEJA 3M8QB 3UD3P 1L3SA 2E7WA 2H65B 4OX8A 1SFCD 1NTZK 3KLGB 4A8KA 1JNMA 3R5BA 2M2BA 1N6QB 2CJBA 1K44A 3EICA 4ZVPB 4E2FB 3NNAA 2R42A 4DV6F 1F3FA 1CI6B 4EFAC 1L0LK 3MEEB 3BQ2A 2CQ0A 1WACA 1OFCX 4KGZB 4KFBB 1M1GA 1NTMD 1OWXA 1N48A 4WIIA 4F7VA 3RK2B 1RWKB 2GJ2A 3FCVA 4X66J 5KG5A 2UUAJ 2KNCA 1P27B 3THVA 4CLFA 2BJ1A 2PFXA 2ZUGA 2HK2A 3NFQA 2VG6A 2OSQA 3IC1A 2MB0B 5ETKA 2RRAA 1IO4A 4Y2KA 1HBUB 3ZC4A 4LF6J 4BRYA 4LR9A 4OHYA 2Z4PA 1OXZA 1FDNA 3DLGB 4WWSA 5KFVA 1NTZD 2DNPA 2B4PA 4O44A 1YHQP 1SIWB 2XMMA 3N79A 3R6LB 3UVJA 3KK2A 2HHTA 2RB7A 3BBFA 2IBZE 4MK9A 2VQFJ 1L0LD 1RT7A 1S9FA 4IFVB 2UXDJ 1B64A 5GAEU 1JTHB 3NXZA 1XERA 3FC9A 2HAIA 1VRUB 3SIPB 4F4YA 1P84E 1X79B 4X62J 2XMWA 4NYZA 1JX4A 1KYOI 1XJWB 2H8PD 1YJTA 2C42A 3MEGB 1HNZF 2G4BA 1QAJA 3V6DA 4NXNJ 4N56A 4RUAA 4ETXA 3FFIB 1G1JA 2K9JB 2HQIA 5HN0A 2ZFHA 3FRYA 5EX3A 2YX4A 2NCKL 4QIEA 4FF2A 1RE1B 1FZGA 2FZGB 2HHQA 3HJFA 1VF5C 5CZXA 2V34A 2CUYA 1VF5D 2P67A 2FC9A 3CC4S 2BOPA 4DS5A 4DSJA 3JSVC 1XMBA 4KHMA 5KG7A 1QLNA 1Y0HA 1JM0A 4OIXA 3H5XA 1TL1B 2CJAA 5ETTA 1RT1A 4ED8A 3GTYX 8AT1B 2LQJA 3USSA 5C39A 1OQ3A 1QVGO 3PEHA 4L6V3 4IDKB 2QRXA 4TYBA 1MFTA 4USIA 1IK9A 2ZH8A 1FKOA 4DSIA 4OYOA 4I68A 3TYYA 1KLNA 5BU5A 1FZEA 4PUOB 2D74B 4YR0A 1VQ5S 3MEDA 3H1IJ 2JL9A 1EAYC 4NMXA 2QVAA 4NLPA 4ANEA 3HP6A 5DZ6A 4PWDA 5ETQA 1Y47A 4RX6A 1R8BA 2O3DA 3KG0A 2GFFA 2DY1A 4IFMA 4UTGA 1N36F 2GUSA 3NS5A 2HHSA 2M9KA 1W7WA 3MM5B 3RK3E 3NY0A 1NUEA 2A10A 3TZWA 5CMZA 2JEGA 2PI5A 1X9SA 3X1LB 3GR0A 4M5MA 2ZOFA 1N0UA 3K58A 3GF3A 2K37A 1LKZA 5APTA 3FWNA 4XTTA 4CM2A 1KB9H 3PCOB 2CDQA 2B5JA 3C3LA 4RU9A 1X4AA 1X5OA 3I4HX 1AZSA 1SXLA 5KFNA 2DGXA 4DG1A 2FVRA 2CQ4A 5CBOA 3DM2B 4CNYA 2C3PA 3CD7A 4X4QA 3TEGA 5HO4A 2HNDA 3PYEA 1QVGR 4NCAA 2XEXA 2VL1A 5CYMA 2J6TA 1SQBK 1YQ3C 2UV8G 1BE4A 2VG7A 5AW8B 3MUTP 4H0LB 3A2AA 2F40A 4Y3CA 2UVUA 1L0NE 1T9UA 2GCFA 3BCCD 4PYDA 4DX7A 2EFPA 1AVYA 4IFYA 2FYZA 2FYXA 5GAHU 2JO1A 1JB0J 2HHPA 1KTMA 3DRYA 5JVGQ 3PH0A 3BV8A 2E76B 4IOCQ 2F4FA 2FHMA 1YJUA 1FC2C 1YJ7A 3OBIA 1FZCA 4ZITA 2HYIB 1ZR4A 4KPYA 1SQBD 1UPPA 2VOOA 2YNGA 1IC2A 2PEBA 1CULA 2CJXB 4IOAQ 4AT1B 5D3GA 2N9YB 2I2YA 4YN3B 3BBCA 3KDOA 3HFVA 3G6YA 3SCIE 2KZMA 4YXWH 5TISE 3GR1A 2Y0CA 2PE8A 3PJWA 3CI9A 2ZJSE 2QA4P 3QIPB 4IL6E 1FWLA 4URGA 3MXHP 1QL2A 4IH6A 1UTAA 1UEVA 3H7HB 4H4OB 5B0AA 1XR5A 3BR9A 2NZ4A 5L9NA 3I0RA 4KKOA 4BDPA 1QTNB 4EZ6A 2BJ8A 4K3AA 1VQ6S 3LQVA 4I7FA 1NTZJ 2J9DE 4D3GA 5FLXU 1FWKA 1S1WA 1N4LA 2K1AA 1ZYQA 5D0RA 3MDFA 1LWUA 1SQFA 4FF1A 1FVSA 4C48A 2RS2A 5T14A 3CCRS 1Q82T 1M1KQ 2LXCB 2R5DA 4WY4A 3PRJA 3H6PA 4QQBA 1SBRA 2C9NY 3KUGA 4N8OA 1KVIA 4OYMA 3EDRB 4KBIA 3ZNJ1 1LWFA 2DD8S 2ASDA 1FJKA 3W64A 2FVCA 1MV8A 1LWCA 2ITAA 1FNXH 3P32A 2AJ0A 4IQMA 1WKJA 2IIHA 3Q2YA 1SL0A 2QLFB 4PWUA 2OPQA 4CLPA 1ZAWA 5JMNA 3JTNA 4G6VB 4IRKA 2HODA 3FNNA 3AE7C 4A8SA 7FDRA 2DH9A 3FXDA 2CKWA 2CQDA 2F1FA 3QAEA 2RT3A 3AE8C 1MWZA 2Z5IA 4HKZH 1SQVK 2BMBA 4DPUA 2C3YA 2W8KA 4B3RJ 5HATA 5BYQA 4M5LA 2VG5A 4HTJA 3L75E 4R8UB 3I5CA 1RCOB 3ITHB 1CJTA 1YZ6A 4I7ZB 4LT6A 3W61A 4Q8EA 3OR2B 2FJDB 4KHPF 1HJBA 3AXMA 1IVZA 4NLOA 1L3TA 4WYLA 1FDAA 3DOLA 3HX9A 1K05A 2EFVA 4QPTA 1S5ZA 4ED2A 3WU2E 4X84A 1RH5B 1PFIA 1PC4A 2KZIA 4NPDA 3PRDA 2HSEB 5AVUB 2AJ2A 1IFJA 2P9GA 1YX2A 2YH0A 1NKCA 4CWBA 2QLXA 1S9KD 2BQUA 1K1QA 2BJDA 4UOHA 1SQVD 1JJ2R 3OR1B 3LOUA 2ZM6J 4LVOP 1YJRA 5CQGA 4QWBA 4C8ZA 2Q6BA 1H0TA 4K8RA 1U2RA 2I1KA 3VP8A 2OPSA 2QG9B 3QJJA 1FFSB 3H1IG 2HIYA 4C0HA 1H7WA 2JEIA 1IM4A 3M1VA 2IMOA 3IRXA 2Z4EA 3D54A 3FUYA 3LALA 2VPWB 4I69A 1H3DA 3TJ9A 1CZQA 1S6QB 1U1MA 2WTFA 4QYRA 2EFNA 2YMKA 5BVZA 2H5JB 3CWBE 2BANA 2P2UA 2KXNB 4OJHA 2LLZA 4ALZA 2ALYB 3CC2S 4HACA 4FYWB 2ZZNA 2XI3A 5C25A 3BM7A 3NOGA 1M5OC 1RTIB 3CJ0A 2R3VA 1RBAA 4GKGA 2RNEA 1S1UA 1PJ7A 2HG5D 1LT9C 1JLAA 3B5NC 3MMJA 2NUHA 3N9UC 2LECA 3PYDA 1BWEA 1JCCA 4I6AA 3FQKA 2VF3A 3TX8A 1S7HA 3D0HE 4M63A 4L76A 3BCCJ 2XLIA 1IZNB 4X4OA 4HHJA 2LR2A 3M2VB 2F65A 1VISA 1L3KA 2MZ1A 3KHHA 3NKYA 1TV6A 5I4MA 2EG1A 3A12A 1XMOF 4C8KA 4JYCA 1UEUA 3RTVA 3DRPA 4KB7A 2Z2ZA 2UVWA 3M05A 1M1JC 1EXIA 1C1CA 4PABA 4DR6F 1XTZA 5DM7Q 1RT5A 2DTJA 1U1PA 3MTUE 4RUBA 3M9BA 4GC6A 3LW5H 3HKWA 1RAJA 2MY8A 1JY3N 4DX5A 4ZHRA 3EFFK 2ILYA 4YR2A 1YHQS 2KT2A 4DL6A 4QIWD 2MKSA 2W90A 3HK2A 1KLMB 5KT6A 5A8KB 4DV0J 1U7LA 5KFEA 5J2NA 3EMTA 3SXLA 1MWYA 4GC7A 2D9PA 1OPIA 3HE5B 4DV5F 2CQ2A 4NCBA 5CYQB 1FXDA 1R0AA 2GW8A 5C42A 1YZ7A 1VIXA 2XGQA 4C7NA 1HQUB 3OQ2A 3JYTA 4WKRA 2GA1A 1WC5A 1NTMG 3TDKA 2FTRA 3R2DJ 4FZVA 5K8MA 2G2OA 1YITS 3GIJA 1SFCA 3ONQA 4AUWA 2W2OP 5I42A 3LWLA 3QYYA 2HS3A 5AVRB 2BEFA 3JAMY 3CE8A 2HPCB 5CA5A 1NCLA 3MD1A 2N3OA 1H2TZ 1VLYA 3L72D 2EC0A 3R7SB 4OL8A 2AWZA 1HBNB 3NGKA 1X4GA 1X60A 1RXOB 1NTZG 4Y99C 4DR2F 1WJ9A 5J2MB 1RWXB 2G3AA 1O0PA 3FEYB 1HPZA 5KG6A 3BZQA 2FVPA 2GC8A 1L0LG 1JUNA 1URQC 3IS9A 3T5JA 2R7VA 2IM2A 5D4OA 2K1RB 1NK0A 1L3VA 1VFJA 1URQD 1NSAA 1VQKP 1LWEA 4GO5X 2HQGA 1FJCA 2HLOA 1LXNA 5GTHE 2QSIA 4O4GA 1XNRJ 3TGUE 3CB4A 2CNKB 1SQQK 4C46A 1FNMA 2OELA 3H1HJ 4PXDA 4L72B 1MROB 2WBRA 3FBBA 1X5SA 1IFNA 4L3NA 3F89A 1JJHA 4HVZA 3AJ2A 1WKLA 3LAKA 3DU5A 3FCHA 3VTIA 2KUBA 3RW6A 2GIRA 3DCAA 5L1KA 2DH7A 2WSCC 3G9CA 2WITA 1NAYA 3WIVA 4LF2A 2AV5A 4ID8A 4OZ3A 4O23A 2MLXA 1LTJA 2NXUA 3TWZA 4K4YA 2MQMA 2NXCA 4DR7J 1B3TA 2D3UA 4H13B 1YI2S 3P8BB 3IGVA 2E9ZA 3RK3C 1Y3KA 1UZDA 4J9LA 2MLZA 3PP5A 1SQVJ 3HCXA 3D1OA 4ZVTB 4LF4J 2WVBA 1C0TA 4OMFG 4USWA 2B43A 1SQQD 1HW9A 2POHA 1V5VA 3RK3D 1K0VA 2DIUA 4PD4D 1JMTA 1RWWB 1L0NK 4CIOA 4ZPBA 4GKJF 3K59A 1FRHA 4LRBA 1TKTB 1PIXA 1Z4UA 4NLTA 3ENWA 3PJ9A 2ZHOA 2HHXA 1KWMA 4PPDA 2CPFA 2B9EA 3NGRA 2Z5HA 4ANDA 2WOMB 3W68A 3AJDA 2ZH9A 2AGQA 5C7PA 1CJVB 4F2RA 1LQ9A 3NNHA 3C2PA 4ZP9A 2DNMA 2F9JA 3VMAA 2L91A 1IK7A 4OYWA 3JSMB 1HQ2A 2OTLP 4O4RA 5KFPA 5JVHQ 2MZRA 3UWTA 3P3DA 2ZZMA 3O6QB 1NYHA 4B9MA 3BVHA 3L70E 3I9V9 2A1BA 1AYEA 1RY3A 2UUCF 2QA4S 4TLFA 4EIJA 3BPDA 1NM2A 3FWLA 2PEHA 1VR6A 1ZXGA 2AZ3A 3N01A 4QBUA 3OL7A 3OAKA 4MK7A 1KZUB 2FLNA 1FE0A 1FZAA 3I5BA 1C1BA 2IFNA 3CVKA 2DW3A 1Q4RA 2KYZA 5DETA 3V5RA 1E6VB 3DDNA 2KSJA 2FYUJ 2NSBA 1UETA 4GVBB 1RF0C 3QFWA 1GD2E 1RYRA 3E2EA 2VD3A 2DXFA 2WPRA 1NTKE 3BCCG 2YKNB 2VICA 4IQXA 3PW2A 3RK2C 3RB6A 5I3QA 7AT1B 1TUGB 1JQGA 2KXPB 3RK2D 2VQEJ 3KDNA 3L4FA 1EB0A 5IM0A 4H4MA 4NCGA 5D6GA 1GW4A 2XM3A 1GMWA 2OEMA 3S4RA 3MZWB 4J9RA 4OVNF 2IDBA 4X64J 1I6JA 4IR9A 3GFZA 2M3BA 2MQ8A 2IDEA 2V2KA 1T03A 1C4CA 2FXPA 1AV1A 1VQPP 3DI6B 4DV3J 2BDPA 1HBOA 4BHQA 4NRTA 2W9AA 1FJ7A 2E1PA 2VA3A 1GXTA 3ILOA 2DCUB 3K5OA 2HBYB 2HRYA 3UI3A 4A8YA 4N8NA 3KJVB 1G6BA 2PD1A 2KN4A 4Y6IA 3AD7C 1QDUB 2BM1A 3TJAA 5HMYA 1H8AA 3MHYA 1TZ0A 3OXGA 2J58A 4CTAB 4EGLA 2LFVA 2KTQA 3QT5A 4ZLLA 1H7XA 3CJ3A 4OI4A 4X65J 3OW2O 5B0EA 3KK3B 3MECA 2RQMA 4RPFA 4IG0B 3G82B 3NCPA 2VFUA 5KFCA 3VR1A 1ZETA 2FIUA 4N77A 3PKMA 2AJFE 4DZ6A 4ECYA 1TL4A 1U0HA 1VDHA 4TT3H 1NDKA 2XG8A 1T3OA 2R8KA 3AEEC 1N0VC 1FJGJ 1IKVA 2FJAB 4XDDA 1JXLA 4O3NA 1ZOTA 1JLBB 1KP6A 3SYZA 5B09A 4DOJA 3D6MB 2O01C 2H1YA 1H88A 4CO5A 2YXLA 3WUUA 4IO9Q 5I3UA 3VAFA 1U6BA 5KLVE 4C8YA 1IKWA 5KG1A 4ID5A 2RRNA 1KVKA 3U1CA 1LJ2A 2AJ1A 1RHUB 4JI3F 2QA1A 3KG1A 5KFXA 3KNGA 2NPFA 1PGOA 1NPKA 2WSCJ 5FD1A 3U1LA 4D3HA 3GV7B 4NXMF 2MXYA 2B9XA 3L7UA 1KONA 2VC1A 1PG5B 2B89A 3H1HG 4JI5J 1KQFB 4ES1A 3P45B 2CPJA 4HEA9 3CCUP 3OW2R 2PP6A 1Q5YA 2BE7D 2MPUA 5B66E 3A8JA 5B7WA 4WFNQ 1KHVA 4PG4A 1TMMA 3V81B 2SPZA 3RR7A 2E5LF 1NKBA 2EBGA 1TL7B 2DNHA 1FDIA 2N7CA 2CPSA 2PA3A 3RAMA 4K7QA 3EZ5A 2LP4A 3UCZP 3T97B 1XR7A 3VV2B 3AFGA 3MM8A 3MCNA 3R1HA 2J7WA 2PI4A 4ASWA 2W9BB 2CK3H 1UVKA 1CPZA 1SQVG 3CWBD 3OUYB 5IWAF 4WE1A 4QWDA 2Q79A 2D7SA 3W3SA 4WJBA 3I96A 2P58A 1R6YA 3AY0A 1IR1A 5M2RA 4LBHA 2W9CB 1ZM9A 4I2QA 4RJTA 3CIMA 1CBKA 3POTB 5D0EA 4RW4B 1Y5IB 5AVXB 3A5TA 2ASYA 3PIPQ 5ADZA 4Q2MA 3W9IA 5B0GA 1NOHA 4TVAB 2ZYGA 1L0NJ 2E76C 1BMQB 3DLKA 1WELA 3IBCB 3Q2SC 5GAEI 1RBOB 4DS4A 3T9NA 1Y9BA 1Q8BA 2E76D 2ZT9B 4ILRA 5IC4B 9ATCB 3HVRA 4GRSA 4KQZA 4F04B 3TUIC 2WBMA 3P8CE 1YJWP 2FDNA 1BE3D 1HI0P 3RG6A 3DLJA 2R7XA 5AVWB 4ICLA 2QT7A 3FGVA 5KOWA 4WIQA 3JTOA 2EEYA 3Q8SB 1NU4A 2H51B 1FK9A 3BBBA 3G3ZA 1YDLA 5CZVA 4WTOB 5L1IA 1VC6A 2RH3A 1KFSA 2UXBJ 2MJNA 1XTCC 1KILE 4W7YA 1NJXA 2V4JA 5C24B 2PC6A 2F5GA 3CX5E 1FVQA 2GMHA 4IRCA 1LT9A 3FBFA 1LTTC 2DNKA 3CJQA 1YIJP 3PZPA 4K5RA 1GMUA 2HWHA 4N78D 2QMXA 2FYUG 5IOLA 1TL3B 4RW7B 3Q0AA 3W2WA 3GW6A 2CJQA 1JWWA 3UD5A 3O3LA 3RRKA 1CS4A 3H90A 2BE2B 2VASA 1NMEB 3VOPA 3GE9A 5BU8B 4XDCA 2C2OB 4D6TD 2QEXP 2M5AA 1PP9D 1W2BO 5KT4A 2HW3A 1RJJA 1T9VA 2KH9A 3CCQP 1LK5A 2V2QA 1M1JA 4HDHA 1FS0E 1LW2A 3QWPA 4JYAF 4ZP8A 1G2CA 4HI1A 5K14B 4HH2A 3GMGA 1I94J 4ELVA 4JI4F 4JV1A 3W2VB 2I5JA 2Q6QA 5E79H 3VMXA 1VQKS 1VHFA 1M0SA 3PYGA 2WSEC 4EYIB 3UDEA 4LFBF 3J7Z5 1ZLLA 2X1AA 2KXFA 3KDPB 3KTQA 2WTYA 3KK1B 4KO0A 3LP1A 3L36A 2FHOB 3D5MA 2Q6CA 4K4ZA 4LBPA 2Z0GA 4NLWA 5J2PB 2BYCA 2IBZG 5M2PA 4USTA 1N8RT 3NMDA 3R27A 4HLBA 5E79E 1NDCA 4ED0A 4OV1A 1A02F 3MGNA 1S59A 5KFJA 1DH3A 2B3TB 2DGQA 3CDWA 3TGUD 5KLIB 2XSFA 5E3RA 4OZ5A 3DYAB 1MN9A 3H2UB 3HSZA 3A7OA 3L75J 4F3OA 1W2BR 2MHEA 3JS9A 2J5UA 4GT1A 2HZAA 2V63A 3AQOA 4EUVA 3MUMP 2OMLA 2BEQD 1HNWJ 1JMMA 3HD7B 1X4EA 3W9JA 1MU2B 2O01H 3IR6B 4DX8H 4DQSA 3ZZ0A 1XNQF 1TKZB 4I2LC 2VJUA 2YXRB 4F4WA 2G8YA 3H1KE 4L75A 1J2JB 5KFAA 2OYIB 2ZXEB 2JNJA 5LXYA 1RQ0A 5D4LA 2FB0A 1CJKA 3M8PA 1IQTA 1RT2B 4BCAA 2DYAA 4RR5A 2VFSA 5CCGA 1X9VA 4JUZA 1U8WA 4KGXB 1Y7PA 2QSWA 2MKIA 4UB8E 4O3PA 2OTLS 1CQNA 3MOJB 2QYCA 4WP3A 4B17A 4Y65A 2KFZA 4JI6J 5DJTB 1FZFA 3HD1A 2E42A 3CJ4A 3GJRB 2U2FA 5THWA 3C16A 4R5PB 3TAMB 4F3QA 3KYQA 4KGKA 1RYSA 4ZVRB 3KLIA 4TU7A 3CWBJ 1WC4A 3NAHA 2BCCE 3VAJA 1SQQG 4KIAA 2MZQA 2ZBPA 4YP3A 4G1QA 1WC6A 3L71E 2HQCA 4DV6J 2RJZA 2CADA 1NZ8A 3HZEA 2K8GA 2OHDA 5F9NA 3L9ZA 2EKNA 1S0MA 3K17A 4OX9F 4U95A 1Q8IA 4NLRA 4J7CA 5CCMA 4UUWA 3GQCA 5AVQB 2KU7A 4NYOA 1P6TA 3CJ8A 3GYXB 2Q5UA 3QH9A 4JV5J 2K7JA 4PEOA 5A8WB 3CC7P 1YYCA 3A8EA 3WIUA 3A8KA 2CJKA 3WDOA 3J80U 3KLHA 2DHSA 2CVIA 1SPBP 3JQJA 1SJ3P 3HSDA 4UOFA 4TN2A 5EWFA 3EJMA 2ZBCA 1VQPS 4MIWA 3QJPA 3V2PA 4TXSA 4HYTB 2U1AA 5KFQA 1L0NG 4Z7CA 4OLPA 2P1JA 1PC5A 4A7PA 4NZ7A 3D6ZA 2LEAA 2MY7A 1RE4C 4ECUA 3CCLP 1RTJB 2Z57B 3QT6A 3FEXB 3BO4A 3VZIA 3PW5A 4ZPDA 1L4AB 1HNZJ 3MM9B 1AQTA 2P6SA 2H4YB 2E5TA 4JF7A 3OJUA 2ZJRQ 2NPSB 2FY8A 4ED7A 5L8RC 2UU9J 2C2MB 3M8SA 3WMM0 5HANA 3RAXA 3CJRA 1NH4A 4JQ0D 2WVFA 4DR1J 4EYYQ 3ZZUA 3DLLQ 5SZTA 4RW9B 3EVWA 2YTCA 2BKOA 4WBFA 4RBTA 4M3LA 1CSBA 3AEAC 1KQGB 3M8RA 1S5LX 2Y1JA 2ZXXA 1B0VA 2GMLA 2XNXA 3CO9A 4PD4I 1M90T 2IZ0A 3I9ZA 1TKXA 2WVRA 3QQCD 4QW8A 5E7OB 1NAQA 3D3CJ 4URQU 3BO3A 2HVDA 3D71A 1XIQA 3BN4A 2V4HA 1LP1B 3CCTA 3PYFA 1RF0A 5LMNJ 1EDIA 3OD2A 2KJVA 3OSPA 2N3LA 1S1VA 3BGLA 1DTTA 3RR8A 2G2YA 2NREA 1A9NB 1NSKL 1I1GA 1EETB 1FEEA 2D3OR 4QU6A 5KLVK 3RL0C 2C3OA 2YNIA 5FDLB 4MAKA 3KFWX 3L74D 4ECSA 3RL0D 1E79H 5LL6d 3E01B 5GTIH 1ZZNA 2V9WA 2WSEH 4WBAA 4NPEA 5KFKA 3M7VA 3G71P 2YWEA 4LLHA 1R8CA 3DHWC 4LRAA 1OS5A 5AVZB 1JEKA 3MPVA 3GHGA 2B4VA 3QLHB 2RE1A 3DRRA 3IG1B 1JTHA 3TGUJ 3CCUS 5DQIA 4OYAA 2ROGA 4UOGA 1DARA 1KD1Q 3HHNB 2XLKA 1GNKA 3SCJE 1X4FA 1QEXA 1JMBA 5KLVD 5L9XA 2Q3PA 1VRTB 3UPFA 4ZPTR 2XLJA 3A0BE 4WXOA 1EHWA 2ZH6A 2IBKA 1TAUA 3FFIA 2DGWA 4H13C 2IVMA 2XMUA 3CCVP 2N1TB 3CO0P 4WFZA 4F25A 2FKWB 3TP2A 1Q79A 3SDEA 2ZVSA 4U7JA 4H13D 4R4MA 4JI0J 2HMIA 4W90B 1F3VA 4OI3A 5CD4H 1LWXA 2XV5A 1HYSB 5HROA 4RKUC 5GMDA 3L75G 3NG8A 3UN5A 4A47A 4DSKA 4ZP7A 3V4WA 1RAAB 1LGHB 5U47A 1WEZA 2E1CA 3PEJA 3ET6A 2F4VF 2WCXA 2VPXB 4K4TA 1U57A 3PM9A 4YY3J 4DT0A 2YIUC 4K50A 3LP2A 1RADB 5DZ7A 1Q86T 1U7JA 3BO2A 2E44A 3M8WA 2YH1A 3G9RA 4FVCA 2DXDA 3V2RA 3GV8B 1YJWS 1BCCE 2JVOA 2V4RA 2KS1B 1UL3A 3D6YA 2DEJA 3MF5A 1X4DA 1KQLA 3OHBA 1RU1A 2DR8A 1N32F 3CCJP 5B08A 3M6UA 5AW9B 2HNYB 1KBRA 5CCHC 4JYBA 3CXHD 4CLSA 3VP9A 3QT8A 2JC0A 2C2EA 1TELA 1C0UB 4U67Q 1XMQJ 3IR9A 3L70J 5CCHD 5KFGA 4DV4F 2FBWC 1BGYE 1N5YA 4JV2A 3LF0A 2GNKA 3OLBA 2QE5A 4R0JA 2HGLA 3CWBG 2QJKB 3BQ0A 1GDTA 1JLGB 4R25A 2Y9HA 1MLAA 5DG9A 4UZCA 4Q7AA 1YIJS 4CO1A 2RKLA 2H7HA 4OJ1A 3Q1MA 1OIAA 1USDA 4DUZJ 2BJ9A 1NDLA 4ZVQB 1JLCB 1T3NA 5GADU 1J5EF 1JY3O 4MKBA 2FFDB 1GW3A 1NTKJ 4B02A 1Q1KA 3RB3A 5A76A 1Q81T 2QEXS 4MK8A 1FOSE 5HLFA 3BH6B 2DHXA 3CCMP 3CCQS 2XMAA 1YTZT 1WSVA 3TO8A 4YDXA 4ATNA 5AW7B 3CX5D 2AZ1A 3SCKE 2NXEA 1BE3G 2GVDA 1FEHA 1FD2A 2L08A 3CDBA 1K9MT 3G87A 5EWGA 3OPKA 2IMWP 5L8RJ 3VMYA 2LXBA 4PKDB 2IM3A 2Y8YA 1P9YA 1BLUA 1NJIT 1LFWA 4PAAA 1RSCA 3MR5A 4U3FE 2V9KA 3M0AA 5A0YA 2ASLA 1ZRTD 2RD5C 2ZH1A 4ECZA 5E33A 1SC1B 2KLUA 2VB6A 3B4MA 3N5BA 3DLHA 1JLQA 2KNCB 1EZZB 3QNWB 4P10A 1Y5NB 1ZS6A 2WVEA 4EI2A 1M90Q 2VG6B 4RJVA 3L73E 4PZVA 4KH0B 5DQGA 5A8RA 1QY7A 4JI1F 3TQEA 3BRTB 5AJ3F 1HWKA 2XMJA 4BRYB 2KM8C 4OFZA 1WTBA 3HSGA 3CNQP 1BWVA 4BWJA 4C97A 4OGQB 4KHPJ 4C8LA 3JAMU 1PGJA 1EC5A 4O44B 1ROFA 1M8OB 2HPUA 3UVJB 3KK2B 2XC9A 2EG2A 2OTKE 1JXEA 2MYFA 4J9KA 1RT7B 2FJWA 1BSHA 5G4DA 1UWAA 3T6BA 1CW5A 3A8IA 2JLFA 3EX7B 1A7GE 4A46A 1SQPE 3NGUA 3V6DB 2DGVA 2XY5A 3CJKA 1N34F 2OPPA 5F8JA 1IWAA 1HR0F 4FBUA 3PLNA 4ZA1A 5T7LA 1SVFA 3ENVA 1UFWA 3K7RA 2J0QD 5KLVJ 4NMLA 1DX7A 3FSXA 1KN7A 2E43A 2XCPA 4FF4A 4B9VA 4XPCA 3H5UA 4C7QA 2XYHB 4DR3F 2BEZF 2MKYA 5KTBA 2PMHA 3HT3A 5KFZA 3DOMA 3EDQB 4PG6A 2YKOA 4URSA 1OVVA 3J81Y 1VHIA 2JWNA 1RT1B 4MMOA 3TGUG 2Z56B 2LQBA 3OVBA 2B56A 2MQQA 1RCXB 3E7KA 4WFXA 4F0HA 1FKOB 3ABVC 4OI1A 4ZLPA 2DBBA 3TZYA 5AVVB 4X66F 1SJ4P 4RKUJ 1N86A 1ZPWX 2UUAF 2KXHA 1QSLA 1ZA1B 4OQJA 3MEDB 4DL2A 4OV6A 4X2BA 2AMCB 2IC3A 4JI2J 2JH3A 1P9QC 4PWDB 1XMOJ 4LF6F 3ITHA 3K8VA 3TNUB 1NO4A 1TUWA 1YTYA 4DR6J 2QIWA 3ULHA 5H2FE 3M0DC 2Z2LA 4QYZK 1S9EA 3AXKA 3L95X 4FBTA 2DNQA 4DV1F 2HBQB 2UUWA 1MZ9A 1IKYA 5CD4A 2E74D 2BW7A 4CH7A 1Q86Q 3CC7S 4X4TA 3KOAA 4WFAQ 1OZHA 1CLFA 2YKMA 5CYJA 3ZZZA 2HFZA 3OL8A 3QATA 3L71D 5K5GB 2R2SA 4FN5A 3SFEC 3M30A 4C3KA 2M8HA 4X62F 1R5SA 2I1RA 2M0GB 1N73B 1IBLJ 4UQGA 2C3MA 2B5JB 2ZT9C 2JDIH 1MFZA 4NXNF 1AZSB 2XDJA 3GIIA 3W1YC 2XSJA 4DV5J 4DG1B 3M91A 2ZT9D 3CCLS 3PTZA 5ETVA 3FVYA 3MWBA 4PV1B 1NRKA 1P1TA 2HNDB 5F8GA 4KR0B 3CXHH 2IJFA 1TVRA 5CYMB 4DFPA 3HDSA 2CNNB 3M2RA 3T1HF 2B88A 4NI2B 4F26A 3C9IA 2YMYA 1Q8KA 2VG7B 2ZDPA 2Q3IA 1DD4A 5E5NA 3TAPA 1EZVD 1N7LA 1ZW0A 3L70G 2CQ1A 4XAKA 3H98A 1RA7A 1IXKA 2XY7A 4IFYB 2BM0A 4DSLA 2Y0EA 3VGUA 1ZTWA 3PR5B 1IJFB 5APVA 3T41A 2CG4A 2HFOA 1D9AA 3IWXA 1NBEB 1Q81Q 2R3CA 3KLFA 2W83C 2OKQA 4DR2J 1KYOE 4USUA 2LDIA 1GL2C 2YNGB 1A6LA 1CULB 4ECWA 2NXNA 2JZ5A 4LF8F 1NTKG 2CDRB 1GL2D 2HQDA 1YSJA 4MN4C 1VQ4P 4ED6A 1K9MQ 1ZPVA 5F8IA 2GQQA 4UF4A 3MCSA 3IO1A 2YKPA 4PCQA 3OTEA 4UB6E 1WHVA 5H9EJ 5AW5B 1UW9A 2HFSA 2MTLA 5HBMA 5HK4A 1NJIQ 3LUYA 1QSYA 2H88C 4HL9A 2QV6A 4KGVB 3G71S 4OZLA 3KZIH 2IYPA 4I56A 2IX7C 4TLQA 1EQMA 4KKOB 4LSNA 3PVXA 2M7SA 1GAOA 1KLMA 4ZJQA 4BWNA 5A8KA 2BJ3A 2X7IA 3CCWA 2Y9YA 5A2QU 3J81j 4I7FB 4A8MP 3VF0B 1IFDA 3V6IA 2JLEA 3L3CA 1S1WB 5K8PA 1YG0A 2H89C 3N6LA 1LWUB 4LGDE 3VGTA 1TP7A 4A8WA 1FXRA 3AOCA 2LVWA 4WY4B 4FS1A 2W7OA 5EFWB 2OQQA 2GUVA 3NWRA 4PQUA 2ROPA 3OFHA 1CC8A 4GVLA 1BUXA 1EP4A 3ETMA 1QE1A 1LWFB 3SI8A 1HTLC 3CSKA 1LWCB 2C2ZB 3AE9C 1UMJA 5IV3A 4WP9A 4K4SA 1VJWA 2FVSA 1BSNA 1L2PA 4CO3A 2DNNA 2OTJP 1PSDA 2FC8A 1JJCB 3HD7C 1WF0A 2OPQB 1WC0A 5MAOA 5F8NA 2HODB 1Y4ZB 2D69A 2DT9A 4E98A 1ZOYC 3HD7D 4ZVSB 3N0VA 2GHVC 2LQ8A 4OYBA 1RQVA 2Q43A 3IBWA 4IR1A 4XA4A 5HMZA 1ZM4A 1IFMA 4Y2CA 2OYIC 4NASA 4A4JA 2XU6A 4Z1MH 1CJUA 1T0TV 2CPDA 4YHHJ 1YKWA 3W5YA 5MLCV 1UA1A 3BRVB 1AXQA 2AX1A 2A45G 2RQCA 1J1EB 2G13A 2QLWA 3H1KJ 2D41A 1HWUA 2VG5B 1FDOA 3V2NA 3U7JA 3C8YA 2DVIA 3AJ1A 1VBXA 2AEMA 3GG2A 5H1SV 4MKAA 1CJTB 5KLVG 2KFNA 2UUBJ 3TAQA 1U1RA 2ZBIA 2W4DA 1N5VA 2R7RA 2VRSA 4N6JA 2RMLA 3LGHA 1M5HA 1E6YA 3CCJS 3A0HE 3H1ID 3DOLB 4Z37A 3EM1A 1NK6A 2GAGC 4DL0C 3PHTA 1TAQA 2FJVA 4KRWA 1N33F 2HQ3A 4USVA 2YBVA 2ZE2A 1WKKA 2D1CA 2E1AA 1X8DA 1NJYA 2CYYA 4ZLNA 5DDOC 2R3SA 4NLGA 4LF1A 1JY2O 1AB8A 4OYIA 3CMEP 1WOSA 4PXCA 1H0TB 2Y3YA 2BCCJ 2P9EA 2OPSB 5ETPA 3TUJC 4DV2J 4HH0A 3L71J 3EYZA 4ZVGA 3Q3DA 3M1VB 3IRXB 1I51B 4IG3A 4MTPA 2ASJA 2HHVA 4YFUA 1W5CE 4PG8A 3NS7B 3GIMA 2MQLA 1QJHA 4F3MA 1BDDA 3CCMS 1GTEA 2BANB 4HACB 2MZTA 1QTMA 5C25B 4K4WA 1NB2A 2EKYA 1ZP0C 2L9NA 3KLEB 5G0RA 4CLUA 3E1IA 2XTJP 1S1UB 1F6TA 1UIIA 1MG7A 2HWTA 1JLAB 1U49A 1V9OA 2XULA 3B4DA 3I0SB 1Q2NA 4LSLA 2A45I 2H5IB 1S2EA 5IZHA 2COLA 1RHKB 2Y1IA 4IRDA 4Y2MA 2Z8QA 1VQOP 2DCLA 2UXCJ 2YX7A 1SH3A 4UZBA 3C66A 2CQIA 1ZBTA 1JB0C 3VYIA 2Y0BB 4QU7A 1L4AC 4AL5A 4F02A 4FXWA 2QMWA 1G4CA 3F44A 3JSMA 1APSA 4WB4A 2O1JA 4HR2A 2R8IA 2MDAA 3OTCA 2GHWA 5KAKA 1L4AD 1TV6B 3VN0A 2KHCA 3O6QA 3FZ2A 4CRJA 3DRPB 2IYIA 5SUHA 1C1CB 5RUBA 3GP9A 2MGZA 5CCHA 1RT5B 2RU9A 1UW4A 2VPZB 3QWUA 3E3XA 4I1LA 1JY3P 3R3TA 4O3OA 5APUA 2ZWPA 4ZHRB 2O01N 1BQMA 1KQSR 2CPHA 4DQQA 2KJWA 1NSPA 2H3EB 1E6VA 2YNHA 4U3FD 3GSIA 2Z30B 4NLSA 4DJGA 3TYTA 5B5EE 5J2NB 1QUPA 2P9CA 1S1XA 2WPVB 1B7FA 3MZIA 5KFTA 3MGJA 4N7TA 1N88A 3PX4A 3BGOP 1GK6A 4Q44A 2ZHBA 3EZOA 1R0AB 1F9FA 1EDJA 1YVFA 1SH2A 5C42B 1H74A 4OHZA 4C7NB 3TA0A 1GZLA 1EARA 1M5PC 3PO4A 2PAJA 3TQ1A 3JYTB 3BJYA 4AUKA 1S49A 1X22A 4M5IA 4I1TA 4JI3J 2MJUA 1M1KT 2D3O1 4P7VA 3NP5A 2P2CB 4HYKA 2X1BA 1FJEB 3DGPA 1RAIB 1NAFA 2NLWA 4GMKA 2RIJA 1SFCB 1HD1A 2QMUB 3CXHI 5I42B 3BSAA 1JKHA 4DU8A 4WTYA 1U6FA 4N41A 2KYXA 2KLVA 1LTGC 2KDOA 2ATCB 5AXNA 2HHHJ 3ZTQA 5KFWA 3MUDC 3CDEA 2E5LJ 1OW7A 1S6PA 3KQGA 3U1AA 1FT8A 3MTJA 3VHQA 4MIAA 5FLXY 4GDOA 1HPZB 4CO0A 3IS9B 4S0MA 2PDAA 2GS8A 4QR2A 2N1TC 5HVFA 2DRAA 2YQ1A 5DDQC 1YITP 3SBMA 2GVZA 1VC0A 1WG4A 4M5KA 3CL3D 1LTBC 2WSFJ 3HHLC 4MYUA 2XO7A 5IWAJ 1N7SA 1LWEB 1IJEB 1IFPA 4LFCJ 2KG1A 2W25A 4O4GB 2QFJA 3HHLD 1GK4A 5AW2B 5IXUA 1VGYA 3MIWA 4DSEA 3TUPA 4RZRA 3AHPA 3CX5I 3UW1A 4CPGA 2AD9A 2PMWA 4OYXA 3C6TA 1VIOA 5CBNA 1RZMA 3T1AA 1J5OA 4J9QA 1V5IB 3L35A 2G0IA 3QO9A 2AJQA 5BJRA 2JKVA 2ZDOA 2HQFA 2NZCA 2UZAA 2R8JA 3K5LA 1UVJA 3DOKA 2RHQB 4QPXA 1RLDA 2IDLA 2OFGX 2AHOB 4R4LA 3S1TA 4MKYA 4P52A 1LTJB 4ZS6A 2E7VA 1PGPA 4O9BA 4TQRA 2X51A 4GO7X 3BQ1A 5K20B 2YQ0A 3PRVA 3HKZD 3TARA 1T7PA 1C0TB 4J90A 4NA1A 4YB7A 5LJ5Y 5HMXA 4NZ6A 3TVYA 3B4SA 1VQ7P 1NU1E 2BJ7A 3LP0A 1BCCJ 5LSRA 4PG5A 4Q0BA 2CQHA 2QL9B 1KFNA 1B0PA 2P8IA 3EUNA 2QGFB 2W6JH 4F4XA 4QMAA 2QJKC 5DG7A 1GX5A 4F4KA 4LRFA 4FKYA 1BGYJ 1GMJA 3PHLA 1YI2P 1AROP 3SQGA 1S97A 4PPZA 4ITSA 4CLTA 4RWWA 2BX6A 4B3TJ 1SJRA 2KI7B 4JPZB 2VPYB 1IBCB 3L71G 2VA2A 2V67A 3ILJA 2FFDC 2V8GA 4Q45A 2W9BA 4ZN1A 1LNQA 1USEA 1D3WA 5ITHA 4XE5B 1KB9E 2HFED 1DJ0A 4KV8A 1VQ4S 1XNRF 4KHXA 2MKJA 2RH0A 5GVQA 4NLXA 4FPIA 4HDGA 4JI4J 3QRQA 2YNFA 5E3AA 3IFMA 3WBZA 1SI9A 4KT0C 1HF9A 2UV8A 1NLKL 2DITA 4ED4A 5AVTB 3H0PA 4OZ2A 4AE5A 2CA9A 1C1BB 4M94A 3EE3A 3JB9k 2QYGA 2MEWA 3VGSA 5AE2A 1U48A 1FE4A 4J91A 3HT0A 1R31A 4JB8B 2RQ4A 3A3YB 1EZVG 1Y5LB 3QBCA 3KHRA 2XZDB 4DR7F 1PO6A 1JIHA 3MFHA 2HR3A 1Y9OA 5IV4A 5J1PA 3AA8A 1ZM3A 1DRZA 1VQLP 4XPEA 3I55P 4OZJA 5A6WA 4U3FJ 5IM0B 4H4MB 4KJMA 4NCGB 1WG1A 4LF4F 2W4CA 3CWJA 1Q7YT 4DMZA 4PXEA 5ETMA 1HIYA 5KG4A 2VKZG 3G6VA 3GJQB 4NWBA 2FGOA 2R2RA 2Y1RI 5DJBA 1JNRB 4C6AA 3QGPA 3L73J 5KFFA 5AE3A 1T03B 1HBOB 3CD5A 2W4PA 2KB7P 1YTZI 5KFHA 2RMZA 1Q78A 2N82B 1PJ6A 2WZ7A 4I0WA 4M5DA 1S4FA 2OEKA 2OTJS 4X4PA 2CPEA 3TVKA 4U6PA 2CPBA 2RF2B 1Z2ZA 4JI7J 2K7KA 2KK7A 2IZ1A 3K2YA 2GQCA 3PW7A 1GL2A 3MM6B 1VCTA 4FXDA 2QRRA 2X1FA 1DTQA 4WZMA 1NTME 5L1LA 1Y11A 1ZMEC 4F0MA 2GQ2A 3BSNA 3T5LA 1SQPJ 2VDIA 1IFIA 4KE5A 3BYPA 3M6WA 1X9MA 3MECB 1RWMB 3TOQA 4X4NA 5DDPC 3D6TB 1YBKA 2MSTA 1X0TA 1U0HB 2H43A 1EZVI 3KK1A 3FMBA 2YWGA 3H25A 3OTBA 1YQHA 2LQ5A 1RHQB 3PDNA 3RBXA 1IKVB 2YXQB 2CNOB 2FVQA 5HP1A 3SCLE 4RU2A 5J2PA 2BE9B 2AYMA 2FLLA 2XYGB 2FUG9 1L0LE 4U7UK 1HARA 2ADCA 1RAFB 1HMVA 1PGZA 4CO4A 5AVSB 4ZIVA 3TF5A 3H1LE 3LGMA 3U27A 5F9LA 3H1HD 1J2VA 1GH8A 4KAIA 5I3UB 3CMES 2XNRA 4KH1B 4LFAF 3I5AA 4LVNP 4OX9J 1IKWB 2DHAA 2HFUA 5GADI 2JJLA 1Q95G 1Y10A 2VDHA 5D4PA 4DL4A 3U02A 4ID5B 3NGTA 1ZM2A 1VQ9P 1U8SA 1S76D 1F60B 3AE1C 2J7UA 3W8GA 1F2GA 1IBKJ 3VAIA 2CQPA 3S8SA 4CLLA 3M9HA 2KB2A 3AD8C 4DV3F 5JXSA 3IRWP 1X0FA 4LQ9A 3QJLA 4PR6A 2WSSH 5APQA 3FJ2A 3Q8PB 2ZYDA 1FE6A 3HD7A 2P10A 2HNZA 4U7UD 1MU2A 5E2QA 1SUQA 1SJ1A 2JWDA 2JWAA 1TFWA 1SH0A 4J9VA 1M7LA 2V2VA 2AYEA 1LEOA 1N73C 4U8YA 3I32A 4RNNA 4PJ0H 4USJC 4Y2IA 1FF2A 1S5LH 2OYIA 3CUNA 2AQ4A 1VQOS 2EI5A 2P5VA 4YQWA 3MM8B 3CMAP 3MD0A 5KFUA 2RDJA 2MQOA 5GAGI 4C98A 5LMUF 3NCRA 2ZJPQ 3BB5A 5CABA 1SL2A 2QA2A 2XGPA 2RQKA 4WE1B 3T1YF 2X3GA 2ZNZA 3EFGA 1R27B 3SEOA 3OL9A 3BS9A 1JCDA 2FYUK 3IAS9 1PBUA 2R7SA 1Q53A 3WZ0A 1G7CB 4I2QB 2WONA 2BXJA 3MR6A 1FJGF 2X3DA 4OZ0A 3B5ND 1RWVB 1WEYA 4ZVUB 2MSSA 3DLKB 3G8TA 5KFBA 1BGYG 3CJTA 4B3OA 3BDPA 2NRGA 4RO0A 4RBVA 1FFGB 4OJGA 1YJVA 2M0BA 1SQEA 1JLFB 3ZZPA 4AXJA 4KT0J 1PJ5A 1D9DA 4Z7YA 5B0DA 2XCAA 1OYDA 3DFEA 1OSDA 3KWMA 5DJUB 2E5IA 2FYUD 4ICLB 1PBAA 3A3NB 4HT5A 2FPHX 3VAMA 2IJNA 2OMOA 4ZMMA 4FYDA 1FK9B 1KORA 4XIUA 2RKIA 1S1CX 4USHA 2XNDH 1T8ZA 4DLEA 2PSZA 3PTWA 4JI5F 1AW0A 4IO1A 2V4JB 1YGYA 4P2MA 4CZCA 3OV7A 3NEKA 1LT9B 3QZ8A 2M5YA 3UCUP 2RRBA 4B9TA 1RTHB 3MMAA 1Q7YQ 3W2WB 3D2WA 2AU0A 3SMZA 1JO5A 2MZSA 3OL6A 2FJXA 2DR6A 3HHEA 1CS4B 2WAQD 1FU1A 1UWBB 2JX2A 5DM6Q 2FZCB 1LWUC 5HI7A 2KO1A 3E1RA 3T9ZA 2M5AB 5IFMA 4U3FG 5IQ6A 4TYAA 5KAIH 1SQBE 2AYGA 4LC1A 2F8MA 1GXLA 3LPYA 4CI0B 3SWYA 4EYHB 2A6MA 2J0WA 1M1JB 3NS6A 3UNGC 1LW2B 4YB5A 2IBZD 1G2CB 1K04A 1OW8A 4OHVA 2I5JB 2J5AA 3TJ8A 1PPJE 3L73G 3HZGA 4ENOA 2B4OA 1NVOA 1RAHB 3A4TA 1P84D 3OVAA 5TJHA 4WCEQ 2ZD1A 5HQLA 2CWKA 3MCOA 2WMMA 2LXUA 3LP1B 4CO2A 4EBDA 2DHGA 5HAOA 4K5SA 4B9UA 3C14B 5KAIE 2F4VJ 1HJ0A 4OWFA 2IVYA 5IT9Y 2A06E 4RNOA 3MEKA 1MNEA 4X4SA 2ZBRA 2ZH3A 2EVZA 3V6HA 3HUSC 1RTZA 2NSCA 2QIFA 2V6AA 1KOHA 3EPGA 3VWSA 2LKMA 4DUYF 1O8BA 5ETRA 3VVTA 4N47A 1FZBA 1J1EC 1W2EA 3C8VA 4CT9A 3HHKA 1NDPA 1SQPG 3EQ2A 1RQUA 3AECC 6AT1B 4ZPWR 2QJYB 1VQ8P 1VQMP 2XHWA 1G1XA 3CDAA 2UXBF 1NU1K 4NL5A 2XMTA 1IKXA 4AQRD 1HNVA 2I8EA 4M5NA 4H54A 1VQ7S 2N4DA 2HVEA 4QWCA 4C11A 3JC22 4I67A 5D0HA 4LF5F 2R2UA 4DV4J 3THPA 2ACYA 1OY8A 3KLVA 2CQBA 2DJWA 4DCKA 1RB0A 3RB0A 3MUDA 1DLOA 3M32A 6FD1A 3RBEA 1YJNS 4TY9A 4O3RA 2CZ4A 4IOBA 1VRTA 4YEAA 5AW4B 3CTRA 3HM9A 3GU0A 1S6UA 3GV5B 1V3ZA 1CJKB 3M8PB 1FAVA 2LXIA 4TY8A 1QM9A 1RT6A 2DHHA 2BKPA 3C15A 2R32A 1JK9B 2DO4A 2EFOA 2LU2A 3HHLA 2LU1A 2E9TA 4RNHA 3V4QA 4OHWA 3KG4A 3LGNA 4WK1A 1K73Q 3MM7A 2A18A 2IVFB 2JVRA 4MH8A 1OMIA 3TEHB 3UNYA 4EWTA 3K5MA 2ZKTA 1G1IA 4K2JA 3C16B 2KKHA 4FNHA 4N76A 1FXLA 4ES2A 1DAXA 2E75C 1HKAA 1KFDA 2JSXA 4ZCLA 4G1PA 2HFVA 2E75D 1REVA 1U2FA 3AOAA 2ZFCA 4G1QB 3NLCA 3AEBC 5KJ7C 1P1LA 1K8AT 1S9KE 5KJ7D 4ZPCA 1X31C 2YO2A 3DHXA 1KB9D 1UFLA 3QZ7A 4NLVA 2B6AA 3R5JB 1L0ND 1M1HA 1HNIA 4TU9A 2HLTA 2XMKA 1VQLS 3I55S 1MMNA 3P96A 1TK8A 3CJ2A 5AJ3J 2ZNYA 2IM1A 4DPYA 4MT1A 1PAUB 3CEDA 3KLHB 3PACA 2IFXA 2WT7A 3BF4A 1JJ4A 1HNWF 4KHRA 4UY8T 3W63A 1BQNA 3DDIA 1WC1A 2EBEA 2VONA 2IJRA 5L1JA 5F8HA 3D7SB 5L46A 2UUTA 3GFHA 3GWCA 4K59A 3US5A 2V8VA 3DRSB 3PR4A 4JP8A 3ENQA 2OYHB 1Z56A 4WPAA 3Q8QB 2EC2A 4ECTA 5D77A 4B3MF 3QT7A 4I2PA 3WX4A 3D67A 1JLCA 2V50A 1ZV8A 3TANA 1KILB 1KC8Q 1WHWA 3NWGA 3DLEA 1HNXF 2FFDA 2KZJA 2YPZA 4OZNA 3DRXA 2QTWA 4KSEB 5DGBA 2XS7A 1IN0A 2G0JA 1GXUA 3HMJG 3R5GA 4YXDC 4C2MA 2YWWA 3AA9A 2QE7H 4DR3J 4KYZA 4IKAA 1HBWA 1TKXB 1LW0A 3NMAA 4DR5J 1NKZB 3C6UA 4I6MC 5F3TA 1NHKL 2KHDA 2IPOB 3MMBA 5D78A 1IJDB 5J2QA 5BXIA 2JEJA 1NH7A 1S1VB 1DTTB 2Z2MA 3OSNA 2MKKA 3ZZTA 1HWLA 3RRHA 3OVSA 4ZKPA 3MTKA 2QZ8A 1OVUA 3R7NB 3FXEA 4HB1A 1U45A 2FZKB 3UN2A 5BR8F 1S1TA 3SFDC 2YNIB 3IR5B 4AFFA 2RVJA 1P84H 3WHIA 3DDKA 4TU8A 2ROEA 5B0BA 3NRBA 4JV5F 2XKMA 3D0GE 2EK1A 1VQ9S 3R6GB 3MMCA 2V5HG 1HBMA 1UJ5A 4OX6A 2W27A 1N5QA 4DV1J 3QGGA 5BYRA 3KHLA 2C2NA 3GHGB 1WG5A 3DRRB 2OD4A 1UZHA 3VQTA 1F0XA 4JI8F 3H1LD 3OJSA 3I4PA 1AJYA 2OPRA 1MMLA 3L72E 3B8HA 3SSRA 3L75D 3N7NA 3KMSA 4ED3A 3JSBA 3NOCA 2QFIA 4LR8A 1DHMA 1LTJC 4K4UA 2BJEA 2PA8D 2DH8A 3B71A 3KPEA 2UU9F 4P2XA 3FEZA 3DN9A 3TW0A 3LIDA 1UP1A 1XQIA 1SL1A 4DR1F 1W25A 1YWXA 1D0EA 1N54B 2UP1A 3SDEB 2CQCA 2HMIB 1HH0A 1Z1ZA 4ECRA 1U1LA 4LRDA 3GONA 1GTHA 3CMAS 3T1HJ 1FRLA 3W7BA 1WI6A 5F8LA 2Y8WA 2YQ3A 1ACMB 5HROB 4K4XA 1KV4A 3NGSA 4W7ZA 3V5BA 3MAAA 2WSCH 4DZOA 2J9CA 3HVTA 3FQLA 1NU1J 1HI1A 4G65A 5GMKa 2CPYA 3P6YC 3ET6B 4QIVA 5HVGA 1S3JA 2C2DA 5LMNF 3L4BC 1R7IA 3NTNA 3HTKA 2A2DA 4IH5A 4U96A 3II6A 3LP2B 2WB4A 3MR3A 5EWEA 2VV5A 3OTDA 3ITKA 3UIAA 2HAFA 2F8EX 4U9RA 5CHXA 4PD4H 4A48A 2QA4G 3Q5SA 4G1IA 1PILA 4NEZA 3V6KA 3UCGA 1FKPA 3DGVA 3UE2A 1ZA2B 5D8HB 1RBLA 2H5EA 4C4WA 1JY2N 4B3SJ 4LF8J 2XS2A 2PN6A 4H0LC 3IBFB 3TNUA 4J9OA 2HYNA 1XR6A 1PCAA 3M2UA 3FBCA 4H0LD 2ZH2A 4CYUA 3S1KA 1CQMA 1SQQE 3BATA 1BXNA 1PAEX 2J76E 2E66A 1K8AQ 1U25A 1WWHA 1N5YB 3EGWB 4PD4E 4BLGA 2HURA 4N5SA 3MD3A 1ZR2A 4UOCA 3U59A 4ANCA 1KOOA 4ZKUA 1HQEA 2IYGA 1HFEL 1H89A 2D3ZA 4ZIWA 1K47A 4ZK7M 1N73A 3H4DA 4LUBA 1ZZFA 2IBOA 5AW1B 2OARA 2DRDA 1R43A 1F5AA 1PL5A 4RW6A 3DKDA 3SWFA 3WX8A 2V69A 1HI8A 5APSA 3S7RA 4JI0F 1RP5A 4BXLA 3ISNC 3J7A1 5C2CA 1RKIA 1WF2A 4NI2A 3RB4A 5HLFB 4DCOB 5E41A 1NKNA 3ISND 3OXLA 4WFBQ 2RILA 2BKNA 1DEEG 2E9RX 1GMWD 2BUNA 2AKWB 4QJVA 3W66A 1U24A 3B5NA 1X4HA 2GVDB 3JSYA 4AQYJ 3J80Y 3MCMA 1U1OA 3KKFA 3O2IA 5TISH 3LW5C 4TNOA 4YY3F 4IL6H 1FKAF 4NOHA 4CM0A 3G96A 3H1JE 2WVDA 2AT1B 4BC7A 3CJSA 1HHQA 5A0YB 3A3OB 3BGRA 1D9FA 3JTPA 2AJ4A 2JJ4D 3OJAB 2E5YA 2B87A 3NBPA 1VI7A 4C0BA 3G6EP 4K0KF 1JLQB 3Q2TC 1VK8A 1RTDA 4G3IA 4LMZA 3VZHA 4J5OA 3GCXP 2HS0A 2PT0A 3FZBA 3FKBA 1L3UA 1FX2A 1PPJD 4W98A 2XY6A 4F50A 1WORA 2C9LY 5A8RB 1CVJA 1TU3F 1N52B 1NTMJ 3SSSA 4LF7J 1VQ8S 3GFXA 4RBUA 4ER8A 2W24A 4NLQA 4WXWA 1VQMS 1XMQF 1RHRB 2C2RA 5KFRA 5IC6B 2NPIA 1TFYA 1KRPA 2A06D 1WHYA 4YMEA 1N33J 3F5HA 4LR7A 5K8OA 1RWOB 2XQCA 2FYNB 2O1PA 4B9SA 3IWLA 4MKVA 2WRMA 3S01A 1KEKA 4DUZF 4RW8A 1EDLA 3BGFA 2XWXA 4LBIA 4DR4J 1UVIA 5E3PA 1L0LJ 3CJKB 3MAQA 3CJ5A 2OPPB 1KD1T 3OFEA 4I7ZC 1Q8LA 5T7LB 3H1LJ 5KKZB 4USKA 5J1EA 1MUUA 5APYA 2BA9A 1SKSA 1SJFA 3DMJA 1UJ6A 1UAWA 2GGPA 2DR7A 2F7VA 4LF9F 2BW2A 5DLFA 4GKKF 4DV7J 1FRKA 1AT1B 1SV5A 3DOMB 2M3EA 2PO4A 3KHGA 2G1DA 1TMJA 3M4XA 4X4UA 2Z2YB 3MPYA 4DSFA 1ZN5A 2K9YA 3HE4A 2OJ3A 1S4XA 2ZWOA 3T19A 3GIRA 2M8DB 1URQA 3ICLA 2N9BA 3CCZA 3R7BB 3WU2H 3HUSA 1RKJA 1OMSA 4DF4A 1S9GB 3P8MC 1DBDA 3Q5RA 3V4IA 3IGNA 1T11A 2IAJB 3HSJA 3B8EB 3C1LA 2OUGA 3ETOA 3BSCA 1Y3JA 1W2IA 3D6HB 1WD6A 1PYSB 2HBRB 2IC3B 1S72P 1T05A 3AODA 3BSOA 2YKQA 3S9OA 1HWJA 3I87A 3Q5PA 2Q1LA 3BDEA 3AE6C 3FCWA 3IAOA 2R5BA 3TA2A 2HRTA 4ERDA 1YBUA 2IBZI 2FY1A 1S9EB 2VBWA 1SS1A 2W6AA 3B6BA 4UQTA 3R4YA 2MQPA 5KT5A 1IKYB 3L7PA 3DNCA 2KRBA 1PKUA 4WVZA 3CULA 2FJEB 1P84I 2YKMB 1NU1G 2VFRA 5KFYA 1S0VA 1RGVA 2W2QP 4BBYA 5LSLA 4ZOSA 3M30B 1JLEA 1NTKK 1QX8A 2HGNA 3JCUH 1ULRA 3T6JA 2ZAEB 4DZDA 3J7AN 4ZPAA 2GIFA 2KT3A 3L70D 2XSJB 2C0XA 1SQXE 1FDMA 1FRIA 2NZ2A 4USMA 1OW6A 1JOCA 1RF1B 1TVRB 3DC2A 1EIYB 3ISZA 2J0SD 5LM7E 3M2RB 3SZ2A 3QGIA 3Q8RB 3BGUA 1LTIC 2EK6A 2XS5A 5DS7A 5AE1A 2R9LA 2WW4A 4OI2A 2HLUA 2QN6B 3HRNA 2MKCA 3O8WA 3JCUE 1ZAVA 4Q5VA 1H72C 1SLQA 5ETNA 1UCNA 3HJVA 3Q24A 4CCHA 4XFJA 4I64A 3KLEA 1NTKD 1DIPA 2J8AA 3R5DA 4I6WA 4J9NA 3R5AA 4DCPB 2ZITA 1OQ6A 1QL1A 1EX8A 4MFBA 2GJIA 1SC3B 3I0SA 4CH0S 1RT3A 2R7UA 2XNQA 5KJ7A 3H32A 1QAIA 4YS2A 3KLFB 3GILA 2RDDA 2KIKA <