3I5CA

Crystal structure of a fusion protein containing the leucine zipper of gcn4 and the ggdef domain of wspr from pseudomonas aeruginosa
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
196
structure length
196
Chain Sequence
RMKQLEDKVEELLSKNYHLENEVARLKKLVNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPGGGGQTFRVLIEMADQALYQAKNNGRNQVGLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion of General control protein GCN4 and WSPR response reg
publication title Determinants for the activation and autoinhibition of the diguanylate cyclase response regulator WspR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 68
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3i5cA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i5cA02
1C2PA 1DLOB 4IR1A 1JLCB 3M8QA 2D7SA 2W8LA 3QGHA 2IM2A 4Q8EA 3CJ4A 4MK7A 4F4YA 2YNGA 4Q44A 3H59A 2I1RA 4OL8A 1NAFA 2WOMA 4RW4B 3QZ8A 2I5JB 3HVTB 3G6YA 1HNIB 4ECXA 3C6UB 2W9CA 1HWTC 4RNMA 2WTYA 3ISND 4LQ3A 4B3OA 3OHAA 3BSNA 5KFJA 4F4XA 3LP2B 4Q43A 3DOLA 1T05B 1EETB 4O3NA 3I0SB 1TV6A 3MFHA 3L35A 3DLGA 1U09A 4RW9A 1N4LA 1HPZA 5KFEA 4TLRA 2B6AB 4NLUA 5AW9B 3N6LA 2UVWA 1TQLA 2IM1A 2AX1A 1C0UA 5KFCA 3M0AA 4O3OA 3CWJA 3M8QB 2WK4A 3H40A 3UQSA 1TL3A 3GIMA 2YNGB 4MK9A 2GIRA 1MMLA 4R0EA 2WOMB 4TY8A 2HMIA 2XGQA 5KFFA 2V9WA 1RA7A 2FJVA 1I6JA 2JEFA 2YNHA 2XGPA 4B3OB 2P67A 4TYBA 3OHBA 2YNYA 4J9OA 1W25A 3KHLA 1HARA 2R5DA 3MR3A 1LWCA 1TV6B 2JEIA 1YVFA 5I42B 3DLGB 4ZP8A 4RW9B 1GTWA 1HPZB 4J9KA 3BSCA 4TY9A 2AWZA 1HBWA 2JC0A 1C0UB 1NWQA 2HNZB 4WZQA 4O3PA 1KQLA 4KE5A 4URGA 5KG6A 2RDJA 1C0TA 3M8PA 2BR0A 1SLQA 3N6MA 4JV1A 4TY8B 4MFBA 3UPFA 3CDWA 2IJNA 5AW8B 2RF2B 4F4WA 3H4BA 2YNFA 2WCXA 4G1QA 5KFSA 2YNHB 4M3LA 1JIHA 1LWFB 1S0MA 4JYCA 4X2BA 3H5UA 1CZQA 3B8EB 1T2KD 2C9LY 5AVQB 4KHRA 1LWCB 1FKOB 2D3ZA 4LQ9A 4DG1A 3EPGA 3OL6A 5KFRA 3PHEA 2IJFA 3IS9A 4IQXA 2Z5IA 2KP8A 1QUVA 1FKPA 1JLGA 3BR9A 1OXZA 1S1WA 4DZOA 2XU6A 5AW0B 4ZMMA 2XI2A 1RT6A 4XPEA 1JXLA 1C0TB 3M8PB 4KB7A 3TAMA 4MFBB 3M9HA 3ISNC 4ECUA 3OL8A 4Y2CA 5DGBA 2W9BB 2IM3A 3BGRA 4G1QB 1IKVA 5F8HA 3GV5B 5KFTA 3QGIA 2WB4A 3DOKA 4NLPA 2FJXA 5DLGA 2XI3A 1S6QA 4RNNA 2E9ZA 3MTKA 3V6HA 5F8JA 4DG1B 3IGVA 3NBPA 4KV8A 4ZPAA 3IS9B 2JLEA 1G2CB 4I7FB 3LP0A 4IG3A 1JLGB 2UUWA 1H89A 1XR5A 2E9RX 4RW7A 1HYSA 2FVQA 1KLMA 4F50A 5L1JA 5APQA 3NMAA 1RT6B 1OWAA 5F8GA 3QIDA 1X8YA 2JC1A 3TAMB 1RA6A 1SP4A 2BE2A 3RB4A 2Z5HA 2R8JA 3PZPA 1GX6A 3CDUA 2QE5A 1HNVA 5DQGA 3DYAA 3IRXA 3V4IA 5J2NA 3DOKB 3I5BA 5KFOA 1RT1A 4WYWA 4URQU 2W6AA 1S6QB 1N6QA 4IFVB 1K1SA 1BQNA 5AW4B 1VRUA 3ITHA 1S48A 4YR0A 3CO9A 2R2TA 3NAIA 3HVAA 4KV8B 3M9MB 4PQUA 4ICLA 2DPJA 3FFIB 4IG3B 2GC8A 1IKYB 4QWBA 4ED2A 4NLGA 3L37A 2WPSA 4RW7B 1HYSB 5J2MA 1LW0A 4GT1A 1HQUA 4M95A 4IDKA 4IRDA 4Y2AA 3Q8RB 1S1VA 5C5JA 2BE2B 4NLXA 2QM8A 1WNEA 3KNAA 1T2KC 4AQRD 1C1BA 4QWEA 1HNVB 2R2UA 1JLEA 3OSNA 1MU2A 3DYAB 3IRXB 4LSLB 5J2NB 2XC9A 1RT1B 5FDLA 1N6QB 5APVA 4O3RA 2C2DA 3PW4A 1BQNB 2D41A 5F8IA 1VRUB 1J2JB 5KFNA 1S49A 5AVWB 1RT4A 3ITHB 3LAMA 3BQ0A 4ECRA 2BQUA 3BJYA 3G6XA 4PQUB 4KKOA 4I2PA 4ICLB 1C1CA 4WFZA 1H8AA 3VN0A 5AVZB 2HWIA 3TNUA 5J2QA 1HJBA 3KHGA 3RAXA 4O3SA 3DRRA 4RU9A 1LW2A 5J2MB 2HAIA 1FOSE 2C28A 1LW0B 4MH8A 3L36A 4IDKB 5DG9A 4AYCA 1S1VB 1CSJA 3BQ1A 2WPQA 3HVWA 1RDRA 4R8UB 1QAIA 3D28A 1T03A 2ASDA 5KG5A 1C1BB 5DQHA 5EWGA 1JLEB 3LP1B 1MU2B 1NHVA 3KK3A 4K4TA 2JEJA 1HQEA 4Q8FA 5FDLB 3FDSA 3V4QA 1RT4B 2WPRA 1N48A 1JNMA 2WONA 5EUHA 4ZHRB 4KAIA 2D3UA 4KKOB 3PJWA 4I2PB 4U6PA 3KHRA 4J9MA 4G3IA 1C1CB 2ILYA 3LIDA 1T3NA 3TNUB 5J2QB 3DM2A 2VG7B 2R2RA 4H54A 3FSIA 1SUQA 4PUOB 5AVTB 5C25A 3GIKA 4RNOA 3KLGB 2P7JA 2ALZA 1LW2B 3MEGA 4ZPCA 1H88A 2CJQA 1D1UA 4B86A 4NLQA 2FLPA 3I5CA 5KFZA 5KG1A 3V5BA 2OPSA 2WT7A 2J6SA 1T03B 2ZE2A 2GIQA 1RTDA 1GZLA 2W7PA 3UDLA 2ZKUA 1VRTA 3D5MA 5JUMA 2BQ3A 2QM7A 2W9CB 1S0OA 4RNFA 3OSPA 3KK3B 4IH5A 2YNIA 4H4MA 1HQEB 5HLFA 5KG4A 5KT3A 3KLEA 5KT7A 3V6DA 4IRKA 3DOLB 3CJ0A 4TN2A 3QGGA 3ICLA 2E43A 5CMZA 1MUUA 3CJ3A 4NLRA 3E51A 2HNYA 1KHWA 4TQRA 4TXSA 3I5AA 3H98A 4IKAA 5KFPA 3CVKA 1SUQB 4RZRA 2R8HA 4J9PA 4GKGA 5CYMA 5APYA 3MEGB 4Y34A 5C24A 3BQ2A 3GIIA 5KFLA 2VA2A 5AW2B 1TL3B 2IC3A 2W27A 2R5BA 2WT7B 2HMIB 4ECVA 1RTDB 1VRTB 3VQSA 3MR5A 3VTPC 1LWEA 2YNIB 4H4MB 5HLFB 3DI6A 3GYNA 2ZD1A 3FQLA 3RBEA 1HUCA 3NL0A 3KLFA 5KFVA 3PR5B 2R32A 4JV0A 3C6TA 3MR6A 4EOTA 1RTIA 1CSBA 4NLDA 2AQ4A 2C2EA 3A5TA 2UUTA 1JX4A 4DL6A 1TKTA 4EBDA 5KFAA 1T94A 5AW7B 3UIAA 3QO9A 1S0NA 2ASLA 3H4DA 3TVKA 4IG0A 4TYAA 4K4SA 5C24B 3IN5A 3PW7A 1Z4UA 4ID5A 3T97A 3E01A 4RESB 4O4GA 1S9GA 2IC3B 2N9BA 5AVYB 5DQIA 1RT7A 3H5XA 1S1UA 5F8NA 2IA6A 3HTKA 2YO2A 1S9EA 1FOSF 1HMVA 3CDEA 1RTJA 4NRTA 3MFIA 4ZP9A 2YNFB 3H5SA 1LWEB 3G6VA 1N5YA 4QWDA 5HROA 3RBDA 3DI6B 3RAQA 3MF5A 4IRCA 4MK8A 5APSA 4KFBA 2V0NA 4I2LC 3V4WA 3KLFB 1MV8A 5KG7A 2FVCA 3C6TB 4MIAA 3KDPB 1RTIB 5KFUA 4K4YA 4LSNA 4O3QA 3TQ1A 4EYIB 1TKTB 3OLBA 3DMJA 3QO9B 2V4QA 5APXA 4IG0B 1FKPB 4HYKA 5APTA 2XZRA 1S1WB 3FRZA 3GV8B 4KHMA 2AX0A 2R2SA 4ID5B 3E01B 1NNDA 3A7OA 3KLVA 4O4GB 1S9GB 3GILA 3KQGA 2Q3IA 1RT7B 4YQWA 1S1UB 2RKIA 3Q8QB 5KFQA 4ED8A 1S9EB 3EPIA 1HMVB 3HE4A 1RTJB 3MECA 1S4FA 1FK9A 3BGRB 1N5YB 1IKVB 1SV5A 2FVSA 4MIBA 2HNDA 5L9XA 4WXWA 1DTQA 4KFBB 3UR0A 4DL3A 3PW2A 5KG3A 1S6PA 3SI8A 4DEZA 3M9OB 4LSNB 5KG2A 4RNHA 5AW1B 2C9NY 3DMJB 3NBPB 1XR6A 4ECWA 5F8MA 1QE1A 3I0RA 4ECZA 3LP0B 5KFIA 5CYQA 2FVPA 3DLKA 3RB0A 2OPPA 2Q7CA 2BANA 1TVRA 3DRSA 5KFMA 3SFGA 1KLMB 1RAJA 1IKWA 4Q45A 3DRPA 3BSAA 2RKIB 4NYZA 1IKXA 4MKAA 3H2LA 1GK4A 3HE4B 5EDWA 2B43A 3MECB 2EC0A 1FK9B 5DGAA 4FS1A 1OS5A 3QLHA 4DL5A 3PJXA 4DL4A 3TYYA 2OPQA 2FVRA 4I6MC 1JKHA 2HNDB 1J5OA 2ASJA 4AUWA 4R5PA 4PWDA 3V4IB 1RT2A 1DTQB 2J6TA 4XO0A 2DPIA 2WRMA 1S6PB 2ILZA 4YP3A 4K4XA 3OL7A 3KK2A 1REVA 3HVTA 3JSMA 1HNIA 2W9AA 2VG6A 5KFBA 2IM0A 1MFZA 1S9KD 5KG0A 3GQCA 2XWYA 4IFYA 4ECSA 4WZMA 1TL1A 1QE1B 2R3CA 3I0RB 4WYLA 4ED3A 1DTTA 3EZUA 1RTHA 5F8LA 5CYQB 3DLKB 3DLEA 3NMDA 4NLOA 2OPPB 3OLAA 2BANB 5AW6B 4QWCA 3BSOA 3VYIA 1IKWB 4EYHB 4QPXA 3KMSA 3VMZA 1HQUB 1JLAA 1IKXB 4EO6A 4YR2A 3KMQA 2O5DA 2WWWA 5D3GA 5L1IA 2JEGA 4RUCA 2R8IA 3LIEA 3QZ7A 2IAJA 3QLHB 1R0AA 5J2PA 3N6NA 3T1AA 2OPQB 5JXSA 1S97A 3NXSA 4WFXA 1JKHB 1J5OB 4NLSA 3DDKA 3M91A 4R5PB 4PWDB 4FBTA 1RT2B 4ED7A 2C2RA 4FS2A 4I2QA 1RT3A 5F9LA 4NRUA 4ED1A 3IR9A 3KK2B 1REVB 3V6KA 2IMWP 3JSMB 1JLFA 3PR4A 2VG6B 1TKXA 5C42A 1RYRA 4IFYB 1TL1B 2ZXEB 1DTTB 1RTHB 4K4VA 3VMYA 3DLEB 1JLQA 1GU4A 3KJVA 3DRRB 4QW9A 1ZTTA 3Q8PB 2UVRA 2BRLA 5I42A 4C7NA 3GIJA 1JLAB 3G86A 5HP1A 4RW8A 1GD2E 5J1EA 4NLTA 5D3GB 4ZPDA 4JYBA 5KFGA 1DH3A 5EWEA 2IAJB 2VRSA 1R0AB 5J2PB 3P8MC 3MEDA 5EWFA 2HNZA 4U7CA 3HHKA 2FLNA 5AVXB 5F9NA 4I2QB 2H7HA 1RT3B 2ATLA 2W7OA 2B5JA 4EEYA 1JLFB 5KT4A 3LALA 4O44A 2RF2A 3H5YA 1TKXB 5C42B 2WONB 1GX5A 1SH3A 5L1LA 5K14A 1YYCA 3NTNA 3MGNA 4EBCA 1S9FA 3T5HA 1LWFA 4QW8A 5HBMA 2BRKA 1JUNA 4ED0A 3KK1A 3OAKA 3DM2B 4EBEA 5AVUB 3TK1A 2F8EX 4ECQA 1JLQB 4H4OA 1S1TA 3KJVB 3M0DA 4ECTA 5C25B 4F4ZA 4IR9A 1FKOA 4K4ZA 3A3YB 2RDIA 4C7NB 4GC6A 5DG8A 1N56A 2XV5A 5HP1B 4RW8B 4TQSA 3MD0A 1CI6A 5J1EB 5DG7A 1D0EA 4ZVEA 4J9QA 5KFHA 3KOAA 2OPSB 3LANA 5L1KA 2ZE2B 3HKWA 3KHHA 3MEDB 1A02J 2VG5A 3VMXA 1SH2A 4RUAA 4J9LA 2W8KA 2FJWA 4GC7A 3M9BA 2WTFA 2B5JB 1K1QA 3KLEB 4O44B 2W9BA 3T5LA 3V6DB 4LC1A 5K14B 1RYSA 1GK6A 3SWFA 4XE5B 3IG1A 4ZVHA 2CKWA 5DLFA 2HNYB 5HBMB 5KT2A 3KK1B 1ZTWA 5KFDA 4DL7A 4JV2A 4H4OB 5AVRB 1S1TB 2R8GA 4FBUA 3NFQA 4IH7A 2AU0A 4J9SA 2OH2A 3RB6A 4KSEB 5CYMB 2VA3A 4K4WA 4URSA 3BREA 1UWBA 4NLVA 3PW5A 1CI6B 4MKBA 2BQRA 4KO0A 3NAHA 4ZP7A 4I7FA 3PW0A 2BASA 3QYYA 1TP7A 3NGDA 1KHVA 2VG5B 4WFYA 4J9RA 1NHUA 5KFWA 1GU5A 2AGOA 2HWHA 5KFXA 2ZD1B 3NKYA 3MEEA 5KT5A 5APWA 3CIZA 2UVUA 3HE5A 2E42A 4KHXA 4XPCA 4NZ0A 3IG1B 2OPRA 4JUZA 3T5KA 3IGNA 3V6JA 4IFVA 1QAJA 2IPPA 1IM4A 2WHOA 3CJ2A 1TKZA 2JJLA 5AVVB 3M9NB 1UWBB 1IO4A 3V81A 5T14A 4KO0B 5AW5B 3FFIA 2YKNA 4Q0BA 4WE1A 1S1XA 4ZVGA 1IKYA 3T5JA 4NLYA 3KLHA 5I3UA 4K4UA 5HROB 4NCGA 1JLBA 3MEEB 4YMEA 4Y3CA 2AGPA 4ED6A 5KFKA 3HE5B 4ZVFA 2ZFCA 4QWAA 2P2UA 3OL9A 2AGQA 2XCPA 4LSLA 4KBIA 4YR3A 2OPRB 3P32A 4K50A 3JYTA 2FLLA 3M06A 3T19A 2J6UA 1ZETA 1TKZB 1EP4A 4M94A 3KLIA 1SH0A 1RT5A 4ZPBA 2YO3A 3V81B 1BQMA 2UVVA 2YKMA 2YKNB 3MR2A 4Q0BB 4RW6A 4WE1B 1S1XB 2E9TA 3GV7B 3QIPA 2IBKA 3KLHB 5I3UB 3RB3A 5APUA 4ZP6A 1DLOA 4NCGB 1JLBB 4EO8A 3SFUA 1JLCA 1SV5B 4HYTB 1XR7A 3CJ5A 3A2AA 4R8UA 5AW3B 4RW4A 4J9NA 4IOBA 5KT6A 2I5JA 3LP1A 3C6UA 2QV6A 3Q8SB 3JYTB 2XCAA 4IH6A 1S9KE 3P7KA 5KFYA 5AVSB 2Q5UA 3LAKA 4ECYA 3LP2A 1FAVA 1T05A 1EETA 1EP4B 1TVRB 4ZHRA 3DRSB 4WXOA 3KLIB 1RT5B 3I0SA 4O4RA 1BQMB 4DL2A 3FQKA 2C22A 2R8KA 2YKMB 3DRPB 4HKQA 4RW6B 1A02F 4C46A 3PVXA 2VG7A 1S10A 2B6AA 3O8ZA 4PUOA 4NLWA 3QIPB 3KLGA 2V4RA
chains in the Genus database with same CATH superfamily
3B6BA 4PG6A 4C8OA 1M1KQ 1CULA 1VQPS 1B99A 3QGHA 4Q8EA 2ACYA 3CNQP 4MK7A 1NK8A 2BACA 4ETZA 1YJNP 1CLFA 1KTQA 1WG5A 2WOMA 4RW4B 2HHTA 4FN5A 2LXCB 2QX0A 2BM0A 2GUSA 1GXTA 4ECXA 2PAJA 3AOBA 3H1LD 2GA1A 5A8WB 2M3EA 5HN0A 5E5NA 4LQ3A 4B3OA 4HH2A 3K5BA 3BSNA 5B5EE 2CJYB 4LF4F 4GKKJ 3LP2B 1T05B 4NZ7A 2GVZB 3O44A 2PA3A 3I0SB 1TV6A 1MN9A 3DLGA 3CW2C 1FERA 1WSVA 1RBAA 4DV3J 1U09A 5KJ7C 2FFDB 1V3RA 2GCFA 2CPXA 1TFYA 1HPZA 4DPWA 2R7SA 2AJFE 1N33F 3W8PA 5DJUB 1FZBA 2J0WA 5KLIC 4CYUA 3SQGA 1TQLA 1OPIA 2AX1A 3M6WA 4O3OA 5KAIH 3M8QB 3C9IA 1GL2A 3OTOJ 3UQSA 2CWXA 3NP5A 2GS8A 2W2NP 3NMRA 2ITAA 2E29A 4PXDA 3B4DA 2YNGB 4P10A 1MMLA 3SCKE 1ZAXA 1YJ9S 1GMVA 1PPJD 1F5BA 2V9WA 1RA7A 3G4SP 2QSIA 3AD8C 3BATA 4ZKAA 2JEFA 3IR5B 1MROB 4X66J 2XHCA 2P67A 4TYBA 1RHMB 5ITHA 1PJ7A 5CCGC 1P27B 4G1PA 4LF5F 3MR3A 3CC4S 3SIPB 1EZVE 1AQ5A 1CEZA 2DR6A 2EWHA 2ZJQQ 1GTWA 1RAOA 5JJBA 2WITA 1QAXA 2V5HG 1WJ9A 2J0SD 3K57A 1HBWA 1QM9A 2JC0A 3ELHA 3G87A 1C0UB 1OY6A 2W25A 1PBUA 1SS1A 4Q7AA 3PACA 1ZS6A 3PRVA 4UY85 2H3EB 2UWJE 2CQGA 2I9SA 3B71A 4QPTA 5BVZA 3R8YA 2RDJA 3N6MA 5KJ7A 2O3JA 3HT0A 3UPFA 2GGPA 3CDWA 1FTCA 1XMOJ 5AW8B 1SQBE 4WY4C 1DQAA 3CCUS 3A8EA 2YNFA 1G6BA 1V3SA 3SSSA 2YNHB 2HZCA 2NXNA 3E3XA 4NA3A 3VF0B 3D3CJ 1LWFB 1S0MA 2YXQB 4X2BA 1EHWA 2JWDA 1O0PA 3AEFC 1VQ9P 2JRSA 4LF6F 1X4AA 5AVQB 1LWCB 1IBLF 3OW2O 2E76D 1P9QC 1FRMA 3VAFA 1IBMJ 5ETOA 3EPGA 3HHNB 5KFRA 1FA0A 3Q86A 1SQQD 2Z5IA 3MMJA 1FKPA 3Q8VA 1VQ5S 2L9NA 3PM9A 1KQSR 4PZVA 4QIVA 4UY8T 3PP5A 1WG4A 5CCMA 5CCGA 2N7YA 3G6ES 3Q89A 1NTMD 5AW0B 2XI2A 4WKYA 3U02A 3M8PB 5MAOA 1RHJB 2X1FA 3BPDA 3MM6A 1Z1ZA 4N78D 4HI1A 2M0BA 2W9BB 4P7TA 2IM3A 3BGRA 4G1QB 3AEAC 1ZA1B 2PDAA 4MJKA 5CJ0A 4L74A 3LTOA 4JI4F 3R5DA 1U0HB 3QGIA 2WB4A 3QAEA 3DOKA 2FJXA 3UN3A 1LJ2A 4FPIA 3NS5A 3M32B 2XI3A 1S6QA 2GVDA 1TK5A 3PFOA 4P75A 5T41A 4OV6A 2DNLA 2E9ZA 3MTKA 2KOGA 4PXCA 3V6HA 5F8JA 1IUJA 3WU2E 1KC8Q 1VQLS 2Q6BA 4WY4A 4DUZJ 4DG1B 1VF5B 3IGVA 3AD9C 2DR8A 2F8MA 4ZPAA 2JLEA 4W98A 4K5SA 2EEYA 4C0BA 4IG3A 3F89A 5A0YB 1JLGB 1EZVI 2BA9A 2UUWA 2W4DA 1WEZA 1X5PA 2O67A 1XR5A 1OMSA 3HSGA 4F0MA 4ZKUA 2FVQA 4BBYA 4F3OA 1IK9A 4CO0A 3NEKA 4F50A 5L1JA 1RT6B 3M30A 4DWIA 2J58A 1HTLC 2JC1A 5H2FH 2MY7A 5D6GA 1VQ6S 1NYHA 3FMBA 1SP4A 2BE2A 5B0GA 4FYDA 2YMYA 1IK7A 1IC2A 4DT0A 1LGHB 3PZPA 3WUUA 3TEHB 2CG4A 1ZR4A 1H3DA 2YVSA 3VAIA 4Z7CA 1QTNB 1S4EA 4DX7A 4FXVA 1VQ7S 3THPA 2RQMA 3SMZA 4L72B 5H9EK 3HF5A 4WYWA 5EN1A 2KXNB 1YIJS 2N9YB 2W6AA 1NDPA 1LTAC 1XEZA 2XQCA 4Z1MH 3BO4A 1GMUA 1BQNA 1WTBA 2EI5A 4CLKA 3CDBA 1TK8A 1HBNB 4B9NA 1E6VB 4KV8B 3M9MB 4WVZA 4RJTA 4FZVA 4C97A 2ZKTA 2IX7C 1DJ0A 1OFCX 2DPJA 1PIEA 2IMOA 4WF9Q 3FFIB 4RU2A 2FYUD 2CVIA 3C16B 3G3ZA 2CNOB 2GM4A 1U1PA 4ED2A 3L37A 3JTNA 2V94A 1N5TA 1OIAA 5C7PA 1Q82T 5J2MA 4OLOA 3G71P 3OVAA 2CVEA 2V67A 1N52B 2RRNA 1HQUA 4PD4D 4M95A 4FF4A 1RU1A 2VQEF 4IRDA 4Y2AA 3FSYA 1IN0A 2E7VA 4NL5A 1UEUA 4CP5A 2OYHC 3A1YG 4QR2A 1WNEA 1JCDA 5CCLA 2HHQA 1YJUA 2ZH8A 2RB7A 4X4TA 1HNVB 2R2UA 1N5VA 2E76C 1BHNA 3OSNA 3GHGA 1U24A 3BH7B 3M2UB 4Y99B 2LQ8A 1RT1B 1UVLA 4RWWA 3OTCA 4C2MA 2AT1B 3PW4A 4A8OA 5M2RA 1RT4A 4EWTA 3LAMA 3D68A 3FXEA 3BQ0A 2JFDA 3U27A 3F5HA 3BJYA 2EXUA 2XLKA 4PQUB 4ICLB 2CADA 1C1CA 5ETKA 3L73D 3VN0A 6FD1A 2CA9A 5A6WA 2KZZA 1NJZA 1HJBA 3KHGA 1GK8A 1SC3B 4GMKA 4OV1A 2PC6A 3MAQA 1H2TZ 4RU9A 2PP6A 3EXYA 1LW0B 3GP9A 2GQ2A 1VQ8P 3W8GA 3L36A 1KS2A 1USEA 2QMWA 2FJDB 1W2EA 3BRTB 5IT9Y 1SBRA 3CXCR 1T03A 1ZRTD 2FHOB 1C1BB 2FLOA 4RLEA 4USJC 4DPOA 4LIWA 5GAGU 3BEGB 3LP1B 3G9RA 1NHLA 3MPUB 2DT9A 1NHVA 2RVJA 2DNHA 2BVZA 3H1LE 1UEVA 4U3FJ 3NCQA 4YY3F 3X1LB 3E1IA 2GMLA 3LPEA 1WC4A 1N48A 4KGMA 2OYHA 2CK3H 4E2FB 1RAIB 1UMJA 2D3UA 3RR8A 2QL5B 4I2PB 2HFED 3AA9A 3I9ZA 3D9BA 1VISA 4CDIA 3AE4C 3TNUB 3BCCE 2IDEA 3HUSB 3FSIA 5DJTB 3MTJA 3DOMA 4FKXA 1HR0F 1FDNA 3HMJG 5AVTB 4RNOA 4ED5A 2CPZA 2LR2A 4H0LB 4J5OA 1LW2B 4B3MJ 4IL6E 2DGOA 1SQPJ 4X64F 2MQQA 1H88A 1D1UA 1T9YA 2POHA 2L5GB 4F26A 3RK2B 4WFNQ 4F3QA 2FZGB 5KG1A 4Y00A 3DU5A 3RBXA 3IP0A 2W6BA 1QSYA 2WT7A 5L38A 2MTLA 3H1KD 4KYZA 3UN2A 3RYLA 2ZE2A 2LQ9A 4NYPA 2RH3A 1RTDA 1GZLA 2ZKUA 3D5MA 1PYOB 5IT4A 2ZITA 4RWXA 2CQHA 1Q4RA 3OSPA 3ENWA 3KK3B 3H7HB 2JWAA 5GADI 5HLFA 4AXIA 5G0RA 2ACMA 2BJ3A 3MM8B 2CPYA 2X1AA 1T95A 4IRKA 3OUYB 1VQ4S 3EJMA 3O2IA 1XN9A 1T8EA 3QT5A 2I2YA 2C0XA 2E43A 5CMZA 4WBFA 3NY0A 2AJ1A 1F5AA 4ZVOB 4NXMJ 4IKAA 5KFPA 1VDFA 2EKYA 3EVMA 2KYXA 3UCGA 1W5CE 3OFHA 3I31A 1SVDA 2Y1RI 5B08A 1O6XA 1VQPP 3IWXA 3MEGB 1SKUB 3GIIA 5KFLA 5AW2B 4AE5A 2DCUB 2IC3A 1RB0A 1SJQA 4FPRA 1FFGB 5EGYA 1BD6A 3H20A 4U3FG 4K2JA 2XNRA 3DXBA 1H0HB 2J9DA 3JQJA 3DLJA 4DX8H 2B51A 1RAEB 3MR5A 1PIXA 1LWEA 2XS5A 4H44D 2BOPA 2AW0A 4YUDA 4H4MB 4JYAJ 3DI6A 1X9SA 3GYNA 3QWPA 4DR4J 1RE3C 2VOOA 3FQLA 4LUBA 1HUCA 1B3TA 3KLFA 2YPZA 3GIRA 5KFVA 3MR6A 4PKDB 4JI2F 2MLXA 4NA2A 2C2EA 3HD7B 4WBAA 2UUTA 1SQPG 4IYQA 4EBDA 2KKHA 5KFAA 5K20B 3VZHA 3UIAA 1S0NA 3C8YA 4DQIA 2KSEA 3RL0D 3L74D 1UETA 4JI6J 2UV8A 1YTYA 3AT1B 3IN5A 3WHIA 4BWMA 3PW7A 3E01A 2KXPB 3CC7P 2FJBB 1YJ7A 3OPKA 3VCDA 1USDA 4GO5X 2CQIA 2HEKA 4HACA 2Q6QA 2LEBA 4C8LA 2BXJA 5F8NA 1YJ9P 4JI5F 3HTKA 1FOSF 3CD6S 5H9FK 2EPIA 1YITP 1A0OB 3CDEA 3TNVA 4JI0F 4NRTA 3MFIA 4ZP9A 2YNFB 4CPGA 5KLIB 1R31A 2XHWA 2IRXA 4QWDA 3GCXP 3M2VB 3WBZA 3RAQA 3NNCA 1LFPA 1Q7YQ 1N73B 1FRLA 3V6IA 3SSUA 1XNQJ 1L3SA 1BDDA 5AE2A 3V4WA 3AXMA 2DB1A 5KLVK 2HBZB 5KG7A 4RR5A 3AD7C 2FVCA 3C6TB 4MIAA 4OZ0A 1AVYA 5KFUA 1KOOA 2LQJA 2WSSH 2DH7A 3TQ1A 1UVMA 3L75E 1LT9C 1TKTB 3D71A 3ET6A 1GMJA 4F67A 3QO9B 2LXUA 1M56D 1VIXA 2RUSA 1WHWA 3W3SA 3QJLA 1FKPB 2OJ3A 4HYKA 3G2XA 3MM7A 4KHMA 3TVYA 3FBFA 2AJ2A 3MHYA 3KLVA 4Q5VA 2BKNA 3KJNB 2Q3IA 4YQWA 3Q8QB 3ISZA 5HI7A 2W90A 1S9EB 4N3YB 3WIUA 1URQC 3NS7B 1R6YA 2IYGA 2LXFA 1RLDA 2PEBA 3CCUP 3HE4A 4K35A 5CCHD 2UU9J 3C14A 1S4FA 1RF0C 1NTKE 1X0TA 4ZVPB 2PA8D 4XDDA 3BGRB 1NU1E 1N5YB 3Q83A 3TJ9A 1OYEA 5J1PA 1K73T 1BCCD 1L0LD 4B3SF 3DNCA 2BCCJ 4ZIWA 2HNDA 4N8OA 3PYGA 4JF7A 4WPAA 1NXIA 2I38A 5KG3A 2GVDB 3SZ2A 3TANA 1D09B 3GR1A 1QL1A 3CXHH 2ZH7A 1KILC 2YKPA 1R0CB 2E7WA 1NAYA 4WK3A 3OFGA 2W1BA 1HKAA 3W5XA 3FCWA 4J37A 4ZJOA 2C9NY 4ECWA 1IBKF 1QE1A 3CCRP 1TL7A 3I0RA 3C19A 3UN5A 1KN7A 5B0DA 1AROP 1N7SB 3CCSP 2FB0A 3UVJB 3POTB 4CZCA 3TDKA 2FVPA 3RJMB 2YIUB 3CMEP 4DS4A 1YJWP 3NGUA 4A8FA 2BE7D 2OPPA 2BANA 1X4EA 1CS4B 2FYUE 1M5PC 4DUYF 3IF4A 1H2UX 4ZCKA 2ZM6J 1UW4A 4H44C 1R8PA 2HHPA 1I1GA 3BSAA 2ASYA 3PX0A 1TKDA 4NYZA 1LT9A 2MQNA 1IKXA 1BUXA 3GMGA 5K9FA 4JBCA 5DDOC 4PD4E 2ZH5A 2B43A 3CLQA 3QQCD 1FK9B 1KFMA 1VQOP 2DIUA 1B4SA 4BRYB 2KYZA 3QLHA 3FGAD 1MWQA 3US5A 5GAHU 3S8SA 3TYYA 2MJZA 3M8YA 1AV1A 2HVDA 2HPUA 1SC4B 1J5OA 4R5PA 4PWDA 1SQVJ 3CD7A 4CH1A 1DTQB 3W2WA 1SL2A 4LJMA 4XO0A 1N5QA 1RWPB 2KYVA 2V7QH 2DPIA 1T0TV 1FRJA 4A7PA 3CCES 4YP3A 1RP5A 4DPTA 3RL0C 1URQA 5B66E 4BC7A 2W9AA 1HWLA 2VG6A 3FXDA 1RF0A 2JLGA 4IFYA 4ED3A 1UIIA 3TJ8A 5IWAJ 3AHPA 5CYQB 4ZLJA 4DV7J 2H51B 1T6AA 3QFHA 4HH0A 2DRAA 3CJ8A 1JNRB 2EBGA 3BSOA 1KILA 2OYIC 2ERRA 1ROFA 4IFFA 1SFCD 4QPXA 2XY5A 1FU1A 1HQUB 2BCCG 3D3BJ 4YTPC 1NUEA 4EO6A 4YR2A 1AT1B 2O5DA 1SQXK 4PJ0H 4ZVUB 2R8IA 4LVNP 1Y3JA 1DD4A 3V4MA 1JY2N 1KWMA 1S97A 3NXSA 4WFXA 1ZRTE 1JKHB 3GYGA 4ED7A 2C2RA 1YIJP 5LMUF 3W64A 2RJZA 3UNYA 1KN6A 4IO1A 4DR3F 1LK7A 3M0DC 1CJKA 4IQMA 1TELA 3MPWA 3V6KA 2HHHF 1VMBA 1ZM3A 3NOCA 2HWTA 4DS5A 2C2ZB 3FBCA 3ENAA 1R89A 4K4VA 1IR2A 1M7LA 2DRDA 9ATCB 5A76A 4YEAA 3HD2A 2OFHX 1ZTTA 5CCHC 3E7KA 3VAHA 3QSYB 1HQ2A 2IYIA 4CLPA 2O01C 2G8YA 1JLAB 2R7WA 3G86A 1TU0B 4Q2LA 5HP1A 1VQSA 1SQVG 4ZJLA 3FKBA 5D3GB 4JYBA 5KFGA 4GOEA 4K8RA 5EWEA 2F4VF 1HWJA 1UFWA 1X5OA 1LTBC 1KSPA 2WVRA 1U8SA 1CQNA 2H5JB 3L71D 4OGQB 3H1KE 3TX0A 2Y8WA 3AE3C 2PE8A 2YTCA 2LA6A 1NZ8A 3MM9A 1RT3B 1WHVA 2UXDJ 4UT4A 1RWWB 2K3IA 4ZVTB 4PD4I 2B5JA 3MCSA 2H4YB 2YX1A 1WSRA 3W2VB 1TKXB 2F40A 5C42B 2OYHB 2NR0A 1GX5A 1XNRJ 2UUAF 5L1LA 5K14A 1YYCA 1NO4A 3NTNA 3KJQB 1KYOH 3CXHD 1FCAA 2E76B 2K9JB 4XA4A 3MUMP 1ZA2B 2M4MA 4QW8A 2ADBA 3KK1A 4EBEA 5AVUB 2R7QA 4C8ZA 3DOMB 4KHPJ 3PHTA 3H8YA 3A8IA 3M0DA 1RKJA 2WBMA 1DEBA 1ELOA 3DKDA 4HR2A 1HNXF 2K1RA 2EFOA 2RNEA 2RDIA 3ETOA 2CG8A 1E6YB 3GTYX 3M1VA 4WKRA 3KOAA 2Z56B 1OSDA 3QRRA 3OVSA 3P6YC 2ZE2B 1LNQA 4P2FA 2YWEA 3JCUE 1A02J 1JOCA 3KZIH 1U7LA 5CCHA 2CNKB 1LP1A 4J9LA 2W8KA 2FJWA 3BRVB 2HVZA 3CE8A 3M9BA 2AMCB 3WZ0A 2U2FA 5KAFE 2W8ZA 3T9ZA 1T9XA 1W26A 3MUDC 4O44B 4EI2A 2N82B 3VMAA 5TISE 4WU3A 3D6MB 4DV5J 3IG1A 1WHXA 2KFZA 3QNWB 1SFCC 2GJFA 2WW8A 5HBMB 1NH4A 1NTMJ 2AIRB 1ZTWA 5KFDA 4JV2A 3HI9A 1ACMB 1S1TB 2UXBF 5A8KA 4IH7A 2Q1KA 4J9SA 1XQIA 4LFAF 1NTZJ 1CI6B 5JVGQ 2BQRA 2P5VA 2F63A 4DSFA 4P71A 2PSZA 4J9UE 1UPPA 2KLUA 3QYYA 1HNZJ 8ATCB 5KLVD 1GDTA 1PP9E 4CCHA 1PC5A 3O6QA 2Z2LA 2ABYA 2VG5B 1PV3A 3HJVA 5F0UA 4WFYA 1WEXA 2NCKL 2H54B 2GFFA 4CLFA 1J2VA 1GU5A 3Q5RA 1BMQB 2YH1A 2GJIA 1KZUB 3MEEA 1Q81Q 3UWTA 1U8WA 1WMKA 2DGQA 4N47A 2LKMA 3HE5A 1VBKA 2PD1A 1APSA 1CQMA 4ZVQB 2M5AA 3IBCB 5D4OA 2DHSA 2VKZG 4FVMA 3D4JA 3IGNA 2BABA 4ELTA 2V8HA 4IFVA 1QAJA 3AB2B 3EGNA 1VQKP 3KG1A 1IM4A 2DHHA 4YN3B 2RMZA 4YXDC 1UWBB 3N28A 1VQNS 1RKIA 2MPUA 4OVNF 2PFDA 1L4AA 4KO0B 3VVUA 2CRLA 4B08A 2J0QD 3MGJA 3DGPA 3LW5J 3K5PA 4KY3A 3OJSA 1YHQP 2YMKA 4ELUA 5A8RB 4A8MP 2D74B 4CM2A 4UB8E 3KLHA 5I3UA 4LRFA 1GW4A 1K04A 1HW9A 2B9XA 5HVFA 1L0ND 1QLED 3HDSA 1HI1A 1P84H 2L9DA 1L0LE 4Y3CA 1NTMG 1N54B 3MMCA 4ZVFA 2ZFCA 1NOHA 4QWAA 5CQGA 2KNCA 2AGQA 2VBZA 3P4UB 2W6JH 3I9V9 2OSRA 4EZ6A 4L3KA 4LSLA 4IL6X 2BEZF 4KBIA 1NTZG 3VZIA 1ICEB 2BUNA 2FLLA 2G2ZA 4P7VA 2ZZNA 3I96A 7AT1B 1TKZB 4RUHA 3M2RB 1LWUC 1RBLA 4OX9J 2HRYA 4DV2F 5T7LB 4ANDA 1R8HA 2CPIA 2QEXP 2HFZA 4M5KA 1RT5A 1R0BG 2YO3A 3LO3A 1KP6A 2B4VA 4CQ1A 2VQFF 2YKNB 2LMIA 1S1XB 2E9TA 2WSCH 3RRKA 4JI7J 2CPJA 1H7XA 2AKWB 4GO7X 2A2DA 3KKFA 1DLOA 4FYWB 2FC9A 3SFUA 2G4BA 4DV1J 4HYTB 4FKYA 3FX0A 3CJ5A 4QR1A 2DXEA 4OI0A 3A2AA 1XJWB 5AW3B 2MQOA 1O51A 1SVFA 4USMA 1YRTA 4HEA9 2I5JA 1N8RQ 1RSCA 1U1LA 4ZN1A 1KFSA 4I67A 3C6UA 1T9VA 1GXLA 3EE3A 1BXNA 1R8CA 2J76E 2XCAA 4N6JA 4IH6A 5KFYA 5LMNF 2VBXA 3I4PA 2D3OR 3HJFA 1SB6A 1FAVA 2RDDA 2OAUA 1EP4B 4ZHRA 3D6HB 4YHHJ 2XSFA 4O4RA 2YPYA 4TU8A 3FJ2A 1FDOA 1BQMB 2RHQB 2C22A 2R8KA 4EGLA 4FP9A 4UOFA 1YTZT 2VG7A 2E66A 1T9TA 1F0XA 1OX3A 3UCUP 4PUOA 3QIPB 5IQQA 3QRPA 4F36A 3KLGA 1AW0A 4DQPA 1L3UA 2UV8G 3GLJA 3R97A 3KG4A 2W8LA 2IM2A 1S0VA 2N3OA 4OYWA 1FD8A 4ZOSA 3LA0A 1X0PA 1NCLA 4F4YA 1NK6A 2KXHA 3W2WB 4Y28J 4Q44A 3H59A 2I1RA 1YKWA 2WSEC 2RD5C 2LXBA 2V4JA 3QZ8A 3ZDMA 3G6YA 1AXQA 3NLCA 1J1EB 4PG7A 4LREA 2OI2A 1HWTC 2IDLA 4DXLA 4FYYB 3EDQB 5IM0B 4PXEA 1QUPA 1FRXA 1L3TA 3ISND 3BYRA 3T1HF 1MKMA 3THVA 2AXCA 4DR1J 1YSJA 5CZVA 5KFJA 5HMXA 2OELA 3DOLA 4W4MA 3PXGa 1EETB 3CCVS 1BGYJ 3UDCA 1FJPA 2B0GA 3U1AA 4DFJA 5CABA 3P96A 2Y3YA 3RGUA 4D6TE 3U1NA 1ZMEC 5KFEA 2JOQA 4TLRA 2B6AB 1SJFA 1JTHA 2WVEA 4NLUA 1Y9BA 3CJRA 2IM1A 1T9WA 4I64A 3W5YA 2MZSA 3CWJA 3FWNA 2WK4A 2E5TA 1TL3A 3GFHA 3L71E 1Y00A 2M8DB 2V6AA 1JB0J 4H44B 2XWXA 1CJKB 2PMWA 3IWLA 3CJQA 4BS2A 2MYFA 3P49B 3A3OB 3OXLA 4CO2A 2GV1A 2XGPA 2V2ZA 2YXRB 1ZXGA 2YNYA 2E5JA 4ZLNA 4J9OA 1R7IA 1SQFA 3DLLQ 1W25A 4I4BA 2VHGA 3KHLA 2A0FB 4FXDA 1RWMB 1HARA 2ROPA 2QL9B 4AYBD 2HS4A 4OYMA 2J7UA 2JEIA 1YVFA 2FYNB 3IRWP 3D6ZA 1FZCB 5LMNJ 2CQDA 4RW9B 2BE9B 4C4WA 1GW3A 3OTBA 2ZZTA 3PV8A 2F9DA 2B4UA 1Q86Q 2AWZA 1YQHA 2P2CB 4C11B 3H2VE 4LFBJ 1ZOYC 1RK8A 3SSRA 1M5KC 4WZQA 1PGOA 2MGZB 4AQYJ 4URGA 2OYIB 1VK3A 2BR0A 1SLQA 3IXQA 4TY8B 2YQ0A 3GSIA 1M5VC 1D7MA 1XTZA 3H1JE 2HVHA 1DRZA 3H4BA 2WCXA 4HKZH 1F60B 3O3LA 2VBYA 3AJ1A 1BGYG 2QLJB 2MQMA 1WOOA 4M3LA 4QOTA 1JIHA 1VI7A 3GG2A 3HK2A 2MMYA 2VC1A 2ZT9D 5E3PA 2W2QP 1I51B 2KH9A 2MQLA 3K5NA 4DLGA 4X4QA 2FZKB 2RAQA 4G6VB 1NB7A 4A48A 3SDEA 3MPVA 4QIEA 1Q82Q 4LQ9A 2NUUG 1OPZA 4QU6A 1NSKL 1TUVA 3OL6A 1S72S 1SQBK 4IQXA 3K7RA 5FD1A 4U96A 1QUVA 4WWIA 5KLVE 3HXMA 2PMHA 4DJGA 5CBOA 3PRBA 4XPEA 1C0TB 2RS2A 1R6VA 4MFBB 3ISNC 4ECUA 1OMIA 5GMEA 1S5ZA 2MZQA 2VKRA 1IKVA 2DISA 2WSFH 5F8HA 5CZXA 2YKQA 4FYVB 1ZR2A 2WAQD 1RHUB 2EW9A 3JSYA 3MCNA 1JCCA 1S76D 2HW3A 1KB9H 2HFUA 3ZNUA 2L9WA 1DD3A 4CH7A 2HFSA 4P6QA 4GKJJ 5IT0A 1KVIA 2Y0BB 3IS9B 4NWBA 1XMQF 5I3QA 2CZVC 1H89A 1CPZA 2G0JA 2L91A 3EM1A 3TQEA 2E9RX 1HYSA 2EG2A 1PAUB 1KLMA 1U6ZA 3GB0A 5GTIH 3NMAA 2WZ1A 5DRKA 1JY3P 3SQOP 3TAMB 1S5LE 1QD1A 2ZOFA 1VFJA 1MZ9A 1Y4ZB 2P6TA 1GX6A 3CDUA 2QE5A 1LTJC 1VC0A 1NU4A 3DYAA 3IRXA 3BKTA 3I5BA 2UUCJ 1WC6A 2GZOA 1SXLA 1YJNS 1RCXB 4IFVB 1K1SA 5GTHH 5AW4B 4WCEQ 4FF2A 3ITHA 1N2DC 3TGUE 2D3O1 2ZOMA 4DV4F 3CDAA 4YR0A 2BKOA 2R2TA 3R7NB 4EFAC 3L7UA 3DGPB 3P5BP 1F9FA 1SFCB 1UA0A 3P8CE 4QWBA 3MIWA 2HFVA 2WPSA 1GMWD 4XDCA 4RW7B 3BN7A 2D1CA 5KTQA 3N5BA 3M6UA 3MTUE 4P74A 1ZAVA 2MKKA 1WC5A 4IDKA 1BSHA 4LF7J 1S1VA 5E41A 4H13B 1N36F 1AZSB 3M8SA 4IOAQ 2PI4A 2QFJA 5B0BA 2HRTA 2VPYB 4QWEA 3J81U 1SL1A 3FZBA 3CCMP 1TAQA 2XBPA 2KNCB 1MU2A 1RQVA 4LSLB 5J2NB 2NRGA 2XC9A 3D2WA 5D77A 1IQZA 4RBVA 5FDLA 1N6QB 2WVCA 3A0BE 1VRUB 1J2JB 1S49A 4LIRA 1DZ5A 2NYIA 3G4SS 3HP6A 4ILMA 3SYZA 1RAFB 3G6XA 4PPDA 2XEXA 2FY1A 2K2PA 4CTAB 1LTJA 3RTVA 2HWIA 1X7VA 2XMKA 5M2UA 2IIHA 3PTZA 5D0HA 1U2RA 4HT5A 1VL2A 4U9RA 4O3SA 1KVJA 5ETPA 1RF1C 1GEHA 1FOSE 3VAMA 4LRBA 3BBBA 2V9KA 3VAKA 4LF1A 5DG9A 2O1JA 3A0HE 2WPQA 3HVWA 1GTHA 1UJ4A 4OZ1A 3BCCJ 3IBWA 2F7VA 1UP1A 2LDIA 5DQHA 5EWGA 2BJEA 2KDOA 1C4CA 2D9OA 1YQ4C 3BF4A 1JLEB 1YZ6A 4P2SA 4LMZA 2JX2A 3MMAA 1OJ4A 3PX6A 1J1DB 5HVGA 4CIOA 3GJRB 4Y65A 4K4TA 2OTLP 4USUA 2VFTA 4UOGA 1PGQA 1HQEA 3J7YU 3C8VA 3CJKB 5ETVA 2L08A 2WPRA 3PKMA 5EUHA 4ZHRB 1LEOA 5J1NA 1MW7A 4K0KF 1KB9D 1UPMB 4LF2A 2E5HA 1RHRB 1N88A 4KKOB 4G3IA 3ZZZA 5F3TA 4JV5J 3LIDA 1HGZA 5J2QB 2CDRB 3A4TA 3DM2A 2VG7B 3CL3D 4DF8A 2E1MC 1G1JA 2G2YA 2VIHA 4PUOB 3CCJP 4JI3F 1VQ9S 3KLGB 2P7JA 2ALZA 3TA1A 1U1KA 2MZ1A 2MKCA 1LWUB 3QT8A 1HBUA 4U3FD 2JDJA 2ZH2A 4B86A 4QIFA 2FLPA 4ENOA 5KFZA 2BJ7A 2HSEB 3V5BA 5ADZA 1JO5A 1BY9A 4DOJA 2KJVA 2V4JB 2GIQA 3RAMA 1HBOA 1OQ3A 3BBFA 1VRTA 4F02A 2QM7A 3AJ2A 3P3DA 1S0OA 2MHEA 1H7WA 4X65J 2YNIA 2AXTE 3GONA 3GW6A 3MD1A 4CLTA 1SQPD 3DGVA 3V6DA 3KPEA 3DOLB 1Q0NA 3CJ0A 4TN2A 1U7MA 3ZC4A 1R8EA 1U26A 2JH3A 3ICLA 4CI0B 1LFWA 4D3GA 5GAGI 4DFMA 1MUUA 5GMKa 1FNMA 3E51A 4XTTA 2R7VA 4PABA 3ZZTA 4I56A 4TQRA 4MTPA 2C0WA 3PYFA 5LSOA 2XTJP 5C39A 4HTJA 4N5SA 3D70A 4ED4A 1PGJA 1HL6A 1SUQB 3E2EA 2FHMA 2I8EA 2HYNA 2R8HA 3BCCG 4DSKA 2G1DA 5CYMA 5APYA 4OHWA 3CULA 5AXNA 2GMHA 2VA2A 1TL3B 2XKMA 2V7QJ 3OR2B 2W27A 1HIYA 1QVGR 4B9SA 3SEOA 4DDFA 2KFYA 3WX8A 4ZITA 1YI2P 2AZ1A 2LXIA 1M1KT 5E3RA 1U7JA 3Q8UA 1FJGJ 3JSBA 3T6BA 3UFCX 3ZTPA 2ZD1A 2OMLA 1RAGB 3TJAA 2KSJA 2R32A 4JV0A 3ZZ0A 1VS3A 1RTIA 4TLQA 1UTAA 1NM2A 1CSBA 3A5TA 4AXJA 4AL7A 3AB4B 3M6VA 2M52A 1YBTA 2ASLA 3CMAS 4RL1A 2FBWC 4NPFX 4JP8A 4IG0A 4USHA 1VK8A 4TYAA 2F3JA 5C24B 1WF1A 4P72A 1GMWA 2ZHOA 4LVOP 2BJ1A 2RRAA 3TRGA 3DHWC 1AFJA 5DQIA 3L75J 4W7ZA 5AVYB 3K5OA 3OFFA 1S1UA 2WSFC 2DNQA 2IZ1A 1HMVA 1RTJA 3H25A 1HHQA 1IJEB 1N32F 5BR8F 2LYVA 4I68A 3G71S 1CJTB 2XZTB 1UWAA 3MF5A 2ZUGA 3EDRB 3SWKA 1U6FA 1H0TA 4KJMA 1SQQK 3IFEA 5JMNA 2QA4P 1PKUA 2RIJA 2O3DA 3MCOA 3TEGA 1CW5A 5LSRA 3KDPB 2KLVA 1CJVA 3OW2R 1NTKJ 4K4YA 1NU1J 4O3QA 1NTMK 3DDNA 1Q8BA 4EYIB 3EVOA 1TR0A 4ZCIA 2UP1A 2W83C 4C3KA 2V4QA 1LTGC 2XYPB 1N34F 2C3PA 1YDLA 4OJ1A 3SFEC 2XZRA 1IFIA 4ID5B 3T97B 3A7OA 2OTJP 4O4GB 1S9GB 4WB4A 2EBEA 4M5MA 1V5IB 1WOPA 1RE1B 2CQBA 1RT7B 4KH0B 3R9LA 2RKIA 4ED8A 1A9NB 4LFCJ 1DY3A 3MR7A 1TTHB 1UJ6A 1HHSA 4DSJA 4WP9A 2XB2D 3V2PA 3U59A 2CPSA 1IKVB 2VH7A 4PRFA 4NE9C 1SV5A 1VQ8S 3X3UA 1HNWJ 1WDTA 4GVBB 4KFBB 3QT6A 2R7TA 4DL3A 4XFJA 1S6UA 3TVZA 3PW2A 2PIIA 1LXJA 1KRPA 2CXEA 4DEZA 4LSNB 4DR5J 5LJ5Y 2RH0A 3I56P 2FTRA 3OJAB 2CQ0A 4RNHA 4DR6F 5CXTA 3DMJB 1T9UA 1XR6A 5AXLA 4F4AA 3HSDA 1ITPA 5M2PA 3L75G 4RBTA 4ECZA 2DNOA 2E75D 2V2KA 4OMFG 2BCCD 2Q7CA 1TVRA 2KN4A 3DRSA 4MYUA 1OW6A 5KFMA 3SFGA 3MCMA 4C0OC 1KLMB 2KL8A 3MMBA 1RWVB 1RAJA 2QLWA 4DR2F 3KUGA 5ETNA 1D8YA 2B9YA 4MKAA 1JXVA 5CCGD 4M1KA 2LP4A 1GK4A 3MECB 3QATA 2OD6A 5DGAA 4FS1A 4Z2XA 1OS5A 4DL5A 3CEDA 3PJXA 4K59A 1URRA 1M57D 1NTKG 2DY9A 1NU1G 2ASJA 1QLNA 2U1AA 2MZJA 2E5LF 3F44A 1ZAWA 2FYUK 3GFXA 1J5EJ 1S6PB 4B3RF 2XYGB 2ILZA 2KUBA 3R6GB 3KK2A 1L0NG 1REVA 3HHLD 3V2UC 3CCQP 1S9KD 5KG0A 3GQCA 3UO0A 2XWYA 3I4HX 2KFNA 1P1LA 4ECSA 1S1CX 2R3CA 2QMUB 4WYLA 1RTHA 4NPOA 1DURA 1Z56A 2XMJA 3DLKB 1FJ7A 2PO4A 4M5NA 1M5OC 3NMDA 5DM6Q 3OLAA 4DFPA 3CF5Q 1SQVD 4NCBA 5AW6B 4YOEA 1KC8T 1CG2A 3VYIA 1IKWB 1Q1KA 2VJUA 2BX6A 1GH8A 2G0IA 4UQTA 2HQ3A 4PPZA 1FRKA 2HS0A 2WWWA 3DN9A 4LT6A 3MPDA 2FQQB 3I87A 4PYAA 4F4KA 2IAJA 4A4JA 2EK6A 4OZNA 5J2PA 1W2IA 2DBBA 4LBPA 4U67Q 2OPQB 3IR7B 3NCRA 5D78A 5LXRA 4NLSA 1RT2B 2AP6A 4X4VA 4E98A 4M5GA 1KFDA 3BGOP 3K8VA 4ITSA 2YWFA 3CI9A 2ZVIA 3JSMB 1SC6A 2FY8A 4JBZA 1JLFA 2RUGA 3H32A 5HMZA 4LF9F 5GAHI 1RYRA 1JY3O 2LDYA 1TL1B 1L2PA 3PNIA 1DTTB 2Q66A 4YS2A 3FZ2A 1LTJB 2OEKA 2BW2A 1CJUA 3DLEB 2XLJA 4RKUJ 4QYRA 1EB0A 2ZVOB 1KONA 1GU4A 4X4SA 3L70E 2IFNA 4QW9A 2E5GA 3Q8PB 4MIWA 3KWMA 5EFWB 1YBKA 3H0PA 2M0GB 3PTWA 1V6HA 4U3FE 5J1EA 1PC4A 4ZPDA 2NPSD 2P9GA 3RGIA 1R0AB 3W62A 3MEDA 4C8MA 2HNZA 5EWFA 3GG0A 5HJYA 3HHKA 2IJRA 2F8HA 5ETSA 2CJ9A 4GRSA 3CC7S 2ZBPA 3OTDA 3T1YF 3H6PA 1QVGO 1GTEA 2E5IA 2H7HA 4I2QB 5LL6d 1VOMA 4YB1P 3LWLA 1BC6A 1EKSA 3PRDA 1LT1A 5KT4A 3LALA 3LW5H 2E75C 1YITS 1LTIC 1G4CA 2ZT9B 3C46A 1SQPE 3OR1B 1U2CA 3CX5E 2HPCB 1U1OA 3MGNA 4EBCA 2WSCJ 3T5HA 4DR7J 1JUNA 3FCHA 4ZK7M 2KT5A 3DM2B 2IVFB 3EXCX 1JLQB 1S5LX 3KJVB 2K37A 1RLCL 2JO1A 4F4ZA 1FKOA 2ZNYA 2W4CA 4X84A 4PR6A 3VAGA 3DLBA 4C7NB 4ZN3A 3EFGA 1N56A 4RW8B 4DZ6A 4TQSA 3MD0A 2W2MP 2ZEJA 5DG7A 4ZVEA 4J9QA 1RXOB 1SJ1A 3AODA 4ES3A 2ZYAA 3E1RA 4YB6A 3HHLC 3TUJC 1RBOB 5K8NA 4C7QA 2DXDA 3HT3A 1XERA 3K5MA 1RF1B 3GE9A 3A8KA 4ETXA 5ETMA 4GC7A 2NREA 3MI7X 1U45A 1PGPA 3A3NB 3W7BA 4YDDB 3LWMA 4KR0B 5DDRC 3T5LA 1VC6A 3V6DB 2VPXB 3IFMA 1REGX 1PP9J 1XTGB 4P2XA 4C9DA 2KS1A 4BDPA 4XE5B 1X4HA 5LSLA 4X4RA 4DV6F 2DH8A 3J81Y 4C48A 5BYSA 1PGZA 2HHSA 2HYIB 5KT2A 1WHYA 4QBUA 4NOHA 2GO9A 1LTSC 4DV0F 2IRYA 5AVRB 4H4OB 4B17A 2Q43A 5AJ3F 3QWUA 1BE3E 4ZKPA 3BO2A 2AU0A 3C15A 2F9JA 4OH8B 4KSEB 5CYMB 2VA3A 4AUKA 3L7OA 2IRUA 4URSA 4LF4J 2Z0GA 3JS9A 3MAAA 3PW5A 2FGCA 3R5JB 3MOZA 3NAHA 1G2CA 3CCRS 1SCJB 4NI2A 2BASA 3BVHA 2DNZA 4HHHA 3CCSS 3VALA 3CTRA 3CMES 1YJWS 3GJQB 4MN4C 1R5LA 2E7XA 4J9RA 1N33J 1NHUA 1LXNA 2Q9IA 5KFWA 2KZMA 2D9PA 2HWHA 2MJUA 4J91A 2ZD1B 4LF8F 4JI8F 2UXCF 5APWA 1NTZD 3CIZA 5H9EJ 2UVUA 5B5EH 1VQOS 2E42A 4M5JA 4B3TF 4HJGH 4ASWA 1K44A 5EX0A 3HHLA 3GMAA 1NRKA 1M1JB 3R5BA 4JUZA 3MAHA 2QRRA 2XNQA 3V6JA 1HFEL 2WHOA 1S99A 2NPSC 3CJ2A 4ZLLA 3PIPQ 4EYYQ 5AXMA 2JJLA 2B87A 3T41A 3CX5I 2EG1A 2HQCA 1X9WA 3SCJE 3V81A 5AW5B 2KXFA 4LF5J 2LA4A 1U0SA 1FE0A 2YQ1A 3NRBA 4Q0BA 2BBEA 3B8HA 2HODA 5E79E 4ZVGA 1IKYA 1AA1B 3GHGC 3S7RA 3T5JA 1FZEA 2EC2A 2PFFB 1VQMP 3ZTOA 4V19J 1PP9G 4K4UA 4ANEA 2QFIA 3BH6B 1JLBA 4LR7A 3MURP 2G3AA 2WPVB 5CH7B 3R5GA 2N3LA 1Q95G 1JWWA 2P2UA 1P8GA 2IDBA 2XCPA 2VJVA 4DN9A 2FFDC 2J8AA 2OPRB 3D0IE 4QYZK 4K50A 2MQ8A 1D3WA 3G8QA 4C6AA 3CMAP 4CNZA 3CIMA 2JKVA 2J6UA 1ZETA 1VF5D 1J27A 3HZGA 4M94A 5FJ4A 1L0LK 2PI5A 3TOQA 2BCCE 4LF6J 1IBLJ 2OEJA 3MR2A 3PG9A 4WE1B 4X62F 4KGXB 2EFGA 4UB6E 1EDIA 3GFZA 4ZPTR 1KLNA 2V8PA 4KPCA 2NPSA 4ZP6A 4AL6A 3VAJA 3WIVA 2ZHBA 4NCGB 3KTQA 1SV5B 1XMBA 4WWSA 5IV4A 1R3NA 4R8UA 1FVSA 2P1JA 2SXLA 4RW4A 4CT9A 4J9NA 5KT6A 2H8PD 3HFZB 3R1LA 2Z58B 3VOPA 1EDKA 3AXKA 3Q8SB 5A8WA 4GVLA 3JYTB 2J9CA 1Q79A 1S9KE 2NZ4A 3ZFVA 2A1BA 4JI4J 2DKOB 4QCLA 3LP2A 1WEYA 2IHR1 1T05A 4M5DB 2KT3A 2HQIA 1TVRB 2GVZA 3DRSB 4ILRA 3KLIB 4WXOA 2RILA 3S6EA 1G1XA 3I0SA 4HL9A 3CT9A 4DL2A 3T3FA 1SQVE 2YKMB 4USTA 1TMMA 1LV5A 1WG1A 1FS0E 4RW6B 3VHQA 2FFDA 2CDQA 3PVXA 3K89A 1NKBA 4I6WA 1G2EA 2IBZG 2QJYC 1HA1A 2WSFJ 2E1PA 2B7CB 4B02A 1KFNA 5D4LA 1C2PA 5D8HB 1FNXH 1FKAF 1JLCB 2XLIA 3M8QA 1R8AA 3LQVA 4NA1A 4EUVA 2Q1LA 3CJ4A 1PZQA 3AH6A 5K8MA 3MZWB 3JTOA 2F65A 2YNGA 1WI6A 4OL8A 3Q0AA 2E44A 4R4LA 2DEIA 2UUBF 2MKSA 3KNGA 4RNMA 1S7IA 3ZZUA 4DZDA 3WU2H 2H5EA 2WTYA 1MROA 2KM8C 1UL3A 4F4XA 3HCXA 4M5IA 4Q43A 2FDNA 2XO6A 4S0MA 4O3NA 3CGIA 1IJFB 2A45I 2MSSA 4OYZA 3MFHA 4BC9A 3L35A 4D3HA 1LKZA 1N4LA 3ZO7A 2OHDA 1QVFO 1E79H 4P9SA 2H1YA 2A10A 4IOIH 2D2CB 4ZJQA 5KKZC 1EQ0A 2O1KA 3HFVA 2YKOA 1NGMB 1C0UA 5F41A 3GCWP 1CULB 2I1KA 3H40A 5BXIA 2K1AA 1QTMA 3NNAA 2IA0A 1IWGA 2RU3A 2DW3A 3LW5C 1YRXA 3L09A 2A45H 1BGYD 2MZRA 2WOMB 2HMIA 2VOPA 2XGQA 3EQ2A 2VQEJ 4KGVB 2HVEA 4OZ2A 3H32B 1VF5C 1RJJA 4DCPB 2CQPA 4M63A 5HQLA 4NEZA 1PPJE 4KIAA 2I8DA 4PXBA 1TAUA 2YNHA 3KDNA 4OQJA 2L48A 5DZ7A 4B3OB 1URQD 1X0FA 2ZH4A 2BZ2A 3CCZA 3QRQA 1KQGB 3VVTA 1N0VC 3OXFA 3H1JJ 1LWCA 1TV6B 2PFXA 3K2YA 3M6XA 3DLGB 5KOXA 2VZ9A 2DY1A 4ZP8A 3WDOA 3V2NA 4P73A 3H1HJ 1HPZB 3AECC 1QGKB 4LRDA 1B0PA 1I94F 4WTOB 1KILD 4TY9A 3AJDA 3QT7A 1VQKS 4CYUB 3SQGB 3K59A 1U4BA 2HNZB 3ZZRA 3R7BB 3I32A 4ZCLA 1GL2B 1DFDA 5H9FJ 4O3PA 1AA0A 3PFEA 2Z30B 3TZYA 3TP2A 4LLHA 2ZH6A 3A3PB 3M8PA 4JV1A 1NHKL 2DHXA 3NWRA 4DU7A 4CM0A 2IJNA 3RW7A 4NXNF 2PN6A 5GAEU 1WC0A 3L7PA 1YHQS 1XC9A 4G1QA 2A06G 3MUTP 1YG0A 1Y9OA 1U0HA 1AQTA 2JP3A 1URNA 1NPKA 4OHVA 1CZQA 3B8EB 1T2KD 3BGLA 2HRUA 5L46A 4CO4A 1T3JA 1FKOB 2N4CA 4V1Ak 1KR4A 4DQQA 1FRHA 2D3ZA 1EJ7L 4YY3J 2ZZMA 2NXJA 4DG1A 4A8QA 3UDEA 2H9ZA 1F3FA 3FK4A 3GZ7A 1OYDA 2GAHC 2BKPA 2IJFA 3D0GE 2ZYDA 4IFMA 4C8NA 2CAJA 3QWOC 4DCKA 4UTGA 1NK4A 3BASA 5A0YA 1JLGA 1SQQE 1S1WA 4CLYA 2QEXS 2OSQA 1UA1A 5A6PA 4Y99C 1HR0J 1RT6A 1OIPA 1FF2A 4YDXA 2OFGX 4JI1F 1NTME 4KB7A 3M9HA 2GGPB 4X64J 4AT1B 3OL8A 3OXGA 5DGBA 3VGVA 2V2QA 4N78E 3H1JG 3WX4A 3GV5B 4JB8B 5HQMA 4M5LA 4Y28C 1X4FA 4NLPA 2RKLA 3H1HG 5DLGA 1MNEA 2CIMA 2FKWB 3CD0A 3HD7D 1M8OB 1TZ0A 2G2OA 5HL7Q 1IFDA 1U48A 1ZH5A 3TSIA 1Q8IA 3OT9A 3A13A 1E6VA 4IL6H 2J59M 4KV8A 2E1CA 2QTWA 1QDUB 3MUVP 2EFVA 1G2CB 4ANCA 2DNKA 3C66A 5LM7E 4CLUA 3KFWX 4DOZA 3C16A 4C8YA 1WOSA 1SI9A 2ZBQA 2YWWA 3TGUJ 2K7KA 4MMOA 3AE7C 3QIDA 1X8YA 2K88A 3MM6B 5CHXA 3CMQA 1NK0A 1HD1A 1FRIA 2YWHA 3ENVA 4NPDA 2J9DE 5KAIE 2Z5HA 4WU2A 5B09A 2VFSA 3DC2A 3RZAA 1UZDA 1HNVA 1FX4A 4GKKF 2FHJA 1JB0C 3HHLB 1FJCA 2CJXB 1SL0A 3V4IA 2CJBA 3DOKB 4DHVA 3HUSC 1RT1A 2HKEA 3S1KA 1EX8A 1F2HA 1S6QB 1Q7LB 4DV3F 1OVRA 5E7OB 1NBEB 4UF4A 1S59A 3EFFK 2QT7A 3NGRA 1S48A 4WY4B 1DEEG 2DHGA 3CO9A 1RABB 3NAIA 3QSIA 4YB5A 5L39A 4WIIA 4A8KA 3SV3A 4PQUA 4PCQA 1L0NK 4ICLA 1OY9A 2HFNA 2P58A 1IZNB 4JI2J 4IG3B 3OTOF 1IFPA 1IKYB 4NLGA 1UAWA 1RU2A 4HLBA 4DQSA 4RPFA 2DCLA 3DLHA 1SQXJ 1VQYA 2FUG9 3M30B 1LW0A 5HMYA 4UZBA 5E3QA 4R25A 1FEEA 3G96A 3GU0A 3Q8RB 1FD2A 2BE2B 4DMZA 2QM8A 3NNHA 2RE1A 4NMXA 1NKZB 1T2KC 1NKEA 4KJIA 3W9IA 3D6TB 4X66F 1C1BA 3H1IJ 2IBOA 4JI5J 1V3ZA 4U8YA 1F6TA 3B5ND 2YY3A 1MN7A 4WP3A 5HATA 4JI0J 1WDDA 2ZFHA 5L9NA 1Q81T 2ADCA 2C2DA 3TUIC 1BQNB 2D41A 3TI0A 5F8IA 5SZTA 2AYBA 3DCAA 2L41A 1X9MA 1M1HA 5ETRA 1X31C 2M2BA 2BQUA 2HGLA 2QGFB 2W7AA 4DSEA 1F9EB 1N7SD 3TGUG 4I2PA 1H8AA 1IJDB 2IY5B 5AVZB 1FXDA 3TNUA 1SQGA 3HUSA 2J7KA 3L73E 5HO4A 3FBBA 3RAXA 2GHPA 2VPWB 2RQKA 3DRRA 1L4AD 2HGNA 3UE2A 3I55S 2HZVA 1LW2A 2NPSB 5J2MB 2YXLA 5CBNA 1XMOF 4AYCA 3TO8A 1EAYC 4PG4A 4H4KC 3BQ1A 3PDNA 3HRNA 3QJJA 1RDRA 4R8UB 1B0TA 1QAIA 3F56A 2ASDA 2HLUA 1RUSA 5KG5A 2CPBA 5EX3A 1KD1Q 1Y47A 3HD7C 4QU7A 3GHGB 1QJHA 5B0FA 4ELVA 1IFJA 4UZCA 1HWUA 1SC1B 2X7IA 3KK3A 2JEJA 3ILLA 3AEEC 4OLPA 3FDSA 4IFDK 1IBMF 3MM8A 1LWXA 1RT4B 4B3SJ 2JLFA 3CWBJ 1DX7A 3OUYA 3GWCA 1LQ9A 1EZZB 1Z2ZA 4RO0A 1WKKA 2YX4A 2LQBA 5B0CA 3LH2S 4W80A 4KAIA 2Q3PA 3PJWA 1SQXG 3BCCD 1C1CB 4UUXA 5DDPC 1T3NA 1PG5B 3AEDC 3R2CJ 3LUYA 1Z2LA 2DITA 2HHVA 5F0WA 1UCNA 2GX8A 1YBAA 2HS3A 1B7FA 4X4OA 2M3DA 3GIKA 1IBKJ 1KKHA 5E3CA 4BWJA 3FCVA 3L72J 3H1IG 2ROGA 4JQ0D 2XMUA 1H6KX 3MEKA 1YGYA 3MEGA 3EZ5A 2CJQA 1N73C 1RADB 3PRJA 1RWKB 4DUYJ 1D9DA 1T03B 3Q5PA 1N5SA 1KNZA 3IC1A 1BGYE 2W7PA 3UDLA 4WIQA 5H2FE 3K5LA 1KMIZ 4IH5A 4H4MA 3JQKA 3DU6A 2IPOB 4I7ZC 3OBIA 4DUZF 2VASA 1W2BR 5KT7A 2X3GA 4H4KA 3ULHA 4DF4A 5HK4A 1M90T 4ALZA 1N8RT 4U7JA 3BYPA 4PG5A 1OVUA 3CJ3A 3HD7A 1NK7A 2HNYA 2CQ2A 4TXSA 5B7WA 4Y2KA 3I5AA 5FLXU 3J7YI 2C3MA 3CVKA 3BKUA 2DR7A 3CSKA 2BYCA 3HKZD 4PD4H 4GKGA 1KILE 1JJHA 3S1TA 1UJ5A 1ZPVA 2ALYB 3B5NC 5CJ4A 1JJ4A 4KRWA 2MQPA 2R5BA 2WT7B 4G65A 2JVRA 1VRQC 2HMIB 4OGQD 1G3OA 4ECVA 1RTDB 5IQ6A 4AL5A 5C2GA 3CWBG 4DBQA 2QJYB 2QYCA 3VQSA 1U57A 5H1SV 5B66H 2ZBCA 3M2VA 4C0HA 5HLFB 6FDRA 3FBEA 5DO2A 1N7SC 2EVZA 3DRYA 5G0RB 4U7UD 2YIUC 1N73A 2A2CA 3RBEA 2NXCA 3NL0A 2ZHAA 2VFVA 2V2VA 5LMUJ 2AD9A 1KORA 3C6TA 1FWPA 3HD1A 3JSVC 1IWAA 3VTIA 4DR3J 2NUHA 1L4AC 4PYDA 5IS2A 2AQ4A 3L72G 1RWOB 3QGPA 2DTJA 4DL6A 1HD0A 1TKTA 2HHHJ 3R1HA 2Z2YB 2Z2ZA 2OLWA 4N56A 2CPDA 2Y0EA 5AW7B 2V63A 3QO9A 1Y7PA 2H4WB 2KM8B 3RBZA 1K47A 1OZHA 1JJ2R 4K4SA 3Q2TC 3L74E 1IR1A 1Z4UA 1M5HA 2WVFA 4OZLA 3J7Z5 1FJEB 4RESB 2XO7A 4R4MA 2IC3B 3MD3A 3L3CA 1Q78A 3H5XA 2IA6A 2LCWA 1S12A 1WORA 3W9JA 1S9EA 3ABVC 3J7AN 3H5SA 5KKZB 3UD4P 1LWEB 1N5YA 1R27B 4UUWA 3MHVA 4ZVRB 1YZ7A 3DI6B 5G4DA 2F4VJ 3E8OA 2HVIA 2GMJA 2C2MB 4MK8A 3AE9C 1Y10A 3B4SA 2DGXA 1RAAB 1Y5IB 4LRAA 4ES2A 3B5NA 1Y11A 3LGHA 1FEHA 3KLFB 4DFKA 2G9OA 4O0IA 3GFYA 1A7GE 2HGMA 2RU9A 3L75D 3IAOA 3CCTA 3CCMS 1JY3N 2IFXA 4ASVA 3RK3D 2QO3A 2UUAJ 1N7SA 3NCPA 4HI2A 3POTA 3UVJA 5A2QU 3ZXWA 3NS6A 2J8SA 1HH0A 3ZZPA 3CCLS 4L73A 1TU3F 3AE5C 2QSFA 1S1WB 4OYAA 3FRZA 5L8RJ 3HPOA 2AX0A 1CS4A 2R2SA 2QLFB 3E01B 1NNDA 3JAMU 3J7ZT 1Y0HA 3GILA 4HACB 2H43A 4ZDNA 3LPYA 1T02A 5THWA 4X4NA 1UVNA 5KFQA 2CQ4A 1HNXJ 3HTKB 4BXLA 3OD2A 1NTKD 1FWKA 1Q86T 1NU1D 2Y9HA 1FK9A 3WC0A 3W5ZA 4BRYA 1BQXA 3ZTRA 2CQ3A 2FVSA 4MIBA 3TX8A 4R0JA 2MEWA 4W92B 4U95A 5L9XA 1WT6A 1BCCE 1S3JA 1DTQA 3UR0A 3VGTA 2FXMA 3H90A 3CC2P 4PAAA 2CNNB 1WKLA 4A8SA 3M9OB 4O23A 2P6SA 5AW1B 1OSCA 2XS2A 3ET6B 5F8MA 3BV8A 1MMDA 2OTLS 4B3MF 3THTA 1QAYA 1D8ZA 4LBIA 5KFIA 5CYQA 1KYOD 1WTFA 1NKCA 3V2RA 1X4BA 1ZM4A 1P9YA 3MM7B 3RB0A 4OGQC 4KT0J 3AE6C 3JCUH 2UXBJ 1JK9B 3DRPA 1KQKA 4DPYA 2W01A 3H2LA 4LFAJ 3PO5A 3W65A 2IFMA 3HE4B 3N4WA 3C14B 4G1IA 2EC0A 2NSBA 5KAFH 1NB2A 3CCJS 2I6WA 1RHQB 2DGWA 4I6MC 5TISH 1JKHA 2HNDB 4OZ5A 2ZH1A 4IUFA 2G13A 3V4IB 1MG7A 1NJWA 4QR0A 4DSLA 1S57A 1WI8A 3IWNC 1OQ6A 3HVTA 4NXMF 1HNIA 3BBCA 2KHCA 1EC5A 2ZH9A 3EVWA 3EWGA 5DS7A 2NSCA 2KTQA 4WZMA 1T8ZA 1QE1B 3I0RB 1TL7B 2B4OA 4DPUA 3EZUA 5F8LA 1HF9A 2QMXA 1NO8A 2GJ2A 3HHEA 1JMBA 1HGVA 3LGMA 5LXYA 4NLOA 2OPPB 3D67A 2C3UA 4F2RA 2BANB 3N4XA 4QWCA 2R44A 1P1TA 3C3LA 3IMQJ 4FF1A 3VMZA 2LVWA 3PCOB 3VV2B 1JLAA 1OW8A 1LT9B 2HHUA 1IKXB 4ES1A 1NJIT 3KMQA 2VD3A 3CB4A 5D3GA 1GNKA 3Q5SA 2HIQA 5L1IA 2JEGA 4UOHA 4RUCA 2CFXA 4JYAF 1N0UA 3QZ7A 1FWLA 3QLHB 4DR4F 3N6NA 1VJQA 3L70J 5JXSA 1J5OB 4WP8A 3DDKA 4R5PB 4PWDB 1UEKA 1LK5A 4FS2A 4OI4A 2XNXA 2ZBRA 1RT3A 3RK3C 1NPRA 2QLBB 2QG9B 4ED1A 3IR9A 1MWYA 2R3SA 1S7HA 2IMWP 1URQB 2L3MA 1FDBA 1H98A 3UD5A 2VG6B 3CJTA 3W2VA 1TKXA 3SFDC 5C42A 2FXOA 1YI2S 4IFYB 3W61A 1XBWA 4JI6F 2K9JA 3VMYA 2DHAA 1W2BO 1EDJA 1MWZA 2AYEA 1WC3A 2QVAA 4CLWA 3AFGA 1OO0B 3TAQA 3DRRB 2DNGA 2KJWA 4RBUA 2UVRA 2BRLA 5I42A 1KILB 4HTIA 2GW8A 3FC9A 1X4CA 3CUNA 3L4FA 1BLUA 4UB8H 3D6FB 3GIJA 1GD2E 1E6YA 2DGUA 4OZ3A 4DV2J 2SPZA 4ZVSB 1S6OA 3GSDA 1ZM2A 2O01H 1VCTA 2KB7P 3P8MC 2VQFJ 1XNQF 2CPEA 2FLNA 1S77D 5AVXB 3G82A 5IC4B 2WVBA 3ILIA 3C2PA 2F4FA 3MM5A 3EZOA 1VGYA 1KBRA 4O44A 4LR9A 2RF2A 1P84D 3H5YA 1VR6A 4ZA1A 1MSWD 5BJRA 3HO1A 2Y0DA 1SH3A 3T6JA 2DRBA 1Q90D 1PJ6A 2CWKA 2VU5A 1S9FA 1K05A 2BRKA 5HBMA 4ED0A 3OAKA 3CXHE 2JEEA 3F73A 2F8EX 3FSXA 3RU0A 2QA4S 1DBDA 2N4DA 1S1TA 3I55P 3PHLA 5D4NA 4IR9A 1SQBJ 3RL0B 1TUGB 4K4ZA 3L95X 3L70G 3A3YB 1OVVA 5DG8A 2UU9F 2XV5A 5HP1B 3GR0A 4QZVB 1CI6A 2HG5D 4DCJB 5KFHA 3LANA 1SQPK 1SIZA 3HKWA 2MLYA 2GNKA 3QBCA 4OI1A 1KQSO 3KHHA 2AEMA 1BE3J 2VG5A 1XK8A 2OTJS 1RI7A 3VMXA 1SH2A 3MM9B 2B7BB 1BWVA 2J5AA 3R5CA 2B5JB 2X1BA 4OX7A 1X9VA 2HBQB 2XSJA 1HW8A 2AHOB 2QJKC 3W9HA 2J7WA 5K14B 1GK6A 2ROEA 3SWFA 3ZZYA 3GF3A 4ZVHA 5D4PA 2GA7A 5DLFA 3W68A 4KPYA 2OARA 2HNYB 2Q3EA 3KK1B 3JB9k 2R3VA 3AOCA 2KB2A 1N7LA 1X4GA 4FBUA 3NFQA 2ZM6F 3M9QA 2QG4A 4UW2A 2K1RB 2V8VA 2OH2A 2OMOA 3T1HJ 4M5HA 4KGKA 2VBWA 1EZVG 1UWBA 4NLVA 3I56S 2LLZA 2ZVSA 3IAM9 4MKBA 4KO0A 3M1VB 4ZP7A 4I7FA 1PP9D 3PW0A 4WJBA 3LOUA 1RZMA 3U7JA 1TP7A 3NGDA 1WUUA 4TKTA 2NQPA 4HT7A 5A8RA 1FDAA 1LP1B 2VPZB 1U1NA 4DL0C 4C8KA 4QIGA 1NSPA 5KFXA 4DJBA 4PJ0E 4FVCA 3Q22A 3QH9A 3NKYA 1FZGA 2GO8A 2XDJA 4L76A 1IBCB 2I0XA 3P8BB 3CC4P 4MKVA 4F25A 5IWAF 3AQOA 1SQBG 1GXUA 2JZ5A 4DV7F 4NZ0A 2P10A 3IG1B 2F5GA 1AUDA 2DNNA 3CPWR 2I1JA 1H2VZ 2RN0A 3Q8YA 3U1MA 2KK7A 4Y0FA 1M5SA 3M8ZA 5A8KB 3RK3E 5I4MA 1RE3A 4I7ZB 1TKZA 3M2RA 1I5OB 5AVVB 2Y8YA 3M9NB 5T7LA 2ZAEB 3JTPA 3CCQS 1BE3G 4CT8A 3IN6A 5DZ6A 3N7NA 1Q8KA 5T14A 2AJ4A 3BR8A 4RKUC 2EK1A 3CXHI 2YKNA 2IVYA 3BGUA 1S1XA 3BZQA 3SBMA 4X4PA 1M1GA 4DPXA 4CLZA 1J1EC 3O6QB 1PYTA 2HK2A 4NLYA 4AD6A 3WMM0 3TA0A 2XS7A 4MKYA 4P52A 3H42A 1TMJA 1VBXA 2Y0CA 3KXDA 5IZHA 1ZM9A 5BU5A 2DNYA 3MEEB 3F0NA 2CNLB 5B0AA 2LU1A 3B5NB 1L0NE 4ED6A 5KFKA 3UW1A 3HE5B 3D1HA 3N01A 5TJHA 1HBMA 4C98A 2AV5A 1Y8AA 2M5AB 2FC8A 1X5SA 4OHXA 5M1BA 4YR3A 4PWWA 1PJ5A 3P32A 1FDMA 3FEXB 1MFTA 2LEPA 3ETMA 2QN6B 3M06A 3O8WA 3AQPA 3FEYB 1VQ5P 3BDPA 2XMAA 1YQ3C 2MKYA 2X3DA 3SCIE 1KEKA 4OYBA 1KYOE 1EP4A 2WSCC 3G6EP 1QEXA 4ZPBA 2IBZD 1BQMA 2UVVA 3W1YC 1L4AB 1FC2C 2WB1D 2DGVA 4OWFA 2Q79A 1GFWB 3DFEA 2N1TD 4W90B 3IR6B 2B8PA 5DJBA 1KTMA 4DUTA 3QIPA 3WC2A 5FLXY 3OFEA 3KLHB 2UXDF 5I3UB 3RB3A 5KAKA 3AE8C 1JM0A 3S4RA 4NPEA 1I3OB 4ZIVA 1D9FA 4EO8A 4ZMDA 3PJ9A 3RRGA 3RG6A 1XR7A 4BCAA 3D1OA 1QY7A 1XNRF 2KU7A 2ZJSE 3MMCB 2ATCB 2NXEA 2VDIA 3KZIE 2FYNC 2CYYA 1FZCC 1VQLP 1IQTA 3O1LA 4KHPF 5IM0A 4OYIA 2A45G 1K9MT 3P7KA 2XNDH 1WF2A 3USSA 2Q5UA 4GIFA 3CCLP 4MT1A 4NEYA 4ECYA 3J80U 4F0KA 4CO3A 4PQAA 2BDPA 4F2SA 1EETA 4P2MA 2B9BA 1RT5B 4J90A 5CD4H 2QL7B 2A6OA 1AUSL 3FQKA 4CWBA 3DRPB 1A02F 1VQ6P 4C46A 2RSQA 3H1LJ 3ENQA 4MYTA 2F1FA 4LSZB 1S10A 2B6AA 1EDLA 2OYOA 2HFOA 4NLWA 4CLLA 2V4RA 2HG4A 3M05A 2VB6A 1DLOB 4J9VA 1XMQJ 4IR1A 1WKJA 1L3KA 1CC8A 2ZC4A 1AFIA 1VQ7P 4H13D 2D7SA 2OTKE 3HX9A 4DSIA 4C3MA 2HBRB 4DV5F 2H65B 3QFWA 8RUCA 3AEBC 1NAFA 1UIXA 1GT8A 1BWEA 2I5JB 3HVTB 1SQVK 1U47A 1HNIB 3C6UB 1U1RA 1YK9A 2JR8A 2O01N 2W9CA 1U25A 2G1HA 2WSEH 2KG1A 3OQ2A 2K8GA 1UZHA 4GOFA 2OO4A 2V8GA 1DIPA 3HM9A 3OHAA 2C1EB 3TZWA 1FE6A 2HBYB 4QQBA 3O5TB 2OD4A 2HHXA 4KH1B 2E5YA 3ZTSA 3R5AA 4F8RA 4MAKA 1A6LA 3EMTA 3A8JA 4D6TD 5SUHA 2QA1A 1HNZF 2ZWPA 1FZCA 2B4PA 4RW9A 4IO9Q 1T7PA 5KTBA 4DV4J 3K8WA 5IFMA 4F0HA 5AW9B 3N6LA 2DNMA 4C11A 2UVWA 1S5LH 1KYOI 2UZAA 1JNZB 4XAKA 5D0EA 2MXYA 5KFCA 3M0AA 4K3AA 4USKA 5A2QY 3M4XA 2IZ0A 4DN0A 5K5MA 1SIWB 4OYOA 9RUBA 2MGZA 3GIMA 2VONA 2OYIA 2KZJA 3UNGC 4MK9A 3JAMY 2GIRA 3KHUA 7FDRA 2WBRA 4R0EA 2A06D 4TY8A 4L3NA 1NZAA 2ZYGA 5KFFA 4O9BA 5DDQC 3HHDA 3BKFA 3VP9A 2JDIH 2FJVA 1N36J 3N79A 3ZZOA 1I6JA 1P84E 4OYXA 3ILOA 3Q2YA 1RHKB 3JSRA 3OTEA 2Z4EA 3OHBA 3I82A 2MZTA 3H1LG 2N1TC 2DJWA 3BB5A 1KVKA 2MHNA 3FNNA 1KV4A 2BJ9A 2DO0A 2R5DA 3T9NA 1U2FA 5I42B 3G8SA 3IAS9 2CJAA 4TU9A 2BJDA 4I0WA 1Q16B 2BV3A 1AVOA 4J9KA 1JTHB 3H2UB 3BSCA 2WVDA 1FFWB 3BPSP 1X8DA 1WRGA 3AEGC 3ZTQA 3PIOQ 1NWQA 4N8NA 2V8DA 2XY7A 1K73Q 4I69A 3S9OA 1O8BA 1KQLA 3G82B 2K7JA 4KE5A 3U1CA 1K8AT 5KG6A 1C0TA 3H1JD 3MM5B 4MFBA 4HVZA 2ZXXA 1SKRA 3W60A 2RF2B 4F4WA 5IC6B 1KQFB 3H1HD 2KI7B 3A0BH 5F3ZA 1VQMS 1SQQJ 5KFSA 4B9VA 1H73A 2FJEB 4Y6IA 2Y1LB 2OQQA 4K5RA 4OX9F 1SJ4P 2W2PP 1PPJG 2PRRA 4JYCA 3H5UA 3AOAA 1EXIA 2NYHA 1NDLA 3RK3B 3PX4A 2C9LY 4KHRA 1NPPA 2E74D 3KUEA 2B9EA 3CPWO 4JI7F 3NGTA 1PILA 3V5RA 4H13C 4E0DA 3PHEA 2VICA 2WW4A 2FYZA 1OW7A 2R4FA 3HLUA 3IS9A 3EICA 4FDFA 4ILLA 2BW7A 4K0KJ 2XMVA 2KP8A 5BYQA 4OYPA 4DV1F 3A0HH 3GJTB 4OZJA 3BR9A 2N1TA 1OXZA 5FIIA 2GIFA 4DZOA 1X4DA 2VL1A 4NCAA 3R2DJ 2XU6A 2GAGC 2NZCA 4ZMMA 3UR3C 2AJQA 1JXLA 2RT3A 2ZOGA 4JI3J 1L5UA 1NK5A 2RQCA 2XYHB 3TAMA 4LGDE 3Q3DA 4QJVA 1VQ4P 2D69A 2DNRA 4Y2CA 2E1AA 4XIUA 2XSJB 2QC3A 3SXLA 2NPFA 3EUNA 1R5SA 1YLXA 5U47A 2FXPA 5CHCB 5KFTA 1AYEA 1R8BA 4YHHF 4RNNA 1HJ0A 2O66A 1H72C 3OVBA 1EXJA 2XY6A 4F7VA 5GAEI 3MUDA 2R9LA 1P84I 3SDEB 5HVHA 1ZOTA 3KJFB 1WWHA 2KVIA 3PLNA 3NBPA 3II6A 4EU0A 1TFWA 1UFLA 4I7FB 2KG0A 1FDDA 3LP0A 1EIYB 1UVKA 1SFCA 1NTZK 1VHFA 2YKAA 5E3AA 2FZCB 1F5CA 2C2OB 3RW6A 1J1DC 4RW7A 2KIKA 1SQQG 3PH0A 4DU8A 5APQA 1OWAA 5F8GA 3HVRA 2VDHA 2KI2A 2M8RA 1RA6A 3RB4A 1UKUA 4OI2A 2QSWA 1AZSA 3ILJA 2NZ2A 1SJRA 3R7SB 2AXTH 2LKZA 2R8JA 5MLCV 3DXSX 2C3YA 4OJGA 4B9MA 2FYUJ 4DR1F 5DQGA 1BE4A 1G7CB 4UOCA 1HI8A