3I5CA

Crystal structure of a fusion protein containing the leucine zipper of gcn4 and the ggdef domain of wspr from pseudomonas aeruginosa
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
196
structure length
196
Chain Sequence
RMKQLEDKVEELLSKNYHLENEVARLKKLVNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPGGGGQTFRVLIEMADQALYQAKNNGRNQVGLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Fusion of General control protein GCN4 and WSPR response reg
publication title Determinants for the activation and autoinhibition of the diguanylate cyclase response regulator WspR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 68
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3i5cA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i5cA02
5J2QA 1HMVB 1S9EA 1MFZA 1DH3A 3H5SA 5HROA 1SH0A 4Q8EA 5J2NA 4H4MA 2J6SA 4NZ0A 2B6AA 1RTJA 4KB7A 2IJNA 4M3LA 4I7FB 4O3OA 2FLPA 3KJVA 4MFBA 4ZPDA 2HAIA 2I1RA 2R3CA 1N5YA 3M8PA 2C2DA 4O4GA 3M8PB 3DOKB 3KK1A 4ECYA 1C2PA 3DRSA 2O5DA 1KHVA 2W9CB 3DRSB 3V6DB 4NRTA 4TN2A 3M9MB 4F50A 2E43A 4EEYA 4RNNA 5KFNA 3HVTB 3DMJA 4ED6A 4WFYA 3DMJB 5C24B 1IKYB 2BANA 1LW2B 1RAJA 4LSNA 3PW4A 1BQNB 2C28A 4Y34A 3ISND 1EETA 4RNMA 2HMIB 3BSOA 4F4YA 4NLWA 2VG6A 4TY8A 3CVKA 5DQIA 3HVWA 3DRPA 1SH2A 2HNDA 2HNDB 3FFIA 4IG3A 2XV5A 1KQLA 1T94A 3HVAA 5AW9B 1QAIA 3MEGA 2ZE2A 3MEGB 2ZE2B 3HHKA 1RTHA 2P67A 4DG1A 4HYKA 1RTDA 4DEZA 4GKGA 1RTDB 1TV6B 4NLSA 3QGGA 2RF2B 4U6PA 2D7SA 4Q0BB 5L1IA 4R0EA 3MR6A 4J9KA 2C9NY 3OHBA 4DL2A 4AYCA 4I2QB 5KG0A 5KFBA 5KFKA 1J2JB 2WONB 1JX4A 5DLFA 3KLGA 1QUVA 3HKWA 4Y2CA 4O3QA 3KLHA 4AUWA 3KLHB 3RBEA 1S1WA 4QWDA 4ECZA 5HBMA 4MK8A 3N6LA 4WYWA 1GX5A 3KQGA 1LWCA 2R2RA 4NLGA 3KHHA 4Y3CA 4PQUA 2GIQA 3LAKA 1RT5A 3P7KA 5KG3A 4ED8A 1HARA 2ZKUA 2UVRA 2AGQA 3KMSA 3QGHA 3KK2B 2OPRA 1C1CA 2C9LY 3GYNA 3RB0A 3GQCA 4LQ9A 3GIMA 4B3OA 4K4YA 4ZVEA 1RTIB 2W9AA 4KAIA 4EO6A 4R5PA 4ED3A 1R0AA 3T19A 2R8HA 1S6PA 4JV2A 1NHVA 1DTTA 2WRMA 3KLVA 1JLAB 2IM1A 1HNIB 3IG1A 3MEDA 3IG1B 2D3UA 5HLFA 3VMYA 3KLEA 1S9GB 1MV8A 2V9WA 4EBDA 5D3GA 2W27A 2YNGB 5D3GB 2ILZA 3C6TB 4ZPCA 4JYCA 4PUOB 4ZP7A 4ECWA 1RT4B 3M06A 4IRCA 3OLBA 4OL8A 1S9KE 3IS9B 2VG7A 5AW6B 2UVVA 2IBKA 3KLIA 5KFFA 2IAJA 3OL6A 2XZRA 2R5BA 3DI6A 5EWFA 1SV5B 3DI6B 4AQRD 4ECTA 3KHRA 4LQ3A 2WT7A 3M0DA 1T2KC 4O3RA 1CSBA 4IKAA 5KG1A 4YR3A 4RW8A 5J2PA 5J2PB 3DYAA 1N6QA 5KT2A 5CYMB 1RYRA 2C2RA 1S6QA 5APYA 4IDKB 3H5XA 1VRTA 3PHEA 4ED7A 1T03B 1SP4A 2VRSA 1VRTB 3BQ0A 4NLQA 5L1KA 2YKNA 1W25A 1RT1B 4IH5A 4RNOA 4H4OB 2W8KA 1N56A 4ZP9A 1GX6A 1S48A 1ZETA 3H59A 2E9RX 1LWEA 4RNFA 3PJWA 2RKIB 1HQEB 3MEEB 3H5UA 2ZD1B 3RB3A 2FJXA 2R8JA 2ALZA 5I3UB 5KFPA 1N48A 5KFLA 2YKMA 2WCXA 1BQMB 2FVSA 3QO9B 3LALA 2WK4A 1JLCA 5KFUA 3KLFA 3BSNA 4IFVA 4IH7A 5KFIA 3MECA 5APTA 3IRXA 1CZQA 3M8QB 4EBCA 3CDWA 2HNZA 1ZTTA 2VG5A 1T3NA 3NBPB 4ZHRB 1WNEA 2UVWA 2WB4A 1OXZA 4R8UA 3QLHA 5KT3A 1D0EA 5KFXA 2JC0A 1IKWA 4NLTA 4MKAA 4I6MC 5C25B 4F4XA 4KKOA 4I2PB 3CIZA 3CJ4A 4J9RA 3H40A 4ECRA 2OPPA 3PW5A 3DM2A 3BGRB 4IRDA 3DDKA 2FJWA 1REVB 3KNAA 4ECVA 1TKXA 3G6XA 4K4TA 3O8ZA 5AW7B 1C0UA 4HYTB 1C0UB 3JYTA 5KFRA 2OPSB 3BR9A 5F8JA 5CMZA 1JLBA 4YR2A 4TQSA 1SLQA 2Z5IA 5L1LA 5AVXB 5DG9A 2UUWA 5F8IA 4WE1A 1TKZB 3MTKA 2R8KA 3E01A 3MFIA 1IKXB 3V6KA 1RT7A 3E01B 3M9OB 4O3NA 1RT7B 2QV6A 4IR9A 5KFMA 1HNVA 1LW0A 1HNVB 3IN5A 1JLQB 4XE5B 4ICLA 4Q8FA 3LIDA 5KG5A 2WHOA 1UWBB 3QZ7A 3LANA 1XR7A 3RAQA 3NTNA 1LWFB 2R32A 3GV5B 3EPIA 4GC6A 2XU6A 3TNUB 3M9NB 5AVRB 1IM4A 4PWDA 4WXOA 1XR6A 3MGNA 4C7NA 1OS5A 5J2QB 1S9EB 4C7NB 2EC0A 2JLEA 4ZVFA 1CSJA 5HROB 5KFOA 1TL1A 3UQSA 5J2NB 4H4MB 1DLOA 2B6AB 1GK4A 1RTJB 5KFDA 3CO9A 3KJVB 4I2LC 4MFBB 3FSIA 3Q8SB 2ASLA 4QPXA 5KFJA 3V4IA 1MMLA 1N5YB 2B43A 1S1VA 4O4GB 1S1VB 3KK1B 2BE2A 1HQUA 2R2UA 1RT2A 1HQUB 1RT2B 4TLRA 3DOLA 2KP8A 3NXSA 4KHMA 5F9NA 5L1JA 2BANB 1NNDA 3UPFA 3KDPB 4LSNB 1S0OA 4QWBA 3UR0A 2XGQA 1H8AA 1EETB 2AWZA 5DGBA 2VG6B 4TY8B 4NLOA 2WTFA 5AVUB 4TYBA 3DRPB 5L9XA 3PW2A 4IFYA 3FFIB 4IG3B 4ED2A 4IR1A 4TXSA 4NLRA 3VTPC 3NAHA 1RTHB 4DG1B 3MR2A 5AVYB 2WOMA 4RNHA 2WOMB 1RA7A 5I42A 3LP2A 3LP2B 3A5TA 3V81A 1QE1A 3V81B 4NLDA 2AGPA 2CJQA 4RW7A 2IC3A 4NLUA 4FS1A 2IC3B 5EDWA 2FJVA 3KHLA 5AVZB 2P7JA 5KFYA 3KLGB 1MUUA 2R8GA 4YMEA 3T1AA 3G6YA 2D41A 4G3IA 3H4BA 1S10A 3KHGA 1HPZA 2JJLA 3PVXA 1S1WB 3NKYA 1HPZB 1FK9A 5HBMB 4KFBA 4H54A 2FVPA 4KFBB 1LWCB 3GILA 4Y2AA 3I0RA 5J1EA 1FKPA 4PQUB 5J1EB 1RT3A 3OL7A 3ITHA 2BQRA 4WFXA 4DZOA 1RT5B 4K4XA 3ITHB 5KT7A 4MKBA 4K4WA 1FOSF 5J2MA 4K4ZA 5J2MB 2XC9A 3SFGA 3GIKA 4DL5A 5KFTA 3Q8PB 4MH8A 2OPRB 1C1CB 3L35A 5DQGA 2HNYA 4RESB 4JYBA 2E9ZA 2W8LA 1RT6A 4B3OB 1RT6B 1NWQA 4R5PB 1R0AB 1RA6A 4IOBA 3OHAA 1NAFA 1S6PB 4Q44A 1DTTB 3SI8A 4KHRA 1C1BA 3MEDB 4KE5A 2JEIA 5HLFB 1S49A 4F4WA 3KLEB 4ED1A 4KO0A 2AQ4A 1A02J 5KG6A 3V4WA 2VG7B 3C6UA 4EO8A 4RW4A 3KLIB 1T05A 3C6UB 2IAJB 4RW4B 4KV8A 1T05B 5DG8A 5KT6A 4GC7A 2ASDA 5KT5A 2YNHA 2WT7B 2IJFA 3QIPA 5FDLA 2W7OA 4MK7A 4O44A 4RW8B 4WFZA 3DYAB 1N6QB 1EP4A 1S6QB 5KFGA 3PJXA 3BSAA 1MU2A 5C42A 4LC1A 1MU2B 2YKNB 1HBWA 4RZRA 3DLGA 2OPQA 3NGDA 1GTWA 4EBEA 3B8EB 4QW9A 5DGAA 1H88A 4QWEA 3KK3A 5KFZA 2WPSA 1K1QA 5DLGA 4J9LA 1LWEB 4WZMA 4XPCA 1JLGA 1JLGB 2ZXEB 3RBDA 3PR4A 3V5BA 4NCGA 1TP7A 5AW5B 2C22A 4DL4A 3VN0A 2YKMB 5KG4A 4RW9A 1GU4A 4YR0A 5T14A 1JLCB 3BQ2A 1HWTC 3KLFB 3E51A 4IFVB 1S1XA 1S1XB 3MECB 1YVFA 3IRXB 3LP1A 1TL3A 4IG0A 3M9HA 1GU5A 2C2EA 3H2LA 2HNZB 2VG5B 2N9BA 2H7HA 2W9BA 1HYSA 2I5JA 3ISNC 1QAJA 4ZMMA 1JUNA 1HJBA 4R8UB 1C0TA 3QLHB 3L36A 3CJ2A 3HTKA 2JEGA 1JLEA 3QYYA 3I5CA 1IKWB 3P8MC 1N4LA 1JKHA 1S1UA 2UVUA 4KKOB 1S1UB 3PW7A 4ZPBA 5KFEA 5KFCA 2VA3A 3T97A 3VMXA 1K1SA 2OPPB 2E42A 3DM2B 2AX0A 2IM0A 3T5HA 2J6TA 1S97A 3M91A 5F8HA 1TKXB 3TVKA 5DQHA 5JUMA 4NLXA 3TAMA 5KG7A 3JYTB 3QZ8A 1GD2E 1CI6A 4MIAA 3LP0A 1JLBB 3V6JA 3LP0B 2R2TA 4IH6A 4ZVHA 3I0SA 5APQA 2YNIA 4ID5A 3A2AA 4F4ZA 2YNIB 4C46A 4WE1B 4B86A 4ECUA 2ILYA 1IKVA 1RYSA 3MF5A 1J5OA 1LW0B 4KHXA 4ZPAA 4ICLB 1SUQA 5CYQA 1YYCA 4JV1A 3HE5A 4X2BA 5AW3B 3HE5B 3FDSA 1T2KD 3DRRA 4O4RA 4PWDB 5KFVA 4KSEB 2BQUA 4K4VA 5AW8B 3NMAA 3VMZA 1TL1B 1HMVA 3QIDA 1DLOB 3M9BA 1FOSE 4TYAA 2AU0A 4NLYA 1ZTWA 2VA2A 3V4IB 1G2CB 3OL8A 4I7FA 4GT1A 2V4QA 4Q43A 2GIRA 3VYIA 3TQ1A 4J9MA 2XI3A 5KFSA 2BE2B 4DL3A 3PR5B 5AW0B 4O3PA 4FBTA 3DOLB 3DOKA 3V4QA 3UDLA 1X8YA 3MR5A 4DL6A 4MIBA 2W9CA 3V6DA 3D5MA 3G6VA 4URSA 3NMDA 4EYHB 4WYLA 2QE5A 4ECQA 3HVTA 2V4RA 5APVA 2W7PA 3GIJA 5C24A 1IKYA 1LW2A 2ZFCA 3OL9A 3IGNA 3PW0A 1S0MA 2E9TA 1BQNA 3DLKA 3CJ3A 2FVQA 3BQ1A 3DLKB 5AVSB 2HMIA 2IM2A 4IFYB 1U09A 5APWA 4ED0A 1A02F 5KFHA 5AW4B 2WPQA 2QM8A 4JUZA 2XGPA 3LIEA 2HWIA 4MK9A 3SWFA 3CDUA 2FLNA 3OSPA 5EWEA 1I6JA 1OWAA 5I42B 3P32A 3FQLA 3I5BA 5AW2B 1QE1B 5APSA 1TV6A 5APXA 4J9OA 4RW7B 5DG7A 4XPEA 2J6UA 2RF2A 1S0NA 4K4UA 4K4SA 4Q0BA 5AW1B 5AVTB 2Q7CA 1XR5A 3T5JA 2HWHA 1NHUA 4I2QA 3MFHA 2IA6A 3EPGA 3MR3A 5KFAA 2WONA 4ECXA 1D1UA 4RUAA 2IPPA 4EOTA 5HP1A 2Q3IA 2YNFA 2FLLA 3Q8QB 4ZVGA 5HP1B 2YNFB 1FK9B 3A3YB 3NL0A 5EWGA 4URQU 2XI2A 4ZP8A 2RDJA 3I0RB 4KBIA 1FKPB 3IGVA 1RT3B 3PZPA 3BSCA 4YQWA 4XO0A 4FBUA 4J9PA 3HE4A 2IM3A 3HE4B 4YP3A 2AGOA 2HNYB 2JEFA 4M95A 2YO2A 3KK2A 4RUCA 2Z5HA 3SFUA 4EYIB 4G1QA 1S9FA 5EUHA 1SH3A 2CKWA 4G1QB 2OH2A 1RTIA 1C1BB 5F8MA 2BQ3A 2W6AA 3H98A 2BR0A 5AVWB 1JLAA 3CDEA 2JC1A 1HNIA 2Q5UA 4KO0B 4RW6A 4RW6B 1S9GA 2QM7A 5AVVB 2YNGA 3OSNA 4M94A 2R2SA 3C6TA 4KV8B 2GC8A 2DPJA 3MD0A 4PUOA 5JXSA 3NFQA 1RT4A 1HUCA 3IS9A 3OAKA 3UIAA 2YNHB 3QIPB 5FDLB 1SV5A 5C5JA 4O44B 1FKOA 1FKOB 3T5KA 4JV0A 4HKQA 3LAMA 1EP4B 2YO3A 2R5DA 2XWYA 3DLEA 2WPRA 3DLEB 3RB6A 1FAVA 1KHWA 5CYMA 5C42B 4ECSA 4QW8A 4DL7A 4QWCA 3JSMA 3JSMB 4J9QA 3EZUA 2ASJA 4NLVA 4IDKA 2WWWA 1T03A 3I5AA 3GV7B 3DLGB 3CJ5A 2OPQB 4WZQA 3D28A 2AX1A 4IRKA 1RT1A 2BASA 3KK3B 4ZP6A 4H4OA 1JIHA 2ATLA 2F8EX 4QWAA 3IR9A 4LSLA 1GZLA 4LSLB 1S1TA 1RDRA 4URGA 1S1TB 4NCGB 2XCAA 2D3ZA 2RKIA 1HQEA 5F9LA 3MEEA 2FVRA 2ZD1A 3Q8RB 4RW9B 3T5LA 5I3UA 3KMQA 1S9KD 3TK1A 3L37A 2R8IA 1BQMA 2FVCA 3QGIA 3VQSA 3QO9A 3LP1B 3CWJA 1TL3B 4IG0B 1H89A 3NAIA 2JEJA 3RAXA 2WTYA 2W9BB 1HYSB 1KLMA 2I5JB 3N6MA 1S4FA 2UUTA 1KLMB 3H5YA 3M8QA 4K50A 5F8NA 1C0TB 1JLEB 2RDIA 4RU9A 3NBPA 4ZHRA 3V6HA 5KFQA 5F8LA 3N6NA 3GIIA 1JKHB 1IO4A 4Q45A 3M0AA 3BREA 2B5JA 4O3SA 2B5JB 4J9NA 5C25A 4J9SA 1GK6A 5F8GA 4I2PA 1JLFA 3RB4A 1JLFB 1TQLA 3FRZA 4WXWA 2BRLA 3BGRA 2BRKA 3TAMB 4NYZA 1VRUA 1CI6B 1REVA 1VRUB 5K14A 3FQKA 5K14B 2XCPA 3KOAA 3OLAA 4U7CA 3I0SB 2V0NA 2OPSA 2DPIA 4ID5B 1DTQA 4TQRA 3H4DA 1DTQB 3CJ0A 2YNYA 1IKVB 4FS2A 5APUA 1JNMA 1JXLA 1J5OB 5KT4A 1TKZA 5KG2A 3G86A 3A7OA 1IKXA 1SUQB 5CYQB 2P2UA 1TVRA 1Z4UA 3TYYA 1TVRB 1TKTA 1JLQA 1TKTB 4NLPA 3BJYA 5AVQB 1UWBA 3DRRB 3GV8B 1LWFA 2IMWP 3ICLA 5KFWA 3TNUA 4NRUA 4TY9A 4IQXA
chains in the Genus database with same CATH superfamily
1FE6A 5J2QA 4USJC 1IFMA 3H1JJ 4CIOA 1DH3A 3QWOC 3H5SA 2B56A 1M90T 1JCCA 3AE2C 1NMEB 2Q3EA 3WUTA 2IVMA 2B6AA 1RTJA 5FJ4A 1WF1A 2XY7A 2MGZA 2IMOA 3SSQA 2OYHC 4G1IA 4MFBA 4ZPDA 1H38A 2HAIA 1SQQG 1FI4A 1Q8IA 4P52A 2HFVA 3H1JG 4B9SA 2AF6A 3P96A 3MGJA 4J9VA 2DIVA 4ZPWR 2CYYA 3AEBC 3PFOA 3DRSB 1QSYA 2E43A 4A4JA 2ZUGA 4W90B 2E74C 1U1MA 1AJYA 1WSRA 4EEYA 4RNNA 1UFWA 3B82A 1WC3A 2YQ1A 1RAJA 4KJIA 3BZQA 1PCAA 2MXYA 4E2FB 2ITAA 4YY3J 4YB6A 1KBRA 4NLWA 2CQ2A 5DQIA 3AEDC 3MEKA 1SH2A 2HNDA 1FRXA 3PEHA 3FFIA 2IBZI 2XV5A 4M8LA 2IBZG 3HVAA 5AW9B 5J1NA 3NGTA 1GK8A 3MEGB 3HHKA 4OZ0A 1SFCB 2KSEA 1RTDA 4F3MA 4GKGA 4EK2A 3EFFK 1BE3D 3QGGA 3ZTOA 2VKZG 5L1IA 2OAUA 1WACA 3KUGA 5B0FA 2G4BA 2BCCD 3K5PA 1FS0E 3WIVA 2QEXS 2C9NY 1X4DA 3GLMA 4USMA 4AYCA 2PEHA 2GVDA 3B8HA 4GRSA 1FDMA 4DPXA 1T8EA 1J2JB 3D6TB 3KLGA 4PD4E 3IBWA 1Y7PA 2KH9A 4O3QA 1NTKK 4W80A 6FD1A 3RRGA 3KLHB 3CPWO 2LQJA 1QVFR 1VPCA 3TZWA 3CULA 4QWDA 4ECZA 4PABA 1R27B 2IPOB 4NYPA 4A8QA 1NK7A 5LSOA 4MK8A 3GMGA 3MUTP 4BWMA 3AEAC 5RUBA 3H8YA 3KQGA 2QZ8A 1LWCA 3M6WA 1RKJA 1U2FA 3GHGA 4ANDA 3KHHA 4WY4B 2B4PA 4F67A 4K59A 1YGYA 3L75J 3ZXWA 4LF2A 1UMJA 5H9FK 2N3LA 3MM9A 2EFVA 4KQZA 2BXJA 4ZCMA 3AD8C 3H1KD 1C1CA 2C9LY 3FMBA 1JNRB 1KONA 4LQ9A 2FYZA 3TJAA 5B7WA 3GIMA 4D6TE 3VP8A 1RTIB 5KAIE 3L75G 3IR7B 4EO6A 4ED3A 2F9JA 3OW2O 4B3SF 2BOPA 1SQXD 4DV1F 1NHVA 1DTTA 3GJSB 1JLAB 2EKYA 1HNIB 1RQUA 2MMYA 3NS7B 2ZWOA 3N5BA 3VMYA 4JP8A 3CCEP 1L3UA 1S9GB 3TO8A 3CJ8A 1F60B 2PDAA 2CPBA 3Q5SA 2W27A 1TK0A 2ILZA 3ENVA 4LT6A 3M06A 3H1ID 1QM9A 3AODA 1FFWB 2IBKA 3KLIA 4QMAA 3GIRA 1R6VA 3DI6A 3H2UB 2J58A 3E2EA 3TZZA 2VQEF 4U7UD 2QJKC 4LFAF 2WVCA 4C0HA 1VQ8P 1IQZA 2DIUA 4C2MA 1W2BR 4O3RA 1CSBA 2PIIA 4LRFA 4OYZA 5U47A 5KG1A 5J2PA 3ABVC 1Y3KA 4TKTA 3WZ0A 3K5MA 1GMJA 3SYZA 2IRUA 4LSZB 1CQMA 2YKOA 3LPYA 3PX4A 3G8TA 4I6AA 4KC5A 2Z2ZA 3H5XA 2QSFA 2RJZA 1T03B 5LMNF 1OY9A 1UVIA 8ATCB 3K0JA 4HI2A 4PV1B 3W8PA 4J91A 1RT1B 2H54B 1GT8A 1NPKA 4AFFA 2ZNZA 2M2BA 1NSQA 1N56A 3PLNA 2DW3A 2L3MA 3I9ZA 2V50A 1UTAA 3TR5A 4DR7J 2F5GA 2DNRA 2P5VA 1S77D 4NXNJ 1GXLA 3HD7C 3DGPB 1NB7A 1LWEA 1HQEB 5IM0B 3H5UA 1UEUA 1CULA 1OJ4A 3LGNA 1FTCA 1I94F 5I3UB 2XDJA 3W63A 2G1HA 2YKMA 4JI1F 2R3SA 2QVAA 4BC7A 4N56A 1MN9A 1U8SA 5CQGA 3BRVB 1JLCA 1IVZA 3KLFA 4PWWA 2PP6A 2W25A 1VQSA 2QA2A 4ED4A 5DDPC 3BO2A 2YPZA 5APTA 3CB4A 3IRXA 1CZQA 1F3FA 2MQNA 2GHVC 3J7YI 1PILA 3RJMB 3SMZA 4DPOA 2MJUA 2M0BA 1R43A 2VG5A 1ZTTA 2L9NA 3OTOF 1ROFA 5F0WA 3OUYA 4JI5F 4DJGA 5DETA 2UVWA 4I4BA 2DR7A 2B4OA 2E5YA 3N7NA 3A0HH 2JC0A 2HG5D 4NLTA 4MKAA 2LQBA 5C25B 4F4XA 3Q3DA 1UVKA 5DJUB 5A0YA 1ZP0C 5BR8F 4I2PB 1BHNA 4J9RA 2JWDA 4LF6J 2V2QA 1RF0C 2OPPA 1PAEX 2V6AA 2D1CA 3PW5A 3ZO7A 3DM2A 5HSPA 2GMHA 1ZR2A 3DDKA 1LWUC 1DFDA 3RBZA 2GV1A 3KZIH 3O8ZA 1SQVJ 4I0WA 5CD4H 1X9SA 3JYTA 3RL0D 2OPSB 3TNVA 2WPVB 1NJZA 5B0CA 1JLBA 2HW3A 2IA0A 1WG4A 5H2FH 5EGYA 5L1LA 2VB6A 4OH8B 1QVGR 5DG9A 3I4HX 1GL2C 5F8IA 4U95A 2K88A 1TKZB 4DDFA 1SQVG 3MFIA 3E01B 3M9OB 2IX7C 3CCJP 2XS2A 4NOHA 5KFMA 1HNVA 3L72J 3BS9A 1J5EF 2AW0A 4GVBB 1JLQB 2ZZTA 1U1LA 4PG8A 1T0TV 2E7XA 1AW0A 2RE1A 2VC0A 1ZAXA 1FBMA 3D71A 3NTNA 4DSFA 3I31A 4TU8A 4GC6A 3OXLA 2XB2D 3M9NB 1NK0A 4ZKAA 3M32A 1VQNP 3L72G 2O01C 1XR6A 1SQXK 1KTVA 3ILLA 1M5SA 1S9EB 3LW5C 1RAIB 2JLEA 2WW4A 2Y0EA 4U8YA 1CSJA 3P3DA 1TL1A 4HTJA 1LT9B 2QL9B 2N3OA 2FZGB 5C2CA 1F2GA 5GAGI 2HVHA 3PX0A 3B54A 2HS4A 2Y0BB 4NYOA 1BE3E 2MPUA 1SI9A 4B3RJ 2RAQA 1Y11A 3K5NA 2P1JA 4QPXA 2YIUB 2ZDOA 3NS6A 3V4IA 2KT3A 1HA1A 5KLIC 3M2VB 3P5TL 3KK1B 1XMOJ 3MM6A 4U7UK 2GW8A 3L95X 5AXKA 2R2UA 4RUBA 1HQUB 1OO0B 1JNZB 4TLRA 1RAAB 1HHSA 2KK7A 3DOLA 3PXGa 2GS8A 1YI2S 4IL6X 2AXTE 2B8QA 2L08A 2MSSA 3BCCD 5L1JA 2Z30B 2ZUAA 3B5NC 1JJCB 2WZ1A 1VYAA 3KDPB 5FD1A 4LSNB 1MKMA 3ZZPA 1VQLP 5M2UA 2NXJA 1S0OA 7FD1A 2PD1A 4L3NA 1H8AA 4ZLPA 4CDIA 1HGZA 1RU1A 3ISZA 1SQPD 1VLOA 2M5AA 5AVUB 3BN7A 3CO0P 4QYZK 3EGWB 3DRPB 3SIPB 4OI6A 1VQ7S 2J9DE 2NSBA 4JI8J 4DLEA 2ZOMA 4TXSA 3CE8A 3H1KE 3K8WA 3CD0A 3OJAB 1RWOB 2POHA 3NXZA 1FDDA 5AVYB 3G8SA 3U1AA 4NCBA 2E44A 2WOMB 1ZM4A 1RA7A 3R3TA 1WD6A 1EHWA 2C2MB 1O8BA 3SCLE 2DRDA 5LL6d 1UETA 2G9OA 1YHQS 1JY2P 1B7YB 1SQXE 2HR3A 1QE1A 3D3BJ 1LKZA 4NLDA 3MP7B 4DUYF 2AGPA 2DR9A 5HVGA 3J7YU 3FXEA 2ZBPA 2IC3A 1CS4B 5B5EH 5CD4A 3K59A 1KRPA 2GHWA 2ZH4A 2B9EA 2NPSB 1U57A 4Z7CA 1YJ9S 2LXIA 3KHGA 4FNHA 1H72C 1HPZA 2JJLA 2LEPA 1PGPA 2Z4EA 2PEBA 2WQYC 4MKVA 2MZ1A 2ZT9D 2WVBA 2V68A 3GILA 3I0RA 2O1PA 1Q7YT 3RL0g 5J1EA 3CCTA 1IR1A 2CQHA 4QR0A 3TA0A 2BQRA 2MQQA 2CFXA 1FVQA 3NP5A 4K4WA 1HD1A 4WFBQ 5GTHE 2B7BB 3RK3D 3PHLA 2UUBJ 3SFGA 4DL5A 1AXQA 3U59A 1V3ZA 5CZVA 2G0JA 3TUPA 4IFDK 1RHJB 1HWKA 1RT6A 4ENOA 3CWBJ 1Z2LA 2HLOA 1Q95G 1JY3P 3G6EP 3PDNA 2RU3A 1R0AB 1CEZA 1WG1A 1YBAA 1V3RA 1RA6A 1WUUA 1N7SA 4QIWD 2OUGA 2DNOA 3PTZA 1QDUB 3MPWA 4ZMDA 1RU2A 4KHRA 1HW8A 3OQ2A 5BJRA 3M30A 1YQ4C 4OI2A 4XDDA 3KLEB 2N7YA 1U1KA 5BU5A 2G1DA 1ZXGA 3CWBG 3VAJA 2AQ4A 1RXOB 3QBCA 1A02J 4F7VA 2AXCA 1PV3A 3G9CA 3TYTA 3ZC4A 4NA2A 3I6PA 4S0MA 1YKWA 2XZDB 4RW4B 1T05B 5KT6A 1H0TA 1M90Q 2OYHA 1PBAA 2KUBA 4I6WA 1K9MT 4EZ6A 2WT7B 3QIPA 1NAQA 1S12A 2DCUB 4F3QA 1KOOA 2KJVA 2ZEJA 5GAGU 1M8OB 2GFFA 5ETVA 4DHVA 1MMNA 3VALA 1EP4A 4J7CA 1X31C 2IIHA 2HLUA 1QSSA 1VIOA 2DB1A 3LQVA 3WX8A 1K44A 1FZEA 2YX1A 3CSKA 5CA5A 4LC1A 5BXIA 4C9DA 3CCRS 1MU2B 4PZVA 2C3UA 3P45B 4QU7A 3I9V9 3CCSS 5IT4A 3U1MA 1S5LE 1EDJA 2B9YA 3UVJB 5A8RB 2RD5C 3NGDA 1ZAWA 3K2YA 1EDLA 1T9UA 5KFZA 3RZAA 1K1QA 2J9EA 5DLGA 4J9LA 4XPCA 1JLGA 4CO0A 2AMCB 1Q0NA 2NXEA 5HQMA 3DHXA 4FVMA 4NCGA 1U02A 1L0LJ 5AW5B 4DV5J 1Y3JA 4Y2IA 3UD4P 3VN0A 1RE3C 4RW9A 4X66J 3HCXA 2IFNA 1X9MA 4YR0A 5GTIH 3HXMA 1WOSA 4J5OA 2ZC3A 1N36J 2Y9YA 2BJEA 2NLWA 1SQPK 1S57A 2R3VA 4KPCA 1QVFO 3BBBA 3LP1A 4P75A 1L0LG 4O0NA 2ZM6F 1UW4A 2QA4P 1NK9A 3H2LA 1X22A 3MPUB 1CC8A 1NK8A 3IAS9 3B4MA 1RUSA 4KGKA 2IZ0A 4DMZA 4R8UB 3QLHB 3GR1A 2JEGA 3K17A 8RUCA 3P8MC 2NXNA 2UVUA 3R2CJ 1P9QC 2RH3A 4CO3A 1X5TA 3F89A 2MKSA 3NCQA 4ZPBA 4TLQA 3T97A 1K1SA 4ZCIA 2HVDA 2PGDA 4L6V3 4UW2A 2Y8WA 4BCAA 2IM0A 3T5HA 4CLFA 1S97A 3M91A 1LOUA 5I3PA 1M0SA 4ZITA 4Q7AA 4QR2A 1NK6A 2L91A 5KG7A 3EWGA 1GD2E 1WHVA 1HBUB 2YKPA 3FCWA 3MIWA 3LP0A 3V6JA 2DH7A 2R2TA 1NRKA 4ZVHA 2CPYA 4LFCJ 1FJGJ 3KXDA 2RN0A 3CC4P 3JAMY 3HHLB 3A0BH 1NJIT 2I1JA 4ECUA 4B3TF 5HMWA 1RYSA 5HO4A 3KUEA 1H3DA 3AQOA 3BCCE 1P1LA 4KHXA 1DY3A 4DZDA 2UUCJ 3HLUA 1S0VA 2XNRA 3HULA 1S99A 2M3EA 4HHUA 1F5BA 3OXGA 3NGUA 3FDSA 1T2KD 3LPEA 2NPFA 4Y0FA 1HW9A 2FHKA 1SQPE 4KGVB 2XMAA 2F4VF 1T11A 2XEXA 3EDRB 1RAOA 2KM8B 1SJQA 3BR8A 3AB2B 3WQPA 5AW8B 4A48A 1U25A 5G0RB 3AOBA 1RK8A 4USIA 1KDNA 1HMVA 2KHCA 2HBRB 1OX3A 1DLOB 1P9YA 1VQ6S 2O01H 5K5MA 4YHHJ 4FF2A 1U1PA 2VA2A 2E1RA 1Z56A 3LW5H 2MY8A 1UZDA 3EGVA 4Q43A 2BJ7A 2A3JA 2XY6A 2UU9J 4CRJA 1FNMA 4FYXB 1U7LA 2O66A 4W7ZA 3TQ1A 4J9MA 1SQBJ 2Z0GA 2N1TB 1N33F 4H44C 3ADAC 2OMOA 2KYZA 1YX2A 5AW0B 4OJ1A 2C1EB 2Z2LA 4C8KA 2QLBB 2KL8A 3ZTRA 1IK7A 1KQFB 2QYCA 3N9UC 2A1BA 3KTQA 4C98A 1U0SA 1HI1A 2YKAA 4MIBA 5LMUJ 4OX9F 1AUSL 1NU1G 2FIUA 3KG4A 3NMDA 2DO4A 2YH0A 3HD7A 2WMMA 4PV1C 4V19X 4UY85 1SQBG 4HL9A 5D8HB 3HVTA 3VAGA 3W5ZA 2W7PA 4L3KA 3GIJA 2R7VA 1IKYA 3B4DA 4DR2F 1LW2A 2B51A 1WWHA 3IGNA 2HPCA 3PW0A 1S0MA 4AD6A 4DFJA 1CJTB 1XNRF 2E9TA 4J9UE 2FHMA 3CJ3A 3DLKA 5AVSB 4DSIA 4O23A 1SFCD 2DITA 3RK3E 1NBEB 1VQNS 2X7IA 2BV3A 2EG2A 1YG0A 3TF5A 3R4YA 2V8DA 3C16A 5AE1A 1DD4A 1GEHA 1Q78A 1I6JA 3L74G 3HD1A 2CPDA 4NI2A 1GTEA 3FQLA 5AW2B 2FFDC 3IFEA 3L9ZA 1TV6A 1S3JA 4EU0A 1KLNA 4XPEA 2J6UA 9ATCB 2L41A 1M1JB 3PYGA 2FYUJ 3O6QA 4EFAC 3RK2B 1AYEA 2N9YB 4MT1A 4LBPA 3GYGA 3AOAA 2HWHA 2RUGA 1Y5IB 1RF0A 3L3CA 1KB9H 3MM8B 1U45A 4CLWA 4P7VA 4ECXA 1QVGO 4DXLA 1WC4A 3CD5A 1LWUA 4EYYQ 4EOTA 5HP1A 2YNFA 2FLLA 3P5BP 2FYUG 3MM5B 3MPVA 4WY4D 1N34F 1RQVA 1U0HB 1OW6A 3TGUJ 3NL0A 4URQU 4P74A 3Q2YA 1S76D 1AFIA 5CCMA 3MI7X 1AV1A 3IGVA 1JK9B 3ILJA 4DFMA 4DT0A 5D77A 2JH3A 3HJVA 3L7UA 5ETMA 1GL2A 5B66H 2RU9A 2LP4A 2QTWA 2OEMA 4J9PA 3TGUG 2H5IB 2HNYB 1AVOA 1R7IA 2JEFA 2I8DA 4M95A 2GJ2A 4WJBA 3SFUA 4EYIB 2D2CD 2UZAA 2CKWA 2OH2A 4ZVOB 2H4YB 1TAQA 1TL4A 2BQ3A 3R5AA 5BU8B 3H98A 3GG1A 1VQ9S 4Y65A 3GW6A 1RI7A 1AZSA 5AVVB 2YNGA 1AUDA 2MLYA 2KZIA 2DPJA 1REGX 5H9EJ 5GMDA 3NFQA 4OHWA 1URRA 3F0NA 1HUCA 3MMCB 4YFUA 3L71D 2J5UA 1QEXA 5FDLB 3D2WA 3C1LA 2E75C 1UVLA 5JVGQ 3OA7A 3V2NA 1FKOB 2BW2A 1LT9C 2F63A 1ZR4A 2YH1A 3Q23A 3PYFA 2ZYAA 3NGSA 4AQYF 3A1YG 2NQPA 2WPRA 2FJDB 1L0NJ 1KHWA 1EZVI 1EZVG 3JSMA 1EX8A 3EZUA 3B5NA 1H7XA 4IDKA 2MZRA 1T9TA 3GV7B 3CJ5A 2YTCA 4KHPJ 4DZ6A 3PRJA 4DQSA 4X4VA 1FRMA 2P9GA 4PPDA 4IRKA 1FEEA 1VHIA 3G6ES 2ATLA 1L0NG 2B8PA 3IR9A 1PYOB 2A10A 1IBKF 4LSLB 2JWAA 1RDRA 2MZSA 3QATA 3WDOA 4USTA 4QQBA 1TAUA 5F9LA 3TI0A 1RAEB 5HN0A 2ZD1A 1CW5A 3CF5Q 4Z1MH 5LJ3Y 3R5BA 2W4CA 1IFPA 4I67A 1K8AQ 4A47A 4FN5A 2FVCA 2KDOA 2HQ3A 3QGIA 3QO9A 1UFKA 1R0CB 3CWJA 1ZW0A 1TL3B 1NZ8A 3US5A 3UE2A 3NAIA 1S79A 2LYVA 3MMBA 1SJFA 2W9BB 4B3SJ 1O51A 1HYSB 1KLMA 2I5JB 2DVIA 2NZ4A 4DV1J 1JY3N 2BEZF 3S1TA 2UXDF 2HS3A 5F8NA 1JLEB 1U2RA 4ZHRA 3E1RA 5DO2A 2RHSB 5KFQA 3GIIA 3BB5A 1IO4A 3QT6A 1S7HA 1IFJA 2W6BA 3EE3A 3UNGC 2E1CA 2KG1A 2B5JB 4ER8A 2GA1A 3IR6B 4DR1F 4J9SA 1GK6A 5CCGD 3R2DJ 2NPSC 1JCDA 5HAOA 1KTMA 3M1VB 4WXWA 2VQEJ 1ACMB 4LFAJ 2O01J 4ERDA 1Q7YQ 3IN6A 3PP5A 3TAMB 4I1TA 4NYZA 1VOMA 1NOHA 3TUJC 1CI6B 1REVA 1VRUB 3LW5J 3FQKA 5K14B 1HGVA 3CXHI 1ZM9A 2W24A 5EX3A 2CPSA 2O3JA 4XA4A 2V63A 3TGUD 4LF5F 3MAAA 3TJ8A 1DTQA 3SQOP 5LMNJ 2BJDA 2QN6B 1X9WA 4R0JA 2RNEA 3AA8A 1HBOA 3JXOA 3OR2B 1J5OB 2H5JB 1B64A 2VBXA 1X9VA 2EFNA 3DLLQ 1DHMA 2QA1A 2P2UA 1M5HA 2NYIA 1TFYA 3QRQA 1VQKS 3TYYA 3A0HE 3MHVA 1VQPP 2QA4S 4N41A 4USHA 1TKTB 1WC0A 5AVQB 3DRRB 4ETZA 4F0HA 2I1KA 3N0VA 2NZ2A 2P2CB 3S8SA 2KB7P 4H13B 4V1Ak 1ZRTD 3ICLA 5KFWA 1I94J 3FBBA 1N0VC 4CWBA 2I8EA 4PXBA 4CYUA 2ATCB 1CLFA 5TISE 1N8RQ 3CLQA 1HBNA 4JI1J 5CCHD 1PYSB 2B0GA 4KR0B 2ZVOB 1K9MQ 2QRRA 4A8WA 3FKBA 1SC6A 5HROA 1L0LE 4YTPC 2EVZA 3W5XA 4NZ0A 1URQC 1Q5VA 4M3LA 4I7FB 5F3TA 3KJVA 3OTOJ 2HRTA 1UVNA 4JV5F 5L38A 3GFYA 4JI5J 1BE4A 2W01A 4O4GA 3EMTA 3DOKB 2Y9ZA 4ES3A 4ECYA 3AJ1A 3DRSA 3A3NB 3BVHA 3FWNA 2W9CB 3NY0A 4NRTA 2DRAA 4UOCA 3ZZ0A 5BR8J 2PI4A 1RJJA 2C2KB 4LF9F 3KJFB 1L4AC 2LFVA 3JQKA 2RUSA 1VQ4P 3DMJB 1PJ7A 2CNOB 2BANA 1F9EB 1O6XA 1VGYA 1MWQA 2QJYB 2BMBA 1QLNA 1RE3A 1VRQC 1VQOP 1TELA 3ET6B 1AB8A 3ISND 4LGDE 1LT1A 1EETA 4RNMA 2HMIB 4DX5A 1SKUB 1DRZA 2VG6A 4PG5A 3CVKA 2FLOA 4NPDA 3HVWA 5LXRA 1X79B 3W3SA 1IC2A 2FYXA 2KZZA 4N77A 3VOPA 3PJSK 3FZBA 1T94A 1QAIA 5K8OA 4OYOA 2DYAA 3MEGA 2ZE2B 3OXFA 1RTHA 2WSFC 1NJWA 4HYKA 1J5EJ 4DEZA 3PEJA 2KS1A 2ZDPA 2RF2B 4U6PA 5ETTA 4Q0BB 3MR6A 2KZMA 4UOHA 2DEJA 1FFSB 3DU6A 3R97A 4ELVA 1WKLA 4DL2A 1ICEB 4XIUA 1NDCA 1NDKA 3SDEA 3CC2P 2C2NA 1NH4A 2JFKA 2WONB 3LTOA 5DLFA 5CJ0A 4FKYA 1QUVA 2NPIA 2NSCA 3KLHA 3PRVA 4DPYA 4FPIA 3DFEA 3L71E 2KG0A 3RBEA 1S1WA 5KKZC 1KFSA 4ILRA 3WUVA 4OHZA 1GX5A 4FZVA 2OD4A 1RACB 2W8ZA 3G9RA 1GW4A 4PQUA 2VPXB 4DS5A 1TK8A 1EQ7A 2GIQA 3MTJA 3QWPA 2IZ1A 3TA2A 3P7KA 4YUDA 3M2UB 1OY6A 2HG4A 4ZNCA 2CPHA 2ZKUA 1SJ4P 2DK2A 1T6AA 2W1BA 3QGHA 1P84D 2OFGX 4U3FJ 2VV5A 3KK2B 4P2XA 4GMKA 3GYNA 3RB0A 1JMMA 3I55S 4NWBA 2V4HA 5B5EE 4B3OA 4AL7A 2C2ZB 2ZH8A 4R5PA 5K20B 1S6PA 2P6SA 4ZVQB 1N0UA 4R25A 4JV2A 3KLVA 2WRMA 2IM1A 4CLZA 1T7PA 4U3FG 5HMZA 5HLFA 1MLAA 2MLXA 2OTJP 1D09B 1N54B 1C4CA 5D3GB 4Y2KA 1BGYJ 4OZJA 2GGPB 4IRCA 4OL8A 3IS9B 3RRHA 3L73G 2VG7A 4DCKA 2UVVA 1QY7A 4N5SA 2Y3YA 2RS8A 4UB8H 1PBUA 3OL6A 1S5LX 5EWFA 4AQRD 4LF6F 2XBPA 2GJFA 2JSXA 1FRJA 3PYEA 4CLYA 2AKWB 3BF4A 4X4PA 4IKAA 4DUYJ 1IJEB 2WB1D 3DYAA 1N6QA 1N32F 5KT2A 5CYMB 1RYRA 2Y0CA 5LXYA 4K7QA 3VR1A 1WHYA 1S6QA 1KQSR 3S4RA 4RX6A 3ZZYA 2IFXA 4B3MJ 3HP6A 3PHEA 4ED7A 2VRSA 1B4SA 3W64A 1VRTB 3BQ0A 5L1KA 3H1LJ 2VQFF 3V2RA 1Q8KA 3CIMA 7AT1B 3GJTB 4AT1B 3H1HJ 2ZITA 2CA9A 1FE0A 1B0TA 2WSCC 3GLJA 1FD2A 3C66A 4YB1P 1YQ3C 2O1JA 5D15A 2D9OA 1H74A 2ZOGA 2WSSH 5ETQA 5LSLA 3SZ2A 3TWZA 3H1LG 1R89A 2J5AA 2RKIB 2LDYA 1XEZA 3PKMA 3RB3A 3HF5A 2H89C 2QG4A 3TGUE 2FPHX 5GMKa 5DDRC 2WCXA 2FVSA 1MFTA 2FFDA 2WK4A 1QLED 1IJDB 2ZH1A 3QT5A 3BSNA 4GKJF 4IFVA 1KC8T 2Q1LA 1GXUA 3MECA 1TL7A 3CD6S 4KIAA 2EPIA 2Q6CA 1WTBA 3M8QB 4Y99B 2Z2MA 3DN9A 4KH1B 3NBPB 2FGCA 4W4MA 4G6VB 2GVZB 1IBMF 4RR5A 3HUSC 5KT3A 2HQGA 1ZRTE 4KTQA 1B99A 2AJ2A 1D0EA 3RBXA 1IKWA 2IYGA 3IAOA 2OP5A 2FY1A 3BPDA 2DNMA 4QIFA 1TU3F 2OTLP 1KVJA 5AJ3F 3CIZA 3CJ4A 2J8AA 2F65A 1FZCC 1D8ZA 1IUJA 2RIJA 2CQDA 4A46A 3BGRB 3CNQP 2H3EB 2X1FA 3KNAA 1TKXA 4KGXB 3HHLD 2HHHF 5AW7B 3CDBA 3NS5A 4LRCA 4ZVPB 3P8BB 4DOJA 5KFRA 1UIIA 4N8OA 1RF1B 4C7RA 2E5HA 3PHTA 4TQSA 3Q24A 1SLQA 3MURP 2UUWA 3GSIA 2B89A 4WE1A 2GO8A 4RO0A 3MTKA 2XWXA 3E01A 3W7BA 3MOJB 1LWXA 1RT7B 3MM7A 4O3NA 2QV6A 1OQ6A 4IR9A 1LW0A 1CJVA 3EJMA 3CCVP 2EFOA 3ZNUA 2FJAB 3CPWR 5IOLA 4XE5B 4ICLA 4Z37A 5KG5A 1UWBB 1NZAA 4JYAF 3IFMA 4C8ZA 3ZZTA 1E6VB 1GH8A 3RAQA 2VPWB 3GV5B 3EPIA 4C8OA 2XU6A 4DV2F 3RTVA 4PWDA 3T1HJ 1X60A 3II6A 3U1LA 2X3GA 5J2QB 4C7NB 1CJKA 5HL7Q 4ZVFA 5KLVJ 1CBKA 1TU0B 2AJFE 4JI2F 3GMAA 1JTHA 4CP5A 2YWKA 2DRBA 1B0VA 1LT9A 3RYLA 1NJXA 5E79H 1OVRA 2B6AB 1RTJB 4IL6H 3KNGA 2MGZB 2ZM6J 3H7HB 1BGYD 3FUYA 1GDTA 1NTMD 3J7AN 3MPDA 4I2LC 4MFBB 2XMUA 3OW2R 1JMBA 3A0BE 1LTJC 2DNHA 5FLXU 5KFJA 1MMLA 5KLVG 3M05A 2CJ9A 2DR5A 2LECA 3F41A 3K5BA 2PI5A 1HQUA 3MR7A 5BYRA 4I7ZC 5BVZA 2F9DA 1J1DC 2L9WA 1BMQB 4NPEA 5F9NA 2YVSA 1NDLA 1IBCB 4EWTA 1NNDA 3UPFA 5K8NA 3O1LA 1IFIA 4QWBA 2PGCA 2XGQA 3H1HD 2LCWA 2EK6A 1QX8A 3OT9A 4B08A 2GQCA 4NLOA 4P2MA 4TYBA 2Z8QA 1RAFB 4OYXA 3FFIB 3P49B 3DLJA 4IR1A 2BKNA 2HBYB 1RWXB 3IBFB 4DV0J 4X4RA 2W90A 4NLRA 4B3TJ 1P84E 1WF2A 2VD3A 3NAHA 5T41A 3W2VA 2WOMA 5I42A 1K04A 1KFDA 2KT2A 1WKJA 3RGUA 3C8YA 2UXBF 1T9XA 2FTRA 1YLXA 2YKQA 5IT9U 2QA4G 4QZVB 2VKRA 3SCKE 1YTYA 2CJQA 4RW7A 4NLUA 5B0EA 1TR0A 1F3VA 2GVDB 5AVZB 4X4QA 2WSFH 2F4VJ 4LBHA 1OFCX 3V2QA 1S4EA 3KLGB 2NPSA 1MUUA 5A2QY 2R8GA 1MG7A 4G1PA 3T1AA 2AYBA 2D41A 1FDAA 2XMJA 3H4BA 2K37A 3D68A 3T6JA 2FUG9 2MQ8A 3HFVA 2FVPA 4KFBB 1LWCB 3GHGB 4K0KF 2B9WA 2NS1B 3IWNC 3H32A 1FKPA 4B9MA 1RT3A 4OLOA 4WFXA 1VQOS 3SV4A 3ITHB 4MKBA 4BBYA 1FOSF 2ERRA 4K4ZA 3DHWC 3GFZA 3J80U 2DH8A 9RUBA 2FC8A 4QBUA 3MM9B 5KFTA 2J0QD 2C3YA 3OV7A 1H2VZ 2DXEA 2C3PA 4P6QA 1C1CB 3G4SS 3L35A 4RESB 3GFHA 4JYBA 4OX9J 2W8LA 2QG9B 2HRYA 2V34A 3R5JB 1HNZF 1PO6A 4IOBA 3RK3B 1DTTB 4BRYA 5ETLA 4LFBF 3QFWA 1C1BA 4OZ5A 3L70J 2W2OP 3G96A 3GB0A 2DHSA 4KE5A 4DR2J 2HYIB 2KHDA 1G1JA 1S49A 4F4WA 2M3BA 1XNQF 2AZ1A 5L9NA 1XNRJ 2APOA 3FMWA 2VH7A 2YWWA 1XTGB 2X1AA 1SL1A 1JB0C 3JTNA 4F8RA 4H0LB 3AA9A 4RW4A 3L70G 3KLIB 1T05A 2PC6A 5IZHA 2OEJA 2HLTA 2PFDA 1URQA 2V8VA 4CM2A 3JCUH 2QJPC 3SBMA 2ASDA 2YNHA 2FXMA 4A8SA 5B66E 1HFEL 2P9CA 4C4WA 4MK7A 2Q1KA 3GTYX 2E5GA 3NWGA 4WFZA 2XNDH 4JI4J 3W8GA 2DHAA 5KFGA 4WVZA 4Z7YA 3BSAA 1MU2A 1NTMK 1L4AA 1PP9D 4KGZB 1RLDA 1DQ8A 1YJVA 2VUGA 3BKFA 1H2UX 4UZCA 4WP9A 4RZRA 2KJWA 2MDAA 3KJQB 1NH7A 1GTWA 2VL1A 2MQOA 3SSSA 3VTIA 1N34J 4QWEA 1AFJA 3KK3A 2F40A 1LWEB 4WZMA 1Q16B 1CULB 3PR4A 3RBDA 3CL3D 1ULRA 1NKBA 2WSCH 3GONA 1TP7A 1DEEG 2XYPB 4DL4A 1P1TA 2YKMB 4OHVA 1QD1A 2M9KA 4F0KA 5T14A 4B02A 1JLCB 1HWTC 1FRKA 3KLFB 1VF5B 3E51A 1Q8LA 1S1XB 4F26A 1SKRA 3IRXB 2R7OA 2OKQA 2HHTA 4DS4A 1O5JA 2VG5B 2N9BA 1GMWA 4YHHF 4ZMMA 4A8FA 1UWAA 5H1SV 1I1GA 3K5OA 1W2EA 2KN4A 3PV8A 4LREA 4F0MA 3CJ2A 2ZYGA 3QYYA 3OTCA 1LTGC 2CNNB 1R5LA 2KNCA 3SV3A 1JKHA 3AT1B 4DBQA 5A0YB 1YTZT 4WP3A 5K9FA 4Y28C 4ZPTR 3KYLA 4DLGA 3KHUA 5KFEA 5KFCA 2DGXA 1SPBP 2OPPB 5ADZA 4ANEA 3BGOP 4A7PA 5LMUF 2E42A 4IFMA 3DM2B 4N6JA 2AJ4A 3M2RA 3GPAA 2JOQA 4CZCA 1Q90D 2B87A 1KFNA 2MQLA 5DQHA 5JUMA 1BGYE 3D7SB 4LRDA 2KRBA 4YS2A 1PSDA 3G87A 3JYTB 3QZ8A 2DISA 4RU2A 4ZA1A 2K2PA 4AQYJ 3D6ZA 1JLBB 3BBCA 1KILD 4IH6A 1P84I 3I0SA 3OFFA 4OGQC 2GUVA 1S4XA 1HWLA 1RHMB 1GMUA 4C46A 1TMMA 2BX6A 2ILYA 2YWEA 2Q9IA 2JDJA 2GZOA 1YI2P 2P6TA 3QJLA 3VCDA 1LV5A 3IM8A 1NKEA 1HWIA 2WVFA 4H13D 2M8RA 4ZPAA 1K05A 4M5GA 1DARA 1NHLA 3V6IA 1SUQA 3KJNB 2M8DB 1IBKJ 2EKNA 4CM0A 4X2BA 4CCHA 1X5OA 3LWLA 2CZVC 3H1HE 1RKIA 2BQUA 4HHHA 2YWGA 3OJSA 4K2XA 4FKXA 3SCJE 5G0RA 2HK2A 1KQKA 2DKOB 1VQ7P 2K9JB 1JXVA 3VMZA 2R4FA 4ZCLA 1TL1B 2OTLS 3QIDA 1KTQA 4UT4A 3CCLP 1SQQJ 2HIQA 4TYAA 3SFDC 5JMNA 2PMWA 5F41A 4LJMA 3HO1A 1ZTWA 4NASA 1SB6A 1NSAA 1F1BB 1UFLA 1N5TA 4M5MA 3V4IB 1YHQP 2UXDJ 2R9LA 5AXLA 1AA0A 2V4QA 1ITPA 2GIRA 2K8GA 2W6JH 3TDKA 3VYIA 3MM6B 3M0DC 3Q1MA 4DL3A 2V8PA 2H8PD 4NMXA 1H2TZ 1ZV8A 2AT1B 2P8IA 2Y8YA 3DOLB 4NA1A 2Z2YB 3UDLA 1OSCA 3I96A 2CQPA 5IV3A 2RQMA 3V6DA 1WF0A 2HFOA 3D5MA 1D9AA 3G6VA 3MDFA 4DR1J 1YJ9P 2M3DA 5B0BA 4WYLA 3N4WA 4ECQA 4PD4H 4C11A 3S01A 1FT8A 1KKHA 3CCVS 3BH7B 2HPUA 1K73Q 1GFWB 4GVLA 5C24A 4X4TA 3S6EA 2V8HA 1E79H 3OL9A 4FP9A 5CAAA 2V67A 2M5AB 1BQNA 2HRUA 1NUEA 2LQ9A 2FZCB 3BQ1A 5EN1A 3PNIA 4TLFA 1U09A 3THVA 4LF5J 4ED0A 1RQ0A 4M5HA 2K7KA 1WG5A 5KFHA 3O44A 4P10A 4PG6A 2XGPA 3M8ZA 3JSVC 3TAQA 2FLNA 4OMFG 4PG7A 4CT9A 3E8OA 1OWAA 2EWHA 1FNXH 1LTIC 1W26A 3WC0A 2E76B 4C8NA 5DDOC 2HHUA 1QE1B 1VMBA 1Y4ZB 5L39A 4DX8H 3HUSA 3FSYA 3FWLA 5DG7A 4NCAA 4HACA 1S0NA 4K4SA 5AVTB 1FE4A 3DU5A 3LGHA 5HJYA 2XTJP 3A8EA 3A4TA 1DURA 3PO5A 1BSHA 1BCCG 2HVZA 4DV6F 3T5JA 1DJ0A 4LF7J 4LRAA 1Y0HA 1FZCA 4I2QA 5T7LA 3CX5I 2ZVSA 5ETNA 2IA6A 3EPGA 4DPTA 5KFAA 5HATA 2HZVA 2XMKA 4RUAA 4NEZA 1IXKA 2QX0A 1FA0A 4KHPF 4ILMA 3Q8QB 3WBZA 2D3OR 2AJQA 1UAWA 4I64A 4WKRA 1USEA 1N5SA 2H88C 2ZVNB 2JFDA 2XI2A 3I0RB 4KBIA 3UWTA 4M1KA 4H4KC 2YXQB 4WCEQ 1HIYA 4JV5J 4YQWA 1RE4C 3AHPA 3VWSA 3CC7P 3EQ2A 3I56S 1GNKA 2WSEC 4JBZA 2IM3A 4DUZF 3HE4B 2ZHAA 1KEKA 3CCRP 1PP9E 1KYOD 1SJRA 1WJ9A 4F36A 3CCSP 4FNIA 1XWLA 4LF9J 1UIXA 3MZIA 4P72A 1N7SB 1FZFA 3J7Z5 2A6MA 2V94A 3F5HA 1A0OB 1S9FA 3CI9A 5E3QA 4G1QB 5EUHA 4C6AA 2C0XA 3BGFA 3QPIA 4FF4A 3CJSA 1URQD 3M30B 2W6AA 1OPZA 4UTGA 3RL0C 2CQIA 3CXCR 4DR3F 2BR0A 2HHQA 1N86A 3V4MA 1HR0F 2ACMA 2IYIA 2WSCJ 1SS1A 2PSZA 1RB0A 3ZDMA 2XYGB 1W5CE 2D2CB 2VPYB 2R2SA 2HURA 3C6TA 1TFWA 3PIOQ 1XMBA 1JM0A 4PUOA 1RT4A 3MMCA 5E3PA 4DR4F 5CBOA 2OO4A 1EQMA 5JVHQ 3HFKA 1SKWA 2LXUA 2XYHB 2IFMA 1LTJA 3UCGA 1FHTA 1L4AD 4E8UA 3QIPB 2A06G 3SCIE 1SV5A 2BJ3A 2MTLA 1FKOA 5A76A 2UP1A 2ZJPQ 3J81Y 3BKUA 3T5KA 1OW7A 4JV0A 1VISA 1EP4B 2Y0DA 4DWIA 1WMKA 1XQIA 2R5DA 2XWYA 3EYZA 1SQQD 2BE7D 2E74B 3H1JD 2R42A 3F56A 4ECSA 4DL7A 2FYNC 2JO1A 4U7JA 3T1YF 1HH0A 4NLVA 3OTBA 1TK5A 2K7JA 3MWBA 4OHYA 4OV6A 3CDAA 1VFJA 1FRHA 2AX1A 3FXDA 2BASA 3HPOA 3NCPA 4H4OA 4CLSA 2Y9HA 1JIHA 1BXNA 2F8EX 1Q2NA 4QWAA 3MMJA 1RGVA 2NZCA 1NTZJ 2VFVA 3PIPQ 3IWLA 4LSLA 3FBFA 5KAFE 5EX0A 1OYDA 4NCGB 2IVFB 2D3ZA 2B88A 5IFMA 1M5PC 3MEEA 2FVRA 4DU7A 2AP6A 3HHDA 4RW9B 3T5LA 5GMEA 1KILE 3M8WA 1NTZG 3KMQA 2O3DA 1QAYA 3TZXA 1DAXA 3TK1A 3G2XA 2E1MC 3L37A 2DGVA 2R8IA 1BQMA 3BM7A 2IBZD 5D4PA 4CT8A 2F8HA 3VQSA 5DRKA 3LP1B 2C3MA 5KTBA 3D67A 2UUTA 4OX8A 1CJUA 2WVDA 3M7VA 1WC1A 1TL5A 2RDIA 3CMES 5D0GA 1BC6A 3V6HA 2XSFA 2N7CA 2Q3PA 2B5JA 4MKYA 4O3SA 4A8MP 2IDEA 4J9NA 2ZNYA 1EC5A 3T97B 2XS5A 2W2QP 5KJ7D 1TUGB 5F8GA 1HBMA 2AYEA 2OYOA 1WRGA 2CQGA 3PX6A 4K5SA 5BYSA 3CMQA 3P8CD 4B9LA 1YK9A 3QSIA 1VQ6P 4V19J 5CZXA 1VRUA 5K14A 3D54A 5GAHI 1FXRA 3TX0A 3AEFC 1RHQB 3KOAA 1N32J 1PZQA 3OLAA 1N7LA 4U7CA 2J0SD 4GOFA 4QOTA 1TUWA 2GMLA 4PYDA 3UD3P 2DXDA 1Y9BA 3NRBA 4TQRA 3CJ0A 1PKUA 5LOQA 2VF3A 2VQFJ 2FC9A 3G71S 1FXDA 5IQ6A 5KT4A 2AJ1A 3G86A 3A7OA 1IKXA 1K0VA 4OFZA 2DBBA 1U7JA 2ZT9C 2K9YA 1LFWA 4F02A 5DZ6A 3L75D 2ACYA 3EUNA 1TVRB 1TKTA 1NB2A 1KOHA 4EGLA 4NLPA 2KYVA 3R7SB 3U1NA 5IC6B 2W4DA 4WTYA 1VC0A 2NRGA 2E7WA 3QNWB 2MSTA 4CLLA 3IR5B 1LWFA 2HVEA 2MKCA 2XSJA 1PG5B 1YZ6A 3TNUA 4RLEA 3MMAA 3I4PA 4PD4I 3W67A 4WWIA 4NRUA 4TY9A 2FJBB 2KZJA 1HMVB 1UW9A 4PXDA 3LOUA 2VFTA 4GKJJ 5D4NA 3R5DA 2OD6A 4YB7A 5J2NA 4H4MA 4NXMJ 3BBFA 2B3TB 1FERA 2IJNA 4OI0A 1J2VA 4RKUC 4YOEA 2A18A 4B17A 1OZHA 5E3CA 2I1RA 2CIMA 3HHNB 1Y5NB 3AE7C 4FPRA 4DSKA 2R3CA 1N5YA 3FC9A 1IBMJ 1EIYB 2C2DA 1KQGB 3M8PB 3I82A 4OX6A 4QJVA 2O5DA 1KHVA 2HQFA 2MKHA 1D9DA 3M9MB 4K8RA 4D6TG 5AJ3J 3HD7B 1SQQK 1F2HA 4R4MA 3UNYA 3AE6C 5KFNA 3HVTB 3DMJA 2KXNB 4ED6A 2FBWC 4WFYA 2JDIH 1IKYB 4EUVA 2VBZA 2N4CA 1M57D 1LW2B 2HPCB 1JO5A 2HHHJ 1M5OC 1BQXA 2GAGC 1QAXA 3BSOA 4OJ3A 4PJ0E 4TY8A 1D8YA 3C16B 4IG3A 3SXLA 4DPWA 1NTKJ 1KYOE 5GTHH 1KQLA 2LA6A 4LMZA 1PPJG 4NI2B 3AE9C 2CWXA 2ZE2A 4NE9C 1HNWJ 3MD3A 4RPFA 4M5JA 3CCLS 4DG1A 2GQ2A 4ZIWA 4YPCA 3OJUA 2CZ9A 1TV6B 4NLSA 2KYXA 3RG6A 2LDIA 4JYAJ 2BYCA 2D7SA 5B09A 3A3PB 3O6QB 1NTKG 2A2DA 4R0EA 4J9KA 3C46A 4DV2J 1A9NB 1VQ9P 4D3HA 1YJNS 2HBQB 5KFBA 3FK4A 4B3MF 4RBVA 3HKWA 5AE2A 1LWUB 2KFZA 2RH0A 2H51B 1RBAA 3E1IA 3IM9A 2QL5B 4JI2J 4AUWA 4E0DA 3NCRA 5DDQC 1GXTA 4YB5A 2E66A 1HTLC 1JB0J 4KT0J 5HBMA 3J7A1 2Y1RI 3N6LA 4WYWA 4UUXA 2BM1A 2R2RA 4NLGA 1GL2B 3GF3A 1M1KQ 2H5EA 1KP6A 3IP0A 1SL0A 3LAKA 1RT5A 1SQQE 5GAHU 3JAMU 3H1JE 3UD5A 2GCFA 4OI3A 2UVRA 4CTAA 1EXJA 2VJVA 2ZKTA 1VQMS 3GP9A 1UA0A 2CDQA 3QRRA 2OPRA 4WWSA 1MSWD 1I51B 1LNQA 1NPPA 3GQCA 2DO0A 5CHXA 4C3MA 1SQVD 4JI7J 4AL5A 4K4YA 4IO1A 2PFFB 2VC1A 4KAIA 2BJ8A 2DR8A 2WSEH 1IWGA 2HQIA 2OYIC 2R8HA 2GMJA 1S5LH 2PMZD 1OMSA 4DV7F 2BACA 4H0LD 2WVEA 3MEDA 3IG1B 3W62A 2R7UA 1KZUB 4OI1A 1FD8A 1AZSB 2V9WA 2H9ZA 1XMQF 5D3GA 2YNGB 2ZJSE 3GCXP 2UXCF 1PL5A 3L72D 2G2OA 4ZPCA 3ZFVA 1ZZNA 4ZP7A 4ECWA 1R0BG 1RHZB 2AEFA 5KFFA 2IAJA 3HM9A 2R5BA 2IBZE 2POKA 3HK2A 3ITKA 5KLIB 2FGOA 2CDRB 4ECTA 1T95A 2YQ3A 3KHRA 2CZ4A 3QT7A 3M0DA 1T2KC 2UXBJ 2ABYA 1X0PA 4WFAQ 1VBXA 4RW8A 2XO6A 2K1RB 2C2RA 3WU2E 1VBYA 3CC7S 5APYA 4IDKB 2G2YA 1VRTA 1SP4A 1HL6A 4NLQA 2HQDA 3JS9A 2ZJRQ 4HKZH 1LQ9A 2YKNA 2L9DA 4OJGA 1PGQA 2LKMA 1S5ZA 4RNOA 5CHCB 3CCWA 1HJ0A 1GX6A 1RHUB 3D9BA 1ZETA 1BWEA 4AE5A 4X65F 2CQ1A 4M5DB 3P8CE 3VGUA 1SIZA 4GO7X 3LO3A 2VASA 1EDIA 4K0KJ 5GAEU 2ZFHA 4Y28J 2VHGA 4RNFA 1VF5D 2ZD1B 2FJXA 3R1HA 2HHVA 1JXEA 1R8PA 3MOZA 2ALZA 2VOOA 1N48A 2FQQB 2HZCA 2DY9A 5KFLA 4ES1A 3T1HF 4NPOA 2MKKA 2BCCJ 1R8CA 3UFCX 6AT1B 2CJKA 4DQIA 1FJCA 3QO9B 2BABA 1EKRA 2RS2A 1HNZJ 3DXSX 1V6HA 1X7VA 5KFIA 1NTZK 1R8HA 1BE3G 4I69A 1JY2O 1UEKA 3L75E 4EBCA 4LFBJ 1VQKP 5HQ8A 5TJHA 1DQAA 1RH5B 2HNZA 1T3NA 2BCCG 4CO4A 1XNQJ 4HJGH 4ZHRB 1WNEA 5AT1B 4N47A 1SFCC 2IRXA 2Q66A 4OYPA 1YITS 4ELTA 2WB4A 1OXZA 3R6GB 1BLUA 3ENAA 1YZ7A 3QAEA 3Q8VA 5HVHA 2VZ9A 1AROP 1I3OB 3PY8A 3FRYA 2V2KA 1FWPA 2J0WA 1V9OA 4KKOA 3C8VA 4WU3A 2E7VA 1NHKL 2AHOB 3TUIC 4ZJQA 2YWHA 4H4KA 1XJWB 5D6GA 1RE4A 4IRDA 3H1KJ 1VDHA 2D3O1 1KFMA 1REVB 4ECVA 4K4TA 3QWUA 4X62F 4HYTB 3QRPA 1C0UB 3HKZD 3BR9A 3MAAB 1MZ9A 2HYNA 1KYOI 4OZLA 1SQXJ 3RW7A 3R5CA 4YR2A 4L76A 5ETOA 1JOCA 2Z5IA 1HBOB 3H1KG 2DHGA 4OYBA 5AVXB 4USUA 3O8WA 1FWLA 4RJVA 2J7UA 1ZYQA 1JY3O 3SSUA 4WY4C 2R8KA 4DV0F 4C3KA 1NSKL 3V6KA 1RT7A 1PFIA 2BA9A 1OPIA 4HEA9 4WK3A 3J81j 1SQXG 3HJFA 3H1IJ 3BN4A 4Q8FA 3LIDA 3QZ7A 4WP8A 1XR7A 2A45H 2R44A 5F0UA 1SQVK 1SJ3P 2E5IA 2HHWA 3CWBD 1IM4A 4IOCQ 1IJFB 2CG4A 4R4LA 3A13A 4CYUB 2KLVA 1HBNB 1NTZE 3MGNA 4C7NA 3A3OB 8AT1B 1OS5A 3AY0A 3H1IG 3R6LB 4W92B 3IWXA 3F44A 2D2CC 1IR0A 1JMTA 5HROB 1L3KA 2EXUA 2C2OB 4USKA 3CXHH 4YEAA 2GX8A 2HODA 5HMXA 1YIJS 2HFED 1L3TA 4N3YB 2M70A 3KJVB 3FSIA 1VBKA 3Q8SB 3MUMP 1G2CA 1NU1J 7FDRA 1RBLA 1GW3A 1OW8A 4O4GB 4QYZJ 4P71A 2HGLA 1S1VB 1LTSC 2HHSA 2J0XA 4TU7A 2BE2A 3FBCA 4JI6F 2LQ8A 1OVUA 4NZ6A 1RT2B 3U27A 4WKYA 4N76A 4XAKA 2KP8A 1BY9A 3K8VA 1RTZA 1EB0A 3AJ2A 1FU1A 2BANB 1U6BA 3R2PA 2BKOA 1LXJA 2KU7A 1EETB 3HMJG 4DR6F 2VG6B 1JJHA 3L74J 4QU6A 2MHNA 5L9XA 3CT9A 3PW2A 3JTPA 4IFYA 2E76D 4EMDA 3SQGA 2X1GA 1IK9A 3OFHA 4DOZA 4OYIA 3K57A 5GADU 1E6YA 3EVOA 4IYQA 1RTHB 2VFRA 3PFEA 5ETPA 1MMDA 2NYHA 4RNHA 1SQVE 3I55P 1MN7A 2J7WA 2RQCA 2KS1B 1Q4RA 2WSEJ 2ZAEB 1FJ7A 1L0LD 3RU0A 3LP2B 4W98A 2MB0B 3A5TA 3V81B 2ADBA 3KKFA 3C15A 2BKPA 1WEYA 2EEYA 5JJBA 3ENQA 3THPA 4FS1A 4LUBA 5EDWA 4JI4F 2QFJA 3SDEB 1ELOA 2EBGA 2YPYA 5I4MA 4OGQD 2RT3A 3L72E 2YBVA 2KO1A 1USDA 1P6TA 2HEKA 4OI4A 3G6YA 1HF9A 5DS7A 3C19A 4ZVTB 3UW1A 3VZHA 1S1WB 1RZMA 2LXFA 3EVMA 1FK9A 1YQHA 3MTUE 3VV2B 4KFBA 2Z56B 1KN6A 4CH1A 1NK4A 1HKAA 1GMVA 2E1PA 3D3CJ 5B0GA 4LIWA 1FJEB 4PQUB 3USSA 3ITHA 4DZOA 1FCAA 4HHJA 5KT7A 3X1LB 3EX7B 2DNQA 1SC4B 2V4JA 5J2MB 1N7SD 3LGMA 1EARA 2K06A 2MKIA 1R8BA 1FRLA 3NNHA 3Q8PB 3ZTSA 4MH8A 3V2UC 5CCGC 2E9ZA 4LVNP 4I56A 2LKZA 4B3OB 1PC4A 1JJ4A 1U6FA 4R5PB 5KOXA 1M56D 1HNXJ 1S6PB 5D78A 5K8MA 2VDIA 1OIPA 1IZNB 1SCJB 4Q44A 2YXRB 1BGXT 1KD1T 4U9RA 3BDEA 5HLFB 1IBLF 1UL3A 2LLZA 2OQQA 1N73B 2N82B 4MIWA 1A6LA 4ED1A 1WDTA 3CJKA 1WSVA 4KGMA 3CJRA 4RBUA 3MD1A 4KO0A 3BGLA 4D3GA 2QJ3A 1X4AA 1V5VA 2VG7B 4F04B 4JI0F 3CCUS 1GQEA 1M5KC 3C6UB 3RW6A 4KV8A 5DG8A 1PPJE 4NMLA 1U48A 2E74D 2IJFA 3BDPA 2JVRA 1KNZA 3CD6P 4O44A 4GDOA 4H44B 3QFHA 1Q53A 4PR6A 3BCCJ 2OMLA 1NTKE 3DYAB 1N6QB 3OPKA 2HBZB 3N5FA 2U1AA 1S6QB 3TEHB 4KJMA 4DV6J 1ZOTA 4FVCA 1UKUA 5C42A 2GQQA 5CCHC 2R7WA 2YIUC 3BCCG 3DLGA 4FF3A 1SQPJ 1VLYA 1NU1D 2JR8A 2OPQA 2W7AA 1MROA 1JJ2R 4EBEA 3K89A 3B8EB 5DGAA 3ILOA 3TARA 4FYVB 3U1CA 2OARA 1SQBD 1PAUB 2F1FA 5KOWA 2WPSA 1KVIA 3VF0B 1V3SA 3W61A 4C0OC 3TZYA 1YDLA 2QSWA 1EJ7L 1SQPG 2AZ3A 3Q2TC 2CPEA 4HT7A 4P7TA 2IJRA 4DUZJ 6FDRA 3SSRA 3B4SA 2FFDB 4OX7A 3BYRA 1NKZB 4IFVB 1S1XA 2ASYA 4ZK7M 3MECB 1QSLA 1TL7B 2NXUA 3L74D 1YVFA 1HVVA 4HTIA 1KVKA 4HI1A 4IG0A 2CPIA 4CLUA 3M9HA 1ZPWX 1GU5A 2I9SA 3POTA 2C2EA 2H7HA 2XS7A 3EGNA 3ISNC 3VZIA 4DR3J 2OLWA 1U49A 1JUNA 2BOAA 1RWWB 1HR0J 3H2VE 1IWAA 1C0TA 3L36A 3D0GE 1S2EA 4JPZB 3TX8A 3HTKA 2CQCA 2XMVA 1MNEA 1OMIA 3CWBE 1IKWB 1L0LK 4U67Q 3PRDA 3VAFA 4LR7A 1S1UB 5A8WA 3OR1A 1VS3A 2A45I 2GA7A 2A45G 5A8KB 2OEKA 1CVJA 4DR4J 1RWPB 2RRAA 3VMXA 2C3OA 1HLWA 4LVOP 2FYUD 5TISH 3GWCA 1LP1A 2OSRA 1WORA 1FJKA 4OV1A 1TKXB 3TVKA 1YTZI 4NLXA 5CABA 4QYRA 3A8KA 2MLZA 1LTAC 3GSDA 4C8LA 4HH0A 1YJWS 3EZ5A 1WEZA 4FYWB 1FO1A 2W83C 1YBUA 3D0HE 3T1YJ 1ZA2B 2ZBIA 4DL0C 1O0PA 4ID5A 4RJTA 4F4ZA 2YNIB 4RKUJ 4WE1B 2FJEB 2OYIA 1P8GA 4BHQA 2WITA 1IKVA 1T3OA 1F0XA 3L09A 3HFZB 5LT5A 3MM7B 2F4FA 1LW0B 4Y00A 4X4NA 1CJVB 1WI6A 1RABB 3ZTPA 4ICLB 3Q86A 3CJTA 1UJ6A 1KILB 1RCOB 3MCSA 5CYQA 3G82B 3GJQB 3M8SA 3HE5B 3HT3A 4O4RA 2FD2A 4PWDB 2YX4A 3RR7A 3CJQA 4KSEB 4LBIA 2FXPA 4NPFX 2RRBA 2QMUB 1CJKB 2ZH6A 1HWUA 2E75B 2K9JA 2DY1A 3JSYA 4LF7F 1CPZA 2V7QH 1AQ5A 1JTHB 3KZIE 3EDQB 4WPAA 4F2RA 4DSLA 2J9CA 1AA1B 1FOSE 1VJWA 4ZOSA 1LXNA 2KXHA 2KTQA 2EG1A 2ZYDA 2DT9A 2NXCA 2BCCE 3OL8A 1MWZA 5H2FE 1Q82T 3FJ2A 1RBOB 4LR9A 4C7QA 5K5GB 5IWAJ 3HD7D 1T9WA 1F5CA 2WW8A 5KFSA 4U8VA 3CD7A 5L46A 1EZVD 3PR5B 4ZVRB 3QSYB 3IA0A 3V4QA 4WK1A 1X8YA 3MR5A 3PO4A 4DL6A 4GKKJ 2G0CA 5E3RA 3TOQA 3E7KA 1S7IA 3BASA 4URSA 4EYHB 1UVJA 3L7OA 2QE5A 2HIYA 1L0ND 2V4RA 3AOCA 4PYAA 1UJ4A 1XTZA 1SVFA 3CMAS 3WC2A 2ZFCA 3WHIA 4WBAA 3DRXA 5SUHA 3BATA 1NU1K 2RMZA 3O3LA 4DQRA 4WIIA 4CNYA 2VOPA 2FVQA 4DCOB 2ADCA 3TA1A 2IM2A 4JI3F 3ZTQA 1SQBK 4KYZA 5APWA 4FXWA 3TUZC 2WPQA 1K8AT 1SJ1A 3LIEA 5CH7B 2HWIA 1CG2A 1BDCA 3UDVA 3W60A 4C3LA 3G4SP 5EWEA 3W2VB 1B7FA 3HSZA 5I42B 2EFPA 3P32A 3EFGA 2MYFA 3DNCA 4BDPA 3VAIA 4B9UA 1SFCA 1X5PA 5APXA 4J9OA 4OZ2A 4RW7B 2ZWPA 4WU2A 3R7NB 4K4UA 4BLGA 5IC4B 4TT3H 4DQQA 1VQ5P 3MUDC 2WVRA 2DXFA 3MZWB 2RDDA 2M4MA 1RWUA 2HQCA 3M6XA 3H1IE 3MFHA 3DRYA 3C9IA 5KAKA 1D1UA 3OVBA 5HVFA 2CXEA 3CGIA 2VBYA 1GL2D 4ZVGA 4MJKA 4CLKA 3ONQA 4OYAA 1Q81T 3A3YB 4DCPB 1A7GE 2M5YA 5EWGA 2XLIA 1HHTP 2GO9A 4ZP8A 3H32B 1FKPB 3M6UA 2ROGA 1RT3B 2OIHA 3W2WB 2PMHA 1BWVA 3PTWA 3CXHD 2FYUK 1FJPA 5FIIA 4WY4A 4XO0A 3O2IA 3V2PA 3GFXA 4FBUA 3HE4A 3JQMA 4YP3A 1KR4A 3I32A 2AGOA 4CLPA 1NJIQ 5E7OB 2KOGA 3T41A 5DJTB 2A0FB 1MW7A 4EZ9A 2GHPA 4I6YA 1NU1E 2Z5HA 4G1QA 3DOMB 3NWRA 4BRYB 1SH3A 4UY8T 1RTIA 3HHLC 1C1BB 5F8MA 1GTHA 2LU2A 1SQBE 1S6UA 3NEKA 4JQ0D 2LU1A 1K47A 4PG4A 2DJWA 5AVWB 1JLAA 1HNIA 3AH6A 3UO0A 2JNJA 2Q5UA 3L73J 5G4DA 2N4DA 2K3IA 4RW6B 5E0OA 1S9GA 4KPYA 3UCZP 2QM7A 3Q0AA 3C2PA 1FXLA 3AE1C 4L74A 3OSNA 2XZTB 4M94A 1N8RT 3EGZA 3KPEA 5KTQA 2GC8A 3MD0A 1URQB 2QGFB 5JXSA 4ILLA 2CJXB 1T3JA 1VJQA 3KYQA 2YNHB 2KM8C 3L7PA 2XZWA 3L74E 2CQBA 1EAYC 2RKLA 3M8YA 5C5JA 1G7CB 3B5ND 1FZAA 4X84A 3Q2SC 4F4KA 4HKQA 2EFQA 3LAMA 2YXLA 3X3UA 4Q5VA 2W2NP 3P4UB 2YO3A 1BD6A 4ZS6A 4GODA 3Q8YA 3DLEB 1FAVA 4B9VA 4QW8A 4ETXA 2ZBCA 1L4AB 2AEJA 2GJIA 2PN6A 4PQAA 2VODA 4J9QA 2U2FA 2ASJA 4ZN3A 2P58A 1T03A 3HZGA 3I5AA 4EDFA 4G65A 2HZAA 1LTBC 1SXLA 4DR5F 4WZQA 1F9HA 3KG1A 5H9EK 1PYTA 1RT1A 5B0DA 1YWXA 2N1TC 3KK3B 1NO4A 4ZP6A 3BPSP 2B4UA 1NEEA 2FYUE 1ZH5A 2VJUA 2X3DA 2HK3A 2XNXA 2QLWA 1KB9D 5LSRA 3CCES 3A8IA 2Y1LB 4URGA 1S1TB 1ZM3A 3DGPA 2VPZB 5D0RA 1HQEA 5IM0A 3C14B 1Y5LB 3AE5C 1L0NK 1PGJA 5I3UA 1S9KD 1LGHB 1N2DC 1FWKA 1FNOA 4WTOB 2O01N 3S9OA 3BEGB 4DV3F 1K0TA 2CADA 4ZIVA 3T9ZA 3KFWX 1RHKB 2QLFB 2BE9B 2IHR1 2DGTA 2M7SA 1VQ8S 2Q43A 2F3JA 2JEJA 5MLCV 3Q5PA 5MAOA 3GZ7A 3N6MA 4NXMF 3UCUP 4DV7J 1NU4A 4BXLA 2JL9A 3CUNA 3H5YA 3H6PA 4GO5X 4OQJA 5C39A 5AXNA 2LQ5A 1G4CA 4YXWH 5A2QU 1EZZB 5F8LA 3N6NA 2KNCB 3M8RA 1JKHB 1XMQJ 4Q45A 2UXCJ 5E3AA 3M0AA 4GIFA 5KKZB 4F25A 3BREA 1U24A 4Q2MA 3QMQA 5CJ4A 4X4UA 2XULA 2E29A 2V7QJ 1YSJA 1M1JC 2XQCA 4DCJB 5C25A 3RK2C 1RISA 3BRTB 1XC9A 2E5LF 3M2RB 1ZA1B 4I2PA 2K3KA 2WBMA 4WFNQ 2DTJA 2B87B 3AFGA 1JLFB 1TQLA 1VR6A 2ZH2A 4ITSA 2C0WA 3TP2A 3OVAA 2XMTA 2OI2A 3CW2C 3EVWA 5GTIE 4UZBA 2XCPA 3R27A 1BUXA 4CPGA 5CCGA 3I0SB 2J7KA 2V0NA 3TAPA 3N28A 1FKAF 2OPSA 4DJBA 1EZVE 3H4DA 5D4LA 4OWFA 4FS2A 1JNMA 1RP5A 3VVUA 1JXLA 1LK7A 4M5KA 4LF4F 1TKZA 5KG2A 1YJ7A 1SUQB 1HNWF 2DNKA 1KD1Q 1W2BO 2V8GA 4X65J 1TVRA 4MN4C 1L0NE 4AXJA 4GVBA 1JLQA 3L4FA 4MMOA 2JJ4D 1Q7LB 3GV8B 3L71J 4DUTA 2AYMA 1S1CX 4U3FD 4WBFA 4DV4F 2IMWP 4GOEA 3IRWP 1KN7A 2LXCB 1PC5A 4X4SA 1N73C 2I2YA 1QTNB 1RWMB 4ALZA 1W7WA 4IQXA 2OELA 1FX2A 1F5AA 1S9EA 1VCTA 3L73D 1MFZA 3L71G 3PM9A 3VVTA 3T9NA 4CH0S 1SH0A 3Q22A 4Q8EA 2JVOA 2J6SA 4YN3B 2VFUA 1P84H 4KB7A 1URNA 2MZQA 4O3OA 3NGRA 2FLPA 3KUHA 5CCHA 4I68A 5J1PA 1DQ9A 4MAKA 3M8PA 2H43A 1OY8A 3M2VA 4ZLLA 3DXBA 4OZ1A 2W4PA 3KK1A 1C2PA 4BC9A 4QCLA 3V6DB 4ZDNA 3C3LA 1NJYA 4TN2A 2V5HG 4F50A 1VC5A 2VFSA 3CCQP 3CCJS 2GAHC 4OZ3A 4C11B 1B3TA 3R9LA 2CQ0A 4JI7F 4ZN1A 3DGVA 2J8SA 5C24B 2R7TA 1UJ5A 3WMM0 3AD9C 3NNCA 4LSNA 2FHJA 3SWYA 1FZGA 2EBEA 4PPZA 3PW4A 2ROEA 1BQNB 3H1LD 3OBIA 2C28A 4X62J 4Y34A 3JB9k 1RWNB 3M6VA 4F4YA 3BH6B 3D1OA 3CXHE 4LR8A 3Q89A 3I56P 1FRIA 3DRPA 2KVQE 2GNKA 3R5GA 2M8HA 2HNDB 2RSQA 3D1QA 5E33A 1XN9A 5HK4A 2R7SA 2A6OA 4M5LA 5K8PA 3FSXA 1X5SA 1R8EA 2P67A 1QL1A 3PJ9A 1T02A 4UQTA 1RTDB 4UUWA 4J37A 3F73A 3HUSB 2YMKA 4PEOA 2PT0A 4HACB 5M1BA 4AXIA 2CNLB 2JLGA 4BWNA 3OFEA 3OHBA 3IAM9 3N4XA 1CS4A 3D6YA 5ETKA 1FZCB 2UUAF 4I2QB 5T7LB 2AIRB 4BS2A 2B4VA 5KG0A 5KFKA 2QO3A 1JX4A 1H6KX 3LF0A 4Y2CA 4X64F 4ASWA 2DGQA 3UR3C 3EWKA 2DGSA 1FZBA 2D69A 2G13A 1VQLS 2Z57B 1Z2ZA 3D1HA 5DM6Q 3AXKA 1QL2A 1DD3A 3ETMA 2MZTA 1HHQA 2ZBRA 1RAHB 4Y3CA 2QSIA 1B70B 4BWJA 4M63A 1IQTA 1VL2A 5KG3A 5CCLA 1ZAVA 4JI6J 2NCKL 4ED8A 1U2CA 3HZEA 4ZLNA 1HARA 3Q5RA 3K7RA 2AGQA 3KMSA 1J1EB 2V69A 4A8KA 3CCMP 1QJHA 1UA1A 2IYOA 2D74B 1YRTA 4N8NA 3BV8A 3GF7A 1FFGB 3UI3A 2YQ0A 4ZVEA 5IQQA 1X0FA 3MCMA 2DNLA 2W9AA 1R0AA 3T19A 3UDCA 4Q2LA 4Y6IA 2EW9A 3TQEA 1U4BA 4LIRA 1XBWA 4AL6A 4ZKUA 1T3UA 3IG1A 3CX5H 3B6BA 2CRLA 1KB9E 1LJ2A 2D3UA 4PWUA 1KILC 3KLEA 1U8WA 4DR6J 1VQ5S 1MV8A 3CEDA 4EBDA 4OIXA 4DPUA 2MEWA 2NUUG 3K5LA 2QL7B 1X0TA 2ZHOA 3C6TB 3PG9A 4ZVSB 4JYCA 2HGNA 2I0XA 4PUOB 4F4AA 1RT4B 4H44D 2MQMA 2CK3H 3OLBA 1S9KE 4M5IA 2H65B 4EIJA 5AW6B 1LTJB 4P2SA 4H13C 2XZRA 1CQNA 5L8RC 1SV5B 3DI6B 1WC5A 3OFGA 3ULHA 4LQ3A 2WT7A 4HH1A 4PV1D 1WKKA 2MZJA 2X51A 3TVYA 4QIGA 3RUBL 3FX0A 1Q82Q 2XHCA 1TKDA 4OYWA 3JC22 2DR6A 1F6TA 4I7ZB 1Q86T 4YR3A 2CPXA 2OSQA 4DN0A 1J1DB 5EFWB 5J2PB 1Y8AA 2M88A 2K1RA 1JY2N 3EXYA 5KLVD 3V5RA 3QQCD 3CMEP 1UPPA 1L3VA 3GG2A 1NXIA 1FDOA 4N78D 3UDEA 1G1IA 2PE8A 3IC1A 4AYBD 4TVAB 4HT5A 1W25A 1R6YA 4IH5A 4H4OB 4LF8F 3HRNA 4XFJA 2ZH9A 2W8KA 4ZP9A 3UVJA 5A8RA 1S48A 4QIVA 5ITHA 4M5DA 1H98A 3OTEA 1AT1B 3H59A 2E9RX 5E2QA 4L72B 3MHYA 2KVIA 3NGKA 4HDHA 1LFPA 3PJWA 2FKWB 1EXIA 3MEEB 4XK8C 2NREA 5ETSA 1J27A 5HJXA 2R8JA 5KFPA 1YJRA 3AXMA 3FBEA 2QJYC 2FB0A 4TNOA 1WTFA 2HSEB 2M52A 1BQMB 1R31A 1YJTA 4W7YA 4ES2A 4WIQA 3LALA 5KFUA 3G71P 2K3RA 4UB6H 4IH7A 3GU0A 3MUDA 1UEVA 1CJUB 1HI8A 1VDFA 3CDWA 1IBLJ 2AEMA 2GM4A 2DH9A 1RE1B 2LEBA 1TTHB 2R7QA 2ZXXA 2COLA 3LA0A 3GYXB 3OUYB 4QIEA 4U3FE 3MXHP 2I6WA 1EQ0A 4R8UA 3QLHA 1WELA 2P9EA 1PGOA 4DF4A 5KFXA 2ZZNA 3ETOA 1OSDA 2MKYA 3D70A 4I6MC 1ZMEC 4JI0J 1PIXA 4I1LA 1HBMB 2F8MA 2XLJA 3H40A 1Q81Q 3IO1A 2DGUA 3L73E 1OIAA 3HI9A 4ECRA