3I5CA

Crystal structure of a fusion protein containing the leucine zipper of gcn4 and the ggdef domain of wspr from pseudomonas aeruginosa
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
196
structure length
196
Chain Sequence
RMKQLEDKVEELLSKNYHLENEVARLKKLVNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPGGGGQTFRVLIEMADQALYQAKNNGRNQVGLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determinants for the activation and autoinhibition of the diguanylate cyclase response regulator WspR.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Fusion of General control protein GCN4 and WSPR response reg
total genus 68
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3i5cA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i5cA02
1RTIB 2XV5A 2XGPA 1Z4UA 5L1KA 1IKXA 4WXWA 1LWEB 4GC6A 3GIMA 4EEYA 5D3GA 1KLMB 1T3NA 1S9KE 3VMYA 1LWCA 5KFGA 5HLFB 2JEIA 4EBCA 2WPRA 3GIIA 1N6QB 4U7CA 1CI6B 5KFKA 2OPRB 3MF5A 2JC0A 5FDLB 3GV8B 1GU4A 2FJWA 1U09A 3H59A 4FBTA 1S6QB 5AW9B 4NLWA 4XPEA 3TVKA 3Q8QB 5J2NA 1LW2B 3E51A 2C2DA 1J5OB 5J2PB 2R8HA 1JLAB 4IDKA 5KFAA 4ZP9A 4K4ZA 5KFBA 4TYBA 4ZMMA 1HPZA 5HROB 2UUTA 3DMJA 3DOKA 1C1CB 3FRZA 3M06A 3RB0A 3SFGA 1S1VA 3H2LA 1HUCA 4K4TA 2BRLA 5F9NA 3DOLB 5DGBA 2BR0A 3QIPA 3QLHA 4F50A 2ZXEB 1JLBA 3PVXA 3ICLA 3PR5B 4ECRA 1EETA 1S1UB 3I5AA 4I2QA 1TKTB 1RTJA 3KLVA 4G1QA 5KFZA 2V4RA 4ZP6A 3OSPA 4ED8A 4RNOA 1OXZA 5APWA 5HP1B 2RF2A 2W7PA 3QIDA 3H4DA 3PW7A 2JJLA 3LP2B 2XZRA 5CMZA 2DPIA 1HQUA 4I6MC 5AW1B 2WHOA 4WYWA 3C6UB 3M8QA 1RT6B 3H5XA 3RB6A 2FLNA 3ISNC 1H8AA 4K4UA 4NRUA 5CYQA 2R2UA 1FOSF 3H98A 3H40A 2R8IA 2AGOA 4I2PB 3MEGB 4JYCA 4YR3A 4WFXA 1S1WB 5DG8A 3QZ8A 3DLKB 4GC7A 5K14B 4Y34A 1BQNA 1JKHB 5KFSA 3RAQA 3CVKA 4FS1A 5AVXB 2WT7A 3BQ0A 3O8ZA 2CJQA 2OPSA 2R32A 3V81B 1MU2A 1SH0A 1SP4A 4ED6A 4RW8A 1R0AB 2QM8A 4KAIA 3FSIA 1KQLA 4TY8A 2BQUA 1EP4B 5HP1A 1EETB 1S1UA 4I2QB 4DL3A 1HQEB 3IG1B 2YNHB 4NLPA 3KK3A 4G1QB 2VA2A 3TNUA 4NCGB 1LW0B 4WFZA 2YNFB 4R8UB 3NMDA 1JUNA 3V6HA 4XPCA 3V6JA 1TL1B 4Q0BA 1RT5B 4XE5B 1D1UA 2UVVA 1CZQA 5F8MA 4YR2A 1RT1A 1YVFA 2HNYB 2XCAA 4KBIA 3KK1A 3CJ5A 1TKXA 4WE1A 4NLOA 5KT4A 2VG5B 3H5UA 2IM3A 5AW5B 2WCXA 3G6VA 3GV5B 4O3PA 5KFPA 3RB4A 4YR0A 2P2UA 4K4YA 2YNGB 4J9PA 4F4XA 3MR2A 5F8NA 5F8JA 1RA7A 3C6TB 1JLQA 4DL7A 4RW8B 4NLRA 1R0AA 4FBUA 3I0SB 1N6QA 3CWJA 4AYCA 4Q8FA 2W9AA 3L37A 1DH3A 2AWZA 4ZPAA 3SWFA 1RT7A 5F8GA 3T5HA 2WONA 2W6AA 1S97A 3BQ1A 4MK9A 2BQ3A 1C1BA 1HARA 1SUQA 3EZUA 2XGQA 1H89A 3NTNA 2Q5UA 4TQRA 1S1XB 4ED0A 2AGPA 3KOAA 1BQNB 1JKHA 1RT1B 2OPPB 4Q8EA 1RT5A 4GT1A 1C1CA 5KFVA 2OPQB 3IR9A 4LSNB 4Y3CA 1FKPA 4QWCA 3BSAA 5F8IA 4K4WA 1QUVA 4RU9A 3DRRB 1DTQA 2D3ZA 5KFRA 2QM7A 4JV2A 1TP7A 3MD0A 1G2CB 2E9ZA 4KHMA 3FDSA 1JLCB 3MGNA 3M91A 3KLIB 4URQU 4QPXA 4EO6A 1DTTB 3LIEA 3HE5B 1RT4A 4ZP7A 5AW3B 4WFYA 3CJ2A 1TKTA 2IC3B 5JXSA 1HPZB 3KLEA 4Q0BB 4EBDA 1TV6A 3VYIA 2FVRA 2ZKUA 5APXA 1GU5A 2C9NY 3OLAA 4RW6A 3KLGA 5L1JA 4K4XA 4ECXA 5HROA 4K4SA 2WTYA 3OAKA 2AU0A 3KLHA 3IRXB 3EPIA 1JLQB 5DG9A 4NLDA 1IKVA 3M0AA 1S9GA 1MUUA 1VRTA 3DM2B 4TY9A 1S9EA 3LP0B 2W7OA 1DTQB 4MFBA 2I5JA 1T05A 2J6TA 4O3SA 2WPQA 3HE4B 4QWAA 4J9NA 1LWCB 4ZPDA 1S1TB 2VG6B 3NBPA 4QWEA 3BJYA 1CI6A 5JUMA 4ZVEA 2IAJB 3KQGA 5AW0B 4C46A 5KFOA 2C2EA 1N5YB 3MEDA 2FLLA 4NLVA 4TYAA 5KFIA 3Q8PB 5KFNA 2R8KA 1TV6B 1HQEA 2ILYA 1LWFB 3IG1A 3PJXA 1JLFB 2HNDB 2P7JA 1GD2E 5DLGA 1I6JA 1IKXB 4HKQA 3QO9B 3B8EB 4IFYB 5J2NB 4IFVB 4H4MB 3OHBA 3V81A 4NLYA 1C0UA 4ZPCA 4IG0B 4LSLA 4J9SA 1TQLA 4Y2AA 2EC0A 1QAJA 2CKWA 1D0EA 2BE2A 2HAIA 4PWDB 4PQUB 1RTDA 4ECWA 1SV5A 4KV8B 4TN2A 3A2AA 5APYA 5AVTB 2FVCA 2WOMB 3BGRB 4EBEA 4ED3A 3A7OA 2HNYA 2I1RA 2WRMA 2YKNA 2IJNA 3VQSA 3KK1B 2IAJA 3I0SA 1N5YA 4EO8A 2V4QA 2ALZA 3CO9A 3DLEB 4RW9A 3LP2A 4ZVFA 3GILA 3DOKB 1ZTTA 2N9BA 1RT7B 1ZETA 1OWAA 2RKIB 1S6PB 1MV8A 4YMEA 4O4GA 4ECUA 4NLGA 3M9OB 3HVTB 5KFMA 5AVSB 4C7NB 1FK9B 1JLEB 4H4MA 4Q44A 3JYTA 3PW4A 1S9FA 3QLHB 5KFFA 2W8KA 2W27A 3C6TA 4Q43A 4ZHRA 3RAXA 4XO0A 4RUCA 2BE2B 4RW4A 4LC1A 4EYIB 1T03B 1IKYA 2QV6A 1T2KD 2Q7CA 4PQUA 2WPSA 5DQIA 4J9QA 1EP4A 3M9NB 3C6UA 4NLXA 4ICLA 4RUAA 3OL7A 1JLCA 1GZLA 5APTA 2YNYA 2WOMA 4NCGA 4IFVA 4URSA 4O44A 4IOBA 5KFHA 5J2MA 1TL1A 3GIKA 1HNVA 2RDIA 2IPPA 4MKAA 4F4YA 3VMXA 3V4QA 3MR5A 3M9HA 4NLSA 3G6XA 3M9BA 2E42A 3ITHB 1S6PA 4QW8A 4ED2A 3I0RB 5C24A 1S0OA 2JEGA 2OH2A 3QGIA 5AVZB 3PW5A 1IM4A 4WE1B 5KG4A 3V6KA 4B86A 3E01A 4IH5A 4I2LC 2OPSB 1CSJA 3LAMA 4NLTA 5HLFA 4ZHRB 3OHAA 1S1VB 5J2QA 5APQA 5KFLA 4B3OB 2YNIB 2W9BB 4MIAA 1LW0A 4NLUA 4ECSA 1T03A 2IA6A 2I5JB 4PUOB 3LP1B 3UPFA 4WYLA 1SH3A 2BASA 3IN5A 1LW2A 3N6MA 1J5OA 4M94A 4Q45A 5I42A 2VG6A 3NBPB 3GYNA 4Y2CA 1JLEA 4EOTA 4O44B 3T19A 1IKVB 4DEZA 4J9OA 2FVPA 2IBKA 1FKOA 5J1EA 1C0TA 1FOSE 2E43A 2HWHA 2AQ4A 2AGQA 3P8MC 3DI6A 5EWEA 2VG7B 4ECVA 2OPQA 4LSNA 3NKYA 5KG3A 3DOLA 4ZVGA 3PW0A 4H4OA 5KT6A 3QGHA 2JEJA 4J9KA 2XI2A 5DQGA 3MECA 2IM1A 3DYAB 4KO0A 1VRUB 3CIZA 3A3YB 1TL3A 2GIRA 2QE5A 5C25A 1RDRA 1YYCA 1XR6A 1S9KD 3DRSB 5AW8B 1C1BB 3GIJA 1RTDB 3DRPB 2WONB 5HBMA 5AW4B 3D5MA 1RTHB 4I7FA 3M8PB 2YO2A 2F8EX 4TY8B 1LWFA 3KHGA 1RT3A 3PW2A 5DG7A 2ATLA 3KHRA 5AW6B 1ZTWA 4IFYA 3DLKA 3N6LA 2FVQA 3TYYA 3VN0A 2AX0A 3BSOA 3KLFA 1T94A 1RTIA 1KHVA 3MEGA 5DQHA 5KFDA 1REVA 2HWIA 1X8YA 3M0DA 2XWYA 2YNIA 3ISND 5K14A 3KLGB 2W9BA 5L1LA 4PUOA 3LP1A 1LWEA 2C9LY 2JLEA 2ASJA 2Z5IA 3KK2B 5C42A 1HNIA 2J6SA 1JXLA 2YNFA 2B6AA 3FQLA 5KT3A 2R2RA 4KE5A 2YKMA 3HE4A 3KK3B 3KNAA 4ICLB 5KFTA 3UIAA 4DZOA 2H7HA 3VTPC 5KFXA 2BQRA 1MFZA 3M8PA 4NLQA 4QWBA 1GX6A 3I5BA 5KG0A 5HBMB 3LANA 3KMSA 2W8LA 4RNNA 4KHXA 1HJBA 1TKXB 2HNZB 4YQWA 3H4BA 2R2SA 4K4VA 3MEDB 3OL8A 1NAFA 2VG5A 4U6PA 2R5DA 3RBEA 1HYSB 3OLBA 3HVWA 3DYAA 4KFBA 4KO0B 2XC9A 5CYMA 1S1XA 4MIBA 3KMQA 5I3UA 5AW2B 1IKYB 2IM0A 1T2KC 3ITHA 5KFWA 1UWBB 1QAIA 1IKWB 3HHKA 2B5JA 3NFQA 4HYKA 1S49A 2YO3A 1IO4A 1S0MA 1J2JB 5C42B 2B6AB 4J9MA 2V9WA 4OL8A 1RT2A 2YKNB 5L9XA 2BRKA 1RAJA 2OPPA 4O3NA 3Q8RB 3EPGA 5AVYB 2ZE2A 3BGRA 3BSCA 5KFYA 4DG1B 2R8GA 5APUA 4IR9A 2RKIA 3N6NA 1RT6A 3CDEA 5KT7A 5CYQB 4KSEB 3RB3A 2C22A 1CSBA 2C2RA 1XR5A 3M9MB 3IGNA 3Q8SB 4ECZA 2WK4A 4C7NA 1FK9A 1DLOA 4KKOB 4I2PA 3L36A 3IS9B 4R0EA 4ED1A 1JIHA 1SV5B 4KV8A 1K1SA 5C5JA 2ASDA 2R8JA 4IRDA 4O3RA 3H5YA 5F9LA 5KT2A 2W9CB 1RA6A 1HQUB 4MK8A 1UWBA 1H88A 1MU2B 3TQ1A 1FAVA 1GX5A 3MECB 3KJVB 4JUZA 3UQSA 4IG3A 4IKAA 4AQRD 1S1TA 4O4RA 4ECQA 4M95A 2D3UA 2VG7A 2XI3A 2B43A 3MR6A 2ZE2B 4DG1A 4LQ9A 3BSNA 3IGVA 3T5JA 4ECYA 3DI6B 3CDUA 1S9EB 3LP0A 3KLFB 2ASLA 1T05B 4NRTA 3DM2A 3JYTB 2E9RX 5KG2A 4F4ZA 3FFIA 1A02J 3TAMA 3DMJB 2ZD1B 1MMLA 2KP8A 5AVQB 4MFBB 4ZP8A 4TQSA 5FDLA 4MKBA 1RTHA 4I7FB 3UR0A 3KHLA 4URGA 2RDJA 3TK1A 1RTJB 2ZFCA 4EYHB 4DL6A 3P7KA 4WZQA 1QE1B 3MEEB 1TVRB 3L35A 4RNMA 5KG7A 3MFHA 1N48A 5KFUA 3A5TA 4QWDA 3V4IA 2GIQA 1N56A 3CJ0A 4NYZA 2HNZA 2D41A 2IJFA 4QW9A 4LQ3A 4J9LA 1BQMA 3LAKA 3M8QB 5AVWB 1C0UB 4WZMA 3MR3A 3NXSA 4K50A 1C2PA 2WB4A 5KFCA 4LSLB 3TAMB 5KFEA 4YP3A 2RF2B 3PHEA 3DRRA 5C25B 2FLPA 1HBWA 2R3CA 5F8LA 3RBDA 2FJVA 2FVSA 5D3GB 2D7SA 3MEEA 2C28A 2IC3A 3KLEB 4FS2A 3DDKA 1TL3B 3D28A 5KG6A 3LIDA 1HWTC 1C0TB 2V0NA 3HKWA 1DTTA 5L1IA 2P67A 2ILZA 3NGDA 1HYSA 5DLFA 4RNHA 4TXSA 3NAIA 3T1AA 3HVTA 4IH6A 1FKOB 2O5DA 5J1EB 4R8UA 4DL5A 2UVWA 2HMIB 4O4GB 2JEFA 3VMZA 1HMVB 4IRCA 3HVAA 3V5BA 1BQMB 1S9GB 3OSNA 3V6DA 2DPJA 3MTKA 3KLHB 3DRSA 3GQCA 4JV1A 1KLMA 1JLBB 1IKWA 4O3OA 2OPRA 4ID5A 3I5CA 1SLQA 3NMAA 3CDWA 4AUWA 1JLGB 2WWWA 2JC1A 1A02F 4H54A 1W25A 3QZ7A 1NNDA 3E01B 3V4WA 3TNUB 1NHUA 4GKGA 4RW7A 2GC8A 4IQXA 5J2QB 4IG3B 5EDWA 3PZPA 4ZPBA 1HNVB 5KG1A 2XCPA 2YKMB 4RZRA 3JSMB 5F8HA 4WXOA 1DLOB 4KKOA 2VA3A 2BANA 3PR4A 5AVUB 1K1QA 5AVVB 3I0RA 5C24B 5I42B 5AW7B 1JLFA 2HNDA 2Z5HA 3CJ3A 3KK2A 2VRSA 3QGGA 1FKPB 1JNMA 1XR7A 2IM2A 1S1WA 2UUWA 3IS9A 3QO9A 4KHRA 3T5KA 1TKZB 4NZ0A 5I3UB 1GTWA 1S4FA 2WT7B 2AX1A 2IMWP 4B3OA 1RYSA 5CYMB 4IR1A 4ED7A 3G86A 1GK6A 4ID5B 4MK7A 4MH8A 5T14A 4F4WA 3T5LA 2E9TA 1JLGA 5EUHA 3PJWA 5KG5A 1TVRA 5DGAA 1WNEA 4RW7B 2UVUA 4PWDA 3QYYA 2YNHA 1SUQB 3H5SA 3DLGA 3BQ2A 1HMVA 1QE1A 2WTFA 4JYBA 5AVRB 3SI8A 3LALA 3HTKA 3V6DB 2UVRA 3NAHA 3SFUA 3DRPA 4IG0A 4J9RA 3DLEA 4M3LA 1RT2B 1SH2A 2BANB 4RW9B 3UDLA 1S0NA 4G3IA 2ZD1A 4ZVHA 4KFBB 3IRXA 4O3QA 4RW6B 3JSMA 3FFIB 5KFQA 3KHHA 5APVA 5KFJA 4X2BA 4IRKA 1JX4A 2B5JB 4H4OB 2J6UA 3CJ4A 4R5PB 2YNGA 1S10A 3KDPB 4RESB 3BR9A 2R5BA 2FJXA 1VRUA 1OS5A 4RW4B 5EWFA 2R2TA 1TKZA 3T97A 3MFIA 3KLIA 1S48A 3BREA 4TLRA 1NWQA 4ECTA 4DL4A 3V4IB 5EWGA 3QIPB 3HE5A 1RT4B 1S6QA 5KT5A 5APSA 3OL6A 1RT3B 4KB7A 3KJVA 3G6YA 2W9CA 1JLAA 4IDKB 3FQKA 1HNIB 2Q3IA 1N4LA 3OL9A 2XU6A 1KHWA 1NHVA 1GK4A 4R5PA 4DL2A 3NL0A 5J2PA 3DLGB 4HYTB 1VRTB 3P32A 4IH7A 1RYRA 5J2MB 4RNFA 4JV0A 2HMIA 1REVB 3GV7B
chains in the Genus database with same CATH superfamily
4KJMA 1X9VA 2DBBA 1Z4UA 3D0HE 3BCCG 3GIRA 5D3GA 1WF0A 2V9KA 3PYFA 2WW4A 1SQBG 1M5OC 3K0JA 5KFKA 2G8YA 2FJWA 2IIHA 2HHTA 3J7YU 3CCRS 3GFHA 8ATCB 3QNWB 5KFBA 1PC5A 1HPZA 3E2EA 2J76E 3I55P 2ZH4A 3NLCA 1H74A 2HQGA 4KT0C 4RNOA 3VZIA 2VQFJ 1W2EA 5HP1B 3KG0A 3PYGA 2E7VA 1RAEB 4YDXA 4HT5A 2XY6A 4WYWA 2E74C 3M1VB 4D3GA 1YZ7A 3F73A 3J81U 1E6YA 2PFXA 4CM0A 1PV3A 1KSPA 4Z37A 1X31C 3TNUA 3CMQA 4C8LA 4ZJQA 2WSEH 4M5IA 1YBTA 2UUCJ 3KK1A 4OI4A 3SWYA 1D7MA 3C2PA 3TYTA 1X22A 3MR2A 4J9PA 4FBUA 5IS2A 1QDUB 2XLJA 4P73A 3A8JA 4TQRA 5EGYA 1MMNA 1OJ4A 2Z4EA 1RT1B 4GT1A 1SQEA 2WSFC 4B3RJ 2LYVA 3AT1B 1FKPA 1VQYA 1WHXA 2H5IB 3L75G 1G2CB 3I31A 2PT0A 4D6TE 1JLCB 2KFNA 4DDFA 2MKYA 1R89A 2KYVA 5APXA 2AKWB 5KLVE 3R9LA 2DEJA 1TUVA 1KQSR 5KKZC 4WWSA 4QU7A 2ZVSA 2C42A 3M0AA 1HWUA 3DM2B 2H54B 2WPQA 1V3SA 2LR2A 3BJYA 1RBLA 4ZVEA 5AW0B 1RE4A 3TI0A 2KUBA 3RBZA 2B4UA 3BKTA 5K20B 2BEZF 1HWLA 1VQ4P 2HBQB 4IFVB 2ZVNB 4PJ0H 1OYEA 2XB2D 3G71S 4PQUB 1RTDA 2XYGB 3ETOA 1SFCC 4Z7YA 2GJIA 1LK7A 2RS8A 2L3MA 3BRVB 2VOOA 2R7SA 2G3AA 3H1JJ 2GW8A 4C7RA 4HI1A 2FYUG 3CXHD 5D8HB 1JY3N 4O44A 4KGKA 4RBUA 2POKA 5E0OA 1YQHA 4LRCA 1RHJB 1QL1A 2UUCF 1U49A 4DV4J 5AVZB 1IM4A 1WKLA 3V6KA 4IOCQ 2HGLA 5H9EJ 1TL7B 3D70A 2LA4A 3BZQA 1GXTA 5HATA 2HR3A 2EFGA 4Q45A 2OAUA 1FC2C 3MD3A 2OKQA 4EDFA 3AAWB 4M5NA 2HWHA 5CYJA 3QJPA 2GVDA 4ZVGA 2LMIA 2XI2A 2IM1A 2VQFF 2ZOMA 1NU1J 4K3AA 2QGFB 1UA0A 3AJ2A 1YJWP 2ZBCA 4WIQA 2PFDA 5B5EH 3IWNC 3L74D 1HBUB 2P2CB 4ZJLA 2FVQA 2CVIA 4YXWH 2W2PP 3KK2B 4PXEA 2B6AA 4LBHA 3FJ2A 3KZIH 1GX6A 3WX4A 4B9TA 2AW0A 3V2UC 1X9MA 2UUBF 4PXBA 4DR2F 4PV1B 1AQ5A 2AP6A 4X66J 3Q23A 4OHVA 3SQGA 4MIBA 1N2DC 1T2KC 5KFWA 4ES2A 4CDIA 2B87A 1QLED 1YIJP 2V9WA 4WU3A 4ZCMA 3OTOJ 3BSCA 3GU0A 4WFBQ 1E79H 2W24A 2PEHA 3H32B 1YRXA 1SV5B 2ASDA 5F9LA 2F4VJ 4LMZA 2IYPA 2NQPA 2GQQA 1VBZA 4HDGA 1FFWB 1FRMA 3JSRA 4DV1J 2ZE2B 3LP0A 2Q1KA 3DLLQ 2M7SA 1A02J 4F2RA 5AVQB 2HHHJ 3IR6B 3TF5A 4MKBA 3GG2A 4D6TD 2L9WA 2KZJA 1IFMA 3IXQA 1R7IA 2AXCA 3C8VA 2IJFA 5B5EE 4ZK7M 2ZHBA 4K50A 3WUTA 5KFEA 4YP3A 1OW6A 1L4AD 2FLPA 2JR8A 4FF4A 3UVJB 1RHMB 1I1GA 1DTTA 2ILZA 4IL6E 1YRUA 1UP1A 1OW7A 4CH7A 3R5BA 4IRCA 4CLFA 1BQMB 2K06A 2E5IA 5K5MA 3IP0A 1SLQA 1O8BA 4AUWA 4RO0A 2GA7A 3CSKA 2N9YB 3IBFB 4N7TA 3HM9A 1A6LA 1CULB 3PCOB 4USVA 2ERRA 4RZRA 3JSMB 2G2ZA 3B5NA 1KB9H 2RDDA 1R3NA 3KK2A 1XR7A 3T5KA 5FJ4A 3CJ8A 5I3UB 3NCPA 2SPZA 1TKDA 2WVRA 3BO2A 5DGAA 3M6WA 4WKRA 3MM7B 1HMVA 4XAKA 1RT2B 1VLYA 3OTDA 4Y99C 4FNHA 1ZP0C 1VCTA 2J6UA 4HACB 4P2XA 1S10A 3BR9A 2FJXA 3TA0A 4RW4B 4K5RA 3QIPB 4HL9A 2YWFA 3OL6A 2WSSH 1JK9B 1HNIB 2OI2A 4WY4B 1VQ7P 3MOZA 2Q79A 4ZOSA 2YMKA 3GHGB 4HYTB 3H1HG 1OY9A 2R4FA 3AD8C 1YJRA 2MKSA 2XMTA 1PZQA 4ID8A 1YSJA 3CIMA 3M4XA 4QCLA 4OYAA 3R7NB 4WBAA 1GU4A 5J2NA 1S1CX 3MCOA 2H65B 2C3OA 3FRZA 3M06A 5LMNF 3H2LA 5SZTA 5DGBA 2FC9A 4J9UE 1FDMA 2FXMA 1TKTB 2E44A 1NM2A 4IYQA 4ZP6A 4PD4H 2NPIA 2PO4A 2WHOA 3RB6A 2FLNA 4NRUA 4XDDA 3C66A 1BQNA 3QH9A 2ZKTA 3O8ZA 2CJQA 3Q3DA 4FDFA 2FYNC 4PABA 3B4MA 4C4WA 4X4SA 1NJIQ 2JHEA 5RUBA 1NDLA 5F8MA 2GAHC 1RHQB 1AT1B 3P6YC 4DPWA 1DQ9A 3EUNA 1S3JA 2Z2YB 2VFUA 1N34J 3MPWA 2RU9A 1R0AA 4Q8FA 3L37A 1RT7A 1NCLA 2WONA 2IFNA 4LRDA 2HHPA 3D6HB 3EXYA 1Z56A 2E75D 2ZNZA 2Y1JA 1VC6A 2E76B 3PTZA 2OMOA 3DHXA 3J81Y 3FDSA 3M91A 2NYHA 5DS7A 1DTTB 4F04B 5JXSA 3T97B 1EQ0A 1GU5A 3NGKA 2IFMA 1NPKA 4MFBA 2Y0BB 1IVZA 4QWAA 3QWOC 2VV5A 3NBPA 2UV8A 1B0PA 2MKKA 2CQ2A 3B5NB 2BUNA 3CCSP 4AUKA 4DV5F 2Q9IA 1PBAA 2KVQE 2EC0A 2RJZA 3F89A 4KV8B 5A0YB 3OR1B 4EBEA 4ED3A 1RWOB 2VC1A 2KRRA 2HG5D 2V4QA 1Q8LA 1ZTTA 1X60A 1UEUA 1VQ4S 4U96A 4Q43A 4ZCLA 3MTUE 1KMIZ 1BGYJ 2XZTB 1P84D 2B51A 1N5VA 1FZCB 2FHKA 4OI6A 5H9EK 1RCXB 3IR7B 4IOBA 3FC9A 2HFSA 1N54B 1S6PA 3I0RB 2NZCA 3P45B 4IH5A 4I2LC 3W5YA 2BW2A 1CSJA 3IMQJ 5HLFA 4ZHRB 4J9VA 3GB0A 2MGZB 1LW0A 2I5JB 2JOQA 1L0NE 3DLHA 1NU1K 1KYOD 1VQ5S 2DH8A 2OPQA 1Q90D 4UB6E 1UAWA 4WVZA 3QGHA 3M8ZA 1R0BG 3NGRA 1VOMA 3Q1MA 2CZVC 3LUYA 3J80Y 5KJ7C 2ATLA 4DCJB 2BJ9A 3EPGA 1X8YA 3M0DA 2XYPB 1Q8KA 2YQ1A 3RL0C 2JFDA 2UXDF 1RF0C 2J6SA 4RKUC 5KT3A 1VQLP 1H7WA 3QPIA 1L5UA 2H4YB 4JI1J 4ICLB 5KG0A 4HB1A 4RBTA 3KYLA 4RNNA 2HNZB 4BWJA 2AZ1A 5CYMA 5KLIB 3KMQA 4YHHJ 4GMKA 3QWPA 4DBQA 4FYWB 1KVKA 3GE9A 2PC6A 3A3PB 4JI6J 1N8RT 3QFHA 3S6EA 4DJBA 2OPPA 3M8WA 4IR9A 3BDPA 2R7QA 4ZLPA 3RB3A 2C22A 3C19A 1D3WA 3IS9B 4KIAA 4O3RA 4YUDA 3H5YA 3CO0P 5B7WA 1W2BR 2OYIA 5IWAJ 1Y8AA 1WKKA 2M9KA 3SMZA 2GVDB 4IO1A 1EHWA 5E3PA 2RILA 1R8CA 1FVSA 2WZ7A 1JB0J 1RSCA 4YY3F 2LQ9A 1NH4A 2ZUAA 3PTWA 3AOAA 5KFUA 2CAJA 3QRQA 3B71A 3KFWX 1CS4B 2U1AA 1VQPP 1ZM9A 3WIVA 4WFNQ 2FY1A 2D7SA 4DSEA 5THWA 4FS2A 2W7AA 1XMBA 5B0FA 4LRFA 5IM0A 3HHNB 3HVTA 4H4KA 4B3TJ 4E98A 3TJ9A 4UF4A 3MTKA 2VONA 3GONA 4O0IA 3RW6A 3RGIA 2ASYA 1IFPA 3V4WA 3S4RA 4DUYF 8AT1B 2R3SA 1OWXA 3QSYB 1GTWA 3NS7B 1QEXA 4DV0J 1H72C 4WWIA 2GS8A 3QYYA 2C1EB 3BQ2A 1R8BA 1BE4A 2WTFA 3MOJB 2C2OB 4RW9B 2ZD1A 2DD8S 3OXFA 1VQOS 5F3TA 1S7HA 3DKDA 2HGMA 3KJVA 1JLAA 3HHLD 2V68A 1S57A 2HRYA 4JV0A 5GAEU 1KYOE 2RKLA 1YITS 4GC6A 2CPEA 3CE8A 3HZEA 1S9KE 1LWXA 3GIIA 2KK7A 4C48A 4U7CA 3LW5H 4UW2A 3DXSX 3MF5A 1NPRA 2DGUA 3CCUP 1U6FA 4ILMA 4AXIA 2LQ5A 1IJFB 1DEEG 4P2SA 3RK3B 1FDNA 4MTPA 3I5AA 2GO8A 1RTJA 1ULRA 5K8OA 1ZZNA 1EDJA 2RF2A 3BH6B 3W60A 1MN9A 1ZA2B 3SV3A 3G6ES 3HLUA 4P6QA 3BGUA 2UUAF 2BW7A 2JZ5A 4AXJA 2RT3A 1K8AQ 1ELOA 1HQEB 3IG1B 3V6JA 1SQFA 1RT5B 5B0AA 1AXQA 1YVFA 4NLOA 1SQGA 3OJAB 1XNQJ 4OYXA 4KTQA 5KFPA 5IOLA 2OEMA 2YNGB 5CH7B 3M2RA 4B3SF 2QFIA 1BE3D 3I0SB 3U59A 2DISA 3RGUA 2BQ3A 2OP5A 1KTMA 1SJ4P 2KSEA 1S6OA 3H1IJ 4LSNB 5F8IA 3QGPA 3NNCA 1VYAA 3KLIB 3HD2A 1FD8A 3BS9A 2IC3B 4A8WA 3DNCA 3CCQP 2PA8D 3C15A 2GVZB 1NHKL 3QT5A 1PP9J 1TTHB 3L72E 2QVAA 4XIUA 1BCCJ 4H4KC 1NK6A 4DV0F 2KS1A 1QM9A 1AFJA 3KQGA 4Y00A 3Q5PA 3GCXP 4LFAJ 1LP1A 5DJUB 1DURA 5GMEA 3ENAA 1X5SA 3GJSB 3KZIE 2HRUA 5APYA 1NGMB 2WOMB 2IYOA 3DLEB 4ZVFA 4QIVA 3AQPA 4NLGA 3QJLA 5AVSB 4QJVA 3C6TA 3D6YA 2DJWA 3RAXA 3GYXB 1CC8A 4PCQA 1FE0A 1VQMP 1M5PC 1H3DA 2W6JH 3FUYA 2Z30B 1WHWA 2G13A 3TUPA 1GXUA 2D74B 5C24A 3MP7B 1IFJA 3D6ZA 2DXEA 2PMZD 2GJ2A 2HBRB 5J2QA 4WKYA 2IRUA 1ZV8A 2FUG9 2DY9A 1IR1A 4EOTA 2FVPA 2E43A 3M30B 1FDOA 2AD9A 4I7ZB 2CDRB 1DQAA 4BLGA 4ELUA 3GF3A 3F41A 3D6FB 3G6EP 2KZIA 3KKFA 3BSOA 4NCBA 2SXLA 1X4AA 3TGUG 1S59A 2MGZA 2LLZA 3OXGA 1P84H 3CCVS 2JLEA 1SBRA 4LVNP 1RHKB 1SJQA 4I64A 3UIAA 2DRDA 1NTKK 4KHXA 3H4BA 1RU1A 4Z1MH 4CT8A 2ZJSE 5E3CA 2DNZA 5AW2B 3ITHA 2DYAA 1NK9A 4YDDB 3UN2A 3PJSK 3GJQB 3BGRA 4NCAA 3N6NA 2YPYA 9RUBA 1FJKA 3L3CA 4JV5F 1M1GA 4BHQA 5HN0A 1FK9A 4ED1A 4W80A 3ZZPA 3IN6A 1QD1A 5CCGD 5KT2A 2MSSA 3RK2C 1H88A 2XMUA 1JJHA 2COLA 2OEKA 4IG3A 1BGYE 2EFNA 4JV5J 1JY2N 2B43A 3WX8A 2IVYA 3I9ZA 1MSWD 2F1FA 2ZT9C 1JB0C 3DMJB 3ZFVA 4KGXB 4J5OA 4ZP8A 2QJ3A 2X3GA 3MFHA 2L5GB 2YWKA 4MKYA 2RSQA 1IZNB 3HSDA 1UKUA 1H0TB 4U7UD 2DGVA 1PO6A 3AQOA 2XY5A 1NKEA 4K59A 5CZVA 3R5JB 2UP1A 4OGQC 5CA5A 4ETZA 1TK0A 3HKWA 4Q2MA 2UVWA 5J1EB 1DZ5A 2HMIB 3TVZA 3U1MA 3RUBL 4AT1B 3QQCD 2EVZA 3NP5A 1IKWA 2YMYA 1GL2D 4RW7A 2WW8A 1RHZB 2B4PA 2XY7A 3LTOA 2YKMB 1WSVA 3QATA 1X5OA 5LXYA 4KHRA 1JNMA 1HHQA 2QG4A 5CYMB 4ZVPB 3IBCB 2OYIC 1GK6A 3ZZOA 3VAHA 5EUHA 3TAQA 1T3OA 4ENOA 3GHGA 3SI8A 5JJBA 3SFUA 1NDPA 3DLEA 5APVA 3UI3A 2P6TA 3I32A 4TLRA 4YB7A 5EWGA 1RKJA 4KB7A 3RRGA 2CQBA 3KTQA 4MAKA 3LGNA 3SCLE 3PM9A 5H2FH 1NXIA 3MUVP 1EZVD 1CJUB 4P2FA 3PRJA 1KLMB 1KD1T 1EQ7A 2I1JA 1PG5B 4MKVA 2KVIA 2JLFA 2WVFA 1Y10A 3OFEA 1N34F 1VC5A 2KTQA 1BSNA 4Z7CA 1QVFO 3GF7A 1SS1A 3BV8A 1M8OB 2ZXEB 4RWXA 2HZCA 2QJYC 5AJ3J 4MYTA 1NK5A 1U1NA 1QLNA 1OXZA 2AYGA 2H8PD 1KB9D 3L72D 3H5XA 2N1TA 5CYQA 2DB1A 2JH3A 1HNZJ 4DF8A 1SQPG 1Y5LB 4A8KA 1JKHB 2VFVA 3Q0AA 3AOCA 5I3QA 3LOUA 5ETVA 1IBKF 1MKMA 1WHYA 3VP8A 2LXIA 3IF4A 2XCAA 2ZBIA 3Q24A 2HNYB 2YQ0A 4WE1A 1U1QA 2LQJA 1FRHA 4YR0A 2P2UA 3CWBG 2KU7A 4PG7A 2DITA 3MZWB 3C6TB 3E1RA 2ZVOB 1T9YA 4A8FA 3SWFA 3VR1A 1S5LE 4MK9A 1C1BA 1NZ8A 3DOMA 3Q8UA 2KHCA 1JKHA 1RABB 2ZM6F 3KDOA 1RK8A 2BEQD 3FSYA 2RD5C 5KFRA 3EVMA 3D71A 2KB7P 4CZCA 3A3OB 2J0SD 4DJGA 1RP5A 2R9LA 5HROA 4K4SA 1DFDA 5HK4A 3ZNUA 3D0IE 2HLOA 5CCMA 2VC0A 4U8YA 1EZVG 1M1JB 3KWMA 3BB5A 1J2VA 3CD0A 3BATA 1JQGA 5KFIA 2ILYA 1NTKG 3PJXA 4N8NA 1WRGA 1GD2E 4CLWA 3B8EB 4UOHA 1XNQF 1CJVA 1WWHA 1BWEA 3PRDA 4ECWA 4G3IA 2W4PA 3CO9A 2HQFA 1MV8A 2IY5B 5K9FA 1UL3A 2VPYB 1UMJA 1M56D 1SQBE 3B6BA 4OYOA 3JYTA 1Y11A 1S9FA 5DJBA 1L3UA 4PQUA 1G3OA 4J9QA 3LW5C 1EXJA 4MMOA 3OXLA 3L72J 1R31A 5IQQA 5K8PA 3I9V9 3O5TB 3H1HD 5TISE 1U2FA 2JEGA 1S0OA 4ZA1A 5KG4A 2GVZA 1YLXA 1OMSA 2XG8A 1LV5A 3UPFA 4WYLA 5F0UA 5KAFE 4OZ0A 2QLFB 2VICA 5HANA 4O44B 4OV1A 3NS5A 1LTJB 4ECVA 1Y5NB 3MECA 5C7PA 3M8PB 1VJQA 2HEKA 2VFRA 3KHGA 2FYNB 2EFPA 5AW6B 2VF3A 1NOHA 1U47A 5K14A 2XWYA 3EM1A 3R5GA 3ISND 2C3MA 3ZZYA 2RRAA 1NEEA 2HZVA 1HVVA 4USHA 3UD4P 1HNIA 1S12A 2XWXA 3ZTQA 3HT0A 4TLFA 3VTPC 3I5BA 2B4VA 3VAFA 2O1JA 3MZIA 4OGQD 1IKWB 2B5JA 7FD1A 1CJKB 3OPKA 4AE5A 1IUJA 2E5GA 2FYXA 2IA0A 1FTCA 5KLVG 3M1VA 4OZLA 3IGNA 4ELTA 2E75C 1L0ND 1JIHA 2ACYA 1WTFA 2ZZNA 1H38A 2XZWA 1MU2B 3RK3D 3TQ1A 4F3MA 2CPSA 4M95A 1VQPS 3C1LA 4M5LA 2KT5A 5KAKA 1NDCA 4OJGA 1SC3B 2LXUA 3KHLA 1X4GA 4EK2A 4RNMA 4LREA 1NK8A 2FZCB 3HHLB 2JL9A 3W7BA 3HJVA 2BKPA 3L71G 3TGUD 1ROFA 1VHFA 2GGPA 2L08A 4MYUA 1I94F 1ZXGA 4C8ZA 2KI2A 1Q5VA 3B5ND 2P67A 4FYXB 3K5PA 2DEIA 4R8UA 1EC5A 4FKYA 3HVAA 2C2MB 2J0QD 1RQ0A 2E1PA 2M8HA 2ZYAA 4P10A 4JV1A 1KLMA 4ID5A 1LJ2A 2ZH7A 3CDWA 3HHLA 1U1MA 4H54A 3EZ5A 2Y3YA 5J2QB 1OSDA 2W6BA 1QAXA 2AT1B 4LIWA 5C24B 2HNDA 3H2VE 2FJBB 4B9MA 5HVGA 2XMVA 3DU5A 3CPWR 3CCSS 3RK2D 1VMBA 2RUSA 3MTJA 5K8NA 1E6YB 5LSRA 4H13D 2E76D 4ID5B 4OYWA 3Q89A 2X1FA 2B89A 4OJ1A 4LF9F 3LALA 3V6DB 1JWWA 3DRPA 2VIHA 3CL3D 1ZAVA 1KOHA 5KFQA 2JKVA 2NPFA 1KQGB 2Y1LB 1ZOTA 3BREA 2M88A 3CCUS 2DY1A 2BCCD 2QA4G 4N41A 1JY3P 2FBWC 3G4SS 1GK4A 4R5PA 2MJUA 3P32A 1U7JA 1R0CB 4Y2MA 3HXMA 3JQMA 3BBBA 2V4JA 2XGPA 3P5BP 2ZOFA 3X1LB 2N82B 1BDDA 2JEIA 3Q5RA 1SQXG 1UFLA 1YJVA 4LF9J 5HMZA 2CNOB 1LP1B 1R27B 3CXHH 4DV5J 4K4ZA 2M0GB 2RMLA 2BCCJ 1URQA 4C3MA 1NTME 2RQMA 2B9BA 4PXDA 2Y9YA 3T1YJ 4C0OC 3A1YG 4F02A 3AE2C 4CLYA 5CMZA 2B7CB 3FBEA 2ITAA 1YGYA 4AD6A 2R2UA 3CCRP 1TFWA 3H40A 4AYBD 3HKZD 1FZCC 3W66A 2XMJA 1NKCA 4PPZA 3BGFA 4I2QB 2AJQA 1VQSA 1XC9A 3P8CD 4QYZK 4U7JA 3DGPB 2J0XA 4O3PA 3ZZZA 2ZT9D 3UO0A 4ZNCA 1BC6A 3ILOA 5IC6B 3EZUA 2E1RA 1KB9I 1SL0A 1FWKA 1WDDA 4Q8EA 3U1AA 1RT5A 4NYOA 5EX3A 1HFEL 1PFIA 5KFVA 1CPZA 4JV2A 3AE6C 2RIJA 3AY0A 2MQQA 1HTLC 4ATNA 4EO6A 2P6SA 2F8HA 4ZN1A 3VYIA 1HBNB 2BDPA 2AU0A 4KYZA 1S9GA 2BA9A 4USIA 1IBLJ 2VPXB 1YBAA 4OZJA 2VG6B 2XSJA 2PE8A 3CEDA 2KSJA 2QMXA 3HJFA 1IKXB 4HKQA 2AYMA 3J7Z5 4IG0B 1L4AB 1HBMB 4NA2A 2IYGA 3FZBA 4KR0B 2DIUA 4CLLA 3BGRB 4C8NA 2R7RA 3KK1B 3A4TA 3U1CA 2GHWA 5BYRA 2OTKE 4HLBA 2KZZA 3KJFB 4FP9A 2HLUA 4ZN3A 4JYAF 4DFKA 1U1LA 2PSZA 2QV6A 1T2KD 2WPSA 2MHNA 4A48A 3G4SP 1JLCA 1U24A 1D9DA 3VALA 4X4RA 3M9BA 3NMAA 4CO5A 3L7UA 1G1JA 3O1LA 3N5FA 4WE1B 3OFHA 4B86A 2XMMA 4ITSA 3JSBA 3CF5Q 3BBFA 1J5OA 3NGTA 4B3SJ 4Y0FA 2RH3A 4LUBA 3RK3E 4R4LA 3DI6A 1E6VB 5LL6d 3VWSA 3DOLA 2HKEA 5EFWB 2XSJB 5KOWA 1SJ1A 4ZVUB 1SCJB 3DYAB 3A3YB 2H89C 5B66E 3UR3C 3M6VA 1PP9D 1P1TA 1FDIA 4OH8B 4P7VA 1JMTA 1T0TV 4W7ZA 2C3YA 3KHRA 4QMAA 3N6LA 9ATCB 5KFDA 2W2OP 1PL5A 2DRBA 1Z2LA 3R1HA 5B0CA 1SIWB 4R25A 1QY7A 1YJTA 5CAAA 2CJXB 3FQLA 2R2RA 5HJYA 5HBMB 4F0MA 4K4VA 2VL1A 3OL8A 4LF5F 3HSZA 3PX6A 2R5DA 2V34A 1HYSB 2DNYA 1D8ZA 3D66A 5E33A 3DLJA 4CWBA 3PFOA 2AJ4A 5IXUA 1J2JB 1S0MA 4A8QA 3B4SA 1OFCX 3NMRA 1RE1B 4GIFA 2WK4A 1VPCA 1UWBA 1FAVA 3ZZTA 1IBKJ 1L0LJ 1HNXF 2XI3A 2OUGA 3EWGA 4DLEA 3MCSA 1RAGB 2ASLA 1S9EB 3BDEA 4JYAJ 4B17A 3V2NA 3N7NA 3P5TL 5M2PA 4I7FB 5HQLA 3P7KA 1K8AT 1SQXK 2JJ4D 5HAOA 4O9BA 2QT7A 3L4BC 1KILC 3M8YA 3MWBA 3VTIA 2CQPA 1GXLA 3LAKA 3O3LA 5L38A 1W26A 4C8OA 2KO1A 1VQ6S 8RUCA 3IR5B 1IJEB 3LIDA 1HYSA 2NPSC 3K5OA 4IOIH 4IH6A 1L0NG 3FGAD 2WSCC 4O4GB 5G0RA 2H3EB 3VMZA 1H0TA 3BCCD 4KRWA 3GCWP 3OSNA 1T9XA 2B9EA 3PJ9A 3I5CA 4FYYB 4QIFA 2M5AA 1T9WA 2XS7A 1BY9A 3CJTA 5B09A 1JY2O 5KG1A 2XCPA 4CO1A 2QRXA 2Z57B 3PLNA 3S01A 4CCHA 1RGVA 1DRZA 1TL5A 3CJ3A 2QLBB 2O67A 4ZPWR 2AX1A 2CFXA 4F4WA 2JWAA 3H1JD 2VJVA 1FF2A 3L75J 2K2PA 4DQIA 2H43A 4KPCA 2VFTA 2YTCA 3Q83A 1F5BA 2HWTA 4IRKA 2FJEB 2LECA 3KDPB 1Y9OA 4B08A 1J1DC 1Z2ZA 2QJPB 4NZ6A 1UVIA 1RT3B 1UWAA 3OL9A 1Q95G 2J58A 1VRTB 1RYRA 2KT2A 4K0KJ 2VDHA 1IWAA 2XV5A 4KHPF 3CI9A 1O5JA 3ENVA 1DD3A 3LF0A 2J7UA 4OI2A 1AW0A 1ZA1B 1TAQA 3T1YF 2WSFJ 4ED4A 5CZXA 1IFIA 2Y8YA 4LT6A 1GMUA 3SYZA 3DOKA 2MTLA 1KYOI 3DOLB 1FNXH 1EETA 3AHPA 4QQBA 3R2CJ 3FBBA 3TA1A 1X4HA 3S1TA 5K14B 3EVWA 1L4AA 2WT7A 1HBMA 3RG6A 4WB4A 1IR0A 4A8YA 2DGQA 2VA2A 4XA4A 1L3TA 2YNFB 3AEDC 1D1UA 3DLBA 1HNWF 4JI7F 4PWUA 5E79E 3BN4A 3LW5J 3T5HA 1PPJE 2NUHA 2B3TB 3BQ1A 1NU1E 1BQNB 2OPPB 5KJ7D 5KAFH 4V19X 3BSAA 1Z1ZA 3D6MB 4IFMA 1J27A 3TQEA 2J7WA 2D2CB 1RT4A 5AW3B 4WFYA 1TKTA 3NXZA 3OUYB 2A10A 4CLUA 2MQ8A 2ZKUA 4HI2A 3QBCA 1K73T 2IJRA 5T41A 2HK3A 2AXTE 2IZ0A 1ACMB 1S5ZA 1XMQJ 4LSZB 3AE7C 1ZLLA 2BM0A 3P96A 3H1LG 5KFNA 1PP9E 3L73G 2OFHX 5J2NB 1RE3C 5EN1A 1I94J 1WOPA 2UXBJ 4DFMA 1PGQA 1FZFA 1LFWA 3CCLP 4X4QA 2ZHOA 1OMIA 2KXHA 1FE4A 4F3QA 3VAMA 2IJNA 2N3OA 5JVGQ 4B9SA 4O4GA 5G0RB 2IPOB 3PP5A 1PYOB 1JLEB 1AV1A 3QLHB 1NK4A 4RUCA 1WC3A 3W62A 5IT0A 2D9PA 2Q7CA 3C6UA 3OL7A 4ICLA 1KP6A 5APTA 1EX8A 5KFHA 3G82B 3GP9A 1EZVI 3H1KE 3MHYA 2EFQA 1CC7A 4OLPA 3L73E 1YTZT 4Q7AA 4Y2CA 1IKVB 1IR2A 1G7CB 1G1IA 4HDHA 2DR6A 2WVDA 2VG7B 5KG3A 3PW0A 2JEJA 5DQGA 2MB0B 4DOZA 1AROP 3DRPB 2D3OR 3CW2C 1SQQE 4P9SA 5CCHC 3BPSP 2Z2ZA 2V8DA 3KLGB 1AZSA 4PUOA 4ED5A 2CNLB 2YX7A 4A46A 5BXIA 2Z5IA 1VK8A 3M2RB 3HE4A 2HODA 2LXCB 1AUDA 2XEXA 4JI0J 3CX5D 1HJBA 3FSXA 3BF4A 1S1XA 1YQ3C 3QSIA 3LWMA 2JDIH 4YB5A 1NVOA 3CX5H 3PFEA 1FWLA 2R44A 1IO4A 4U9RA 4J9MA 2IBZD 4OYMA 3CT9A 1QTNB 1V6HA 2HQDA 2ZE2A 3OVBA 2RKIA 4J91A 5IT9U 1RT6A 1MFTA 1UJ6A 3UW1A 4ECZA 2KN4A 4KKOB 3VV2B 3H1HJ 5KLVD 1K04A 4IOAQ 3M2VB 2K7KA 1JTHA 4JUZA 3JTNA 2GO9A 3CCQS 2D3UA 2F65A 2M5YA 5KG2A 3FFIA 2KP8A 3ENWA 1B0VA 4W98A 2IBZE 1HQ2A 3ZTRA 3FEYB 4DR3F 2NXNA 2R7XA 2FYUK 5A0YA 1HH0A 1OVUA 4I4BA 2J9EA 4J9LA 1HIYA 3MR3A 2VOPA 2VBWA 3TAMB 5CBNA 1NK0A 3CCLS 3VGTA 4GOEA 3TARA 2FVSA 3HSGA 2RN0A 4ZMDA 4A7PA 2IBZI 4DV7F 3D28A 2V0NA 3NGDA 3CC4S 1FXDA 5F0WA 2AEMA 1JLBB 1RI7A 4NPEA 5BU5A 1NTMD 4FKXA 2ZC4A 1LT9B 5GMDA 2MYFA 2HVZA 2BANA 3PR4A 1K1QA 2V63A 5AW7B 1JLFA 4UQTA 3I82A 4I1TA 3RZAA 1U7MA 1ZH5A 1S1WA 1EDLA 2APOA 4B3OA 2VBZA 5FLXY 2ZM6J 1VDHA 4RW7B 1V3ZA 4LVOP 1AVYA 2AF6A 3M32A 1NKBA 3QFWA 3IRXA 4O3QA 4RW6B 3GPAA 1ZW0A 1JX4A 2G2OA 1K9MQ 1HI1A 4RESB 1SJRA 4Z2XA 3R27A 4DWIA 2ZOGA 3FXDA 3HFVA 5AE2A 1LT9C 3V4IB 2XLKA 3K5BA 5BU8B 1N4LA 3TGUE 1WG5A 1KHWA 3EJMA 3NL0A 3CJQA 3VAJA 3L70G 1IBLF 1RTIB 2J9CA 4WXWA 2CZ4A 1VS3A 5DETA 5GTIH 1FZAA 4IL6X 3HHDA 2PRRA 3MIWA 4P75A 3OTOF 2RVJA 3RL0g 3UE2A 5J2PB 2V8PA 4ZMMA 2R7VA 1SQQD 3DMJA 1S5LH 3MAHA 1X4DA 1PBUA 2IZ1A 4QOTA 4F50A 1JLBA 2DCUB 4I2QA 3TWZA 3P49B 5KFZA 2LA6A 1IFDA 1PIXA 3LP2B 1BGYG 4I6MC 4DT0A 3PXGa 1EQMA 3MEGB 3CDBA 4JYCA 3QZ8A 1EZVE 3G8TA 4DX5A 3M6XA 1DQ8A 1KQLA 2C3UA 4J7CA 5HP1A 2DR5A 2FGCA 2BOPA 3W65A 1H2UX 1JUNA 3FWLA 3DGVA 1RT1A 2NXJA 2F5GA 1FVQA 2UXCF 2WVBA 4LGDE 3SEOA 2O66A 1QSLA 1DAXA 1ZRTE 2AWZA 4NA1A 4Y2KA 4RPFA 1SUQA 1NZAA 1VR6A 4Y3CA 1SXLA 4RU9A 4ZIVA 5T7LB 3A8EA 4WK3A 6AT1B 3AJDA 3NY0A 3E3XA 2CQHA 3UDEA 2UXDJ 1X9WA 2K1RB 1N5SA 2FVRA 2C9NY 4DX8H 1AYEA 4OX6A 4GVLA 3I6PA 3L74J 2VODA 3KLHA 5TISH 4U7UK 4PJ0E 1VRTA 1SL2A 1LOUA 4DSLA 3LP0B 2I5JA 1NTZJ 2XBPA 4NI2B 1CI6A 3IFMA 2HSEB 4C46A 1BGXT 4NLVA 4C7QA 1TV6B 5E5NA 2YWWA 5T7LA 3AB4B 2VUGA 2NRGA 1B70B 2J7KA 3HF5A 4L76A 4J9SA 3CNQP 4IUFA 3MXHP 1S76D 1U1OA 5LSOA 3SBMA 2Z58B 2I1RA 3HPOA 3RJMB 1FFSB 5K8MA 3W9IA 2HVEA 4YMEA 3MURP 4JI3F 4ANEA 2W8KA 3CX5E 2Q43A 1UEKA 1BHNA 4XO0A 4RBVA 2MY8A 2O01C 1IKYA 5CCLA 4DL0C 2DNMA 5H1SV 1NH7A 2IBOA 2WOMA 1HNWJ 1Q82T 3GFXA 5CQGA 1GH8A 3A13A 2KFYA 2GUSA 2E42A 4ED2A 2RU3A 2M8DB 2B88A 3E01A 2OPSB 3OHAA 1CJTB 3M6UA 2XNRA 3GLMA 1SB6A 1IWGA 4FYDA 2MLYA 1JLEA 4DSFA 2QO3A 5D0GA 5J1EA 1C0TA 5LJ5Y 2Z56B 2VPZB 1M7LA 3FGVA 2C3PA 3CJSA 1RQVA 2LQ8A 3CIZA 3HD7B 1YYCA 1S9KD 2V69A 2C0XA 1PAEX 5HBMA 1U2RA 1Y3KA 3US5A 1SFCD 3CCJS 1FJPA 2DNRA 2ABYA 2F9DA 1RTIA 1KQFB 1KQKA 3VVUA 5E3RA 2C9LY 5B08A 1NKZB 1Q16B 4C6AA 1K47A 1M1JC 3HZGA 2FLOA 2H7HA 4QWBA 4P71A 2ZXXA 2R2SA 5MLCV 3Q8VA 2NS1B 2XC9A 1R43A 2PEBA 3VF0B 3RK3C 1GAOA 5DDPC 2QG9B 4EZ6A 3E1IA 3RRHA 1Q81Q 2U2FA 5KT7A 2YIUB 1CSBA 4N47A 3N4XA 1BWVA 3M9MB 4I2PA 1K1SA 4UB8E 2A2CA 1HQUB 2ZH5A 2NUUG 2ROPA 3KJVB 4EMDA 1WUUA 4O4RA 3DU6A 3CX5I 1QAYA 1I3OB 2E9RX 5IZHA 5AXKA 2OELA 5KAIH 1RTJB 4ZVOB 4MT1A 3A5TA 1N7SA 4QWDA 5DZ7A 2GIQA 5DO2A 3CJ0A 2ADBA 4WP9A 4M5KA 4HVZA 1BQMA 3D1OA 3M8QB 3HCXA 2XMKA 1WJ9A 1HF9A 3GG1A 2NLWA 2A6OA 3RBDA 1C0TB 1F0XA 1U4BA 3NAIA 1ZMEC 3A3NB 1HMVB 3BGOP 3DHWC 2K8GA 2YKQA 1TK5A 1URQC 2O3DA 1FKAF 5DZ6A 3U27A 2AJ0A 2W8ZA 4C8MA 3E7KA 3TNUB 3WUUA 5H2FE 4D6TJ 2YXRB 3MAAA 5F8HA 1SQQG 4DR4F 4KKOA 2HQ3A 1H7XA 4U3FG 4PG5A 2RQKA 3MEKA 2VRSA 2XMAA 1FKPB 2O01N 2IM2A 2PN6A 4ERDA 1TKZB 2F8MA 2O01J 3T5LA 2HHWA 1WC1A 5KG5A 1TVRA 4JQ0D 4YPCA 3H5SA 1NSPA 4P74A 2UVRA 3NAHA 4KJIA 4IG0A 1YJUA 1SH2A 1TFYA 4LF1A 4GO7X 2AIRB 3KHHA 1ITPA 1ZPWX 3KJNB 4DR1J 4AQYJ 3MCMA 1F1BB 3MUDA 3POTB 1PP9G 2N4DA 5D0EA 1ZN5A 4LF4J 2IDLA 3H1KG 3ILLA 1IQZA 1GTHA 1BCCG 1JOCA 2A18A 2YX4A 4RUHA 1LKZA 5DRKA 3VHQA 2DO0A 1TK8A 1LXNA 1Y47A 5L1KA 3RR8A 3L70D 5AXMA 4NASA 3VMYA 3OTEA 2ZNYA 3SFDC 2JC0A 5FDLB 3BCCE 4NLWA 3Q8QB 3ITKA 3HHLC 1UIXA 4TYBA 2YWHA 2I2YA 2X3DA 2GAGC 1HUCA 2IVMA 4JB8B 2V6AA 2E5JA 3GYGA 3CCMS 2D69A 3H7HB 2B9YA 4G1QA 2FIUA 4BDPA 4JP8A 1U2CA 2MQPA 4LIRA 5GAGI 4ZVSB 1H8AA 4C11B 1FOSF 1FO1A 2IDEA 4ZVQB 4EZ9A 1SVFA 1BE3G 2KS1B 2OPSA 2N7CA 3NOGA 3QWUA 2QM8A 1IBMJ 3VQTA 2BQUA 4ZCKA 2G1DA 3AD7C 3J81j 1UVLA 3KK3A 4WU2A 4Q0BA 1PYSB 4J9OA 3EDQB 1X7VA 2KH9A 2LQBA 3HD1A 3NOCA 4IO9Q 4GKJJ 2VQEF 4K4YA 5D6GA 1LK5A 1SPBP 1F6TA 3BKFA 3M0DC 2EK6A 1HNZF 1HR0F 4NLRA 2RRBA 1N6QA 2M52A 2W9AA 4DCOB 5KJ7A 4NE9C 1S97A 1M1HA 2LEBA 2BJ3A 2Q5UA 4YB6A 2CK3H 2B0GA 5AJ3F 5MAOA 1FT8A 3UNGC 4NPDA 2HHHF 3UN3A 4QWCA 3MD0A 4OI0A 5GAGU 4L3KA 2QLWA 3GZ7A 2KHDA 1UZHA 3PG9A 4DUYJ 2QLJB 2FFDA 3C14B 2VKZG 1KONA 1MUUA 2R7WA 1Q7YQ 3Q2YA 3CD7A 1IJDB 3P3DA 2WVEA 2CXEA 4TYAA 5I4MA 2MZTA 4X62F 1HQEA 3IG1A 1I6JA 2K3IA 3HUSC 4IFYB 2ZH1A 1WEXA 2PD1A 3TOQA 3V81A 4Y6IA 2CQ4A 2MDAA 2EEYA 3WU2H 1SV5A 4K8RA 2WRMA 3VQSA 3TO8A 2QA1A 1M0SA 2V7QH 2LEAA 3TEHB 2QLXA 1J5EF 4CRJA 1E5WA 1FK9B 1KOOA 4Q44A 2W27A 1HWJA 1WEZA 4X65F 3R6GB 2G0JA 4IFVA 1B3TA 2RDIA 2IPPA 3VMXA 3V4QA 3ITHB 4QW8A 3TEGA 3PW5A 2CJKA 4LF8F 4RL1A 1X4BA 1RWWB 4NLTA 1MLAA 1S2EA 2NZ4A 2J9DA 5E7OB 3UD3P 2NCKL 3SSSA 2G4BA 3ABVC 2JVRA 3FMBA 4JI6F 1N73A 1H73A 2QJKB 3SCJE 1FX4A 2A45I 1WDTA 3T3FA 5KT6A 4R0JA 2W4CA 3GIJA 1XR6A 2XNDH 2Z2LA 1RY3A 2H48B 1M1KQ 4DQSA 4TY8B 1RT3A 2CQ3A 3QJJA 3OW2R 4F25A 3H1HE 2E1CA 1YI2P 1P8GA 3CGIA 4OX9F 1J1EB 4CLPA 3D9BA 2JP3A 3FMWA 2IHR1 1T7PA 3HRNA 4KE5A 5KFXA 2BQRA 4PV1D 3M8PA 2AYEA 2GMHA 2K7JA 3MEDB 1NAFA 2VG5A 5IM0B 3GW6A 4F8RA 1VQ9S 3ET6B 4NWBA 3MM8B 3K7RA 1SQVJ 4HYKA 5GVQA 2YO3A 2HZAA 2QJYB 3RW7A 4C8KA 2BRKA 5KFYA 1XTZA 5GMKa 4LR9A 3BM7A 1MROA 3T9ZA 1R8HA 1SQVD 3MMBA 1IQTA 2J9DE 4RX6A 3BCCJ 4LF6J 2DO4A 1VF5D 4CO2A 3CXCR 4IKAA 4AQRD 1MWYA 4TU9A 1IK9A 3M30A 3DGPA 3KLFB 3D1HA 3PHLA 1FRJA 2Y0DA 4GODA 3I56P 2RDJA 4NMLA 2VU5A 4DPXA 2M3EA 1N56A 2C0WA 2D41A 2E7XA 3OFGA 5AVWB 2JLGA 1ZAXA 5CCHA 2LU1A 1AA0A 1WOOA 1O0PA 5A8KA 4C97A 2KT3A 3KLEB 3CCWA 4UOFA 3EMTA 5L1IA 1P9YA 4TXSA 4YS2A 3VAGA 1WORA 4DHVA 3HTKB 4E8UA 3W1YC 2CNKB 3GMAA 2Y8WA 1U6BA 3B5NC 1EKRA 1JLGB 1G1XA 3QZ7A 3H1KD 3CWBJ 2ZYGA 3BRTB 2OYHA 4IQXA 3GJTB 3PZPA 1HNVB 3G82A 4DQPA 1OVVA 3QO9A 2UUWA 3IS9A 3AE1C 4JI4F 2BJEA 4LBIA 1WI6A 4F0KA 2E9TA 4H44B 2HHQA 2YNHA 3L4FA 1IM6A 1LTAC 2V4HA 4H4OB 1J1DB 3D3BJ 1HBOB 3M2UA 5L39A 4ILLA 1CULA 3CCTA 1TKZA 4LFAF 4ECTA 2RMZA 1F2GA 2AMCB 1K05A 2XU6A 1NHVA 1RHRB 1FJGJ 2H5JB 4ZITA 2UWJE 4ZVRB 1OPIA 1CI6B 2ZT9B 1JMBA 4FBTA 4KT0J 2OIHA 1J5OB 2CPYA 2BACA 4N5SA 2IDBA 3OUYA 1YDLA 2JSXA 3EX7B 1VBYA 1VK3A 2YXQB 2BRLA 1GT8A 2ZBRA 1FJCA 1SKUB 2RE1A 3H1JG 2FYUD 4NZ7A 4XFJA 4MJKA 4LJMA 2DPIA 2JVOA 2IRYA 1S99A 5JVHQ 2JO1A 4N76A 3ISNC 4C0HA 5DJTB 1YRTA 5DG8A 4GC7A 5KFSA 3BQ0A 1QUPA 1R0AB 4ZIWA 3L7OA 1S1UA 1VISA 4DL3A 5IT9Y 4NLPA 3J7ZT 5ETTA 2ZWPA 3O8WA 4WY4D 3W8GA 3VAIA 5KT4A 1GK8A 1P6TA 1NTMJ 5AW5B 1QJHA 3GV5B 2XNXA 3O6QB 2MSTA 4DPTA 4RW8B 3TZXA 4AYCA 2OMLA 2G2YA 2CG4A 2GQCA 2VDIA 3TR5A 3W63A 4I6YA 2DHGA 4YOEA 3SDEB 1YX2A 1RWXB 2P5VA 2QIWA 3R4YA 3W9HA 3MAQA 5BYSA 3PYEA 2MQNA 1M5SA 2QA4P 2HYIB 1WT6A 4BWNA 1U0SA 3VGVA 3IRXB 4WFAQ 2J0WA 4O3SA 1VLOA 3IM9A 3VOPA 3EQ2A 1PPJD 1L2PA 3KPEA 3JTPA 5JUMA 3SIPB 3CC2P 3Q8PB 4CTAB 1IK7A 4YTPC 2HHUA 5D4PA 1URNA 3MMCB 4QIEA 3HP6A 4LSLA 5KLVJ 1KC8T 2JWDA 3B78A 2A0FB 1TAUA 1Q7YT 5AVTB 3WDOA 3BYRA 1RT7B 4AL5A 5IC4B 3LPYA 3HVTB 5LXRA 4OFZA 3WBZA 2D9OA 4DV1F 3THVA 3M9NB 2YNYA 1WTBA 2RS2A 2QL5B 3NCQA 2K37A 5CJ4A 2PIIA 5D4OA 4BC7A 3TUIC 4B3TF 4FN5A 1URQB 4B3OB 3L71J 1RCOB 1LW2A 1RF1C 3N6MA 3T41A 3CCJP 3JSYA 3GYNA 3T19A 4TLQA 1CG2A 2IRXA 3II6A 2MZ1A 4DR2J 1KB9E 5CHXA 2D2CD 4C11A 1G2EA 4HTJA 3UVJA 1K44A 4Q5VA 1FZEA 1ZR2A 2QE5A 1N7LA 3J7YI 1ZAWA 2R42A 3CD6P 3ZZUA 4Y65A 2J8SA 4ZPVR 1N73B 3DLKA 3TYYA 4YY3J 1T94A 4PD4I 2PMHA 1OY8A 5AT1B 5L1LA 1WEYA 3IBWA 1RF1B 2YNFA 1X5PA 2KXNB 3FCHA 4M5DB 4DZOA 5IWAF 2WVCA 1MFZA 2M0BA 3AE4C 1WSRA 4TU8A 1FJGF 2QZ8A 1JJ2R 1Q78A 2X7IA 1T95A 4NEYA 2QSWA 4HACA 4DV3J 1QAIA 4CP5A 2CRLA 3HHKA 4FF3A 4U8VA 4BRYA 4OX8A 3N28A 1N33J 1DY3A 3FK4A 5CYQB 3K5MA 2C2RA 2N1TB 2QJKC 3Q8SB 1NYHA 3KDNA 2QYGA 1UZDA 1BQXA 3LO3A 2Y1IA 4NXNF 1GX5A 2GIFA 1SKWA 4FF2A 3OBIA 1EDKA 1X4EA 1U25A 2HG4A 4DG1A 2W2MP 1T05B 3I4HX 2FYUJ 2ZDPA 1PPJG 3MM6A 3D6TB 3RRKA 2MJZA 4DV2F 2DXDA 1YJNP 1RLCL 2P9CA 3DDIA 1NSAA 2DGTA 3R5CA 2FYZA 4M8LA 1JJ4A 1VQ8P 2O1KA 1Q5YA 2H9ZA 3V2QA 3THTA 2VH7A 3KUGA 5F8LA 4OVNF 5D4NA 5BR8F 3I56S 5D3GB 3FVYA 1PJ6A 4NA3A 4ZDNA 4DL5A 1C4CA 1FD2A 1EKSA 3HHEA 2WITA 3OR2B 3KLHB 4TT3H 1CQMA 4CLSA 4B02A 1VQ6P 1NHUA 4GKGA 2LDIA 2GC8A 1S0VA 1ZBTA 1N86A 3TX8A 1OW8A 1PGPA 4OZ2A 1Q81T 1K9MT 3W2WA 3QGGA 2EFVA 3VGUA 2F9JA 2MXYA 4X4VA 3BO3A 3AE3C 4PWDA 5B0GA 1WI8A 1Q86Q 3EYZA 3DLGA 3KJQB 2HW3A 3W68A 4ALZA 2B9WA 4CH0S 2YNGA 2A6MA 1VRUA 3R7SB 5EWFA 3JQJA 3P8BB 1RT4B 2WBMA 1BLUA 2MLXA 1EARA 2CPFA 3FQKA 1WG1A 4Y28C 2YH0A 3CDAA 5GADU 1REVB 4DPOA 3R2DJ 1HKAA 2NPSA 3Q86A 4K5SA 3UDVA 2O01H 1FBMA 2OPRB 3GV8B 3PHTA 4DR6J 4JI8F 2V67A 3H6PA 3VVTA 5KFAA 2FXPA 4F2SA 4U3FD 4USTA 2OTJP 2BJ8A 3CD5A 1B7YB 1LTJA 5E3AA 5F9NA 1YITP 3PVXA 3M9QA 2ZJQQ 2V4RA 2RAQA 1LTJC 3H4DA 3C16A 4ZKUA 4KH1B 3W3SA 3TVYA 2FC8A 4WFXA 1S1WB 4I67A 4Y34A 4DX7A 3CVKA 4EGLA 4A8XA 4M5GA 5CCGC 3A0BE 4RW8A 4KAIA 2LEPA 4TY8A 1U48A 2KNCA 4A8OA 1TU3F 2DT9A 3SSQA 2MKJA 2Y0SD 2Q1LA 5A76A 1RBAA 1MZ9A 3QT8A 3USSA 2XYHB 2CJYB 2X1BA 2FTRA 4N3YB 3WUVA 2XLIA 3CWJA 4QYZJ 2VBXA 2XGQA 1H89A 2ZFHA 1F5CA 1RAHB 2KJVA 1VQ8S 1RQUA 3BPDA 1C1CA 1KQSO 1PCAA 1QUVA 3QT6A 2MQLA 1N7SC 3GWCA 1JEKA 2E9ZA 4CLTA 3HE5B 3CWBE 4CTAA 1KR4A 4K4XA 3CC4P 4LFCF 2Q6QA 4M1KA 3F44A 3MR7A 4OJHA 5AXNA 2W7OA 1DTQB 2E5TA 5CCGA 4I56A 2QA4S 4LLHA 2ZZTA 2VJUA 1FESA 1DEBA 3F0NA 4WK1A 1D0EA 4PG8A 2BABA 2QL7B 3PO4A 4X4UA 2K1RA 3TUZC 1U6ZA 2HNYA 1N5YA 1FRIA 1ZETA 2GNKA 1OWAA 1AVOA 3ZTPA 3HK2A 2ZH3A 1G6BA 4PR6A 1LTGC 3M05A 4OV6A 1EP4A 3L70E 4O23A 4GKJF 1OPZA 4MKAA 1NB7A 5LM7E 1RKIA 2N3LA 4P52A 4ES3A 4DOJA 5APQA 2W9BB 2IA6A 2QN6B 2UUAJ 4F4AA 1SH3A 3NGUA 1R8AA 1N32J 3UN5A 1AFOA 4DEZA 4F4KA 4AFFA 2XTJP 2AQ4A 3H1ID 4TNOA 5LMUF 1MW7A 4PEOA 1M1KT 1PYTA 4H4OA 3RL0D 5A8KB 1I5OB 3EE3A 1KD1Q 1P27B 1FNMA 2FZKB 4CPGA 2P10A 3AD9C 1RTHB 3P4UB 4GO5X 2L91A 5DQHA 1KHVA 3U7JA 3EGZA 2B87B 1U8WA 4F26A 1JXLA 1M90Q 5HQMA 1UVKA 2BEFA 1TKXB 3TJ8A 1RF0A 3GSDA 4UOCA 1FEEA 4OHXA 1IKYB 4LF4F 3QRPA 3CCMP 4DR1F 1OX3A 4AQYF 4NEZA 3Q8RB 6FDRA 3BN7A 3CDEA 1NU4A 2KDOA 4LR8A 3ZTSA 1DLOA 3IAS9 2ALYB 4V1Ak 4ZVTB 3QT7A 5C39A 3UCGA 1F3VA 2W9CB 1V9OA 2KL8A 3V2RA 1WG4A 2L41A 4ECQA 4OHYA 1FZCA 4DFJA 3DI6B 5J1NA 2WSCH 4WPAA 4F7VA 1NSKL 2CQIA 1RTHA 4EYHB 1TL7A 1EDIA 2FKWB 3MPUB 3MM9A 3CWBD 3CC7S 4C9DA 4QR0A 1Q79A 3F5HA 2WB4A 4P7TA 1DD4A 3ULHA 2RF2B 3S9OA 3DRRA 1R5LA 2MQOA 1N36F 2QX0A 1USEA 5L8RJ 1Q7LB 4R4MA 2HVDA 5KG6A 1TL3B 1KWMA 1SQVK 3AFGA 3OA7A 3CXHE 2EK1A 3DRSA 3HT3A 2AJFE 2JC1A 1NNDA 4DSIA 1KFMA 2JWNA 4ZPBA 5ETNA 2CNNB 4DQRA 2FXOA 3MMCA 1P84I 3W2VB 5I42B 4WIIA 5JMNA 2ZH9A 5CD4H 1SQXE 1S4FA 4IR1A 3EWKA 5D15A 3OR1A 3HI9A 4N77A 5AVRB 2IFXA 5IV3A 1U8SA 4KFBB 2B8PA 2B5JB 3L74E 1HL6A 1NWQA 4KY3A 5HMWA 4U67Q 5HVHA 1NRKA 2XQCA 4DL2A 5J2PA 1BDCA 4RNFA 2V50A 1UETA 1T9TA 3H1IE 3ILJA 1IKXA 2GHVC 4GDOA 4DCPB 1LWCA 5KFGA 2EI5A 1T3UA 2WPRA 1K73Q 2V2VA 5B0BA 3H59A 5AW9B 3Q8YA 3K57A 1JLAB 2M4MA 1F60B 1YKWA 1VF5B 1C1CB 1UJ5A 2QYCA 3ICLA 4F0HA 1OYDA 4YEAA 1S1UB 2P9GA 2C2KB 4ED8A 2LXBA 2B56A 3QIDA 2FJDB 2JJLA 2HS0A 1HQUA 1TMMA 3CTRA 3H1LE 1F5AA 1RT6B 2E7WA 4USWA 2LCWA 2CQGA 3PO5A 4LRAA 4PKDB 2AGOA 4I2PB 4NOHA 1YI2S 4OGQB 4MIWA 4RKUJ 5M1BA 3L95X 3V81B 1SH0A 2M2BA 3FSIA 5D0HA 3JS9A 1CW5A 2YNHB 3EGWB 2HIYA 1HI0P 1LGHB 4BC9A 4OYBA 2RHSB 3RB4A 4NL5A 5GAHI 4CI0B 1L0NK 2CQDA 1X8DA 4IL6H 1VQ9P 4H0LD 3C14A 3C16B 3CMAP 5FLXU 4OX9J 3CCEP 3FZ2A 1KFNA 1DH3A 2W01A 2OYHB 2W6AA 3WMM0 2DIVA 2OJ3A 3MM7A 4OYZA 3Q22A 4X64J 3WHIA 2WZ1A 2Q3PA 1NB2A 4D3HA 3DRRB 1D8YA 2NXUA 3TGUJ 1HGZA 5H9FK 4DU8A 3CC2S 3T6JA 4QYRA 3KLEA 2ADCA 2WPVB 2GMJA 3AOBA 4TY9A 1UIIA 1S9EA 3KUEA 1DHMA 2CQ1A 1WELA 2HLTA 1SQPE 3W9JA 2IAJB 3MHVA 2C2EA 1N7SD 2HHVA 2MKVA 5DLGA 4HT7A 2P7JA 1KV4A 2DNLA 1HD1A 3CUNA 2DH9A 3MDFA 4ILRA 2E76C 1OO0B 2YKNA 2FB0A 3I0SA 2R3VA 3FCVA 2RKIB 2EBEA 1RUSA 1ZPVA 1WMKA 5KFFA 1VRQC 2ZITA 1NHLA 2Q3EA 1N36J 2K9JA 4EYIB 3QRRA 1UEVA 4G6VB 3K5LA 3SWKA 3S7RA 3N79A 4NCGA 4URSA 1MMDA 4FF1A 1TL1A 1HW9A 1VBXA 3AEAC 3NS6A 2HFVA 4JI2J 3QGIA 6FD1A 2HPCB 3H32A 5ETPA 3FEZA 4BXLA 4MIAA 3TZWA 2XULA 2BASA 1KN7A 1TMJA 4NMXA 4U95A 5BJRA 2FYUE 5EWEA 1JM0A 1DBDA 2X1AA 1VQLS 4PV1C 5AW8B 1C1BB 2KG1A 3H1IG 2YO2A 3PW2A 3CPWO 2JNJA 2WAQD 1H0HB 3MAAB 4OQJA 2W9BA 3U1NA 2HRTA 5KOXA 3LP1A 1LWEA 1PGZA 2W2NP 4LFBJ 1CLFA 5C42A 3G87A 2PA3A 4ETXA 4DR7J 4FXVA 1KVJA 2W2QP 2DNNA 1USDA 4KFBA 2OD6A 2DNPA 2DRAA 2DNKA 2HQIA 2YXLA 5DDOC 4I0WA 1REGX 5AVYB 4GKKJ 2QFJA 3CCZA 4B3MF 4NXMF 1W7WA 3L36A 4IRDA 5KTQA 2MPUA 3I96A 4CO3A 5KKZB 1W2BO 2H88C 3RL0B 1QL2A 3UQSA 1NBEB 2I8EA 1JCCA 3MR6A 3PV8A 2XO6A 2XMWA 2YY3A 3H90A 4PXCA 1GNKA 4HHHA 2H4WB 1QVGO 2WQYC 4MFBB 1F3FA 3AE8C 2QMWA 3HVRA 3J80U 2KFZA 3T1HJ 4NYZA 4A4JA 3CB4A 3MPVA 5M2RA 1C0UB 4LSLB 3G71P 1YZ6A 3PHEA 1FI4A 5C25B 5E41A 2FJVA 1RACB 4LFBF 1EAYC 1FKOB 4WP8A 1P84E 3CMEP 1D9AA 2YVSA 2DGOA 1S9GB 2KM8B 3M8SA 2OPRA 5E3QA 1FHTA 1A02F 2KG0A 2G1HA 3E01B 1L4AC 1R8EA 1T3JA 4C2MA 1RE4C 1DLOB 2OTLP 4FXDA 3W64A 3DC2A 3SSRA 3A8KA 4HH2A 1RXOB 1TZ0A 2F4VF 2HVHA 4NZ0A 5IT4A 1RYSA 4MH8A 4Q2LA 2GQ2A 4DR7F 1T8ZA 1VJWA 1H2VZ 4FXWA 3FWNA 1JNRB 4XDCA 3BEGB 2BANB 2J8AA 4PWWA 3FFIB 1QGKB 1NAYA 4NX9A 2VHGA 3HFKA 3L74G 4I6AA 2R2TA 1A7GE 3B4DA 2E5HA 3MCNA 4C3KA 2M3BA 1JNZB 2W9CA 1P9QC 1NTZG 2E75B 2OTJS 2NPSD 3DLGB 4DZ6A 5J2MB 3UNYA 4DUZJ 1U02A 3IC1A 4OI3A 2W83C 1FFGB 1HJ0A 4I68A 1N8RQ 4EBCA 3M8RA 1CEZA 1N6QB 3TDKA 4M5HA 5IQ6A 2HBYB 4QPTA 1S6QB 2KYZA 4CNZA 4WY4A 2A45G 2R8HA 1X5TA 5A2QU 2Z0GA 2BR0A 1OIPA 2MEWA 3ZXWA 1WOSA 3KLVA 3OSPA 4OMFG 4I69A 1Y00A 1A0OB 1SQPD 2A3JA 2R8IA 3IRWP 3HUSA 2GFFA 4FS1A 3HDSA 4YHHF 2R32A 4CH1A 3ZNJ1 1EXIA 3TAPA 4DV4F 1EP4B 5CD4A 4R8UB 1TL1B 1W5CE 1CZQA 3M7VA 3EZOA 4DS4A 1ZYQA 2F63A 2WCXA 3DN9A 1NSQA 2K9YA 3R3TA 3UFCX 1UVJA 1JLQA 4DL7A 2KYXA 3MUMP 1UPMB 4DF4A 3EFFK 4ZPAA 5F8GA 1RJJA 1M57D 2CJAA 2QC3A 1HGVA 1S1XB 5E2QA 4X4PA 1NH8A 3UD5A 3B54A 4B9NA 2QSFA 1F9EB 4ZKAA 1WC0A 1DTQA 3B8HA 1SQPK 2QM7A 1QVGR 3HD7C 4HR2A 4UUXA 4LF2A 4CIOA 4ZP7A 2B7BB 3CCES 2DGXA 3KLGA 2V2KA 1KS2A 2XSFA 3OAKA 3EPIA 3TZYA 3FNNA 1IXKA 1XMQF 4V19J 5KLVK 3OJUA 2CA9A 2FHJA 4X4OA 3MMAA 1NTZE 5DM6Q 4UB8H 1LWFB 1KBRA 2OTLS 1LQ9A 2GUVA 3H1JE 1RAOA 1FWPA 1ZOYC 1NTZK 1SQBJ 5HL7Q 1CJKA 1W2IA 4H44C 1TUGB 3W5XA 4RWWA 4DPUA 3A2AA 4OZNA 3A7OA 5I3PA 1HBUA 4RW9A 3LP2A 2YIUC 1QSSA 2XDJA 3V2PA 1SQQK 3OVSA 1KORA 4UTGA 3M32B 2J59M 1SKSA 2G9OA 3M9OB 1GW3A 1RWKB 1NJIT 4HHJA 4W90B 2BE2B 2IX7C 5FD1A 3S8SA 4L73A 1SQPJ 2BKNA 2WSFH 2OGUA 1PGJA 3HX9A 3FKBA 1OIAA 3M9HA 2W1BA 2BX6A 2V94A 4NPFX 1FA0A 3RU0A 1RAAB 3GG0A 2ZVIA 4DFPA 1M5KC 1NJWA 3MUDC 2MKHA 2KLVA 2E5LJ 1LNQA 1RISA 1TELA 2OHDA 3X3UA 2POHA 4N6JA 4RJTA 3FXEA 4LSNA 1APSA 3V4MA 3A0BH 1VBKA 1CJVB 4NXNJ 3MR5A 4DV6F 2GCFA 1RTDB 3Q2TC 2GZOA 4DU7A 3ISZA 1LWFA 1WF1A 3G96A 1DX7A 3PRVA 2AX0A 3KLFA 1REVA 3KG1A 1LWUA 2EKYA 1YQ4C 1OY6A 1SQQJ 2ASJA 1IC2A 5D78A 2CDQA 2NSBA 4DN0A 2ZBQA 4NLQA 3CULA 2DGWA 3HMJG 3DRXA 4PWDB 4K0KF 3UCZP 3U1LA 2VPWB 3WZ0A 5I3UA 2CPJA 2RUGA 4PAAA 5GTIE 1NTKJ 5HJXA 5BVZA 4JF7A 3ZDMA 4M5JA 1PSDA 2D1CA 3A12A 5HO4A 1XR5A 3GLJA 1WC4A 4UQGA 4H44D 1G2CA 4C3LA 4H13B 5LMNJ 3ONQA 3KHUA 4CO4A 1S72P 2PGCA 2H5EA 1SQXJ 5HVFA 1NK7A 4LQ9A 1LXJA 4NRTA 3JYTB 4F4ZA 4CLZA 4TVAB 2I0XA 1DJ0A 2OARA 1XIQA 4K7QA 3ILIA 3UR0A 1QE1B 1YK9A 3OTCA 1Q82Q 3NWRA 2B4OA 2L9NA 5CHCB 4N56A 1XQIA 4LQ3A 1ZR4A 3BH7B 1Q8BA 2FZGB 3G9RA 2XO7A 2RB7A 2LKZA 1YHQS 4RNHA 3SXLA 1NU1G 3V5BA 3DFEA 4QR1A 3GQCA 3O6QA 1Y3JA 3QMQA 1FDAA 1KNZA 1XBWA 3TRGA 4YB1P 1KTVA 3JCUH 4W4MA 2EW9A 2ZJPQ 2MQMA 2VQEJ 1VC0A 5LT5A 4UB6H 4P2MA 4UOGA 2XHWA 3SQGB 3AODA 2G0CA 3A8IA 1JLGA 3TX0A 2LKMA 1HHSA 2UVUA 3THPA 3L09A 1XTGB 3J7AN 1U1RA 3BBCA 3OD2A 3HTKA 1F2HA 2PI4A 1HWIA 3UDLA 2CPZA 2A45H 3W8PA 4X2BA 2XM3A 1YBUA 3CD6S 4L6V3 1S6QA 2C2NA 1FDBA 1RWUA 2ACMA 4AL7A 1FXLA 3FEXB 4B3MJ 1V3RA 3TUJC 4DR3J 3GV7B 4ER8A 5ETRA 1JXVA 1X0PA 4EEYA 4DQQA 1JO5A 2HURA 4GKKF 3TJAA 1YTYA 1XEZA 1WD6A 1LW2B 1X4FA 3BASA 2W90A 4CYUA 3RB0A 2AV5A 4M5MA 1NJZA 3QLHA 3TANA 3PR5B 3W61A 4ANDA 2FY8A 4H13C 2HYNA 5APWA 2W7PA 2NZ2A 3PW7A 1K0VA 2XZRA 2HGNA 3K5NA 5AW1B 1AA1B 3H98A 3KYQA 4YR3A 2OLWA 3DLKB 4GOFA 5CBOA 2RHQB 4PD4D 3WU2E 5CCHD 3U02A 2WB1D 3G9CA 2MLZA 4OLOA 4YFUA 1VI7A 4EIJA 4WFZA 4C98A 4YR2A 4U3FE 2VG5B 1LTSC 2IM3A 2OSQA 3GR0A 2VD3A 1E6VA 4DR4J 2HK2A 2NREA 3LA0A 1RA7A 2DGSA 1N88A 1R5SA 4K2XA 2Z4PA 3L75E 2RQCA 2CVEA 1NJXA 4ED0A 3GJRB 2OPQB 1BD6A 4K4WA 3K89A 4PD4E 2D3ZA 4KH0B 2I6WA 3KUHA 3LIEA 2DHXA 4A8SA 3OLAA 3FBCA 4RW6A 3IO1A 4A47A 2WTYA 1SIZA 5DG9A 4NLDA 2AJ2A 1SQBD 1RWPB 1FU1A 2XS5A 1I51B 2MKCA 1L3VA 2FLLA 3MEDA 3RYLA 1SQXD 1D9FA 1JLFB 3CC7P 4UUWA 4JI4J 3PKMA 1PGOA 1AQTA 1C0UA 3MM5A 1L3SA 4LR7A 1MROB 4Y2AA 1QAJA 2BE2A 5EHHA 2BYCA 2EXUA 2XS2A 3L7PA 1JTHB 4EO8A 1KILB 1JCDA 3DOKB 2PI5A 2N7YA 1MG7A 1NKNA 1L0LG 1AJYA 2RH0A 3NEKA 3UCUP 4GRSA 1U45A 2JFKA 1KZUB 3LWLA 1KDNA 3PIOQ 1T03B 5CABA 2YWGA 3SQOP 4NLXA 1GZLA 1F9FA 3TP2A 1XMOJ 4ZLNA 2ZC3A 5H9FJ 4NLSA 4UZCA 4DV6J 2HFED 3W2VA 2CPIA 3N01A 1UTAA 3MI7X 2CPDA 2OEJA 2N1TD 4Y2IA 3N0VA 3IN5A 4M94A 5I42A 2VG6A 1SQVE 2KKHA 1WACA 2E5LF 3ETMA 3C3LA 4Y28J 2Y0CA 1EZZB 3PIPQ 2PGDA 1S79A 3CXHI 4J9KA 4B3RF 4B9UA 3EFGA 1NLKL 1TL3A 1ZM2A 1RDRA 3DRSB 1IBCB 2WONB 5AW4B 4WF9Q 1BMQB 1X0FA 4IFYA 1YTZI 3VN0A 1FX2A 1HBNA 2HWIA 2ZYDA 5GADI 5BR8J 4UY8T 4LRBA 4JBCA 3L73D 3A0HH 2R7OA 3ZZRA 3FX0A 3KNAA 4OJ3A 2W8LA 3LANA 4YQWA 2FFDB 1OSCA 3RBEA 3HVWA 4S0MA 4ZPTR 1U57A 4CYUB 1FNOA 1UWBB 2EKNA 3HFZB 3ZTOA 2PAJA 1HW8A 1N52B 5A8RB 1ZS6A 1RT2A 2YKNB 5LSLA 4WBFA 2FHOB 4N78D 4TU7A 1AZSB 2EG1A 3WIUA 4NYPA 3DXBA 2MZJA 3I87A 4JBZA 2DW3A 2QA2A 4ZJOA 4C7NA 4PQAA 4R0EA 2J5AA 3MUTP 2DNQA 1GL2C 2ZJRQ 3ZC4A 4F3OA 2VG7A 1CS4A 1CVJA 3KNGA 3MMAB 4ECYA 3CDUA 5ETOA 3IM8A 4KGVB 4KC5A 5D77A 2DVIA 5FDLA 2ZFCA 4MN4C 4KHPJ 3MEEB 4EUVA 4J90A 1VF5C 3JC22 3NRBA 3SSUA 4WCEQ 1R6VA 2HNZA 4KQZA 1UW4A 3HSJA 2H51B 1YBKA 4PZVA 1HBWA 7AT1B 1HI8A 1YJNS 2C28A 2AEFA 4DPYA 1VIXA 4USUA 3G8QA 1B7FA 3OTBA 1NTZD 1GMVA 2O5DA 1Q53A 2XHCA 1KTQA 4J37A 2VZ9A 2FQQB 3W2WB 1O6XA 1FDDA 3FCWA 2CPXA 5U47A 1LT1A 1FZGA 2Y9HA 5FIIA 1NTMG 1YJ7A 2WWWA 5GAHU 4I1LA 1XNRF 1J1EC 1FCAA 2VA3A 1RH5B 1LTTC 5AVUB 3I0RA 2N1TC 1IFNA 4X62J 1H6KX 4CNYA 3G86A 4WP3A 2XNQA 1SUQB 1QE1A 4L72B 3E8OA 1N5QA 1S0NA 3TZZA 3AA9A 4ZVHA 1LEOA 2L48A 2UV8G 5BYQA 3OW2O 1TR0A 2R5BA 5LJ3Y 3R1LA 3MFIA 3T97A 5D4LA 5A6PA 2MMYA 3HE5A 2Q3IA 2KXPB 2EWHA 3Q5SA 4FYVB 4M5DA 1BXNA 1FS0E 2YPZA 3PY8A 4DR5J 1H2T<