1X22A

Solution structure of a novel moricin analogue, an antibacterial peptide from a lepidopteran insect, spodoptera litura
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
42
structure length
42
Chain Sequence
GKIPVKAIKKAGAAIGKGLRAINIASTAHDVYSFFKPKHKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords moricin
publication title Isolation, gene expression and solution structure of a novel moricin analogue, antibacterial peptide from a lepidopteran insect, Spodoptera litura
pubmed doi rcsb
molecule tags Antibiotic
total genus 12
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2005-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06451 Moricin Moricin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.750 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Moricin domain 1x22A00
1KV4A 1X22A 2JR8A
chains in the Genus database with same CATH superfamily
3CX5I 3JC22 1KB9E 1EC5A 3VP8A 1L0LK 1YYCA 3RK3D 2PGDA 1LWUB 4WY4A 3P7KA 3OA7A 3AE7C 5AW4B 1Q86Q 1ZLLA 4I1LA 4OWFA 3RL0B 2FKWB 3H1LE 2AXTH 2IBZD 1W2BO 2JR8A 3CCMP 2NPSA 3L74E 3CC4P 4H13C 3Q2YA 1S4XA 1ZR2A 1JO5A 2H43A 1NAYA 1VQLP 3MP7B 4W80A 3CXHH 2OTLP 2JDIH 3KHUA 5AW3B 3NTNA 1OX3A 3VMAA 2CPSA 1PP9E 4K3AA 1EZVG 1LWUC 1H89A 4IOIH 1PIXA 3G4SP 2NPSC 2VRSA 4JQ0D 1XTGB 3GHGB 3RL0C 5KJ7D 2M8RA 1M90Q 1BDDA 5TISE 2XDJA 1GZLA 1NTMG 1HTLC 3WUTA 2OYIB 2ZJSE 3S1KA 1P84D 3C1LA 3CX5D 3RK2C 2QSIA 3Q5RA 1L0LD 3I55P 2D2CB 2Z5IA 5CHXA 5AW6B 1S5LE 3V4WA 1FS0E 5CCHC 1IFPA 2QJKB 2O1KA 1U57A 1EDKA 2QG4A 2LR2A 3TF5A 5KAIH 5APWA 2O01J 2KNCA 3H25A 4UB8H 2V7QJ 1IJDB 1KC8Q 3AE1C 2LXCB 2FYZA 3L36A 1N7SB 2RH0A 2J59M 5APQA 1BGYJ 3USSA 1DEBA 1NKZB 2Q5UA 3WU2E 2ZAEB 3AEFC 1L0LG 3HD7B 3CPWO 2OYIC 1NTKD 4ASWA 1HH0A 3L75J 4WBAA 1K05A 4L74A 1ZRTE 2HODA 3H1IG 3BATA 2D2CC 4U7JA 1JNMA 1MFTA 1RE4C 1GMJA 1KYOH 1FC2C 1EQ7A 1KQGB 2HPCB 2P67A 2QJKC 1NTZJ 1PPJD 1T8ZA 5GTIH 1VF5B 1NYHA 4BXLA 4EYYQ 3ABVC 2KZJA 2AXTE 1QVGO 1G1IA 1K9MQ 4B86A 2FYNB 2HPCA 2JKVA 1PFIA 1ZW0A 2HYNA 1KFMA 1RF1A 3L75E 2WPRA 1YHQP 2IFNA 2E75B 2KSJA 2FYUJ 3CXHE 3HD7C 3CWBG 3P8CD 3H1JD 3Q5SA 3CCLP 3A3YB 2ZT9B 5B66H 3W68A 1FZGA 3BVHA 1PPJG 1KTMA 3A0HE 4ZKUA 1DD3A 2N1TB 2Y0EA 1L4AB 4HB1A 2B88A 3H32B 3C9IA 1EDJA 1A02J 2WSCJ 1H0TA 4U3FG 2OARA 3TDKA 1VF5C 2IZ0A 2RKLA 3L70D 4DZOA 3LIDA 2WZ7A 3I56P 1SQQK 1M8OB 1X22A 2FYNC 2FYUE 1VQKP 2KI7B 1OWAA 3H1HJ 3AE4C 2O01N 3O6QA 1SFCB 3HE5B 1CW5A 1VDFA 1FE6A 3H1JG 3SFDC 1SQXK 2ZYDA 3FXEA 2E75C 1BCCG 2ITAA 2R3SA 1LJ2A 1SQVK 3S4RA 1S9KD 3SWKA 2KZIA 2QE7H 1FZAA 3WUVA 4UB8E 3B8EB 1Y8AA 1WMKA 1X79B 1IFIA 1Q2NA 1HUCA 2N1TC 3TNUB 2W83C 4IFMA 3F89A 3AE2C 2C9NY 1CI6A 2N9YB 2KB7P 4NPEA 1YQ3C 2KYVA 4EOTA 1YBKA 2B87A 4Y28J 5CCHD 1PV3A 1RE3A 2HLOA 2FFDB 3V2RA 1MV8A 1MKMA 3ZDMA 1SFCC 4K35A 3QH9A 1XTCC 3WMM0 1VQOP 1IK7A 1LTJB 3FXDA 1JCCA 5K5GB 1KQFB 1NKNA 1MFZA 2IPPA 2AXCA 2I1KA 5KJ7C 5DJTB 3PHLA 2XNDH 2FY8A 1SQPK 3AEGC 2E43A 3EFGA 1GW3A 1L0NK 1NTMJ 1DX7A 1PZQA 2H8PD 2A06G 1SQXD 1OMIA 1RE3C 5CJ4A 1LP1A 3AECC 2D2CD 3RK3E 1FDIA 1PGPA 1SQVD 3KDPB 1IK9A 3OAKA 4MN4C 5CCGD 2BEZF 1KQSO 4NPFX 5APVA 1OVRA 3V4QA 1EZVE 2W6AA 1KMIZ 4BRYA 2FFDC 5KTBA 5B66E 1DIPA 3HUSA 1X0TA 1S5LX 5TISH 2IBZI 1JMBA 1SQQG 5KAFE 4GOEA 1VL2A 1N7SD 2W90A 2W6JH 3AE9C 1NTME 4LC1A 2OYOA 5BVZA 1Y9BA 3VN0A 1SQXG 1S5LH 1YJ9P 3L71D 1A02F 1LTIC 1J1DC 1L0LJ 2A45I 3TGUD 1N73A 1QL1A 2LXBA 3M0DA 1SQVG 4RESB 1PGQA 1LTAC 2BCCD 2G8YA 1UIIA 2P2UA 3H1IJ 5KLVK 3MD0A 4N6JA 1SP4A 3CMEP 4RJTA 1K73Q 1E79H 3A7OA 1JTHB 2HG5D 1QL2A 5AVXB 4W7YA 4A7PA 1IZNB 2WWWA 1YITP 2P1JA 1G1JA 3H1HG 1HF9A 1KV4A 5APSA 3CMAP 3MUDC 4D6TE 3CX5E 1L0LE 1VQ8P 1D7MA 1P84I 3L71G 3LW5J 4LGDE 1N73C 3PP5A 4PD4D 2Q9IA 1YJNP 3M0DC 5AVUB 5AW1B 1FAVA 2Z5HA 3VMZA 2O01H 3EFFK 2E75D 2V7QH 3H1IE 4I7ZB 3MIWA 2Y9YA 2CK3H 3F5HA 4WB4A 3CWBJ 3MGNA 1BE3E 3K5BA 2ZT9D 1LWUA 2ZFCA 2RMZA 2ZYAA 4RKUJ 2BEQD 3L72D 2C9LY 1LTSC 1M1JB 1SQPG 4W7ZA 2N1TD 1VPCA 1URQB 1L4AD 2AEFA 1QVFO 1L0NG 2OYHB 3II6A 1LTBC 1SVFA 4HH2A 1T3UA 2AEMA 5AW8B 3CD6P 4U3FJ 3HTKB 1M1JA 3CI9A 3CCSP 5AVWB 4QMAA 1EDIA 1NGMB 1Q90D 1NTKK 3TSIA 3NXSA 3AEBC 3CWBE 1SFCD 5KLVD 2QM8A 1WRGA 3A0HH 3H1JJ 2YXRB 5CCHA 3GW6A 1BCCJ 4PV1D 4I7ZC 1NU1K 1N2DC 2IBZG 1PPJE 1YTZT 5AVTB 3WUUA 3S9OA 1JY3O 1ZXGA 2HR3A 2SPZA 3KYQA 4U3FE 1M1JC 4Y99B 3FWNA 3L73D 1JB0J 5CBOA 4OVNF 3GHGA 3G71P 4DT0A 2A45G 1JCDA 2PP6A 2OYIA 3KZIH 2KLVA 5KLVG 1SLQA 2C0WA 4GT1A 4H0LB 2MKVA 3M91A 1BCCE 3FWLA 1DH3A 4IL6E 1KB9D 2WSCH 1RE4A 5AVZB 2E74B 3CCJP 2P58A 3A5TA 1JUNA 3GHGC 3T97B 3N4XA 3L4FA 3M9HA 1NO4A 3Q1MA 3L74D 1OVVA 1N7SA 1M1KQ 5CJ0A 1WT6A 4Y99C 3G3ZA 3GLMA 1YTZI 3AEAC 1G2CB 3SWFA 4EIJA 5E79E 5KLIB 1QLED 3HD7A 4TLFA 1NU1D 1QGKB 5CCGC 3NMDA 3H1KD 1KILB 5BU8B 1G2CA 4ZNCA 2QJPB 2L5GB 4YXDC 5DJUB 1BGYE 1GK4A 3BRVB 3E1RA 1PP9D 1N7LA 1HBWA 2E74C 2YKPA 5TJHA 1N7SC 1SQQJ 1M7LA 4KHXA 1ZR4A 1OIPA 1NTKG 1N86A 4AYCA 3VMXA 4GDOA 2CPBA 2A06E 2WMMA 4C7NB 1SQXJ 4PJ0E 2IFMA 1J2JB 1YI2P 1NU1G 2M3BA 2WVRA 1KZUB 1ZN5A 3L37A 2YXQB 2ZVOB 1NTZE 2E76D 1SQVJ 3H1KG 5APXA 1GL2B 4C7NA 3I5CA 5KAFH 2C0XA 4XE5B 3PJSK 1PP9G 2XV5A 4ZMDA 1EDLA 2Y0DA 3EWKA 2QJPC 1SQQE 1VQ4P 3IR9A 4KT0J 5AW0B 2K88A 2N1TA 1L4AA 1GD2E 3H32A 3BRTB 5APYA 4HYTB 1SQXE 1LGHB 3L71J 4PV1B 3KZIE 4WY4D 1KORA 1LT9B 2KK7A 3IN6A 1S1CX 2P10A 3HE4B 2WTYA 1SFCA 3HE5A 4GKGA 2FYUK 2V4HA 2ZT9C 4GODA 3B5NB 1FBMA 1OXZA 2QJYB 1PGJA 1USDA 3L70G 1X8YA 1L4AC 1SQPJ 2H88C 3CX5H 5KJ7A 2XKMA 2M3EA 1FZCB 1URQD 2KOGA 2FXMA 3H1HE 4N3YB 1L0NJ 1SQBK 2GUVA 1ZMEC 3TNUA 3IFMA 2JP3A 1AV1A 2QRXA 3CCQP 5AVSB 1OW7A 2YIUB 3N7NA 1Z56A 2M0BA 3CXHD 4JPZB 4PV1C 2KSEA 1KQLA 1AA0A 2M5AB 1LT9C 2FFDA 4L73A 1SQPE 3U59A 1BSNA 1FZBA 2K9YA 3LW5H 1LT1A 2QJYC 2Q6QA 1L0NE 1LTJA 3EQ2A 1AFOA 2M5AA 1KYOI 1QX8A 1BSHA 1FZCC 3IF4A 4PD4I 2H89C 1RF0A 4M3LA 1X9VA 2OGUA 2FYUD 3HRNA 4O9BA 2UWJE 1FU1A 1TU3F 5KLVJ 1GW4A 2XU6A 4H0LD 1K8AQ 3C8VA 2WPSA 4HKZH 2XNXA 3R2PA 2YIUC 2IBZE 2J58A 2E74D 3FGAD 3G9RA 4EDFA 4DJGA 1JOCA 3AE6C 1KD1Q 5M1BA 1LTJC 1IFNA 1ZOYC 3V5BA 4IL6X 1SQBD 3P32A 2J5UA 3TYYA 1Y47A 3VP9A 2QEXP 3MHVA 5B5EH 1L2PA 1RF0C 2FBWC 2LKMA 3MUDA 1H8AA 3B4SA 1YIJP 5AW2B 3D71A 1R5LA 2KIKA 1SS1A 2E76B 4IL6H 3PLNA 3MTUE 1HJ0A 2WT7B 1Q82Q 1NTMK 5CMZA 1BDCA 1FOSE 1RH5B 4TT3H 1OFCX 1IFDA 1S72P 3AEDC 2R5DA 4XA4A 5H2FE 2YO3A 2JWDA 1T2KD 1KILD 4JF7A 2WT7A 4CPGA 3MZWB 4OGQB 2WSFJ 3P8MC 4KJMA 1SQBG 3M0AA 1KYOD 1IFMA 1JEKA 4ZKPA 1P84E 3CL3D 1JTHA 1JY2O 2KLUA 4ASVA 2GA1A 3JCUH 3IAOA 1U7MA 3TGUG 5E79H 2P7JA 2POHA 1NTKJ 4WY4B 1VQNP 3O8ZA 1R8EA 5BU5A 2G3AA 2ZXEB 2W27A 1USEA 2BCCG 1EXJA 4H44B 4LLHA 2PAJA 1QEXA 4N78D 2R44A 4RO0A 2E76C 2MJZA 1KB9I 5GTHE 3RL0g 1NU1J 2B89A 3LIEA 3H1KJ 2NPSB 1GL2D 1NVOA 3FX0A 2WPVB 1EZVD 1PP9J 4I2LC 2NZ2A 5C39A 3VTPC 4OGQC 1YJWP 2FXOA 2IDBA 2R32A 1VQ7P 5AW5B 1IC2A 1URQA 3RK2B 1NTKE 1FZFA 1W5CE 4PJ0H 2OYHA 1NTMD 2WSEJ 2Y0CA 1J1EB 2WSSH 2KUBA 3HTKA 1OW6A 2JO1A 2PRRA 1NU1E 2XZRA 1RQVA 1VQMP 1Q7YQ 4WY4C 1OZHA 1ZP0C 3H1KE 5KKZB 1JMMA 3Q3DA 3L72G 4H44C 2AEJA 1N8RQ 2KP8A 5AW7B 4XFJA 3B5ND 1OW8A 1GTWA 1FOSF 3A2AA 4IFFA 3L70J 1URQC 4EI2A 2ZXXA 2OYHC 2YKOA 3VOPA 2Z4EA 5B5EE 3P8CE 2R5BA 1FJKA 3BCCD 3H1JE 1R5SA 1RY3A 4D6TD 2YNYA 3L35A 2E5TA 4UB6E 5APTA 1U7JA 4HJGH 2RN0A 1RQUA 2ZVNB 1J1EC 2KNCB 3RGUA 5CCGA 2WITA 2L91A 3SFEC 2HFED 3H1ID 5AVYB 4WVZA 5KKZC 1BE3D 1PGOA 3KPEA 3L73G 1NOHA 3L70E 3H1LD 4YTPC 4JYCA 1AQ5A 3W67A 5L8RJ 3D6ZA 2IYPA 1FDOA 4R4LA 3PH0A 1FJPA 3AE5C 2E42A 2OTJP 4OH8B 2KS1B 3JCUE 2HODB 3T97A 1NHLA 2K37A 3BCCG 2O1JA 4D6TG 2YO2A 3KQGA 2QM7A 3GF3A 4BWNA 1S9KE 2KS1A 4H0LC 2YMYA 3AE3C 3BASA 4GIFA 3CWBD 3CLQA 2QVAA 1BE3G 3D70A 2K3RA 1FDMA 2WPQA 1JY2N 2N9BA 3H1LG 1DEEG 1KILA 4GOFA 3L74G 1DD4A 4PD4H 1AVOA 1MUUA 4R4MA 4AUWA 1RF1B 1GU4A 3GF7A 3PTZA 3JSVC 4C7RA 1H88A 1HJBA 4U3FD 2Q7CA 1T3JA 2K9JB 3QWOC 3CCVP 2Y9ZA 2OTKE 3RK3B 1YQ4C 4WWIA 1K04A 5KLIC 2I1JA 2WQYC 3CXHI 2K9JA 4YXWH 3AEEC 1T2KC 3VYIA 1BCCD 1KILC 5AVQB 3AE8C 2DW3A 1VQ5P 1H0TB 1HVVA 1M57D 3ITKA 3A0BH 3NFQA 1M56D 3UIAA 2OQQA 4OGQD 1NTZK 3CC2P 1GL2A 1KFNA 2A45H 2Q3IA 4H13D 1SQBJ 4YPCA 2YKQA 3E1IA 3O6QB 5CBNA 2BASA 1RF1C 5EFWB 1GK6A 4L75A 1SQVE 3TGUJ 2W8ZA 5H2FH 1JY3N 1ZRTD 4H44D 4IFDK 1W2EA 2BCCJ 2KXPB 3SWYA 2W6BA 3RK3C 1NJIQ 1LTGC 2I8DA 4DOJA 4AQRD 1GU5A 1LT9A 1IFJA 1GL2C 1VQPP 2NRGA 1HGZA 2NPSD 3G6EP 3HE4A 1LNQA 1P84H 3CCEP 1FZEA 1SQBE 5KAIE 3B5NA 1GDTA 3RL0D 1BGYD 2R3CA 1CI6B 1EXIA 1AJYA 1NH4A 3L71E 2B87B 3R4YA 3TGUE 3M9QA 1FZCA 3RK2D 1OVUA 4L76A 1KB9H 3H6PA 2GM4A 1ZV8A 3L75D 2QIWA 1NAFA 2BCCE 5GTHH 3GG2A 2Q3EA 1AVYA 2A06D 2WSFH 5AVVB 1PL5A 1CSBA 4Z1MH 3RBXA 5AVRB 1KILE 3PRJA 3D6YA 1NTZD 3L72J 3B71A 1Q81Q 3B5NC 1E5WA 2JEEA 1KYOE 1BGYG 4C46A 1HGVA 2JJLA 2IX7C 3OW2O 5GTIE 2GUSA 1SQQD 4PD4E 1MZ9A 1LP1B 1T6AA 3SSUA 1J1DB 3L75G 2QA4P 2PFXA 3KXDA 3RBZA 4N78E 4BRYB 1JY2P 1VQ6P 3L72E 3HUSB 3V6IA 3U1CA 1VQ9P 1NTZG 3V2QA 3V2PA 3CC7P 1EZVI 4I6MC 3VMYA 3E7KA 3GMAA 3A0BE 2WSEH 3L73J 1S3JA 4DCKA 4JYBA 1N73B 2JWAA 4UB6H 2O3JA 3H1HD 5AW9B 5KLVE 2FYUG 3BCCJ 1HWTC 1IO4A 4D6TJ 4JBZA 3TK1A 1NWQA 3HD7D 5APUA 3CCRP 1KN7A 4NPDA 2B9BA 2FXPA 2IZ1A 3HUSC 2E5YA 4H13B 2IYOA 3L73E 1BE3J 3M06A 3CCUP 1LTTC 3OJAB 1AQTA 3H1LJ 3M9BA 2ZYGA 1SQPD 3Q5PA 3U1AA 1VF5D 3WU2H 3L74J 1RHZB 1S2EA 2K1AA 1JY3P 1L0ND 2YMKA 2H7HA 1CZQA 3BCCE 2Q1KA 1UIXA 1JM0A 3V2NA
chains in the Genus database with same CATH topology
1KV4A 1X22A 2JR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KV4 A;  1X22 A;  2JR8 A; 
#chains in the Genus database with same CATH topology
 3CX5 I;  3JC2 2;  1KB9 E;  1EC5 A;  3VP8 A;  1L0L K;  1YYC A;  3RK3 D;  2PGD A;  1LWU B;  4WY4 A;  3P7K A;  3OA7 A;  3AE7 C;  5AW4 B;  1Q86 Q;  1ZLL A;  4I1L A;  4OWF A;  3RL0 B;  2FKW B;  3H1L E;  2AXT H;  2IBZ D;  1W2B O;  2JR8 A;  3CCM P;  2NPS A;  3L74 E;  3CC4 P;  4H13 C;  3Q2Y A;  1S4X A;  1ZR2 A;  1JO5 A;  2H43 A;  1NAY A;  1VQL P;  3MP7 B;  4W80 A;  3CXH H;  2OTL P;  2JDI H;  3KHU A;  5AW3 B;  3NTN A;  1OX3 A;  3VMA A;  2CPS A;  1PP9 E;  4K3A A;  1EZV G;  1LWU C;  1H89 A;  4IOI H;  1PIX A;  3G4S P;  2NPS C;  2VRS A;  4JQ0 D;  1XTG B;  3GHG B;  3RL0 C;  5KJ7 D;  2M8R A;  1M90 Q;  1BDD A;  5TIS E;  2XDJ A;  1GZL A;  1NTM G;  1HTL C;  3WUT A;  2OYI B;  2ZJS E;  3S1K A;  1P84 D;  3C1L A;  3CX5 D;  3RK2 C;  2QSI A;  3Q5R A;  1L0L D;  3I55 P;  2D2C B;  2Z5I A;  5CHX A;  5AW6 B;  1S5L E;  3V4W A;  1FS0 E;  5CCH C;  1IFP A;  2QJK B;  2O1K A;  1U57 A;  1EDK A;  2QG4 A;  2LR2 A;  3TF5 A;  5KAI H;  5APW A;  2O01 J;  2KNC A;  3H25 A;  4UB8 H;  2V7Q J;  1IJD B;  1KC8 Q;  3AE1 C;  2LXC B;  2FYZ A;  3L36 A;  1N7S B;  2RH0 A;  2J59 M;  5APQ A;  1BGY J;  3USS A;  1DEB A;  1NKZ B;  2Q5U A;  3WU2 E;  2ZAE B;  3AEF C;  1L0L G;  3HD7 B;  3CPW O;  2OYI C;  1NTK D;  4ASW A;  1HH0 A;  3L75 J;  4WBA A;  1K05 A;  4L74 A;  1ZRT E;  2HOD A;  3H1I G;  3BAT A;  2D2C C;  4U7J A;  1JNM A;  1MFT A;  1RE4 C;  1GMJ A;  1KYO H;  1FC2 C;  1EQ7 A;  1KQG B;  2HPC B;  2P67 A;  2QJK C;  1NTZ J;  1PPJ D;  1T8Z A;  5GTI H;  1VF5 B;  1NYH A;  4BXL A;  4EYY Q;  3ABV C;  2KZJ A;  2AXT E;  1QVG O;  1G1I A;  1K9M Q;  4B86 A;  2FYN B;  2HPC A;  2JKV A;  1PFI A;  1ZW0 A;  2HYN A;  1KFM A;  1RF1 A;  3L75 E;  2WPR A;  1YHQ P;  2IFN A;  2E75 B;  2KSJ A;  2FYU J;  3CXH E;  3HD7 C;  3CWB G;  3P8C D;  3H1J D;  3Q5S A;  3CCL P;  3A3Y B;  2ZT9 B;  5B66 H;  3W68 A;  1FZG A;  3BVH A;  1PPJ G;  1KTM A;  3A0H E;  4ZKU A;  1DD3 A;  2N1T B;  2Y0E A;  1L4A B;  4HB1 A;  2B88 A;  3H32 B;  3C9I A;  1EDJ A;  1A02 J;  2WSC J;  1H0T A;  4U3F G;  2OAR A;  3TDK A;  1VF5 C;  2IZ0 A;  2RKL A;  3L70 D;  4DZO A;  3LID A;  2WZ7 A;  3I56 P;  1SQQ K;  1M8O B;  1X22 A;  2FYN C;  2FYU E;  1VQK P;  2KI7 B;  1OWA A;  3H1H J;  3AE4 C;  2O01 N;  3O6Q A;  1SFC B;  3HE5 B;  1CW5 A;  1VDF A;  1FE6 A;  3H1J G;  3SFD C;  1SQX K;  2ZYD A;  3FXE A;  2E75 C;  1BCC G;  2ITA A;  2R3S A;  1LJ2 A;  1SQV K;  3S4R A;  1S9K D;  3SWK A;  2KZI A;  2QE7 H;  1FZA A;  3WUV A;  4UB8 E;  3B8E B;  1Y8A A;  1WMK A;  1X79 B;  1IFI A;  1Q2N A;  1HUC A;  2N1T C;  3TNU B;  2W83 C;  4IFM A;  3F89 A;  3AE2 C;  2C9N Y;  1CI6 A;  2N9Y B;  2KB7 P;  4NPE A;  1YQ3 C;  2KYV A;  4EOT A;  1YBK A;  2B87 A;  4Y28 J;  5CCH D;  1PV3 A;  1RE3 A;  2HLO A;  2FFD B;  3V2R A;  1MV8 A;  1MKM A;  3ZDM A;  1SFC C;  4K35 A;  3QH9 A;  1XTC C;  3WMM 0;  1VQO P;  1IK7 A;  1LTJ B;  3FXD A;  1JCC A;  5K5G B;  1KQF B;  1NKN A;  1MFZ A;  2IPP A;  2AXC A;  2I1K A;  5KJ7 C;  5DJT B;  3PHL A;  2XND H;  2FY8 A;  1SQP K;  3AEG C;  2E43 A;  3EFG A;  1GW3 A;  1L0N K;  1NTM J;  1DX7 A;  1PZQ A;  2H8P D;  2A06 G;  1SQX D;  1OMI A;  1RE3 C;  5CJ4 A;  1LP1 A;  3AEC C;  2D2C D;  3RK3 E;  1FDI A;  1PGP A;  1SQV D;  3KDP B;  1IK9 A;  3OAK A;  4MN4 C;  5CCG D;  2BEZ F;  1KQS O;  4NPF X;  5APV A;  1OVR A;  3V4Q A;  1EZV E;  2W6A A;  1KMI Z;  4BRY A;  2FFD C;  5KTB A;  5B66 E;  1DIP A;  3HUS A;  1X0T A;  1S5L X;  5TIS H;  2IBZ I;  1JMB A;  1SQQ G;  5KAF E;  4GOE A;  1VL2 A;  1N7S D;  2W90 A;  2W6J H;  3AE9 C;  1NTM E;  4LC1 A;  2OYO A;  5BVZ A;  1Y9B A;  3VN0 A;  1SQX G;  1S5L H;  1YJ9 P;  3L71 D;  1A02 F;  1LTI C;  1J1D C;  1L0L J;  2A45 I;  3TGU D;  1N73 A;  1QL1 A;  2LXB A;  3M0D A;  1SQV G;  4RES B;  1PGQ A;  1LTA C;  2BCC D;  2G8Y A;  1UII A;  2P2U A;  3H1I J;  5KLV K;  3MD0 A;  4N6J A;  1SP4 A;  3CME P;  4RJT A;  1K73 Q;  1E79 H;  3A7O A;  1JTH B;  2HG5 D;  1QL2 A;  5AVX B;  4W7Y A;  4A7P A;  1IZN B;  2WWW A;  1YIT P;  2P1J A;  1G1J A;  3H1H G;  1HF9 A;  1KV4 A;  5APS A;  3CMA P;  3MUD C;  4D6T E;  3CX5 E;  1L0L E;  1VQ8 P;  1D7M A;  1P84 I;  3L71 G;  3LW5 J;  4LGD E;  1N73 C;  3PP5 A;  4PD4 D;  2Q9I A;  1YJN P;  3M0D C;  5AVU B;  5AW1 B;  1FAV A;  2Z5H A;  3VMZ A;  2O01 H;  3EFF K;  2E75 D;  2V7Q H;  3H1I E;  4I7Z B;  3MIW A;  2Y9Y A;  2CK3 H;  3F5H A;  4WB4 A;  3CWB J;  3MGN A;  1BE3 E;  3K5B A;  2ZT9 D;  1LWU A;  2ZFC A;  2RMZ A;  2ZYA A;  4RKU J;  2BEQ D;  3L72 D;  2C9L Y;  1LTS C;  1M1J B;  1SQP G;  4W7Z A;  2N1T D;  1VPC A;  1URQ B;  1L4A D;  2AEF A;  1QVF O;  1L0N G;  2OYH B;  3II6 A;  1LTB C;  1SVF A;  4HH2 A;  1T3U A;  2AEM A;  5AW8 B;  3CD6 P;  4U3F J;  3HTK B;  1M1J A;  3CI9 A;  3CCS P;  5AVW B;  4QMA A;  1EDI A;  1NGM B;  1Q90 D;  1NTK K;  3TSI A;  3NXS A;  3AEB C;  3CWB E;  1SFC D;  5KLV D;  2QM8 A;  1WRG A;  3A0H H;  3H1J J;  2YXR B;  5CCH A;  3GW6 A;  1BCC J;  4PV1 D;  4I7Z C;  1NU1 K;  1N2D C;  2IBZ G;  1PPJ E;  1YTZ T;  5AVT B;  3WUU A;  3S9O A;  1JY3 O;  1ZXG A;  2HR3 A;  2SPZ A;  3KYQ A;  4U3F E;  1M1J C;  4Y99 B;  3FWN A;  3L73 D;  1JB0 J;  5CBO A;  4OVN F;  3GHG A;  3G71 P;  4DT0 A;  2A45 G;  1JCD A;  2PP6 A;  2OYI A;  3KZI H;  2KLV A;  5KLV G;  1SLQ A;  2C0W A;  4GT1 A;  4H0L B;  2MKV A;  3M91 A;  1BCC E;  3FWL A;  1DH3 A;  4IL6 E;  1KB9 D;  2WSC H;  1RE4 A;  5AVZ B;  2E74 B;  3CCJ P;  2P58 A;  3A5T A;  1JUN A;  3GHG C;  3T97 B;  3N4X A;  3L4F A;  3M9H A;  1NO4 A;  3Q1M A;  3L74 D;  1OVV A;  1N7S A;  1M1K Q;  5CJ0 A;  1WT6 A;  4Y99 C;  3G3Z A;  3GLM A;  1YTZ I;  3AEA C;  1G2C B;  3SWF A;  4EIJ A;  5E79 E;  5KLI B;  1QLE D;  3HD7 A;  4TLF A;  1NU1 D;  1QGK B;  5CCG C;  3NMD A;  3H1K D;  1KIL B;  5BU8 B;  1G2C A;  4ZNC A;  2QJP B;  2L5G B;  4YXD C;  5DJU B;  1BGY E;  1GK4 A;  3BRV B;  3E1R A;  1PP9 D;  1N7L A;  1HBW A;  2E74 C;  2YKP A;  5TJH A;  1N7S C;  1SQQ J;  1M7L A;  4KHX A;  1ZR4 A;  1OIP A;  1NTK G;  1N86 A;  4AYC A;  3VMX A;  4GDO A;  2CPB A;  2A06 E;  2WMM A;  4C7N B;  1SQX J;  4PJ0 E;  2IFM A;  1J2J B;  1YI2 P;  1NU1 G;  2M3B A;  2WVR A;  1KZU B;  1ZN5 A;  3L37 A;  2YXQ B;  2ZVO B;  1NTZ E;  2E76 D;  1SQV J;  3H1K G;  5APX A;  1GL2 B;  4C7N A;  3I5C A;  5KAF H;  2C0X A;  4XE5 B;  3PJS K;  1PP9 G;  2XV5 A;  4ZMD A;  1EDL A;  2Y0D A;  3EWK A;  2QJP C;  1SQQ E;  1VQ4 P;  3IR9 A;  4KT0 J;  5AW0 B;  2K88 A;  2N1T A;  1L4A A;  1GD2 E;  3H32 A;  3BRT B;  5APY A;  4HYT B;  1SQX E;  1LGH B;  3L71 J;  4PV1 B;  3KZI E;  4WY4 D;  1KOR A;  1LT9 B;  2KK7 A;  3IN6 A;  1S1C X;  2P10 A;  3HE4 B;  2WTY A;  1SFC A;  3HE5 A;  4GKG A;  2FYU K;  2V4H A;  2ZT9 C;  4GOD A;  3B5N B;  1FBM A;  1OXZ A;  2QJY B;  1PGJ A;  1USD A;  3L70 G;  1X8Y A;  1L4A C;  1SQP J;  2H88 C;  3CX5 H;  5KJ7 A;  2XKM A;  2M3E A;  1FZC B;  1URQ D;  2KOG A;  2FXM A;  3H1H E;  4N3Y B;  1L0N J;  1SQB K;  2GUV A;  1ZME C;  3TNU A;  3IFM A;  2JP3 A;  1AV1 A;  2QRX A;  3CCQ P;  5AVS B;  1OW7 A;  2YIU B;  3N7N A;  1Z56 A;  2M0B A;  3CXH D;  4JPZ B;  4PV1 C;  2KSE A;  1KQL A;  1AA0 A;  2M5A B;  1LT9 C;  2FFD A;  4L73 A;  1SQP E;  3U59 A;  1BSN A;  1FZB A;  2K9Y A;  3LW5 H;  1LT1 A;  2QJY C;  2Q6Q A;  1L0N E;  1LTJ A;  3EQ2 A;  1AFO A;  2M5A A;  1KYO I;  1QX8 A;  1BSH A;  1FZC C;  3IF4 A;  4PD4 I;  2H89 C;  1RF0 A;  4M3L A;  1X9V A;  2OGU A;  2FYU D;  3HRN A;  4O9B A;  2UWJ E;  1FU1 A;  1TU3 F;  5KLV J;  1GW4 A;  2XU6 A;  4H0L D;  1K8A Q;  3C8V A;  2WPS A;  4HKZ H;  2XNX A;  3R2P A;  2YIU C;  2IBZ E;  2J58 A;  2E74 D;  3FGA D;  3G9R A;  4EDF A;  4DJG A;  1JOC A;  3AE6 C;  1KD1 Q;  5M1B A;  1LTJ C;  1IFN A;  1ZOY C;  3V5B A;  4IL6 X;  1SQB D;  3P32 A;  2J5U A;  3TYY A;  1Y47 A;  3VP9 A;  2QEX P;  3MHV A;  5B5E H;  1L2P A;  1RF0 C;  2FBW C;  2LKM A;  3MUD A;  1H8A A;  3B4S A;  1YIJ P;  5AW2 B;  3D71 A;  1R5L A;  2KIK A;  1SS1 A;  2E76 B;  4IL6 H;  3PLN A;  3MTU E;  1HJ0 A;  2WT7 B;  1Q82 Q;  1NTM K;  5CMZ A;  1BDC A;  1FOS E;  1RH5 B;  4TT3 H;  1OFC X;  1IFD A;  1S72 P;  3AED C;  2R5D A;  4XA4 A;  5H2F E;  2YO3 A;  2JWD A;  1T2K D;  1KIL D;  4JF7 A;  2WT7 A;  4CPG A;  3MZW B;  4OGQ B;  2WSF J;  3P8M C;  4KJM A;  1SQB G;  3M0A A;  1KYO D;  1IFM A;  1JEK A;  4ZKP A;  1P84 E;  3CL3 D;  1JTH A;  1JY2 O;  2KLU A;  4ASV A;  2GA1 A;  3JCU H;  3IAO A;  1U7M A;  3TGU G;  5E79 H;  2P7J A;  2POH A;  1NTK J;  4WY4 B;  1VQN P;  3O8Z A;  1R8E A;  5BU5 A;  2G3A A;  2ZXE B;  2W27 A;  1USE A;  2BCC G;  1EXJ A;  4H44 B;  4LLH A;  2PAJ A;  1QEX A;  4N78 D;  2R44 A;  4RO0 A;  2E76 C;  2MJZ A;  1KB9 I;  5GTH E;  3RL0 g;  1NU1 J;  2B89 A;  3LIE A;  3H1K J;  2NPS B;  1GL2 D;  1NVO A;  3FX0 A;  2WPV B;  1EZV D;  1PP9 J;  4I2L C;  2NZ2 A;  5C39 A;  3VTP C;  4OGQ C;  1YJW P;  2FXO A;  2IDB A;  2R32 A;  1VQ7 P;  5AW5 B;  1IC2 A;  1URQ A;  3RK2 B;  1NTK E;  1FZF A;  1W5C E;  4PJ0 H;  2OYH A;  1NTM D;  2WSE J;  2Y0C A;  1J1E B;  2WSS H;  2KUB A;  3HTK A;  1OW6 A;  2JO1 A;  2PRR A;  1NU1 E;  2XZR A;  1RQV A;  1VQM P;  1Q7Y Q;  4WY4 C;  1OZH A;  1ZP0 C;  3H1K E;  5KKZ B;  1JMM A;  3Q3D A;  3L72 G;  4H44 C;  2AEJ A;  1N8R Q;  2KP8 A;  5AW7 B;  4XFJ A;  3B5N D;  1OW8 A;  1GTW A;  1FOS F;  3A2A A;  4IFF A;  3L70 J;  1URQ C;  4EI2 A;  2ZXX A;  2OYH C;  2YKO A;  3VOP A;  2Z4E A;  5B5E E;  3P8C E;  2R5B A;  1FJK A;  3BCC D;  3H1J E;  1R5S A;  1RY3 A;  4D6T D;  2YNY A;  3L35 A;  2E5T A;  4UB6 E;  5APT A;  1U7J A;  4HJG H;  2RN0 A;  1RQU A;  2ZVN B;  1J1E C;  2KNC B;  3RGU A;  5CCG A;  2WIT A;  2L91 A;  3SFE C;  2HFE D;  3H1I D;  5AVY B;  4WVZ A;  5KKZ C;  1BE3 D;  1PGO A;  3KPE A;  3L73 G;  1NOH A;  3L70 E;  3H1L D;  4YTP C;  4JYC A;  1AQ5 A;  3W67 A;  5L8R J;  3D6Z A;  2IYP A;  1FDO A;  4R4L A;  3PH0 A;  1FJP A;  3AE5 C;  2E42 A;  2OTJ P;  4OH8 B;  2KS1 B;  3JCU E;  2HOD B;  3T97 A;  1NHL A;  2K37 A;  3BCC G;  2O1J A;  4D6T G;  2YO2 A;  3KQG A;  2QM7 A;  3GF3 A;  4BWN A;  1S9K E;  2KS1 A;  4H0L C;  2YMY A;  3AE3 C;  3BAS A;  4GIF A;  3CWB D;  3CLQ A;  2QVA A;  1BE3 G;  3D70 A;  2K3R A;  1FDM A;  2WPQ A;  1JY2 N;  2N9B A;  3H1L G;  1DEE G;  1KIL A;  4GOF A;  3L74 G;  1DD4 A;  4PD4 H;  1AVO A;  1MUU A;  4R4M A;  4AUW A;  1RF1 B;  1GU4 A;  3GF7 A;  3PTZ A;  3JSV C;  4C7R A;  1H88 A;  1HJB A;  4U3F D;  2Q7C A;  1T3J A;  2K9J B;  3QWO C;  3CCV P;  2Y9Z A;  2OTK E;  3RK3 B;  1YQ4 C;  4WWI A;  1K04 A;  5KLI C;  2I1J A;  2WQY C;  3CXH I;  2K9J A;  4YXW H;  3AEE C;  1T2K C;  3VYI A;  1BCC D;  1KIL C;  5AVQ B;  3AE8 C;  2DW3 A;  1VQ5 P;  1H0T B;  1HVV A;  1M57 D;  3ITK A;  3A0B H;  3NFQ A;  1M56 D;  3UIA A;  2OQQ A;  4OGQ D;  1NTZ K;  3CC2 P;  1GL2 A;  1KFN A;  2A45 H;  2Q3I A;  4H13 D;  1SQB J;  4YPC A;  2YKQ A;  3E1I A;  3O6Q B;  5CBN A;  2BAS A;  1RF1 C;  5EFW B;  1GK6 A;  4L75 A;  1SQV E;  3TGU J;  2W8Z A;  5H2F H;  1JY3 N;  1ZRT D;  4H44 D;  4IFD K;  1W2E A;  2BCC J;  2KXP B;  3SWY A;  2W6B A;  3RK3 C;  1NJI Q;  1LTG C;  2I8D A;  4DOJ A;  4AQR D;  1GU5 A;  1LT9 A;  1IFJ A;  1GL2 C;  1VQP P;  2NRG A;  1HGZ A;  2NPS D;  3G6E P;  3HE4 A;  1LNQ A;  1P84 H;  3CCE P;  1FZE A;  1SQB E;  5KAI E;  3B5N A;  1GDT A;  3RL0 D;  1BGY D;  2R3C A;  1CI6 B;  1EXI A;  1AJY A;  1NH4 A;  3L71 E;  2B87 B;  3R4Y A;  3TGU E;  3M9Q A;  1FZC A;  3RK2 D;  1OVU A;  4L76 A;  1KB9 H;  3H6P A;  2GM4 A;  1ZV8 A;  3L75 D;  2QIW A;  1NAF A;  2BCC E;  5GTH H;  3GG2 A;  2Q3E A;  1AVY A;  2A06 D;  2WSF H;  5AVV B;  1PL5 A;  1CSB A;  4Z1M H;  3RBX A;  5AVR B;  1KIL E;  3PRJ A;  3D6Y A;  1NTZ D;  3L72 J;  3B71 A;  1Q81 Q;  3B5N C;  1E5W A;  2JEE A;  1KYO E;  1BGY G;  4C46 A;  1HGV A;  2JJL A;  2IX7 C;  3OW2 O;  5GTI E;  2GUS A;  1SQQ D;  4PD4 E;  1MZ9 A;  1LP1 B;  1T6A A;  3SSU A;  1J1D B;  3L75 G;  2QA4 P;  2PFX A;  3KXD A;  3RBZ A;  4N78 E;  4BRY B;  1JY2 P;  1VQ6 P;  3L72 E;  3HUS B;  3V6I A;  3U1C A;  1VQ9 P;  1NTZ G;  3V2Q A;  3V2P A;  3CC7 P;  1EZV I;  4I6M C;  3VMY A;  3E7K A;  3GMA A;  3A0B E;  2WSE H;  3L73 J;  1S3J A;  4DCK A;  4JYB A;  1N73 B;  2JWA A;  4UB6 H;  2O3J A;  3H1H D;  5AW9 B;  5KLV E;  2FYU G;  3BCC J;  1HWT C;  1IO4 A;  4D6T J;  4JBZ A;  3TK1 A;  1NWQ A;  3HD7 D;  5APU A;  3CCR P;  1KN7 A;  4NPD A;  2B9B A;  2FXP A;  2IZ1 A;  3HUS C;  2E5Y A;  4H13 B;  2IYO A;  3L73 E;  1BE3 J;  3M06 A;  3CCU P;  1LTT C;  3OJA B;  1AQT A;  3H1L J;  3M9B A;  2ZYG A;  1SQP D;  3Q5P A;  3U1A A;  1VF5 D;  3WU2 H;  3L74 J;  1RHZ B;  1S2E A;  2K1A A;  1JY3 P;  1L0N D;  2YMK A;  2H7H A;  1CZQ A;  3BCC E;  2Q1K A;  1UIX A;  1JM0 A;  3V2N A; 
#chains in the Genus database with same CATH homology
 1KV4 A;  1X22 A;  2JR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...