1X22A

Solution structure of a novel moricin analogue, an antibacterial peptide from a lepidopteran insect, spodoptera litura
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
42
structure length
42
Chain Sequence
GKIPVKAIKKAGAAIGKGLRAINIASTAHDVYSFFKPKHKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords moricin
publication title Isolation, gene expression and solution structure of a novel moricin analogue, antibacterial peptide from a lepidopteran insect, Spodoptera litura
pubmed doi rcsb
molecule tags Antibiotic
total genus 12
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2005-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06451 Moricin Moricin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.750 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Moricin domain 1x22A00
1X22A 1KV4A 2JR8A
chains in the Genus database with same CATH superfamily
4H13D 2H7HA 1KQFB 1VDFA 3H1LJ 3O6QB 3K5BA 3F5HA 2P2UA 3RK3B 2YO2A 4I6MC 2IBZI 2YXRB 2ZT9D 3PHLA 1N7LA 2WPRA 1FZFA 2N9YB 1L0LD 3A2AA 2B89A 1L4AD 2QEXP 2IZ1A 4C7NB 4AUWA 3CI9A 4B86A 1RE3A 2E76D 2FYUD 1JY2P 1EDIA 1JCCA 1FZAA 1MZ9A 2Q6QA 2J5UA 4D6TG 1N8RQ 5TJHA 3TYYA 1OVUA 5AW0B 2KUBA 2WSCH 4I7ZC 3T97A 5BVZA 1GZLA 2I8DA 1YHQP 3FXEA 2M8RA 1ZMEC 3AEAC 3L37A 2AXTE 3MZWB 4JYCA 4XFJA 2GUSA 2W6BA 2J58A 3AE8C 3CCQP 1OVRA 2CK3H 5KLIB 2P7JA 3I56P 2E43A 1KB9D 3RL0g 1RQUA 2P1JA 2E75C 4JF7A 2KS1A 2ZYAA 4WVZA 3ABVC 3MUDC 1KTMA 3S1KA 2FYUE 2RH0A 3W68A 2SPZA 3MUDA 4PV1D 1LTJB 1ZRTD 3G4SP 2Y0CA 1M1JB 1HGZA 1BE3D 2K9JB 1S5LH 3WU2E 1DIPA 3EQ2A 4QMAA 1XTGB 3L70D 1CSBA 3IAOA 2FBWC 4KJMA 1NTMD 1GW3A 3E1IA 3HUSC 2Q5UA 3B4SA 1G2CB 4PD4E 4L75A 3D6ZA 2GUVA 4LGDE 3S9OA 1G1IA 3M9QA 1JO5A 1KB9E 1BCCJ 2YMYA 1QVFO 3L75D 2QG4A 1QL2A 1YTZI 3H1ID 2L91A 3AEGC 2Q3EA 2LXCB 1SQBD 3SFDC 3OA7A 1OW7A 3SSUA 1KB9I 4I1LA 2O01N 1BE3E 1SFCB 2FFDC 1ZOYC 3L70E 2FFDA 2N1TB 1GL2D 4JBZA 1LWUB 3Q5RA 5CJ0A 5H2FE 2A06D 2P10A 1P84D 5APXA 2ZFCA 2LKMA 2NPSA 2Y0EA 3VN0A 1CW5A 5KAIH 3GHGC 2AXCA 1SQPD 1SQXK 3GHGA 4OH8B 3AE2C 2QJKC 1NYHA 5AW2B 1K73Q 3L75E 3ZDMA 3H1IE 3CWBJ 5GTHE 1KC8Q 3FXDA 1SQBE 3M9BA 3L74D 3BCCE 4RO0A 3FGAD 1JTHB 5AVWB 5CCGA 2FYNC 5AVZB 2CPSA 4U3FD 1YI2P 1USDA 1SQQK 1NGMB 2R44A 4EIJA 2AEFA 2A06E 4OVNF 1E5WA 1EZVG 1P84E 3MHVA 2OYHB 2DW3A 1LP1A 4PJ0E 3RGUA 3KPEA 1NTZK 1SQPE 2JDIH 5APUA 1Q81Q 2VRSA 4DJGA 4H0LC 1VQOP 1IO4A 5TISH 1P84I 1FZBA 2BCCG 3Q5PA 3L74E 1M8OB 2ZJSE 1WRGA 3A0HE 3L73D 5AVTB 5AW9B 1OX3A 2E74B 3LW5J 1T2KD 1NJIQ 2C9LY 1NU1E 1SQXG 4U3FE 1NO4A 2K9YA 1LGHB 3JCUE 4K35A 2R3CA 1ZW0A 1HTLC 1DEEG 5CCHA 3LW5H 3AE9C 3G3ZA 3CCMP 5B5EH 1OFCX 2XNDH 3KZIE 5BU8B 4H13C 3QH9A 1M56D 3D70A 2KB7P 2CPBA 1SQQG 2R5DA 1JY2N 1VQ8P 1NTKD 2ZT9C 2HODA 1SQXJ 3T97B 4I7ZB 5AVXB 2D2CD 1L4AC 4H44D 3RK2C 2E76C 5AVRB 1KQLA 3V6IA 3IFMA 3RL0D 4YPCA 5GTIH 3HTKB 1NAFA 2KS1B 1SQQJ 2E75B 2XV5A 1YJWP 1FZCC 2O1KA 1NAYA 3I55P 1FZCA 1D7MA 1KILA 4D6TD 2PP6A 1VQ9P 1NTKE 2R5BA 2C0WA 2M3EA 2BEZF 1Q86Q 5L8RJ 1JMMA 2Q3IA 1M90Q 4YTPC 3KXDA 1HGVA 3CCVP 1IFJA 1NH4A 3B5NA 4WY4A 2ZYGA 1IFPA 1T3JA 1JB0J 1ZV8A 1J2JB 3HUSB 4IL6X 1EQ7A 4UB8H 1KQGB 3A7OA 3H1KG 1QL1A 5CHXA 3AEFC 3QWOC 1Q7YQ 4W80A 2A45G 2B87A 1KORA 2M3BA 3L71G 1IK7A 1KFMA 3FWNA 4OGQB 2MKVA 1S5LE 4GT1A 5APVA 4D6TE 5M1BA 3PTZA 3M06A 2FFDB 3RK3D 3CCSP 3BASA 1LTBC 1YTZT 4TT3H 4U7JA 1L0NE 5KJ7D 3Q5SA 4LC1A 1FJPA 5CBOA 3H1LG 1VF5D 1IJDB 4IFDK 3W67A 3GHGB 3P8CD 2WSEJ 2QJKB 4EI2A 4A7PA 1QLED 5KLVK 1GL2C 4UB6H 3MD0A 2LR2A 2A45H 3CCJP 2KP8A 3TSIA 3AECC 2IBZE 2KI7B 3WUUA 2WSEH 3WUTA 2HLOA 4NPEA 2RKLA 2FYNB 3RK3E 2NZ2A 3EFFK 3OAKA 1J1DC 1SQVK 5KAIE 2YIUC 2XNXA 3VMXA 1LP1B 3U59A 2PFXA 1IFMA 1EDKA 3P8CE 1PP9G 2PRRA 1LNQA 1R8EA 1U7MA 2W8ZA 2YKOA 4H0LB 4HYTB 1G1JA 3S4RA 1RF1C 2KNCA 1X79B 1IFDA 5EFWB 2K1AA 2KOGA 1PPJG 1RF1A 1WMKA 2KLVA 1Q2NA 5APWA 3PH0A 3E1RA 3BVHA 4L76A 3TK1A 1HJ0A 2H43A 3H1HJ 1EZVD 1PP9J 5CJ4A 1UIXA 3IR9A 1L0LE 3HTKA 5KKZB 3V2PA 1VQPP 1JMBA 4BWNA 2YNYA 5TISE 4K3AA 4Y99C 2JO1A 1JY3O 4H13B 4N6JA 3HD7D 1BCCG 2QSIA 3MIWA 2Y9ZA 2BCCD 2HODB 3GF7A 1SQVG 3VMYA 3L4FA 1YITP 2ZT9B 2N1TD 2AEJA 2K88A 2W27A 4LLHA 1LTTC 5E79H 3TGUG 1BDDA 2O1JA 4N78D 1L4AB 1SQXD 2YKQA 3RK2B 1PL5A 2E76B 3HUSA 3B71A 3GW6A 5B5EE 4IOIH 2QIWA 1EZVE 3BATA 1KFNA 2IFMA 3V4WA 2D2CC 2M0BA 1N7SD 3V2QA 4R4MA 4GODA 2K3RA 5AW3B 4YXDC 4H44C 1SQVJ 2QVAA 1AVYA 1FZCB 1DH3A 2M5AB 3CD6P 1KILB 1SQQD 3RL0C 1NWQA 3TGUJ 3L72G 2WSSH 1EZVI 2BCCE 1ZRTE 4DT0A 3CWBG 1M57D 3CCRP 1OXZA 3PP5A 4AQRD 3B5NB 3KHUA 2WSFJ 4WY4B 4N78E 4ZMDA 2Y9YA 5GTIE 1FBMA 2HYNA 1SQXE 1NTME 5BU5A 2POHA 1GW4A 2JWDA 2QE7H 3VP8A 2OTLP 3U1AA 1BSNA 4ZKPA 2WSFH 2B87B 3P7KA 2ZXEB 3L72J 2WVRA 1A02J 3Q2YA 4CPGA 3V2RA 2FY8A 2C0XA 1T8ZA 2PGDA 1PGJA 2WPQA 4GKGA 2QJPC 2YO3A 4EYYQ 2G3AA 1SQQE 1SVFA 1X8YA 2ZVNB 4WBAA 1W2BO 1T6AA 4L73A 3SFEC 3V2NA 2NRGA 1S1CX 1JY3P 2KLUA 4UB8E 1L2PA 1GU5A 1H89A 1FJKA 4BRYB 5KTBA 1YBKA 2IZ0A 2Z5HA 3H1KD 2E5YA 3WUVA 3Q1MA 1FAVA 3USSA 3H25A 1JOCA 1ZXGA 1MFZA 3L71D 1GL2B 4HJGH 1N86A 1EC5A 1AV1A 3HE5A 5AW5B 1VF5C 3V5BA 1AFOA 5CBNA 2WPSA 4JYBA 2JP3A 3CCLP 1MKMA 1RY3A 1VQNP 5AVVB 1VPCA 3RBXA 3AE7C 2W90A 1SQPK 2R32A 1J1DB 1NHLA 2YIUB 3P8MC 3H1KE 3L36A 1K04A 1AJYA 4R4LA 3H1LD 2XKMA 2WPVB 4UB6E 4DCKA 1KMIZ 1CI6B 1EDLA 3L71E 5DJUB 2Z4EA 3CMAP 1Y47A 1NU1K 2BEQD 1XTCC 2KNCB 3G71P 1RF1B 4C7RA 2WTYA 2A45I 3L73E 1N73C 1FC2C 5B66H 1KQSO 3AEEC 1BE3J 1L4AA 2R3SA 1NTZG 1N73A 3A3YB 3BCCG 1M1KQ 1S2EA 3VYIA 1N2DC 1K8AQ 2Z5IA 1W5CE 3B8EB 1VQKP 4EOTA 1HJBA 1GK4A 3H1LE 3C1LA 3EFGA 4OGQD 1OW6A 5AW1B 1JNMA 3MTUE 1S9KD 3Q3DA 1URQD 2JKVA 3MP7B 3H1IJ 4RKUJ 2M5AA 1QEXA 4N3YB 1HUCA 1NTZJ 2ZYDA 3BCCJ 3VTPC 2C9NY 1PPJD 1JCDA 5AVUB 3KQGA 4I2LC 1PIXA 2NPSD 3H32A 3JC22 3CLQA 4IL6H 2H88C 3HD7C 3H1JG 2P58A 3N7NA 1KD1Q 4PV1C 2HR3A 3KYQA 1TU3F 3R2PA 1NU1G 1LJ2A 1S4XA 3FX0A 1NTKK 2KSEA 2D2CB 4H44B 1LT1A 5CCGD 1KYOH 3AEDC 1X22A 1S9KE 3C8VA 2ZVOB 2ZAEB 1T3UA 1ZR4A 5E79E 1BCCD 1J1EC 3RL0B 1OWAA 1SQVD 3HE4A 4C46A 2QA4P 1NVOA 2B9BA 2FXPA 2KYVA 3L74J 1GDTA 3OJAB 3TGUD 1PPJE 4WWIA 3H1JJ 1N7SC 1N7SA 1FZEA 4BRYA 1NU1J 3E7KA 2J59M 1RE4C 2OYIC 2E42A 1BSHA 2OYIA 1MUUA 3O8ZA 5K5GB 3HRNA 1FU1A 2JWAA 1FOSF 2HPCA 1LTAC 1GTWA 1DD4A 2IPPA 1ZN5A 1GL2A 2QJPB 3L72D 2XZRA 1BCCE 1S72P 3BRTB 1SQVE 3CWBD 3CC2P 5AW4B 1KZUB 1L0NK 3TGUE 4AYCA 3CX5H 1JY3N 2H8PD 1H0TA 1AQ5A 2GM4A 2P67A 2FXMA 1YIJP 5CCHD 1DEBA 1U57A 2JJLA 4JPZB 3TNUA 1JUNA 1GU4A 4RJTA 2WZ7A 3CXHH 3H1HG 4Z1MH 2OGUA 1FDIA 1Y8AA 3M0AA 2RMZA 1CI6A 2QJYC 5AVYB 2BASA 2V4HA 3FWLA 2KZIA 4Y28J 2WSCJ 3GLMA 3L72E 3R4YA 3HE5B 1R5LA 1PV3A 1BGYG 3CWBE 1RE3C 1NTKJ 3RK2D 1VF5B 1FOSE 3G6EP 3C9IA 1PGPA 1WT6A 3A0BH 4DZOA 5KLVG 3AE5C 1OW8A 3D71A 4ZKUA 2IFNA 3WMM0 4ASVA 1AA0A 3IN6A 4GOFA 3PRJA 1HWTC 1SLQA 1U7JA 5CMZA 2GA1A 1KILD 3G9RA 1YYCA 1T2KC 1L0NG 4PD4D 2G8YA 3ITKA 1BGYJ 1PZQA 1LTSC 2O3JA 1SFCD 1S3JA 3B5ND 4WY4D 2WT7A 4D6TJ 1FDMA 1LT9C 5KLVJ 1N73B 3CCUP 1LT9A 3V4QA 4JQ0D 3AEBC 2HFED 1VQ7P 1L0LK 1FS0E 2IBZG 3SWYA 3PLNA 1IFNA 3GF3A 3VOPA 1VQ5P 1KV4A 1YQ4C 4WB4A 3II6A 1AQTA 3UIAA 2JR8A 1USEA 1S5LX 5AVQB 3NXSA 1DD3A 2FYUK 1L0NJ 1YQ3C 3PJSK 1YJNP 2ZXXA 2JEEA 2WITA 1KILE 3NFQA 2LXBA 2OARA 4KT0J 1NOHA 3I5CA 2WWWA 1HBWA 5B66E 4OGQC 1ZLLA 3H32B 1X0TA 4PD4I 5AW7B 1NTZD 1IFIA 3BCCD 1PGOA 4KHXA 2IX7C 4IFMA 3HD7B 1URQC 4PV1B 4NPFX 1UIIA 1URQA 5KAFH 2IYPA 1H8AA 1YJ9P 4XA4A 1KYOD 1RH5B 1SS1A 1IK9A 1OZHA 3CL3D 2W6JH 2NPSC 1VQLP 2FKWB 2L5GB 3CMEP 1L0LG 1W2EA 1HF9A 2FXOA 1J1EB 2E74D 3HE4B 1JEKA 1NTMK 4EDFA 3AE1C 2N9BA 5AW6B 3L35A 4IL6E 2FYUG 1M7LA 4L74A 2O01J 2V7QJ 2WMMA 1N7SB 3CCEP 4HH2A 5AVSB 1NTZE 2HG5D 5AW8B 5CCGC 3H1JD 1GD2E 4MN4C 2OYIB 2XU6A 2Q7CA 1Z56A 1LTIC 1NU1D 2KSJA 1SQBK 1QX8A 3OW2O 2O01H 2V7QH 2I1KA 1ZR2A 1KYOE 3LIEA 5APTA 1L0LJ 2HPCB 3RK3C 3O6QA 2ITAA 3GG2A 3LIDA 2AXTH 3M0DC 1SP4A 2FYUJ 3M91A 3M0DA 3CX5D 4GOEA 5KJ7C 2YXQB 3NMDA 4M3LA 1HH0A 3GMAA 3M9HA 3KDPB 5KJ7A 4C7NA 2OTJP 1KYOI 1KN7A 2KZJA 1H0TB 1CZQA 1MFTA 2Q9IA 2IDBA 3H1JE 3AE4C 1BE3G 3CXHD 3TNUB 2E75D 3L70G 2WQYC 3MGNA 1NTMG 1JM0A 3WU2H 4IFFA 1QGKB 5KLIC 2QJYB 1OVVA 2E5TA 2YMKA 5CCHC 5KKZC 3CC7P 4PD4H 4HKZH 3CX5E 3A5TA 1Q90D 3L75G 2BCCJ 1R5SA 3H1IG 4W7ZA 1KB9H 3CC4P 1SQBG 1X9VA 1PGQA 1LTJC 2PAJA 3L70J 4XE5B 1LTJA 4DOJA 1M1JC 1NTMJ 2Y0DA 3CX5I 1M1JA 3CXHE 2K9JA 3VMAA 1ZP0C 3AE3C 1IC2A 2OQQA 3EWKA 3H1HD 1RQVA 2A06G 1PP9D 1RF0C 1EXIA 1GMJA 4Y99B 1G2CA 1RF0A 3L75J 5H2FH 3CXHI 2OYOA 1RHZB 2KIKA 1SQPG 2WT7B 3VMZA 1SQBJ 5C39A 4RESB 3A0BE 4ASWA 5APQA 4O9BA 1BGYD 2FYZA 2MJZA 1OIPA 1LT9B 1KILC 1FE6A 1LTGC 4NPDA 3VP9A 3L74G 2QM7A 3IF4A 2RN0A 3F89A 5GTHH 2IYOA 5KLVD 3HD7A 2B88A 1SFCC 2W6AA 3B5NC 1NKZB 4WY4C 1SFCA 2N1TC 1EXJA 4U3FG 4GDOA 1QVGO 2AEMA 1E79H 1MV8A 1BDCA 3NTNA 1LWUC 2N1TA 1LWUA 3H1HE 1PP9E 1SQPJ 1L0ND 1JY2O 4OWFA 1K9MQ 1H88A 5APSA 3TF5A 3CPWO 2KK7A 2I1JA 2XDJA 4GIFA 2QRXA 1EDJA 4W7YA 1P84H 1PFIA 4PJ0H 1AVOA 3P32A 1BGYE 2QM8A 4YXWH 2KXPB 3D6YA 1DX7A 3BRVB 1K05A 2K37A 4TLFA 1IZNB 2IBZD 4U3FJ 3L73G 1VQ4P 5KLVE 1URQB 5DJTB 1JTHA 1VL2A 1RE4A 3H6PA 3H1KJ 3A0HH 1GK6A 1A02F 2H89C 1Q82Q 1FDOA 4H0LD 1NKNA 4BXLA 3RBZA 2NPSB 2OYHC 4HB1A 3JCUH 3L71J 2OYHA 1HVVA 3N4XA 3SWKA 2Q1KA 1OMIA 1VQ6P 3SWFA 1VQMP 2YKPA 3TDKA 3KZIH 3L73J 2UWJE 1NTKG 5APYA 5KAFE 3U1CA 4ZNCA 2OTKE 1FZGA 3JSVC 3AE6C 2W83C 1Y9BA 2E74C
chains in the Genus database with same CATH topology
1X22A 1KV4A 2JR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X22 A;  1KV4 A;  2JR8 A; 
#chains in the Genus database with same CATH topology
 4H13 D;  2H7H A;  1KQF B;  1VDF A;  3H1L J;  3O6Q B;  3K5B A;  3F5H A;  2P2U A;  3RK3 B;  2YO2 A;  4I6M C;  2IBZ I;  2YXR B;  2ZT9 D;  3PHL A;  1N7L A;  2WPR A;  1FZF A;  2N9Y B;  1L0L D;  3A2A A;  2B89 A;  1L4A D;  2QEX P;  2IZ1 A;  4C7N B;  4AUW A;  3CI9 A;  4B86 A;  1RE3 A;  2E76 D;  2FYU D;  1JY2 P;  1EDI A;  1JCC A;  1FZA A;  1MZ9 A;  2Q6Q A;  2J5U A;  4D6T G;  1N8R Q;  5TJH A;  3TYY A;  1OVU A;  5AW0 B;  2KUB A;  2WSC H;  4I7Z C;  3T97 A;  5BVZ A;  1GZL A;  2I8D A;  1YHQ P;  3FXE A;  2M8R A;  1ZME C;  3AEA C;  3L37 A;  2AXT E;  3MZW B;  4JYC A;  4XFJ A;  2GUS A;  2W6B A;  2J58 A;  3AE8 C;  3CCQ P;  1OVR A;  2CK3 H;  5KLI B;  2P7J A;  3I56 P;  2E43 A;  1KB9 D;  3RL0 g;  1RQU A;  2P1J A;  2E75 C;  4JF7 A;  2KS1 A;  2ZYA A;  4WVZ A;  3ABV C;  3MUD C;  1KTM A;  3S1K A;  2FYU E;  2RH0 A;  3W68 A;  2SPZ A;  3MUD A;  4PV1 D;  1LTJ B;  1ZRT D;  3G4S P;  2Y0C A;  1M1J B;  1HGZ A;  1BE3 D;  2K9J B;  1S5L H;  3WU2 E;  1DIP A;  3EQ2 A;  4QMA A;  1XTG B;  3L70 D;  1CSB A;  3IAO A;  2FBW C;  4KJM A;  1NTM D;  1GW3 A;  3E1I A;  3HUS C;  2Q5U A;  3B4S A;  1G2C B;  4PD4 E;  4L75 A;  3D6Z A;  2GUV A;  4LGD E;  3S9O A;  1G1I A;  3M9Q A;  1JO5 A;  1KB9 E;  1BCC J;  2YMY A;  1QVF O;  3L75 D;  2QG4 A;  1QL2 A;  1YTZ I;  3H1I D;  2L91 A;  3AEG C;  2Q3E A;  2LXC B;  1SQB D;  3SFD C;  3OA7 A;  1OW7 A;  3SSU A;  1KB9 I;  4I1L A;  2O01 N;  1BE3 E;  1SFC B;  2FFD C;  1ZOY C;  3L70 E;  2FFD A;  2N1T B;  1GL2 D;  4JBZ A;  1LWU B;  3Q5R A;  5CJ0 A;  5H2F E;  2A06 D;  2P10 A;  1P84 D;  5APX A;  2ZFC A;  2LKM A;  2NPS A;  2Y0E A;  3VN0 A;  1CW5 A;  5KAI H;  3GHG C;  2AXC A;  1SQP D;  1SQX K;  3GHG A;  4OH8 B;  3AE2 C;  2QJK C;  1NYH A;  5AW2 B;  1K73 Q;  3L75 E;  3ZDM A;  3H1I E;  3CWB J;  5GTH E;  1KC8 Q;  3FXD A;  1SQB E;  3M9B A;  3L74 D;  3BCC E;  4RO0 A;  3FGA D;  1JTH B;  5AVW B;  5CCG A;  2FYN C;  5AVZ B;  2CPS A;  4U3F D;  1YI2 P;  1USD A;  1SQQ K;  1NGM B;  2R44 A;  4EIJ A;  2AEF A;  2A06 E;  4OVN F;  1E5W A;  1EZV G;  1P84 E;  3MHV A;  2OYH B;  2DW3 A;  1LP1 A;  4PJ0 E;  3RGU A;  3KPE A;  1NTZ K;  1SQP E;  2JDI H;  5APU A;  1Q81 Q;  2VRS A;  4DJG A;  4H0L C;  1VQO P;  1IO4 A;  5TIS H;  1P84 I;  1FZB A;  2BCC G;  3Q5P A;  3L74 E;  1M8O B;  2ZJS E;  1WRG A;  3A0H E;  3L73 D;  5AVT B;  5AW9 B;  1OX3 A;  2E74 B;  3LW5 J;  1T2K D;  1NJI Q;  2C9L Y;  1NU1 E;  1SQX G;  4U3F E;  1NO4 A;  2K9Y A;  1LGH B;  3JCU E;  4K35 A;  2R3C A;  1ZW0 A;  1HTL C;  1DEE G;  5CCH A;  3LW5 H;  3AE9 C;  3G3Z A;  3CCM P;  5B5E H;  1OFC X;  2XND H;  3KZI E;  5BU8 B;  4H13 C;  3QH9 A;  1M56 D;  3D70 A;  2KB7 P;  2CPB A;  1SQQ G;  2R5D A;  1JY2 N;  1VQ8 P;  1NTK D;  2ZT9 C;  2HOD A;  1SQX J;  3T97 B;  4I7Z B;  5AVX B;  2D2C D;  1L4A C;  4H44 D;  3RK2 C;  2E76 C;  5AVR B;  1KQL A;  3V6I A;  3IFM A;  3RL0 D;  4YPC A;  5GTI H;  3HTK B;  1NAF A;  2KS1 B;  1SQQ J;  2E75 B;  2XV5 A;  1YJW P;  1FZC C;  2O1K A;  1NAY A;  3I55 P;  1FZC A;  1D7M A;  1KIL A;  4D6T D;  2PP6 A;  1VQ9 P;  1NTK E;  2R5B A;  2C0W A;  2M3E A;  2BEZ F;  1Q86 Q;  5L8R J;  1JMM A;  2Q3I A;  1M90 Q;  4YTP C;  3KXD A;  1HGV A;  3CCV P;  1IFJ A;  1NH4 A;  3B5N A;  4WY4 A;  2ZYG A;  1IFP A;  1T3J A;  1JB0 J;  1ZV8 A;  1J2J B;  3HUS B;  4IL6 X;  1EQ7 A;  4UB8 H;  1KQG B;  3A7O A;  3H1K G;  1QL1 A;  5CHX A;  3AEF C;  3QWO C;  1Q7Y Q;  4W80 A;  2A45 G;  2B87 A;  1KOR A;  2M3B A;  3L71 G;  1IK7 A;  1KFM A;  3FWN A;  4OGQ B;  2MKV A;  1S5L E;  4GT1 A;  5APV A;  4D6T E;  5M1B A;  3PTZ A;  3M06 A;  2FFD B;  3RK3 D;  3CCS P;  3BAS A;  1LTB C;  1YTZ T;  4TT3 H;  4U7J A;  1L0N E;  5KJ7 D;  3Q5S A;  4LC1 A;  1FJP A;  5CBO A;  3H1L G;  1VF5 D;  1IJD B;  4IFD K;  3W67 A;  3GHG B;  3P8C D;  2WSE J;  2QJK B;  4EI2 A;  4A7P A;  1QLE D;  5KLV K;  1GL2 C;  4UB6 H;  3MD0 A;  2LR2 A;  2A45 H;  3CCJ P;  2KP8 A;  3TSI A;  3AEC C;  2IBZ E;  2KI7 B;  3WUU A;  2WSE H;  3WUT A;  2HLO A;  4NPE A;  2RKL A;  2FYN B;  3RK3 E;  2NZ2 A;  3EFF K;  3OAK A;  1J1D C;  1SQV K;  5KAI E;  2YIU C;  2XNX A;  3VMX A;  1LP1 B;  3U59 A;  2PFX A;  1IFM A;  1EDK A;  3P8C E;  1PP9 G;  2PRR A;  1LNQ A;  1R8E A;  1U7M A;  2W8Z A;  2YKO A;  4H0L B;  4HYT B;  1G1J A;  3S4R A;  1RF1 C;  2KNC A;  1X79 B;  1IFD A;  5EFW B;  2K1A A;  2KOG A;  1PPJ G;  1RF1 A;  1WMK A;  2KLV A;  1Q2N A;  5APW A;  3PH0 A;  3E1R A;  3BVH A;  4L76 A;  3TK1 A;  1HJ0 A;  2H43 A;  3H1H J;  1EZV D;  1PP9 J;  5CJ4 A;  1UIX A;  3IR9 A;  1L0L E;  3HTK A;  5KKZ B;  3V2P A;  1VQP P;  1JMB A;  4BWN A;  2YNY A;  5TIS E;  4K3A A;  4Y99 C;  2JO1 A;  1JY3 O;  4H13 B;  4N6J A;  3HD7 D;  1BCC G;  2QSI A;  3MIW A;  2Y9Z A;  2BCC D;  2HOD B;  3GF7 A;  1SQV G;  3VMY A;  3L4F A;  1YIT P;  2ZT9 B;  2N1T D;  2AEJ A;  2K88 A;  2W27 A;  4LLH A;  1LTT C;  5E79 H;  3TGU G;  1BDD A;  2O1J A;  4N78 D;  1L4A B;  1SQX D;  2YKQ A;  3RK2 B;  1PL5 A;  2E76 B;  3HUS A;  3B71 A;  3GW6 A;  5B5E E;  4IOI H;  2QIW A;  1EZV E;  3BAT A;  1KFN A;  2IFM A;  3V4W A;  2D2C C;  2M0B A;  1N7S D;  3V2Q A;  4R4M A;  4GOD A;  2K3R A;  5AW3 B;  4YXD C;  4H44 C;  1SQV J;  2QVA A;  1AVY A;  1FZC B;  1DH3 A;  2M5A B;  3CD6 P;  1KIL B;  1SQQ D;  3RL0 C;  1NWQ A;  3TGU J;  3L72 G;  2WSS H;  1EZV I;  2BCC E;  1ZRT E;  4DT0 A;  3CWB G;  1M57 D;  3CCR P;  1OXZ A;  3PP5 A;  4AQR D;  3B5N B;  3KHU A;  2WSF J;  4WY4 B;  4N78 E;  4ZMD A;  2Y9Y A;  5GTI E;  1FBM A;  2HYN A;  1SQX E;  1NTM E;  5BU5 A;  2POH A;  1GW4 A;  2JWD A;  2QE7 H;  3VP8 A;  2OTL P;  3U1A A;  1BSN A;  4ZKP A;  2WSF H;  2B87 B;  3P7K A;  2ZXE B;  3L72 J;  2WVR A;  1A02 J;  3Q2Y A;  4CPG A;  3V2R A;  2FY8 A;  2C0X A;  1T8Z A;  2PGD A;  1PGJ A;  2WPQ A;  4GKG A;  2QJP C;  2YO3 A;  4EYY Q;  2G3A A;  1SQQ E;  1SVF A;  1X8Y A;  2ZVN B;  4WBA A;  1W2B O;  1T6A A;  4L73 A;  3SFE C;  3V2N A;  2NRG A;  1S1C X;  1JY3 P;  2KLU A;  4UB8 E;  1L2P A;  1GU5 A;  1H89 A;  1FJK A;  4BRY B;  5KTB A;  1YBK A;  2IZ0 A;  2Z5H A;  3H1K D;  2E5Y A;  3WUV A;  3Q1M A;  1FAV A;  3USS A;  3H25 A;  1JOC A;  1ZXG A;  1MFZ A;  3L71 D;  1GL2 B;  4HJG H;  1N86 A;  1EC5 A;  1AV1 A;  3HE5 A;  5AW5 B;  1VF5 C;  3V5B A;  1AFO A;  5CBN A;  2WPS A;  4JYB A;  2JP3 A;  3CCL P;  1MKM A;  1RY3 A;  1VQN P;  5AVV B;  1VPC A;  3RBX A;  3AE7 C;  2W90 A;  1SQP K;  2R32 A;  1J1D B;  1NHL A;  2YIU B;  3P8M C;  3H1K E;  3L36 A;  1K04 A;  1AJY A;  4R4L A;  3H1L D;  2XKM A;  2WPV B;  4UB6 E;  4DCK A;  1KMI Z;  1CI6 B;  1EDL A;  3L71 E;  5DJU B;  2Z4E A;  3CMA P;  1Y47 A;  1NU1 K;  2BEQ D;  1XTC C;  2KNC B;  3G71 P;  1RF1 B;  4C7R A;  2WTY A;  2A45 I;  3L73 E;  1N73 C;  1FC2 C;  5B66 H;  1KQS O;  3AEE C;  1BE3 J;  1L4A A;  2R3S A;  1NTZ G;  1N73 A;  3A3Y B;  3BCC G;  1M1K Q;  1S2E A;  3VYI A;  1N2D C;  1K8A Q;  2Z5I A;  1W5C E;  3B8E B;  1VQK P;  4EOT A;  1HJB A;  1GK4 A;  3H1L E;  3C1L A;  3EFG A;  4OGQ D;  1OW6 A;  5AW1 B;  1JNM A;  3MTU E;  1S9K D;  3Q3D A;  1URQ D;  2JKV A;  3MP7 B;  3H1I J;  4RKU J;  2M5A A;  1QEX A;  4N3Y B;  1HUC A;  1NTZ J;  2ZYD A;  3BCC J;  3VTP C;  2C9N Y;  1PPJ D;  1JCD A;  5AVU B;  3KQG A;  4I2L C;  1PIX A;  2NPS D;  3H32 A;  3JC2 2;  3CLQ A;  4IL6 H;  2H88 C;  3HD7 C;  3H1J G;  2P58 A;  3N7N A;  1KD1 Q;  4PV1 C;  2HR3 A;  3KYQ A;  1TU3 F;  3R2P A;  1NU1 G;  1LJ2 A;  1S4X A;  3FX0 A;  1NTK K;  2KSE A;  2D2C B;  4H44 B;  1LT1 A;  5CCG D;  1KYO H;  3AED C;  1X22 A;  1S9K E;  3C8V A;  2ZVO B;  2ZAE B;  1T3U A;  1ZR4 A;  5E79 E;  1BCC D;  1J1E C;  3RL0 B;  1OWA A;  1SQV D;  3HE4 A;  4C46 A;  2QA4 P;  1NVO A;  2B9B A;  2FXP A;  2KYV A;  3L74 J;  1GDT A;  3OJA B;  3TGU D;  1PPJ E;  4WWI A;  3H1J J;  1N7S C;  1N7S A;  1FZE A;  4BRY A;  1NU1 J;  3E7K A;  2J59 M;  1RE4 C;  2OYI C;  2E42 A;  1BSH A;  2OYI A;  1MUU A;  3O8Z A;  5K5G B;  3HRN A;  1FU1 A;  2JWA A;  1FOS F;  2HPC A;  1LTA C;  1GTW A;  1DD4 A;  2IPP A;  1ZN5 A;  1GL2 A;  2QJP B;  3L72 D;  2XZR A;  1BCC E;  1S72 P;  3BRT B;  1SQV E;  3CWB D;  3CC2 P;  5AW4 B;  1KZU B;  1L0N K;  3TGU E;  4AYC A;  3CX5 H;  1JY3 N;  2H8P D;  1H0T A;  1AQ5 A;  2GM4 A;  2P67 A;  2FXM A;  1YIJ P;  5CCH D;  1DEB A;  1U57 A;  2JJL A;  4JPZ B;  3TNU A;  1JUN A;  1GU4 A;  4RJT A;  2WZ7 A;  3CXH H;  3H1H G;  4Z1M H;  2OGU A;  1FDI A;  1Y8A A;  3M0A A;  2RMZ A;  1CI6 A;  2QJY C;  5AVY B;  2BAS A;  2V4H A;  3FWL A;  2KZI A;  4Y28 J;  2WSC J;  3GLM A;  3L72 E;  3R4Y A;  3HE5 B;  1R5L A;  1PV3 A;  1BGY G;  3CWB E;  1RE3 C;  1NTK J;  3RK2 D;  1VF5 B;  1FOS E;  3G6E P;  3C9I A;  1PGP A;  1WT6 A;  3A0B H;  4DZO A;  5KLV G;  3AE5 C;  1OW8 A;  3D71 A;  4ZKU A;  2IFN A;  3WMM 0;  4ASV A;  1AA0 A;  3IN6 A;  4GOF A;  3PRJ A;  1HWT C;  1SLQ A;  1U7J A;  5CMZ A;  2GA1 A;  1KIL D;  3G9R A;  1YYC A;  1T2K C;  1L0N G;  4PD4 D;  2G8Y A;  3ITK A;  1BGY J;  1PZQ A;  1LTS C;  2O3J A;  1SFC D;  1S3J A;  3B5N D;  4WY4 D;  2WT7 A;  4D6T J;  1FDM A;  1LT9 C;  5KLV J;  1N73 B;  3CCU P;  1LT9 A;  3V4Q A;  4JQ0 D;  3AEB C;  2HFE D;  1VQ7 P;  1L0L K;  1FS0 E;  2IBZ G;  3SWY A;  3PLN A;  1IFN A;  3GF3 A;  3VOP A;  1VQ5 P;  1KV4 A;  1YQ4 C;  4WB4 A;  3II6 A;  1AQT A;  3UIA A;  2JR8 A;  1USE A;  1S5L X;  5AVQ B;  3NXS A;  1DD3 A;  2FYU K;  1L0N J;  1YQ3 C;  3PJS K;  1YJN P;  2ZXX A;  2JEE A;  2WIT A;  1KIL E;  3NFQ A;  2LXB A;  2OAR A;  4KT0 J;  1NOH A;  3I5C A;  2WWW A;  1HBW A;  5B66 E;  4OGQ C;  1ZLL A;  3H32 B;  1X0T A;  4PD4 I;  5AW7 B;  1NTZ D;  1IFI A;  3BCC D;  1PGO A;  4KHX A;  2IX7 C;  4IFM A;  3HD7 B;  1URQ C;  4PV1 B;  4NPF X;  1UII A;  1URQ A;  5KAF H;  2IYP A;  1H8A A;  1YJ9 P;  4XA4 A;  1KYO D;  1RH5 B;  1SS1 A;  1IK9 A;  1OZH A;  3CL3 D;  2W6J H;  2NPS C;  1VQL P;  2FKW B;  2L5G B;  3CME P;  1L0L G;  1W2E A;  1HF9 A;  2FXO A;  1J1E B;  2E74 D;  3HE4 B;  1JEK A;  1NTM K;  4EDF A;  3AE1 C;  2N9B A;  5AW6 B;  3L35 A;  4IL6 E;  2FYU G;  1M7L A;  4L74 A;  2O01 J;  2V7Q J;  2WMM A;  1N7S B;  3CCE P;  4HH2 A;  5AVS B;  1NTZ E;  2HG5 D;  5AW8 B;  5CCG C;  3H1J D;  1GD2 E;  4MN4 C;  2OYI B;  2XU6 A;  2Q7C A;  1Z56 A;  1LTI C;  1NU1 D;  2KSJ A;  1SQB K;  1QX8 A;  3OW2 O;  2O01 H;  2V7Q H;  2I1K A;  1ZR2 A;  1KYO E;  3LIE A;  5APT A;  1L0L J;  2HPC B;  3RK3 C;  3O6Q A;  2ITA A;  3GG2 A;  3LID A;  2AXT H;  3M0D C;  1SP4 A;  2FYU J;  3M91 A;  3M0D A;  3CX5 D;  4GOE A;  5KJ7 C;  2YXQ B;  3NMD A;  4M3L A;  1HH0 A;  3GMA A;  3M9H A;  3KDP B;  5KJ7 A;  4C7N A;  2OTJ P;  1KYO I;  1KN7 A;  2KZJ A;  1H0T B;  1CZQ A;  1MFT A;  2Q9I A;  2IDB A;  3H1J E;  3AE4 C;  1BE3 G;  3CXH D;  3TNU B;  2E75 D;  3L70 G;  2WQY C;  3MGN A;  1NTM G;  1JM0 A;  3WU2 H;  4IFF A;  1QGK B;  5KLI C;  2QJY B;  1OVV A;  2E5T A;  2YMK A;  5CCH C;  5KKZ C;  3CC7 P;  4PD4 H;  4HKZ H;  3CX5 E;  3A5T A;  1Q90 D;  3L75 G;  2BCC J;  1R5S A;  3H1I G;  4W7Z A;  1KB9 H;  3CC4 P;  1SQB G;  1X9V A;  1PGQ A;  1LTJ C;  2PAJ A;  3L70 J;  4XE5 B;  1LTJ A;  4DOJ A;  1M1J C;  1NTM J;  2Y0D A;  3CX5 I;  1M1J A;  3CXH E;  2K9J A;  3VMA A;  1ZP0 C;  3AE3 C;  1IC2 A;  2OQQ A;  3EWK A;  3H1H D;  1RQV A;  2A06 G;  1PP9 D;  1RF0 C;  1EXI A;  1GMJ A;  4Y99 B;  1G2C A;  1RF0 A;  3L75 J;  5H2F H;  3CXH I;  2OYO A;  1RHZ B;  2KIK A;  1SQP G;  2WT7 B;  3VMZ A;  1SQB J;  5C39 A;  4RES B;  3A0B E;  4ASW A;  5APQ A;  4O9B A;  1BGY D;  2FYZ A;  2MJZ A;  1OIP A;  1LT9 B;  1KIL C;  1FE6 A;  1LTG C;  4NPD A;  3VP9 A;  3L74 G;  2QM7 A;  3IF4 A;  2RN0 A;  3F89 A;  5GTH H;  2IYO A;  5KLV D;  3HD7 A;  2B88 A;  1SFC C;  2W6A A;  3B5N C;  1NKZ B;  4WY4 C;  1SFC A;  2N1T C;  1EXJ A;  4U3F G;  4GDO A;  1QVG O;  2AEM A;  1E79 H;  1MV8 A;  1BDC A;  3NTN A;  1LWU C;  2N1T A;  1LWU A;  3H1H E;  1PP9 E;  1SQP J;  1L0N D;  1JY2 O;  4OWF A;  1K9M Q;  1H88 A;  5APS A;  3TF5 A;  3CPW O;  2KK7 A;  2I1J A;  2XDJ A;  4GIF A;  2QRX A;  1EDJ A;  4W7Y A;  1P84 H;  1PFI A;  4PJ0 H;  1AVO A;  3P32 A;  1BGY E;  2QM8 A;  4YXW H;  2KXP B;  3D6Y A;  1DX7 A;  3BRV B;  1K05 A;  2K37 A;  4TLF A;  1IZN B;  2IBZ D;  4U3F J;  3L73 G;  1VQ4 P;  5KLV E;  1URQ B;  5DJT B;  1JTH A;  1VL2 A;  1RE4 A;  3H6P A;  3H1K J;  3A0H H;  1GK6 A;  1A02 F;  2H89 C;  1Q82 Q;  1FDO A;  4H0L D;  1NKN A;  4BXL A;  3RBZ A;  2NPS B;  2OYH C;  4HB1 A;  3JCU H;  3L71 J;  2OYH A;  1HVV A;  3N4X A;  3SWK A;  2Q1K A;  1OMI A;  1VQ6 P;  3SWF A;  1VQM P;  2YKP A;  3TDK A;  3KZI H;  3L73 J;  2UWJ E;  1NTK G;  5APY A;  5KAF E;  3U1C A;  4ZNC A;  2OTK E;  1FZG A;  3JSV C;  3AE6 C;  2W83 C;  1Y9B A;  2E74 C; 
#chains in the Genus database with same CATH homology
 1X22 A;  1KV4 A;  2JR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...