1X22A

Solution structure of a novel moricin analogue, an antibacterial peptide from a lepidopteran insect, spodoptera litura
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
42
structure length
42
Chain Sequence
GKIPVKAIKKAGAAIGKGLRAINIASTAHDVYSFFKPKHKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic
molecule keywords moricin
publication title Isolation, gene expression and solution structure of a novel moricin analogue, antibacterial peptide from a lepidopteran insect, Spodoptera litura
pubmed doi rcsb
total genus 12
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2005-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06451 Moricin Moricin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.750 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Moricin domain 1x22A00
2JR8A 1KV4A 1X22A
chains in the Genus database with same CATH superfamily
3CWBE 1BCCD 1NU1K 3I5CA 2PAJA 2WSEJ 2A45G 1NGMB 3CMAP 1FDIA 1BE3E 1L4AA 3M0DC 3S1KA 4ZMDA 5CBOA 1ZR4A 4H13B 4PV1C 1FE6A 1KB9E 2IBZG 5L8RJ 1AFOA 4IFDK 3L72D 4HB1A 5BVZA 4JYBA 3EFFK 2WPRA 1OMIA 3H1HG 4Y28J 1NTKG 4IFMA 3Q2YA 4ZNCA 1SQQD 5CCGA 1OX3A 4EIJA 1Y9BA 4WVZA 1S5LX 2OYHB 3HD7A 1T8ZA 3B4SA 3LIDA 1NYHA 2V7QJ 3AE4C 1LT9B 2K9JB 1FDMA 2RKLA 1QVGO 1P84E 2W90A 3C1LA 4PD4D 3A3YB 3WU2E 1GL2D 1OFCX 1Q81Q 3SFDC 3AEDC 3IFMA 2M8RA 1QGKB 1SLQA 1PP9J 3B8EB 1L4AC 1RF1A 1DX7A 1JTHA 3HTKA 3AEAC 4WWIA 1QL2A 1EXJA 1GTWA 1FZFA 2E75B 3D71A 2BCCJ 2GUSA 2KUBA 2CK3H 1AA0A 5AVUB 4DCKA 3CCSP 1CI6B 1BCCG 2WPQA 2HODA 3A0BE 1GZLA 3V2NA 3L73E 5DJTB 3SSUA 3RK2D 2OYOA 4IOIH 3K5BA 5CCGC 2Y0DA 1JM0A 3CXHD 4N78D 3H25A 2I1JA 1E79H 5CCHA 1HBWA 2FY8A 3U59A 2R32A 3V6IA 3VYIA 1KZUB 3L72G 2WWWA 3HD7C 1L0ND 2HPCB 5B5EE 2AEFA 3T97B 3VN0A 1U57A 1WMKA 1DD4A 2WSCH 2QA4P 3FWNA 2M5AA 1KV4A 1JY2P 2R3CA 3CC4P 1KMIZ 3G9RA 3L75E 3H6PA 5TJHA 5APVA 1SQPK 3CCJP 2NPSA 2IYPA 2QJKC 1KB9I 3TF5A 1BDCA 1RF1C 5KKZC 2ZYGA 5AVYB 1X0TA 3L70D 5E79E 5KLVD 2ZFCA 3FGAD 1SFCB 3M0AA 2E75D 2O01H 3V2QA 1IK7A 2KI7B 3SWFA 1JUNA 2E76B 3H1HJ 1N2DC 1NTKJ 4H44C 2WPSA 1BGYE 3QWOC 1WRGA 1PGPA 1M7LA 1ZMEC 4GOFA 5APYA 3GG2A 2ZXEB 1NU1E 3BASA 1FZCB 2H7HA 2YXRB 1MKMA 1JY3N 5CCHC 3A0HE 2JKVA 3D6YA 5KAFE 2M3EA 3ZDMA 2XDJA 5AVTB 2E74C 2MJZA 4H0LB 1URQB 1JOCA 1IC2A 2I1KA 4OWFA 3E1RA 4L74A 3N7NA 3RL0g 1AVOA 3JC22 3Q5SA 3HD7D 4TLFA 4PD4H 1LP1B 1KILD 3VOPA 1S5LH 1YTZI 3G4SP 2QM8A 1PFIA 3P8CD 2NPSC 2N1TD 2KB7P 2P10A 3H1LD 1BCCJ 2B87B 3GW6A 1K9MQ 1AQTA 1GU5A 3NMDA 2YKPA 2K88A 4KT0J 3E1IA 1X22A 1EDLA 1YTZT 1W2BO 3L70G 1RQVA 3L72J 3KXDA 5KLVG 3W68A 1PP9D 4EDFA 1VF5B 1L0LK 1QLED 3L74G 4BXLA 2HFED 2RH0A 1J1EC 3CXHH 3BCCD 4H0LD 5GTHH 2P67A 1SQQJ 2G8YA 1SQXD 2KZJA 5AVXB 2WITA 2BCCD 3KPEA 5AW4B 3H1KE 1OW7A 2ZVNB 5BU8B 1NAYA 4I6MC 5APTA 1LTTC 3WUUA 3M9HA 2QE7H 1S72P 4HH2A 1SQBD 1M1KQ 2IX7C 2DW3A 2WSSH 1Q7YQ 5AVVB 2FYUE 5AVQB 1H8AA 2A06E 2D2CC 1LTSC 1EZVE 4JYCA 2ZJSE 1KQFB 1GD2E 2P2UA 2P58A 1SQVK 2XZRA 1HF9A 2YXQB 3AE1C 3HE5B 3PH0A 2JWAA 4YTPC 4L75A 1A02F 2PFXA 3RL0B 4OVNF 1YQ3C 3S9OA 1IO4A 2Q9IA 4N6JA 1USEA 3GLMA 1SQPE 3GHGA 4OGQC 1DH3A 1VF5D 3H1LG 4UB6H 4QMAA 4PJ0H 4C7NB 1OVRA 2CPBA 3V4WA 1XTGB 2H8PD 1AJYA 1NH4A 1J1DB 1HUCA 3EWKA 1KQLA 1JMBA 3KZIH 1ZLLA 1BSNA 3H1HD 1GDTA 2JJLA 4C46A 1NTKD 3SFEC 3CCEP 1LTJB 4TT3H 1JY3P 4DJGA 3L71D 3AE5C 4K3AA 4YXWH 2PGDA 2K1AA 1QX8A 2FFDB 3BVHA 3BCCG 2RMZA 3O6QB 2IFMA 3RK3D 1SQXG 3L37A 2C0XA 2B9BA 2YO2A 1T6AA 1PPJG 4DT0A 1YIJP 1OW8A 2XNDH 1CSBA 2J5UA 4WY4D 2C0WA 1SQBG 3SWKA 1DD3A 4BRYB 3L70J 2OYHA 3HE4A 5KLVJ 2D2CD 3L74J 2YKQA 1FJKA 4Y99B 4HYTB 3GHGC 1LT9A 2NZ2A 1ZXGA 1YHQP 2KNCA 1FDOA 4NPEA 1JCCA 1N73B 1SVFA 1NTZG 1SQQE 2W83C 3WUVA 1HJ0A 1IFDA 4WB4A 1ZW0A 2QG4A 3CC2P 4YXDC 2IZ1A 3FWLA 3CLQA 3VMXA 5AW2B 3TNUB 1YITP 2QJPB 2IBZI 3CCUP 4H13C 1LTGC 1MFZA 2XU6A 1X79B 1HJBA 2HLOA 4AQRD 4PD4E 3HUSA 1N7SA 1EZVI 1S5LE 1CI6A 1NAFA 1L0LE 3Q5PA 1HGVA 2O1KA 3TDKA 4U3FD 1FZAA 3MP7B 3RK2B 1KYOD 1VQMP 2W6BA 3L71G 3MTUE 2W27A 1N7LA 2OYHC 3H1LJ 1FC2C 4D6TG 5AVZB 2PRRA 1J2JB 3T97A 1EDIA 1VQNP 4RO0A 1LT9C 2A45H 2OTKE 2YKOA 2POHA 5AW0B 5AVSB 5KJ7A 2WZ7A 2UWJE 2HYNA 4EI2A 1JCDA 3CXHE 4N78E 2QSIA 3WMM0 3M9QA 2XKMA 3AE8C 2KS1B 2QJYB 5GTHE 1SQVE 3MIWA 2FYNC 3USSA 1OVVA 2WTYA 1L0NE 2FKWB 3KDPB 2YIUB 1PGOA 3BCCJ 1SQXJ 2OYIA 2KXPB 3A5TA 1H89A 3HUSC 1N7SC 2FBWC 1IFMA 2AEMA 3VMZA 3H32B 1VQ8P 3F89A 1SQBJ 5APXA 5C39A 4PV1D 3RBZA 1VL2A 3AE7C 1D7MA 3VTPC 2FYUK 3PLNA 2QVAA 3AECC 1P84D 3CX5D 1EC5A 1H0TA 2FXMA 1YYCA 3TSIA 3I56P 3BATA 1URQA 2YO3A 1NTKK 4ASWA 3AE6C 1NTZJ 4U3FG 3MZWB 4I7ZB 2W8ZA 4GDOA 2ZYDA 5KJ7C 2FXPA 4UB6E 3LIEA 1S9KD 1UIXA 2SPZA 3VP8A 3HD7B 4PJ0E 4HKZH 4OH8B 1IZNB 3JSVC 1IK9A 3H1IG 1KILB 1E5WA 3A2AA 3P7KA 2WQYC 2KSJA 2N1TB 1VQ7P 4PD4I 4JBZA 3KZIE 2IFNA 3L73D 2OYIC 2JDIH 3L35A 3L74D 3D70A 3MUDA 2R5BA 5DJUB 1BE3G 2KZIA 2E76C 2QJKB 3M9BA 1L4AD 1K8AQ 1VQPP 1RF1B 4BWNA 1JTHB 1KILE 2Z4EA 3L71J 3B5NA 3P8CE 1OZHA 2J59M 3RGUA 1N7SD 1M56D 2Q3IA 3AE3C 1YBKA 3H1LE 1KYOH 2VRSA 1FZBA 1RY3A 2O1JA 1VQ6P 1URQC 1NTMD 5CCGD 1OW6A 4XA4A 2J58A 3CXHI 5EFWB 3ITKA 1RH5B 1AVYA 3N4XA 4NPDA 3UIAA 4LGDE 1KC8Q 5AW7B 1T2KC 5M1BA 1PP9E 2BASA 2Y9YA 4R4LA 2ITAA 2ZT9C 1KTMA 2Y0CA 3LW5H 2M5AB 5KJ7D 3H1JD 3BCCE 1BGYD 1SQQK 1PGQA 3GF3A 1ZRTD 2GA1A 1SQXE 1YJWP 2N9BA 1LWUA 1YI2P 2BCCE 2OTJP 3MUDC 1L2PA 4K35A 5CJ0A 2WSFJ 1NKNA 5KLIB 1PGJA 4UB8H 1NU1D 4RJTA 1SQBE 1G2CB 3B5NC 1GW4A 1Y47A 5K5GB 2W6AA 1RF0A 1M1JB 3L73G 2HG5D 4H44D 1NO4A 4U3FJ 3NXSA 2OGUA 2R44A 3C8VA 1K05A 3CX5H 3NFQA 2WMMA 2LKMA 3TGUD 1PPJD 5CCHD 3S4RA 1SS1A 3H1IJ 5AW1B 1LTJA 1JY2O 1HTLC 1R5SA 2KYVA 2E74D 1MZ9A 3QH9A 3V2PA 5KAIH 2FFDA 2KOGA 3R2PA 3L75G 3BRTB 3O6QA 1TU3F 2IBZE 1NHLA 3MD0A 2KP8A 1NTMG 2CPSA 1KN7A 3RK3B 2Z5IA 3TK1A 1FJPA 1HWTC 3P8MC 1KQSO 3LW5J 1QL1A 1PV3A 2OQQA 1LWUC 4GKGA 2N9YB 5BU5A 2ZYAA 4RKUJ 2RN0A 2NPSD 2R5DA 2L91A 2ZT9D 3H1HE 1NTKE 3RBXA 5GTIH 1IFJA 2P1JA 1NTZD 1L0NK 3IN6A 4WY4B 1VQLP 1DEEG 3RL0C 3OJAB 4EOTA 2D2CB 3H1JG 3SWYA 1BGYG 1RF0C 3II6A 3RK3E 2KLVA 3EFGA 2E5YA 1Y8AA 5CHXA 1N73A 1GL2A 1U7MA 5AVWB 3B5ND 3CCVP 1SP4A 1NU1G 5AW3B 2NRGA 4ZKPA 2KSEA 2I8DA 4JQ0D 4WBAA 4ZKUA 1S2EA 4U7JA 1XTCC 5KLVK 3TNUA 3CC7P 1ZN5A 2KIKA 4A7PA 2K3RA 2M0BA 2FFDC 4D6TD 3V4QA 5AW9B 3IF4A 1M8OB 3TGUG 2K9YA 1EXIA 2BEZF 1VQ9P 1BCCE 2WT7B 1X9VA 4MN4C 2XV5A 2V4HA 2E43A 1LJ2A 3CL3D 2P7JA 3L73J 1KD1Q 4Y99C 3L72E 2OTLP 1KFNA 2K9JA 2JR8A 3PJSK 4GT1A 3FXEA 4EYYQ 3CCLP 1OVUA 1N73C 1GL2C 1KYOE 2A45I 2WPVB 2KS1A 4OGQD 3E7KA 1MUUA 3BRVB 2ZVOB 3PRJA 4KHXA 2O01N 2Q5UA 5CBNA 1VPCA 3L75J 1Q82Q 1NTMJ 3H1KG 4HJGH 3H32A 3AE2C 1VQKP 1BSHA 1QVFO 2L5GB 1GU4A 2JP3A 5APSA 3IAOA 3RK2C 2H89C 4PV1B 3F5HA 2FYUG 1FOSE 4KJMA 2E5TA 4IL6H 1JB0J 2R3SA 3H1JJ 2A06G 2JWDA 2G3AA 1EZVG 3H1ID 1BGYJ 3L4FA 4UB8E 1SQXK 1N8RQ 3MHVA 4I2LC 2HPCA 1JEKA 3M06A 1OXZA 1T3JA 3CWBD 1EQ7A 1NU1J 1SQBK 1DEBA 1ZP0C 2B88A 3IR9A 3HE4B 3GMAA 1BE3D 3V5BA 1SQPG 4M3LA 4XE5B 1KILA 1CW5A 4Z1MH 2QJYC 3VP9A 2Q7CA 2WVRA 1KB9D 2N1TA 3VMAA 4GODA 3CX5E 1KQGB 1MFTA 4JPZB 2KNCB 1OIPA 2ZAEB 2H88C 2YIUC 1L0LD 5H2FH 3G3ZA 1YQ4C 1JY3O 1SFCA 1YJ9P 1PZQA 1NTZK 2E75C 2AXTH 5APUA 3TGUJ 2JEEA 3EQ2A 5KAIE 2H43A 1S9KE 1Z56A 1G1IA 2FYNB 1L4AB 3CCQP 2QIWA 3FX0A 1JO5A 4H13D 1Q2NA 2IYOA 1PIXA 1QEXA 1DIPA 1HVVA 1FZCA 3HUSB 1N7SB 3L70E 5KLVE 3AE9C 5GTIE 1AV1A 3L74E 2FYZA 2C9NY 1HGZA 5TISH 3OW2O 1RQUA 1FS0E 3WUTA 3U1CA 1KYOI 4I7ZC 2Z5HA 1GW3A 4RESB 5B66H 1SQVD 1FZGA 5APWA 1MV8A 2Q3EA 3R4YA 3G6EP 5APQA 3HRNA 1LP1A 3NTNA 2B89A 1GMJA 4I1LA 1KILC 3CMEP 2IZ0A 3PP5A 2N1TC 1VDFA 4DOJA 2JO1A 3M91A 3H1KJ 1SQQG 3ABVC 2WSFH 3CWBG 2C9LY 1ZV8A 1NTME 1SFCC 2B87A 3Q5RA 1N86A 1JNMA 5AW8B 3W67A 1AQ5A 1NWQA 2Q6QA 1LTAC 1EDKA 2FYUJ 1G2CA 5KKZB 2E42A 3HTKB 1RE3A 1KFMA 2OYIB 4N3YB 3B71A 1RE4A 3KQGA 1L0LG 4D6TJ 1FZCC 1M1JA 3H1JE 1BDDA 4L73A 1IJDB 1ZRTE 4H44B 3TYYA 2HODB 2LXBA 3L75D 4W7ZA 4H0LC 1U7JA 3JCUH 4NPFX 4CPGA 1NVOA 1SQPJ 5CMZA 5AVRB 4W7YA 2AEJA 2PP6A 4C7RA 2Y0EA 1P84I 2M3BA 1H0TB 3CX5I 3KHUA 2E74B 1FOSF 3CPWO 4GIFA 2QRXA 1VQ4P 1KB9H 2WSCJ 1ZOYC 3PTZA 1SQVG 3TGUE 3Q1MA 1PPJE 3CD6P 2K37A 2AXCA 5KLIC 2NPSB 1L0NG 2ZT9B 1S4XA 3HE5A 3G71P 4WY4A 3Q3DA 1RHZB 5AW5B 1FU1A 1RE3C 1SFCD 1Q90D 1RE4C 1ZR2A 2E76D 1K73Q 1NKZB 1M1JC 1VF5C 4AYCA 1NOHA 2BEQD 1YJNP 1VQOP 1R5LA 2O01J 4C7NA 4IL6E 1Q86Q 5CJ4A 4LLHA 3B5NB 4YPCA 3OA7A 1P84H 2YMKA 1S3JA 1H88A 3WU2H 1NTZE 1T3UA 2GUVA 1IFIA 3AEFC 1PL5A 2ZXXA 1J1EB 4IFFA 3AEGC 3GF7A 2HR3A 2IDBA 3L36A 1URQD 1GK6A 4IL6X 1S1CX 1WT6A 1LGHB 3O8ZA 3CWBJ 3V2RA 1R8EA 4W80A 3RK3C 1FZEA 3VMYA 1BE3J 4L76A 2Y9ZA 3AEBC 2MKVA 1T2KD 4XFJA 5H2FE 2WT7A 4GOEA 2LR2A 3PHLA 2Q1KA 3A0BH 4BRYA 4WY4C 2AXTE 1UIIA 4DZOA 1LTIC 2YNYA 1L0LJ 1LT1A 3L71E 1CZQA 4O9BA 1LWUB 4LC1A 1JMMA 4D6TE 1OWAA 3I55P 3D6ZA 2FXOA 3H1KD 5B5EH 3KYQA 5KTBA 1W2EA 1J1DC 4OGQB 5TISE 4AUWA 1LTJC 2IBZD 2FYUD 2W6JH 2WSEH 5B66E 1FBMA 4B86A 2A06D 1EZVD 2GM4A 4ASVA 5E79H 1SQVJ 3P32A 3CCMP 2QM7A 2O3JA 3M0DA 1L0NJ 1PP9G 4R4MA 1KORA 3CCRP 2XNXA 1K04A 1SQPD 1M90Q 1FAVA 1NJIQ 1EDJA 3MGNA 2QEXP 2KK7A 1G1JA 2LXCB 3CI9A 1USDA 1VQ5P 2BCCG 1NTMK 3A7OA 3AEEC 1JY2N 3A0HH 1X8YA 5KAFH 2OARA 2V7QH 3RL0D 4U3FE 1M57D 4JF7A 1W5CE 3C9IA 1LTBC 1IFPA 2IPPA 3GHGB 1IFNA 3H1IE 3JCUE 1GK4A 3FXDA 2YMYA 3U1AA 5AW6B 1GL2B 2QJPC 3OAKA 1LNQA 1HH0A 2KLUA 1A02J
chains in the Genus database with same CATH topology
2JR8A 1KV4A 1X22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JR8 A;  1KV4 A;  1X22 A; 
#chains in the Genus database with same CATH topology
 3CWB E;  1BCC D;  1NU1 K;  3I5C A;  2PAJ A;  2WSE J;  2A45 G;  1NGM B;  3CMA P;  1FDI A;  1BE3 E;  1L4A A;  3M0D C;  3S1K A;  4ZMD A;  5CBO A;  1ZR4 A;  4H13 B;  4PV1 C;  1FE6 A;  1KB9 E;  2IBZ G;  5L8R J;  1AFO A;  4IFD K;  3L72 D;  4HB1 A;  5BVZ A;  4JYB A;  3EFF K;  2WPR A;  1OMI A;  3H1H G;  4Y28 J;  1NTK G;  4IFM A;  3Q2Y A;  4ZNC A;  1SQQ D;  5CCG A;  1OX3 A;  4EIJ A;  1Y9B A;  4WVZ A;  1S5L X;  2OYH B;  3HD7 A;  1T8Z A;  3B4S A;  3LID A;  1NYH A;  2V7Q J;  3AE4 C;  1LT9 B;  2K9J B;  1FDM A;  2RKL A;  1QVG O;  1P84 E;  2W90 A;  3C1L A;  4PD4 D;  3A3Y B;  3WU2 E;  1GL2 D;  1OFC X;  1Q81 Q;  3SFD C;  3AED C;  3IFM A;  2M8R A;  1QGK B;  1SLQ A;  1PP9 J;  3B8E B;  1L4A C;  1RF1 A;  1DX7 A;  1JTH A;  3HTK A;  3AEA C;  4WWI A;  1QL2 A;  1EXJ A;  1GTW A;  1FZF A;  2E75 B;  3D71 A;  2BCC J;  2GUS A;  2KUB A;  2CK3 H;  1AA0 A;  5AVU B;  4DCK A;  3CCS P;  1CI6 B;  1BCC G;  2WPQ A;  2HOD A;  3A0B E;  1GZL A;  3V2N A;  3L73 E;  5DJT B;  3SSU A;  3RK2 D;  2OYO A;  4IOI H;  3K5B A;  5CCG C;  2Y0D A;  1JM0 A;  3CXH D;  4N78 D;  3H25 A;  2I1J A;  1E79 H;  5CCH A;  1HBW A;  2FY8 A;  3U59 A;  2R32 A;  3V6I A;  3VYI A;  1KZU B;  3L72 G;  2WWW A;  3HD7 C;  1L0N D;  2HPC B;  5B5E E;  2AEF A;  3T97 B;  3VN0 A;  1U57 A;  1WMK A;  1DD4 A;  2WSC H;  2QA4 P;  3FWN A;  2M5A A;  1KV4 A;  1JY2 P;  2R3C A;  3CC4 P;  1KMI Z;  3G9R A;  3L75 E;  3H6P A;  5TJH A;  5APV A;  1SQP K;  3CCJ P;  2NPS A;  2IYP A;  2QJK C;  1KB9 I;  3TF5 A;  1BDC A;  1RF1 C;  5KKZ C;  2ZYG A;  5AVY B;  1X0T A;  3L70 D;  5E79 E;  5KLV D;  2ZFC A;  3FGA D;  1SFC B;  3M0A A;  2E75 D;  2O01 H;  3V2Q A;  1IK7 A;  2KI7 B;  3SWF A;  1JUN A;  2E76 B;  3H1H J;  1N2D C;  1NTK J;  4H44 C;  2WPS A;  1BGY E;  3QWO C;  1WRG A;  1PGP A;  1M7L A;  1ZME C;  4GOF A;  5APY A;  3GG2 A;  2ZXE B;  1NU1 E;  3BAS A;  1FZC B;  2H7H A;  2YXR B;  1MKM A;  1JY3 N;  5CCH C;  3A0H E;  2JKV A;  3D6Y A;  5KAF E;  2M3E A;  3ZDM A;  2XDJ A;  5AVT B;  2E74 C;  2MJZ A;  4H0L B;  1URQ B;  1JOC A;  1IC2 A;  2I1K A;  4OWF A;  3E1R A;  4L74 A;  3N7N A;  3RL0 g;  1AVO A;  3JC2 2;  3Q5S A;  3HD7 D;  4TLF A;  4PD4 H;  1LP1 B;  1KIL D;  3VOP A;  1S5L H;  1YTZ I;  3G4S P;  2QM8 A;  1PFI A;  3P8C D;  2NPS C;  2N1T D;  2KB7 P;  2P10 A;  3H1L D;  1BCC J;  2B87 B;  3GW6 A;  1K9M Q;  1AQT A;  1GU5 A;  3NMD A;  2YKP A;  2K88 A;  4KT0 J;  3E1I A;  1X22 A;  1EDL A;  1YTZ T;  1W2B O;  3L70 G;  1RQV A;  3L72 J;  3KXD A;  5KLV G;  3W68 A;  1PP9 D;  4EDF A;  1VF5 B;  1L0L K;  1QLE D;  3L74 G;  4BXL A;  2HFE D;  2RH0 A;  1J1E C;  3CXH H;  3BCC D;  4H0L D;  5GTH H;  2P67 A;  1SQQ J;  2G8Y A;  1SQX D;  2KZJ A;  5AVX B;  2WIT A;  2BCC D;  3KPE A;  5AW4 B;  3H1K E;  1OW7 A;  2ZVN B;  5BU8 B;  1NAY A;  4I6M C;  5APT A;  1LTT C;  3WUU A;  3M9H A;  2QE7 H;  1S72 P;  4HH2 A;  1SQB D;  1M1K Q;  2IX7 C;  2DW3 A;  2WSS H;  1Q7Y Q;  5AVV B;  2FYU E;  5AVQ B;  1H8A A;  2A06 E;  2D2C C;  1LTS C;  1EZV E;  4JYC A;  2ZJS E;  1KQF B;  1GD2 E;  2P2U A;  2P58 A;  1SQV K;  2XZR A;  1HF9 A;  2YXQ B;  3AE1 C;  3HE5 B;  3PH0 A;  2JWA A;  4YTP C;  4L75 A;  1A02 F;  2PFX A;  3RL0 B;  4OVN F;  1YQ3 C;  3S9O A;  1IO4 A;  2Q9I A;  4N6J A;  1USE A;  3GLM A;  1SQP E;  3GHG A;  4OGQ C;  1DH3 A;  1VF5 D;  3H1L G;  4UB6 H;  4QMA A;  4PJ0 H;  4C7N B;  1OVR A;  2CPB A;  3V4W A;  1XTG B;  2H8P D;  1AJY A;  1NH4 A;  1J1D B;  1HUC A;  3EWK A;  1KQL A;  1JMB A;  3KZI H;  1ZLL A;  1BSN A;  3H1H D;  1GDT A;  2JJL A;  4C46 A;  1NTK D;  3SFE C;  3CCE P;  1LTJ B;  4TT3 H;  1JY3 P;  4DJG A;  3L71 D;  3AE5 C;  4K3A A;  4YXW H;  2PGD A;  2K1A A;  1QX8 A;  2FFD B;  3BVH A;  3BCC G;  2RMZ A;  3O6Q B;  2IFM A;  3RK3 D;  1SQX G;  3L37 A;  2C0X A;  2B9B A;  2YO2 A;  1T6A A;  1PPJ G;  4DT0 A;  1YIJ P;  1OW8 A;  2XND H;  1CSB A;  2J5U A;  4WY4 D;  2C0W A;  1SQB G;  3SWK A;  1DD3 A;  4BRY B;  3L70 J;  2OYH A;  3HE4 A;  5KLV J;  2D2C D;  3L74 J;  2YKQ A;  1FJK A;  4Y99 B;  4HYT B;  3GHG C;  1LT9 A;  2NZ2 A;  1ZXG A;  1YHQ P;  2KNC A;  1FDO A;  4NPE A;  1JCC A;  1N73 B;  1SVF A;  1NTZ G;  1SQQ E;  2W83 C;  3WUV A;  1HJ0 A;  1IFD A;  4WB4 A;  1ZW0 A;  2QG4 A;  3CC2 P;  4YXD C;  2IZ1 A;  3FWL A;  3CLQ A;  3VMX A;  5AW2 B;  3TNU B;  1YIT P;  2QJP B;  2IBZ I;  3CCU P;  4H13 C;  1LTG C;  1MFZ A;  2XU6 A;  1X79 B;  1HJB A;  2HLO A;  4AQR D;  4PD4 E;  3HUS A;  1N7S A;  1EZV I;  1S5L E;  1CI6 A;  1NAF A;  1L0L E;  3Q5P A;  1HGV A;  2O1K A;  3TDK A;  4U3F D;  1FZA A;  3MP7 B;  3RK2 B;  1KYO D;  1VQM P;  2W6B A;  3L71 G;  3MTU E;  2W27 A;  1N7L A;  2OYH C;  3H1L J;  1FC2 C;  4D6T G;  5AVZ B;  2PRR A;  1J2J B;  3T97 A;  1EDI A;  1VQN P;  4RO0 A;  1LT9 C;  2A45 H;  2OTK E;  2YKO A;  2POH A;  5AW0 B;  5AVS B;  5KJ7 A;  2WZ7 A;  2UWJ E;  2HYN A;  4EI2 A;  1JCD A;  3CXH E;  4N78 E;  2QSI A;  3WMM 0;  3M9Q A;  2XKM A;  3AE8 C;  2KS1 B;  2QJY B;  5GTH E;  1SQV E;  3MIW A;  2FYN C;  3USS A;  1OVV A;  2WTY A;  1L0N E;  2FKW B;  3KDP B;  2YIU B;  1PGO A;  3BCC J;  1SQX J;  2OYI A;  2KXP B;  3A5T A;  1H89 A;  3HUS C;  1N7S C;  2FBW C;  1IFM A;  2AEM A;  3VMZ A;  3H32 B;  1VQ8 P;  3F89 A;  1SQB J;  5APX A;  5C39 A;  4PV1 D;  3RBZ A;  1VL2 A;  3AE7 C;  1D7M A;  3VTP C;  2FYU K;  3PLN A;  2QVA A;  3AEC C;  1P84 D;  3CX5 D;  1EC5 A;  1H0T A;  2FXM A;  1YYC A;  3TSI A;  3I56 P;  3BAT A;  1URQ A;  2YO3 A;  1NTK K;  4ASW A;  3AE6 C;  1NTZ J;  4U3F G;  3MZW B;  4I7Z B;  2W8Z A;  4GDO A;  2ZYD A;  5KJ7 C;  2FXP A;  4UB6 E;  3LIE A;  1S9K D;  1UIX A;  2SPZ A;  3VP8 A;  3HD7 B;  4PJ0 E;  4HKZ H;  4OH8 B;  1IZN B;  3JSV C;  1IK9 A;  3H1I G;  1KIL B;  1E5W A;  3A2A A;  3P7K A;  2WQY C;  2KSJ A;  2N1T B;  1VQ7 P;  4PD4 I;  4JBZ A;  3KZI E;  2IFN A;  3L73 D;  2OYI C;  2JDI H;  3L35 A;  3L74 D;  3D70 A;  3MUD A;  2R5B A;  5DJU B;  1BE3 G;  2KZI A;  2E76 C;  2QJK B;  3M9B A;  1L4A D;  1K8A Q;  1VQP P;  1RF1 B;  4BWN A;  1JTH B;  1KIL E;  2Z4E A;  3L71 J;  3B5N A;  3P8C E;  1OZH A;  2J59 M;  3RGU A;  1N7S D;  1M56 D;  2Q3I A;  3AE3 C;  1YBK A;  3H1L E;  1KYO H;  2VRS A;  1FZB A;  1RY3 A;  2O1J A;  1VQ6 P;  1URQ C;  1NTM D;  5CCG D;  1OW6 A;  4XA4 A;  2J58 A;  3CXH I;  5EFW B;  3ITK A;  1RH5 B;  1AVY A;  3N4X A;  4NPD A;  3UIA A;  4LGD E;  1KC8 Q;  5AW7 B;  1T2K C;  5M1B A;  1PP9 E;  2BAS A;  2Y9Y A;  4R4L A;  2ITA A;  2ZT9 C;  1KTM A;  2Y0C A;  3LW5 H;  2M5A B;  5KJ7 D;  3H1J D;  3BCC E;  1BGY D;  1SQQ K;  1PGQ A;  3GF3 A;  1ZRT D;  2GA1 A;  1SQX E;  1YJW P;  2N9B A;  1LWU A;  1YI2 P;  2BCC E;  2OTJ P;  3MUD C;  1L2P A;  4K35 A;  5CJ0 A;  2WSF J;  1NKN A;  5KLI B;  1PGJ A;  4UB8 H;  1NU1 D;  4RJT A;  1SQB E;  1G2C B;  3B5N C;  1GW4 A;  1Y47 A;  5K5G B;  2W6A A;  1RF0 A;  1M1J B;  3L73 G;  2HG5 D;  4H44 D;  1NO4 A;  4U3F J;  3NXS A;  2OGU A;  2R44 A;  3C8V A;  1K05 A;  3CX5 H;  3NFQ A;  2WMM A;  2LKM A;  3TGU D;  1PPJ D;  5CCH D;  3S4R A;  1SS1 A;  3H1I J;  5AW1 B;  1LTJ A;  1JY2 O;  1HTL C;  1R5S A;  2KYV A;  2E74 D;  1MZ9 A;  3QH9 A;  3V2P A;  5KAI H;  2FFD A;  2KOG A;  3R2P A;  3L75 G;  3BRT B;  3O6Q A;  1TU3 F;  2IBZ E;  1NHL A;  3MD0 A;  2KP8 A;  1NTM G;  2CPS A;  1KN7 A;  3RK3 B;  2Z5I A;  3TK1 A;  1FJP A;  1HWT C;  3P8M C;  1KQS O;  3LW5 J;  1QL1 A;  1PV3 A;  2OQQ A;  1LWU C;  4GKG A;  2N9Y B;  5BU5 A;  2ZYA A;  4RKU J;  2RN0 A;  2NPS D;  2R5D A;  2L91 A;  2ZT9 D;  3H1H E;  1NTK E;  3RBX A;  5GTI H;  1IFJ A;  2P1J A;  1NTZ D;  1L0N K;  3IN6 A;  4WY4 B;  1VQL P;  1DEE G;  3RL0 C;  3OJA B;  4EOT A;  2D2C B;  3H1J G;  3SWY A;  1BGY G;  1RF0 C;  3II6 A;  3RK3 E;  2KLV A;  3EFG A;  2E5Y A;  1Y8A A;  5CHX A;  1N73 A;  1GL2 A;  1U7M A;  5AVW B;  3B5N D;  3CCV P;  1SP4 A;  1NU1 G;  5AW3 B;  2NRG A;  4ZKP A;  2KSE A;  2I8D A;  4JQ0 D;  4WBA A;  4ZKU A;  1S2E A;  4U7J A;  1XTC C;  5KLV K;  3TNU A;  3CC7 P;  1ZN5 A;  2KIK A;  4A7P A;  2K3R A;  2M0B A;  2FFD C;  4D6T D;  3V4Q A;  5AW9 B;  3IF4 A;  1M8O B;  3TGU G;  2K9Y A;  1EXI A;  2BEZ F;  1VQ9 P;  1BCC E;  2WT7 B;  1X9V A;  4MN4 C;  2XV5 A;  2V4H A;  2E43 A;  1LJ2 A;  3CL3 D;  2P7J A;  3L73 J;  1KD1 Q;  4Y99 C;  3L72 E;  2OTL P;  1KFN A;  2K9J A;  2JR8 A;  3PJS K;  4GT1 A;  3FXE A;  4EYY Q;  3CCL P;  1OVU A;  1N73 C;  1GL2 C;  1KYO E;  2A45 I;  2WPV B;  2KS1 A;  4OGQ D;  3E7K A;  1MUU A;  3BRV B;  2ZVO B;  3PRJ A;  4KHX A;  2O01 N;  2Q5U A;  5CBN A;  1VPC A;  3L75 J;  1Q82 Q;  1NTM J;  3H1K G;  4HJG H;  3H32 A;  3AE2 C;  1VQK P;  1BSH A;  1QVF O;  2L5G B;  1GU4 A;  2JP3 A;  5APS A;  3IAO A;  3RK2 C;  2H89 C;  4PV1 B;  3F5H A;  2FYU G;  1FOS E;  4KJM A;  2E5T A;  4IL6 H;  1JB0 J;  2R3S A;  3H1J J;  2A06 G;  2JWD A;  2G3A A;  1EZV G;  3H1I D;  1BGY J;  3L4F A;  4UB8 E;  1SQX K;  1N8R Q;  3MHV A;  4I2L C;  2HPC A;  1JEK A;  3M06 A;  1OXZ A;  1T3J A;  3CWB D;  1EQ7 A;  1NU1 J;  1SQB K;  1DEB A;  1ZP0 C;  2B88 A;  3IR9 A;  3HE4 B;  3GMA A;  1BE3 D;  3V5B A;  1SQP G;  4M3L A;  4XE5 B;  1KIL A;  1CW5 A;  4Z1M H;  2QJY C;  3VP9 A;  2Q7C A;  2WVR A;  1KB9 D;  2N1T A;  3VMA A;  4GOD A;  3CX5 E;  1KQG B;  1MFT A;  4JPZ B;  2KNC B;  1OIP A;  2ZAE B;  2H88 C;  2YIU C;  1L0L D;  5H2F H;  3G3Z A;  1YQ4 C;  1JY3 O;  1SFC A;  1YJ9 P;  1PZQ A;  1NTZ K;  2E75 C;  2AXT H;  5APU A;  3TGU J;  2JEE A;  3EQ2 A;  5KAI E;  2H43 A;  1S9K E;  1Z56 A;  1G1I A;  2FYN B;  1L4A B;  3CCQ P;  2QIW A;  3FX0 A;  1JO5 A;  4H13 D;  1Q2N A;  2IYO A;  1PIX A;  1QEX A;  1DIP A;  1HVV A;  1FZC A;  3HUS B;  1N7S B;  3L70 E;  5KLV E;  3AE9 C;  5GTI E;  1AV1 A;  3L74 E;  2FYZ A;  2C9N Y;  1HGZ A;  5TIS H;  3OW2 O;  1RQU A;  1FS0 E;  3WUT A;  3U1C A;  1KYO I;  4I7Z C;  2Z5H A;  1GW3 A;  4RES B;  5B66 H;  1SQV D;  1FZG A;  5APW A;  1MV8 A;  2Q3E A;  3R4Y A;  3G6E P;  5APQ A;  3HRN A;  1LP1 A;  3NTN A;  2B89 A;  1GMJ A;  4I1L A;  1KIL C;  3CME P;  2IZ0 A;  3PP5 A;  2N1T C;  1VDF A;  4DOJ A;  2JO1 A;  3M91 A;  3H1K J;  1SQQ G;  3ABV C;  2WSF H;  3CWB G;  2C9L Y;  1ZV8 A;  1NTM E;  1SFC C;  2B87 A;  3Q5R A;  1N86 A;  1JNM A;  5AW8 B;  3W67 A;  1AQ5 A;  1NWQ A;  2Q6Q A;  1LTA C;  1EDK A;  2FYU J;  1G2C A;  5KKZ B;  2E42 A;  3HTK B;  1RE3 A;  1KFM A;  2OYI B;  4N3Y B;  3B71 A;  1RE4 A;  3KQG A;  1L0L G;  4D6T J;  1FZC C;  1M1J A;  3H1J E;  1BDD A;  4L73 A;  1IJD B;  1ZRT E;  4H44 B;  3TYY A;  2HOD B;  2LXB A;  3L75 D;  4W7Z A;  4H0L C;  1U7J A;  3JCU H;  4NPF X;  4CPG A;  1NVO A;  1SQP J;  5CMZ A;  5AVR B;  4W7Y A;  2AEJ A;  2PP6 A;  4C7R A;  2Y0E A;  1P84 I;  2M3B A;  1H0T B;  3CX5 I;  3KHU A;  2E74 B;  1FOS F;  3CPW O;  4GIF A;  2QRX A;  1VQ4 P;  1KB9 H;  2WSC J;  1ZOY C;  3PTZ A;  1SQV G;  3TGU E;  3Q1M A;  1PPJ E;  3CD6 P;  2K37 A;  2AXC A;  5KLI C;  2NPS B;  1L0N G;  2ZT9 B;  1S4X A;  3HE5 A;  3G71 P;  4WY4 A;  3Q3D A;  1RHZ B;  5AW5 B;  1FU1 A;  1RE3 C;  1SFC D;  1Q90 D;  1RE4 C;  1ZR2 A;  2E76 D;  1K73 Q;  1NKZ B;  1M1J C;  1VF5 C;  4AYC A;  1NOH A;  2BEQ D;  1YJN P;  1VQO P;  1R5L A;  2O01 J;  4C7N A;  4IL6 E;  1Q86 Q;  5CJ4 A;  4LLH A;  3B5N B;  4YPC A;  3OA7 A;  1P84 H;  2YMK A;  1S3J A;  1H88 A;  3WU2 H;  1NTZ E;  1T3U A;  2GUV A;  1IFI A;  3AEF C;  1PL5 A;  2ZXX A;  1J1E B;  4IFF A;  3AEG C;  3GF7 A;  2HR3 A;  2IDB A;  3L36 A;  1URQ D;  1GK6 A;  4IL6 X;  1S1C X;  1WT6 A;  1LGH B;  3O8Z A;  3CWB J;  3V2R A;  1R8E A;  4W80 A;  3RK3 C;  1FZE A;  3VMY A;  1BE3 J;  4L76 A;  2Y9Z A;  3AEB C;  2MKV A;  1T2K D;  4XFJ A;  5H2F E;  2WT7 A;  4GOE A;  2LR2 A;  3PHL A;  2Q1K A;  3A0B H;  4BRY A;  4WY4 C;  2AXT E;  1UII A;  4DZO A;  1LTI C;  2YNY A;  1L0L J;  1LT1 A;  3L71 E;  1CZQ A;  4O9B A;  1LWU B;  4LC1 A;  1JMM A;  4D6T E;  1OWA A;  3I55 P;  3D6Z A;  2FXO A;  3H1K D;  5B5E H;  3KYQ A;  5KTB A;  1W2E A;  1J1D C;  4OGQ B;  5TIS E;  4AUW A;  1LTJ C;  2IBZ D;  2FYU D;  2W6J H;  2WSE H;  5B66 E;  1FBM A;  4B86 A;  2A06 D;  1EZV D;  2GM4 A;  4ASV A;  5E79 H;  1SQV J;  3P32 A;  3CCM P;  2QM7 A;  2O3J A;  3M0D A;  1L0N J;  1PP9 G;  4R4M A;  1KOR A;  3CCR P;  2XNX A;  1K04 A;  1SQP D;  1M90 Q;  1FAV A;  1NJI Q;  1EDJ A;  3MGN A;  2QEX P;  2KK7 A;  1G1J A;  2LXC B;  3CI9 A;  1USD A;  1VQ5 P;  2BCC G;  1NTM K;  3A7O A;  3AEE C;  1JY2 N;  3A0H H;  1X8Y A;  5KAF H;  2OAR A;  2V7Q H;  3RL0 D;  4U3F E;  1M57 D;  4JF7 A;  1W5C E;  3C9I A;  1LTB C;  1IFP A;  2IPP A;  3GHG B;  1IFN A;  3H1I E;  3JCU E;  1GK4 A;  3FXD A;  2YMY A;  3U1A A;  5AW6 B;  1GL2 B;  2QJP C;  3OAK A;  1LNQ A;  1HH0 A;  2KLU A;  1A02 J; 
#chains in the Genus database with same CATH homology
 2JR8 A;  1KV4 A;  1X22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...