1X22A

Solution structure of a novel moricin analogue, an antibacterial peptide from a lepidopteran insect, spodoptera litura
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
42
structure length
42
Chain Sequence
b'GKIPVKAIKKAGAAIGKGLRAINIASTAHDVYSFFKPKHKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords moricin
molecule tags Antibiotic
publication title Isolation, gene expression and solution structure of a novel moricin analogue, antibacterial peptide from a lepidopteran insect, Spodoptera litura
pubmed doi rcsb
total genus 12
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2005-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06451 Moricin Moricin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.750 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Moricin domain 1x22A00
1X22A 2JR8A 1KV4A
chains in the Genus database with same CATH superfamily
1L0LD 2FFDC 3H1LJ 3C9IA 1JOCA 1IK9A 3AE1C 4Y28J 3H32B 4ZKUA 5AW3B 2UWJE 3OA7A 1A02J 2HPCA 4RESB 3H1KE 5CBNA 1JO5A 3CCRP 5KLVE 4TT3H 5GTIE 1X79B 2K9JB 1L4AA 4WY4B 5CBOA 1KQFB 1HWTC 1LT1A 1YQ3C 3C8VA 1FJPA 1YITP 2JEEA 1NTZE 2J58A 2O3JA 4IFFA 5DJUB 2ZT9B 2A45H 3I55P 1QVGO 1K73Q 3BVHA 1FDMA 2YXRB 4AUWA 1G2CB 2O1KA 3M06A 1T8ZA 4H13D 4OGQB 4K35A 2L5GB 3V2QA 1HUCA 2MKVA 2OTKE 4IL6E 2GUVA 5AVQB 1PFIA 2CPBA 4GIFA 1M1JC 1OW8A 2ZAEB 3FWLA 3PRJA 5BU5A 3TGUE 2G8YA 1KZUB 1IO4A 3CX5H 5KKZB 2HODB 2DW3A 3L36A 4WBAA 1VF5C 2WSSH 2YNYA 5AVSB 3RL0D 3HRNA 3L75G 1SFCA 1SQVK 5E79E 3LIEA 4D6TE 1HH0A 2E5TA 4HB1A 3CCEP 4I1LA 5KAIE 1NTZK 1Q7YQ 2Y0DA 1FDIA 4GKGA 2IYPA 3H1KJ 1XTCC 1J1EB 1KORA 4PD4E 1EZVI 2R3SA 1VL2A 4N78D 3VP9A 5KAFH 3CCSP 1AVYA 2LR2A 4Y99C 1L0LJ 4OGQD 3H1IG 3V4WA 5KLVK 5AW5B 1LT9B 1L0NJ 1VQ8P 2Z5HA 2N1TC 5CHXA 1PPJG 1H0TA 2I1KA 2P1JA 1KQLA 2YO3A 3VTPC 3G71P 1AA0A 3L4FA 1LTSC 2PGDA 4L75A 1NYHA 2IZ0A 5APTA 3GMAA 2M3BA 4L73A 1NU1J 3PLNA 2W6AA 3CX5D 1X9VA 1QX8A 3AEDC 2ZYGA 1LTAC 3GF7A 3CCVP 1MFTA 3HD7A 1FAVA 1Q81Q 4PJ0H 2KZJA 1NKZB 2Y0EA 2QJYB 5TJHA 4HKZH 3GW6A 2W6JH 4OH8B 1RE3C 4H13C 2K88A 2N1TB 1M1KQ 5H2FE 1ZR4A 1FOSE 3CCLP 4YXDC 1KC8Q 2AXTE 2PRRA 4I7ZC 1CI6B 3AE2C 1NOHA 2KUBA 2P7JA 1SQXJ 1GU4A 2IPPA 5KTBA 3VMAA 1YJWP 1OVUA 2IDBA 3IR9A 1DEEG 5B5EH 3OJAB 1J1EC 1WRGA 5CCHA 3TF5A 1S5LE 3VOPA 3KHUA 1U7JA 3H1KD 3WU2E 1HVVA 1PGOA 1U57A 1USDA 1N86A 2YIUB 3CLQA 2W8ZA 3H6PA 5TISH 1W5CE 3A2AA 3O6QA 1UIIA 3L70E 3CCMP 2HG5D 1FZCB 3L71D 1GMJA 3L74E 1Y47A 4KJMA 4LGDE 2QJPC 5EFWB 1WT6A 2NPSD 1K8AQ 3CC4P 2O01H 2JJLA 3KQGA 1E5WA 3I5CA 4JF7A 2WITA 5APXA 3MTUE 1S5LH 1BSNA 1LTJA 2E74C 1YQ4C 1T3JA 4U3FG 1PGJA 1PL5A 1BCCD 2A06E 4JYBA 5AW0B 5GTHE 2AXTH 3CCJP 2M0BA 2Q3EA 3A0HH 3D70A 3NXSA 3Q1MA 2YXQB 5K5GB 1IFPA 1QL1A 1LTBC 3V2NA 1QL2A 1LP1B 1SQBG 1GZLA 5APQA 1ZP0C 1NTZD 1YYCA 1Y9BA 1URQC 2OYHC 5AW9B 1LTIC 5DJTB 5AVVB 1PGQA 3G9RA 4Z1MH 1IZNB 5CCGD 1NH4A 1JY3P 2FKWB 1NTKK 1GTWA 2C9NY 1ZW0A 4IL6H 4ZKPA 2IBZG 2NPSC 1K04A 1RF1B 3AECC 2KSJA 2I8DA 1K9MQ 1L0NG 1OFCX 2IBZI 3PH0A 3TNUA 1YJNP 1NTKG 2IFMA 2QM8A 4RO0A 2FYUJ 1KFNA 2Q3IA 1LTGC 1JY2N 1GK4A 1M1JA 4NPDA 2XV5A 1FBMA 2E76D 2WSEJ 4PD4H 5KAFE 3EWKA 4WY4D 1LT9A 3A7OA 1FC2C 1FZAA 4UB8E 3BCCG 3VN0A 1OVRA 1N7SC 1JCCA 1EZVE 1KMIZ 1OMIA 4H44D 3KXDA 1AFOA 3AEFC 4I6MC 3CWBD 4IFMA 4IFDK 1GW3A 4K3AA 1VQLP 2YKOA 3H1LG 1J2JB 3BRTB 4OWFA 1SQPE 2E76C 1H8AA 5CCGC 1SQVE 5AVUB 1SP4A 2ITAA 3M9HA 5BU8B 5KAIH 3CD6P 1FZFA 3A3YB 1GW4A 2KS1A 1PGPA 2P10A 4LC1A 1RH5B 1JCDA 2K1AA 2K9JA 1NO4A 3H1HG 1GK6A 3H1JE 3H1JD 3L71G 3CX5E 4M3LA 2KB7P 4BRYB 1ZMEC 1IFIA 2B9BA 3PJSK 4D6TD 1VQPP 2YIUC 1JMBA 3IFMA 3N4XA 1GL2D 1SQQJ 1FS0E 4NPFX 3SWKA 3HE4A 2G3AA 1U7MA 2PP6A 2AEJA 3AE8C 2GM4A 1PP9G 1YTZI 3GHGB 4PD4D 1ZV8A 1ZXGA 5TISE 3HD7C 3L72J 1L4AD 1VQ7P 1E79H 1SQBD 2IX7C 3CMEP 2BCCJ 1NTZG 4DZOA 1KILA 2KLVA 1RE4A 3LW5J 3A0BH 2WSFJ 1FZGA 4UB6E 1S9KE 1KYOH 3E1IA 1S4XA 1BE3E 4PV1C 3FXEA 5CJ0A 1YHQP 1NAFA 1PPJE 5AW1B 2QE7H 2E5YA 1PIXA 2KS1B 2J5UA 2A45I 5KLVD 2Y9ZA 1J1DB 1KFMA 2P58A 3U59A 1CI6A 1LTJB 1HGVA 1RE4C 3WMM0 1Q82Q 2JDIH 1L0ND 1Z56A 3H25A 3Q5PA 1S1CX 5CCHC 3VP8A 3CXHE 1BSHA 3EFGA 2JWAA 1DIPA 2XNXA 2FY8A 2H88C 3RK3E 2OTJP 1JUNA 2FXOA 2V7QJ 1SQVD 1VQ5P 2JWDA 5AVYB 2AXCA 2FBWC 1M8OB 2Z5IA 2QSIA 3GHGA 3TGUJ 1BCCE 1CZQA 2NZ2A 3MGNA 3B4SA 5AVZB 2WT7A 3TGUD 1N2DC 2W90A 3O6QB 2SPZA 1KQGB 4KT0J 3NFQA 3O8ZA 1VQ6P 1QLED 1EZVG 1N7SD 1NTMG 2O01J 2P2UA 3M0AA 4H13B 2QVAA 1KYOD 1LTJC 2KI7B 2ZVNB 1BE3J 3C1LA 2JP3A 1VF5B 3KDPB 3RGUA 1SLQA 1SS1A 2LXBA 3WU2H 1JEKA 4EOTA 2YO2A 1YJ9P 3H1JG 1T2KC 2WSEH 3L70D 1R8EA 1SQBE 2BCCD 1L0NE 2E74B 2QG4A 2WQYC 4PV1B 3HD7D 2JO1A 1XTGB 1MFZA 1SQPG 2M5AB 1SQXG 4H0LC 1MV8A 3SSUA 1LWUC 3L73G 3Q5RA 1S9KD 2YMYA 2HPCB 4U3FE 1DX7A 2BASA 3B8EB 2E74D 1SQPJ 2V7QH 1HJBA 3PTZA 2W27A 3VYIA 2FFDB 2QJPB 2K9YA 1KN7A 1JY2O 3BCCJ 1VF5D 1SQXE 5CCGA 5APVA 1KYOE 2QJKB 2OGUA 2D2CD 3CXHD 1BGYE 2VRSA 3LIDA 4W7ZA 5APSA 4BRYA 3M0DA 1BCCJ 3GF3A 1NTKJ 2H8PD 1SQQE 4C7NB 2ZJSE 3WUUA 2GUSA 1SQQK 1EDLA 4H0LD 5GTIH 1OVVA 2HODA 1X0TA 3AEBC 3H1IJ 1NU1K 5AVWB 2KP8A 1NGMB 3B5NA 1S3JA 2E43A 1YIJP 2OYOA 1P84E 4XA4A 3VMZA 5CJ4A 1LTTC 2E75C 3B5ND 1L0LG 2HLOA 2I1JA 3HUSC 4YPCA 2K37A 2M3EA 1OIPA 2R3CA 4EDFA 1OWAA 1RF1C 1N73B 2KSEA 1KQSO 1RY3A 5H2FH 4EI2A 3B5NC 1JY3N 3V2RA 2WVRA 1L0LK 2E42A 1EZVD 3CI9A 1NTMD 4YXWH 3KPEA 3A5TA 1FZBA 5KLIB 3RK3D 1RF1A 1GD2E 1SVFA 1H89A 4DJGA 1LGHB 4WB4A 5L8RJ 1VQNP 2FXMA 2QRXA 1SQBK 2JR8A 4C7NA 1SQQD 4Y99B 1KD1Q 3D71A 3L70G 3PHLA 3TK1A 2BCCG 1W2BO 1T6AA 1OX3A 2E75D 2RKLA 2QIWA 3IAOA 1GL2A 3JCUE 3RBZA 3CWBJ 2WPSA 3P32A 1PP9J 1IFJA 1QGKB 3II6A 1SQXD 1P84D 4U7JA 1NKNA 2WZ7A 3B5NB 3P8CE 4EIJA 3S4RA 1KV4A 4JQ0D 4DOJA 1PV3A 3L75D 3BASA 1BE3G 1DEBA 1HGZA 3GG2A 5CMZA 3CC2P 1KILD 1X22A 1GL2C 1KILE 3F5HA 1JMMA 3RBXA 1AQ5A 1URQD 1NTMK 1OXZA 2WPQA 3Q3DA 1OZHA 1YBKA 3H1ID 1KYOI 4NPEA 5B66H 4EYYQ 5KLVJ 2OQQA 1URQA 3HUSB 1IK7A 3H1LE 3G6EP 3P8MC 3ABVC 3M91A 1USEA 5E79H 1JB0J 1M1JB 2NPSB 5APWA 1EDIA 3RK3B 3TDKA 1NWQA 1DD3A 1CW5A 1IJDB 3GHGC 3H32A 4L76A 4R4LA 2QEXP 1FZCC 1PPJD 1SFCD 1YTZT 1SQVJ 2C0WA 4GOEA 4RKUJ 2XKMA 3QH9A 3RL0g 1HBWA 1RF0C 5GTHH 1TU3F 4A7PA 1G1IA 1SQBJ 2QJKC 4I2LC 1GU5A 3CC7P 2M5AA 1LWUA 2Y0CA 3G3ZA 3ITKA 3CWBE 3L74J 4WVZA 1KILB 1P84H 3VMXA 2WTYA 3BRVB 3NTNA 3SFDC 1HF9A 2O01N 1ZR2A 2H43A 3BATA 4D6TJ 1FDOA 1IFNA 1J1DC 1RF0A 2KXPB 3N7NA 1LT9C 1LNQA 1JTHB 4DCKA 3CXHI 2H89C 2Q5UA 1N7SA 2P67A 1MZ9A 2N9BA 2E75B 3T97B 3JCUH 4GT1A 1VQMP 2W83C 1Q2NA 2OYIA 2KZIA 3P8CD 2WPRA 1EXIA 1SQQG 3L75E 3H1KG 1H0TB 5APYA 1NTKE 3Q5SA 3IF4A 3USSA 4PV1D 1D7MA 1HJ0A 1VQ4P 2W6BA 3K5BA 1QVFO 1S5LX 2BCCE 4TLFA 3VMYA 1FJKA 3AE6C 5AVRB 3HUSA 3L71J 4ZNCA 2IBZE 1DH3A 4HYTB 1NAYA 1MKMA 2QM7A 2R44A 1Q90D 2XU6A 3AE5C 4N3YB 4OGQC 1RQUA 1JTHA 2OARA 1LJ2A 1BE3D 3HD7B 3LW5H 2FYUE 1JY2P 4JPZB 4R4MA 2CPSA 4U3FD 1N73A 3V4QA 2M8RA 3WUVA 1FZEA 3RK2C 1SFCC 3CPWO 2YKPA 2AEFA 4XE5B 5AW2B 1EXJA 3B71A 1X8YA 2E76B 4DT0A 1SQPK 1BCCG 4H0LB 3Q2YA 3UIAA 1H88A 4IOIH 1FZCA 2B89A 3I56P 3H1JJ 3U1CA 3CCQP 2KK7A 2Q7CA 1KTMA 1M57D 1NHLA 2XNDH 2ZFCA 3P7KA 3M9BA 4KHXA 3HE5A 2WPVB 3R2PA 3U1AA 2FYUG 2WT7B 2B88A 1L4AB 4WY4A 2OTLP 2GA1A 2KLUA 2WSCJ 2HR3A 3FX0A 3M9QA 3RK3C 4N6JA 1ZOYC 5BVZA 2R5BA 2IBZD 3AE3C 3L70J 2R5DA 2FYNB 1JM0A 5KJ7A 1ZRTE 1EQ7A 2IYOA 2PFXA 2XZRA 4YTPC 3NMDA 4WY4C 1JNMA 1T2KD 2ZVOB 4XFJA 5KJ7D 1NTKD 3F89A 2WSCH 5KLIC 4BWNA 4AQRD 2J59M 1Q86Q 2BEQD 1RQVA 1L2PA 4OVNF 4UB8H 4B86A 3AEEC 2Y9YA 1NTME 5APUA 2RMZA 2AEMA 3AEGC 3BCCD 3EFFK 1UIXA 2V4HA 3H1LD 4GDOA 3KZIE 3PP5A 2HYNA 3L73E 1LP1A 1MUUA 3CWBG 4HJGH 1BDDA 1Y8AA 2Q1KA 2XDJA 4U3FJ 4C7RA 4RJTA 2FFDA 1W2EA 4I7ZB 2YMKA 1G1JA 3QWOC 3R4YA 3SFEC 2Q9IA 2KIKA 1AQTA 3H1HE 2KOGA 1YI2P 3H1HD 1LWUB 3L37A 1NU1D 2D2CC 1ZLLA 2Z4EA 1NVOA 3E1RA 1T3UA 5AVTB 3W68A 2OYHB 2C9LY 4D6TG 2PAJA 3TNUB 3MUDA 1BGYJ 1FU1A 1L4AC 1ZRTD 1BGYD 1N7SB 3RL0B 2OYIB 1R5LA 1VQOP 1VDFA 4CPGA 1KB9H 1KB9E 1EDKA 3MZWB 2FXPA 3L72D 3H1IE 1G2CA 4AYCA 3A0HE 4JYCA 1PP9D 1VQ9P 3FWNA 3JSVC 3M0DC 3AE7C 3GLMA 3L71E 2D2CB 1SFCB 1IFDA 1OW6A 3L74D 2FYUD 3CL3D 3L73J 4PJ0E 4W80A 1EC5A 1PZQA 1K05A 1NJIQ 5KLVG 1RHZB 2RH0A 4HH2A 3KYQA 2A06D 3V5BA 2OYHA 4JBZA 5AVXB 2OYIC 3W67A 3WUTA 1BDCA 2Q6QA 1VPCA 3AEAC 3T97A 3FXDA 1URQB 1N73C 3V2PA 2K3RA 3S1KA 3BCCE 3KZIH 3CX5I 3CMAP 2NPSA 3E7KA 1M90Q 1ZN5A 2B87A 2LXCB 4LLHA 5B5EE 3IN6A 1M56D 2JKVA 3JC22 5C39A 1SQVG 4PD4I 1KB9D 2NRGA 2O1JA 3HE4B 1N8RQ 3MHVA 2IFNA 1S72P 1CSBA 4GODA 1PP9E 2H7HA 4ASWA 2QJYC 3TGUG 1L0LE 3HTKA 4BXLA 4H44C 5AW4B 3D6YA 1WMKA 3OAKA 1DD4A 2HFED 2WWWA 3CXHH 1M7LA 2ZYDA 3FGAD 2ZXEB 3S9OA 3MIWA 4O9BA 1NU1G 3D6ZA 2N1TA 2IZ1A 5AW7B 1AJYA 3L72E 5KJ7C 1L0NK 5B66E 2N1TD 2KNCA 3SWYA 3G4SP 2LKMA 3RK2B 2RN0A 5CCHD 2N9YB 3SWFA 3AE9C 1P84I 3HE5B 3TYYA 1BGYG 2B87B 3MP7B 1NTMJ 2ZXXA 2ZYAA 3L73D 3EQ2A 3MD0A 1JY3O 3A0BE 4L74A 4UB6H 5AW6B 1N7LA 3V6IA 1KB9I 3ZDMA 1NTZJ 2MJZA 1SQPD 4ASVA 1EDJA 4H44B 2L91A 5M1BA 3RK2D 2R32A 3L35A 1AV1A 2POHA 1QEXA 3L72G 2KYVA 1IC2A 2ZT9C 3TSIA 1NU1E 2BEZF 1GDTA 2WMMA 1RE3A 1S2EA 1SQXK 2FYUK 3L74G 4ZMDA 3RL0C 2CK3H 3OW2O 2C0XA 1HTLC 3HTKB 2YKQA 1OW7A 2FYZA 5KKZC 2ZT9D 1R5SA 1A02F 1FE6A 2FYNC 1KILC 2A06G 2A45G 3L75J 4GOFA 4MN4C 1IFMA 2KNCB 3H1HJ 4WWIA 4IL6X 3CCUP 1FOSF 4QMAA 2QA4P 3MUDC 1AVOA 4N78E 4W7YA 4C46A 3AE4C 5AW8B 1VQKP 1GL2B 2WSFH
chains in the Genus database with same CATH topology
1X22A 2JR8A 1KV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X22 A;  2JR8 A;  1KV4 A; 
#chains in the Genus database with same CATH topology
 1L0L D;  2FFD C;  3H1L J;  3C9I A;  1JOC A;  1IK9 A;  3AE1 C;  4Y28 J;  3H32 B;  4ZKU A;  5AW3 B;  2UWJ E;  3OA7 A;  1A02 J;  2HPC A;  4RES B;  3H1K E;  5CBN A;  1JO5 A;  3CCR P;  5KLV E;  4TT3 H;  5GTI E;  1X79 B;  2K9J B;  1L4A A;  4WY4 B;  5CBO A;  1KQF B;  1HWT C;  1LT1 A;  1YQ3 C;  3C8V A;  1FJP A;  1YIT P;  2JEE A;  1NTZ E;  2J58 A;  2O3J A;  4IFF A;  5DJU B;  2ZT9 B;  2A45 H;  3I55 P;  1QVG O;  1K73 Q;  3BVH A;  1FDM A;  2YXR B;  4AUW A;  1G2C B;  2O1K A;  3M06 A;  1T8Z A;  4H13 D;  4OGQ B;  4K35 A;  2L5G B;  3V2Q A;  1HUC A;  2MKV A;  2OTK E;  4IL6 E;  2GUV A;  5AVQ B;  1PFI A;  2CPB A;  4GIF A;  1M1J C;  1OW8 A;  2ZAE B;  3FWL A;  3PRJ A;  5BU5 A;  3TGU E;  2G8Y A;  1KZU B;  1IO4 A;  3CX5 H;  5KKZ B;  2HOD B;  2DW3 A;  3L36 A;  4WBA A;  1VF5 C;  2WSS H;  2YNY A;  5AVS B;  3RL0 D;  3HRN A;  3L75 G;  1SFC A;  1SQV K;  5E79 E;  3LIE A;  4D6T E;  1HH0 A;  2E5T A;  4HB1 A;  3CCE P;  4I1L A;  5KAI E;  1NTZ K;  1Q7Y Q;  2Y0D A;  1FDI A;  4GKG A;  2IYP A;  3H1K J;  1XTC C;  1J1E B;  1KOR A;  4PD4 E;  1EZV I;  2R3S A;  1VL2 A;  4N78 D;  3VP9 A;  5KAF H;  3CCS P;  1AVY A;  2LR2 A;  4Y99 C;  1L0L J;  4OGQ D;  3H1I G;  3V4W A;  5KLV K;  5AW5 B;  1LT9 B;  1L0N J;  1VQ8 P;  2Z5H A;  2N1T C;  5CHX A;  1PPJ G;  1H0T A;  2I1K A;  2P1J A;  1KQL A;  2YO3 A;  3VTP C;  3G71 P;  1AA0 A;  3L4F A;  1LTS C;  2PGD A;  4L75 A;  1NYH A;  2IZ0 A;  5APT A;  3GMA A;  2M3B A;  4L73 A;  1NU1 J;  3PLN A;  2W6A A;  3CX5 D;  1X9V A;  1QX8 A;  3AED C;  2ZYG A;  1LTA C;  3GF7 A;  3CCV P;  1MFT A;  3HD7 A;  1FAV A;  1Q81 Q;  4PJ0 H;  2KZJ A;  1NKZ B;  2Y0E A;  2QJY B;  5TJH A;  4HKZ H;  3GW6 A;  2W6J H;  4OH8 B;  1RE3 C;  4H13 C;  2K88 A;  2N1T B;  1M1K Q;  5H2F E;  1ZR4 A;  1FOS E;  3CCL P;  4YXD C;  1KC8 Q;  2AXT E;  2PRR A;  4I7Z C;  1CI6 B;  3AE2 C;  1NOH A;  2KUB A;  2P7J A;  1SQX J;  1GU4 A;  2IPP A;  5KTB A;  3VMA A;  1YJW P;  1OVU A;  2IDB A;  3IR9 A;  1DEE G;  5B5E H;  3OJA B;  1J1E C;  1WRG A;  5CCH A;  3TF5 A;  1S5L E;  3VOP A;  3KHU A;  1U7J A;  3H1K D;  3WU2 E;  1HVV A;  1PGO A;  1U57 A;  1USD A;  1N86 A;  2YIU B;  3CLQ A;  2W8Z A;  3H6P A;  5TIS H;  1W5C E;  3A2A A;  3O6Q A;  1UII A;  3L70 E;  3CCM P;  2HG5 D;  1FZC B;  3L71 D;  1GMJ A;  3L74 E;  1Y47 A;  4KJM A;  4LGD E;  2QJP C;  5EFW B;  1WT6 A;  2NPS D;  1K8A Q;  3CC4 P;  2O01 H;  2JJL A;  3KQG A;  1E5W A;  3I5C A;  4JF7 A;  2WIT A;  5APX A;  3MTU E;  1S5L H;  1BSN A;  1LTJ A;  2E74 C;  1YQ4 C;  1T3J A;  4U3F G;  1PGJ A;  1PL5 A;  1BCC D;  2A06 E;  4JYB A;  5AW0 B;  5GTH E;  2AXT H;  3CCJ P;  2M0B A;  2Q3E A;  3A0H H;  3D70 A;  3NXS A;  3Q1M A;  2YXQ B;  5K5G B;  1IFP A;  1QL1 A;  1LTB C;  3V2N A;  1QL2 A;  1LP1 B;  1SQB G;  1GZL A;  5APQ A;  1ZP0 C;  1NTZ D;  1YYC A;  1Y9B A;  1URQ C;  2OYH C;  5AW9 B;  1LTI C;  5DJT B;  5AVV B;  1PGQ A;  3G9R A;  4Z1M H;  1IZN B;  5CCG D;  1NH4 A;  1JY3 P;  2FKW B;  1NTK K;  1GTW A;  2C9N Y;  1ZW0 A;  4IL6 H;  4ZKP A;  2IBZ G;  2NPS C;  1K04 A;  1RF1 B;  3AEC C;  2KSJ A;  2I8D A;  1K9M Q;  1L0N G;  1OFC X;  2IBZ I;  3PH0 A;  3TNU A;  1YJN P;  1NTK G;  2IFM A;  2QM8 A;  4RO0 A;  2FYU J;  1KFN A;  2Q3I A;  1LTG C;  1JY2 N;  1GK4 A;  1M1J A;  4NPD A;  2XV5 A;  1FBM A;  2E76 D;  2WSE J;  4PD4 H;  5KAF E;  3EWK A;  4WY4 D;  1LT9 A;  3A7O A;  1FC2 C;  1FZA A;  4UB8 E;  3BCC G;  3VN0 A;  1OVR A;  1N7S C;  1JCC A;  1EZV E;  1KMI Z;  1OMI A;  4H44 D;  3KXD A;  1AFO A;  3AEF C;  4I6M C;  3CWB D;  4IFM A;  4IFD K;  1GW3 A;  4K3A A;  1VQL P;  2YKO A;  3H1L G;  1J2J B;  3BRT B;  4OWF A;  1SQP E;  2E76 C;  1H8A A;  5CCG C;  1SQV E;  5AVU B;  1SP4 A;  2ITA A;  3M9H A;  5BU8 B;  5KAI H;  3CD6 P;  1FZF A;  3A3Y B;  1GW4 A;  2KS1 A;  1PGP A;  2P10 A;  4LC1 A;  1RH5 B;  1JCD A;  2K1A A;  2K9J A;  1NO4 A;  3H1H G;  1GK6 A;  3H1J E;  3H1J D;  3L71 G;  3CX5 E;  4M3L A;  2KB7 P;  4BRY B;  1ZME C;  1IFI A;  2B9B A;  3PJS K;  4D6T D;  1VQP P;  2YIU C;  1JMB A;  3IFM A;  3N4X A;  1GL2 D;  1SQQ J;  1FS0 E;  4NPF X;  3SWK A;  3HE4 A;  2G3A A;  1U7M A;  2PP6 A;  2AEJ A;  3AE8 C;  2GM4 A;  1PP9 G;  1YTZ I;  3GHG B;  4PD4 D;  1ZV8 A;  1ZXG A;  5TIS E;  3HD7 C;  3L72 J;  1L4A D;  1VQ7 P;  1E79 H;  1SQB D;  2IX7 C;  3CME P;  2BCC J;  1NTZ G;  4DZO A;  1KIL A;  2KLV A;  1RE4 A;  3LW5 J;  3A0B H;  2WSF J;  1FZG A;  4UB6 E;  1S9K E;  1KYO H;  3E1I A;  1S4X A;  1BE3 E;  4PV1 C;  3FXE A;  5CJ0 A;  1YHQ P;  1NAF A;  1PPJ E;  5AW1 B;  2QE7 H;  2E5Y A;  1PIX A;  2KS1 B;  2J5U A;  2A45 I;  5KLV D;  2Y9Z A;  1J1D B;  1KFM A;  2P58 A;  3U59 A;  1CI6 A;  1LTJ B;  1HGV A;  1RE4 C;  3WMM 0;  1Q82 Q;  2JDI H;  1L0N D;  1Z56 A;  3H25 A;  3Q5P A;  1S1C X;  5CCH C;  3VP8 A;  3CXH E;  1BSH A;  3EFG A;  2JWA A;  1DIP A;  2XNX A;  2FY8 A;  2H88 C;  3RK3 E;  2OTJ P;  1JUN A;  2FXO A;  2V7Q J;  1SQV D;  1VQ5 P;  2JWD A;  5AVY B;  2AXC A;  2FBW C;  1M8O B;  2Z5I A;  2QSI A;  3GHG A;  3TGU J;  1BCC E;  1CZQ A;  2NZ2 A;  3MGN A;  3B4S A;  5AVZ B;  2WT7 A;  3TGU D;  1N2D C;  2W90 A;  3O6Q B;  2SPZ A;  1KQG B;  4KT0 J;  3NFQ A;  3O8Z A;  1VQ6 P;  1QLE D;  1EZV G;  1N7S D;  1NTM G;  2O01 J;  2P2U A;  3M0A A;  4H13 B;  2QVA A;  1KYO D;  1LTJ C;  2KI7 B;  2ZVN B;  1BE3 J;  3C1L A;  2JP3 A;  1VF5 B;  3KDP B;  3RGU A;  1SLQ A;  1SS1 A;  2LXB A;  3WU2 H;  1JEK A;  4EOT A;  2YO2 A;  1YJ9 P;  3H1J G;  1T2K C;  2WSE H;  3L70 D;  1R8E A;  1SQB E;  2BCC D;  1L0N E;  2E74 B;  2QG4 A;  2WQY C;  4PV1 B;  3HD7 D;  2JO1 A;  1XTG B;  1MFZ A;  1SQP G;  2M5A B;  1SQX G;  4H0L C;  1MV8 A;  3SSU A;  1LWU C;  3L73 G;  3Q5R A;  1S9K D;  2YMY A;  2HPC B;  4U3F E;  1DX7 A;  2BAS A;  3B8E B;  2E74 D;  1SQP J;  2V7Q H;  1HJB A;  3PTZ A;  2W27 A;  3VYI A;  2FFD B;  2QJP B;  2K9Y A;  1KN7 A;  1JY2 O;  3BCC J;  1VF5 D;  1SQX E;  5CCG A;  5APV A;  1KYO E;  2QJK B;  2OGU A;  2D2C D;  3CXH D;  1BGY E;  2VRS A;  3LID A;  4W7Z A;  5APS A;  4BRY A;  3M0D A;  1BCC J;  3GF3 A;  1NTK J;  2H8P D;  1SQQ E;  4C7N B;  2ZJS E;  3WUU A;  2GUS A;  1SQQ K;  1EDL A;  4H0L D;  5GTI H;  1OVV A;  2HOD A;  1X0T A;  3AEB C;  3H1I J;  1NU1 K;  5AVW B;  2KP8 A;  1NGM B;  3B5N A;  1S3J A;  2E43 A;  1YIJ P;  2OYO A;  1P84 E;  4XA4 A;  3VMZ A;  5CJ4 A;  1LTT C;  2E75 C;  3B5N D;  1L0L G;  2HLO A;  2I1J A;  3HUS C;  4YPC A;  2K37 A;  2M3E A;  1OIP A;  2R3C A;  4EDF A;  1OWA A;  1RF1 C;  1N73 B;  2KSE A;  1KQS O;  1RY3 A;  5H2F H;  4EI2 A;  3B5N C;  1JY3 N;  3V2R A;  2WVR A;  1L0L K;  2E42 A;  1EZV D;  3CI9 A;  1NTM D;  4YXW H;  3KPE A;  3A5T A;  1FZB A;  5KLI B;  3RK3 D;  1RF1 A;  1GD2 E;  1SVF A;  1H89 A;  4DJG A;  1LGH B;  4WB4 A;  5L8R J;  1VQN P;  2FXM A;  2QRX A;  1SQB K;  2JR8 A;  4C7N A;  1SQQ D;  4Y99 B;  1KD1 Q;  3D71 A;  3L70 G;  3PHL A;  3TK1 A;  2BCC G;  1W2B O;  1T6A A;  1OX3 A;  2E75 D;  2RKL A;  2QIW A;  3IAO A;  1GL2 A;  3JCU E;  3RBZ A;  3CWB J;  2WPS A;  3P32 A;  1PP9 J;  1IFJ A;  1QGK B;  3II6 A;  1SQX D;  1P84 D;  4U7J A;  1NKN A;  2WZ7 A;  3B5N B;  3P8C E;  4EIJ A;  3S4R A;  1KV4 A;  4JQ0 D;  4DOJ A;  1PV3 A;  3L75 D;  3BAS A;  1BE3 G;  1DEB A;  1HGZ A;  3GG2 A;  5CMZ A;  3CC2 P;  1KIL D;  1X22 A;  1GL2 C;  1KIL E;  3F5H A;  1JMM A;  3RBX A;  1AQ5 A;  1URQ D;  1NTM K;  1OXZ A;  2WPQ A;  3Q3D A;  1OZH A;  1YBK A;  3H1I D;  1KYO I;  4NPE A;  5B66 H;  4EYY Q;  5KLV J;  2OQQ A;  1URQ A;  3HUS B;  1IK7 A;  3H1L E;  3G6E P;  3P8M C;  3ABV C;  3M91 A;  1USE A;  5E79 H;  1JB0 J;  1M1J B;  2NPS B;  5APW A;  1EDI A;  3RK3 B;  3TDK A;  1NWQ A;  1DD3 A;  1CW5 A;  1IJD B;  3GHG C;  3H32 A;  4L76 A;  4R4L A;  2QEX P;  1FZC C;  1PPJ D;  1SFC D;  1YTZ T;  1SQV J;  2C0W A;  4GOE A;  4RKU J;  2XKM A;  3QH9 A;  3RL0 g;  1HBW A;  1RF0 C;  5GTH H;  1TU3 F;  4A7P A;  1G1I A;  1SQB J;  2QJK C;  4I2L C;  1GU5 A;  3CC7 P;  2M5A A;  1LWU A;  2Y0C A;  3G3Z A;  3ITK A;  3CWB E;  3L74 J;  4WVZ A;  1KIL B;  1P84 H;  3VMX A;  2WTY A;  3BRV B;  3NTN A;  3SFD C;  1HF9 A;  2O01 N;  1ZR2 A;  2H43 A;  3BAT A;  4D6T J;  1FDO A;  1IFN A;  1J1D C;  1RF0 A;  2KXP B;  3N7N A;  1LT9 C;  1LNQ A;  1JTH B;  4DCK A;  3CXH I;  2H89 C;  2Q5U A;  1N7S A;  2P67 A;  1MZ9 A;  2N9B A;  2E75 B;  3T97 B;  3JCU H;  4GT1 A;  1VQM P;  2W83 C;  1Q2N A;  2OYI A;  2KZI A;  3P8C D;  2WPR A;  1EXI A;  1SQQ G;  3L75 E;  3H1K G;  1H0T B;  5APY A;  1NTK E;  3Q5S A;  3IF4 A;  3USS A;  4PV1 D;  1D7M A;  1HJ0 A;  1VQ4 P;  2W6B A;  3K5B A;  1QVF O;  1S5L X;  2BCC E;  4TLF A;  3VMY A;  1FJK A;  3AE6 C;  5AVR B;  3HUS A;  3L71 J;  4ZNC A;  2IBZ E;  1DH3 A;  4HYT B;  1NAY A;  1MKM A;  2QM7 A;  2R44 A;  1Q90 D;  2XU6 A;  3AE5 C;  4N3Y B;  4OGQ C;  1RQU A;  1JTH A;  2OAR A;  1LJ2 A;  1BE3 D;  3HD7 B;  3LW5 H;  2FYU E;  1JY2 P;  4JPZ B;  4R4M A;  2CPS A;  4U3F D;  1N73 A;  3V4Q A;  2M8R A;  3WUV A;  1FZE A;  3RK2 C;  1SFC C;  3CPW O;  2YKP A;  2AEF A;  4XE5 B;  5AW2 B;  1EXJ A;  3B71 A;  1X8Y A;  2E76 B;  4DT0 A;  1SQP K;  1BCC G;  4H0L B;  3Q2Y A;  3UIA A;  1H88 A;  4IOI H;  1FZC A;  2B89 A;  3I56 P;  3H1J J;  3U1C A;  3CCQ P;  2KK7 A;  2Q7C A;  1KTM A;  1M57 D;  1NHL A;  2XND H;  2ZFC A;  3P7K A;  3M9B A;  4KHX A;  3HE5 A;  2WPV B;  3R2P A;  3U1A A;  2FYU G;  2WT7 B;  2B88 A;  1L4A B;  4WY4 A;  2OTL P;  2GA1 A;  2KLU A;  2WSC J;  2HR3 A;  3FX0 A;  3M9Q A;  3RK3 C;  4N6J A;  1ZOY C;  5BVZ A;  2R5B A;  2IBZ D;  3AE3 C;  3L70 J;  2R5D A;  2FYN B;  1JM0 A;  5KJ7 A;  1ZRT E;  1EQ7 A;  2IYO A;  2PFX A;  2XZR A;  4YTP C;  3NMD A;  4WY4 C;  1JNM A;  1T2K D;  2ZVO B;  4XFJ A;  5KJ7 D;  1NTK D;  3F89 A;  2WSC H;  5KLI C;  4BWN A;  4AQR D;  2J59 M;  1Q86 Q;  2BEQ D;  1RQV A;  1L2P A;  4OVN F;  4UB8 H;  4B86 A;  3AEE C;  2Y9Y A;  1NTM E;  5APU A;  2RMZ A;  2AEM A;  3AEG C;  3BCC D;  3EFF K;  1UIX A;  2V4H A;  3H1L D;  4GDO A;  3KZI E;  3PP5 A;  2HYN A;  3L73 E;  1LP1 A;  1MUU A;  3CWB G;  4HJG H;  1BDD A;  1Y8A A;  2Q1K A;  2XDJ A;  4U3F J;  4C7R A;  4RJT A;  2FFD A;  1W2E A;  4I7Z B;  2YMK A;  1G1J A;  3QWO C;  3R4Y A;  3SFE C;  2Q9I A;  2KIK A;  1AQT A;  3H1H E;  2KOG A;  1YI2 P;  3H1H D;  1LWU B;  3L37 A;  1NU1 D;  2D2C C;  1ZLL A;  2Z4E A;  1NVO A;  3E1R A;  1T3U A;  5AVT B;  3W68 A;  2OYH B;  2C9L Y;  4D6T G;  2PAJ A;  3TNU B;  3MUD A;  1BGY J;  1FU1 A;  1L4A C;  1ZRT D;  1BGY D;  1N7S B;  3RL0 B;  2OYI B;  1R5L A;  1VQO P;  1VDF A;  4CPG A;  1KB9 H;  1KB9 E;  1EDK A;  3MZW B;  2FXP A;  3L72 D;  3H1I E;  1G2C A;  4AYC A;  3A0H E;  4JYC A;  1PP9 D;  1VQ9 P;  3FWN A;  3JSV C;  3M0D C;  3AE7 C;  3GLM A;  3L71 E;  2D2C B;  1SFC B;  1IFD A;  1OW6 A;  3L74 D;  2FYU D;  3CL3 D;  3L73 J;  4PJ0 E;  4W80 A;  1EC5 A;  1PZQ A;  1K05 A;  1NJI Q;  5KLV G;  1RHZ B;  2RH0 A;  4HH2 A;  3KYQ A;  2A06 D;  3V5B A;  2OYH A;  4JBZ A;  5AVX B;  2OYI C;  3W67 A;  3WUT A;  1BDC A;  2Q6Q A;  1VPC A;  3AEA C;  3T97 A;  3FXD A;  1URQ B;  1N73 C;  3V2P A;  2K3R A;  3S1K A;  3BCC E;  3KZI H;  3CX5 I;  3CMA P;  2NPS A;  3E7K A;  1M90 Q;  1ZN5 A;  2B87 A;  2LXC B;  4LLH A;  5B5E E;  3IN6 A;  1M56 D;  2JKV A;  3JC2 2;  5C39 A;  1SQV G;  4PD4 I;  1KB9 D;  2NRG A;  2O1J A;  3HE4 B;  1N8R Q;  3MHV A;  2IFN A;  1S72 P;  1CSB A;  4GOD A;  1PP9 E;  2H7H A;  4ASW A;  2QJY C;  3TGU G;  1L0L E;  3HTK A;  4BXL A;  4H44 C;  5AW4 B;  3D6Y A;  1WMK A;  3OAK A;  1DD4 A;  2HFE D;  2WWW A;  3CXH H;  1M7L A;  2ZYD A;  3FGA D;  2ZXE B;  3S9O A;  3MIW A;  4O9B A;  1NU1 G;  3D6Z A;  2N1T A;  2IZ1 A;  5AW7 B;  1AJY A;  3L72 E;  5KJ7 C;  1L0N K;  5B66 E;  2N1T D;  2KNC A;  3SWY A;  3G4S P;  2LKM A;  3RK2 B;  2RN0 A;  5CCH D;  2N9Y B;  3SWF A;  3AE9 C;  1P84 I;  3HE5 B;  3TYY A;  1BGY G;  2B87 B;  3MP7 B;  1NTM J;  2ZXX A;  2ZYA A;  3L73 D;  3EQ2 A;  3MD0 A;  1JY3 O;  3A0B E;  4L74 A;  4UB6 H;  5AW6 B;  1N7L A;  3V6I A;  1KB9 I;  3ZDM A;  1NTZ J;  2MJZ A;  1SQP D;  4ASV A;  1EDJ A;  4H44 B;  2L91 A;  5M1B A;  3RK2 D;  2R32 A;  3L35 A;  1AV1 A;  2POH A;  1QEX A;  3L72 G;  2KYV A;  1IC2 A;  2ZT9 C;  3TSI A;  1NU1 E;  2BEZ F;  1GDT A;  2WMM A;  1RE3 A;  1S2E A;  1SQX K;  2FYU K;  3L74 G;  4ZMD A;  3RL0 C;  2CK3 H;  3OW2 O;  2C0X A;  1HTL C;  3HTK B;  2YKQ A;  1OW7 A;  2FYZ A;  5KKZ C;  2ZT9 D;  1R5S A;  1A02 F;  1FE6 A;  2FYN C;  1KIL C;  2A06 G;  2A45 G;  3L75 J;  4GOF A;  4MN4 C;  1IFM A;  2KNC B;  3H1H J;  4WWI A;  4IL6 X;  3CCU P;  1FOS F;  4QMA A;  2QA4 P;  3MUD C;  1AVO A;  4N78 E;  4W7Y A;  4C46 A;  3AE4 C;  5AW8 B;  1VQK P;  1GL2 B;  2WSF H; 
#chains in the Genus database with same CATH homology
 1X22 A;  2JR8 A;  1KV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...