1SQXK

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
53
structure length
53
Chain Sequence
MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 14
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqxK00
2J59M 2FYUK 1NTKK 2WSFH 2WSCH 3CLQA 1SQXK 1SQVK 1L0NK 2WSEH 3LW5H 2O01H 3M9QA 1NTMK 1NU1K 1SQBK 4IFDK 1SQPK 3G3ZA 1SQQK 1L0LK 2LKMA 1NTZK 5KLVK 2OARA
chains in the Genus database with same CATH superfamily
1LGHB 5TJHA 2IBZE 1SQPJ 4H44D 4A7PA 1VQ5P 1FZGA 1Z56A 2W6AA 2Y0CA 1JNMA 1KQSO 5H2FE 3H1JE 1JY2P 2Q3IA 3OA7A 3JCUE 3CCEP 1IC2A 1H88A 1FBMA 1PIXA 3OJAB 5AVUB 4NPEA 5GTHH 4GT1A 1XTCC 2N1TD 1JOCA 1RE3A 2I1KA 3R4YA 3RL0g 1LT9C 4YXDC 3WUVA 3A2AA 4HJGH 1QVFO 2RN0A 3O6QB 4U3FE 1NJIQ 1HWTC 3CC4P 5KLIB 2C0XA 1KQLA 1PP9D 3B71A 1IFPA 3L35A 1AQ5A 3L75D 2QM8A 1NTZG 3B4SA 2WPRA 2Y0EA 5KTBA 1BGYJ 2OTKE 3L75G 5AW3B 1K8AQ 1YJ9P 1KYOD 3LW5J 4N6JA 1EDIA 1N86A 2J58A 2QSIA 3JSVC 3L70G 4Y28J 4HB1A 2Q7CA 3NXSA 2OQQA 2LXBA 3A5TA 3CCMP 2WITA 1X8YA 3A0HE 3GHGA 3HUSC 3L70D 4H13C 5APXA 3M9HA 1GU4A 1LP1A 2RMZA 3PTZA 2ZT9D 3TSIA 2AXTE 1R5SA 1LTJB 1LWUB 4WY4B 4CPGA 4AUWA 1VDFA 1J1DB 4TLFA 2JEEA 4BRYA 1GDTA 2OGUA 1GW3A 1NU1G 2FXMA 2E75B 1RH5B 1MFZA 2V4HA 3H1KD 2H88C 3L37A 3C1LA 1YITP 3I56P 1IJDB 1S9KD 1MZ9A 1PGJA 3GW6A 4H44C 5AVVB 3G9RA 1GL2D 3VOPA 3TK1A 5KLVJ 1BSHA 3CC7P 1OFCX 3U59A 2M3EA 1JTHB 1ZXGA 1RE4A 3CWBD 1DX7A 3A0HH 1S5LX 2E76B 1L0LK 1KILB 4WB4A 2A45I 1RF0A 1VQKP 1A02J 1IZNB 1L0LJ 1MKMA 1NH4A 1N7SB 3G4SP 1SQBJ 2W6BA 1PGPA 3TYYA 2Y9YA 3S4RA 2H7HA 1GK4A 1M57D 2IZ0A 2JJLA 4K3AA 1M1JB 3V2PA 2IFNA 1N73B 3L70J 3RBXA 1L0NK 2E5YA 1DIPA 3H1LJ 2QJKC 3V5BA 2M5AB 4WVZA 3V4QA 1GL2B 3KDPB 2C0WA 1BDDA 2QJYC 1NHLA 1YIJP 1HJBA 1EC5A 2V7QH 1OW6A 2E75D 2E76C 1EDJA 4XA4A 2CPSA 1KYOH 4IOIH 4PV1D 5BVZA 4O9BA 3GLMA 1SP4A 1M1JA 5B66H 3M06A 1BGYD 2VRSA 1T2KC 2IFMA 2NPSD 1N7SC 4WY4D 2G8YA 2K9YA 1XTGB 3KQGA 3MHVA 2WSEJ 5AVSB 3P8MC 2KNCB 3MGNA 4N78E 4D6TJ 1KB9D 3O8ZA 2CK3H 2BEQD 1UIXA 3EWKA 2BCCD 3H32B 3N4XA 4C46A 1URQB 2OYOA 3GF3A 3AE1C 3HD7C 3L73J 3RBZA 2HPCA 2B87B 2Z5IA 1NAYA 1ZW0A 3B5NB 3NFQA 1NU1J 1SQQE 2Z5HA 2R3CA 5AW4B 3BRTB 1GU5A 2QG4A 4RJTA 5AVTB 3H1KJ 1U57A 3M91A 1N2DC 1MV8A 2KNCA 2P1JA 3U1AA 2AXCA 5GTIE 3HE4B 1ZMEC 1FJKA 1FC2C 4L74A 2N9BA 3FGAD 4HKZH 3BCCE 5CJ4A 3TF5A 1Q81Q 1RY3A 5GTHE 1N7SA 2Q5UA 1S3JA 3II6A 2IDBA 3L36A 1L0NE 3KZIH 3IF4A 1SQPK 3CXHH 3ITKA 4H0LC 4IL6X 1GMJA 1NU1E 1SQQJ 4U7JA 5AW8B 3S9OA 2QA4P 3OW2O 1YHQP 1URQD 2DW3A 3RL0C 1J1EB 3B5NC 1URQC 2WSFJ 1JY2N 1UIIA 1NTZK 3MZWB 1PL5A 3RL0D 1IFDA 1QX8A 2HR3A 3AE3C 3AEBC 3CCQP 1PFIA 4H0LD 4D6TD 1NTKK 2WSFH 3CX5I 2Y0DA 2AXTH 3L72G 2WT7A 4JPZB 1YQ4C 3VP9A 1N73A 2FXOA 2QRXA 5CCHA 1SQVE 1YJNP 1LTSC 3TGUE 2G3AA 4Z1MH 2A06G 2Q1KA 2ZYGA 1IFJA 3LW5H 4W7YA 2XNDH 2WQYC 5AW7B 1PP9G 1SLQA 3CXHD 4EOTA 2A06D 5CCGC 3OAKA 1OZHA 1NU1K 3JC22 4KHXA 4M3LA 4DZOA 1VQ7P 5C39A 2Q3EA 3AE8C 5APYA 2YIUB 2W27A 3L72E 1YI2P 3H32A 3PLNA 1KB9E 1RF1B 2E42A 3L74E 3IN6A 1SQVG 1N73C 5CCHD 1JY2O 3TGUG 3Q5SA 1W5CE 2LR2A 1EQ7A 3KHUA 4RO0A 3TGUD 1S5LE 4U3FJ 2JWDA 3GG2A 3KPEA 3N7NA 2NZ2A 3H1JD 2N9YB 2I8DA 3PHLA 1S2EA 1SFCA 3GHGB 2KS1B 5AVZB 1ZLLA 1EZVI 1AQTA 4QMAA 2E75C 1YYCA 5BU8B 3AEEC 1M8OB 1VQMP 1M90Q 1HVVA 2A45H 3L74D 5AVRB 1GD2E 3RGUA 1NGMB 2W6JH 4H44B 1L0ND 1OW7A 1NTMK 1VL2A 3CWBG 4GOEA 4I1LA 1EZVD 1JCCA 2NRGA 1EZVE 5TISH 1EXJA 5H2FH 2W90A 1LT9A 3CL3D 5CBOA 3V2NA 3HRNA 5KKZB 2Q6QA 1KC8Q 1K04A 1GTWA 5AW6B 2IBZI 3H1HD 4ZMDA 2J59M 2ZYAA 3G71P 1L0LD 4N3YB 5KLIC 2RH0A 3TGUJ 1L0LE 2M0BA 2QJPC 1OW8A 2JR8A 2M3BA 1JY3O 1SQBD 1NO4A 2QM7A 4IL6H 1T3UA 5K5GB 3Q2YA 1BE3J 1DEEG 1FU1A 1SQXE 2WSEH 3L73G 1IO4A 3KXDA 2KSJA 5AW1B 3BATA 3VMZA 1CI6B 3CMEP 1KTMA 2O01H 1YJWP 1K73Q 3HD7D 3RL0B 2R5DA 3M0DA 2KZJA 1SFCD 1NKZB 3UIAA 3L70E 4NPFX 1Y9BA 3SWFA 1DH3A 2WSCJ 2Q9IA 1E5WA 2WVRA 3WUTA 1HTLC 2A06E 1X79B 2PRRA 5DJUB 5KAFE 1FZCC 2JKVA 4H13B 4B86A 4PJ0E 4HH2A 1SFCB 4ZNCA 1G1JA 1WT6A 3P8CE 1SQPG 1OXZA 2KI7B 1SQQD 3H1JJ 4IL6E 1S4XA 3TNUA 2YO3A 2OYIC 1HF9A 3HTKB 2FKWB 5KAIH 4L75A 2E74B 2E76D 2HLOA 1ZV8A 4D6TE 2KS1A 2KUBA 3V2QA 1PPJD 3FWLA 1H0TA 4I7ZB 1NTKG 2FFDA 3PH0A 1N7LA 1R5LA 2HPCB 3SWKA 1NTKD 3A3YB 2JO1A 3A7OA 1JCDA 1T3JA 5AW9B 2L5GB 1KQFB 1SQXD 1CSBA 2D2CC 1SQBE 5E79E 4KT0J 5CJ0A 3T97B 4DOJA 1A02F 1PP9J 1S1CX 1KB9I 4PD4H 1Y8AA 1G2CB 2E43A 3AEDC 1KB9H 2PP6A 1U7JA 2R32A 3F89A 1KV4A 3CMAP 3H1KE 3SFDC 1T6AA 1HGZA 1LTGC 3H1HE 5KLVD 3H1IG 1KORA 2K37A 5CHXA 1NTKE 2FYUE 1QL1A 5KLVG 2GUSA 3IFMA 2FFDC 1VQ4P 3CWBE 5APUA 2A45G 5AVQB 1Q86Q 2P67A 2YKPA 1GL2C 2OARA 1J1EC 3P32A 1CI6A 1ZOYC 1BE3E 1NTMJ 1S5LH 4C7NA 4ASVA 2FYNB 1BE3D 2YNYA 3USSA 2OYHC 1G1IA 1OVUA 1J1DC 1LTAC 2O1KA 1AA0A 1OVRA 2CPBA 2P58A 3MTUE 2YKQA 1BCCD 5B5EE 1LNQA 2ZT9B 3HUSB 1FZEA 2H89C 2KK7A 3H1LD 4L73A 2FYUG 3H6PA 2GUVA 3C9IA 2R3SA 1W2BO 2ZAEB 2N1TB 1JUNA 1U7MA 3A0BH 1GK6A 4C7NB 1SQVJ 5KJ7A 3TNUB 2IBZG 4AYCA 4PJ0H 3CWBJ 2WPQA 3S1KA 1ZR2A 4NPDA 5KAFH 3O6QA 1JMMA 3H1JG 1FZBA 4EI2A 3SWYA 1K05A 2WPSA 1RQUA 2O1JA 3RK2B 5TISE 1RF1A 2ZXXA 2W83C 1VQLP 4LLHA 2OTJP 2J5UA 5KAIE 1N7SD 1QEXA 3SSUA 1FS0E 1T2KD 4ASWA 3BASA 1NYHA 4U3FD 1KILD 3D71A 2BCCJ 4PV1C 1L4AA 4U3FG 2ZYDA 4JQ0D 2XU6A 1LT1A 3P8CD 3CCLP 1SQPE 4H0LB 5AW5B 2B9BA 1Q7YQ 4XE5B 4WY4A 4BXLA 5BU5A 2MKVA 3AE7C 3GF7A 1JY3N 2KP8A 3RK3C 2GM4A 3M9BA 1W2EA 1KFMA 2HODB 3EFGA 3T97A 3VYIA 1FZCA 1JO5A 4EYYQ 1DEBA 3HE5A 2I1JA 2Y9ZA 4AQRD 1WRGA 2XZRA 2FYUJ 3B5ND 5APQA 1KILA 2BASA 2O01J 1BSNA 2YXRB 3NTNA 1JTHA 4I7ZC 2C9LY 1SQBG 2LKMA 1EDKA 1ZRTD 5KJ7D 3Q5RA 2B88A 2K1AA 3L73D 1USDA 1VQOP 2UWJE 1X22A 3LIDA 1BGYG 1WMKA 2FYUK 1S9KE 2NPSA 3H1KG 3CC2P 4W80A 1M56D 1OX3A 1S72P 3BCCD 4RESB 3M0AA 3L74J 1J2JB 2KIKA 1Q2NA 2YO2A 4PD4D 4PV1B 3MUDC 2MJZA 3RK3D 3L72J 2WTYA 3VMYA 1QL2A 3A0BE 4XFJA 3L74G 1R8EA 4I2LC 1RF0C 3G6EP 4PD4I 1VPCA 1IK9A 1JMBA 2KXPB 2KZIA 3E7KA 1SQXJ 4OWFA 1ZN5A 1RE4C 2NPSB 1SQQG 5B66E 5CCGA 5CMZA 4OVNF 3P7KA 1KYOE 1IFIA 3IR9A 1P84D 2KSEA 2Z4EA 2E74C 2SPZA 2KB7P 1NKNA 2HYNA 1L2PA 3L71D 3VP8A 4YXWH 5APSA 4Y99B 5CCHC 4OH8B 2OYIB 1VF5B 1CW5A 1NVOA 1ZP0C 1SFCC 1DD4A 2B87A 3B5NA 3E1RA 3EFFK 3VMXA 1P84H 4TT3H 1L4AB 3Q3DA 1HUCA 1LJ2A 3K5BA 4DJGA 1URQA 1D7MA 1ZRTE 2WZ7A 2ZVNB 1TU3F 5APVA 1Y47A 2XKMA 3QWOC 3NMDA 1PZQA 1X9VA 2IPPA 3BRVB 1LTIC 3L72D 4GIFA 2W8ZA 5AVYB 3RK2C 3HTKA 1OMIA 3HE5B 3KYQA 1SQBK 3VN0A 3WUUA 3HE4A 4ZKUA 3BVHA 1EDLA 2PAJA 3V4WA 2O3JA 3CCJP 1SS1A 1H8AA 1BDCA 2B89A 1KZUB 4BWNA 2OTLP 1VF5C 1OVVA 2KLVA 1G2CA 1HH0A 3CXHE 1QGKB 1NTZD 3AEFC 3KZIE 4LGDE 4Y99C 2FBWC 2IYPA 3FXDA 2KYVA 3HD7A 5APWA 2ZXEB 3FX0A 5AVWB 3CCRP 3AE4C 1SQPD 1YBKA 1IFMA 1L4AC 5KLVK 2HG5D 1OIPA 2YIUC 5AW0B 1H89A 1PGQA 2AEMA 3GMAA 3TDKA 1FZFA 3H1HJ 3MUDA 2K3RA 3CD6P 1USEA 4JYBA 4ZKPA 3CCVP 2JWAA 3AE9C 1NTMD 4OGQD 2R44A 5AW2B 4UB8H 4DCKA 1VQPP 1FDIA 1HJ0A 2OYHB 4UB6H 1AJYA 2D2CD 3MD0A 1NU1D 1NWQA 1KD1Q 3Q1MA 2ZT9C 3M9QA 1LTBC 2M8RA 4WWIA 1M1JC 1KILC 1BGYE 2XV5A 3CCSP 3VMAA 1JEKA 3R2PA 1HGVA 3MP7B 1IFNA 2C9NY 3Q5PA 3L75J 1KYOI 4KJMA 2PFXA 4D6TG 4YTPC 3W67A 2KOGA 3H1ID 3H1LE 2WWWA 4DT0A 3AEAC 3PJSK 2QEXP 1H0TB 2E74D 2N1TA 1PP9E 1AVOA 1GW4A 2BEZF 2QJYB 2YKOA 4LC1A 4WY4C 2L91A 3WMM0 1LTJC 1LWUC 3JCUH 2R5BA 1BCCJ 4YPCA 2D2CB 1SQXK 3AE2C 4HYTB 4MN4C 3WU2E 3ZDMA 4N78D 1Q90D 2P7JA 2ZFCA 2WPVB 4RKUJ 1BCCG 1FOSE 3H1HG 2QJPB 1Q82Q 1PV3A 2RKLA 3H1IE 3RK3E 3VTPC 4OGQC 3F5HA 3H1LG 4PD4E 3I55P 1KQGB 1SQVD 2P10A 3QH9A 5CBNA 1NTKJ 5KLVE 2WT7B 3D6ZA 1NTME 1OWAA 1X0TA 3HD7B 2K9JB 2GA1A 3AECC 3IAOA 2ITAA 5AVXB 1RF1C 1FDMA 1KN7A 1FZCB 2IBZD 1NTZJ 1FAVA 3L73E 3RK3B 5M1BA 1QLED 2FYZA 3PRJA 3SFEC 1T8ZA 2WSSH 1SQQK 2FYNC 3EQ2A 4JF7A 4L76A 1SVFA 4JYCA 5KJ7C 1LT9B 1VF5D 1BCCE 1VQNP 3GHGC 3HUSA 3H1IJ 3BCCG 1HBWA 3MIWA 1JB0J 1PPJE 2E5TA 2HODA 1DD3A 2BCCG 4IFMA 3U1CA 4JBZA 2K9JA 1JM0A 3BCCJ 1MFTA 3RK2D 2WSCH 1L0NG 5GTIH 3CLQA 1MUUA 2M5AA 3W68A 3B8EB 1EZVG 3CX5E 1GL2A 4GKGA 3FWNA 3L4FA 4UB8E 1AFOA 2YXQB 2PGDA 2JP3A 2AEJA 4W7ZA 2OYHA 2IYOA 2FY8A 1NTZE 1P84E 2HFED 2QJKB 1FE6A 3L75E 5KKZC 4R4LA 3D6YA 1VQ6P 4C7RA 3I5CA 4K35A 1PPJG 1QVGO 1KILE 3V6IA 2BCCE 2ZJSE 3L71G 1GZLA 1JY3P 2IZ1A 1L0LG 1NOHA 1RE3C 2P2UA 3FXEA 4H13D 4I6MC 1PGOA 3AE6C 3G3ZA 2H43A 3D70A 2K88A 1RQVA 1E79H 1SQXG 2NPSC 2QIWA 4EDFA 1M1KQ 2POHA 5EFWB 2FXPA 1M7LA 2ZVOB 1FDOA 2V7QJ 1NAFA 3CCUP 3C8VA 3LIEA 2FFDB 3CXHI 2XNXA 3CX5H 3PP5A 1LTTC 4EIJA 4GODA 5B5EH 1SQVK 2QE7H 3WU2H 1K9MQ 1VQ8P 3L71E 5L8RJ 1KFNA 3AE5C 1AVYA 1LTJA 1LWUA 4BRYB 5CCGD 3V2RA 5E79H 1L0NJ 1RHZB 1IK7A 1N8RQ 2N1TC 2O01N 2IX7C 2XDJA 2YMKA 1FOSF 3CX5D 1VQ9P 1BE3G 1LP1B 2JDIH 2KLUA 3CPWO 2OYIA 3AEGC 2QVAA 4IFFA 4UB6E 4IFDK 2YMYA 5APTA 2H8PD 4GDOA 2LXCB 4OGQB 1EXIA 3M0DC 2WMMA 1P84I 3ABVC 4GOFA 1FZAA 1CZQA 3L71J 2FYUD 4R4MA 1ZR4A 1L4AD 4WBAA 3E1IA 1YTZI 2AEFA 5DJTB 1YTZT 3H25A 1AV1A 1NTMG 3CI9A 1YQ3C 1FJPA 1KMIZ
chains in the Genus database with same CATH topology
1LGHB 1FZGA 1Z56A 2W6AA 1JNMA 1JY2P 2Q3IA 3OA7A 1IC2A 1H88A 1FBMA 3OJAB 5AVUB 4GT1A 1XTCC 2N1TD 1JOCA 1RE3A 2I1KA 1LT9C 3A2AA 1HWTC 2C0XA 1KQLA 3L35A 1AQ5A 2QM8A 2WPRA 5KTBA 5AW3B 4N6JA 1N86A 2J58A 2Q7CA 3NXSA 3A5TA 2WITA 1X8YA 3GHGA 3HUSC 1GU4A 5APXA 3M9HA 3TSIA 1LTJB 1LWUB 4WY4B 4AUWA 1VDFA 1J1DB 2JEEA 1GDTA 1GW3A 2FXMA 1MFZA 3L37A 1IJDB 1S9KD 1MZ9A 5AVVB 3VOPA 1GL2D 3TK1A 3U59A 1JTHB 1RE4A 1L0LK 1KILB 4WB4A 2A45I 1RF0A 1A02J 1NH4A 1N7SB 2H7HA 2W6BA 3TYYA 1GK4A 2JJLA 1M1JB 3V2PA 2IFNA 1N73B 1L0NK 3V5BA 3V4QA 1GL2B 3KDPB 2C0WA 1NHLA 1HJBA 4XA4A 2CPSA 5BVZA 4O9BA 1SP4A 1M1JA 3M06A 1T2KC 2VRSA 2IFMA 2NPSD 1N7SC 4WY4D 1XTGB 3KQGA 5AVSB 3P8MC 3MGNA 4N78E 3O8ZA 4C46A 3N4XA 3H32B 1URQB 3HD7C 2HPCA 2Z5IA 3B5NB 3NFQA 2Z5HA 5AW4B 2R3CA 1GU5A 3BRTB 5AVTB 3M91A 1N2DC 1MV8A 2P1JA 3U1AA 3HE4B 1FJKA 2N9BA 5CJ4A 1RY3A 1N7SA 2Q5UA 3II6A 3L36A 1SQPK 5AW8B 3BVHA 1URQD 3RL0C 1J1EB 3B5NC 1URQC 3RL0D 1JY2N 1NTZK 1IFDA 1PFIA 1NTKK 2WSFH 2WT7A 1N73A 3VP9A 5CCHA 1LTSC 3LW5H 4W7YA 1IFJA 5AW7B 4EOTA 1SLQA 5CCGC 3OAKA 4KHXA 1NU1K 4M3LA 4DZOA 5APYA 2W27A 3H32A 1RF1B 2E42A 1N73C 5CCHD 1JY2O 1EQ7A 3N7NA 3KPEA 1SFCA 3GHGB 5AVZB 1ZLLA 1YYCA 5BU8B 1HVVA 2A45H 5AVRB 1GD2E 1NTMK 4I1LA 1JCCA 1LT9A 3CL3D 3V2NA 3HRNA 1GTWA 5AW6B 2J59M 4N3YB 2M3BA 1JY3O 1FZFA 1NO4A 2QM7A 1T3UA 1FU1A 2WSEH 1IO4A 2KSJA 5AW1B 3BATA 3VMZA 1CI6B 2O01H 3HD7D 3RL0B 2R5DA 3M0DA 1SFCD 1NKZB 3UIAA 3SWFA 1DH3A 2Q9IA 1E5WA 1FZCC 1HTLC 1X79B 4B86A 4HH2A 1SFCB 1G1JA 1WT6A 3P8CE 2OYIC 1OXZA 3TNUA 2YO3A 3HTKB 2FKWB 2HLOA 1ZV8A 3V2QA 2FFDA 1N7LA 2HPCB 3A3YB 3A7OA 1JCDA 1T3JA 5AW9B 2L5GB 1CSBA 1A02F 5CJ0A 4DOJA 1G2CB 2E43A 2PP6A 2R32A 1HGZA 1LTGC 5CHXA 1QL1A 2GUSA 3IFMA 2FFDC 5APUA 5AVQB 2A45G 2YKPA 2P67A 2OARA 1GL2C 1J1EC 3P32A 1CI6A 4C7NA 2OYHC 2YNYA 1G1IA 3MTUE 1J1DC 1LTAC 2O1KA 2CPBA 2YKQA 1FZEA 3H6PA 2GUVA 3C9IA 1JUNA 2N1TB 1GK6A 4C7NB 5KJ7A 3TNUB 4AYCA 2WPQA 1ZR2A 1JMMA 1FZBA 3SWYA 2WPSA 3RK2B 2O1JA 1RF1A 4LLHA 1N7SD 1T2KD 3BASA 1KILD 1L4AA 2XU6A 3P8CD 5AW5B 4XE5B 4WY4A 5BU5A 1JY3N 2KP8A 3RK3C 2GM4A 3M9BA 1W2EA 1KFMA 2HODB 3EFGA 3T97A 3VYIA 1FZCA 1JO5A 1DEBA 3HE5A 2I1JA 4AQRD 1WRGA 2XZRA 3B5ND 5APQA 1KILA 2BASA 3NTNA 2C9LY 1JTHA 2LKMA 5KJ7D 3LIDA 2FYUK 1S9KE 2NPSA 4W80A 4RESB 3M0AA 1J2JB 2YO2A 2MJZA 3RK3D 2WTYA 3VMYA 1QL2A 4I2LC 1RF0C 1VPCA 1IK9A 1ZN5A 1RE4C 2NPSB 5CCGA 5CMZA 3P7KA 1IFIA 3IR9A 2Z4EA 2KB7P 1NKNA 2HYNA 3VP8A 5CCHC 5APSA 4Y99B 4OH8B 2OYIB 1CW5A 1SFCC 3B5NA 3VMXA 1L4AB 1HUCA 1URQA 2WZ7A 5APVA 2XKMA 3NMDA 1X9VA 2IPPA 3BRVB 1LTIC 4GIFA 3RK2C 5AVYB 3HTKA 3HE5B 3KYQA 3VN0A 1SQBK 4ZKUA 3HE4A 2PAJA 3V4WA 1H8AA 1KZUB 2KLVA 4LGDE 1G2CA 1HH0A 4Y99C 5APWA 5AVWB 2KYVA 3HD7A 2ZXEB 1IFMA 1L4AC 5KLVK 2HG5D 5AW0B 1H89A 3MUDA 4JYBA 4ZKPA 5AW2B 2OYHB 3MD0A 1NWQA 3M9QA 1LTBC 2M8RA 1M1JC 1KILC 2XV5A 3R2PA 1HGVA 1IFNA 2C9NY 2KOGA 2WWWA 2N1TA 1GW4A 4WY4C 2YKOA 4LC1A 3WMM0 1LTJC 1LWUC 2R5BA 1SQXK 4HYTB 4N78D 2P7JA 1FOSE 2ZFCA 3VTPC 1DX7A 1OWAA 3HD7B 5AVXB 1RF1C 1FDMA 1FZCB 3RK3B 1FAVA 2FYZA 1T8ZA 3EQ2A 1SQQK 4JF7A 5KJ7C 1SVFA 4JYCA 1LT9B 1HBWA 3GHGC 3HUSA 3MIWA 2HODA 4IFMA 3U1CA 3RK2D 2WSCH 3CLQA 1MUUA 3B8EB 1GL2A 4GKGA 1AFOA 3L4FA 4W7ZA 2OYHA 2HFED 4C7RA 3I5CA 1GZLA 1JY3P 4I6MC 1NOHA 1RE3C 2P2UA 3G3ZA 2H43A 2NPSC 2POHA 1M7LA 1NAFA 3LIEA 2FFDB 4EIJA 2XNXA 3PP5A 1LTTC 1SQVK 1KFNA 1LTJA 1LWUA 5CCGD 3V2RA 2N1TC 2IX7C 2XDJA 1FOSF 2OYIA 4IFFA 4IFDK 2YMYA 5APTA 2H8PD 3M0DC 1FZAA 1CZQA 1ZR4A 1L4AD 4WBAA 3E1IA 1YTZI 1YTZT 3CI9A 3HUSB 1FJPA 2WT7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J59 M;  2FYU K;  1NTK K;  2WSF H;  2WSC H;  3CLQ A;  1SQX K;  1SQV K;  1L0N K;  2WSE H;  3LW5 H;  2O01 H;  3M9Q A;  1NTM K;  1NU1 K;  1SQB K;  4IFD K;  1SQP K;  3G3Z A;  1SQQ K;  1L0L K;  2LKM A;  1NTZ K;  5KLV K;  2OAR A; 
#chains in the Genus database with same CATH topology
 1LGH B;  5TJH A;  2IBZ E;  1SQP J;  4H44 D;  4A7P A;  1VQ5 P;  1FZG A;  1Z56 A;  2W6A A;  2Y0C A;  1JNM A;  1KQS O;  5H2F E;  3H1J E;  1JY2 P;  2Q3I A;  3OA7 A;  3JCU E;  3CCE P;  1IC2 A;  1H88 A;  1FBM A;  1PIX A;  3OJA B;  5AVU B;  4NPE A;  5GTH H;  4GT1 A;  1XTC C;  2N1T D;  1JOC A;  1RE3 A;  2I1K A;  3R4Y A;  3RL0 g;  1LT9 C;  4YXD C;  3WUV A;  3A2A A;  4HJG H;  1QVF O;  2RN0 A;  3O6Q B;  4U3F E;  1NJI Q;  1HWT C;  3CC4 P;  5KLI B;  2C0X A;  1KQL A;  1PP9 D;  3B71 A;  1IFP A;  3L35 A;  1AQ5 A;  3L75 D;  2QM8 A;  1NTZ G;  3B4S A;  2WPR A;  2Y0E A;  5KTB A;  1BGY J;  2OTK E;  3L75 G;  5AW3 B;  1K8A Q;  1YJ9 P;  1KYO D;  3LW5 J;  4N6J A;  1EDI A;  1N86 A;  2J58 A;  2QSI A;  3JSV C;  3L70 G;  4Y28 J;  4HB1 A;  2Q7C A;  3NXS A;  2OQQ A;  2LXB A;  3A5T A;  3CCM P;  2WIT A;  1X8Y A;  3A0H E;  3GHG A;  3HUS C;  3L70 D;  4H13 C;  5APX A;  3M9H A;  1GU4 A;  1LP1 A;  2RMZ A;  3PTZ A;  2ZT9 D;  3TSI A;  2AXT E;  1R5S A;  1LTJ B;  1LWU B;  4WY4 B;  4CPG A;  4AUW A;  1VDF A;  1J1D B;  4TLF A;  2JEE A;  4BRY A;  1GDT A;  2OGU A;  1GW3 A;  1NU1 G;  2FXM A;  2E75 B;  1RH5 B;  1MFZ A;  2V4H A;  3H1K D;  2H88 C;  3L37 A;  3C1L A;  1YIT P;  3I56 P;  1IJD B;  1S9K D;  1MZ9 A;  1PGJ A;  3GW6 A;  4H44 C;  5AVV B;  3G9R A;  1GL2 D;  3VOP A;  3TK1 A;  5KLV J;  1BSH A;  3CC7 P;  1OFC X;  3U59 A;  2M3E A;  1JTH B;  1ZXG A;  1RE4 A;  3CWB D;  1DX7 A;  3A0H H;  1S5L X;  2E76 B;  1L0L K;  1KIL B;  4WB4 A;  2A45 I;  1RF0 A;  1VQK P;  1A02 J;  1IZN B;  1L0L J;  1MKM A;  1NH4 A;  1N7S B;  3G4S P;  1SQB J;  2W6B A;  1PGP A;  3TYY A;  2Y9Y A;  3S4R A;  2H7H A;  1GK4 A;  1M57 D;  2IZ0 A;  2JJL A;  4K3A A;  1M1J B;  3V2P A;  2IFN A;  1N73 B;  3L70 J;  3RBX A;  1L0N K;  2E5Y A;  1DIP A;  3H1L J;  2QJK C;  3V5B A;  2M5A B;  4WVZ A;  3V4Q A;  1GL2 B;  3KDP B;  2C0W A;  1BDD A;  2QJY C;  1NHL A;  1YIJ P;  1HJB A;  1EC5 A;  2V7Q H;  1OW6 A;  2E75 D;  2E76 C;  1EDJ A;  4XA4 A;  2CPS A;  1KYO H;  4IOI H;  4PV1 D;  5BVZ A;  4O9B A;  3GLM A;  1SP4 A;  1M1J A;  5B66 H;  3M06 A;  1BGY D;  2VRS A;  1T2K C;  2IFM A;  2NPS D;  1N7S C;  4WY4 D;  2G8Y A;  2K9Y A;  1XTG B;  3KQG A;  3MHV A;  2WSE J;  5AVS B;  3P8M C;  2KNC B;  3MGN A;  4N78 E;  4D6T J;  1KB9 D;  3O8Z A;  2CK3 H;  2BEQ D;  1UIX A;  3EWK A;  2BCC D;  3H32 B;  3N4X A;  4C46 A;  1URQ B;  2OYO A;  3GF3 A;  3AE1 C;  3HD7 C;  3L73 J;  3RBZ A;  2HPC A;  2B87 B;  2Z5I A;  1NAY A;  1ZW0 A;  3B5N B;  3NFQ A;  1NU1 J;  1SQQ E;  2Z5H A;  2R3C A;  5AW4 B;  3BRT B;  1GU5 A;  2QG4 A;  4RJT A;  5AVT B;  3H1K J;  1U57 A;  3M91 A;  1N2D C;  1MV8 A;  2KNC A;  2P1J A;  3U1A A;  2AXC A;  5GTI E;  3HE4 B;  1ZME C;  1FJK A;  1FC2 C;  4L74 A;  2N9B A;  3FGA D;  4HKZ H;  3BCC E;  5CJ4 A;  3TF5 A;  1Q81 Q;  1RY3 A;  5GTH E;  1N7S A;  2Q5U A;  1S3J A;  3II6 A;  2IDB A;  3L36 A;  1L0N E;  3KZI H;  3IF4 A;  1SQP K;  3CXH H;  3ITK A;  4H0L C;  4IL6 X;  1GMJ A;  1NU1 E;  1SQQ J;  4U7J A;  5AW8 B;  3S9O A;  2QA4 P;  3OW2 O;  1YHQ P;  1URQ D;  2DW3 A;  3RL0 C;  1J1E B;  3B5N C;  1URQ C;  2WSF J;  1JY2 N;  1UII A;  1NTZ K;  3MZW B;  1PL5 A;  3RL0 D;  1IFD A;  1QX8 A;  2HR3 A;  3AE3 C;  3AEB C;  3CCQ P;  1PFI A;  4H0L D;  4D6T D;  1NTK K;  2WSF H;  3CX5 I;  2Y0D A;  2AXT H;  3L72 G;  2WT7 A;  4JPZ B;  1YQ4 C;  3VP9 A;  1N73 A;  2FXO A;  2QRX A;  5CCH A;  1SQV E;  1YJN P;  1LTS C;  3TGU E;  2G3A A;  4Z1M H;  2A06 G;  2Q1K A;  2ZYG A;  1IFJ A;  3LW5 H;  4W7Y A;  2XND H;  2WQY C;  5AW7 B;  1PP9 G;  1SLQ A;  3CXH D;  4EOT A;  2A06 D;  5CCG C;  3OAK A;  1OZH A;  1NU1 K;  3JC2 2;  4KHX A;  4M3L A;  4DZO A;  1VQ7 P;  5C39 A;  2Q3E A;  3AE8 C;  5APY A;  2YIU B;  2W27 A;  3L72 E;  1YI2 P;  3H32 A;  3PLN A;  1KB9 E;  1RF1 B;  2E42 A;  3L74 E;  3IN6 A;  1SQV G;  1N73 C;  5CCH D;  1JY2 O;  3TGU G;  3Q5S A;  1W5C E;  2LR2 A;  1EQ7 A;  3KHU A;  4RO0 A;  3TGU D;  1S5L E;  4U3F J;  2JWD A;  3GG2 A;  3KPE A;  3N7N A;  2NZ2 A;  3H1J D;  2N9Y B;  2I8D A;  3PHL A;  1S2E A;  1SFC A;  3GHG B;  2KS1 B;  5AVZ B;  1ZLL A;  1EZV I;  1AQT A;  4QMA A;  2E75 C;  1YYC A;  5BU8 B;  3AEE C;  1M8O B;  1VQM P;  1M90 Q;  1HVV A;  2A45 H;  3L74 D;  5AVR B;  1GD2 E;  3RGU A;  1NGM B;  2W6J H;  4H44 B;  1L0N D;  1OW7 A;  1NTM K;  1VL2 A;  3CWB G;  4GOE A;  4I1L A;  1EZV D;  1JCC A;  2NRG A;  1EZV E;  5TIS H;  1EXJ A;  5H2F H;  2W90 A;  1LT9 A;  3CL3 D;  5CBO A;  3V2N A;  3HRN A;  5KKZ B;  2Q6Q A;  1KC8 Q;  1K04 A;  1GTW A;  5AW6 B;  2IBZ I;  3H1H D;  4ZMD A;  2J59 M;  2ZYA A;  3G71 P;  1L0L D;  4N3Y B;  5KLI C;  2RH0 A;  3TGU J;  1L0L E;  2M0B A;  2QJP C;  1OW8 A;  2JR8 A;  2M3B A;  1JY3 O;  1SQB D;  1NO4 A;  2QM7 A;  4IL6 H;  1T3U A;  5K5G B;  3Q2Y A;  1BE3 J;  1DEE G;  1FU1 A;  1SQX E;  2WSE H;  3L73 G;  1IO4 A;  3KXD A;  2KSJ A;  5AW1 B;  3BAT A;  3VMZ A;  1CI6 B;  3CME P;  1KTM A;  2O01 H;  1YJW P;  1K73 Q;  3HD7 D;  3RL0 B;  2R5D A;  3M0D A;  2KZJ A;  1SFC D;  1NKZ B;  3UIA A;  3L70 E;  4NPF X;  1Y9B A;  3SWF A;  1DH3 A;  2WSC J;  2Q9I A;  1E5W A;  2WVR A;  3WUT A;  1HTL C;  2A06 E;  1X79 B;  2PRR A;  5DJU B;  5KAF E;  1FZC C;  2JKV A;  4H13 B;  4B86 A;  4PJ0 E;  4HH2 A;  1SFC B;  4ZNC A;  1G1J A;  1WT6 A;  3P8C E;  1SQP G;  1OXZ A;  2KI7 B;  1SQQ D;  3H1J J;  4IL6 E;  1S4X A;  3TNU A;  2YO3 A;  2OYI C;  1HF9 A;  3HTK B;  2FKW B;  5KAI H;  4L75 A;  2E74 B;  2E76 D;  2HLO A;  1ZV8 A;  4D6T E;  2KS1 A;  2KUB A;  3V2Q A;  1PPJ D;  3FWL A;  1H0T A;  4I7Z B;  1NTK G;  2FFD A;  3PH0 A;  1N7L A;  1R5L A;  2HPC B;  3SWK A;  1NTK D;  3A3Y B;  2JO1 A;  3A7O A;  1JCD A;  1T3J A;  5AW9 B;  2L5G B;  1KQF B;  1SQX D;  1CSB A;  2D2C C;  1SQB E;  5E79 E;  4KT0 J;  5CJ0 A;  3T97 B;  4DOJ A;  1A02 F;  1PP9 J;  1S1C X;  1KB9 I;  4PD4 H;  1Y8A A;  1G2C B;  2E43 A;  3AED C;  1KB9 H;  2PP6 A;  1U7J A;  2R32 A;  3F89 A;  1KV4 A;  3CMA P;  3H1K E;  3SFD C;  1T6A A;  1HGZ A;  1LTG C;  3H1H E;  5KLV D;  3H1I G;  1KOR A;  2K37 A;  5CHX A;  1NTK E;  2FYU E;  1QL1 A;  5KLV G;  2GUS A;  3IFM A;  2FFD C;  1VQ4 P;  3CWB E;  5APU A;  2A45 G;  5AVQ B;  1Q86 Q;  2P67 A;  2YKP A;  1GL2 C;  2OAR A;  1J1E C;  3P32 A;  1CI6 A;  1ZOY C;  1BE3 E;  1NTM J;  1S5L H;  4C7N A;  4ASV A;  2FYN B;  1BE3 D;  2YNY A;  3USS A;  2OYH C;  1G1I A;  1OVU A;  1J1D C;  1LTA C;  2O1K A;  1AA0 A;  1OVR A;  2CPB A;  2P58 A;  3MTU E;  2YKQ A;  1BCC D;  5B5E E;  1LNQ A;  2ZT9 B;  3HUS B;  1FZE A;  2H89 C;  2KK7 A;  3H1L D;  4L73 A;  2FYU G;  3H6P A;  2GUV A;  3C9I A;  2R3S A;  1W2B O;  2ZAE B;  2N1T B;  1JUN A;  1U7M A;  3A0B H;  1GK6 A;  4C7N B;  1SQV J;  5KJ7 A;  3TNU B;  2IBZ G;  4AYC A;  4PJ0 H;  3CWB J;  2WPQ A;  3S1K A;  1ZR2 A;  4NPD A;  5KAF H;  3O6Q A;  1JMM A;  3H1J G;  1FZB A;  4EI2 A;  3SWY A;  1K05 A;  2WPS A;  1RQU A;  2O1J A;  3RK2 B;  5TIS E;  1RF1 A;  2ZXX A;  2W83 C;  1VQL P;  4LLH A;  2OTJ P;  2J5U A;  5KAI E;  1N7S D;  1QEX A;  3SSU A;  1FS0 E;  1T2K D;  4ASW A;  3BAS A;  1NYH A;  4U3F D;  1KIL D;  3D71 A;  2BCC J;  4PV1 C;  1L4A A;  4U3F G;  2ZYD A;  4JQ0 D;  2XU6 A;  1LT1 A;  3P8C D;  3CCL P;  1SQP E;  4H0L B;  5AW5 B;  2B9B A;  1Q7Y Q;  4XE5 B;  4WY4 A;  4BXL A;  5BU5 A;  2MKV A;  3AE7 C;  3GF7 A;  1JY3 N;  2KP8 A;  3RK3 C;  2GM4 A;  3M9B A;  1W2E A;  1KFM A;  2HOD B;  3EFG A;  3T97 A;  3VYI A;  1FZC A;  1JO5 A;  4EYY Q;  1DEB A;  3HE5 A;  2I1J A;  2Y9Z A;  4AQR D;  1WRG A;  2XZR A;  2FYU J;  3B5N D;  5APQ A;  1KIL A;  2BAS A;  2O01 J;  1BSN A;  2YXR B;  3NTN A;  1JTH A;  4I7Z C;  2C9L Y;  1SQB G;  2LKM A;  1EDK A;  1ZRT D;  5KJ7 D;  3Q5R A;  2B88 A;  2K1A A;  3L73 D;  1USD A;  1VQO P;  2UWJ E;  1X22 A;  3LID A;  1BGY G;  1WMK A;  2FYU K;  1S9K E;  2NPS A;  3H1K G;  3CC2 P;  4W80 A;  1M56 D;  1OX3 A;  1S72 P;  3BCC D;  4RES B;  3M0A A;  3L74 J;  1J2J B;  2KIK A;  1Q2N A;  2YO2 A;  4PD4 D;  4PV1 B;  3MUD C;  2MJZ A;  3RK3 D;  3L72 J;  2WTY A;  3VMY A;  1QL2 A;  3A0B E;  4XFJ A;  3L74 G;  1R8E A;  4I2L C;  1RF0 C;  3G6E P;  4PD4 I;  1VPC A;  1IK9 A;  1JMB A;  2KXP B;  2KZI A;  3E7K A;  1SQX J;  4OWF A;  1ZN5 A;  1RE4 C;  2NPS B;  1SQQ G;  5B66 E;  5CCG A;  5CMZ A;  4OVN F;  3P7K A;  1KYO E;  1IFI A;  3IR9 A;  1P84 D;  2KSE A;  2Z4E A;  2E74 C;  2SPZ A;  2KB7 P;  1NKN A;  2HYN A;  1L2P A;  3L71 D;  3VP8 A;  4YXW H;  5APS A;  4Y99 B;  5CCH C;  4OH8 B;  2OYI B;  1VF5 B;  1CW5 A;  1NVO A;  1ZP0 C;  1SFC C;  1DD4 A;  2B87 A;  3B5N A;  3E1R A;  3EFF K;  3VMX A;  1P84 H;  4TT3 H;  1L4A B;  3Q3D A;  1HUC A;  1LJ2 A;  3K5B A;  4DJG A;  1URQ A;  1D7M A;  1ZRT E;  2WZ7 A;  2ZVN B;  1TU3 F;  5APV A;  1Y47 A;  2XKM A;  3QWO C;  3NMD A;  1PZQ A;  1X9V A;  2IPP A;  3BRV B;  1LTI C;  3L72 D;  4GIF A;  2W8Z A;  5AVY B;  3RK2 C;  3HTK A;  1OMI A;  3HE5 B;  3KYQ A;  1SQB K;  3VN0 A;  3WUU A;  3HE4 A;  4ZKU A;  3BVH A;  1EDL A;  2PAJ A;  3V4W A;  2O3J A;  3CCJ P;  1SS1 A;  1H8A A;  1BDC A;  2B89 A;  1KZU B;  4BWN A;  2OTL P;  1VF5 C;  1OVV A;  2KLV A;  1G2C A;  1HH0 A;  3CXH E;  1QGK B;  1NTZ D;  3AEF C;  3KZI E;  4LGD E;  4Y99 C;  2FBW C;  2IYP A;  3FXD A;  2KYV A;  3HD7 A;  5APW A;  2ZXE B;  3FX0 A;  5AVW B;  3CCR P;  3AE4 C;  1SQP D;  1YBK A;  1IFM A;  1L4A C;  5KLV K;  2HG5 D;  1OIP A;  2YIU C;  5AW0 B;  1H89 A;  1PGQ A;  2AEM A;  3GMA A;  3TDK A;  1FZF A;  3H1H J;  3MUD A;  2K3R A;  3CD6 P;  1USE A;  4JYB A;  4ZKP A;  3CCV P;  2JWA A;  3AE9 C;  1NTM D;  4OGQ D;  2R44 A;  5AW2 B;  4UB8 H;  4DCK A;  1VQP P;  1FDI A;  1HJ0 A;  2OYH B;  4UB6 H;  1AJY A;  2D2C D;  3MD0 A;  1NU1 D;  1NWQ A;  1KD1 Q;  3Q1M A;  2ZT9 C;  3M9Q A;  1LTB C;  2M8R A;  4WWI A;  1M1J C;  1KIL C;  1BGY E;  2XV5 A;  3CCS P;  3VMA A;  1JEK A;  3R2P A;  1HGV A;  3MP7 B;  1IFN A;  2C9N Y;  3Q5P A;  3L75 J;  1KYO I;  4KJM A;  2PFX A;  4D6T G;  4YTP C;  3W67 A;  2KOG A;  3H1I D;  3H1L E;  2WWW A;  4DT0 A;  3AEA C;  3PJS K;  2QEX P;  1H0T B;  2E74 D;  2N1T A;  1PP9 E;  1AVO A;  1GW4 A;  2BEZ F;  2QJY B;  2YKO A;  4LC1 A;  4WY4 C;  2L91 A;  3WMM 0;  1LTJ C;  1LWU C;  3JCU H;  2R5B A;  1BCC J;  4YPC A;  2D2C B;  1SQX K;  3AE2 C;  4HYT B;  4MN4 C;  3WU2 E;  3ZDM A;  4N78 D;  1Q90 D;  2P7J A;  2ZFC A;  2WPV B;  4RKU J;  1BCC G;  1FOS E;  3H1H G;  2QJP B;  1Q82 Q;  1PV3 A;  2RKL A;  3H1I E;  3RK3 E;  3VTP C;  4OGQ C;  3F5H A;  3H1L G;  4PD4 E;  3I55 P;  1KQG B;  1SQV D;  2P10 A;  3QH9 A;  5CBN A;  1NTK J;  5KLV E;  2WT7 B;  3D6Z A;  1NTM E;  1OWA A;  1X0T A;  3HD7 B;  2K9J B;  2GA1 A;  3AEC C;  3IAO A;  2ITA A;  5AVX B;  1RF1 C;  1FDM A;  1KN7 A;  1FZC B;  2IBZ D;  1NTZ J;  1FAV A;  3L73 E;  3RK3 B;  5M1B A;  1QLE D;  2FYZ A;  3PRJ A;  3SFE C;  1T8Z A;  2WSS H;  1SQQ K;  2FYN C;  3EQ2 A;  4JF7 A;  4L76 A;  1SVF A;  4JYC A;  5KJ7 C;  1LT9 B;  1VF5 D;  1BCC E;  1VQN P;  3GHG C;  3HUS A;  3H1I J;  3BCC G;  1HBW A;  3MIW A;  1JB0 J;  1PPJ E;  2E5T A;  2HOD A;  1DD3 A;  2BCC G;  4IFM A;  3U1C A;  4JBZ A;  2K9J A;  1JM0 A;  3BCC J;  1MFT A;  3RK2 D;  2WSC H;  1L0N G;  5GTI H;  3CLQ A;  1MUU A;  2M5A A;  3W68 A;  3B8E B;  1EZV G;  3CX5 E;  1GL2 A;  4GKG A;  3FWN A;  3L4F A;  4UB8 E;  1AFO A;  2YXQ B;  2PGD A;  2JP3 A;  2AEJ A;  4W7Z A;  2OYH A;  2IYO A;  2FY8 A;  1NTZ E;  1P84 E;  2HFE D;  2QJK B;  1FE6 A;  3L75 E;  5KKZ C;  4R4L A;  3D6Y A;  1VQ6 P;  4C7R A;  3I5C A;  4K35 A;  1PPJ G;  1QVG O;  1KIL E;  3V6I A;  2BCC E;  2ZJS E;  3L71 G;  1GZL A;  1JY3 P;  2IZ1 A;  1L0L G;  1NOH A;  1RE3 C;  2P2U A;  3FXE A;  4H13 D;  4I6M C;  1PGO A;  3AE6 C;  3G3Z A;  2H43 A;  3D70 A;  2K88 A;  1RQV A;  1E79 H;  1SQX G;  2NPS C;  2QIW A;  4EDF A;  1M1K Q;  2POH A;  5EFW B;  2FXP A;  1M7L A;  2ZVO B;  1FDO A;  2V7Q J;  1NAF A;  3CCU P;  3C8V A;  3LIE A;  2FFD B;  3CXH I;  2XNX A;  3CX5 H;  3PP5 A;  1LTT C;  4EIJ A;  4GOD A;  5B5E H;  1SQV K;  2QE7 H;  3WU2 H;  1K9M Q;  1VQ8 P;  3L71 E;  5L8R J;  1KFN A;  3AE5 C;  1AVY A;  1LTJ A;  1LWU A;  4BRY B;  5CCG D;  3V2R A;  5E79 H;  1L0N J;  1RHZ B;  1IK7 A;  1N8R Q;  2N1T C;  2O01 N;  2IX7 C;  2XDJ A;  2YMK A;  1FOS F;  3CX5 D;  1VQ9 P;  1BE3 G;  1LP1 B;  2JDI H;  2KLU A;  3CPW O;  2OYI A;  3AEG C;  2QVA A;  4IFF A;  4UB6 E;  4IFD K;  2YMY A;  5APT A;  2H8P D;  4GDO A;  2LXC B;  4OGQ B;  1EXI A;  3M0D C;  2WMM A;  1P84 I;  3ABV C;  4GOF A;  1FZA A;  1CZQ A;  3L71 J;  2FYU D;  4R4M A;  1ZR4 A;  1L4A D;  4WBA A;  3E1I A;  1YTZ I;  2AEF A;  5DJT B;  1YTZ T;  3H25 A;  1AV1 A;  1NTM G;  3CI9 A;  1YQ3 C;  1FJP A;  1KMI Z; 
#chains in the Genus database with same CATH homology
 1LGH B;  1FZG A;  1Z56 A;  2W6A A;  1JNM A;  1JY2 P;  2Q3I A;  3OA7 A;  1IC2 A;  1H88 A;  1FBM A;  3OJA B;  5AVU B;  4GT1 A;  1XTC C;  2N1T D;  1JOC A;  1RE3 A;  2I1K A;  1LT9 C;  3A2A A;  1HWT C;  2C0X A;  1KQL A;  3L35 A;  1AQ5 A;  2QM8 A;  2WPR A;  5KTB A;  5AW3 B;  4N6J A;  1N86 A;  2J58 A;  2Q7C A;  3NXS A;  3A5T A;  2WIT A;  1X8Y A;  3GHG A;  3HUS C;  1GU4 A;  5APX A;  3M9H A;  3TSI A;  1LTJ B;  1LWU B;  4WY4 B;  4AUW A;  1VDF A;  1J1D B;  2JEE A;  1GDT A;  1GW3 A;  2FXM A;  1MFZ A;  3L37 A;  1IJD B;  1S9K D;  1MZ9 A;  5AVV B;  3VOP A;  1GL2 D;  3TK1 A;  3U59 A;  1JTH B;  1RE4 A;  1L0L K;  1KIL B;  4WB4 A;  2A45 I;  1RF0 A;  1A02 J;  1NH4 A;  1N7S B;  2H7H A;  2W6B A;  3TYY A;  1GK4 A;  2JJL A;  1M1J B;  3V2P A;  2IFN A;  1N73 B;  1L0N K;  3V5B A;  3V4Q A;  1GL2 B;  3KDP B;  2C0W A;  1NHL A;  1HJB A;  4XA4 A;  2CPS A;  5BVZ A;  4O9B A;  1SP4 A;  1M1J A;  3M06 A;  1T2K C;  2VRS A;  2IFM A;  2NPS D;  1N7S C;  4WY4 D;  1XTG B;  3KQG A;  5AVS B;  3P8M C;  3MGN A;  4N78 E;  3O8Z A;  4C46 A;  3N4X A;  3H32 B;  1URQ B;  3HD7 C;  2HPC A;  2Z5I A;  3B5N B;  3NFQ A;  2Z5H A;  5AW4 B;  2R3C A;  1GU5 A;  3BRT B;  5AVT B;  3M91 A;  1N2D C;  1MV8 A;  2P1J A;  3U1A A;  3HE4 B;  1FJK A;  2N9B A;  5CJ4 A;  1RY3 A;  1N7S A;  2Q5U A;  3II6 A;  3L36 A;  1SQP K;  5AW8 B;  3BVH A;  1URQ D;  3RL0 C;  1J1E B;  3B5N C;  1URQ C;  3RL0 D;  1JY2 N;  1NTZ K;  1IFD A;  1PFI A;  1NTK K;  2WSF H;  2WT7 A;  1N73 A;  3VP9 A;  5CCH A;  1LTS C;  3LW5 H;  4W7Y A;  1IFJ A;  5AW7 B;  4EOT A;  1SLQ A;  5CCG C;  3OAK A;  4KHX A;  1NU1 K;  4M3L A;  4DZO A;  5APY A;  2W27 A;  3H32 A;  1RF1 B;  2E42 A;  1N73 C;  5CCH D;  1JY2 O;  1EQ7 A;  3N7N A;  3KPE A;  1SFC A;  3GHG B;  5AVZ B;  1ZLL A;  1YYC A;  5BU8 B;  1HVV A;  2A45 H;  5AVR B;  1GD2 E;  1NTM K;  4I1L A;  1JCC A;  1LT9 A;  3CL3 D;  3V2N A;  3HRN A;  1GTW A;  5AW6 B;  2J59 M;  4N3Y B;  2M3B A;  1JY3 O;  1FZF A;  1NO4 A;  2QM7 A;  1T3U A;  1FU1 A;  2WSE H;  1IO4 A;  2KSJ A;  5AW1 B;  3BAT A;  3VMZ A;  1CI6 B;  2O01 H;  3HD7 D;  3RL0 B;  2R5D A;  3M0D A;  1SFC D;  1NKZ B;  3UIA A;  3SWF A;  1DH3 A;  2Q9I A;  1E5W A;  1FZC C;  1HTL C;  1X79 B;  4B86 A;  4HH2 A;  1SFC B;  1G1J A;  1WT6 A;  3P8C E;  2OYI C;  1OXZ A;  3TNU A;  2YO3 A;  3HTK B;  2FKW B;  2HLO A;  1ZV8 A;  3V2Q A;  2FFD A;  1N7L A;  2HPC B;  3A3Y B;  3A7O A;  1JCD A;  1T3J A;  5AW9 B;  2L5G B;  1CSB A;  1A02 F;  5CJ0 A;  4DOJ A;  1G2C B;  2E43 A;  2PP6 A;  2R32 A;  1HGZ A;  1LTG C;  5CHX A;  1QL1 A;  2GUS A;  3IFM A;  2FFD C;  5APU A;  5AVQ B;  2A45 G;  2YKP A;  2P67 A;  2OAR A;  1GL2 C;  1J1E C;  3P32 A;  1CI6 A;  4C7N A;  2OYH C;  2YNY A;  1G1I A;  3MTU E;  1J1D C;  1LTA C;  2O1K A;  2CPB A;  2YKQ A;  1FZE A;  3H6P A;  2GUV A;  3C9I A;  1JUN A;  2N1T B;  1GK6 A;  4C7N B;  5KJ7 A;  3TNU B;  4AYC A;  2WPQ A;  1ZR2 A;  1JMM A;  1FZB A;  3SWY A;  2WPS A;  3RK2 B;  2O1J A;  1RF1 A;  4LLH A;  1N7S D;  1T2K D;  3BAS A;  1KIL D;  1L4A A;  2XU6 A;  3P8C D;  5AW5 B;  4XE5 B;  4WY4 A;  5BU5 A;  1JY3 N;  2KP8 A;  3RK3 C;  2GM4 A;  3M9B A;  1W2E A;  1KFM A;  2HOD B;  3EFG A;  3T97 A;  3VYI A;  1FZC A;  1JO5 A;  1DEB A;  3HE5 A;  2I1J A;  4AQR D;  1WRG A;  2XZR A;  3B5N D;  5APQ A;  1KIL A;  2BAS A;  3NTN A;  2C9L Y;  1JTH A;  2LKM A;  5KJ7 D;  3LID A;  2FYU K;  1S9K E;  2NPS A;  4W80 A;  4RES B;  3M0A A;  1J2J B;  2YO2 A;  2MJZ A;  3RK3 D;  2WTY A;  3VMY A;  1QL2 A;  4I2L C;  1RF0 C;  1VPC A;  1IK9 A;  1ZN5 A;  1RE4 C;  2NPS B;  5CCG A;  5CMZ A;  3P7K A;  1IFI A;  3IR9 A;  2Z4E A;  2KB7 P;  1NKN A;  2HYN A;  3VP8 A;  5CCH C;  5APS A;  4Y99 B;  4OH8 B;  2OYI B;  1CW5 A;  1SFC C;  3B5N A;  3VMX A;  1L4A B;  1HUC A;  1URQ A;  2WZ7 A;  5APV A;  2XKM A;  3NMD A;  1X9V A;  2IPP A;  3BRV B;  1LTI C;  4GIF A;  3RK2 C;  5AVY B;  3HTK A;  3HE5 B;  3KYQ A;  3VN0 A;  1SQB K;  4ZKU A;  3HE4 A;  2PAJ A;  3V4W A;  1H8A A;  1KZU B;  2KLV A;  4LGD E;  1G2C A;  1HH0 A;  4Y99 C;  5APW A;  5AVW B;  2KYV A;  3HD7 A;  2ZXE B;  1IFM A;  1L4A C;  5KLV K;  2HG5 D;  5AW0 B;  1H89 A;  3MUD A;  4JYB A;  4ZKP A;  5AW2 B;  2OYH B;  3MD0 A;  1NWQ A;  3M9Q A;  1LTB C;  2M8R A;  1M1J C;  1KIL C;  2XV5 A;  3R2P A;  1HGV A;  1IFN A;  2C9N Y;  2KOG A;  2WWW A;  2N1T A;  1GW4 A;  4WY4 C;  2YKO A;  4LC1 A;  3WMM 0;  1LTJ C;  1LWU C;  2R5B A;  1SQX K;  4HYT B;  4N78 D;  2P7J A;  1FOS E;  2ZFC A;  3VTP C;  1DX7 A;  1OWA A;  3HD7 B;  5AVX B;  1RF1 C;  1FDM A;  1FZC B;  3RK3 B;  1FAV A;  2FYZ A;  1T8Z A;  3EQ2 A;  1SQQ K;  4JF7 A;  5KJ7 C;  1SVF A;  4JYC A;  1LT9 B;  1HBW A;  3GHG C;  3HUS A;  3MIW A;  2HOD A;  4IFM A;  3U1C A;  3RK2 D;  2WSC H;  3CLQ A;  1MUU A;  3B8E B;  1GL2 A;  4GKG A;  1AFO A;  3L4F A;  4W7Z A;  2OYH A;  2HFE D;  4C7R A;  3I5C A;  1GZL A;  1JY3 P;  4I6M C;  1NOH A;  1RE3 C;  2P2U A;  3G3Z A;  2H43 A;  2NPS C;  2POH A;  1M7L A;  1NAF A;  3LIE A;  2FFD B;  4EIJ A;  2XNX A;  3PP5 A;  1LTT C;  1SQV K;  1KFN A;  1LTJ A;  1LWU A;  5CCG D;  3V2R A;  2N1T C;  2IX7 C;  2XDJ A;  1FOS F;  2OYI A;  4IFF A;  4IFD K;  2YMY A;  5APT A;  2H8P D;  3M0D C;  1FZA A;  1CZQ A;  1ZR4 A;  1L4A D;  4WBA A;  3E1I A;  1YTZ I;  1YTZ T;  3CI9 A;  3HUS B;  1FJP A;  2WT7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...