1SQXK

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
53
structure length
53
Chain Sequence
MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 14
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqxK00
1SQPK 1SQQK 1SQVK 3CLQA 2WSFH 2O01H 1SQXK 1NTKK 1SQBK 2OARA 2FYUK 3LW5H 3G3ZA 1NTMK 1L0NK 1NU1K 5KLVK 2WSEH 4IFDK 2WSCH 1NTZK 2J59M 2LKMA 1L0LK 3M9QA
chains in the Genus database with same CATH superfamily
3V2PA 4W7YA 2E5TA 1L4AC 4AUWA 4U3FE 3L70G 1N7SA 2JKVA 4UB8E 1FJPA 2IZ0A 1L0NE 1QL2A 1Q82Q 2IBZI 1WRGA 1SFCB 4RJTA 2KNCB 3NXSA 2VRSA 1VQOP 5CCGD 3ABVC 4LC1A 2YNYA 1QVGO 1NVOA 3I5CA 3QWOC 1Q2NA 5KTBA 3CWBG 4PJ0E 4EOTA 2AXTH 2N1TD 2IYPA 1N7SC 2A06G 2N9YB 4OGQB 2CK3H 1OXZA 3L75G 1SQXE 5B66E 1FBMA 2L5GB 1SP4A 3BCCE 4C7NB 3BASA 1OZHA 1P84I 2O1JA 2ZYGA 2RKLA 3G71P 1L0LK 3P8MC 1LTSC 3OW2O 1SQVE 1YTZT 3L35A 4LLHA 3G6EP 1LJ2A 3H1LD 4KHXA 4GODA 4UB8H 3W68A 1IK9A 4I6MC 4L73A 2POHA 1NTKD 1DEEG 1NO4A 3S4RA 3M9QA 2NRGA 1SQBE 3RK2D 1HTLC 3H1KE 2XKMA 2N1TB 4M3LA 4TLFA 3L71D 3KDPB 2KB7P 3T97B 3SWYA 2QEXP 3H1JG 2WPSA 4EI2A 2D2CD 3B4SA 4PJ0H 2E76B 4U3FJ 1W2BO 3L4FA 4H44B 1L0NJ 5B66H 1NGMB 3SSUA 1QGKB 2KZIA 2JWAA 4YTPC 1L4AD 3L72G 1KD1Q 3GHGA 4H13C 3FX0A 2WSEJ 1LT9A 3H1HD 4RESB 4BWNA 5KKZB 5AVYB 2FXOA 1J1DC 1PGPA 2FBWC 2B87B 4IFFA 1UIXA 3RK2B 4KT0J 4D6TJ 1S9KE 3AE4C 1LTIC 2YO2A 1YI2P 1PGOA 5E79E 2D2CB 3BCCJ 2QJKC 1VQ5P 2KSEA 4N6JA 2LXBA 3LIEA 2K37A 3GHGC 4GOFA 2O01J 4W80A 1SQVJ 2YO3A 3B5NC 1LT9C 3H1ID 2PGDA 1T2KC 1IFMA 3TGUG 1ZXGA 1EZVI 2OYIB 1N8RQ 3L74E 4HB1A 3AE3C 1N73A 1UIIA 2OARA 1MUUA 1J1EC 1NTME 4PD4E 2IBZG 3L70D 4IOIH 1NTZK 4NPDA 3FWLA 2QSIA 2V4HA 1SVFA 1NKZB 2P67A 1LTJB 2LR2A 3VMAA 1SQBJ 1VQNP 3L73G 2FYUJ 1VQMP 3U1AA 1GU4A 4RKUJ 3D71A 1PGJA 1RF1B 2ZYDA 2E75C 1KC8Q 1K04A 3I56P 2K9YA 1N73C 2WWWA 4L76A 3CWBD 1LTBC 2KOGA 3CX5E 1GL2B 2E43A 2BASA 1JTHA 1FAVA 2H7HA 2JDIH 2A06D 1VQLP 2JR8A 5E79H 2HODB 3L71J 1IK7A 5AW8B 3IR9A 3GF7A 2GA1A 2XDJA 3AE8C 1JMMA 1SQQK 3WUUA 1PP9E 4GDOA 2E74B 1NWQA 2DW3A 2FYNB 5KAFE 4PD4H 2Y9ZA 3A2AA 1LP1A 1OVRA 2C0WA 3AE6C 1SQPK 1U57A 2Y0EA 1VF5B 5APTA 2OYHB 1PIXA 3A0HE 3TYYA 1FZGA 3PH0A 2GUSA 2NZ2A 2LXCB 2Y9YA 2O01N 4PD4I 3AE1C 3KZIE 2QIWA 2YXQB 1M7LA 1YJ9P 3A3YB 2WZ7A 3H1JD 3CX5H 5AVXB 2YKOA 2KZJA 3N4XA 3Q5RA 1L0LJ 3A0BE 4JPZB 4ZNCA 3CCLP 3B5ND 3V2RA 1PZQA 2V7QJ 2M5AB 1KQLA 1HGVA 2R5DA 1VQ6P 3ZDMA 2WQYC 3RL0B 1X22A 1W5CE 5CHXA 3L72D 2BEZF 3CX5I 4C7NA 1NTZE 2L91A 5KLVK 1OFCX 1YJNP 1R8EA 3P8CE 1FZCC 1JY2O 5KAFH 2MJZA 3E1IA 3GMAA 1A02F 2WVRA 2M8RA 5KLIB 1YJWP 4NPFX 3A0HH 4OGQC 5KJ7A 1H0TB 2QRXA 2OTJP 2H43A 3JSVC 1OVUA 3HTKB 2LKMA 2FFDA 2W90A 4PV1B 1EZVG 3KZIH 3RK3B 1OW7A 1RQVA 3P7KA 3H1KG 1HBWA 3AEEC 2GUVA 4WWIA 3OAKA 2WT7B 3TGUD 1NU1K 3CCMP 3M0AA 2YKPA 2KI7B 1Y9BA 5K5GB 4UB6E 3A0BH 3L75J 4ZMDA 1IC2A 2Z4EA 2W83C 2IBZD 2IZ1A 1SQQE 1PPJD 3AE2C 2Q5UA 2HFED 1BE3E 1YTZI 1JCDA 2FFDC 3L73D 3EFGA 1OIPA 2ZFCA 1M1JB 2Y0CA 1SQPE 2NPSD 1RY3A 4I7ZB 1URQD 5AVRB 5AW2B 1RH5B 2B87A 2E76C 1FZEA 1MFZA 3TF5A 1M90Q 3EFFK 1BDCA 1P84D 3TNUB 4I1LA 3V4WA 3MHVA 1EDLA 1YHQP 5DJTB 1H88A 3HD7D 1M1KQ 4EDFA 2YXRB 1KYOI 1NTZJ 4WY4A 1ZRTD 2PFXA 1HGZA 1BDDA 1NYHA 4EIJA 1HVVA 2YIUC 3GW6A 5AW7B 4O9BA 1ZV8A 3HE4B 1HH0A 4UB6H 1KB9E 1CZQA 3FXDA 2BCCG 3L74G 1AVYA 1NTKK 5KLVE 2ZXEB 1IFDA 3D70A 1NTMG 1GW3A 3CXHI 2XU6A 1H8AA 2NPSB 2HR3A 2OYOA 2KSJA 1FE6A 1LTJA 4DZOA 1GMJA 4WY4C 1RF0C 2YMKA 5CCHA 2QVAA 2Z5HA 2Q3EA 3BVHA 5AVWB 3U1CA 1KILB 3CCVP 1SQQJ 3HD7B 3SFEC 1GL2A 3I55P 2B89A 1BE3J 1HWTC 1YITP 3IFMA 2HODA 1SQXD 2OTKE 3VMZA 2YKQA 1DH3A 1SQPJ 3AEAC 2WTYA 4H0LD 5CCHC 1GK4A 4D6TE 3TK1A 3CLQA 1KB9H 2IPPA 1PP9G 3GG2A 1KN7A 2N9BA 1QLED 1N2DC 5AVTB 1BGYJ 1QEXA 2OYHA 1EDIA 3CD6P 4AYCA 1FZAA 1KB9I 5CBOA 1TU3F 1RQUA 3V5BA 1EZVD 3OJAB 2I1KA 1T3JA 1FJKA 1D7MA 1G2CB 2IX7C 3H1KD 2A45H 3R2PA 1BCCJ 2FYNC 2ZT9D 2AEMA 2RH0A 1X0TA 5KLVJ 2FYUE 3WU2E 4H0LB 1WMKA 2WSEH 2M5AA 1VF5C 3E7KA 3KHUA 2OYHC 2A45I 1USEA 3JCUE 3N7NA 2WSSH 3WUVA 2JP3A 2KXPB 4JBZA 4C7RA 1AQTA 4IL6E 1KORA 5AW4B 3B8EB 1SS1A 5AVQB 1WT6A 1R5LA 1Q86Q 1FU1A 3PRJA 3RBZA 1AQ5A 3L71E 3H6PA 3V2NA 1JY2P 2O01H 1NU1J 4K3AA 3E1RA 3FWNA 4GT1A 2BEQD 4Y99B 2ZT9B 3CC2P 1QVFO 1ZP0C 1T8ZA 3PTZA 2HPCA 5APSA 1ZN5A 1A02J 1JY3N 2R44A 1CW5A 2WT7A 1S5LX 3NFQA 3BATA 1QX8A 1JM0A 4R4MA 3WU2H 2BCCD 2P1JA 3H32B 2E5YA 1N7SD 3L74D 1Y47A 3PJSK 3HUSB 1JUNA 1JNMA 2H88C 1YQ4C 1NTMD 4PD4D 3K5BA 2P58A 4BRYB 5KLIC 3JCUH 2J58A 1AFOA 3USSA 5AVSB 1RE4A 3CCJP 3CCEP 1LTAC 4IL6H 4PV1C 1L4AB 1GK6A 2KP8A 1PL5A 3U59A 1PPJG 2O3JA 3IN6A 1L0LE 4N3YB 3F89A 4JF7A 2W6AA 1IZNB 3W67A 5GTIE 2HG5D 3H1IE 2IDBA 5L8RJ 3CI9A 4NPEA 3H1LJ 2HLOA 3CX5D 1ZLLA 1E5WA 2QA4P 1RE4C 1NTKJ 3S9OA 1N7SB 3PLNA 1LWUA 2CPSA 3C1LA 4I7ZC 3GLMA 4OH8B 1PP9D 3LIDA 5B5EE 1EXJA 1LTGC 3HE4A 4DOJA 1JMBA 4TT3H 2RN0A 4GKGA 1HF9A 2A06E 4H13D 2M3EA 3C8VA 2CPBA 3L75E 1LWUC 2V7QH 4U3FG 1KQFB 2HYNA 3PHLA 3CCUP 5GTIH 1IJDB 1L0NG 3JC22 2KUBA 1RHZB 2XZRA 3H1HJ 1KILA 1SFCA 1IFIA 2KNCA 2A45G 1MFTA 2QJPC 1G1JA 1K73Q 1HJBA 3VYIA 3RGUA 1XTGB 4IL6X 1KMIZ 3EQ2A 1T2KD 1M56D 5APVA 2OQQA 4JQ0D 1HJ0A 2AXCA 1MKMA 2FXPA 5B5EH 4D6TG 1GW4A 1SQXG 3H1IJ 3P8CD 3AE9C 1KTMA 1SFCC 4YXWH 2Y0DA 1KFNA 4YPCA 3BCCG 1KYOD 3MTUE 1BSHA 1J1DB 3TDKA 3L70J 1DD4A 3RK3E 1SQVG 2Q3IA 3CL3D 3G3ZA 1Q7YQ 1G2CA 5CCGA 2E75D 1U7JA 1OMIA 3L36A 1GDTA 3CXHD 1EQ7A 2QJKB 3L72E 5AVUB 2Z5IA 3M06A 1EDJA 4N78E 4XE5B 3GHGB 1K05A 4DT0A 4KJMA 1SQBG 3B5NB 2FYUG 2N1TA 3CWBJ 5BU5A 5TISE 2W8ZA 3T97A 2Q1KA 2P10A 1J1EB 4R4LA 3SWFA 2K9JB 2R32A 5C39A 4YXDC 3VP8A 2JO1A 2OTLP 5CMZA 5CCGC 5KJ7C 4W7ZA 4HYTB 2B9BA 1W2EA 2Q7CA 4A7PA 2N1TC 3IF4A 3CC7P 1SQXK 2ZAEB 4C46A 5APQA 3A7OA 1N73B 2IBZE 1DIPA 3LW5H 4MN4C 5APXA 4WBAA 2E42A 3KYQA 1S1CX 1ZR4A 4H44C 4HKZH 1YQ3C 2XV5A 1FDMA 3Q5PA 1ZMEC 1BGYE 2R5BA 1RE3A 5KAIE 1OW6A 2W6BA 3H1JJ 3H32A 3M9BA 1KB9D 3HUSA 5TISH 1R5SA 1FOSF 2PP6A 5CJ0A 2IFMA 3GF3A 4L74A 3LW5J 1IFPA 5KKZC 5M1BA 2OYIA 1S5LE 5BVZA 3MZWB 4Y99C 2P2UA 1BCCE 1P84E 2K88A 3VN0A 1L4AA 3RK2C 3IAOA 3NMDA 2WPRA 3WMM0 3L72J 1KILE 2ZJSE 4U3FD 1URQB 3EWKA 1L0LG 3G4SP 4XFJA 5AW9B 1L0ND 4IFMA 1ZRTE 2D2CC 2H89C 3VMXA 2QE7H 2MKVA 5AVZB 4B86A 2B88A 4OGQD 3HUSC 3V4QA 1RF1A 1OW8A 2KS1B 1NAFA 2AEFA 5AW6B 2OYIC 3AECC 5APUA 1VQPP 1Z56A 3KQGA 1JB0J 2C0XA 4LGDE 1GD2E 3BRTB 1NU1E 4DJGA 5KAIH 1LTJC 4D6TD 2GM4A 4XA4A 2FXMA 3TGUJ 3HE5B 3D6ZA 2XNDH 3C9IA 5KJ7D 3BCCD 1FZCB 1RF1C 1FC2C 1S5LH 2PRRA 2KIKA 1P84H 4DCKA 1SQVD 1T3UA 3O6QB 1KQSO 3NTNA 1GL2C 3L73J 2FY8A 4HH2A 1VQKP 2OGUA 4L75A 3CCQP 2E76D 2QM8A 3QH9A 1NTMK 4H44D 5APWA 1HUCA 1SQBD 3MIWA 2FYUD 1G1IA 1NHLA 2E74C 3S1KA 2ZXXA 3SFDC 3D6YA 2ZVNB 3BRVB 2R3CA 1K9MQ 2WSCH 1T6AA 1E79H 2J59M 1L2PA 3H1LE 4GOEA 1EZVE 2FFDB 1N86A 2Q6QA 4I2LC 1CI6B 1NTKE 1MV8A 1VQ4P 1AVOA 4JYCA 5AW5B 4ASWA 1FDIA 2JJLA 4GIFA 2K3RA 1AA0A 1NAYA 3MGNA 1ZW0A 1NTZG 1ZR2A 3AEBC 3O8ZA 1YYCA 1S2EA 4WY4D 4HJGH 1EXIA 1JEKA 2QJYB 3CCRP 3MD0A 1JOCA 2WSCJ 3AEDC 2ITAA 1S9KD 1FZBA 1OX3A 2KK7A 1VPCA 1H0TA 3HTKA 3P32A 3Q5SA 3VMYA 4WB4A 3RL0C 2P7JA 2G3AA 4U7JA 5AW0B 1FOSE 2YIUB 3B5NA 1NOHA 2I1JA 2KLVA 1M57D 2WPQA 1YIJP 1S3JA 1K8AQ 2K9JA 5CCHD 3H1HE 3M91A 1SQXJ 1LNQA 4ZKUA 3TSIA 5EFWB 1JY3O 1NH4A 1AJYA 1SQQG 1OVVA 1L0LD 3Q3DA 3FGAD 4JYBA 1LTTC 4WY4B 1BE3G 3B71A 1GL2D 5AVVB 1M1JA 3RK3C 1PGQA 2WPVB 3M0DA 4OVNF 1SQPG 2KYVA 3CCSP 2BCCE 1VQ7P 3AE7C 3V2QA 4BXLA 1EC5A 2O1KA 3CC4P 3ITKA 2WITA 1GU5A 2E74D 3TNUA 5AW1B 3H1KJ 1S4XA 3L70E 1Q90D 1BGYG 2JEEA 1BSNA 1AV1A 1M1JC 1VDFA 2C9NY 1VF5D 3M0DC 2I8DA 1J2JB 1NKNA 1PV3A 1X8YA 1DD3A 3FXEA 1S72P 2Q9IA 3KPEA 3M9HA 5BU8B 1BCCG 2FYZA 2NPSA 5KLVG 3L75D 4ZKPA 2UWJE 1URQA 3CWBE 1FS0E 3SWKA 3RBXA 1IFJA 4AQRD 3MP7B 5CBNA 1LGHB 3CPWO 2WSFH 2FKWB 2J5UA 3VTPC 2KS1A 1DEBA 2AEJA 3RL0D 1USDA 3Q2YA 3CMEP 3HD7A 1JO5A 1ZOYC 4EYYQ 5AW3B 4Z1MH 4WVZA 2QG4A 2NPSC 4CPGA 1NJIQ 5GTHE 2ZVOB 1URQC 1H89A 1IFNA 1LT1A 1NU1G 2M0BA 2W27A 3HE5A 2PAJA 2WSFJ 2BCCJ 1FZCA 3L74J 2JWDA 1YBKA 1NTZD 1VL2A 1KFMA 1KZUB 3MUDA 1NTMJ 1OWAA 4PV1D 1QL1A 2H8PD 1KILC 3R4YA 3O6QA 2SPZA 3HD7C 3RK3D 4H13B 1GTWA 3H1JE 5DJUB 1JY2N 1EDKA 2C9LY 2YMYA 1VQ8P 1X9VA 5CJ4A 1M8OB 1GZLA 4N78D 3AEFC 3KXDA 3MUDC 1SLQA 2R3SA 1KYOE 5H2FE 1IO4A 1LT9B 5GTHH 4Y28J 1XTCC 1L0NK 1SQQD 1VQ9P 2K1AA 1FDOA 3H1LG 1BE3D 1X79B 1CI6A 2HPCB 2RMZA 1PP9J 2G8YA 3CMAP 3CXHE 1NTKG 3OA7A 3II6A 3A5TA 3V6IA 1SQPD 1U7MA 4K35A 2XNXA 1DX7A 1N7LA 3Q1MA 3VOPA 3TGUE 3L71G 4H0LC 1Y8AA 2E75B 4RO0A 2QM7A 3G9RA 1PPJE 2ZYAA 4OWFA 2W6JH 1BGYD 4ASVA 3AE5C 1CSBA 1JCCA 3L73E 3UIAA 2M3BA 1SQVK 2KLUA 3RL0g 1KYOH 1Q81Q 5H2FH 3F5HA 2QJYC 5APYA 4IFDK 2IYOA 1BCCD 2IFNA 3H1HG 3HRNA 5KLVD 4BRYA 1MZ9A 1KILD 1SFCD 2ZT9C 1SQBK 1JTHB 2FYUK 3CXHH 1LWUB 1JY3P 1RF0A 2AXTE 1PFIA 3PP5A 3WUTA 1RE3C 3H25A 3VP9A 5TJHA 3L37A 2QJPB 3H1IG 1FZFA 3AEGC 4QMAA 1KQGB 1KV4A 1NU1D 2WMMA 1LP1B
chains in the Genus database with same CATH topology
3V2PA 4W7YA 1L4AC 4AUWA 3RK3B 3MD0A 4DOJA 1JOCA 1N7SA 1FJPA 3P7KA 1HBWA 2GUVA 1S9KD 1FZBA 3OAKA 2WT7B 1QL2A 1VPCA 1NU1K 3M0AA 2YKPA 3HTKA 1WRGA 1SFCB 4GKGA 3P32A 3NXSA 2VRSA 3VMYA 4WB4A 3RL0C 1IC2A 2P7JA 2Z4EA 2CPBA 5CCGD 5AW0B 1LWUC 1FOSE 3B5NA 4LC1A 2YNYA 1NOHA 2Q5UA 2I1JA 2HFED 2HYNA 3I5CA 1YTZI 2KLVA 2WPQA 1IJDB 1JCDA 5KTBA 2FFDC 2XZRA 3EFGA 1KILA 1SFCA 1IFIA 4EOTA 2ZFCA 2A45G 5CCHD 1M1JB 2N1TD 3M91A 1N7SC 4ZKUA 2NPSD 3TSIA 1OXZA 1RY3A 1G1JA 1JY3O 1NH4A 1URQD 5AVRB 1HJBA 1FBMA 2L5GB 5AW2B 3VYIA 4JYBA 1LTTC 4WY4B 1XTGB 1SP4A 4C7NB 3BASA 1FZEA 1GL2D 1MFZA 2O1JA 5AVVB 1M1JA 3EQ2A 1T2KD 3RK3C 5APVA 3TNUB 1L0LK 3P8MC 4I1LA 3M0DA 3V4WA 1LTSC 2KYVA 1YTZT 1GW4A 3L35A 3P8CD 3V2QA 4LLHA 1H88A 2O1KA 3HD7D 1SFCC 4KHXA 4WY4A 2WITA 1KFNA 1IK9A 1GU5A 1HGZA 4I6MC 2POHA 3MTUE 4EIJA 1HVVA 1NO4A 3TNUA 5AW7B 4O9BA 1J1DB 1ZV8A 5AW1B 3HE4B 3M9QA 1HH0A 1CZQA 2Q3IA 3RK2D 2JEEA 1HTLC 2XKMA 1NTKK 3CL3D 1M1JC 2N1TB 1VDFA 2ZXEB 1IFDA 3G3ZA 4M3LA 1GW3A 1H8AA 2XU6A 2C9NY 1G2CA 2NPSB 5CCGA 3KDPB 3M0DC 2KSJA 3L36A 2KB7P 1GDTA 3SWYA 1J2JB 2WPSA 1EQ7A 1LTJA 1NKNA 5AVUB 4DZOA 2Z5IA 3M06A 1X8YA 4N78E 4XE5B 3GHGB 4WY4C 3L4FA 2Q9IA 1RF0C 3KPEA 3M9HA 3B5NB 5BU8B 5CCHA 2FYZA 2N1TA 2Z5HA 5BU5A 2NPSA 3BVHA 4ZKPA 1URQA 5AVWB 3T97A 3U1CA 1KILB 1J1EB 1L4AD 3SWFA 1IFJA 3HD7B 2R32A 4AQRD 3VP8A 3GHGA 1GL2A 1LGHB 2WSFH 5CMZA 1LT9A 5CCGC 5KJ7C 1HWTC 4RESB 4W7ZA 4HYTB 2FKWB 3IFMA 3VTPC 5AVYB 2HODA 1J1DC 1W2EA 2Q7CA 1DEBA 3RL0D 4IFFA 3VMZA 2YKQA 1DH3A 3RK2B 3HD7A 1JO5A 1S9KE 2WTYA 5CCHC 5AW3B 1GK4A 2N1TC 3TK1A 2NPSC 3CLQA 1SQXK 1LTIC 2YO2A 4C46A 2IPPA 1URQC 5APQA 3A7OA 1N73B 1H89A 3LW5H 1IFNA 5APXA 2W27A 4WBAA 2N9BA 4N6JA 2E42A 3LIEA 3GHGC 3HE5A 3KYQA 2PAJA 1ZR4A 4W80A 2YO3A 3B5NC 1LT9C 1N2DC 1T2KC 5AVTB 1IFMA 1FZCA 2XV5A 1FDMA 1KFMA 2OYHA 2OYIB 1KZUB 4AYCA 3MUDA 1OWAA 1FZAA 2R5BA 1RE3A 1QL1A 1N73A 3V5BA 2OARA 2W6BA 1MUUA 2H8PD 1KILC 1J1EC 3OJAB 2I1KA 3HD7C 3RK3D 3H32A 3M9BA 1T3JA 1FJKA 1G2CB 1GTWA 1NTZK 3HUSA 2IX7C 1SVFA 1NKZB 2P67A 1LTJB 2A45H 2PP6A 5CJ0A 1FOSF 3R2PA 1JY2N 2IFMA 2OYIA 2C9LY 2YMYA 5BVZA 4Y99C 3U1AA 2P2UA 1GU4A 1X9VA 3VN0A 1L4AA 3RK2C 5CJ4A 3NMDA 2WPRA 1GZLA 4N78D 2WSEH 1RF1B 3WMM0 1URQB 2OYHC 5AW9B 1SLQA 2A45I 4IFMA 3N7NA 3VMXA 1N73C 2WWWA 1LTBC 2KOGA 4C7RA 1IO4A 1GL2B 2E43A 2BASA 5AVZB 1JTHA 1FAVA 4B86A 2H7HA 5AW4B 3B8EB 1LT9B 3HUSC 3V4QA 5AVQB 1XTCC 1RF1A 1L0NK 1WT6A 2HODB 1NAFA 5AW6B 2OYIC 5APUA 5AW8B 1FU1A 1AQ5A 1X79B 3IR9A 3H6PA 3V2NA 1CI6A 2HPCB 2XDJA 1Z56A 1JMMA 3KQGA 1SQQK 2C0XA 1JY2P 2O01H 4LGDE 1GD2E 3OA7A 3II6A 3A5TA 4GT1A 3BRTB 1NWQA 2GM4A 1LTJC 2XNXA 4XA4A 4Y99B 2FXMA 1DX7A 3A2AA 1N7LA 3HE5B 1T8ZA 3VOPA 2C0WA 2HPCA 1SQPK 3C9IA 5KJ7D 1FZCB 5APSA 1ZN5A 1A02J 1RF1C 1JY3N 5APTA 2OYHB 1CW5A 1FZGA 3TYYA 2WT7A 3NFQA 3BATA 2GUSA 2QM7A 1T3UA 2P1JA 3H32B 3NTNA 1N7SD 3HUSB 1JUNA 1GL2C 1JNMA 4HH2A 1CSBA 1JCCA 3UIAA 1M7LA 2M3BA 1SQVK 2J58A 1AFOA 3A3YB 2WZ7A 5AVSB 2QM8A 1RE4A 1LTAC 5AVXB 1L4AB 2YKOA 1NTMK 3N4XA 1GK6A 2KP8A 5APYA 4IFDK 5APWA 3B5ND 3U59A 3V2RA 1HUCA 3MIWA 2IFNA 3HRNA 4N3YB 1G1IA 1KQLA 4JF7A 2W6AA 1NHLA 1HGVA 1MZ9A 2R5DA 1KILD 1SFCD 3RL0B 1SQBK 2HG5D 5CHXA 1JTHB 2FYUK 4C7NA 1LWUB 1JY3P 3CI9A 1RF0A 3BRVB 5KLVK 2R3CA 2WSCH 1PFIA 2HLOA 1ZLLA 3P8CE 1FZCC 1JY2O 2J59M 1E5WA 3PP5A 2FFDB 1N86A 2MJZA 1RE4C 3E1IA 1RE3C 4I2LC 1A02F 1CI6B 3VP9A 1MV8A 1N7SB 4JYCA 5AW5B 3L37A 2JJLA 4GIFA 1LWUA 2CPSA 2M8RA 3MGNA 1FZFA 5KJ7A 1ZR2A 4OH8B 3O8ZA 2H43A 3HTKB 1YYCA 3LIDA 2LKMA 1LTGC 3HE4A 2FFDA 4WY4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP K;  1SQQ K;  1SQV K;  3CLQ A;  2WSF H;  2O01 H;  1SQX K;  1NTK K;  1SQB K;  2OAR A;  2FYU K;  3LW5 H;  3G3Z A;  1NTM K;  1L0N K;  1NU1 K;  5KLV K;  2WSE H;  4IFD K;  2WSC H;  1NTZ K;  2J59 M;  2LKM A;  1L0L K;  3M9Q A; 
#chains in the Genus database with same CATH topology
 3V2P A;  4W7Y A;  2E5T A;  1L4A C;  4AUW A;  4U3F E;  3L70 G;  1N7S A;  2JKV A;  4UB8 E;  1FJP A;  2IZ0 A;  1L0N E;  1QL2 A;  1Q82 Q;  2IBZ I;  1WRG A;  1SFC B;  4RJT A;  2KNC B;  3NXS A;  2VRS A;  1VQO P;  5CCG D;  3ABV C;  4LC1 A;  2YNY A;  1QVG O;  1NVO A;  3I5C A;  3QWO C;  1Q2N A;  5KTB A;  3CWB G;  4PJ0 E;  4EOT A;  2AXT H;  2N1T D;  2IYP A;  1N7S C;  2A06 G;  2N9Y B;  4OGQ B;  2CK3 H;  1OXZ A;  3L75 G;  1SQX E;  5B66 E;  1FBM A;  2L5G B;  1SP4 A;  3BCC E;  4C7N B;  3BAS A;  1OZH A;  1P84 I;  2O1J A;  2ZYG A;  2RKL A;  3G71 P;  1L0L K;  3P8M C;  1LTS C;  3OW2 O;  1SQV E;  1YTZ T;  3L35 A;  4LLH A;  3G6E P;  1LJ2 A;  3H1L D;  4KHX A;  4GOD A;  4UB8 H;  3W68 A;  1IK9 A;  4I6M C;  4L73 A;  2POH A;  1NTK D;  1DEE G;  1NO4 A;  3S4R A;  3M9Q A;  2NRG A;  1SQB E;  3RK2 D;  1HTL C;  3H1K E;  2XKM A;  2N1T B;  4M3L A;  4TLF A;  3L71 D;  3KDP B;  2KB7 P;  3T97 B;  3SWY A;  2QEX P;  3H1J G;  2WPS A;  4EI2 A;  2D2C D;  3B4S A;  4PJ0 H;  2E76 B;  4U3F J;  1W2B O;  3L4F A;  4H44 B;  1L0N J;  5B66 H;  1NGM B;  3SSU A;  1QGK B;  2KZI A;  2JWA A;  4YTP C;  1L4A D;  3L72 G;  1KD1 Q;  3GHG A;  4H13 C;  3FX0 A;  2WSE J;  1LT9 A;  3H1H D;  4RES B;  4BWN A;  5KKZ B;  5AVY B;  2FXO A;  1J1D C;  1PGP A;  2FBW C;  2B87 B;  4IFF A;  1UIX A;  3RK2 B;  4KT0 J;  4D6T J;  1S9K E;  3AE4 C;  1LTI C;  2YO2 A;  1YI2 P;  1PGO A;  5E79 E;  2D2C B;  3BCC J;  2QJK C;  1VQ5 P;  2KSE A;  4N6J A;  2LXB A;  3LIE A;  2K37 A;  3GHG C;  4GOF A;  2O01 J;  4W80 A;  1SQV J;  2YO3 A;  3B5N C;  1LT9 C;  3H1I D;  2PGD A;  1T2K C;  1IFM A;  3TGU G;  1ZXG A;  1EZV I;  2OYI B;  1N8R Q;  3L74 E;  4HB1 A;  3AE3 C;  1N73 A;  1UII A;  2OAR A;  1MUU A;  1J1E C;  1NTM E;  4PD4 E;  2IBZ G;  3L70 D;  4IOI H;  1NTZ K;  4NPD A;  3FWL A;  2QSI A;  2V4H A;  1SVF A;  1NKZ B;  2P67 A;  1LTJ B;  2LR2 A;  3VMA A;  1SQB J;  1VQN P;  3L73 G;  2FYU J;  1VQM P;  3U1A A;  1GU4 A;  4RKU J;  3D71 A;  1PGJ A;  1RF1 B;  2ZYD A;  2E75 C;  1KC8 Q;  1K04 A;  3I56 P;  2K9Y A;  1N73 C;  2WWW A;  4L76 A;  3CWB D;  1LTB C;  2KOG A;  3CX5 E;  1GL2 B;  2E43 A;  2BAS A;  1JTH A;  1FAV A;  2H7H A;  2JDI H;  2A06 D;  1VQL P;  2JR8 A;  5E79 H;  2HOD B;  3L71 J;  1IK7 A;  5AW8 B;  3IR9 A;  3GF7 A;  2GA1 A;  2XDJ A;  3AE8 C;  1JMM A;  1SQQ K;  3WUU A;  1PP9 E;  4GDO A;  2E74 B;  1NWQ A;  2DW3 A;  2FYN B;  5KAF E;  4PD4 H;  2Y9Z A;  3A2A A;  1LP1 A;  1OVR A;  2C0W A;  3AE6 C;  1SQP K;  1U57 A;  2Y0E A;  1VF5 B;  5APT A;  2OYH B;  1PIX A;  3A0H E;  3TYY A;  1FZG A;  3PH0 A;  2GUS A;  2NZ2 A;  2LXC B;  2Y9Y A;  2O01 N;  4PD4 I;  3AE1 C;  3KZI E;  2QIW A;  2YXQ B;  1M7L A;  1YJ9 P;  3A3Y B;  2WZ7 A;  3H1J D;  3CX5 H;  5AVX B;  2YKO A;  2KZJ A;  3N4X A;  3Q5R A;  1L0L J;  3A0B E;  4JPZ B;  4ZNC A;  3CCL P;  3B5N D;  3V2R A;  1PZQ A;  2V7Q J;  2M5A B;  1KQL A;  1HGV A;  2R5D A;  1VQ6 P;  3ZDM A;  2WQY C;  3RL0 B;  1X22 A;  1W5C E;  5CHX A;  3L72 D;  2BEZ F;  3CX5 I;  4C7N A;  1NTZ E;  2L91 A;  5KLV K;  1OFC X;  1YJN P;  1R8E A;  3P8C E;  1FZC C;  1JY2 O;  5KAF H;  2MJZ A;  3E1I A;  3GMA A;  1A02 F;  2WVR A;  2M8R A;  5KLI B;  1YJW P;  4NPF X;  3A0H H;  4OGQ C;  5KJ7 A;  1H0T B;  2QRX A;  2OTJ P;  2H43 A;  3JSV C;  1OVU A;  3HTK B;  2LKM A;  2FFD A;  2W90 A;  4PV1 B;  1EZV G;  3KZI H;  3RK3 B;  1OW7 A;  1RQV A;  3P7K A;  3H1K G;  1HBW A;  3AEE C;  2GUV A;  4WWI A;  3OAK A;  2WT7 B;  3TGU D;  1NU1 K;  3CCM P;  3M0A A;  2YKP A;  2KI7 B;  1Y9B A;  5K5G B;  4UB6 E;  3A0B H;  3L75 J;  4ZMD A;  1IC2 A;  2Z4E A;  2W83 C;  2IBZ D;  2IZ1 A;  1SQQ E;  1PPJ D;  3AE2 C;  2Q5U A;  2HFE D;  1BE3 E;  1YTZ I;  1JCD A;  2FFD C;  3L73 D;  3EFG A;  1OIP A;  2ZFC A;  1M1J B;  2Y0C A;  1SQP E;  2NPS D;  1RY3 A;  4I7Z B;  1URQ D;  5AVR B;  5AW2 B;  1RH5 B;  2B87 A;  2E76 C;  1FZE A;  1MFZ A;  3TF5 A;  1M90 Q;  3EFF K;  1BDC A;  1P84 D;  3TNU B;  4I1L A;  3V4W A;  3MHV A;  1EDL A;  1YHQ P;  5DJT B;  1H88 A;  3HD7 D;  1M1K Q;  4EDF A;  2YXR B;  1KYO I;  1NTZ J;  4WY4 A;  1ZRT D;  2PFX A;  1HGZ A;  1BDD A;  1NYH A;  4EIJ A;  1HVV A;  2YIU C;  3GW6 A;  5AW7 B;  4O9B A;  1ZV8 A;  3HE4 B;  1HH0 A;  4UB6 H;  1KB9 E;  1CZQ A;  3FXD A;  2BCC G;  3L74 G;  1AVY A;  1NTK K;  5KLV E;  2ZXE B;  1IFD A;  3D70 A;  1NTM G;  1GW3 A;  3CXH I;  2XU6 A;  1H8A A;  2NPS B;  2HR3 A;  2OYO A;  2KSJ A;  1FE6 A;  1LTJ A;  4DZO A;  1GMJ A;  4WY4 C;  1RF0 C;  2YMK A;  5CCH A;  2QVA A;  2Z5H A;  2Q3E A;  3BVH A;  5AVW B;  3U1C A;  1KIL B;  3CCV P;  1SQQ J;  3HD7 B;  3SFE C;  1GL2 A;  3I55 P;  2B89 A;  1BE3 J;  1HWT C;  1YIT P;  3IFM A;  2HOD A;  1SQX D;  2OTK E;  3VMZ A;  2YKQ A;  1DH3 A;  1SQP J;  3AEA C;  2WTY A;  4H0L D;  5CCH C;  1GK4 A;  4D6T E;  3TK1 A;  3CLQ A;  1KB9 H;  2IPP A;  1PP9 G;  3GG2 A;  1KN7 A;  2N9B A;  1QLE D;  1N2D C;  5AVT B;  1BGY J;  1QEX A;  2OYH A;  1EDI A;  3CD6 P;  4AYC A;  1FZA A;  1KB9 I;  5CBO A;  1TU3 F;  1RQU A;  3V5B A;  1EZV D;  3OJA B;  2I1K A;  1T3J A;  1FJK A;  1D7M A;  1G2C B;  2IX7 C;  3H1K D;  2A45 H;  3R2P A;  1BCC J;  2FYN C;  2ZT9 D;  2AEM A;  2RH0 A;  1X0T A;  5KLV J;  2FYU E;  3WU2 E;  4H0L B;  1WMK A;  2WSE H;  2M5A A;  1VF5 C;  3E7K A;  3KHU A;  2OYH C;  2A45 I;  1USE A;  3JCU E;  3N7N A;  2WSS H;  3WUV A;  2JP3 A;  2KXP B;  4JBZ A;  4C7R A;  1AQT A;  4IL6 E;  1KOR A;  5AW4 B;  3B8E B;  1SS1 A;  5AVQ B;  1WT6 A;  1R5L A;  1Q86 Q;  1FU1 A;  3PRJ A;  3RBZ A;  1AQ5 A;  3L71 E;  3H6P A;  3V2N A;  1JY2 P;  2O01 H;  1NU1 J;  4K3A A;  3E1R A;  3FWN A;  4GT1 A;  2BEQ D;  4Y99 B;  2ZT9 B;  3CC2 P;  1QVF O;  1ZP0 C;  1T8Z A;  3PTZ A;  2HPC A;  5APS A;  1ZN5 A;  1A02 J;  1JY3 N;  2R44 A;  1CW5 A;  2WT7 A;  1S5L X;  3NFQ A;  3BAT A;  1QX8 A;  1JM0 A;  4R4M A;  3WU2 H;  2BCC D;  2P1J A;  3H32 B;  2E5Y A;  1N7S D;  3L74 D;  1Y47 A;  3PJS K;  3HUS B;  1JUN A;  1JNM A;  2H88 C;  1YQ4 C;  1NTM D;  4PD4 D;  3K5B A;  2P58 A;  4BRY B;  5KLI C;  3JCU H;  2J58 A;  1AFO A;  3USS A;  5AVS B;  1RE4 A;  3CCJ P;  3CCE P;  1LTA C;  4IL6 H;  4PV1 C;  1L4A B;  1GK6 A;  2KP8 A;  1PL5 A;  3U59 A;  1PPJ G;  2O3J A;  3IN6 A;  1L0L E;  4N3Y B;  3F89 A;  4JF7 A;  2W6A A;  1IZN B;  3W67 A;  5GTI E;  2HG5 D;  3H1I E;  2IDB A;  5L8R J;  3CI9 A;  4NPE A;  3H1L J;  2HLO A;  3CX5 D;  1ZLL A;  1E5W A;  2QA4 P;  1RE4 C;  1NTK J;  3S9O A;  1N7S B;  3PLN A;  1LWU A;  2CPS A;  3C1L A;  4I7Z C;  3GLM A;  4OH8 B;  1PP9 D;  3LID A;  5B5E E;  1EXJ A;  1LTG C;  3HE4 A;  4DOJ A;  1JMB A;  4TT3 H;  2RN0 A;  4GKG A;  1HF9 A;  2A06 E;  4H13 D;  2M3E A;  3C8V A;  2CPB A;  3L75 E;  1LWU C;  2V7Q H;  4U3F G;  1KQF B;  2HYN A;  3PHL A;  3CCU P;  5GTI H;  1IJD B;  1L0N G;  3JC2 2;  2KUB A;  1RHZ B;  2XZR A;  3H1H J;  1KIL A;  1SFC A;  1IFI A;  2KNC A;  2A45 G;  1MFT A;  2QJP C;  1G1J A;  1K73 Q;  1HJB A;  3VYI A;  3RGU A;  1XTG B;  4IL6 X;  1KMI Z;  3EQ2 A;  1T2K D;  1M56 D;  5APV A;  2OQQ A;  4JQ0 D;  1HJ0 A;  2AXC A;  1MKM A;  2FXP A;  5B5E H;  4D6T G;  1GW4 A;  1SQX G;  3H1I J;  3P8C D;  3AE9 C;  1KTM A;  1SFC C;  4YXW H;  2Y0D A;  1KFN A;  4YPC A;  3BCC G;  1KYO D;  3MTU E;  1BSH A;  1J1D B;  3TDK A;  3L70 J;  1DD4 A;  3RK3 E;  1SQV G;  2Q3I A;  3CL3 D;  3G3Z A;  1Q7Y Q;  1G2C A;  5CCG A;  2E75 D;  1U7J A;  1OMI A;  3L36 A;  1GDT A;  3CXH D;  1EQ7 A;  2QJK B;  3L72 E;  5AVU B;  2Z5I A;  3M06 A;  1EDJ A;  4N78 E;  4XE5 B;  3GHG B;  1K05 A;  4DT0 A;  4KJM A;  1SQB G;  3B5N B;  2FYU G;  2N1T A;  3CWB J;  5BU5 A;  5TIS E;  2W8Z A;  3T97 A;  2Q1K A;  2P10 A;  1J1E B;  4R4L A;  3SWF A;  2K9J B;  2R32 A;  5C39 A;  4YXD C;  3VP8 A;  2JO1 A;  2OTL P;  5CMZ A;  5CCG C;  5KJ7 C;  4W7Z A;  4HYT B;  2B9B A;  1W2E A;  2Q7C A;  4A7P A;  2N1T C;  3IF4 A;  3CC7 P;  1SQX K;  2ZAE B;  4C46 A;  5APQ A;  3A7O A;  1N73 B;  2IBZ E;  1DIP A;  3LW5 H;  4MN4 C;  5APX A;  4WBA A;  2E42 A;  3KYQ A;  1S1C X;  1ZR4 A;  4H44 C;  4HKZ H;  1YQ3 C;  2XV5 A;  1FDM A;  3Q5P A;  1ZME C;  1BGY E;  2R5B A;  1RE3 A;  5KAI E;  1OW6 A;  2W6B A;  3H1J J;  3H32 A;  3M9B A;  1KB9 D;  3HUS A;  5TIS H;  1R5S A;  1FOS F;  2PP6 A;  5CJ0 A;  2IFM A;  3GF3 A;  4L74 A;  3LW5 J;  1IFP A;  5KKZ C;  5M1B A;  2OYI A;  1S5L E;  5BVZ A;  3MZW B;  4Y99 C;  2P2U A;  1BCC E;  1P84 E;  2K88 A;  3VN0 A;  1L4A A;  3RK2 C;  3IAO A;  3NMD A;  2WPR A;  3WMM 0;  3L72 J;  1KIL E;  2ZJS E;  4U3F D;  1URQ B;  3EWK A;  1L0L G;  3G4S P;  4XFJ A;  5AW9 B;  1L0N D;  4IFM A;  1ZRT E;  2D2C C;  2H89 C;  3VMX A;  2QE7 H;  2MKV A;  5AVZ B;  4B86 A;  2B88 A;  4OGQ D;  3HUS C;  3V4Q A;  1RF1 A;  1OW8 A;  2KS1 B;  1NAF A;  2AEF A;  5AW6 B;  2OYI C;  3AEC C;  5APU A;  1VQP P;  1Z56 A;  3KQG A;  1JB0 J;  2C0X A;  4LGD E;  1GD2 E;  3BRT B;  1NU1 E;  4DJG A;  5KAI H;  1LTJ C;  4D6T D;  2GM4 A;  4XA4 A;  2FXM A;  3TGU J;  3HE5 B;  3D6Z A;  2XND H;  3C9I A;  5KJ7 D;  3BCC D;  1FZC B;  1RF1 C;  1FC2 C;  1S5L H;  2PRR A;  2KIK A;  1P84 H;  4DCK A;  1SQV D;  1T3U A;  3O6Q B;  1KQS O;  3NTN A;  1GL2 C;  3L73 J;  2FY8 A;  4HH2 A;  1VQK P;  2OGU A;  4L75 A;  3CCQ P;  2E76 D;  2QM8 A;  3QH9 A;  1NTM K;  4H44 D;  5APW A;  1HUC A;  1SQB D;  3MIW A;  2FYU D;  1G1I A;  1NHL A;  2E74 C;  3S1K A;  2ZXX A;  3SFD C;  3D6Y A;  2ZVN B;  3BRV B;  2R3C A;  1K9M Q;  2WSC H;  1T6A A;  1E79 H;  2J59 M;  1L2P A;  3H1L E;  4GOE A;  1EZV E;  2FFD B;  1N86 A;  2Q6Q A;  4I2L C;  1CI6 B;  1NTK E;  1MV8 A;  1VQ4 P;  1AVO A;  4JYC A;  5AW5 B;  4ASW A;  1FDI A;  2JJL A;  4GIF A;  2K3R A;  1AA0 A;  1NAY A;  3MGN A;  1ZW0 A;  1NTZ G;  1ZR2 A;  3AEB C;  3O8Z A;  1YYC A;  1S2E A;  4WY4 D;  4HJG H;  1EXI A;  1JEK A;  2QJY B;  3CCR P;  3MD0 A;  1JOC A;  2WSC J;  3AED C;  2ITA A;  1S9K D;  1FZB A;  1OX3 A;  2KK7 A;  1VPC A;  1H0T A;  3HTK A;  3P32 A;  3Q5S A;  3VMY A;  4WB4 A;  3RL0 C;  2P7J A;  2G3A A;  4U7J A;  5AW0 B;  1FOS E;  2YIU B;  3B5N A;  1NOH A;  2I1J A;  2KLV A;  1M57 D;  2WPQ A;  1YIJ P;  1S3J A;  1K8A Q;  2K9J A;  5CCH D;  3H1H E;  3M91 A;  1SQX J;  1LNQ A;  4ZKU A;  3TSI A;  5EFW B;  1JY3 O;  1NH4 A;  1AJY A;  1SQQ G;  1OVV A;  1L0L D;  3Q3D A;  3FGA D;  4JYB A;  1LTT C;  4WY4 B;  1BE3 G;  3B71 A;  1GL2 D;  5AVV B;  1M1J A;  3RK3 C;  1PGQ A;  2WPV B;  3M0D A;  4OVN F;  1SQP G;  2KYV A;  3CCS P;  2BCC E;  1VQ7 P;  3AE7 C;  3V2Q A;  4BXL A;  1EC5 A;  2O1K A;  3CC4 P;  3ITK A;  2WIT A;  1GU5 A;  2E74 D;  3TNU A;  5AW1 B;  3H1K J;  1S4X A;  3L70 E;  1Q90 D;  1BGY G;  2JEE A;  1BSN A;  1AV1 A;  1M1J C;  1VDF A;  2C9N Y;  1VF5 D;  3M0D C;  2I8D A;  1J2J B;  1NKN A;  1PV3 A;  1X8Y A;  1DD3 A;  3FXE A;  1S72 P;  2Q9I A;  3KPE A;  3M9H A;  5BU8 B;  1BCC G;  2FYZ A;  2NPS A;  5KLV G;  3L75 D;  4ZKP A;  2UWJ E;  1URQ A;  3CWB E;  1FS0 E;  3SWK A;  3RBX A;  1IFJ A;  4AQR D;  3MP7 B;  5CBN A;  1LGH B;  3CPW O;  2WSF H;  2FKW B;  2J5U A;  3VTP C;  2KS1 A;  1DEB A;  2AEJ A;  3RL0 D;  1USD A;  3Q2Y A;  3CME P;  3HD7 A;  1JO5 A;  1ZOY C;  4EYY Q;  5AW3 B;  4Z1M H;  4WVZ A;  2QG4 A;  2NPS C;  4CPG A;  1NJI Q;  5GTH E;  2ZVO B;  1URQ C;  1H89 A;  1IFN A;  1LT1 A;  1NU1 G;  2M0B A;  2W27 A;  3HE5 A;  2PAJ A;  2WSF J;  2BCC J;  1FZC A;  3L74 J;  2JWD A;  1YBK A;  1NTZ D;  1VL2 A;  1KFM A;  1KZU B;  3MUD A;  1NTM J;  1OWA A;  4PV1 D;  1QL1 A;  2H8P D;  1KIL C;  3R4Y A;  3O6Q A;  2SPZ A;  3HD7 C;  3RK3 D;  4H13 B;  1GTW A;  3H1J E;  5DJU B;  1JY2 N;  1EDK A;  2C9L Y;  2YMY A;  1VQ8 P;  1X9V A;  5CJ4 A;  1M8O B;  1GZL A;  4N78 D;  3AEF C;  3KXD A;  3MUD C;  1SLQ A;  2R3S A;  1KYO E;  5H2F E;  1IO4 A;  1LT9 B;  5GTH H;  4Y28 J;  1XTC C;  1L0N K;  1SQQ D;  1VQ9 P;  2K1A A;  1FDO A;  3H1L G;  1BE3 D;  1X79 B;  1CI6 A;  2HPC B;  2RMZ A;  1PP9 J;  2G8Y A;  3CMA P;  3CXH E;  1NTK G;  3OA7 A;  3II6 A;  3A5T A;  3V6I A;  1SQP D;  1U7M A;  4K35 A;  2XNX A;  1DX7 A;  1N7L A;  3Q1M A;  3VOP A;  3TGU E;  3L71 G;  4H0L C;  1Y8A A;  2E75 B;  4RO0 A;  2QM7 A;  3G9R A;  1PPJ E;  2ZYA A;  4OWF A;  2W6J H;  1BGY D;  4ASV A;  3AE5 C;  1CSB A;  1JCC A;  3L73 E;  3UIA A;  2M3B A;  1SQV K;  2KLU A;  3RL0 g;  1KYO H;  1Q81 Q;  5H2F H;  3F5H A;  2QJY C;  5APY A;  4IFD K;  2IYO A;  1BCC D;  2IFN A;  3H1H G;  3HRN A;  5KLV D;  4BRY A;  1MZ9 A;  1KIL D;  1SFC D;  2ZT9 C;  1SQB K;  1JTH B;  2FYU K;  3CXH H;  1LWU B;  1JY3 P;  1RF0 A;  2AXT E;  1PFI A;  3PP5 A;  3WUT A;  1RE3 C;  3H25 A;  3VP9 A;  5TJH A;  3L37 A;  2QJP B;  3H1I G;  1FZF A;  3AEG C;  4QMA A;  1KQG B;  1KV4 A;  1NU1 D;  2WMM A;  1LP1 B; 
#chains in the Genus database with same CATH homology
 3V2P A;  4W7Y A;  1L4A C;  4AUW A;  3RK3 B;  3MD0 A;  4DOJ A;  1JOC A;  1N7S A;  1FJP A;  3P7K A;  1HBW A;  2GUV A;  1S9K D;  1FZB A;  3OAK A;  2WT7 B;  1QL2 A;  1VPC A;  1NU1 K;  3M0A A;  2YKP A;  3HTK A;  1WRG A;  1SFC B;  4GKG A;  3P32 A;  3NXS A;  2VRS A;  3VMY A;  4WB4 A;  3RL0 C;  1IC2 A;  2P7J A;  2Z4E A;  2CPB A;  5CCG D;  5AW0 B;  1LWU C;  1FOS E;  3B5N A;  4LC1 A;  2YNY A;  1NOH A;  2Q5U A;  2I1J A;  2HFE D;  2HYN A;  3I5C A;  1YTZ I;  2KLV A;  2WPQ A;  1IJD B;  1JCD A;  5KTB A;  2FFD C;  2XZR A;  3EFG A;  1KIL A;  1SFC A;  1IFI A;  4EOT A;  2ZFC A;  2A45 G;  5CCH D;  1M1J B;  2N1T D;  3M91 A;  1N7S C;  4ZKU A;  2NPS D;  3TSI A;  1OXZ A;  1RY3 A;  1G1J A;  1JY3 O;  1NH4 A;  1URQ D;  5AVR B;  1HJB A;  1FBM A;  2L5G B;  5AW2 B;  3VYI A;  4JYB A;  1LTT C;  4WY4 B;  1XTG B;  1SP4 A;  4C7N B;  3BAS A;  1FZE A;  1GL2 D;  1MFZ A;  2O1J A;  5AVV B;  1M1J A;  3EQ2 A;  1T2K D;  3RK3 C;  5APV A;  3TNU B;  1L0L K;  3P8M C;  4I1L A;  3M0D A;  3V4W A;  1LTS C;  2KYV A;  1YTZ T;  1GW4 A;  3L35 A;  3P8C D;  3V2Q A;  4LLH A;  1H88 A;  2O1K A;  3HD7 D;  1SFC C;  4KHX A;  4WY4 A;  2WIT A;  1KFN A;  1IK9 A;  1GU5 A;  1HGZ A;  4I6M C;  2POH A;  3MTU E;  4EIJ A;  1HVV A;  1NO4 A;  3TNU A;  5AW7 B;  4O9B A;  1J1D B;  1ZV8 A;  5AW1 B;  3HE4 B;  3M9Q A;  1HH0 A;  1CZQ A;  2Q3I A;  3RK2 D;  2JEE A;  1HTL C;  2XKM A;  1NTK K;  3CL3 D;  1M1J C;  2N1T B;  1VDF A;  2ZXE B;  1IFD A;  3G3Z A;  4M3L A;  1GW3 A;  1H8A A;  2XU6 A;  2C9N Y;  1G2C A;  2NPS B;  5CCG A;  3KDP B;  3M0D C;  2KSJ A;  3L36 A;  2KB7 P;  1GDT A;  3SWY A;  1J2J B;  2WPS A;  1EQ7 A;  1LTJ A;  1NKN A;  5AVU B;  4DZO A;  2Z5I A;  3M06 A;  1X8Y A;  4N78 E;  4XE5 B;  3GHG B;  4WY4 C;  3L4F A;  2Q9I A;  1RF0 C;  3KPE A;  3M9H A;  3B5N B;  5BU8 B;  5CCH A;  2FYZ A;  2N1T A;  2Z5H A;  5BU5 A;  2NPS A;  3BVH A;  4ZKP A;  1URQ A;  5AVW B;  3T97 A;  3U1C A;  1KIL B;  1J1E B;  1L4A D;  3SWF A;  1IFJ A;  3HD7 B;  2R32 A;  4AQR D;  3VP8 A;  3GHG A;  1GL2 A;  1LGH B;  2WSF H;  5CMZ A;  1LT9 A;  5CCG C;  5KJ7 C;  1HWT C;  4RES B;  4W7Z A;  4HYT B;  2FKW B;  3IFM A;  3VTP C;  5AVY B;  2HOD A;  1J1D C;  1W2E A;  2Q7C A;  1DEB A;  3RL0 D;  4IFF A;  3VMZ A;  2YKQ A;  1DH3 A;  3RK2 B;  3HD7 A;  1JO5 A;  1S9K E;  2WTY A;  5CCH C;  5AW3 B;  1GK4 A;  2N1T C;  3TK1 A;  2NPS C;  3CLQ A;  1SQX K;  1LTI C;  2YO2 A;  4C46 A;  2IPP A;  1URQ C;  5APQ A;  3A7O A;  1N73 B;  1H89 A;  3LW5 H;  1IFN A;  5APX A;  2W27 A;  4WBA A;  2N9B A;  4N6J A;  2E42 A;  3LIE A;  3GHG C;  3HE5 A;  3KYQ A;  2PAJ A;  1ZR4 A;  4W80 A;  2YO3 A;  3B5N C;  1LT9 C;  1N2D C;  1T2K C;  5AVT B;  1IFM A;  1FZC A;  2XV5 A;  1FDM A;  1KFM A;  2OYH A;  2OYI B;  1KZU B;  4AYC A;  3MUD A;  1OWA A;  1FZA A;  2R5B A;  1RE3 A;  1QL1 A;  1N73 A;  3V5B A;  2OAR A;  2W6B A;  1MUU A;  2H8P D;  1KIL C;  1J1E C;  3OJA B;  2I1K A;  3HD7 C;  3RK3 D;  3H32 A;  3M9B A;  1T3J A;  1FJK A;  1G2C B;  1GTW A;  1NTZ K;  3HUS A;  2IX7 C;  1SVF A;  1NKZ B;  2P67 A;  1LTJ B;  2A45 H;  2PP6 A;  5CJ0 A;  1FOS F;  3R2P A;  1JY2 N;  2IFM A;  2OYI A;  2C9L Y;  2YMY A;  5BVZ A;  4Y99 C;  3U1A A;  2P2U A;  1GU4 A;  1X9V A;  3VN0 A;  1L4A A;  3RK2 C;  5CJ4 A;  3NMD A;  2WPR A;  1GZL A;  4N78 D;  2WSE H;  1RF1 B;  3WMM 0;  1URQ B;  2OYH C;  5AW9 B;  1SLQ A;  2A45 I;  4IFM A;  3N7N A;  3VMX A;  1N73 C;  2WWW A;  1LTB C;  2KOG A;  4C7R A;  1IO4 A;  1GL2 B;  2E43 A;  2BAS A;  5AVZ B;  1JTH A;  1FAV A;  4B86 A;  2H7H A;  5AW4 B;  3B8E B;  1LT9 B;  3HUS C;  3V4Q A;  5AVQ B;  1XTC C;  1RF1 A;  1L0N K;  1WT6 A;  2HOD B;  1NAF A;  5AW6 B;  2OYI C;  5APU A;  5AW8 B;  1FU1 A;  1AQ5 A;  1X79 B;  3IR9 A;  3H6P A;  3V2N A;  1CI6 A;  2HPC B;  2XDJ A;  1Z56 A;  1JMM A;  3KQG A;  1SQQ K;  2C0X A;  1JY2 P;  2O01 H;  4LGD E;  1GD2 E;  3OA7 A;  3II6 A;  3A5T A;  4GT1 A;  3BRT B;  1NWQ A;  2GM4 A;  1LTJ C;  2XNX A;  4XA4 A;  4Y99 B;  2FXM A;  1DX7 A;  3A2A A;  1N7L A;  3HE5 B;  1T8Z A;  3VOP A;  2C0W A;  2HPC A;  1SQP K;  3C9I A;  5KJ7 D;  1FZC B;  5APS A;  1ZN5 A;  1A02 J;  1RF1 C;  1JY3 N;  5APT A;  2OYH B;  1CW5 A;  1FZG A;  3TYY A;  2WT7 A;  3NFQ A;  3BAT A;  2GUS A;  2QM7 A;  1T3U A;  2P1J A;  3H32 B;  3NTN A;  1N7S D;  3HUS B;  1JUN A;  1GL2 C;  1JNM A;  4HH2 A;  1CSB A;  1JCC A;  3UIA A;  1M7L A;  2M3B A;  1SQV K;  2J58 A;  1AFO A;  3A3Y B;  2WZ7 A;  5AVS B;  2QM8 A;  1RE4 A;  1LTA C;  5AVX B;  1L4A B;  2YKO A;  1NTM K;  3N4X A;  1GK6 A;  2KP8 A;  5APY A;  4IFD K;  5APW A;  3B5N D;  3U59 A;  3V2R A;  1HUC A;  3MIW A;  2IFN A;  3HRN A;  4N3Y B;  1G1I A;  1KQL A;  4JF7 A;  2W6A A;  1NHL A;  1HGV A;  1MZ9 A;  2R5D A;  1KIL D;  1SFC D;  3RL0 B;  1SQB K;  2HG5 D;  5CHX A;  1JTH B;  2FYU K;  4C7N A;  1LWU B;  1JY3 P;  3CI9 A;  1RF0 A;  3BRV B;  5KLV K;  2R3C A;  2WSC H;  1PFI A;  2HLO A;  1ZLL A;  3P8C E;  1FZC C;  1JY2 O;  2J59 M;  1E5W A;  3PP5 A;  2FFD B;  1N86 A;  2MJZ A;  1RE4 C;  3E1I A;  1RE3 C;  4I2L C;  1A02 F;  1CI6 B;  3VP9 A;  1MV8 A;  1N7S B;  4JYC A;  5AW5 B;  3L37 A;  2JJL A;  4GIF A;  1LWU A;  2CPS A;  2M8R A;  3MGN A;  1FZF A;  5KJ7 A;  1ZR2 A;  4OH8 B;  3O8Z A;  2H43 A;  3HTK B;  1YYC A;  3LID A;  2LKM A;  1LTG C;  3HE4 A;  2FFD A;  4WY4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...