1SQXK

Crystal structure analysis of bovine bc1 with stigmatellin a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
53
structure length
53
Chain Sequence
MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 14
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2004-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqxK00
1SQVK 1NTMK 1NU1K 1L0LK 1SQQK 2WSFH 3G3ZA 1SQBK 2LKMA 2J59M 3LW5H 3M9QA 2OARA 1SQPK 1NTZK 5KLVK 2O01H 2WSCH 2WSEH 1SQXK 1L0NK 2FYUK 3CLQA 1NTKK 4IFDK
chains in the Genus database with same CATH superfamily
1JCCA 3U59A 2Z4EA 3BCCD 1FAVA 1MFTA 4PD4H 1S5LH 1JMMA 1L0ND 5AW4B 1R5SA 1X9VA 2CPBA 3RL0g 1Q82Q 3M9HA 3A0BE 4PD4D 5B5EE 2R3SA 4EIJA 4IOIH 2N1TA 2QSIA 1N73A 3C8VA 4JYBA 1LT9B 1U7MA 4QMAA 2JP3A 3HTKB 3MIWA 3AEBC 3L71D 1S9KE 2JWAA 2H89C 2OARA 3AEDC 1HTLC 3L75E 2L91A 4TT3H 4WY4D 1YTZI 1LP1B 5KLVE 5KLIC 1IO4A 3T97A 4GDOA 1K73Q 3BCCG 4L76A 1L0NG 1NKNA 4GOFA 5APQA 1JCDA 2W6BA 3R4YA 4IFFA 3A0HH 2YMYA 2FXOA 1MKMA 4ZNCA 1K05A 1N86A 1NTKG 2FYNB 2Q3EA 1XTGB 2IYOA 1IFDA 2E75D 2XKMA 3BRTB 3HRNA 5H2FH 4A7PA 3A7OA 2BEQD 3S1KA 3UIAA 1OVVA 1RQUA 2UWJE 2Z5IA 1LT9C 3E7KA 4RKUJ 3TSIA 4AYCA 2BCCD 1M90Q 2HODB 1BDDA 2KZIA 5APWA 1ZOYC 3NXSA 1JMBA 3T97B 1G2CB 2KNCB 2E74C 3LIDA 4BRYA 3RGUA 3TNUB 1VQ5P 5AVZB 1K04A 5CJ4A 4PV1B 4H0LC 4IFMA 1N73B 3CWBE 1L0LD 1VL2A 2PFXA 2NRGA 3MP7B 2KNCA 1G2CA 1SQVE 1GL2B 1PGPA 2BEZF 1FE6A 1LTGC 3BCCJ 3HD7D 3JC22 3GW6A 4N78E 1X0TA 4DT0A 3MTUE 3V2PA 4ASVA 3Q5RA 3L70G 5CHXA 4EI2A 2QRXA 4D6TG 3CXHH 1GK6A 1NTKK 1W5CE 3H1HD 1IFPA 1NTKJ 4KJMA 1PP9D 2KIKA 4AUWA 1NU1E 3E1IA 3ITKA 1SQVJ 5KLVG 1JB0J 2D2CC 1SQVK 1JY3P 2P7JA 2QJKC 1OFCX 2FKWB 2KP8A 2FFDC 1S5LE 2D2CD 2W6AA 2NPSD 2NZ2A 2WSFH 2XNDH 1JY2O 4KT0J 1CI6B 4WVZA 2KUBA 5M1BA 1BE3D 1SQBK 1JM0A 1JTHA 2HLOA 2AEJA 2XDJA 2YO3A 1KQFB 2OTLP 3NTNA 3VMZA 4JYCA 3TF5A 1EXJA 2AEMA 4W80A 1BDCA 1SQPJ 3OW2O 3G4SP 1BGYG 3H1HE 1NO4A 2K37A 2NPSA 4JPZB 3O6QA 2CK3H 3P8CD 3PH0A 4PJ0E 1PL5A 2OTKE 3HTKA 3CX5D 1NTZE 5KLVK 2QIWA 2OYIB 1RF0A 4HJGH 1RE4A 1L4AA 2ZFCA 2W90A 2WSEH 4YXDC 1P84D 1YTZT 3TDKA 1FDOA 3CX5H 4W7YA 1A02J 1VQ8P 1EZVI 5KTBA 2WTYA 3KYQA 1DEEG 1PIXA 5KKZB 4C7NA 1W2BO 4MN4C 4D6TJ 5AVYB 1HBWA 1UIXA 2FYUD 1VQMP 1NOHA 1R5LA 2FYUE 3II6A 5AVVB 2FYZA 1RF0C 2M8RA 3L72G 1SQVG 1LTTC 1FJKA 2N1TD 3A3YB 3MUDC 1EDKA 5CCHA 3L72E 1H0TB 1GL2D 1L0LJ 1AQTA 5APUA 3Q5SA 1VQ6P 3JSVC 1VPCA 4HYTB 1FBMA 3CCJP 1N7SD 2B87B 3H1JE 1LWUC 2N9BA 3PJSK 3PLNA 3K5BA 3H1LE 5AW5B 2QM7A 2R5DA 1BGYJ 1E79H 1LTSC 2KZJA 3SFEC 4RJTA 3F5HA 1E5WA 1VQPP 1TU3F 3L35A 1BCCD 1ZR2A 3HE5B 3PHLA 3QWOC 4UB8E 1AJYA 2B89A 1GTWA 2JR8A 3JCUH 5BU5A 1ZV8A 1KD1Q 3RK3B 1OX3A 1NH4A 1YIJP 1VQKP 2OTJP 1SQXG 3ZDMA 3R2PA 3RK3C 2KB7P 2KK7A 3AE7C 3GHGA 3M06A 3GF7A 1L0NJ 5CCGC 1VQOP 3G3ZA 3L73E 1IJDB 3AE3C 3L74D 1HGVA 3G6EP 1RE3C 1MFZA 2NPSB 3CCUP 2G8YA 1H8AA 1RF1C 5KAFH 3TGUG 1CSBA 1ZMEC 4H0LB 1YI2P 3RK2D 1T3UA 2N9YB 2YIUC 3GG2A 2IFMA 3GHGB 4GKGA 1YJWP 2IX7C 2Y0CA 4LGDE 3V6IA 1VQ9P 2M0BA 3WU2H 1YYCA 1FZCA 1QL1A 2WPRA 4UB6H 1OW8A 4WWIA 1OVRA 1RE4C 2WSCJ 3E1RA 4RESB 1GK4A 2Q6QA 4I7ZB 1FOSE 3D6YA 2K88A 3FWNA 3N4XA 4L75A 1MV8A 3B5NC 3CCMP 2P58A 4I7ZC 4JF7A 1M1JB 4HB1A 2I1JA 2FFDA 2VRSA 2IBZE 2RN0A 3L36A 1IK7A 1NTME 3L73D 1ZP0C 3MZWB 1OMIA 5CCGD 1PPJE 2K1AA 1NTMG 2JO1A 1A02F 2W27A 5CBOA 2XNXA 2O01N 3I56P 4N6JA 1RH5B 1VDFA 2MKVA 1PV3A 2Y9YA 2LKMA 3LW5H 1YQ4C 3KXDA 1FZBA 1LWUA 3AEFC 1LTJC 1SQPK 5AVTB 3OAKA 3FXDA 5AW8B 4YPCA 3CC4P 3PTZA 2WT7A 2D2CB 2QJKB 3FWLA 1M57D 1KN7A 1BSNA 1PPJD 1SQBG 3U1CA 4UB8H 1L0NE 3CX5E 1RF1B 2WZ7A 1L2PA 2IBZD 5APYA 1NTMD 1XTCC 1YBKA 3L70J 3RK2C 3NFQA 2J58A 3PRJA 1VQ4P 1LT1A 4BXLA 2ZT9B 3G71P 2E76B 3H1KE 1L4AB 4H13B 3AE6C 1NTKD 3B8EB 1N7SA 1DH3A 1BE3E 2WITA 5KJ7D 1NTZG 2RH0A 3O8ZA 2M5AB 1FZEA 1LTJB 3MHVA 4L73A 4CPGA 3CMEP 2OYIA 2HFED 1FJPA 3A5TA 1LWUB 2Q5UA 3IN6A 2Y9ZA 2KXPB 1FOSF 3S4RA 2A06G 1JY2P 1KILE 1Z56A 5TISE 4IL6H 3RL0B 2ZYAA 3USSA 1SQPG 3B5ND 2A06E 3HE4A 2V4HA 4OGQB 1IFIA 2FYNC 1EDLA 1NTZJ 2E74B 3M9BA 4NPFX 1SQXJ 2PRRA 4PD4I 4DJGA 3Q1MA 3IAOA 1QGKB 1EZVD 1L0LE 3P8CE 1M1JA 1N2DC 2FYUK 1YQ3C 3LW5J 4I1LA 5BU8B 1S1CX 3SFDC 2E75B 4EDFA 5E79H 3V2NA 3ABVC 1KFNA 3M0DC 4K3AA 4NPDA 5AW9B 1HJBA 3H1LG 4PJ0H 3SWYA 3AE1C 1NJIQ 2OGUA 1NWQA 2OYHB 1DD4A 1KYOH 4W7ZA 1X8YA 1URQC 1NU1K 3EFGA 1QVGO 1M1JC 2BCCE 2WPVB 1NTKE 2ZXEB 3FXEA 4OH8B 3TK1A 1YHQP 1T6AA 2HG5D 1NGMB 1PZQA 3CXHI 2C0XA 3H1ID 3M0DA 2A45G 3O6QB 3RK3E 3RL0D 5AVUB 2J5UA 2K3RA 2Q3IA 3KPEA 3VMAA 2KLVA 3L74E 1X22A 5H2FE 2ZYDA 3RBXA 2YO2A 3V4QA 1Y8AA 5CMZA 2KYVA 5C39A 3V2RA 5CCHC 5TJHA 1P84H 3CI9A 2B87A 1UIIA 1KQLA 2POHA 3CWBD 4U7JA 1OWAA 2FYUG 2GUVA 1OXZA 3VN0A 5APSA 3CCRP 1LTAC 3RK2B 3F89A 4GODA 2Y0EA 2M5AA 1R8EA 1OIPA 1PGQA 1GDTA 2E76C 2GUSA 4PV1D 1BCCE 2M3EA 2ZT9D 1P84E 2ZXXA 3L70E 1Q81Q 1L0LK 5AVXB 2ZT9C 1NTZD 4XA4A 2OYOA 5B5EH 3A0BH 3BCCE 2KSJA 3B71A 4JBZA 3V5BA 1VF5D 4Y28J 1H88A 2Q9IA 3BVHA 1NAYA 3OA7A 4YTPC 5GTIH 1JY3N 1S3JA 1U57A 2B88A 2R5BA 1ZW0A 4IL6X 5AW6B 1PPJG 2O01J 3B5NB 1AA0A 2O01H 2WQYC 3G9RA 2JEEA 1GZLA 1SQXK 1FZFA 1IFJA 1NU1D 3H1KD 1PGJA 1D7MA 2SPZA 5CJ0A 3TYYA 5CCHD 1AV1A 3H1IJ 4NPEA 5B66E 1GL2A 1S4XA 3H1JD 3L74J 4ZKUA 1T2KD 1M8OB 1P84I 2E75C 2HR3A 5CBNA 2OYIC 3L70D 2YKPA 3CWBG 2AXTH 5AW7B 3CMAP 1HUCA 4AQRD 1KYOD 1SQBE 4DZOA 2WT7B 2WWWA 3B5NA 1RY3A 3JCUE 2QA4P 2FFDB 5KKZC 5KLVD 2A45I 2NPSC 4L74A 2E76D 3CCVP 1GW4A 3H1IG 1YJ9P 2GA1A 3VOPA 4H44B 1ZRTE 3H1KG 1L4AC 4H13C 1KFMA 1NTZK 1IFNA 2E5TA 1ZR4A 3L37A 1N8RQ 4C7RA 1M1KQ 2Y0DA 1HWTC 1JOCA 3KZIE 2B9BA 1T3JA 2WMMA 2YIUB 4LC1A 3KZIH 5EFWB 2QEXP 1DEBA 1QL2A 2O3JA 2W8ZA 1G1JA 1KB9D 1QLED 3AE8C 3FX0A 2DW3A 2V7QH 3H1JJ 1VQLP 2P1JA 2QG4A 1HF9A 1LTJA 1EXIA 4LLHA 1FC2C 3VP9A 2BASA 2XZRA 1Y9BA 4OGQD 1OW6A 1SQPE 2BCCJ 1HGZA 2E74D 2M3BA 3L71J 2R44A 3MD0A 2QJYB 3WUTA 5K5GB 1T2KC 2YKOA 1USDA 3L72D 1EDJA 4XE5B 3CC7P 1EDIA 2WPQA 2AXTE 1AQ5A 1AVYA 5KJ7C 4U3FE 1URQD 5AW2B 2WSFJ 4GT1A 2ZJSE 3GMAA 1FZAA 1SQQE 3CCQP 1Y47A 2LXCB 1ZN5A 1Q7YQ 1KZUB 3C1LA 3L71E 5B66H 4KHXA 3H1LJ 2QJPC 5GTHH 3L71G 2ZVOB 5AW3B 5AW0B 3AE2C 2CPSA 3HD7B 5AVWB 1BGYD 2Z5HA 3CL3D 1SS1A 4OWFA 5DJUB 3CCSP 4EOTA 1KILC 2A06D 5AVRB 3B4SA 3H6PA 4M3LA 2G3AA 2WVRA 2Q7CA 2JDIH 4R4MA 1KILD 1BE3G 3TGUJ 2KS1A 1MUUA 3M91A 4H0LD 2N1TC 3GHGC 1RE3A 3AEEC 3AEGC 4I6MC 4R4LA 2XU6A 3Q5PA 1U7JA 4UB6E 1KILA 3VTPC 1WT6A 3AECC 4WBAA 4WY4A 1IFMA 1KYOE 3WU2E 1W2EA 5APVA 2QJPB 3L75J 3CC2P 2WSSH 3IFMA 3NMDA 3A0HE 1S9KD 3N7NA 3H1LD 3CD6P 2ZVNB 1K9MQ 3HE4B 1HVVA 2ZYGA 5E79E 4IFDK 2KLUA 5GTHE 3L73J 2I8DA 1LTBC 3HD7A 3BATA 3P7KA 2L5GB 2I1KA 2K9JA 2PP6A 5APTA 1URQA 5KAIE 3D6ZA 1SQQD 5KLIB 4N78D 3OJAB 1FU1A 2LXBA 1LTIC 4OGQC 1SLQA 4BRYB 1SQVD 3H32A 4ZMDA 1KMIZ 3I5CA 3EFFK 3L75G 3CPWO 1NU1G 1J1EC 1VF5B 3P8MC 3FGAD 3AE9C 3H1JG 1GL2C 1OZHA 2H43A 1L4AD 4H13D 1S2EA 1BE3J 1WRGA 4WY4B 1PFIA 1M56D 2WPSA 1OW7A 4WB4A 2C0WA 5APXA 2BCCG 2O1KA 3W68A 2HPCA 2RKLA 3VYIA 1FZCB 4Y99C 1FZGA 2R3CA 2QJYC 3EQ2A 1SP4A 3SSUA 1IK9A 2ZAEB 1JY2N 2IBZI 2IZ1A 3CX5I 3KDPB 1LNQA 3PP5A 1RHZB 4ASWA 4OVNF 3GF3A 5KJ7A 2C9LY 1T8ZA 3SWFA 2FY8A 2J59M 2V7QJ 5DJTB 1URQB 4I2LC 4ZKPA 3MUDA 1NYHA 1RQVA 2P10A 2C9NY 3WMM0 3M9QA 3L74G 3TGUD 1JTHB 2IYPA 3QH9A 2MJZA 4GIFA 1LGHB 2AEFA 4RO0A 5KLVJ 2E42A 3P32A 1JO5A 1EQ7A 1J2JB 2JWDA 2KSEA 2KS1B 2WSCH 1ZLLA 3AE4C 3L4FA 1N7SC 1Q90D 1NHLA 1HH0A 2HPCB 2XV5A 2KOGA 4XFJA 1PGOA 2LR2A 1FDIA 1DD3A 4H44D 5TISH 1YJNP 1KILB 1GU4A 4TLFA 5KAIH 1SQXD 1KORA 2KI7B 1SFCC 4C7NB 4PD4E 1KB9I 3SWKA 1BCCG 1OVUA 1KQSO 2E43A 1GW3A 1K8AQ 2R32A 1CW5A 3H25A 1KYOI 3I55P 4Z1MH 5CCGA 2K9JB 3AE5C 2FBWC 2A45H 1AVOA 1KC8Q 2ITAA 2IPPA 1KTMA 1LJ2A 3S9OA 3Q2YA 1JUNA 1NVOA 3HD7C 3AEAC 1VQ7P 5AVSB 2H7HA 1Q86Q 2H88C 2AXCA 2PGDA 4C46A 1BSHA 3BRVB 1SQBD 3W67A 3D70A 4Y99B 3VMXA 1X79B 1BGYE 1EZVE 1PP9E 3A2AA 1EZVG 1SQXE 1ZXGA 4N3YB 3CLQA 2RMZA 3CXHE 2FXMA 1DIPA 2HYNA 3IF4A 4BWNA 3H1HJ 1J1EB 1VF5C 2JJLA 2W6JH 2YNYA 1KQGB 4DCKA 3V4WA 4EYYQ 1HJ0A 3L72J 1AFOA 1NTMK 3CWBJ 3VMYA 3WUVA 1N7LA 1SQQK 2YMKA 4U3FJ 1MZ9A 2FYUJ 3RBZA 1JEKA 1NKZB 3M0AA 1FDMA 3TGUE 2PAJA 4D6TE 3CCEP 2H8PD 3BASA 2HODA 1SQPD 2YXQB 3IR9A 1IZNB 1SFCB 2QVAA 4HH2A 3CXHD 3U1AA 4H44C 3WUUA 2N1TB 1KV4A 1JY3O 1KB9H 4B86A 5AW1B 1CI6A 1G1IA 1KB9E 4PV1C 3HUSA 3LIEA 3TNUA 1S72P 1NTMJ 1VQNP 1PP9J 4K35A 2WSEJ 2IBZG 1GMJA 3Q3DA 2OYHC 1SVFA 1N7SB 1YITP 1ZRTD 2JKVA 3HUSB 4D6TD 3RK3D 5KAFE 3H1HG 2P2UA 3H32B 1GU5A 2E5YA 3HUSC 2YXRB 4U3FD 2QM8A 1JNMA 3CCLP 1SFCA 2OYHA 1SQQG 2FXPA 1H89A 1IC2A 1PP9G 1L0LG 1WMKA 1LT9A 1NU1J 1Q2NA 2IFNA 2K9YA 1SQBJ 5BVZA 4U3FG 3KQGA 3L75D 1S5LX 3RL0C 3GLMA 1FZCC 1GD2E 2Q1KA 1M7LA 5AVQB 1LP1A 1QEXA 1QVFO 1SFCD 3V2QA 2IZ0A 1USEA 3MGNA 5L8RJ 2QE7H 3L73G 2W83C 3C9IA 4GOEA 3H1IE 4IL6E 4DOJA 2GM4A 2OQQA 4HKZH 3EWKA 1QX8A 1BCCJ 1SQQJ 4WY4C 2O1JA 4YXWH 1NAFA 1EC5A 2IDBA 1L0NK 4JQ0D 3D71A 2P67A 1FS0E 2YKQA 4O9BA 1H0TA 1CZQA 1J1DC 1DX7A 1N73C 3KHUA 3VP8A 3H1KJ 1RF1A 5GTIE 1J1DB 3HE5A
chains in the Genus database with same CATH topology
1JCCA 3U59A 2Z4EA 1FAVA 1JMMA 5AW4B 1X9VA 2CPBA 3M9HA 4EIJA 2N1TA 1N73A 4JYBA 1LT9B 3MIWA 3HTKB 1S9KE 4WY4D 2OARA 1HTLC 1YTZI 1IO4A 3T97A 1NKNA 5APQA 1JCDA 2W6BA 4IFFA 2YMYA 1N86A 2OYHB 1XTGB 3HRNA 1IFDA 3BRTB 2XKMA 3A7OA 3UIAA 4AYCA 2Z5IA 1LT9C 3TSIA 2HODB 5APWA 3NXSA 1G2CB 3LIDA 3TNUB 5AVZB 5CJ4A 4IFMA 1N73B 1G2CA 3HD7D 1GL2B 4WY4A 4AQRD 1LTGC 4N78E 3MTUE 3V2PA 5CHXA 1GK6A 1NTKK 4AUWA 3E1IA 1SQVK 1JY3P 2P7JA 2FKWB 2KP8A 2FFDC 2W6AA 2NPSD 2WSFH 1JY2O 2E42A 1CI6B 1SQBK 1JTHA 2HLOA 2XDJA 2YO3A 3NTNA 3VMZA 4JYCA 4W80A 2WTYA 1NO4A 2NPSA 3RK3D 2FFDA 3P8CD 3HTKA 5KLVK 2OYIB 1RF0A 1RE4A 1L4AA 2ZFCA 2WSEH 1YTZT 4W7YA 1A02J 5KTBA 3KYQA 4C7NA 5AVYB 1HBWA 1NOHA 3II6A 5AVVB 2FYZA 1RF0C 2M8RA 1LTTC 1FJKA 3A3YB 2N1TD 5CCHA 1GL2D 5APUA 4HYTB 1VPCA 1FBMA 1N7SD 1LWUC 2N9BA 5AW5B 2QM7A 2R5DA 1LTSC 1E5WA 3L35A 1ZR2A 3HE5B 1GTWA 5BU5A 1ZV8A 3RK3B 1NH4A 3R2PA 3RK3C 2KB7P 3GHGA 3M06A 5CCGC 3G3ZA 1IJDB 1HGVA 1RE3C 1MFZA 2NPSB 1H8AA 1RF1C 1CSBA 3RK2D 1T3UA 2IFMA 3GHGB 4GKGA 2IX7C 4LGDE 1FZCA 1YYCA 1QL1A 2WPRA 1RE4C 4RESB 1GK4A 1FOSE 3N4XA 1MV8A 3B5NC 4JF7A 1M1JB 2I1JA 2VRSA 3L36A 5CCGD 4IFDK 1A02F 2W27A 2XNXA 4N6JA 1VDFA 2LKMA 3LW5H 1FZBA 1LWUA 1LTJC 1SQPK 5AVTB 3OAKA 5AW8B 2WT7A 3U1CA 1RF1B 2WZ7A 5APYA 1XTCC 3RK2C 3NFQA 2J58A 1L4AB 3B8EB 1N7SA 1DH3A 5KJ7D 2WITA 3O8ZA 1FZEA 1LTJB 2OYIA 2HFED 1FJPA 3A5TA 1LWUB 2Q5UA 1FOSF 1JY2P 3RL0B 1Z56A 1FZCB 3B5ND 3HE4A 1IFIA 3M9BA 3P8CE 1M1JA 1N2DC 2FYUK 4I1LA 5BU8B 3V2NA 1KFNA 3M0DC 5AW9B 1HJBA 3SWYA 4W7ZA 1NU1K 1URQC 1X8YA 3EFGA 1M1JC 2ZXEB 4OH8B 3TK1A 2HG5D 2C0XA 3M0DA 2A45G 3RL0D 2FFDB 5AVUB 2Q3IA 1GDTA 3KPEA 2KLVA 2YO2A 3V4QA 5CMZA 5CCHC 2KYVA 3V2RA 3CI9A 1KQLA 2POHA 1OWAA 2GUVA 1OXZA 3VN0A 5APSA 1LTAC 3RK2B 2GUSA 1L0LK 5AVXB 4XA4A 2KSJA 3V5BA 1H88A 2Q9IA 3BVHA 3OA7A 1JY3N 2R5BA 5AW6B 3B5NB 2O01H 2JEEA 1GZLA 1SQXK 1FZFA 1IFJA 5CJ0A 3TYYA 5CCHD 1GL2A 4ZKUA 2OYIC 5AW7B 2YKPA 1HUCA 4DZOA 2WT7B 2WWWA 3B5NA 1RY3A 2A45I 2NPSC 1GW4A 3VOPA 1L4AC 1KFMA 1NTZK 1IFNA 1ZR4A 3L37A 4C7RA 1HWTC 1JOCA 1T3JA 4LC1A 1DEBA 1QL2A 1G1JA 2P1JA 1LTJA 4LLHA 3VP9A 2BASA 2XZRA 1T2KD 2M3BA 1HGZA 3MD0A 1T2KC 2YKOA 4XE5B 2WPQA 1AQ5A 5KJ7C 1URQD 5AW2B 4GT1A 1FZAA 1ZN5A 1KZUB 4KHXA 5AW3B 5AW0B 3HD7B 2CPSA 5AVWB 3CL3D 2Z5HA 4EOTA 1KILC 5AVRB 3H6PA 4M3LA 2Q7CA 1KILD 1MUUA 3M91A 2N1TC 3GHGC 1RE3A 4I6MC 2XU6A 1KILA 3VTPC 1WT6A 4WBAA 1IFMA 1W2EA 5APVA 3NMDA 3IFMA 1S9KD 3N7NA 3HE4B 1HVVA 1LTBC 3HD7A 3BATA 3P7KA 2L5GB 2I1KA 2PP6A 5APTA 1NWQA 1URQA 4N78D 3OJAB 1FU1A 1LTIC 1SLQA 3H32A 3I5CA 1J1EC 3P8MC 1GL2C 2H43A 1L4AD 4WY4B 1WRGA 4WB4A 2WPSA 5APXA 2C0WA 2O1KA 2HPCA 3VYIA 4Y99C 1FZGA 2R3CA 3EQ2A 1SP4A 1IK9A 1JY2N 3KDPB 3PP5A 5KJ7A 2C9LY 1T8ZA 3SWFA 2J59M 4ZKPA 2C9NY 1URQB 4I2LC 3MUDA 3WMM0 3M9QA 1JTHB 2MJZA 4GIFA 1LGHB 3P32A 1JO5A 1EQ7A 1J2JB 2WSCH 1ZLLA 3L4FA 1N7SC 1NHLA 1HH0A 2HPCB 2XV5A 2KOGA 1KILB 1GU4A 1SFCC 4C7NB 2E43A 1GW3A 2R32A 1CW5A 5CCGA 2A45H 2IPPA 1JUNA 3HD7C 5AVSB 2H7HA 4C46A 3BRVB 4Y99B 3VMXA 1X79B 3A2AA 4N3YB 3CLQA 2FXMA 2HYNA 1J1EB 2YNYA 2JJLA 3V4WA 1AFOA 1NTMK 3VMYA 1N7LA 1SQQK 1MZ9A 1NKZB 3M0AA 1FDMA 2PAJA 2H8PD 3BASA 2HODA 3IR9A 1SFCB 4HH2A 3U1AA 2N1TB 1JY3O 4B86A 5AW1B 1CI6A 1G1IA 3HUSA 3LIEA 3TNUA 2OYHC 1SVFA 1N7SB 3HUSB 2P2UA 3H32B 1GU5A 3HUSC 1JNMA 2QM8A 1SFCA 2OYHA 1PFIA 1H89A 1IC2A 1LT9A 2IFNA 5BVZA 3KQGA 1GD2E 3RL0C 1FZCC 5AVQB 1M7LA 1SFCD 3V2QA 3MGNA 3C9IA 4DOJA 2GM4A 4WY4C 2O1JA 1NAFA 1L0NK 2P67A 2YKQA 4O9BA 1CZQA 1J1DC 1DX7A 1N73C 3VP8A 1RF1A 1J1DB 3HE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV K;  1NTM K;  1NU1 K;  1L0L K;  1SQQ K;  2WSF H;  3G3Z A;  1SQB K;  2LKM A;  2J59 M;  3LW5 H;  3M9Q A;  2OAR A;  1SQP K;  1NTZ K;  5KLV K;  2O01 H;  2WSC H;  2WSE H;  1SQX K;  1L0N K;  2FYU K;  3CLQ A;  1NTK K;  4IFD K; 
#chains in the Genus database with same CATH topology
 1JCC A;  3U59 A;  2Z4E A;  3BCC D;  1FAV A;  1MFT A;  4PD4 H;  1S5L H;  1JMM A;  1L0N D;  5AW4 B;  1R5S A;  1X9V A;  2CPB A;  3RL0 g;  1Q82 Q;  3M9H A;  3A0B E;  4PD4 D;  5B5E E;  2R3S A;  4EIJ A;  4IOI H;  2N1T A;  2QSI A;  1N73 A;  3C8V A;  4JYB A;  1LT9 B;  1U7M A;  4QMA A;  2JP3 A;  3HTK B;  3MIW A;  3AEB C;  3L71 D;  1S9K E;  2JWA A;  2H89 C;  2OAR A;  3AED C;  1HTL C;  3L75 E;  2L91 A;  4TT3 H;  4WY4 D;  1YTZ I;  1LP1 B;  5KLV E;  5KLI C;  1IO4 A;  3T97 A;  4GDO A;  1K73 Q;  3BCC G;  4L76 A;  1L0N G;  1NKN A;  4GOF A;  5APQ A;  1JCD A;  2W6B A;  3R4Y A;  4IFF A;  3A0H H;  2YMY A;  2FXO A;  1MKM A;  4ZNC A;  1K05 A;  1N86 A;  1NTK G;  2FYN B;  2Q3E A;  1XTG B;  2IYO A;  1IFD A;  2E75 D;  2XKM A;  3BRT B;  3HRN A;  5H2F H;  4A7P A;  3A7O A;  2BEQ D;  3S1K A;  3UIA A;  1OVV A;  1RQU A;  2UWJ E;  2Z5I A;  1LT9 C;  3E7K A;  4RKU J;  3TSI A;  4AYC A;  2BCC D;  1M90 Q;  2HOD B;  1BDD A;  2KZI A;  5APW A;  1ZOY C;  3NXS A;  1JMB A;  3T97 B;  1G2C B;  2KNC B;  2E74 C;  3LID A;  4BRY A;  3RGU A;  3TNU B;  1VQ5 P;  5AVZ B;  1K04 A;  5CJ4 A;  4PV1 B;  4H0L C;  4IFM A;  1N73 B;  3CWB E;  1L0L D;  1VL2 A;  2PFX A;  2NRG A;  3MP7 B;  2KNC A;  1G2C A;  1SQV E;  1GL2 B;  1PGP A;  2BEZ F;  1FE6 A;  1LTG C;  3BCC J;  3HD7 D;  3JC2 2;  3GW6 A;  4N78 E;  1X0T A;  4DT0 A;  3MTU E;  3V2P A;  4ASV A;  3Q5R A;  3L70 G;  5CHX A;  4EI2 A;  2QRX A;  4D6T G;  3CXH H;  1GK6 A;  1NTK K;  1W5C E;  3H1H D;  1IFP A;  1NTK J;  4KJM A;  1PP9 D;  2KIK A;  4AUW A;  1NU1 E;  3E1I A;  3ITK A;  1SQV J;  5KLV G;  1JB0 J;  2D2C C;  1SQV K;  1JY3 P;  2P7J A;  2QJK C;  1OFC X;  2FKW B;  2KP8 A;  2FFD C;  1S5L E;  2D2C D;  2W6A A;  2NPS D;  2NZ2 A;  2WSF H;  2XND H;  1JY2 O;  4KT0 J;  1CI6 B;  4WVZ A;  2KUB A;  5M1B A;  1BE3 D;  1SQB K;  1JM0 A;  1JTH A;  2HLO A;  2AEJ A;  2XDJ A;  2YO3 A;  1KQF B;  2OTL P;  3NTN A;  3VMZ A;  4JYC A;  3TF5 A;  1EXJ A;  2AEM A;  4W80 A;  1BDC A;  1SQP J;  3OW2 O;  3G4S P;  1BGY G;  3H1H E;  1NO4 A;  2K37 A;  2NPS A;  4JPZ B;  3O6Q A;  2CK3 H;  3P8C D;  3PH0 A;  4PJ0 E;  1PL5 A;  2OTK E;  3HTK A;  3CX5 D;  1NTZ E;  5KLV K;  2QIW A;  2OYI B;  1RF0 A;  4HJG H;  1RE4 A;  1L4A A;  2ZFC A;  2W90 A;  2WSE H;  4YXD C;  1P84 D;  1YTZ T;  3TDK A;  1FDO A;  3CX5 H;  4W7Y A;  1A02 J;  1VQ8 P;  1EZV I;  5KTB A;  2WTY A;  3KYQ A;  1DEE G;  1PIX A;  5KKZ B;  4C7N A;  1W2B O;  4MN4 C;  4D6T J;  5AVY B;  1HBW A;  1UIX A;  2FYU D;  1VQM P;  1NOH A;  1R5L A;  2FYU E;  3II6 A;  5AVV B;  2FYZ A;  1RF0 C;  2M8R A;  3L72 G;  1SQV G;  1LTT C;  1FJK A;  2N1T D;  3A3Y B;  3MUD C;  1EDK A;  5CCH A;  3L72 E;  1H0T B;  1GL2 D;  1L0L J;  1AQT A;  5APU A;  3Q5S A;  1VQ6 P;  3JSV C;  1VPC A;  4HYT B;  1FBM A;  3CCJ P;  1N7S D;  2B87 B;  3H1J E;  1LWU C;  2N9B A;  3PJS K;  3PLN A;  3K5B A;  3H1L E;  5AW5 B;  2QM7 A;  2R5D A;  1BGY J;  1E79 H;  1LTS C;  2KZJ A;  3SFE C;  4RJT A;  3F5H A;  1E5W A;  1VQP P;  1TU3 F;  3L35 A;  1BCC D;  1ZR2 A;  3HE5 B;  3PHL A;  3QWO C;  4UB8 E;  1AJY A;  2B89 A;  1GTW A;  2JR8 A;  3JCU H;  5BU5 A;  1ZV8 A;  1KD1 Q;  3RK3 B;  1OX3 A;  1NH4 A;  1YIJ P;  1VQK P;  2OTJ P;  1SQX G;  3ZDM A;  3R2P A;  3RK3 C;  2KB7 P;  2KK7 A;  3AE7 C;  3GHG A;  3M06 A;  3GF7 A;  1L0N J;  5CCG C;  1VQO P;  3G3Z A;  3L73 E;  1IJD B;  3AE3 C;  3L74 D;  1HGV A;  3G6E P;  1RE3 C;  1MFZ A;  2NPS B;  3CCU P;  2G8Y A;  1H8A A;  1RF1 C;  5KAF H;  3TGU G;  1CSB A;  1ZME C;  4H0L B;  1YI2 P;  3RK2 D;  1T3U A;  2N9Y B;  2YIU C;  3GG2 A;  2IFM A;  3GHG B;  4GKG A;  1YJW P;  2IX7 C;  2Y0C A;  4LGD E;  3V6I A;  1VQ9 P;  2M0B A;  3WU2 H;  1YYC A;  1FZC A;  1QL1 A;  2WPR A;  4UB6 H;  1OW8 A;  4WWI A;  1OVR A;  1RE4 C;  2WSC J;  3E1R A;  4RES B;  1GK4 A;  2Q6Q A;  4I7Z B;  1FOS E;  3D6Y A;  2K88 A;  3FWN A;  3N4X A;  4L75 A;  1MV8 A;  3B5N C;  3CCM P;  2P58 A;  4I7Z C;  4JF7 A;  1M1J B;  4HB1 A;  2I1J A;  2FFD A;  2VRS A;  2IBZ E;  2RN0 A;  3L36 A;  1IK7 A;  1NTM E;  3L73 D;  1ZP0 C;  3MZW B;  1OMI A;  5CCG D;  1PPJ E;  2K1A A;  1NTM G;  2JO1 A;  1A02 F;  2W27 A;  5CBO A;  2XNX A;  2O01 N;  3I56 P;  4N6J A;  1RH5 B;  1VDF A;  2MKV A;  1PV3 A;  2Y9Y A;  2LKM A;  3LW5 H;  1YQ4 C;  3KXD A;  1FZB A;  1LWU A;  3AEF C;  1LTJ C;  1SQP K;  5AVT B;  3OAK A;  3FXD A;  5AW8 B;  4YPC A;  3CC4 P;  3PTZ A;  2WT7 A;  2D2C B;  2QJK B;  3FWL A;  1M57 D;  1KN7 A;  1BSN A;  1PPJ D;  1SQB G;  3U1C A;  4UB8 H;  1L0N E;  3CX5 E;  1RF1 B;  2WZ7 A;  1L2P A;  2IBZ D;  5APY A;  1NTM D;  1XTC C;  1YBK A;  3L70 J;  3RK2 C;  3NFQ A;  2J58 A;  3PRJ A;  1VQ4 P;  1LT1 A;  4BXL A;  2ZT9 B;  3G71 P;  2E76 B;  3H1K E;  1L4A B;  4H13 B;  3AE6 C;  1NTK D;  3B8E B;  1N7S A;  1DH3 A;  1BE3 E;  2WIT A;  5KJ7 D;  1NTZ G;  2RH0 A;  3O8Z A;  2M5A B;  1FZE A;  1LTJ B;  3MHV A;  4L73 A;  4CPG A;  3CME P;  2OYI A;  2HFE D;  1FJP A;  3A5T A;  1LWU B;  2Q5U A;  3IN6 A;  2Y9Z A;  2KXP B;  1FOS F;  3S4R A;  2A06 G;  1JY2 P;  1KIL E;  1Z56 A;  5TIS E;  4IL6 H;  3RL0 B;  2ZYA A;  3USS A;  1SQP G;  3B5N D;  2A06 E;  3HE4 A;  2V4H A;  4OGQ B;  1IFI A;  2FYN C;  1EDL A;  1NTZ J;  2E74 B;  3M9B A;  4NPF X;  1SQX J;  2PRR A;  4PD4 I;  4DJG A;  3Q1M A;  3IAO A;  1QGK B;  1EZV D;  1L0L E;  3P8C E;  1M1J A;  1N2D C;  2FYU K;  1YQ3 C;  3LW5 J;  4I1L A;  5BU8 B;  1S1C X;  3SFD C;  2E75 B;  4EDF A;  5E79 H;  3V2N A;  3ABV C;  1KFN A;  3M0D C;  4K3A A;  4NPD A;  5AW9 B;  1HJB A;  3H1L G;  4PJ0 H;  3SWY A;  3AE1 C;  1NJI Q;  2OGU A;  1NWQ A;  2OYH B;  1DD4 A;  1KYO H;  4W7Z A;  1X8Y A;  1URQ C;  1NU1 K;  3EFG A;  1QVG O;  1M1J C;  2BCC E;  2WPV B;  1NTK E;  2ZXE B;  3FXE A;  4OH8 B;  3TK1 A;  1YHQ P;  1T6A A;  2HG5 D;  1NGM B;  1PZQ A;  3CXH I;  2C0X A;  3H1I D;  3M0D A;  2A45 G;  3O6Q B;  3RK3 E;  3RL0 D;  5AVU B;  2J5U A;  2K3R A;  2Q3I A;  3KPE A;  3VMA A;  2KLV A;  3L74 E;  1X22 A;  5H2F E;  2ZYD A;  3RBX A;  2YO2 A;  3V4Q A;  1Y8A A;  5CMZ A;  2KYV A;  5C39 A;  3V2R A;  5CCH C;  5TJH A;  1P84 H;  3CI9 A;  2B87 A;  1UII A;  1KQL A;  2POH A;  3CWB D;  4U7J A;  1OWA A;  2FYU G;  2GUV A;  1OXZ A;  3VN0 A;  5APS A;  3CCR P;  1LTA C;  3RK2 B;  3F89 A;  4GOD A;  2Y0E A;  2M5A A;  1R8E A;  1OIP A;  1PGQ A;  1GDT A;  2E76 C;  2GUS A;  4PV1 D;  1BCC E;  2M3E A;  2ZT9 D;  1P84 E;  2ZXX A;  3L70 E;  1Q81 Q;  1L0L K;  5AVX B;  2ZT9 C;  1NTZ D;  4XA4 A;  2OYO A;  5B5E H;  3A0B H;  3BCC E;  2KSJ A;  3B71 A;  4JBZ A;  3V5B A;  1VF5 D;  4Y28 J;  1H88 A;  2Q9I A;  3BVH A;  1NAY A;  3OA7 A;  4YTP C;  5GTI H;  1JY3 N;  1S3J A;  1U57 A;  2B88 A;  2R5B A;  1ZW0 A;  4IL6 X;  5AW6 B;  1PPJ G;  2O01 J;  3B5N B;  1AA0 A;  2O01 H;  2WQY C;  3G9R A;  2JEE A;  1GZL A;  1SQX K;  1FZF A;  1IFJ A;  1NU1 D;  3H1K D;  1PGJ A;  1D7M A;  2SPZ A;  5CJ0 A;  3TYY A;  5CCH D;  1AV1 A;  3H1I J;  4NPE A;  5B66 E;  1GL2 A;  1S4X A;  3H1J D;  3L74 J;  4ZKU A;  1T2K D;  1M8O B;  1P84 I;  2E75 C;  2HR3 A;  5CBN A;  2OYI C;  3L70 D;  2YKP A;  3CWB G;  2AXT H;  5AW7 B;  3CMA P;  1HUC A;  4AQR D;  1KYO D;  1SQB E;  4DZO A;  2WT7 B;  2WWW A;  3B5N A;  1RY3 A;  3JCU E;  2QA4 P;  2FFD B;  5KKZ C;  5KLV D;  2A45 I;  2NPS C;  4L74 A;  2E76 D;  3CCV P;  1GW4 A;  3H1I G;  1YJ9 P;  2GA1 A;  3VOP A;  4H44 B;  1ZRT E;  3H1K G;  1L4A C;  4H13 C;  1KFM A;  1NTZ K;  1IFN A;  2E5T A;  1ZR4 A;  3L37 A;  1N8R Q;  4C7R A;  1M1K Q;  2Y0D A;  1HWT C;  1JOC A;  3KZI E;  2B9B A;  1T3J A;  2WMM A;  2YIU B;  4LC1 A;  3KZI H;  5EFW B;  2QEX P;  1DEB A;  1QL2 A;  2O3J A;  2W8Z A;  1G1J A;  1KB9 D;  1QLE D;  3AE8 C;  3FX0 A;  2DW3 A;  2V7Q H;  3H1J J;  1VQL P;  2P1J A;  2QG4 A;  1HF9 A;  1LTJ A;  1EXI A;  4LLH A;  1FC2 C;  3VP9 A;  2BAS A;  2XZR A;  1Y9B A;  4OGQ D;  1OW6 A;  1SQP E;  2BCC J;  1HGZ A;  2E74 D;  2M3B A;  3L71 J;  2R44 A;  3MD0 A;  2QJY B;  3WUT A;  5K5G B;  1T2K C;  2YKO A;  1USD A;  3L72 D;  1EDJ A;  4XE5 B;  3CC7 P;  1EDI A;  2WPQ A;  2AXT E;  1AQ5 A;  1AVY A;  5KJ7 C;  4U3F E;  1URQ D;  5AW2 B;  2WSF J;  4GT1 A;  2ZJS E;  3GMA A;  1FZA A;  1SQQ E;  3CCQ P;  1Y47 A;  2LXC B;  1ZN5 A;  1Q7Y Q;  1KZU B;  3C1L A;  3L71 E;  5B66 H;  4KHX A;  3H1L J;  2QJP C;  5GTH H;  3L71 G;  2ZVO B;  5AW3 B;  5AW0 B;  3AE2 C;  2CPS A;  3HD7 B;  5AVW B;  1BGY D;  2Z5H A;  3CL3 D;  1SS1 A;  4OWF A;  5DJU B;  3CCS P;  4EOT A;  1KIL C;  2A06 D;  5AVR B;  3B4S A;  3H6P A;  4M3L A;  2G3A A;  2WVR A;  2Q7C A;  2JDI H;  4R4M A;  1KIL D;  1BE3 G;  3TGU J;  2KS1 A;  1MUU A;  3M91 A;  4H0L D;  2N1T C;  3GHG C;  1RE3 A;  3AEE C;  3AEG C;  4I6M C;  4R4L A;  2XU6 A;  3Q5P A;  1U7J A;  4UB6 E;  1KIL A;  3VTP C;  1WT6 A;  3AEC C;  4WBA A;  4WY4 A;  1IFM A;  1KYO E;  3WU2 E;  1W2E A;  5APV A;  2QJP B;  3L75 J;  3CC2 P;  2WSS H;  3IFM A;  3NMD A;  3A0H E;  1S9K D;  3N7N A;  3H1L D;  3CD6 P;  2ZVN B;  1K9M Q;  3HE4 B;  1HVV A;  2ZYG A;  5E79 E;  4IFD K;  2KLU A;  5GTH E;  3L73 J;  2I8D A;  1LTB C;  3HD7 A;  3BAT A;  3P7K A;  2L5G B;  2I1K A;  2K9J A;  2PP6 A;  5APT A;  1URQ A;  5KAI E;  3D6Z A;  1SQQ D;  5KLI B;  4N78 D;  3OJA B;  1FU1 A;  2LXB A;  1LTI C;  4OGQ C;  1SLQ A;  4BRY B;  1SQV D;  3H32 A;  4ZMD A;  1KMI Z;  3I5C A;  3EFF K;  3L75 G;  3CPW O;  1NU1 G;  1J1E C;  1VF5 B;  3P8M C;  3FGA D;  3AE9 C;  3H1J G;  1GL2 C;  1OZH A;  2H43 A;  1L4A D;  4H13 D;  1S2E A;  1BE3 J;  1WRG A;  4WY4 B;  1PFI A;  1M56 D;  2WPS A;  1OW7 A;  4WB4 A;  2C0W A;  5APX A;  2BCC G;  2O1K A;  3W68 A;  2HPC A;  2RKL A;  3VYI A;  1FZC B;  4Y99 C;  1FZG A;  2R3C A;  2QJY C;  3EQ2 A;  1SP4 A;  3SSU A;  1IK9 A;  2ZAE B;  1JY2 N;  2IBZ I;  2IZ1 A;  3CX5 I;  3KDP B;  1LNQ A;  3PP5 A;  1RHZ B;  4ASW A;  4OVN F;  3GF3 A;  5KJ7 A;  2C9L Y;  1T8Z A;  3SWF A;  2FY8 A;  2J59 M;  2V7Q J;  5DJT B;  1URQ B;  4I2L C;  4ZKP A;  3MUD A;  1NYH A;  1RQV A;  2P10 A;  2C9N Y;  3WMM 0;  3M9Q A;  3L74 G;  3TGU D;  1JTH B;  2IYP A;  3QH9 A;  2MJZ A;  4GIF A;  1LGH B;  2AEF A;  4RO0 A;  5KLV J;  2E42 A;  3P32 A;  1JO5 A;  1EQ7 A;  1J2J B;  2JWD A;  2KSE A;  2KS1 B;  2WSC H;  1ZLL A;  3AE4 C;  3L4F A;  1N7S C;  1Q90 D;  1NHL A;  1HH0 A;  2HPC B;  2XV5 A;  2KOG A;  4XFJ A;  1PGO A;  2LR2 A;  1FDI A;  1DD3 A;  4H44 D;  5TIS H;  1YJN P;  1KIL B;  1GU4 A;  4TLF A;  5KAI H;  1SQX D;  1KOR A;  2KI7 B;  1SFC C;  4C7N B;  4PD4 E;  1KB9 I;  3SWK A;  1BCC G;  1OVU A;  1KQS O;  2E43 A;  1GW3 A;  1K8A Q;  2R32 A;  1CW5 A;  3H25 A;  1KYO I;  3I55 P;  4Z1M H;  5CCG A;  2K9J B;  3AE5 C;  2FBW C;  2A45 H;  1AVO A;  1KC8 Q;  2ITA A;  2IPP A;  1KTM A;  1LJ2 A;  3S9O A;  3Q2Y A;  1JUN A;  1NVO A;  3HD7 C;  3AEA C;  1VQ7 P;  5AVS B;  2H7H A;  1Q86 Q;  2H88 C;  2AXC A;  2PGD A;  4C46 A;  1BSH A;  3BRV B;  1SQB D;  3W67 A;  3D70 A;  4Y99 B;  3VMX A;  1X79 B;  1BGY E;  1EZV E;  1PP9 E;  3A2A A;  1EZV G;  1SQX E;  1ZXG A;  4N3Y B;  3CLQ A;  2RMZ A;  3CXH E;  2FXM A;  1DIP A;  2HYN A;  3IF4 A;  4BWN A;  3H1H J;  1J1E B;  1VF5 C;  2JJL A;  2W6J H;  2YNY A;  1KQG B;  4DCK A;  3V4W A;  4EYY Q;  1HJ0 A;  3L72 J;  1AFO A;  1NTM K;  3CWB J;  3VMY A;  3WUV A;  1N7L A;  1SQQ K;  2YMK A;  4U3F J;  1MZ9 A;  2FYU J;  3RBZ A;  1JEK A;  1NKZ B;  3M0A A;  1FDM A;  3TGU E;  2PAJ A;  4D6T E;  3CCE P;  2H8P D;  3BAS A;  2HOD A;  1SQP D;  2YXQ B;  3IR9 A;  1IZN B;  1SFC B;  2QVA A;  4HH2 A;  3CXH D;  3U1A A;  4H44 C;  3WUU A;  2N1T B;  1KV4 A;  1JY3 O;  1KB9 H;  4B86 A;  5AW1 B;  1CI6 A;  1G1I A;  1KB9 E;  4PV1 C;  3HUS A;  3LIE A;  3TNU A;  1S72 P;  1NTM J;  1VQN P;  1PP9 J;  4K35 A;  2WSE J;  2IBZ G;  1GMJ A;  3Q3D A;  2OYH C;  1SVF A;  1N7S B;  1YIT P;  1ZRT D;  2JKV A;  3HUS B;  4D6T D;  3RK3 D;  5KAF E;  3H1H G;  2P2U A;  3H32 B;  1GU5 A;  2E5Y A;  3HUS C;  2YXR B;  4U3F D;  2QM8 A;  1JNM A;  3CCL P;  1SFC A;  2OYH A;  1SQQ G;  2FXP A;  1H89 A;  1IC2 A;  1PP9 G;  1L0L G;  1WMK A;  1LT9 A;  1NU1 J;  1Q2N A;  2IFN A;  2K9Y A;  1SQB J;  5BVZ A;  4U3F G;  3KQG A;  3L75 D;  1S5L X;  3RL0 C;  3GLM A;  1FZC C;  1GD2 E;  2Q1K A;  1M7L A;  5AVQ B;  1LP1 A;  1QEX A;  1QVF O;  1SFC D;  3V2Q A;  2IZ0 A;  1USE A;  3MGN A;  5L8R J;  2QE7 H;  3L73 G;  2W83 C;  3C9I A;  4GOE A;  3H1I E;  4IL6 E;  4DOJ A;  2GM4 A;  2OQQ A;  4HKZ H;  3EWK A;  1QX8 A;  1BCC J;  1SQQ J;  4WY4 C;  2O1J A;  4YXW H;  1NAF A;  1EC5 A;  2IDB A;  1L0N K;  4JQ0 D;  3D71 A;  2P67 A;  1FS0 E;  2YKQ A;  4O9B A;  1H0T A;  1CZQ A;  1J1D C;  1DX7 A;  1N73 C;  3KHU A;  3VP8 A;  3H1K J;  1RF1 A;  5GTI E;  1J1D B;  3HE5 A; 
#chains in the Genus database with same CATH homology
 1JCC A;  3U59 A;  2Z4E A;  1FAV A;  1JMM A;  5AW4 B;  1X9V A;  2CPB A;  3M9H A;  4EIJ A;  2N1T A;  1N73 A;  4JYB A;  1LT9 B;  3MIW A;  3HTK B;  1S9K E;  4WY4 D;  2OAR A;  1HTL C;  1YTZ I;  1IO4 A;  3T97 A;  1NKN A;  5APQ A;  1JCD A;  2W6B A;  4IFF A;  2YMY A;  1N86 A;  2OYH B;  1XTG B;  3HRN A;  1IFD A;  3BRT B;  2XKM A;  3A7O A;  3UIA A;  4AYC A;  2Z5I A;  1LT9 C;  3TSI A;  2HOD B;  5APW A;  3NXS A;  1G2C B;  3LID A;  3TNU B;  5AVZ B;  5CJ4 A;  4IFM A;  1N73 B;  1G2C A;  3HD7 D;  1GL2 B;  4WY4 A;  4AQR D;  1LTG C;  4N78 E;  3MTU E;  3V2P A;  5CHX A;  1GK6 A;  1NTK K;  4AUW A;  3E1I A;  1SQV K;  1JY3 P;  2P7J A;  2FKW B;  2KP8 A;  2FFD C;  2W6A A;  2NPS D;  2WSF H;  1JY2 O;  2E42 A;  1CI6 B;  1SQB K;  1JTH A;  2HLO A;  2XDJ A;  2YO3 A;  3NTN A;  3VMZ A;  4JYC A;  4W80 A;  2WTY A;  1NO4 A;  2NPS A;  3RK3 D;  2FFD A;  3P8C D;  3HTK A;  5KLV K;  2OYI B;  1RF0 A;  1RE4 A;  1L4A A;  2ZFC A;  2WSE H;  1YTZ T;  4W7Y A;  1A02 J;  5KTB A;  3KYQ A;  4C7N A;  5AVY B;  1HBW A;  1NOH A;  3II6 A;  5AVV B;  2FYZ A;  1RF0 C;  2M8R A;  1LTT C;  1FJK A;  3A3Y B;  2N1T D;  5CCH A;  1GL2 D;  5APU A;  4HYT B;  1VPC A;  1FBM A;  1N7S D;  1LWU C;  2N9B A;  5AW5 B;  2QM7 A;  2R5D A;  1LTS C;  1E5W A;  3L35 A;  1ZR2 A;  3HE5 B;  1GTW A;  5BU5 A;  1ZV8 A;  3RK3 B;  1NH4 A;  3R2P A;  3RK3 C;  2KB7 P;  3GHG A;  3M06 A;  5CCG C;  3G3Z A;  1IJD B;  1HGV A;  1RE3 C;  1MFZ A;  2NPS B;  1H8A A;  1RF1 C;  1CSB A;  3RK2 D;  1T3U A;  2IFM A;  3GHG B;  4GKG A;  2IX7 C;  4LGD E;  1FZC A;  1YYC A;  1QL1 A;  2WPR A;  1RE4 C;  4RES B;  1GK4 A;  1FOS E;  3N4X A;  1MV8 A;  3B5N C;  4JF7 A;  1M1J B;  2I1J A;  2VRS A;  3L36 A;  5CCG D;  4IFD K;  1A02 F;  2W27 A;  2XNX A;  4N6J A;  1VDF A;  2LKM A;  3LW5 H;  1FZB A;  1LWU A;  1LTJ C;  1SQP K;  5AVT B;  3OAK A;  5AW8 B;  2WT7 A;  3U1C A;  1RF1 B;  2WZ7 A;  5APY A;  1XTC C;  3RK2 C;  3NFQ A;  2J58 A;  1L4A B;  3B8E B;  1N7S A;  1DH3 A;  5KJ7 D;  2WIT A;  3O8Z A;  1FZE A;  1LTJ B;  2OYI A;  2HFE D;  1FJP A;  3A5T A;  1LWU B;  2Q5U A;  1FOS F;  1JY2 P;  3RL0 B;  1Z56 A;  1FZC B;  3B5N D;  3HE4 A;  1IFI A;  3M9B A;  3P8C E;  1M1J A;  1N2D C;  2FYU K;  4I1L A;  5BU8 B;  3V2N A;  1KFN A;  3M0D C;  5AW9 B;  1HJB A;  3SWY A;  4W7Z A;  1NU1 K;  1URQ C;  1X8Y A;  3EFG A;  1M1J C;  2ZXE B;  4OH8 B;  3TK1 A;  2HG5 D;  2C0X A;  3M0D A;  2A45 G;  3RL0 D;  2FFD B;  5AVU B;  2Q3I A;  1GDT A;  3KPE A;  2KLV A;  2YO2 A;  3V4Q A;  5CMZ A;  5CCH C;  2KYV A;  3V2R A;  3CI9 A;  1KQL A;  2POH A;  1OWA A;  2GUV A;  1OXZ A;  3VN0 A;  5APS A;  1LTA C;  3RK2 B;  2GUS A;  1L0L K;  5AVX B;  4XA4 A;  2KSJ A;  3V5B A;  1H88 A;  2Q9I A;  3BVH A;  3OA7 A;  1JY3 N;  2R5B A;  5AW6 B;  3B5N B;  2O01 H;  2JEE A;  1GZL A;  1SQX K;  1FZF A;  1IFJ A;  5CJ0 A;  3TYY A;  5CCH D;  1GL2 A;  4ZKU A;  2OYI C;  5AW7 B;  2YKP A;  1HUC A;  4DZO A;  2WT7 B;  2WWW A;  3B5N A;  1RY3 A;  2A45 I;  2NPS C;  1GW4 A;  3VOP A;  1L4A C;  1KFM A;  1NTZ K;  1IFN A;  1ZR4 A;  3L37 A;  4C7R A;  1HWT C;  1JOC A;  1T3J A;  4LC1 A;  1DEB A;  1QL2 A;  1G1J A;  2P1J A;  1LTJ A;  4LLH A;  3VP9 A;  2BAS A;  2XZR A;  1T2K D;  2M3B A;  1HGZ A;  3MD0 A;  1T2K C;  2YKO A;  4XE5 B;  2WPQ A;  1AQ5 A;  5KJ7 C;  1URQ D;  5AW2 B;  4GT1 A;  1FZA A;  1ZN5 A;  1KZU B;  4KHX A;  5AW3 B;  5AW0 B;  3HD7 B;  2CPS A;  5AVW B;  3CL3 D;  2Z5H A;  4EOT A;  1KIL C;  5AVR B;  3H6P A;  4M3L A;  2Q7C A;  1KIL D;  1MUU A;  3M91 A;  2N1T C;  3GHG C;  1RE3 A;  4I6M C;  2XU6 A;  1KIL A;  3VTP C;  1WT6 A;  4WBA A;  1IFM A;  1W2E A;  5APV A;  3NMD A;  3IFM A;  1S9K D;  3N7N A;  3HE4 B;  1HVV A;  1LTB C;  3HD7 A;  3BAT A;  3P7K A;  2L5G B;  2I1K A;  2PP6 A;  5APT A;  1NWQ A;  1URQ A;  4N78 D;  3OJA B;  1FU1 A;  1LTI C;  1SLQ A;  3H32 A;  3I5C A;  1J1E C;  3P8M C;  1GL2 C;  2H43 A;  1L4A D;  4WY4 B;  1WRG A;  4WB4 A;  2WPS A;  5APX A;  2C0W A;  2O1K A;  2HPC A;  3VYI A;  4Y99 C;  1FZG A;  2R3C A;  3EQ2 A;  1SP4 A;  1IK9 A;  1JY2 N;  3KDP B;  3PP5 A;  5KJ7 A;  2C9L Y;  1T8Z A;  3SWF A;  2J59 M;  4ZKP A;  2C9N Y;  1URQ B;  4I2L C;  3MUD A;  3WMM 0;  3M9Q A;  1JTH B;  2MJZ A;  4GIF A;  1LGH B;  3P32 A;  1JO5 A;  1EQ7 A;  1J2J B;  2WSC H;  1ZLL A;  3L4F A;  1N7S C;  1NHL A;  1HH0 A;  2HPC B;  2XV5 A;  2KOG A;  1KIL B;  1GU4 A;  1SFC C;  4C7N B;  2E43 A;  1GW3 A;  2R32 A;  1CW5 A;  5CCG A;  2A45 H;  2IPP A;  1JUN A;  3HD7 C;  5AVS B;  2H7H A;  4C46 A;  3BRV B;  4Y99 B;  3VMX A;  1X79 B;  3A2A A;  4N3Y B;  3CLQ A;  2FXM A;  2HYN A;  1J1E B;  2YNY A;  2JJL A;  3V4W A;  1AFO A;  1NTM K;  3VMY A;  1N7L A;  1SQQ K;  1MZ9 A;  1NKZ B;  3M0A A;  1FDM A;  2PAJ A;  2H8P D;  3BAS A;  2HOD A;  3IR9 A;  1SFC B;  4HH2 A;  3U1A A;  2N1T B;  1JY3 O;  4B86 A;  5AW1 B;  1CI6 A;  1G1I A;  3HUS A;  3LIE A;  3TNU A;  2OYH C;  1SVF A;  1N7S B;  3HUS B;  2P2U A;  3H32 B;  1GU5 A;  3HUS C;  1JNM A;  2QM8 A;  1SFC A;  2OYH A;  1PFI A;  1H89 A;  1IC2 A;  1LT9 A;  2IFN A;  5BVZ A;  3KQG A;  1GD2 E;  3RL0 C;  1FZC C;  5AVQ B;  1M7L A;  1SFC D;  3V2Q A;  3MGN A;  3C9I A;  4DOJ A;  2GM4 A;  4WY4 C;  2O1J A;  1NAF A;  1L0N K;  2P67 A;  2YKQ A;  4O9B A;  1CZQ A;  1J1D C;  1DX7 A;  1N73 C;  3VP8 A;  1RF1 A;  1J1D B;  3HE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...