3V2NA

Compcc in complex with fatty acids
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
45
structure length
45
Chain Sequence
b'MDLAPQMLRELQETNAALQDVRELLRQQVKEITFLKNTVMECDAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cartilage Oligomerization matrix protein (coiled-coil domain
molecule tags Protein binding
source organism Mus musculus
publication title The pentameric channel of COMPcc in complex with different fatty acids.
pubmed doi rcsb
total genus 19
structure length 45
sequence length 45
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3v2nA00
1DEBA 1MZ9A 3V2QA 3V2PA 3V2NA 1FBMA 1VDFA 3V2RA
chains in the Genus database with same CATH superfamily
1LT9A 1WT6A 3B5NA 3GHGA 4LLHA 1L0LD 1JTHA 2LKMA 1PZQA 2C0XA 3PP5A 1VDFA 4Z1MH 1JB0J 2OYOA 5KLIC 1JY2P 3RK3C 1KILD 3AE1C 1FDOA 1AVYA 3AE6C 3CCSP 3HE5B 1P84D 2BCCJ 3HE4A 2AXTE 3AEEC 3E7KA 1S5LH 1KB9E 4H13D 1R8EA 3CWBD 3CXHE 3CC7P 1LTSC 1PP9J 2KXPB 4HKZH 4YTPC 2AEJA 4YPCA 3VN0A 1N2DC 2I1KA 1JUNA 1MV8A 2YKQA 3VP8A 3BASA 4W7YA 1QL2A 3CL3D 2E5YA 5AW4B 3V5BA 1U7MA 5CMZA 5M1BA 2B88A 1SQBD 1S3JA 2KZIA 1IFJA 1L0NE 3WU2E 2NPSB 1L4AC 2KK7A 1SQBJ 1EDLA 1UIIA 4WY4A 1W5CE 2XZRA 5AVVB 1CI6A 3GLMA 2K1AA 3MZWB 3CLQA 4I7ZC 4N78E 3CWBE 1J1EC 3CXHD 3BATA 1N73B 2OYHB 2C9NY 2KS1A 2ZYDA 4OGQB 2G8YA 4OWFA 1NVOA 3MTUE 4HH2A 5CBNA 1CZQA 2BCCG 2V7QJ 3H1ID 2G3AA 1FS0E 3CMAP 3L74E 4U7JA 1JEKA 1PP9G 3L70J 5GTHH 1L0LK 1OWAA 1RE3C 2QVAA 3AE5C 3L75D 5AVUB 2FXPA 4CPGA 2WT7B 1URQC 3Q5PA 1VQ7P 2V7QH 4N78D 2B87B 3AEAC 2D2CC 1YIJP 1BCCG 2PP6A 2J58A 2H8PD 2E74C 3AE4C 3H32A 3WU2H 3RK3B 2P7JA 3H1IE 3VMXA 1J1DC 1JMBA 1IZNB 1RQUA 2LXBA 3AE8C 2YXRB 4H13C 4C7RA 1NKZB 4DZOA 4ZMDA 1JOCA 3F89A 5AVWB 1SLQA 5APVA 2UWJE 4BXLA 1YHQP 1GDTA 2OYIA 1JY3O 2JR8A 1K73Q 1DEBA 2AXTH 1S5LE 4K35A 1ZW0A 1KB9I 1JMMA 3TK1A 2QG4A 2IBZE 3VYIA 2Q9IA 3IF4A 3BRTB 1PGOA 1PP9E 1L0LG 3AE9C 2XU6A 1URQD 1M1JC 3TGUJ 2O3JA 3TGUD 1RH5B 1R5LA 3M9HA 3U1AA 1OX3A 2A45G 4EIJA 3IR9A 4BWNA 1KB9D 3L72J 3T97B 5L8RJ 4ZNCA 3H6PA 1NGMB 1M1KQ 3Q5RA 5KTBA 1L0NJ 2QJPC 4KHXA 1EDKA 1RQVA 1H88A 1JNMA 2OTJP 1YITP 3MIWA 1FZAA 2ZVOB 1PP9D 2YNYA 3KXDA 4HYTB 1BDDA 3SFEC 4JQ0D 2N1TA 1DX7A 2BCCD 4WY4D 1BDCA 1U57A 2QJKC 5APYA 2E74D 2XNXA 3H32B 1NTMJ 3L73J 4GDOA 3L70E 3SWYA 2M5AB 4JYCA 3LW5H 2QJYB 4GIFA 4U3FD 3CPWO 3L73D 2YO3A 1FDMA 1VF5B 3M0DC 4HB1A 2Q5UA 4BRYB 1FZEA 1OZHA 2YKPA 1OVUA 1VQ9P 4WY4C 1SS1A 2P58A 3GF7A 5B66E 3O6QA 1RHZB 1PGQA 4W7ZA 1Y8AA 3H1JG 5AVYB 1WMKA 2K37A 2YO2A 3L74G 4C7NA 2C0WA 1KC8Q 3H1JJ 1OVRA 3H1IJ 1RF1A 2GM4A 1SQQJ 2QJPB 3M9BA 3RK3D 1BGYG 1RE4C 3FXEA 4NPFX 3RL0B 1SVFA 3A3YB 3B8EB 2W8ZA 3NTNA 5APSA 1M1JA 2AXCA 3TGUG 2QM7A 4XA4A 1CI6B 5CCGC 1YJWP 3E1RA 5CCHD 3K5BA 1KQFB 1N7SA 3JC22 3HE5A 2AEFA 1D7MA 4XFJA 1KQGB 1SQXJ 4OGQD 2P1JA 3R2PA 3W67A 2KNCB 1SQPE 1X8YA 1BE3E 2FYUJ 2KP8A 2MKVA 3L75G 3Q1MA 3CCUP 3BVHA 2FYUG 1NTZK 2B9BA 3MP7B 1QVFO 3KZIE 3MUDC 3P7KA 2YMKA 3P32A 3E1IA 1SQVE 2W6BA 1S9KD 5KLVE 2R3CA 1X22A 2ITAA 3H1LG 2ZT9C 1BGYE 3FX0A 3L36A 4C7NB 2AEMA 1JY3N 2H43A 2WWWA 3R4YA 1YTZI 3KHUA 3WUUA 5CBOA 3G3ZA 1KV4A 5APUA 1T3UA 4R4MA 4WB4A 5KKZB 1QGKB 4PV1B 4AUWA 2O01J 4PD4D 1NH4A 2MJZA 4H13B 4DT0A 1JM0A 5TJHA 4EYYQ 1W2EA 3HD7D 2HFED 1NU1G 5KJ7C 4EOTA 3CC2P 3BCCG 1VQ6P 2HYNA 1SQXG 3KPEA 4PD4I 2N1TD 4UB6H 1QLED 2Q7CA 3TDKA 1DIPA 1EZVG 3L35A 1KB9H 4IL6H 1BGYD 1SFCD 4I1LA 5AVSB 1KILA 1LWUC 1KYOI 4H44C 2IBZG 5APWA 2OGUA 2P10A 3LIDA 1EXIA 4JPZB 3CCVP 2GA1A 3L71J 3G6EP 2IBZD 3W68A 1LTAC 2E76B 2WITA 3G9RA 2NPSC 1SQVG 4IL6X 1YJ9P 5E79E 1FZCB 5BU8B 5CCGA 1FZCA 3JSVC 3A7OA 1PL5A 1KMIZ 1Y9BA 2O01H 4KJMA 1N73C 2RMZA 2OYHC 1EZVE 3L75E 4U3FJ 3D6ZA 1RF1C 1NTKD 1SFCB 2M8RA 1SQBK 1NOHA 1A02J 3SSUA 1NU1K 1NTMD 5KKZC 5AW7B 1GL2A 4N6JA 2K3RA 2V4HA 1LGHB 2VRSA 1SQPJ 2FYUE 3H1LD 1G2CB 3BRVB 1SP4A 4UB8H 2HPCA 2XV5A 4H0LD 1HGVA 1S9KE 1WRGA 1G2CA 4Y99C 2ZVNB 4WVZA 3VP9A 1QX8A 4L73A 5KLVG 1T2KD 1FJKA 2KLUA 3H1JD 1L0LJ 2E75B 3NMDA 2KSJA 5KLVJ 3PTZA 1KZUB 1VQKP 2NPSA 1J1DB 1ZOYC 2IYOA 2JWDA 2QRXA 5DJUB 2Q3EA 2XDJA 3WUTA 1ZRTD 1LP1A 1H8AA 2OYIB 1CW5A 2Y0DA 1JY2N 5KLVD 2D2CB 1KILC 1LWUA 1UIXA 3TGUE 1VQMP 3SWFA 1URQB 3A5TA 3H1HE 3TNUB 5BVZA 1OW6A 1OIPA 2M3EA 2Y0EA 5TISH 2R5DA 3HUSB 2R5BA 1BSNA 2M5AA 1Q81Q 3CWBJ 2FXOA 3RBZA 3CD6P 1NKNA 2K9JB 2N9BA 3RBXA 1TU3F 1AV1A 1GW3A 1IFNA 1PV3A 1X9VA 2PRRA 2YMYA 5KAIE 1NHLA 2YKOA 3AE2C 4L76A 4PJ0E 1VQLP 2KYVA 3V2QA 1BE3G 1HTLC 2PGDA 4TT3H 1M90Q 2KZJA 2A45H 4JBZA 3D6YA 3FGAD 2DW3A 4PV1C 1KQLA 2PFXA 1KQSO 2E75C 1GL2B 2J59M 1K05A 2Q1KA 3V4QA 1BE3D 3JCUE 1OXZA 1NAYA 1XTGB 1L0NK 1KFNA 1G1IA 1M7LA 4K3AA 1NO4A 5KJ7D 1LTJA 2ZJSE 5H2FH 1ZN5A 5GTIE 3Q3DA 1SQVD 1VF5D 2O01N 3H1HG 4DCKA 4Y28J 1HJ0A 2O1JA 4I6MC 2FFDB 1PGPA 3CMEP 1G1JA 3PLNA 2JJLA 3C8VA 5AVZB 1IC2A 1NTZD 1MFTA 3B5ND 2FY8A 3H1JE 3AECC 3HD7B 3OJAB 4H0LC 5AW3B 5AW5B 1IFPA 4PD4E 1GL2D 1P84H 2FYNC 1DD3A 3EWKA 3MUDA 1JCDA 1M56D 2JDIH 3L73G 3V2NA 3M91A 1S2EA 2WSSH 3CX5D 1KYOH 5AW9B 1KYOE 3ZDMA 1K9MQ 1M57D 2WT7A 2ZFCA 2YIUC 1FOSF 2QEXP 2WSCJ 3LIEA 2I1JA 3FXDA 3NXSA 1P84E 3SWKA 4PD4H 1DEEG 3HUSC 2IX7C 1JY3P 1Z56A 4TLFA 2N9YB 1OMIA 3V2RA 1EXJA 2E42A 1XTCC 5AVTB 4IOIH 1DH3A 1NJIQ 3U1CA 3H1HJ 1L4AA 1QL1A 1OFCX 5AVRB 1PPJD 3P8CD 5KAFE 5APQA 4D6TD 3C9IA 3I55P 3AEBC 2PAJA 2Z4EA 3VMYA 1KYOD 2J5UA 3L37A 3RK2C 5GTIH 2WPSA 1HWTC 1VQ4P 2POHA 1KTMA 3CCMP 3CXHI 5AVXB 3H1KE 1S72P 4IFFA 3IAOA 2WVRA 4ASWA 3AE7C 2E74B 3MGNA 2W27A 3CCLP 1LTBC 2K9JA 3A0BE 3BCCJ 3KYQA 1MFZA 1NTME 3EFGA 3L73E 4NPEA 3TSIA 4C46A 5BU5A 5B5EE 3FWLA 5AW2B 2L91A 5K5GB 2FYNB 1T2KC 3RL0D 5DJTB 3A0HH 4R4LA 2W83C 4ASVA 4H0LB 1NTZJ 1T8ZA 2WSCH 2GUSA 1J2JB 3TNUA 1LP1B 4QMAA 2KOGA 3I56P 2WMMA 2R44A 2H89C 5KLIB 3B4SA 5APXA 3A0HE 3CX5H 2WTYA 1BCCD 3EFFK 3HTKA 1NTKJ 1IFDA 1VL2A 2CK3H 2YIUB 3CX5E 3GG2A 2Q3IA 3LW5J 4GOFA 2JWAA 4MN4C 2KB7P 1T6AA 3QWOC 3VMZA 4B86A 1L0NG 3G71P 1S4XA 2H88C 1Q86Q 1NTKE 2BASA 2SPZA 3L70D 4D6TJ 5CCHA 4JYBA 3SFDC 2XKMA 5KJ7A 4YXWH 1NTZG 2Z5IA 3CWBG 4NPDA 1USDA 1GMJA 2W90A 4L74A 1YYCA 2BEQD 1PPJE 1QEXA 4YXDC 2HLOA 1J1EB 3M0AA 4D6TE 2FYUD 1LTIC 1HH0A 1L0ND 2Z5HA 3L71G 4GKGA 3CX5I 1SQVJ 2B89A 1VF5C 1YBKA 2NRGA 2WSFJ 2ZT9D 2ZYGA 3A0BH 2KLVA 4GOEA 4H44B 2QJYC 4Y99B 2IZ1A 5AVQB 1H0TB 3HE4B 2CPSA 1RF1B 1AJYA 3WUVA 1GTWA 3PJSK 3WMM0 2A45I 1EC5A 1IK7A 1IK9A 3P8CE 3CCEP 2K88A 1Q7YQ 1K8AQ 3L72G 4KT0J 2I8DA 1NYHA 5E79H 1JTHB 4D6TG 3A2AA 1JO5A 1SQPG 2FBWC 2IFMA 1X79B 1VPCA 1NTZE 2HODB 2W6AA 1ZR2A 3HTKB 4WWIA 1YJNP 1PFIA 1K04A 2A06D 2ZXXA 1N73A 2OYHA 4O9BA 5KLVK 2WSFH 3L71E 3USSA 4XE5B 3FWNA 4EI2A 1GD2E 3EQ2A 3V6IA 4UB6E 2HPCB 2FKWB 3QH9A 1SQBE 2WPRA 1SFCC 2KSEA 3JCUH 5AW8B 3KDPB 1E79H 3RK2D 1GK4A 1Y47A 1ZLLA 3G4SP 2IFNA 2QM8A 4W80A 3ITKA 3L75J 4U3FE 1ZV8A 3UIAA 1FC2C 2NPSD 2BEZF 1L2PA 3L71D 1NAFA 1U7JA 3AEGC 3RGUA 1M8OB 3F5HA 3M06A 1IJDB 3VMAA 1FE6A 1JCCA 3L4FA 1YI2P 1N7SB 2QJKB 3CCJP 1GL2C 1L0LE 2ZXEB 4AQRD 1W2BO 4PJ0H 4OH8B 1NU1J 2WQYC 1A02F 1SQBG 3IFMA 4M3LA 1ZR4A 1N7LA 3OW2O 5CJ0A 2BCCE 4OVNF 4A7PA 2D2CD 1SQQD 1X0TA 2IDBA 2KIKA 2LXCB 3M9QA 1MUUA 1NU1E 3OA7A 1FZFA 3H1HD 1VQ5P 5CJ4A 5TISE 2R3SA 4GT1A 3CCQP 2E76C 1Q90D 3GF3A 1SQQG 1SQPD 3H1LJ 3P8MC 1FZCC 2Q6QA 1AA0A 2YXQB 1T3JA 3O6QB 2W6JH 3O8ZA 5AW6B 3BCCD 1LJ2A 2NZ2A 1BCCE 3N7NA 2GUVA 2Y9YA 1LWUB 2KNCA 4IFMA 1S1CX 4PV1D 4BRYA 5B5EH 3H1LE 5B66H 1MKMA 1AFOA 1SQXD 2R32A 3L72E 1GZLA 4U3FG 1PGJA 2N1TB 3HUSA 1Q82Q 1BCCJ 1OW8A 2JKVA 1H0TA 1LTGC 5APTA 4I2LC 5CCHC 3HD7C 2OQQA 1L4AD 2KI7B 2RKLA 4RESB 1LT9C 3B5NC 2IYPA 3GHGC 1EZVI 1R5SA 5KAFH 2C9LY 3N4XA 3BCCE 3S4RA 4UB8E 4GODA 2FFDA 1HBWA 1KN7A 2IBZI 2QE7H 2Y0CA 2IZ0A 2ZT9B 3AEFC 4H44D 4ZKUA 3CCRP 3CC4P 3S1KA 1HGZA 1SQQK 3GW6A 3L70G 1KORA 1EDIA 1FJPA 1OW7A 1EZVD 3H25A 3ABVC 2RN0A 4HJGH 4IL6E 2OYIC 1LT9B 3B5NB 3GHGB 1NTKG 2WPVB 2XNDH 2E43A 1VQNP 1LTJC 1RE4A 1IO4A 4ZKPA 1S5LX 1RY3A 1YQ4C 2A06G 2JP3A 2O1KA 3GMAA 3C1LA 1PPJG 1QVGO 1N7SD 2KUBA 1GW4A 1SQQE 3Q5SA 1RF0A 2ZAEB 3KQGA 5CHXA 1VQ8P 3AE3C 3RK3E 2QSIA 5AW1B 2H7HA 2QA4P 5H2FE 1FOSE 4EDFA 1AVOA 2E75D 2HG5D 1HF9A 3TF5A 1ZMEC 4DOJA 1OVVA 1EDJA 3PH0A 1CSBA 2QIWA 3L74D 1HVVA 3MHVA 4LC1A 1KILE 4OGQC 2WSEJ 2WPQA 3AEDC 1IFIA 4DJGA 1NTMK 2N1TC 1NU1D 3H1KD 1DD4A 1NTKK 4AYCA 1LTJB 1RF0C 3H1KJ 1LT1A 1LNQA 2M3BA 5KAIH 5EFWB 3VTPC 2HR3A 3H1KG 1H89A 2FFDC 2P67A 1N7SC 3I5CA 4LGDE 5C39A 1FZGA 2ZYAA 1AQTA 3TYYA 3B71A 1FBMA 1IFMA 2OARA 3MD0A 3KZIH 5GTHE 1SFCA 3RL0C 1EQ7A 1P84I 1BGYJ 1N86A 2K9YA 2LR2A 3V2PA 1LTTC 1ZXGA 3IN6A 4RJTA 4N3YB 4RO0A 3Q2YA 3II6A 1N8RQ 1SQVK 1FU1A 3PHLA 3VOPA 1JY2O 1URQA 2WSEH 1HJBA 1MZ9A 2JEEA 2A06E 1YTZT 5AW0B 1GK6A 2L5GB 1VQPP 1USEA 3CI9A 1YQ3C 2M0BA 1SQXK 3M0DA 2RH0A 1GU5A 1NWQA 2OTLP 2JO1A 3HD7A 1M1JB 2FYUK 2OTKE 1VQOP 4IFDK 1AQ5A 3OAKA 4JF7A 1GU4A 2E5TA 3PRJA 2IPPA 3RK2B 3V4WA 3L74J 3D70A 3CXHH 2Y9ZA 1FZBA 2FXMA 2B87A 3H1IG 4RKUJ 1HUCA 1SQPK 3D71A 1FAVA 1KILB 1ZRTE 3RL0g 1BSHA 2KS1B 1PIXA 4WBAA 4L75A 3S9OA 1E5WA 2FYZA 2CPBA 1SQXE 2P2UA 1RE3A 3L72D 4I7ZB 4WY4B 3U59A 3HRNA 1KD1Q 1NTMG 1Q2NA 2E76D 3NFQA 1BE3J 1ZP0C 2HODA 3T97A 5CCGD 1L4AB 1KFMA 1FDIA 2WZ7A
chains in the Genus database with same CATH topology
1LT9A 1WT6A 3B5NA 3GHGA 4LLHA 1JTHA 2LKMA 3PP5A 2C0XA 1VDFA 1JY2P 1KILD 3HE5B 3HE4A 1LTSC 1N2DC 2I1KA 1JUNA 1MV8A 2YKQA 3VP8A 3BASA 1QL2A 3CL3D 5AW4B 3V5BA 5CMZA 1IFJA 2NPSB 1L4AC 4WY4A 3WMM0 5AVVB 2XZRA 1CI6A 3CLQA 4N78E 1J1EC 3BATA 1N73B 2OYHB 2C9NY 3MTUE 4HH2A 1CZQA 1L0LK 1OWAA 1RE3C 5AVUB 2WT7B 1URQC 4N78D 2PP6A 2J58A 2H8PD 3H32A 3RK3B 2P7JA 3VMXA 4C7RA 1J1DC 1NKZB 4DZOA 1JOCA 5AVWB 1SLQA 5APVA 2OYIA 1JY3O 1DEBA 1JMMA 3TK1A 3VYIA 2Q9IA 3BRTB 2XU6A 1URQD 1M1JC 3M9HA 3U1AA 4EIJA 2A45G 3IR9A 1RF1B 3H6PA 5KTBA 4KHXA 1H88A 1JNMA 3MIWA 1FZAA 2YNYA 4HYTB 2N1TA 1DX7A 4WY4D 5APYA 2XNXA 3H32B 3SWYA 4JYCA 3LW5H 4GIFA 1FDMA 2YO3A 3M0DC 2Q5UA 1FZEA 2YKPA 4WY4C 4W7ZA 5AVYB 2YO2A 4C7NA 2C0WA 1RF1A 2GM4A 3M9BA 3RK3D 3RL0B 1RE4C 1SVFA 3A3YB 3B8EB 3NTNA 5APSA 1M1JA 2QM7A 1CI6B 5CCGC 5CCHD 1N7SA 3HE5A 2P1JA 3R2PA 2KP8A 1X8YA 3BVHA 1NTZK 3P7KA 3P32A 3E1IA 2W6BA 1S9KD 2R3CA 3L36A 4C7NB 1JY3N 2H43A 2WWWA 1YTZI 3G3ZA 5APUA 1T3UA 4WB4A 4AUWA 1NH4A 2MJZA 5KJ7C 1W2EA 3HD7D 2HFED 4EOTA 2HYNA 3KPEA 2Q7CA 2N1TD 3L35A 1SFCD 4I1LA 5AVSB 1KILA 1LWUC 5APWA 3LIDA 1LTAC 2WITA 1FZCB 2NPSC 5BU8B 5CCGA 1FZCA 3A7OA 2O01H 1N73C 2OYHC 1RF1C 1SFCB 2M8RA 1SQBK 1NOHA 1A02J 1NU1K 5AW7B 1GL2A 4N6JA 2VRSA 1LGHB 1G2CB 3BRVB 1SP4A 2HPCA 2XV5A 1HGVA 1S9KE 1WRGA 1G2CA 3VP9A 1FJKA 3NMDA 2KSJA 1KZUB 2NPSA 1J1DB 2XDJA 1H8AA 2OYIB 1CW5A 1JY2N 1KILC 1LWUA 3SWFA 1URQB 3A5TA 3TNUB 5BVZA 2R5DA 3HUSB 2R5BA 1NKNA 2N9BA 1IFNA 1GW3A 1X9VA 2YMYA 1NHLA 2YKOA 2KYVA 3V2QA 1HTLC 2A45H 1KQLA 1GL2B 2J59M 3V4QA 1OXZA 1XTGB 1L0NK 1KFNA 1G1IA 1M7LA 1NO4A 5KJ7D 1LTJA 1ZN5A 2O1JA 4I6MC 2FFDB 1G1JA 2JJLA 5AVZB 1IC2A 3B5ND 3HD7B 5AW5B 3VN0A 3OJAB 1T2KD 5AW3B 1GL2D 3MUDA 1JCDA 3V2NA 3M91A 5AW9B 2WT7A 2ZFCA 1FOSF 3LIEA 2I1JA 3NXSA 3HUSC 2IX7C 1JY3P 1Z56A 3V2RA 2E42A 1XTCC 5AVTB 1DH3A 3U1CA 1L4AA 1QL1A 5AVRB 3P8CD 5APQA 3C9IA 2Z4EA 2PAJA 3VMYA 3L37A 3RK2C 2WPSA 1HWTC 2POHA 5AVXB 4IFFA 3MGNA 2W27A 1LTBC 3TSIA 3KYQA 1MFZA 4C46A 5BU5A 5AW2B 1T2KC 3RL0D 1T8ZA 2WSCH 2GUSA 1J2JB 3TNUA 2KOGA 5APXA 2WTYA 3HTKA 1IFDA 4Y99C 2Q3IA 2KB7P 3VMZA 4B86A 5CCHA 2BASA 4JYBA 5KJ7A 2XKMA 2Z5IA 1YYCA 2HLOA 1J1EB 3M0AA 2Z5HA 1LTIC 1HH0A 4GKGA 3RK3C 5AVQB 2KLVA 4Y99B 3HE4B 2CPSA 1GTWA 2A45I 3P8CE 1IK9A 1JTHB 3A2AA 1JO5A 2IFMA 1X79B 1VPCA 2HODB 2W6AA 1ZR2A 3HTKB 1PFIA 1N73A 2OYHA 4O9BA 5KLVK 2WSFH 4XE5B 1GD2E 3EQ2A 2HPCB 2FKWB 2WPRA 1SFCC 5AW8B 3KDPB 3RK2D 1GK4A 1ZLLA 2IFNA 2QM8A 4W80A 1ZV8A 3UIAA 2NPSD 1NAFA 3M06A 1IJDB 1JCCA 3L4FA 1N7SB 1GL2C 2ZXEB 4AQRD 4OH8B 1A02F 3IFMA 4M3LA 1ZR4A 1N7LA 5CJ0A 4XA4A 3OA7A 3M9QA 1FZFA 1MUUA 5CJ4A 1GDTA 4GT1A 1FZCC 3P8MC 1T3JA 3O8ZA 5AW6B 4IFMA 3N7NA 2E43A 2GUVA 1LWUB 1AFOA 2R32A 1FZGA 1GZLA 3HUSA 2N1TB 1LTGC 5APTA 4I2LC 5CCHC 3HD7C 1L4AD 4RESB 1LT9C 3B5NC 3GHGC 2C9LY 3N4XA 2FFDA 1HBWA 4ZKUA 1HGZA 1SQQK 1FJPA 2OYIC 1LT9B 3B5NB 3GHGB 1LTJC 1RE4A 1IO4A 4ZKPA 1RY3A 2O1KA 1N7SD 1GW4A 1RF0A 3KQGA 5CHXA 5AW1B 2H7HA 1FOSE 2HG5D 4DOJA 4W7YA 1CSBA 1HVVA 4LC1A 2WPQA 1IFIA 1NTMK 2N1TC 1NTKK 4AYCA 1LTJB 1RF0C 2M3BA 3VTPC 1H89A 2FFDC 2P67A 1N7SC 3I5CA 4LGDE 3TYYA 1FBMA 1IFMA 2OARA 3MD0A 1SFCA 3RL0C 1EQ7A 1N86A 3V2PA 1LTTC 4N3YB 3II6A 1SQVK 1FU1A 3VOPA 1JY2O 1URQA 2WSEH 1HJBA 1MZ9A 2JEEA 1YTZT 5AW0B 1GK6A 2L5GB 3CI9A 1SQXK 3M0DA 1NWQA 1GU5A 1KFMA 3HD7A 1M1JB 2FYUK 4IFDK 1AQ5A 3OAKA 4JF7A 1GU4A 2IPPA 3RK2B 3V4WA 1FZBA 2FXMA 1HUCA 1SQPK 1FAVA 1KILB 4WBAA 1E5WA 2FYZA 2CPBA 4WY4B 2P2UA 1RE3A 3U59A 3HRNA 3T97A 3NFQA 5CCGD 2HODA 1L4AB 3EFGA 2WZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DEB A;  1MZ9 A;  3V2Q A;  3V2P A;  3V2N A;  1FBM A;  1VDF A;  3V2R A; 
#chains in the Genus database with same CATH topology
 1LT9 A;  1WT6 A;  3B5N A;  3GHG A;  4LLH A;  1L0L D;  1JTH A;  2LKM A;  1PZQ A;  2C0X A;  3PP5 A;  1VDF A;  4Z1M H;  1JB0 J;  2OYO A;  5KLI C;  1JY2 P;  3RK3 C;  1KIL D;  3AE1 C;  1FDO A;  1AVY A;  3AE6 C;  3CCS P;  3HE5 B;  1P84 D;  2BCC J;  3HE4 A;  2AXT E;  3AEE C;  3E7K A;  1S5L H;  1KB9 E;  4H13 D;  1R8E A;  3CWB D;  3CXH E;  3CC7 P;  1LTS C;  1PP9 J;  2KXP B;  4HKZ H;  4YTP C;  2AEJ A;  4YPC A;  3VN0 A;  1N2D C;  2I1K A;  1JUN A;  1MV8 A;  2YKQ A;  3VP8 A;  3BAS A;  4W7Y A;  1QL2 A;  3CL3 D;  2E5Y A;  5AW4 B;  3V5B A;  1U7M A;  5CMZ A;  5M1B A;  2B88 A;  1SQB D;  1S3J A;  2KZI A;  1IFJ A;  1L0N E;  3WU2 E;  2NPS B;  1L4A C;  2KK7 A;  1SQB J;  1EDL A;  1UII A;  4WY4 A;  1W5C E;  2XZR A;  5AVV B;  1CI6 A;  3GLM A;  2K1A A;  3MZW B;  3CLQ A;  4I7Z C;  4N78 E;  3CWB E;  1J1E C;  3CXH D;  3BAT A;  1N73 B;  2OYH B;  2C9N Y;  2KS1 A;  2ZYD A;  4OGQ B;  2G8Y A;  4OWF A;  1NVO A;  3MTU E;  4HH2 A;  5CBN A;  1CZQ A;  2BCC G;  2V7Q J;  3H1I D;  2G3A A;  1FS0 E;  3CMA P;  3L74 E;  4U7J A;  1JEK A;  1PP9 G;  3L70 J;  5GTH H;  1L0L K;  1OWA A;  1RE3 C;  2QVA A;  3AE5 C;  3L75 D;  5AVU B;  2FXP A;  4CPG A;  2WT7 B;  1URQ C;  3Q5P A;  1VQ7 P;  2V7Q H;  4N78 D;  2B87 B;  3AEA C;  2D2C C;  1YIJ P;  1BCC G;  2PP6 A;  2J58 A;  2H8P D;  2E74 C;  3AE4 C;  3H32 A;  3WU2 H;  3RK3 B;  2P7J A;  3H1I E;  3VMX A;  1J1D C;  1JMB A;  1IZN B;  1RQU A;  2LXB A;  3AE8 C;  2YXR B;  4H13 C;  4C7R A;  1NKZ B;  4DZO A;  4ZMD A;  1JOC A;  3F89 A;  5AVW B;  1SLQ A;  5APV A;  2UWJ E;  4BXL A;  1YHQ P;  1GDT A;  2OYI A;  1JY3 O;  2JR8 A;  1K73 Q;  1DEB A;  2AXT H;  1S5L E;  4K35 A;  1ZW0 A;  1KB9 I;  1JMM A;  3TK1 A;  2QG4 A;  2IBZ E;  3VYI A;  2Q9I A;  3IF4 A;  3BRT B;  1PGO A;  1PP9 E;  1L0L G;  3AE9 C;  2XU6 A;  1URQ D;  1M1J C;  3TGU J;  2O3J A;  3TGU D;  1RH5 B;  1R5L A;  3M9H A;  3U1A A;  1OX3 A;  2A45 G;  4EIJ A;  3IR9 A;  4BWN A;  1KB9 D;  3L72 J;  3T97 B;  5L8R J;  4ZNC A;  3H6P A;  1NGM B;  1M1K Q;  3Q5R A;  5KTB A;  1L0N J;  2QJP C;  4KHX A;  1EDK A;  1RQV A;  1H88 A;  1JNM A;  2OTJ P;  1YIT P;  3MIW A;  1FZA A;  2ZVO B;  1PP9 D;  2YNY A;  3KXD A;  4HYT B;  1BDD A;  3SFE C;  4JQ0 D;  2N1T A;  1DX7 A;  2BCC D;  4WY4 D;  1BDC A;  1U57 A;  2QJK C;  5APY A;  2E74 D;  2XNX A;  3H32 B;  1NTM J;  3L73 J;  4GDO A;  3L70 E;  3SWY A;  2M5A B;  4JYC A;  3LW5 H;  2QJY B;  4GIF A;  4U3F D;  3CPW O;  3L73 D;  2YO3 A;  1FDM A;  1VF5 B;  3M0D C;  4HB1 A;  2Q5U A;  4BRY B;  1FZE A;  1OZH A;  2YKP A;  1OVU A;  1VQ9 P;  4WY4 C;  1SS1 A;  2P58 A;  3GF7 A;  5B66 E;  3O6Q A;  1RHZ B;  1PGQ A;  4W7Z A;  1Y8A A;  3H1J G;  5AVY B;  1WMK A;  2K37 A;  2YO2 A;  3L74 G;  4C7N A;  2C0W A;  1KC8 Q;  3H1J J;  1OVR A;  3H1I J;  1RF1 A;  2GM4 A;  1SQQ J;  2QJP B;  3M9B A;  3RK3 D;  1BGY G;  1RE4 C;  3FXE A;  4NPF X;  3RL0 B;  1SVF A;  3A3Y B;  3B8E B;  2W8Z A;  3NTN A;  5APS A;  1M1J A;  2AXC A;  3TGU G;  2QM7 A;  4XA4 A;  1CI6 B;  5CCG C;  1YJW P;  3E1R A;  5CCH D;  3K5B A;  1KQF B;  1N7S A;  3JC2 2;  3HE5 A;  2AEF A;  1D7M A;  4XFJ A;  1KQG B;  1SQX J;  4OGQ D;  2P1J A;  3R2P A;  3W67 A;  2KNC B;  1SQP E;  1X8Y A;  1BE3 E;  2FYU J;  2KP8 A;  2MKV A;  3L75 G;  3Q1M A;  3CCU P;  3BVH A;  2FYU G;  1NTZ K;  2B9B A;  3MP7 B;  1QVF O;  3KZI E;  3MUD C;  3P7K A;  2YMK A;  3P32 A;  3E1I A;  1SQV E;  2W6B A;  1S9K D;  5KLV E;  2R3C A;  1X22 A;  2ITA A;  3H1L G;  2ZT9 C;  1BGY E;  3FX0 A;  3L36 A;  4C7N B;  2AEM A;  1JY3 N;  2H43 A;  2WWW A;  3R4Y A;  1YTZ I;  3KHU A;  3WUU A;  5CBO A;  3G3Z A;  1KV4 A;  5APU A;  1T3U A;  4R4M A;  4WB4 A;  5KKZ B;  1QGK B;  4PV1 B;  4AUW A;  2O01 J;  4PD4 D;  1NH4 A;  2MJZ A;  4H13 B;  4DT0 A;  1JM0 A;  5TJH A;  4EYY Q;  1W2E A;  3HD7 D;  2HFE D;  1NU1 G;  5KJ7 C;  4EOT A;  3CC2 P;  3BCC G;  1VQ6 P;  2HYN A;  1SQX G;  3KPE A;  4PD4 I;  2N1T D;  4UB6 H;  1QLE D;  2Q7C A;  3TDK A;  1DIP A;  1EZV G;  3L35 A;  1KB9 H;  4IL6 H;  1BGY D;  1SFC D;  4I1L A;  5AVS B;  1KIL A;  1LWU C;  1KYO I;  4H44 C;  2IBZ G;  5APW A;  2OGU A;  2P10 A;  3LID A;  1EXI A;  4JPZ B;  3CCV P;  2GA1 A;  3L71 J;  3G6E P;  2IBZ D;  3W68 A;  1LTA C;  2E76 B;  2WIT A;  3G9R A;  2NPS C;  1SQV G;  4IL6 X;  1YJ9 P;  5E79 E;  1FZC B;  5BU8 B;  5CCG A;  1FZC A;  3JSV C;  3A7O A;  1PL5 A;  1KMI Z;  1Y9B A;  2O01 H;  4KJM A;  1N73 C;  2RMZ A;  2OYH C;  1EZV E;  3L75 E;  4U3F J;  3D6Z A;  1RF1 C;  1NTK D;  1SFC B;  2M8R A;  1SQB K;  1NOH A;  1A02 J;  3SSU A;  1NU1 K;  1NTM D;  5KKZ C;  5AW7 B;  1GL2 A;  4N6J A;  2K3R A;  2V4H A;  1LGH B;  2VRS A;  1SQP J;  2FYU E;  3H1L D;  1G2C B;  3BRV B;  1SP4 A;  4UB8 H;  2HPC A;  2XV5 A;  4H0L D;  1HGV A;  1S9K E;  1WRG A;  1G2C A;  4Y99 C;  2ZVN B;  4WVZ A;  3VP9 A;  1QX8 A;  4L73 A;  5KLV G;  1T2K D;  1FJK A;  2KLU A;  3H1J D;  1L0L J;  2E75 B;  3NMD A;  2KSJ A;  5KLV J;  3PTZ A;  1KZU B;  1VQK P;  2NPS A;  1J1D B;  1ZOY C;  2IYO A;  2JWD A;  2QRX A;  5DJU B;  2Q3E A;  2XDJ A;  3WUT A;  1ZRT D;  1LP1 A;  1H8A A;  2OYI B;  1CW5 A;  2Y0D A;  1JY2 N;  5KLV D;  2D2C B;  1KIL C;  1LWU A;  1UIX A;  3TGU E;  1VQM P;  3SWF A;  1URQ B;  3A5T A;  3H1H E;  3TNU B;  5BVZ A;  1OW6 A;  1OIP A;  2M3E A;  2Y0E A;  5TIS H;  2R5D A;  3HUS B;  2R5B A;  1BSN A;  2M5A A;  1Q81 Q;  3CWB J;  2FXO A;  3RBZ A;  3CD6 P;  1NKN A;  2K9J B;  2N9B A;  3RBX A;  1TU3 F;  1AV1 A;  1GW3 A;  1IFN A;  1PV3 A;  1X9V A;  2PRR A;  2YMY A;  5KAI E;  1NHL A;  2YKO A;  3AE2 C;  4L76 A;  4PJ0 E;  1VQL P;  2KYV A;  3V2Q A;  1BE3 G;  1HTL C;  2PGD A;  4TT3 H;  1M90 Q;  2KZJ A;  2A45 H;  4JBZ A;  3D6Y A;  3FGA D;  2DW3 A;  4PV1 C;  1KQL A;  2PFX A;  1KQS O;  2E75 C;  1GL2 B;  2J59 M;  1K05 A;  2Q1K A;  3V4Q A;  1BE3 D;  3JCU E;  1OXZ A;  1NAY A;  1XTG B;  1L0N K;  1KFN A;  1G1I A;  1M7L A;  4K3A A;  1NO4 A;  5KJ7 D;  1LTJ A;  2ZJS E;  5H2F H;  1ZN5 A;  5GTI E;  3Q3D A;  1SQV D;  1VF5 D;  2O01 N;  3H1H G;  4DCK A;  4Y28 J;  1HJ0 A;  2O1J A;  4I6M C;  2FFD B;  1PGP A;  3CME P;  1G1J A;  3PLN A;  2JJL A;  3C8V A;  5AVZ B;  1IC2 A;  1NTZ D;  1MFT A;  3B5N D;  2FY8 A;  3H1J E;  3AEC C;  3HD7 B;  3OJA B;  4H0L C;  5AW3 B;  5AW5 B;  1IFP A;  4PD4 E;  1GL2 D;  1P84 H;  2FYN C;  1DD3 A;  3EWK A;  3MUD A;  1JCD A;  1M56 D;  2JDI H;  3L73 G;  3V2N A;  3M91 A;  1S2E A;  2WSS H;  3CX5 D;  1KYO H;  5AW9 B;  1KYO E;  3ZDM A;  1K9M Q;  1M57 D;  2WT7 A;  2ZFC A;  2YIU C;  1FOS F;  2QEX P;  2WSC J;  3LIE A;  2I1J A;  3FXD A;  3NXS A;  1P84 E;  3SWK A;  4PD4 H;  1DEE G;  3HUS C;  2IX7 C;  1JY3 P;  1Z56 A;  4TLF A;  2N9Y B;  1OMI A;  3V2R A;  1EXJ A;  2E42 A;  1XTC C;  5AVT B;  4IOI H;  1DH3 A;  1NJI Q;  3U1C A;  3H1H J;  1L4A A;  1QL1 A;  1OFC X;  5AVR B;  1PPJ D;  3P8C D;  5KAF E;  5APQ A;  4D6T D;  3C9I A;  3I55 P;  3AEB C;  2PAJ A;  2Z4E A;  3VMY A;  1KYO D;  2J5U A;  3L37 A;  3RK2 C;  5GTI H;  2WPS A;  1HWT C;  1VQ4 P;  2POH A;  1KTM A;  3CCM P;  3CXH I;  5AVX B;  3H1K E;  1S72 P;  4IFF A;  3IAO A;  2WVR A;  4ASW A;  3AE7 C;  2E74 B;  3MGN A;  2W27 A;  3CCL P;  1LTB C;  2K9J A;  3A0B E;  3BCC J;  3KYQ A;  1MFZ A;  1NTM E;  3EFG A;  3L73 E;  4NPE A;  3TSI A;  4C46 A;  5BU5 A;  5B5E E;  3FWL A;  5AW2 B;  2L91 A;  5K5G B;  2FYN B;  1T2K C;  3RL0 D;  5DJT B;  3A0H H;  4R4L A;  2W83 C;  4ASV A;  4H0L B;  1NTZ J;  1T8Z A;  2WSC H;  2GUS A;  1J2J B;  3TNU A;  1LP1 B;  4QMA A;  2KOG A;  3I56 P;  2WMM A;  2R44 A;  2H89 C;  5KLI B;  3B4S A;  5APX A;  3A0H E;  3CX5 H;  2WTY A;  1BCC D;  3EFF K;  3HTK A;  1NTK J;  1IFD A;  1VL2 A;  2CK3 H;  2YIU B;  3CX5 E;  3GG2 A;  2Q3I A;  3LW5 J;  4GOF A;  2JWA A;  4MN4 C;  2KB7 P;  1T6A A;  3QWO C;  3VMZ A;  4B86 A;  1L0N G;  3G71 P;  1S4X A;  2H88 C;  1Q86 Q;  1NTK E;  2BAS A;  2SPZ A;  3L70 D;  4D6T J;  5CCH A;  4JYB A;  3SFD C;  2XKM A;  5KJ7 A;  4YXW H;  1NTZ G;  2Z5I A;  3CWB G;  4NPD A;  1USD A;  1GMJ A;  2W90 A;  4L74 A;  1YYC A;  2BEQ D;  1PPJ E;  1QEX A;  4YXD C;  2HLO A;  1J1E B;  3M0A A;  4D6T E;  2FYU D;  1LTI C;  1HH0 A;  1L0N D;  2Z5H A;  3L71 G;  4GKG A;  3CX5 I;  1SQV J;  2B89 A;  1VF5 C;  1YBK A;  2NRG A;  2WSF J;  2ZT9 D;  2ZYG A;  3A0B H;  2KLV A;  4GOE A;  4H44 B;  2QJY C;  4Y99 B;  2IZ1 A;  5AVQ B;  1H0T B;  3HE4 B;  2CPS A;  1RF1 B;  1AJY A;  3WUV A;  1GTW A;  3PJS K;  3WMM 0;  2A45 I;  1EC5 A;  1IK7 A;  1IK9 A;  3P8C E;  3CCE P;  2K88 A;  1Q7Y Q;  1K8A Q;  3L72 G;  4KT0 J;  2I8D A;  1NYH A;  5E79 H;  1JTH B;  4D6T G;  3A2A A;  1JO5 A;  1SQP G;  2FBW C;  2IFM A;  1X79 B;  1VPC A;  1NTZ E;  2HOD B;  2W6A A;  1ZR2 A;  3HTK B;  4WWI A;  1YJN P;  1PFI A;  1K04 A;  2A06 D;  2ZXX A;  1N73 A;  2OYH A;  4O9B A;  5KLV K;  2WSF H;  3L71 E;  3USS A;  4XE5 B;  3FWN A;  4EI2 A;  1GD2 E;  3EQ2 A;  3V6I A;  4UB6 E;  2HPC B;  2FKW B;  3QH9 A;  1SQB E;  2WPR A;  1SFC C;  2KSE A;  3JCU H;  5AW8 B;  3KDP B;  1E79 H;  3RK2 D;  1GK4 A;  1Y47 A;  1ZLL A;  3G4S P;  2IFN A;  2QM8 A;  4W80 A;  3ITK A;  3L75 J;  4U3F E;  1ZV8 A;  3UIA A;  1FC2 C;  2NPS D;  2BEZ F;  1L2P A;  3L71 D;  1NAF A;  1U7J A;  3AEG C;  3RGU A;  1M8O B;  3F5H A;  3M06 A;  1IJD B;  3VMA A;  1FE6 A;  1JCC A;  3L4F A;  1YI2 P;  1N7S B;  2QJK B;  3CCJ P;  1GL2 C;  1L0L E;  2ZXE B;  4AQR D;  1W2B O;  4PJ0 H;  4OH8 B;  1NU1 J;  2WQY C;  1A02 F;  1SQB G;  3IFM A;  4M3L A;  1ZR4 A;  1N7L A;  3OW2 O;  5CJ0 A;  2BCC E;  4OVN F;  4A7P A;  2D2C D;  1SQQ D;  1X0T A;  2IDB A;  2KIK A;  2LXC B;  3M9Q A;  1MUU A;  1NU1 E;  3OA7 A;  1FZF A;  3H1H D;  1VQ5 P;  5CJ4 A;  5TIS E;  2R3S A;  4GT1 A;  3CCQ P;  2E76 C;  1Q90 D;  3GF3 A;  1SQQ G;  1SQP D;  3H1L J;  3P8M C;  1FZC C;  2Q6Q A;  1AA0 A;  2YXQ B;  1T3J A;  3O6Q B;  2W6J H;  3O8Z A;  5AW6 B;  3BCC D;  1LJ2 A;  2NZ2 A;  1BCC E;  3N7N A;  2GUV A;  2Y9Y A;  1LWU B;  2KNC A;  4IFM A;  1S1C X;  4PV1 D;  4BRY A;  5B5E H;  3H1L E;  5B66 H;  1MKM A;  1AFO A;  1SQX D;  2R32 A;  3L72 E;  1GZL A;  4U3F G;  1PGJ A;  2N1T B;  3HUS A;  1Q82 Q;  1BCC J;  1OW8 A;  2JKV A;  1H0T A;  1LTG C;  5APT A;  4I2L C;  5CCH C;  3HD7 C;  2OQQ A;  1L4A D;  2KI7 B;  2RKL A;  4RES B;  1LT9 C;  3B5N C;  2IYP A;  3GHG C;  1EZV I;  1R5S A;  5KAF H;  2C9L Y;  3N4X A;  3BCC E;  3S4R A;  4UB8 E;  4GOD A;  2FFD A;  1HBW A;  1KN7 A;  2IBZ I;  2QE7 H;  2Y0C A;  2IZ0 A;  2ZT9 B;  3AEF C;  4H44 D;  4ZKU A;  3CCR P;  3CC4 P;  3S1K A;  1HGZ A;  1SQQ K;  3GW6 A;  3L70 G;  1KOR A;  1EDI A;  1FJP A;  1OW7 A;  1EZV D;  3H25 A;  3ABV C;  2RN0 A;  4HJG H;  4IL6 E;  2OYI C;  1LT9 B;  3B5N B;  3GHG B;  1NTK G;  2WPV B;  2XND H;  2E43 A;  1VQN P;  1LTJ C;  1RE4 A;  1IO4 A;  4ZKP A;  1S5L X;  1RY3 A;  1YQ4 C;  2A06 G;  2JP3 A;  2O1K A;  3GMA A;  3C1L A;  1PPJ G;  1QVG O;  1N7S D;  2KUB A;  1GW4 A;  1SQQ E;  3Q5S A;  1RF0 A;  2ZAE B;  3KQG A;  5CHX A;  1VQ8 P;  3AE3 C;  3RK3 E;  2QSI A;  5AW1 B;  2H7H A;  2QA4 P;  5H2F E;  1FOS E;  4EDF A;  1AVO A;  2E75 D;  2HG5 D;  1HF9 A;  3TF5 A;  1ZME C;  4DOJ A;  1OVV A;  1EDJ A;  3PH0 A;  1CSB A;  2QIW A;  3L74 D;  1HVV A;  3MHV A;  4LC1 A;  1KIL E;  4OGQ C;  2WSE J;  2WPQ A;  3AED C;  1IFI A;  4DJG A;  1NTM K;  2N1T C;  1NU1 D;  3H1K D;  1DD4 A;  1NTK K;  4AYC A;  1LTJ B;  1RF0 C;  3H1K J;  1LT1 A;  1LNQ A;  2M3B A;  5KAI H;  5EFW B;  3VTP C;  2HR3 A;  3H1K G;  1H89 A;  2FFD C;  2P67 A;  1N7S C;  3I5C A;  4LGD E;  5C39 A;  1FZG A;  2ZYA A;  1AQT A;  3TYY A;  3B71 A;  1FBM A;  1IFM A;  2OAR A;  3MD0 A;  3KZI H;  5GTH E;  1SFC A;  3RL0 C;  1EQ7 A;  1P84 I;  1BGY J;  1N86 A;  2K9Y A;  2LR2 A;  3V2P A;  1LTT C;  1ZXG A;  3IN6 A;  4RJT A;  4N3Y B;  4RO0 A;  3Q2Y A;  3II6 A;  1N8R Q;  1SQV K;  1FU1 A;  3PHL A;  3VOP A;  1JY2 O;  1URQ A;  2WSE H;  1HJB A;  1MZ9 A;  2JEE A;  2A06 E;  1YTZ T;  5AW0 B;  1GK6 A;  2L5G B;  1VQP P;  1USE A;  3CI9 A;  1YQ3 C;  2M0B A;  1SQX K;  3M0D A;  2RH0 A;  1GU5 A;  1NWQ A;  2OTL P;  2JO1 A;  3HD7 A;  1M1J B;  2FYU K;  2OTK E;  1VQO P;  4IFD K;  1AQ5 A;  3OAK A;  4JF7 A;  1GU4 A;  2E5T A;  3PRJ A;  2IPP A;  3RK2 B;  3V4W A;  3L74 J;  3D70 A;  3CXH H;  2Y9Z A;  1FZB A;  2FXM A;  2B87 A;  3H1I G;  4RKU J;  1HUC A;  1SQP K;  3D71 A;  1FAV A;  1KIL B;  1ZRT E;  3RL0 g;  1BSH A;  2KS1 B;  1PIX A;  4WBA A;  4L75 A;  3S9O A;  1E5W A;  2FYZ A;  2CPB A;  1SQX E;  2P2U A;  1RE3 A;  3L72 D;  4I7Z B;  4WY4 B;  3U59 A;  3HRN A;  1KD1 Q;  1NTM G;  1Q2N A;  2E76 D;  3NFQ A;  1BE3 J;  1ZP0 C;  2HOD A;  3T97 A;  5CCG D;  1L4A B;  1KFM A;  1FDI A;  2WZ7 A; 
#chains in the Genus database with same CATH homology
 1LT9 A;  1WT6 A;  3B5N A;  3GHG A;  4LLH A;  1JTH A;  2LKM A;  3PP5 A;  2C0X A;  1VDF A;  1JY2 P;  1KIL D;  3HE5 B;  3HE4 A;  1LTS C;  1N2D C;  2I1K A;  1JUN A;  1MV8 A;  2YKQ A;  3VP8 A;  3BAS A;  1QL2 A;  3CL3 D;  5AW4 B;  3V5B A;  5CMZ A;  1IFJ A;  2NPS B;  1L4A C;  4WY4 A;  3WMM 0;  5AVV B;  2XZR A;  1CI6 A;  3CLQ A;  4N78 E;  1J1E C;  3BAT A;  1N73 B;  2OYH B;  2C9N Y;  3MTU E;  4HH2 A;  1CZQ A;  1L0L K;  1OWA A;  1RE3 C;  5AVU B;  2WT7 B;  1URQ C;  4N78 D;  2PP6 A;  2J58 A;  2H8P D;  3H32 A;  3RK3 B;  2P7J A;  3VMX A;  4C7R A;  1J1D C;  1NKZ B;  4DZO A;  1JOC A;  5AVW B;  1SLQ A;  5APV A;  2OYI A;  1JY3 O;  1DEB A;  1JMM A;  3TK1 A;  3VYI A;  2Q9I A;  3BRT B;  2XU6 A;  1URQ D;  1M1J C;  3M9H A;  3U1A A;  4EIJ A;  2A45 G;  3IR9 A;  1RF1 B;  3H6P A;  5KTB A;  4KHX A;  1H88 A;  1JNM A;  3MIW A;  1FZA A;  2YNY A;  4HYT B;  2N1T A;  1DX7 A;  4WY4 D;  5APY A;  2XNX A;  3H32 B;  3SWY A;  4JYC A;  3LW5 H;  4GIF A;  1FDM A;  2YO3 A;  3M0D C;  2Q5U A;  1FZE A;  2YKP A;  4WY4 C;  4W7Z A;  5AVY B;  2YO2 A;  4C7N A;  2C0W A;  1RF1 A;  2GM4 A;  3M9B A;  3RK3 D;  3RL0 B;  1RE4 C;  1SVF A;  3A3Y B;  3B8E B;  3NTN A;  5APS A;  1M1J A;  2QM7 A;  1CI6 B;  5CCG C;  5CCH D;  1N7S A;  3HE5 A;  2P1J A;  3R2P A;  2KP8 A;  1X8Y A;  3BVH A;  1NTZ K;  3P7K A;  3P32 A;  3E1I A;  2W6B A;  1S9K D;  2R3C A;  3L36 A;  4C7N B;  1JY3 N;  2H43 A;  2WWW A;  1YTZ I;  3G3Z A;  5APU A;  1T3U A;  4WB4 A;  4AUW A;  1NH4 A;  2MJZ A;  5KJ7 C;  1W2E A;  3HD7 D;  2HFE D;  4EOT A;  2HYN A;  3KPE A;  2Q7C A;  2N1T D;  3L35 A;  1SFC D;  4I1L A;  5AVS B;  1KIL A;  1LWU C;  5APW A;  3LID A;  1LTA C;  2WIT A;  1FZC B;  2NPS C;  5BU8 B;  5CCG A;  1FZC A;  3A7O A;  2O01 H;  1N73 C;  2OYH C;  1RF1 C;  1SFC B;  2M8R A;  1SQB K;  1NOH A;  1A02 J;  1NU1 K;  5AW7 B;  1GL2 A;  4N6J A;  2VRS A;  1LGH B;  1G2C B;  3BRV B;  1SP4 A;  2HPC A;  2XV5 A;  1HGV A;  1S9K E;  1WRG A;  1G2C A;  3VP9 A;  1FJK A;  3NMD A;  2KSJ A;  1KZU B;  2NPS A;  1J1D B;  2XDJ A;  1H8A A;  2OYI B;  1CW5 A;  1JY2 N;  1KIL C;  1LWU A;  3SWF A;  1URQ B;  3A5T A;  3TNU B;  5BVZ A;  2R5D A;  3HUS B;  2R5B A;  1NKN A;  2N9B A;  1IFN A;  1GW3 A;  1X9V A;  2YMY A;  1NHL A;  2YKO A;  2KYV A;  3V2Q A;  1HTL C;  2A45 H;  1KQL A;  1GL2 B;  2J59 M;  3V4Q A;  1OXZ A;  1XTG B;  1L0N K;  1KFN A;  1G1I A;  1M7L A;  1NO4 A;  5KJ7 D;  1LTJ A;  1ZN5 A;  2O1J A;  4I6M C;  2FFD B;  1G1J A;  2JJL A;  5AVZ B;  1IC2 A;  3B5N D;  3HD7 B;  5AW5 B;  3VN0 A;  3OJA B;  1T2K D;  5AW3 B;  1GL2 D;  3MUD A;  1JCD A;  3V2N A;  3M91 A;  5AW9 B;  2WT7 A;  2ZFC A;  1FOS F;  3LIE A;  2I1J A;  3NXS A;  3HUS C;  2IX7 C;  1JY3 P;  1Z56 A;  3V2R A;  2E42 A;  1XTC C;  5AVT B;  1DH3 A;  3U1C A;  1L4A A;  1QL1 A;  5AVR B;  3P8C D;  5APQ A;  3C9I A;  2Z4E A;  2PAJ A;  3VMY A;  3L37 A;  3RK2 C;  2WPS A;  1HWT C;  2POH A;  5AVX B;  4IFF A;  3MGN A;  2W27 A;  1LTB C;  3TSI A;  3KYQ A;  1MFZ A;  4C46 A;  5BU5 A;  5AW2 B;  1T2K C;  3RL0 D;  1T8Z A;  2WSC H;  2GUS A;  1J2J B;  3TNU A;  2KOG A;  5APX A;  2WTY A;  3HTK A;  1IFD A;  4Y99 C;  2Q3I A;  2KB7 P;  3VMZ A;  4B86 A;  5CCH A;  2BAS A;  4JYB A;  5KJ7 A;  2XKM A;  2Z5I A;  1YYC A;  2HLO A;  1J1E B;  3M0A A;  2Z5H A;  1LTI C;  1HH0 A;  4GKG A;  3RK3 C;  5AVQ B;  2KLV A;  4Y99 B;  3HE4 B;  2CPS A;  1GTW A;  2A45 I;  3P8C E;  1IK9 A;  1JTH B;  3A2A A;  1JO5 A;  2IFM A;  1X79 B;  1VPC A;  2HOD B;  2W6A A;  1ZR2 A;  3HTK B;  1PFI A;  1N73 A;  2OYH A;  4O9B A;  5KLV K;  2WSF H;  4XE5 B;  1GD2 E;  3EQ2 A;  2HPC B;  2FKW B;  2WPR A;  1SFC C;  5AW8 B;  3KDP B;  3RK2 D;  1GK4 A;  1ZLL A;  2IFN A;  2QM8 A;  4W80 A;  1ZV8 A;  3UIA A;  2NPS D;  1NAF A;  3M06 A;  1IJD B;  1JCC A;  3L4F A;  1N7S B;  1GL2 C;  2ZXE B;  4AQR D;  4OH8 B;  1A02 F;  3IFM A;  4M3L A;  1ZR4 A;  1N7L A;  5CJ0 A;  4XA4 A;  3OA7 A;  3M9Q A;  1FZF A;  1MUU A;  5CJ4 A;  1GDT A;  4GT1 A;  1FZC C;  3P8M C;  1T3J A;  3O8Z A;  5AW6 B;  4IFM A;  3N7N A;  2E43 A;  2GUV A;  1LWU B;  1AFO A;  2R32 A;  1FZG A;  1GZL A;  3HUS A;  2N1T B;  1LTG C;  5APT A;  4I2L C;  5CCH C;  3HD7 C;  1L4A D;  4RES B;  1LT9 C;  3B5N C;  3GHG C;  2C9L Y;  3N4X A;  2FFD A;  1HBW A;  4ZKU A;  1HGZ A;  1SQQ K;  1FJP A;  2OYI C;  1LT9 B;  3B5N B;  3GHG B;  1LTJ C;  1RE4 A;  1IO4 A;  4ZKP A;  1RY3 A;  2O1K A;  1N7S D;  1GW4 A;  1RF0 A;  3KQG A;  5CHX A;  5AW1 B;  2H7H A;  1FOS E;  2HG5 D;  4DOJ A;  4W7Y A;  1CSB A;  1HVV A;  4LC1 A;  2WPQ A;  1IFI A;  1NTM K;  2N1T C;  1NTK K;  4AYC A;  1LTJ B;  1RF0 C;  2M3B A;  3VTP C;  1H89 A;  2FFD C;  2P67 A;  1N7S C;  3I5C A;  4LGD E;  3TYY A;  1FBM A;  1IFM A;  2OAR A;  3MD0 A;  1SFC A;  3RL0 C;  1EQ7 A;  1N86 A;  3V2P A;  1LTT C;  4N3Y B;  3II6 A;  1SQV K;  1FU1 A;  3VOP A;  1JY2 O;  1URQ A;  2WSE H;  1HJB A;  1MZ9 A;  2JEE A;  1YTZ T;  5AW0 B;  1GK6 A;  2L5G B;  3CI9 A;  1SQX K;  3M0D A;  1NWQ A;  1GU5 A;  1KFM A;  3HD7 A;  1M1J B;  2FYU K;  4IFD K;  1AQ5 A;  3OAK A;  4JF7 A;  1GU4 A;  2IPP A;  3RK2 B;  3V4W A;  1FZB A;  2FXM A;  1HUC A;  1SQP K;  1FAV A;  1KIL B;  4WBA A;  1E5W A;  2FYZ A;  2CPB A;  4WY4 B;  2P2U A;  1RE3 A;  3U59 A;  3HRN A;  3T97 A;  3NFQ A;  5CCG D;  2HOD A;  1L4A B;  3EFG A;  2WZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...