5BU5A

Hk620 tail needle crystallized at ph 9 (crystal form i)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
174
structure length
174
Chain Sequence
QVKNDEQDVELADHDARIAANTKAINILEVRLTTAEGKIVVLRSDVDYLLDEVIDIQAHLVTVDQRLDGVESDVSDIKSDYVSKTVTESQSLASPLDVKTSYSVDGIQVVGARQTGWTAATGTPLLGSFNANQSYTVGTTYTQSEVAALATGLEQARQRILALETALRLHGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity of the Protein Plug That Traps Newly Packaged Genomes in Podoviridae Virions.
pubmed doi rcsb
source organism Enterobacteria phage hk620
molecule tags Viral protein
molecule keywords DNA stabilization protein
total genus 56
structure length 174
sequence length 174
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5bu5A01
4GIFA 4N78D 4O9BA 1NKNA 1WT6A 3P8CD 3BATA 3N4XA 5KTBA 3VP8A 3U1CA 3N7NA 3BASA 2POHA 4N3YB 3HRNA 2JEEA 3OJAB 5BU5A 3U59A 5BU8B 5BVZA 3VP9A 3U1AA 4ZKUA 4I1LA 3C9IA 1X79B 2FXMA 4ZKPA 1IC2A
chains in the Genus database with same CATH superfamily
1S5LX 1LT1A 3HE4B 1LNQA 1RF0C 5AW3B 1E5WA 1SQVG 1XTCC 3AEDC 1N7SC 3MGNA 4GKGA 5AW8B 1PPJE 1ZLLA 2E74D 3CI9A 3KYQA 1HF9A 1Q2NA 2KLVA 1LWUB 2P58A 3HD7A 1GW4A 2ZT9D 1TU3F 2SPZA 2POHA 3BASA 3M06A 4N3YB 2WPQA 4ZMDA 2K37A 2J59M 1KV4A 1RE3C 2Z4EA 2FYZA 1SQPG 1FE6A 2C0XA 4N78E 5APWA 3WU2H 1N73C 3IN6A 3AE6C 2FY8A 1VQ6P 3L4FA 5BU8B 1SFCC 5BVZA 1VQ8P 1USDA 1L0LD 2Y9YA 1S1CX 4N6JA 4OGQB 1FZCA 1RF0A 5KJ7C 1A02J 1URQD 1X22A 1CI6A 1PGQA 1BGYG 1URQA 2E5YA 4EDFA 1L0LJ 1M1JC 2M0BA 3A2AA 1SQVK 4H13B 4ZKPA 1K04A 2GM4A 3D70A 1NTME 1OIPA 2M5AB 3AEEC 1S3JA 2V7QJ 3HE5A 2NRGA 5KAIE 4O9BA 4U3FG 1X0TA 3G3ZA 1K05A 1ZP0C 2YKPA 3B5NA 1VQ7P 1JCDA 1KQGB 1YTZI 1PGPA 3BATA 3MD0A 1JY3N 1LTBC 3P32A 4W7ZA 3V6IA 1SS1A 2BEZF 2P10A 5KLIB 1SFCD 1N7SB 1FS0E 4RESB 1SFCA 4PJ0H 3IFMA 2CPBA 5APSA 2HPCA 1Z56A 4YTPC 3CCVP 2QRXA 1FZEA 5TISE 5KJ7A 1W5CE 1ZOYC 2B89A 5BU5A 2Z5HA 3GLMA 3MHVA 1MFZA 3UIAA 3H6PA 3RGUA 4JBZA 5AW7B 2W8ZA 2IDBA 1HGVA 1J2JB 4UB8H 1BDDA 1NTMK 3E1RA 3SWFA 3L74D 1NOHA 3CXHH 1OVRA 2AXCA 5L8RJ 3LW5J 1OW6A 3H1KG 4IFMA 1VQ9P 1M7LA 3A7OA 1SQXJ 1KB9D 3NTNA 4L75A 2KK7A 2WPSA 2Y0EA 1JUNA 1NTZD 2W6AA 4WY4D 1NTKJ 2Q5UA 4EYYQ 1JNMA 2FYUE 4HKZH 1RE4A 1VQ4P 1R5SA 1YQ4C 3HE4A 4GOEA 2O1JA 4PV1C 2XU6A 5KKZB 5TISH 1L0ND 1HH0A 1VQNP 3L75E 1ZRTE 1DD4A 2KP8A 3VN0A 5APVA 1VQLP 3CXHD 4JYBA 1H88A 5H2FH 5E79E 1NU1K 1M1KQ 1L0NJ 3HRNA 3VMAA 3H1LE 3O6QA 1JY2O 2H8PD 1NTMG 3EFFK 3WUVA 1G1JA 3H1KJ 3C9IA 3P8CE 3W68A 5KLVG 2XKMA 1G2CB 1IZNB 2KI7B 3CCMP 3E7KA 1AV1A 2Q3IA 4IL6E 1SQBE 1SQQE 2XNXA 3H1LD 4DT0A 1EZVE 4MN4C 2KOGA 3A0BE 3NXSA 1IK9A 1YITP 4RKUJ 5AW5B 4GIFA 1OVVA 4H13D 3V2QA 2JKVA 2ZT9C 2NPSC 3CX5D 4AQRD 1HTLC 2KLUA 2RMZA 3M9BA 1MUUA 3L35A 3P8CD 3GHGC 3CMEP 1IFPA 2N9BA 2YKOA 3R2PA 2KIKA 1IK7A 3MZWB 1N73B 1U57A 3VMZA 1UIXA 2QIWA 3H1JJ 1EDKA 5AVXB 1R8EA 3EWKA 2IBZG 4CPGA 3VYIA 3S4RA 2P2UA 2Z5IA 4WY4B 2FFDC 4U3FD 2JDIH 1KTMA 1CZQA 3A0HE 5AVVB 1QX8A 4LGDE 3GHGB 2BCCG 1LP1B 1U7JA 2C9NY 1SQBK 1SQQK 3U1AA 3A0BH 4H0LC 2KZJA 1Y47A 2B9BA 4H13C 5B5EE 1L4AC 2KSJA 1Q90D 2IZ1A 3M9QA 2Y9ZA 2KB7P 1LTIC 3II6A 3JCUH 1KC8Q 1JTHB 1BE3G 1YQ3C 3TGUJ 3L70D 5AVYB 1PZQA 3CX5H 3L72E 2JWDA 4RJTA 1SQPD 3L72J 1S2EA 2B88A 1URQC 2V7QH 4IFDK 1GL2A 1NH4A 2WSEH 3L71E 2HPCB 1FZCB 1FOSE 3T97B 1OW7A 4AUWA 3AE9C 4YPCA 5APYA 1MZ9A 4KT0J 3AEFC 3AE2C 4OGQC 5AW6B 5KLVJ 3D71A 1BSHA 1VF5B 3RL0C 2IFMA 2JEEA 2ZFCA 1SP4A 2YNYA 3GMAA 2IBZD 1OFCX 2RN0A 1SQPE 3L72D 5DJTB 1GK4A 1T8ZA 1BCCG 2HLOA 3CL3D 1L0NG 1SQXG 2AXTE 3L70J 4H44D 5CCGD 4ZKUA 1PPJD 3RK3C 5M1BA 1T2KC 3B5ND 1KYOH 1MFTA 2BCCD 2R5BA 5KLVE 2KZIA 3FXEA 2ZXEB 2WPRA 1JY2P 3V4WA 1AQ5A 2WMMA 3H1JG 4I2LC 1LWUA 2E76C 2E75B 4PD4I 5C39A 3Q5SA 2WWWA 1HBWA 4Y99B 1NU1J 3NFQA 1L0LK 5DJUB 1ZR2A 4EOTA 1FBMA 2HYNA 1YJ9P 1JM0A 1NTKD 2R44A 1KILD 1PV3A 3H32A 3TGUE 2WSFJ 3CCUP 3D6YA 2WSFH 2P67A 5KLVD 5CCGC 1T6AA 1NU1G 1SQVD 3V4QA 2OYIA 4JF7A 4BRYA 1LJ2A 3P8MC 4C46A 1VQOP 2OGUA 2IX7C 2N1TC 1RHZB 2YXQB 2QJPB 4W7YA 3L74G 5KAFH 1RE4C 2H89C 3OAKA 3CCLP 3RK2B 1SQXK 1BE3D 2Q3EA 4JPZB 2BEQD 5KAIH 3HD7B 3Q5RA 2YKQA 1IO4A 1G1IA 1NTZE 3G71P 4WY4A 4JQ0D 4PD4H 1NU1E 3HE5B 3GG2A 2OQQA 5AW2B 2CK3H 3RK3E 3H1LJ 1QVGO 5EFWB 3EQ2A 1FDOA 3JCUE 3KZIH 5AW0B 1RF1B 1JY2N 1KN7A 1LTJA 1KORA 3A3YB 3CWBJ 3HUSA 4IL6X 4UB6E 2OYHA 3Q2YA 3TNUB 3D6ZA 3TDKA 2ZXXA 1BGYD 1KYOI 2N1TD 2Y0CA 2N1TA 3H25A 2WSEJ 4I6MC 5CJ4A 1NJIQ 2IYOA 3IR9A 5B66E 1S4XA 2L91A 3L75G 1SQXE 1ZW0A 2WPVB 1P84H 2IPPA 1NTZK 4WY4C 2FFDB 3QH9A 4HB1A 2IFNA 2QM7A 5KLIC 3S1KA 1EDLA 1JCCA 5CBOA 1LTTC 2ITAA 3V2PA 4WB4A 3H1LG 1QL1A 3OJAB 1PFIA 2FYUD 1J1DC 3KXDA 1KD1Q 2QJKC 3B5NC 1KMIZ 3AE5C 1L0NE 3H1ID 2WSSH 2WSCH 2ZT9B 3H1IG 1N7LA 5APUA 1WRGA 2JR8A 4EIJA 4WWIA 3F89A 2WT7A 3JC22 2PAJA 3GW6A 3BRVB 2KS1B 2K1AA 2Q1KA 5APTA 3TK1A 5APXA 1IJDB 1HJBA 5AVTB 2G3AA 2Q9IA 2OYOA 2A45I 1RE3A 1DEBA 2OARA 1EZVG 2QJKB 1AQTA 3MTUE 4OH8B 1EDJA 3KPEA 2QSIA 2BASA 2YO2A 3H1IE 2QE7H 3ITKA 2WTYA 1VQPP 3VTPC 1E79H 2WQYC 5CJ0A 2WSCJ 2YIUB 3P7KA 4JYCA 1Q81Q 3CWBE 1KFMA 3N7NA 1CSBA 2FBWC 1LTAC 3OA7A 1NYHA 4M3LA 1RY3A 5AW1B 3RK3B 2HODB 2E43A 2NZ2A 2C0WA 2IZ0A 1K9MQ 3H1IJ 2R32A 3RBZA 3BRTB 3L70E 5KJ7D 3U59A 1YI2P 1M1JB 2ZJSE 4GOFA 1GTWA 1YHQP 1NO4A 1H89A 1FDIA 4PV1D 1FZFA 2ZVOB 1GL2D 1OZHA 2GUVA 2P7JA 2M3BA 4NPEA 1RF1A 1YJWP 1IC2A 3WUUA 3B71A 1LGHB 2E5TA 1NVOA 2M8RA 3MUDA 2E76D 4TT3H 1FC2C 4N78D 3TNUA 1JB0J 3L72G 1NKNA 4H44B 3L37A 3L71G 1H0TA 3QWOC 1JOCA 1LP1A 1L0LE 3I5CA 3FWLA 1FZAA 3IF4A 3M91A 4PJ0E 4AYCA 3U1CA 1W2BO 1FZGA 2KXPB 4ASVA 3AECC 1RQVA 5GTIH 3BCCE 1YJNP 2FXPA 2C9LY 1OW8A 4TLFA 1JMBA 4BWNA 2ZYDA 2GA1A 1NTMD 1QL2A 2R3CA 3KHUA 3R4YA 3V2RA 1IFIA 2ZAEB 4EI2A 3HTKB 1NTKE 1HWTC 3ABVC 1PPJG 2O1KA 1M8OB 3NMDA 4BRYB 3G4SP 1GU4A 3C8VA 3CXHI 4IFFA 1JMMA 1NGMB 3JSVC 1ZMEC 1PP9E 2JP3A 2VRSA 3BVHA 2RH0A 2UWJE 3I55P 1K8AQ 1EDIA 1IFMA 2O3JA 2WZ7A 2MJZA 3L71J 3CCJP 2AXTH 1FU1A 2KS1A 2XV5A 1NTKG 1NTZJ 3SWYA 1LTJC 3HUSC 1YYCA 3WMM0 1S9KE 2OYHC 1JTHA 2R3SA 2JJLA 1NU1D 2QM8A 2FYNB 4H0LD 1YIJP 5E79H 1OXZA 3L74E 5H2FE 2YO3A 1IFDA 1KYOD 1JY3P 5B66H 1DEEG 1USEA 2H7HA 1AVOA 2K88A 2OTJP 3V2NA 5KLVK 2HODA 1KILE 1PL5A 2QG4A 2WT7B 1S9KD 4DZOA 3AEBC 2H43A 2KSEA 1N7SA 2NPSA 3B8EB 1QEXA 1N7SD 2E74C 2W90A 1SQVE 2LR2A 2ZVNB 3KDPB 3L73D 4XE5B 1GDTA 2N9YB 2A45H 1LT9A 1SQXD 3H1HG 4R4LA 2GUSA 3F5HA 1ZRTD 3CCRP 1L4AB 4L74A 1VDFA 2QJYC 3CXHE 1S5LH 1BE3E 1FJPA 1QVFO 3RL0D 1WMKA 2G8YA 1N86A 2O01N 4OVNF 3C1LA 1RH5B 1SQPJ 4PD4E 1DIPA 3T97A 3VMXA 1Q82Q 4GT1A 3RK3D 3PP5A 3TF5A 4H44C 2IYPA 3O6QB 2E76B 3G9RA 1SQQJ 1SQBJ 1N2DC 1MV8A 3VP8A 1OMIA 2YMKA 1HVVA 2Q6QA 3HD7D 1QGKB 3VMYA 5AW4B 1EC5A 1M1JA 1OX3A 3RL0g 4U7JA 2KNCA 1P84I 3S9OA 1J1EB 3CMAP 1SQQD 1BGYE 1SQBD 1IFNA 1W2EA 1SQQG 1LT9C 1SQBG 2AEFA 1NHLA 3M0DC 2K9JB 2KUBA 1D7MA 2J58A 3AE1C 4HYTB 4LC1A 4QMAA 1S72P 3BCCJ 3LIEA 5CCGA 2OYIC 3RK2C 3CCEP 4YXDC 1AVYA 2D2CB 3AE7C 4IL6H 1PP9G 4NPDA 4GDOA 3L75J 2FYUK 4UB8E 1KQSO 1VQKP 3CC2P 3I56P 2I1JA 2WITA 3PH0A 1N8RQ 1DX7A 1CI6B 1URQB 2E74B 4D6TE 1Q7YQ 3CD6P 1GW3A 3CLQA 2OTLP 1JO5A 4HH2A 2HR3A 3TGUG 2LXBA 1KQFB 3KQGA 3WU2E 3L36A 3AE4C 4K3AA 4WBAA 3L73G 5CHXA 4ZNCA 1LTSC 1M56D 3CPWO 2N1TB 3H1JE 1ZV8A 3H1HJ 4OWFA 5GTIE 1EXIA 3H1HE 1PGJA 4D6TG 2Y0DA 1L0NK 2XZRA 4D6TD 2PFXA 1SFCB 3H1KD 1JY3O 3BCCD 1NWQA 1M90Q 1IFJA 1KB9I 3MIWA 2A06D 3L70G 3AEGC 1KILB 4Y99C 1T2KD 4D6TJ 1BSNA 4I1LA 1VL2A 2HG5D 3L71D 1S5LE 2FKWB 1BCCD 4C7RA 5CCHC 5B5EH 1NTKK 4W80A 3H1KE 5AVSB 2JWAA 4I7ZC 5APQA 1AFOA 1EZVI 1FJKA 3A5TA 1SLQA 1CW5A 2FXOA 1NTMJ 1RQUA 3PRJA 1BCCE 3MP7B 1BGYJ 1KZUB 2I8DA 2D2CD 1GMJA 2P1JA 3VOPA 1VF5D 5CBNA 3SFDC 1JEKA 1PP9D 4I7ZB 5AVZB 1J1EC 1XTGB 2YIUC 2YMYA 3USSA 2QVAA 2K3RA 1AA0A 2LXCB 5CCHA 2FYUJ 1AJYA 5CCHD 3B5NB 4K35A 1J1DB 1OVUA 1EQ7A 2KYVA 3B4SA 4KHXA 1NKZB 2YXRB 3FWNA 2O01J 3CX5I 4LLHA 3TYYA 3V5BA 3VP9A 3H32B 2LKMA 3PHLA 2A45G 2H88C 1Y8AA 2CPSA 1X79B 5AVQB 1LTGC 1HGZA 3Q5PA 3Q3DA 2OYIB 1G2CA 2ZYAA 1FDMA 5K5GB 2IBZE 1PGOA 1ZN5A 1EXJA 2NPSB 4U3FJ 2ZYGA 1BDCA 1NTZG 1WT6A 2KNCB 1LT9B 1Y9BA 2BCCE 2R5DA 2O01H 2NPSD 3K5BA 1L4AA 1ZXGA 2XNDH 3L73E 2E42A 1SVFA 4XA4A 1SQPK 3RBXA 2RKLA 2HFED 5AVRB 3TSIA 1RF1C 2DW3A 2OTKE 1H8AA 1T3UA 4C7NB 4OGQD 2J5UA 1LTJB 2M3EA 3HUSB 3MUDC 4B86A 1FZCC 2OYHB 1DD3A 4GODA 2AEJA 2M5AA 3FXDA 3WUTA 3RK2D 3ZDMA 4ASWA 3TGUD 1Q86Q 1GZLA 4KJMA 2W6JH 3GHGA 1GD2E 2XDJA 2PGDA 4H0LB 4UB6H 3M0DA 4C7NA 5KKZC 1P84D 3HTKA 1KYOE 1PIXA 1GK6A 2FXMA 1L2PA 1HUCA 3BCCG 3SSUA 1YBKA 5GTHH 4NPFX 1OWAA 3AEAC 1VPCA 1KFNA 3SFEC 2FFDA 5CMZA 1ZR4A 2FYUG 2B87A 3LIDA 3GF3A 1QLED 2IBZI 3A0HH 1L0LG 3GF7A 4A7PA 4DCKA 1BE3J 1P84E 1M57D 1YTZT 1GL2B 2W6BA 3FGAD 4XFJA 1X9VA 5AW9B 1KILC 2WVRA 5KAFE 1LWUC 1R5LA 2B87B 1KB9E 2PRRA 2W27A 4HJGH 3O8ZA 1SQVJ 1FAVA 3FX0A 4WVZA 5AVUB 1GU5A 4PD4D 3RL0B 3OW2O 5TJHA 5KTBA 5GTHE 3CX5E 3M0AA 1A02F 1GL2C 1NAYA 3L75D 2Q7CA 4YXWH 3CWBD 3L74J 3PTZA 1MKMA 3CWBG 1FZBA 1UIIA 4DOJA 3CC4P 3H1HD 3KZIE 3IAOA 2I1KA 2BCCJ 4Y28J 4IOIH 4R4MA 1KILA 4U3FE 3W67A 2E75D 2AEMA 3CCQP 1VQ5P 3AE3C 2A06E 2V4HA 3EFGA 1VF5C 4Z1MH 2D2CC 1KB9H 3SWKA 2QA4P 3N4XA 1VQMP 2FYNC 3LW5H 2QJPC 2JO1A 4PV1B 1U7MA 1X8YA 1PP9J 1EZVD 3CC7P 3CCSP 3AE8C 1KQLA 4DJGA 2A06G 1DH3A 3HD7C 5AVWB 1L4AD 4BXLA 1K73Q 3Q1MA 3E1IA 3PLNA 1T3JA 3H1JD 3M9HA 4RO0A 2E75C 2L5GB 2K9JA 4L76A 2QEXP 2PP6A 1FOSF 1H0TB 3G6EP 1N73A 4L73A 3L73J 1NAFA 3PJSK 2MKVA 1HJ0A 2QJYB 2K9YA 2W83C 1BCCJ
chains in the Genus database with same CATH topology
3HE4B 1RF0C 5AW3B 1E5WA 1XTCC 1N7SC 3MGNA 4GKGA 5AW8B 3KYQA 1ZLLA 3CI9A 2KLVA 1LWUB 3HD7A 1FOSF 1GW4A 3BASA 2POHA 3M06A 4N3YB 2WPQA 2J59M 1RE3C 2Z4EA 2FYZA 4N78E 2C0XA 5APWA 1N73C 3L4FA 5BU8B 1SFCC 5BVZA 4N6JA 1FZCA 1A02J 1RF0A 5KJ7C 1URQD 1CI6A 1URQA 1M1JC 3A2AA 1SQVK 4ZKPA 2GM4A 3HE5A 4O9BA 3G3ZA 2YKPA 3B5NA 1JCDA 3BATA 1YTZI 3MD0A 3P32A 1JY3N 1LTBC 4W7ZA 1SFCD 1N7SB 4RESB 1SFCA 3IFMA 2CPBA 5APSA 2HPCA 1Z56A 1FZEA 5KJ7A 5BU5A 2Z5HA 1MFZA 3UIAA 3H6PA 5AW7B 1HGVA 1J2JB 1NTMK 3SWFA 1NOHA 4IFMA 1M7LA 3A7OA 3NTNA 2WPSA 1JUNA 2W6AA 4WY4D 2Q5UA 1JNMA 1RE4A 3HE4A 2O1JA 2XU6A 1HH0A 2KP8A 3VN0A 5APVA 1H88A 4JYBA 1NU1K 3HRNA 1JY2O 2H8PD 1G1JA 3C9IA 3P8CE 2XKMA 1G2CB 2Q3IA 2XNXA 2KOGA 3NXSA 1IK9A 5AW5B 4GIFA 3V2QA 4AQRD 2NPSC 1HTLC 3M9BA 1MUUA 3L35A 3P8CD 3GHGC 2N9BA 2YKOA 3R2PA 1N73B 3VMZA 5AVXB 3VYIA 2P2UA 2Z5IA 4WY4B 2FFDC 1CZQA 5AVVB 4LGDE 3GHGB 2C9NY 1SQBK 1SQQK 3U1AA 1L4AC 2KSJA 3M9QA 2KB7P 1LTIC 3II6A 1JTHB 5AVYB 1URQC 4IFDK 1GL2A 1NH4A 2WSEH 2HPCB 1FZCB 1FOSE 4AUWA 5APYA 1MZ9A 5AW6B 3RL0C 2IFMA 2JEEA 2ZFCA 1SP4A 2YNYA 1GK4A 1T8ZA 2HLOA 3CL3D 5CCGD 4ZKUA 1T2KC 3RK3C 3B5ND 2R5BA 2ZXEB 2WPRA 1JY2P 3V4WA 1AQ5A 1HBWA 4I2LC 1LWUA 2WWWA 4Y99B 3NFQA 1L0LK 1ZR2A 4EOTA 1FBMA 2HYNA 3H32A 1KILD 2WSFH 2P67A 5CCGC 3V4QA 2OYIA 4JF7A 3P8MC 4C46A 2IX7C 2N1TC 4W7YA 1RE4C 3OAKA 3RK2B 1SQXK 3HD7B 2YKQA 1IO4A 1G1IA 4WY4A 3HE5B 3EQ2A 5AW0B 1RF1B 1JY2N 1LTJA 3HUSA 3A3YB 2OYHA 3TNUB 2N1TD 2N1TA 4I6MC 5CJ4A 3IR9A 2IPPA 4WY4C 1NTZK 2FFDB 2IFNA 2QM7A 1JCCA 1LTTC 3V2PA 4WB4A 1QL1A 3OJAB 1PFIA 1J1DC 3B5NC 5APUA 2WSCH 1N7LA 1WRGA 4EIJA 2WT7A 2PAJA 3BRVB 5APTA 3TK1A 5APXA 1IJDB 1HJBA 5AVTB 2Q9IA 5AW2B 2A45I 1RE3A 1DEBA 2OARA 4OH8B 3MTUE 3KPEA 2YO2A 2BASA 2WTYA 3VTPC 5CJ0A 3P7KA 4JYCA 1KFMA 3N7NA 1CSBA 3OA7A 1LTAC 4M3LA 5AW1B 1RY3A 3RK3B 2HODB 2E43A 2C0WA 2R32A 3BRTB 5KJ7D 3U59A 1M1JB 1GTWA 1NO4A 1H89A 1FZFA 1GL2D 2GUVA 2P7JA 2M3BA 1RF1A 1IC2A 1LGHB 2M8RA 3MUDA 3TNUA 4N78D 1NKNA 3L37A 1JOCA 3I5CA 1FZAA 4AYCA 3M91A 3U1CA 1FZGA 1CW5A 2C9LY 1QL2A 2R3CA 3V2RA 1IFIA 3HTKB 1HWTC 2O1KA 3NMDA 1GU4A 4IFFA 1JMMA 2VRSA 3BVHA 1IFMA 2WZ7A 2MJZA 1FU1A 2XV5A 3SWYA 1LTJC 3HUSC 1YYCA 3WMM0 1S9KE 2OYHC 1JTHA 2JJLA 2QM8A 1OXZA 2YO3A 1IFDA 1JY3P 2H7HA 3V2NA 5KLVK 2HODA 2WT7B 1S9KD 4DZOA 2H43A 3B8EB 1N7SA 2NPSA 2E42A 1N7SD 3KDPB 4XE5B 1GDTA 2A45H 1LT9A 2GUSA 1L4AB 1VDFA 1FJPA 3RL0D 1N86A 3T97A 3VMXA 4GT1A 3RK3D 3PP5A 1N2DC 5KTBA 1MV8A 3VP8A 3HD7D 1HVVA 3VMYA 5AW4B 1M1JA 1J1EB 1W2EA 1IFNA 1LT9C 1NHLA 3M0DC 2J58A 4HYTB 4LC1A 3LIEA 5CCGA 2OYIC 3RK2C 2FYUK 2I1JA 2WITA 1DX7A 1CI6B 1URQB 1JO5A 1GW3A 3CLQA 4HH2A 3KQGA 3L36A 4WBAA 5CHXA 1LTSC 2N1TB 1ZV8A 1L0NK 2XZRA 1SFCB 1JY3O 1NWQA 1IFJA 3MIWA 1KILB 4Y99C 1T2KD 4I1LA 2HG5D 2FKWB 4C7RA 5CCHC 1NTKK 4W80A 5AVSB 5APQA 1AFOA 1FJKA 3A5TA 1SLQA 1KZUB 2P1JA 3VOPA 5AVZB 1J1EC 1XTGB 2YMYA 5CCHA 5CCHD 3B5NB 1J1DB 1EQ7A 2KYVA 4KHXA 1NKZB 4LLHA 3V5BA 3VP9A 3H32B 2LKMA 2A45G 2CPSA 1X79B 5AVQB 1LTGC 1HGZA 1FDMA 1G2CA 1ZN5A 2NPSB 1WT6A 1LT9B 2R5DA 2O01H 2NPSD 1L4AA 1SVFA 4XA4A 1SQPK 3TSIA 2HFED 5AVRB 1RF1C 1H8AA 1T3UA 4C7NB 1FZCC 1LTJB 3HUSB 4B86A 2OYHB 2OYIB 3RK2D 1GZLA 3GHGA 1GD2E 2XDJA 4C7NA 3M0DA 3HTKA 1GK6A 2FXMA 1HUCA 1OWAA 1VPCA 1KFNA 2FFDA 5CMZA 1ZR4A 3LIDA 1YTZT 1GL2B 2W6BA 5AW9B 1X9VA 1KILC 1LWUC 2W27A 3O8ZA 1FAVA 5AVUB 1GU5A 3RL0B 3M0AA 1A02F 1GL2C 2Q7CA 4DOJA 1FZBA 2I1KA 1KILA 3EFGA 3N4XA 3LW5H 1X8YA 1KQLA 1DH3A 3HD7C 5AVWB 1L4AD 3E1IA 1T3JA 3M9HA 2L5GB 2PP6A 1N73A 1NAFA 3TYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GIF A;  4N78 D;  4O9B A;  1NKN A;  1WT6 A;  3P8C D;  3BAT A;  3N4X A;  5KTB A;  3VP8 A;  3U1C A;  3N7N A;  3BAS A;  2POH A;  4N3Y B;  3HRN A;  2JEE A;  3OJA B;  5BU5 A;  3U59 A;  5BU8 B;  5BVZ A;  3VP9 A;  3U1A A;  4ZKU A;  4I1L A;  3C9I A;  1X79 B;  2FXM A;  4ZKP A;  1IC2 A; 
#chains in the Genus database with same CATH topology
 1S5L X;  1LT1 A;  3HE4 B;  1LNQ A;  1RF0 C;  5AW3 B;  1E5W A;  1SQV G;  1XTC C;  3AED C;  1N7S C;  3MGN A;  4GKG A;  5AW8 B;  1PPJ E;  1ZLL A;  2E74 D;  3CI9 A;  3KYQ A;  1HF9 A;  1Q2N A;  2KLV A;  1LWU B;  2P58 A;  3HD7 A;  1GW4 A;  2ZT9 D;  1TU3 F;  2SPZ A;  2POH A;  3BAS A;  3M06 A;  4N3Y B;  2WPQ A;  4ZMD A;  2K37 A;  2J59 M;  1KV4 A;  1RE3 C;  2Z4E A;  2FYZ A;  1SQP G;  1FE6 A;  2C0X A;  4N78 E;  5APW A;  3WU2 H;  1N73 C;  3IN6 A;  3AE6 C;  2FY8 A;  1VQ6 P;  3L4F A;  5BU8 B;  1SFC C;  5BVZ A;  1VQ8 P;  1USD A;  1L0L D;  2Y9Y A;  1S1C X;  4N6J A;  4OGQ B;  1FZC A;  1RF0 A;  5KJ7 C;  1A02 J;  1URQ D;  1X22 A;  1CI6 A;  1PGQ A;  1BGY G;  1URQ A;  2E5Y A;  4EDF A;  1L0L J;  1M1J C;  2M0B A;  3A2A A;  1SQV K;  4H13 B;  4ZKP A;  1K04 A;  2GM4 A;  3D70 A;  1NTM E;  1OIP A;  2M5A B;  3AEE C;  1S3J A;  2V7Q J;  3HE5 A;  2NRG A;  5KAI E;  4O9B A;  4U3F G;  1X0T A;  3G3Z A;  1K05 A;  1ZP0 C;  2YKP A;  3B5N A;  1VQ7 P;  1JCD A;  1KQG B;  1YTZ I;  1PGP A;  3BAT A;  3MD0 A;  1JY3 N;  1LTB C;  3P32 A;  4W7Z A;  3V6I A;  1SS1 A;  2BEZ F;  2P10 A;  5KLI B;  1SFC D;  1N7S B;  1FS0 E;  4RES B;  1SFC A;  4PJ0 H;  3IFM A;  2CPB A;  5APS A;  2HPC A;  1Z56 A;  4YTP C;  3CCV P;  2QRX A;  1FZE A;  5TIS E;  5KJ7 A;  1W5C E;  1ZOY C;  2B89 A;  5BU5 A;  2Z5H A;  3GLM A;  3MHV A;  1MFZ A;  3UIA A;  3H6P A;  3RGU A;  4JBZ A;  5AW7 B;  2W8Z A;  2IDB A;  1HGV A;  1J2J B;  4UB8 H;  1BDD A;  1NTM K;  3E1R A;  3SWF A;  3L74 D;  1NOH A;  3CXH H;  1OVR A;  2AXC A;  5L8R J;  3LW5 J;  1OW6 A;  3H1K G;  4IFM A;  1VQ9 P;  1M7L A;  3A7O A;  1SQX J;  1KB9 D;  3NTN A;  4L75 A;  2KK7 A;  2WPS A;  2Y0E A;  1JUN A;  1NTZ D;  2W6A A;  4WY4 D;  1NTK J;  2Q5U A;  4EYY Q;  1JNM A;  2FYU E;  4HKZ H;  1RE4 A;  1VQ4 P;  1R5S A;  1YQ4 C;  3HE4 A;  4GOE A;  2O1J A;  4PV1 C;  2XU6 A;  5KKZ B;  5TIS H;  1L0N D;  1HH0 A;  1VQN P;  3L75 E;  1ZRT E;  1DD4 A;  2KP8 A;  3VN0 A;  5APV A;  1VQL P;  3CXH D;  4JYB A;  1H88 A;  5H2F H;  5E79 E;  1NU1 K;  1M1K Q;  1L0N J;  3HRN A;  3VMA A;  3H1L E;  3O6Q A;  1JY2 O;  2H8P D;  1NTM G;  3EFF K;  3WUV A;  1G1J A;  3H1K J;  3C9I A;  3P8C E;  3W68 A;  5KLV G;  2XKM A;  1G2C B;  1IZN B;  2KI7 B;  3CCM P;  3E7K A;  1AV1 A;  2Q3I A;  4IL6 E;  1SQB E;  1SQQ E;  2XNX A;  3H1L D;  4DT0 A;  1EZV E;  4MN4 C;  2KOG A;  3A0B E;  3NXS A;  1IK9 A;  1YIT P;  4RKU J;  5AW5 B;  4GIF A;  1OVV A;  4H13 D;  3V2Q A;  2JKV A;  2ZT9 C;  2NPS C;  3CX5 D;  4AQR D;  1HTL C;  2KLU A;  2RMZ A;  3M9B A;  1MUU A;  3L35 A;  3P8C D;  3GHG C;  3CME P;  1IFP A;  2N9B A;  2YKO A;  3R2P A;  2KIK A;  1IK7 A;  3MZW B;  1N73 B;  1U57 A;  3VMZ A;  1UIX A;  2QIW A;  3H1J J;  1EDK A;  5AVX B;  1R8E A;  3EWK A;  2IBZ G;  4CPG A;  3VYI A;  3S4R A;  2P2U A;  2Z5I A;  4WY4 B;  2FFD C;  4U3F D;  2JDI H;  1KTM A;  1CZQ A;  3A0H E;  5AVV B;  1QX8 A;  4LGD E;  3GHG B;  2BCC G;  1LP1 B;  1U7J A;  2C9N Y;  1SQB K;  1SQQ K;  3U1A A;  3A0B H;  4H0L C;  2KZJ A;  1Y47 A;  2B9B A;  4H13 C;  5B5E E;  1L4A C;  2KSJ A;  1Q90 D;  2IZ1 A;  3M9Q A;  2Y9Z A;  2KB7 P;  1LTI C;  3II6 A;  3JCU H;  1KC8 Q;  1JTH B;  1BE3 G;  1YQ3 C;  3TGU J;  3L70 D;  5AVY B;  1PZQ A;  3CX5 H;  3L72 E;  2JWD A;  4RJT A;  1SQP D;  3L72 J;  1S2E A;  2B88 A;  1URQ C;  2V7Q H;  4IFD K;  1GL2 A;  1NH4 A;  2WSE H;  3L71 E;  2HPC B;  1FZC B;  1FOS E;  3T97 B;  1OW7 A;  4AUW A;  3AE9 C;  4YPC A;  5APY A;  1MZ9 A;  4KT0 J;  3AEF C;  3AE2 C;  4OGQ C;  5AW6 B;  5KLV J;  3D71 A;  1BSH A;  1VF5 B;  3RL0 C;  2IFM A;  2JEE A;  2ZFC A;  1SP4 A;  2YNY A;  3GMA A;  2IBZ D;  1OFC X;  2RN0 A;  1SQP E;  3L72 D;  5DJT B;  1GK4 A;  1T8Z A;  1BCC G;  2HLO A;  3CL3 D;  1L0N G;  1SQX G;  2AXT E;  3L70 J;  4H44 D;  5CCG D;  4ZKU A;  1PPJ D;  3RK3 C;  5M1B A;  1T2K C;  3B5N D;  1KYO H;  1MFT A;  2BCC D;  2R5B A;  5KLV E;  2KZI A;  3FXE A;  2ZXE B;  2WPR A;  1JY2 P;  3V4W A;  1AQ5 A;  2WMM A;  3H1J G;  4I2L C;  1LWU A;  2E76 C;  2E75 B;  4PD4 I;  5C39 A;  3Q5S A;  2WWW A;  1HBW A;  4Y99 B;  1NU1 J;  3NFQ A;  1L0L K;  5DJU B;  1ZR2 A;  4EOT A;  1FBM A;  2HYN A;  1YJ9 P;  1JM0 A;  1NTK D;  2R44 A;  1KIL D;  1PV3 A;  3H32 A;  3TGU E;  2WSF J;  3CCU P;  3D6Y A;  2WSF H;  2P67 A;  5KLV D;  5CCG C;  1T6A A;  1NU1 G;  1SQV D;  3V4Q A;  2OYI A;  4JF7 A;  4BRY A;  1LJ2 A;  3P8M C;  4C46 A;  1VQO P;  2OGU A;  2IX7 C;  2N1T C;  1RHZ B;  2YXQ B;  2QJP B;  4W7Y A;  3L74 G;  5KAF H;  1RE4 C;  2H89 C;  3OAK A;  3CCL P;  3RK2 B;  1SQX K;  1BE3 D;  2Q3E A;  4JPZ B;  2BEQ D;  5KAI H;  3HD7 B;  3Q5R A;  2YKQ A;  1IO4 A;  1G1I A;  1NTZ E;  3G71 P;  4WY4 A;  4JQ0 D;  4PD4 H;  1NU1 E;  3HE5 B;  3GG2 A;  2OQQ A;  5AW2 B;  2CK3 H;  3RK3 E;  3H1L J;  1QVG O;  5EFW B;  3EQ2 A;  1FDO A;  3JCU E;  3KZI H;  5AW0 B;  1RF1 B;  1JY2 N;  1KN7 A;  1LTJ A;  1KOR A;  3A3Y B;  3CWB J;  3HUS A;  4IL6 X;  4UB6 E;  2OYH A;  3Q2Y A;  3TNU B;  3D6Z A;  3TDK A;  2ZXX A;  1BGY D;  1KYO I;  2N1T D;  2Y0C A;  2N1T A;  3H25 A;  2WSE J;  4I6M C;  5CJ4 A;  1NJI Q;  2IYO A;  3IR9 A;  5B66 E;  1S4X A;  2L91 A;  3L75 G;  1SQX E;  1ZW0 A;  2WPV B;  1P84 H;  2IPP A;  1NTZ K;  4WY4 C;  2FFD B;  3QH9 A;  4HB1 A;  2IFN A;  2QM7 A;  5KLI C;  3S1K A;  1EDL A;  1JCC A;  5CBO A;  1LTT C;  2ITA A;  3V2P A;  4WB4 A;  3H1L G;  1QL1 A;  3OJA B;  1PFI A;  2FYU D;  1J1D C;  3KXD A;  1KD1 Q;  2QJK C;  3B5N C;  1KMI Z;  3AE5 C;  1L0N E;  3H1I D;  2WSS H;  2WSC H;  2ZT9 B;  3H1I G;  1N7L A;  5APU A;  1WRG A;  2JR8 A;  4EIJ A;  4WWI A;  3F89 A;  2WT7 A;  3JC2 2;  2PAJ A;  3GW6 A;  3BRV B;  2KS1 B;  2K1A A;  2Q1K A;  5APT A;  3TK1 A;  5APX A;  1IJD B;  1HJB A;  5AVT B;  2G3A A;  2Q9I A;  2OYO A;  2A45 I;  1RE3 A;  1DEB A;  2OAR A;  1EZV G;  2QJK B;  1AQT A;  3MTU E;  4OH8 B;  1EDJ A;  3KPE A;  2QSI A;  2BAS A;  2YO2 A;  3H1I E;  2QE7 H;  3ITK A;  2WTY A;  1VQP P;  3VTP C;  1E79 H;  2WQY C;  5CJ0 A;  2WSC J;  2YIU B;  3P7K A;  4JYC A;  1Q81 Q;  3CWB E;  1KFM A;  3N7N A;  1CSB A;  2FBW C;  1LTA C;  3OA7 A;  1NYH A;  4M3L A;  1RY3 A;  5AW1 B;  3RK3 B;  2HOD B;  2E43 A;  2NZ2 A;  2C0W A;  2IZ0 A;  1K9M Q;  3H1I J;  2R32 A;  3RBZ A;  3BRT B;  3L70 E;  5KJ7 D;  3U59 A;  1YI2 P;  1M1J B;  2ZJS E;  4GOF A;  1GTW A;  1YHQ P;  1NO4 A;  1H89 A;  1FDI A;  4PV1 D;  1FZF A;  2ZVO B;  1GL2 D;  1OZH A;  2GUV A;  2P7J A;  2M3B A;  4NPE A;  1RF1 A;  1YJW P;  1IC2 A;  3WUU A;  3B71 A;  1LGH B;  2E5T A;  1NVO A;  2M8R A;  3MUD A;  2E76 D;  4TT3 H;  1FC2 C;  4N78 D;  3TNU A;  1JB0 J;  3L72 G;  1NKN A;  4H44 B;  3L37 A;  3L71 G;  1H0T A;  3QWO C;  1JOC A;  1LP1 A;  1L0L E;  3I5C A;  3FWL A;  1FZA A;  3IF4 A;  3M91 A;  4PJ0 E;  4AYC A;  3U1C A;  1W2B O;  1FZG A;  2KXP B;  4ASV A;  3AEC C;  1RQV A;  5GTI H;  3BCC E;  1YJN P;  2FXP A;  2C9L Y;  1OW8 A;  4TLF A;  1JMB A;  4BWN A;  2ZYD A;  2GA1 A;  1NTM D;  1QL2 A;  2R3C A;  3KHU A;  3R4Y A;  3V2R A;  1IFI A;  2ZAE B;  4EI2 A;  3HTK B;  1NTK E;  1HWT C;  3ABV C;  1PPJ G;  2O1K A;  1M8O B;  3NMD A;  4BRY B;  3G4S P;  1GU4 A;  3C8V A;  3CXH I;  4IFF A;  1JMM A;  1NGM B;  3JSV C;  1ZME C;  1PP9 E;  2JP3 A;  2VRS A;  3BVH A;  2RH0 A;  2UWJ E;  3I55 P;  1K8A Q;  1EDI A;  1IFM A;  2O3J A;  2WZ7 A;  2MJZ A;  3L71 J;  3CCJ P;  2AXT H;  1FU1 A;  2KS1 A;  2XV5 A;  1NTK G;  1NTZ J;  3SWY A;  1LTJ C;  3HUS C;  1YYC A;  3WMM 0;  1S9K E;  2OYH C;  1JTH A;  2R3S A;  2JJL A;  1NU1 D;  2QM8 A;  2FYN B;  4H0L D;  1YIJ P;  5E79 H;  1OXZ A;  3L74 E;  5H2F E;  2YO3 A;  1IFD A;  1KYO D;  1JY3 P;  5B66 H;  1DEE G;  1USE A;  2H7H A;  1AVO A;  2K88 A;  2OTJ P;  3V2N A;  5KLV K;  2HOD A;  1KIL E;  1PL5 A;  2QG4 A;  2WT7 B;  1S9K D;  4DZO A;  3AEB C;  2H43 A;  2KSE A;  1N7S A;  2NPS A;  3B8E B;  1QEX A;  1N7S D;  2E74 C;  2W90 A;  1SQV E;  2LR2 A;  2ZVN B;  3KDP B;  3L73 D;  4XE5 B;  1GDT A;  2N9Y B;  2A45 H;  1LT9 A;  1SQX D;  3H1H G;  4R4L A;  2GUS A;  3F5H A;  1ZRT D;  3CCR P;  1L4A B;  4L74 A;  1VDF A;  2QJY C;  3CXH E;  1S5L H;  1BE3 E;  1FJP A;  1QVF O;  3RL0 D;  1WMK A;  2G8Y A;  1N86 A;  2O01 N;  4OVN F;  3C1L A;  1RH5 B;  1SQP J;  4PD4 E;  1DIP A;  3T97 A;  3VMX A;  1Q82 Q;  4GT1 A;  3RK3 D;  3PP5 A;  3TF5 A;  4H44 C;  2IYP A;  3O6Q B;  2E76 B;  3G9R A;  1SQQ J;  1SQB J;  1N2D C;  1MV8 A;  3VP8 A;  1OMI A;  2YMK A;  1HVV A;  2Q6Q A;  3HD7 D;  1QGK B;  3VMY A;  5AW4 B;  1EC5 A;  1M1J A;  1OX3 A;  3RL0 g;  4U7J A;  2KNC A;  1P84 I;  3S9O A;  1J1E B;  3CMA P;  1SQQ D;  1BGY E;  1SQB D;  1IFN A;  1W2E A;  1SQQ G;  1LT9 C;  1SQB G;  2AEF A;  1NHL A;  3M0D C;  2K9J B;  2KUB A;  1D7M A;  2J58 A;  3AE1 C;  4HYT B;  4LC1 A;  4QMA A;  1S72 P;  3BCC J;  3LIE A;  5CCG A;  2OYI C;  3RK2 C;  3CCE P;  4YXD C;  1AVY A;  2D2C B;  3AE7 C;  4IL6 H;  1PP9 G;  4NPD A;  4GDO A;  3L75 J;  2FYU K;  4UB8 E;  1KQS O;  1VQK P;  3CC2 P;  3I56 P;  2I1J A;  2WIT A;  3PH0 A;  1N8R Q;  1DX7 A;  1CI6 B;  1URQ B;  2E74 B;  4D6T E;  1Q7Y Q;  3CD6 P;  1GW3 A;  3CLQ A;  2OTL P;  1JO5 A;  4HH2 A;  2HR3 A;  3TGU G;  2LXB A;  1KQF B;  3KQG A;  3WU2 E;  3L36 A;  3AE4 C;  4K3A A;  4WBA A;  3L73 G;  5CHX A;  4ZNC A;  1LTS C;  1M56 D;  3CPW O;  2N1T B;  3H1J E;  1ZV8 A;  3H1H J;  4OWF A;  5GTI E;  1EXI A;  3H1H E;  1PGJ A;  4D6T G;  2Y0D A;  1L0N K;  2XZR A;  4D6T D;  2PFX A;  1SFC B;  3H1K D;  1JY3 O;  3BCC D;  1NWQ A;  1M90 Q;  1IFJ A;  1KB9 I;  3MIW A;  2A06 D;  3L70 G;  3AEG C;  1KIL B;  4Y99 C;  1T2K D;  4D6T J;  1BSN A;  4I1L A;  1VL2 A;  2HG5 D;  3L71 D;  1S5L E;  2FKW B;  1BCC D;  4C7R A;  5CCH C;  5B5E H;  1NTK K;  4W80 A;  3H1K E;  5AVS B;  2JWA A;  4I7Z C;  5APQ A;  1AFO A;  1EZV I;  1FJK A;  3A5T A;  1SLQ A;  1CW5 A;  2FXO A;  1NTM J;  1RQU A;  3PRJ A;  1BCC E;  3MP7 B;  1BGY J;  1KZU B;  2I8D A;  2D2C D;  1GMJ A;  2P1J A;  3VOP A;  1VF5 D;  5CBN A;  3SFD C;  1JEK A;  1PP9 D;  4I7Z B;  5AVZ B;  1J1E C;  1XTG B;  2YIU C;  2YMY A;  3USS A;  2QVA A;  2K3R A;  1AA0 A;  2LXC B;  5CCH A;  2FYU J;  1AJY A;  5CCH D;  3B5N B;  4K35 A;  1J1D B;  1OVU A;  1EQ7 A;  2KYV A;  3B4S A;  4KHX A;  1NKZ B;  2YXR B;  3FWN A;  2O01 J;  3CX5 I;  4LLH A;  3TYY A;  3V5B A;  3VP9 A;  3H32 B;  2LKM A;  3PHL A;  2A45 G;  2H88 C;  1Y8A A;  2CPS A;  1X79 B;  5AVQ B;  1LTG C;  1HGZ A;  3Q5P A;  3Q3D A;  2OYI B;  1G2C A;  2ZYA A;  1FDM A;  5K5G B;  2IBZ E;  1PGO A;  1ZN5 A;  1EXJ A;  2NPS B;  4U3F J;  2ZYG A;  1BDC A;  1NTZ G;  1WT6 A;  2KNC B;  1LT9 B;  1Y9B A;  2BCC E;  2R5D A;  2O01 H;  2NPS D;  3K5B A;  1L4A A;  1ZXG A;  2XND H;  3L73 E;  2E42 A;  1SVF A;  4XA4 A;  1SQP K;  3RBX A;  2RKL A;  2HFE D;  5AVR B;  3TSI A;  1RF1 C;  2DW3 A;  2OTK E;  1H8A A;  1T3U A;  4C7N B;  4OGQ D;  2J5U A;  1LTJ B;  2M3E A;  3HUS B;  3MUD C;  4B86 A;  1FZC C;  2OYH B;  1DD3 A;  4GOD A;  2AEJ A;  2M5A A;  3FXD A;  3WUT A;  3RK2 D;  3ZDM A;  4ASW A;  3TGU D;  1Q86 Q;  1GZL A;  4KJM A;  2W6J H;  3GHG A;  1GD2 E;  2XDJ A;  2PGD A;  4H0L B;  4UB6 H;  3M0D A;  4C7N A;  5KKZ C;  1P84 D;  3HTK A;  1KYO E;  1PIX A;  1GK6 A;  2FXM A;  1L2P A;  1HUC A;  3BCC G;  3SSU A;  1YBK A;  5GTH H;  4NPF X;  1OWA A;  3AEA C;  1VPC A;  1KFN A;  3SFE C;  2FFD A;  5CMZ A;  1ZR4 A;  2FYU G;  2B87 A;  3LID A;  3GF3 A;  1QLE D;  2IBZ I;  3A0H H;  1L0L G;  3GF7 A;  4A7P A;  4DCK A;  1BE3 J;  1P84 E;  1M57 D;  1YTZ T;  1GL2 B;  2W6B A;  3FGA D;  4XFJ A;  1X9V A;  5AW9 B;  1KIL C;  2WVR A;  5KAF E;  1LWU C;  1R5L A;  2B87 B;  1KB9 E;  2PRR A;  2W27 A;  4HJG H;  3O8Z A;  1SQV J;  1FAV A;  3FX0 A;  4WVZ A;  5AVU B;  1GU5 A;  4PD4 D;  3RL0 B;  3OW2 O;  5TJH A;  5KTB A;  5GTH E;  3CX5 E;  3M0A A;  1A02 F;  1GL2 C;  1NAY A;  3L75 D;  2Q7C A;  4YXW H;  3CWB D;  3L74 J;  3PTZ A;  1MKM A;  3CWB G;  1FZB A;  1UII A;  4DOJ A;  3CC4 P;  3H1H D;  3KZI E;  3IAO A;  2I1K A;  2BCC J;  4Y28 J;  4IOI H;  4R4M A;  1KIL A;  4U3F E;  3W67 A;  2E75 D;  2AEM A;  3CCQ P;  1VQ5 P;  3AE3 C;  2A06 E;  2V4H A;  3EFG A;  1VF5 C;  4Z1M H;  2D2C C;  1KB9 H;  3SWK A;  2QA4 P;  3N4X A;  1VQM P;  2FYN C;  3LW5 H;  2QJP C;  2JO1 A;  4PV1 B;  1U7M A;  1X8Y A;  1PP9 J;  1EZV D;  3CC7 P;  3CCS P;  3AE8 C;  1KQL A;  4DJG A;  2A06 G;  1DH3 A;  3HD7 C;  5AVW B;  1L4A D;  4BXL A;  1K73 Q;  3Q1M A;  3E1I A;  3PLN A;  1T3J A;  3H1J D;  3M9H A;  4RO0 A;  2E75 C;  2L5G B;  2K9J A;  4L76 A;  2QEX P;  2PP6 A;  1FOS F;  1H0T B;  3G6E P;  1N73 A;  4L73 A;  3L73 J;  1NAF A;  3PJS K;  2MKV A;  1HJ0 A;  2QJY B;  2K9Y A;  2W83 C;  1BCC J; 
#chains in the Genus database with same CATH homology
 3HE4 B;  1RF0 C;  5AW3 B;  1E5W A;  1XTC C;  1N7S C;  3MGN A;  4GKG A;  5AW8 B;  3KYQ A;  1ZLL A;  3CI9 A;  2KLV A;  1LWU B;  3HD7 A;  1FOS F;  1GW4 A;  3BAS A;  2POH A;  3M06 A;  4N3Y B;  2WPQ A;  2J59 M;  1RE3 C;  2Z4E A;  2FYZ A;  4N78 E;  2C0X A;  5APW A;  1N73 C;  3L4F A;  5BU8 B;  1SFC C;  5BVZ A;  4N6J A;  1FZC A;  1A02 J;  1RF0 A;  5KJ7 C;  1URQ D;  1CI6 A;  1URQ A;  1M1J C;  3A2A A;  1SQV K;  4ZKP A;  2GM4 A;  3HE5 A;  4O9B A;  3G3Z A;  2YKP A;  3B5N A;  1JCD A;  3BAT A;  1YTZ I;  3MD0 A;  3P32 A;  1JY3 N;  1LTB C;  4W7Z A;  1SFC D;  1N7S B;  4RES B;  1SFC A;  3IFM A;  2CPB A;  5APS A;  2HPC A;  1Z56 A;  1FZE A;  5KJ7 A;  5BU5 A;  2Z5H A;  1MFZ A;  3UIA A;  3H6P A;  5AW7 B;  1HGV A;  1J2J B;  1NTM K;  3SWF A;  1NOH A;  4IFM A;  1M7L A;  3A7O A;  3NTN A;  2WPS A;  1JUN A;  2W6A A;  4WY4 D;  2Q5U A;  1JNM A;  1RE4 A;  3HE4 A;  2O1J A;  2XU6 A;  1HH0 A;  2KP8 A;  3VN0 A;  5APV A;  1H88 A;  4JYB A;  1NU1 K;  3HRN A;  1JY2 O;  2H8P D;  1G1J A;  3C9I A;  3P8C E;  2XKM A;  1G2C B;  2Q3I A;  2XNX A;  2KOG A;  3NXS A;  1IK9 A;  5AW5 B;  4GIF A;  3V2Q A;  4AQR D;  2NPS C;  1HTL C;  3M9B A;  1MUU A;  3L35 A;  3P8C D;  3GHG C;  2N9B A;  2YKO A;  3R2P A;  1N73 B;  3VMZ A;  5AVX B;  3VYI A;  2P2U A;  2Z5I A;  4WY4 B;  2FFD C;  1CZQ A;  5AVV B;  4LGD E;  3GHG B;  2C9N Y;  1SQB K;  1SQQ K;  3U1A A;  1L4A C;  2KSJ A;  3M9Q A;  2KB7 P;  1LTI C;  3II6 A;  1JTH B;  5AVY B;  1URQ C;  4IFD K;  1GL2 A;  1NH4 A;  2WSE H;  2HPC B;  1FZC B;  1FOS E;  4AUW A;  5APY A;  1MZ9 A;  5AW6 B;  3RL0 C;  2IFM A;  2JEE A;  2ZFC A;  1SP4 A;  2YNY A;  1GK4 A;  1T8Z A;  2HLO A;  3CL3 D;  5CCG D;  4ZKU A;  1T2K C;  3RK3 C;  3B5N D;  2R5B A;  2ZXE B;  2WPR A;  1JY2 P;  3V4W A;  1AQ5 A;  1HBW A;  4I2L C;  1LWU A;  2WWW A;  4Y99 B;  3NFQ A;  1L0L K;  1ZR2 A;  4EOT A;  1FBM A;  2HYN A;  3H32 A;  1KIL D;  2WSF H;  2P67 A;  5CCG C;  3V4Q A;  2OYI A;  4JF7 A;  3P8M C;  4C46 A;  2IX7 C;  2N1T C;  4W7Y A;  1RE4 C;  3OAK A;  3RK2 B;  1SQX K;  3HD7 B;  2YKQ A;  1IO4 A;  1G1I A;  4WY4 A;  3HE5 B;  3EQ2 A;  5AW0 B;  1RF1 B;  1JY2 N;  1LTJ A;  3HUS A;  3A3Y B;  2OYH A;  3TNU B;  2N1T D;  2N1T A;  4I6M C;  5CJ4 A;  3IR9 A;  2IPP A;  4WY4 C;  1NTZ K;  2FFD B;  2IFN A;  2QM7 A;  1JCC A;  1LTT C;  3V2P A;  4WB4 A;  1QL1 A;  3OJA B;  1PFI A;  1J1D C;  3B5N C;  5APU A;  2WSC H;  1N7L A;  1WRG A;  4EIJ A;  2WT7 A;  2PAJ A;  3BRV B;  5APT A;  3TK1 A;  5APX A;  1IJD B;  1HJB A;  5AVT B;  2Q9I A;  5AW2 B;  2A45 I;  1RE3 A;  1DEB A;  2OAR A;  4OH8 B;  3MTU E;  3KPE A;  2YO2 A;  2BAS A;  2WTY A;  3VTP C;  5CJ0 A;  3P7K A;  4JYC A;  1KFM A;  3N7N A;  1CSB A;  3OA7 A;  1LTA C;  4M3L A;  5AW1 B;  1RY3 A;  3RK3 B;  2HOD B;  2E43 A;  2C0W A;  2R32 A;  3BRT B;  5KJ7 D;  3U59 A;  1M1J B;  1GTW A;  1NO4 A;  1H89 A;  1FZF A;  1GL2 D;  2GUV A;  2P7J A;  2M3B A;  1RF1 A;  1IC2 A;  1LGH B;  2M8R A;  3MUD A;  3TNU A;  4N78 D;  1NKN A;  3L37 A;  1JOC A;  3I5C A;  1FZA A;  4AYC A;  3M91 A;  3U1C A;  1FZG A;  1CW5 A;  2C9L Y;  1QL2 A;  2R3C A;  3V2R A;  1IFI A;  3HTK B;  1HWT C;  2O1K A;  3NMD A;  1GU4 A;  4IFF A;  1JMM A;  2VRS A;  3BVH A;  1IFM A;  2WZ7 A;  2MJZ A;  1FU1 A;  2XV5 A;  3SWY A;  1LTJ C;  3HUS C;  1YYC A;  3WMM 0;  1S9K E;  2OYH C;  1JTH A;  2JJL A;  2QM8 A;  1OXZ A;  2YO3 A;  1IFD A;  1JY3 P;  2H7H A;  3V2N A;  5KLV K;  2HOD A;  2WT7 B;  1S9K D;  4DZO A;  2H43 A;  3B8E B;  1N7S A;  2NPS A;  2E42 A;  1N7S D;  3KDP B;  4XE5 B;  1GDT A;  2A45 H;  1LT9 A;  2GUS A;  1L4A B;  1VDF A;  1FJP A;  3RL0 D;  1N86 A;  3T97 A;  3VMX A;  4GT1 A;  3RK3 D;  3PP5 A;  1N2D C;  5KTB A;  1MV8 A;  3VP8 A;  3HD7 D;  1HVV A;  3VMY A;  5AW4 B;  1M1J A;  1J1E B;  1W2E A;  1IFN A;  1LT9 C;  1NHL A;  3M0D C;  2J58 A;  4HYT B;  4LC1 A;  3LIE A;  5CCG A;  2OYI C;  3RK2 C;  2FYU K;  2I1J A;  2WIT A;  1DX7 A;  1CI6 B;  1URQ B;  1JO5 A;  1GW3 A;  3CLQ A;  4HH2 A;  3KQG A;  3L36 A;  4WBA A;  5CHX A;  1LTS C;  2N1T B;  1ZV8 A;  1L0N K;  2XZR A;  1SFC B;  1JY3 O;  1NWQ A;  1IFJ A;  3MIW A;  1KIL B;  4Y99 C;  1T2K D;  4I1L A;  2HG5 D;  2FKW B;  4C7R A;  5CCH C;  1NTK K;  4W80 A;  5AVS B;  5APQ A;  1AFO A;  1FJK A;  3A5T A;  1SLQ A;  1KZU B;  2P1J A;  3VOP A;  5AVZ B;  1J1E C;  1XTG B;  2YMY A;  5CCH A;  5CCH D;  3B5N B;  1J1D B;  1EQ7 A;  2KYV A;  4KHX A;  1NKZ B;  4LLH A;  3V5B A;  3VP9 A;  3H32 B;  2LKM A;  2A45 G;  2CPS A;  1X79 B;  5AVQ B;  1LTG C;  1HGZ A;  1FDM A;  1G2C A;  1ZN5 A;  2NPS B;  1WT6 A;  1LT9 B;  2R5D A;  2O01 H;  2NPS D;  1L4A A;  1SVF A;  4XA4 A;  1SQP K;  3TSI A;  2HFE D;  5AVR B;  1RF1 C;  1H8A A;  1T3U A;  4C7N B;  1FZC C;  1LTJ B;  3HUS B;  4B86 A;  2OYH B;  2OYI B;  3RK2 D;  1GZL A;  3GHG A;  1GD2 E;  2XDJ A;  4C7N A;  3M0D A;  3HTK A;  1GK6 A;  2FXM A;  1HUC A;  1OWA A;  1VPC A;  1KFN A;  2FFD A;  5CMZ A;  1ZR4 A;  3LID A;  1YTZ T;  1GL2 B;  2W6B A;  5AW9 B;  1X9V A;  1KIL C;  1LWU C;  2W27 A;  3O8Z A;  1FAV A;  5AVU B;  1GU5 A;  3RL0 B;  3M0A A;  1A02 F;  1GL2 C;  2Q7C A;  4DOJ A;  1FZB A;  2I1K A;  1KIL A;  3EFG A;  3N4X A;  3LW5 H;  1X8Y A;  1KQL A;  1DH3 A;  3HD7 C;  5AVW B;  1L4A D;  3E1I A;  1T3J A;  3M9H A;  2L5G B;  2PP6 A;  1N73 A;  1NAF A;  3TYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...