5BU5A

Hk620 tail needle crystallized at ph 9 (crystal form i)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
174
structure length
174
Chain Sequence
QVKNDEQDVELADHDARIAANTKAINILEVRLTTAEGKIVVLRSDVDYLLDEVIDIQAHLVTVDQRLDGVESDVSDIKSDYVSKTVTESQSLASPLDVKTSYSVDGIQVVGARQTGWTAATGTPLLGSFNANQSYTVGTTYTQSEVAALATGLEQARQRILALETALRLHGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords DNA stabilization protein
publication title Structural Plasticity of the Protein Plug That Traps Newly Packaged Genomes in Podoviridae Virions.
pubmed doi rcsb
source organism Enterobacteria phage hk620
total genus 56
structure length 174
sequence length 174
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5bu5A01
3N4XA 3P8CD 3N7NA 3U1AA 3HRNA 3OJAB 3BATA 4N78D 4I1LA 1IC2A 3VP8A 3VP9A 1NKNA 2POHA 3U1CA 4GIFA 2JEEA 3U59A 3C9IA 5BU8B 4ZKPA 4O9BA 1WT6A 1X79B 4N3YB 5KTBA 2FXMA 4ZKUA 5BU5A 5BVZA 3BASA
chains in the Genus database with same CATH superfamily
3H1JJ 2NZ2A 1S4XA 1PP9G 1JY2N 1LJ2A 3CCLP 1KILA 2WVRA 5AW8B 4QMAA 3VP9A 1HJBA 3AEBC 4D6TJ 5APUA 3CL3D 1JMBA 4PD4I 2IYPA 1X22A 3CD6P 2IZ1A 1EDJA 1VL2A 2B87B 1SFCC 1UIIA 1HBWA 2FYUG 2K9JB 3VOPA 2JO1A 1KB9D 3IR9A 3GG2A 3I56P 3E7KA 5KAIH 1QLED 4YXDC 1MUUA 3EFGA 4GOEA 2WT7B 1H0TA 1PP9D 1D7MA 4TLFA 2Z5IA 2LXBA 1QGKB 4N78E 3T97B 2Q3EA 2JP3A 4UB6E 1JEKA 1ZW0A 2QVAA 2YMYA 5APYA 3Q5RA 4WY4B 3CMAP 2O1JA 1KV4A 1H88A 4N3YB 3O8ZA 2FYUD 5KLVG 5CCHA 3II6A 2A06D 1EDKA 4H44B 1IJDB 2YIUB 2XNXA 1AJYA 4MN4C 1AV1A 1M57D 4C7NA 4RJTA 1GL2B 2C0XA 3HTKB 2PP6A 2Y0DA 1T3JA 2B9BA 1EZVG 4W7YA 1MZ9A 1K73Q 1YIJP 4K3AA 1VDFA 2WMMA 4DZOA 2OTKE 3L75D 3TNUB 2KS1A 5E79H 3G4SP 5TISH 5M1BA 1IFNA 1IFMA 3P8CE 2Y0EA 1SQQJ 3ITKA 2N9YB 3SSUA 2Y9ZA 2V7QJ 5GTHE 1XTCC 3E1RA 2LXCB 1YJNP 5KLVD 1VQOP 3RK2C 1AVYA 1ZR4A 1S3JA 4W7ZA 3HUSB 1RQVA 3GHGA 2O01J 3VYIA 1PIXA 3AE1C 4C7RA 3GMAA 1BDCA 1FC2C 3VP8A 1URQB 3QWOC 1JMMA 3TF5A 2IDBA 4PD4H 1LWUC 1T2KC 2IYOA 3RL0B 1E5WA 1EZVD 3JCUH 1OVUA 3L72D 3P8MC 1OIPA 1RF1A 2Q6QA 1M7LA 2QIWA 2V7QH 4L73A 1IFIA 1JY3O 3CWBG 4ZNCA 3RK3B 5AVTB 3O6QB 4JQ0D 1IZNB 4PD4D 2N1TB 2W6BA 1KFMA 3L74E 2CK3H 1NTMK 5KLIB 1MFZA 3CPWO 2IBZE 1RQUA 2M0BA 1M1JB 2PAJA 1MFTA 1FZAA 3V4WA 3ABVC 1SQBD 1NU1E 2KP8A 3M06A 3H1LE 3L74J 2BCCG 5KTBA 3B71A 4HJGH 1S1CX 1YBKA 3CWBD 4WY4D 1AQ5A 3L70E 2JWDA 1L4AC 1FDIA 1HGVA 4TT3H 4LC1A 1KYOE 1HGZA 3PP5A 2SPZA 1NAFA 3A2AA 4H0LB 1VQ4P 1P84E 4H44D 2WPRA 3PJSK 2W6JH 1NU1J 5TJHA 1SQVK 4EI2A 2KYVA 3MP7B 1YJWP 4L74A 2WPSA 1GL2D 1YTZI 4Z1MH 4I2LC 2QE7H 1XTGB 1LTBC 4ZKUA 3L70J 1VQNP 1NWQA 2K9YA 4AQRD 1DEEG 3V2PA 1SQPE 4WVZA 5AVYB 1LTIC 1NTME 3D71A 2BCCD 4PV1B 2W27A 1X8YA 1LTJA 2YKOA 1Q2NA 5AW7B 1OXZA 3RBXA 1JY2P 1GK4A 2FYNC 2YNYA 1GDTA 3B5NB 1Q82Q 2D2CC 1M56D 2OQQA 4YPCA 3CXHE 3WU2H 2K3RA 1Z56A 1YJ9P 1SQPJ 3IAOA 2WSEH 1LTTC 5CCGC 4B86A 1NTMJ 2KI7B 1DEBA 5KJ7A 1J1DC 1CSBA 3RL0D 4RESB 1NAYA 1J1EC 3KQGA 2WZ7A 3M0DA 3HUSA 4ASWA 1KILE 2WSCJ 1SFCB 2FXPA 3H6PA 1MKMA 1BSNA 4Y99C 1IC2A 2E76C 1GW3A 3A0HE 2AXCA 3RK3D 2WTYA 1TU3F 4IFMA 2WQYC 2O1KA 3MIWA 1OW8A 2J5UA 2FYUK 2N1TD 1AFOA 5BVZA 1X9VA 3H1KJ 1L0NK 1RE3C 2FXOA 1ZXGA 5AVRB 2WITA 1ZV8A 1FE6A 1ZP0C 1CZQA 1YITP 1N73A 1Q90D 3LIDA 2WSCH 1YYCA 4H13C 4HYTB 3N7NA 2E75C 2H8PD 2KXPB 4KHXA 2PGDA 4DOJA 1USEA 1G1JA 1KB9E 3LW5H 4PJ0E 1L0LK 2OYIA 1LT9A 1BSHA 1N7SA 5AVQB 3AEGC 5AVUB 2IZ0A 2IX7C 2XNDH 3OJAB 5CBOA 1IFPA 3G71P 5KLVK 3FXEA 1KD1Q 1KILC 1T8ZA 2RH0A 2DW3A 4H0LD 1OFCX 2IFNA 3AE7C 2YKQA 2M5AB 1GZLA 5H2FH 1AA0A 3G9RA 2ZT9C 2E74C 2QJKC 1T3UA 1NO4A 3CCVP 1JNMA 2QJYB 4I7ZC 5KAFE 2Q5UA 1IFDA 5APVA 4XFJA 2Z5HA 2C0WA 2IPPA 1NTZE 2JEEA 2NPSA 2FYUE 3BCCG 4BXLA 2HLOA 2FXMA 1YTZT 4R4LA 1L0NE 3P32A 3PTZA 1ZR2A 4PV1D 3RK2B 4UB8H 3A0BE 4GDOA 2KZIA 2FYZA 4EDFA 1LGHB 3BVHA 1M8OB 3B5ND 1WRGA 1NTZJ 3H1JG 1R8EA 3HRNA 1PGJA 2FYUJ 1LWUB 1RH5B 1S5LX 1L0LE 3EWKA 4BRYB 1KN7A 3AE3C 2A06G 2W90A 1PPJD 4D6TG 1L0NJ 2ZAEB 2JKVA 1KQSO 3CCJP 2P10A 1BGYD 1YQ4C 1WMKA 3HE5B 1H8AA 2CPBA 1FZFA 5KLVE 5CCHC 3BCCD 3VTPC 1IK7A 1FBMA 1SFCD 2ZYAA 2R3CA 5B5EE 1L0LJ 3L75G 1N8RQ 4AYCA 3CCSP 2YKPA 4OGQC 1VPCA 2JWAA 2P1JA 3FXDA 2WPVB 2Q7CA 2QJPC 3IN6A 1K8AQ 3RGUA 2WPQA 1W5CE 3R2PA 3H1JD 2Q1KA 2O01N 1HUCA 1VF5C 1W2EA 3L71G 2Q9IA 3L73E 1JY2O 3VMYA 1QEXA 3A0BH 5GTIE 4D6TD 2KLUA 3E1IA 1N7LA 2Q3IA 5AW0B 5L8RJ 1LP1B 1A02F 2YXQB 4LGDE 2YMKA 1YQ3C 3M9QA 1FZBA 1USDA 3L72G 3GHGC 2OARA 2CPSA 3SFEC 2MJZA 3L73J 4DJGA 3BRVB 2M8RA 3VMZA 2RKLA 2OYHA 3KZIE 2PRRA 2HG5D 1VQ5P 3PH0A 2WSFJ 1RF1C 3PRJA 2JJLA 1AVOA 1RE4A 2I1KA 3CX5E 3L71D 4W80A 5BU8B 4N6JA 1WT6A 2JDIH 3MTUE 1SQQG 3USSA 2HPCA 4UB6H 3AEAC 3HD7B 3F5HA 4EIJA 1KTMA 3U1CA 1JUNA 2HODA 2R5DA 2FY8A 1JTHB 2N9BA 1SQBG 2FYNB 3OA7A 3WMM0 3RK2D 2A45I 4N78D 3FWLA 1SQXK 2KUBA 1R5SA 2BEZF 1CI6B 1G2CB 1KMIZ 1YI2P 2WSSH 1GW4A 3HE4B 5AW4B 1J1DB 1DX7A 3AECC 2O01H 4BWNA 2XU6A 2C9NY 1J1EB 2XV5A 1ZMEC 1SQQD 4GKGA 5APWA 4XA4A 2ZFCA 3KZIH 1QX8A 3C8VA 2B87A 4Y99B 1EDLA 5GTHH 1FAVA 2KSEA 5CBNA 3A5TA 1EDIA 2PFXA 2K9JA 1BE3E 3CX5H 3KYQA 2FFDB 2AEJA 2IFMA 3F89A 3MGNA 4U3FE 1RF0A 3P8CD 5KKZC 4JPZB 2R32A 2GUVA 1FZCB 2OTLP 4CPGA 3CXHI 4A7PA 2RMZA 3U59A 2WT7A 1KQLA 1MV8A 2P67A 4H13B 2K37A 2ZVNB 5AVWB 3L74G 2E75B 1BE3J 3T97A 4R4MA 5AVZB 1LTJC 3H1HE 4LLHA 2KNCB 5AW2B 1SQXE 4YXWH 1HJ0A 3M9HA 3H1LJ 2IBZG 1VQKP 3SWFA 2W8ZA 4WY4A 4U3FJ 1T6AA 1FOSF 3V6IA 1M1KQ 1SLQA 2HFED 1IK9A 1NU1G 2M3BA 3KDPB 1KILB 2YO3A 1FJKA 5APSA 1GL2A 3H1IE 3D70A 5KJ7C 1ZRTE 3H1HJ 3HTKA 2UWJE 2A45G 1SQXJ 2QJKB 1HF9A 3H25A 1S9KD 4I7ZB 4IL6E 3L70G 3CCMP 3M0DC 1GD2E 3HUSC 2E5TA 4GOFA 2J59M 3TGUE 5CHXA 5APXA 3TNUA 3L74D 2MKVA 3B4SA 2V4HA 2A45H 2IBZD 3HD7D 2AXTE 3H1IJ 1FZEA 2ZYGA 1R5LA 4U7JA 1URQD 3D6ZA 4I1LA 1KYOH 1KZUB 1JM0A 2XDJA 4IL6X 2QM7A 4NPEA 1NU1D 1P84H 3CCUP 3TGUJ 1H0TB 1SQPG 5CMZA 1NKZB 1SQVE 3HD7A 1BCCG 3CC2P 3EFFK 1FDMA 3V5BA 2LR2A 1URQA 1N73C 4ZMDA 3A7OA 3I55P 5CCGD 3W67A 5C39A 4JBZA 2ZXXA 1NTKG 1JTHA 2J58A 4M3LA 3MUDC 3L70D 5KLIC 2OYIC 2L91A 3PLNA 5B66E 1LT9C 1KYOD 1VQPP 3SWYA 1Q86Q 1N7SC 1QVFO 2Y0CA 4RKUJ 1SQVJ 4C7NB 3CMEP 3HE4A 4O9BA 3O6QA 2I1JA 4OGQB 1LTGC 2N1TA 1NVOA 3CLQA 1FDOA 3A3YB 3CXHH 2QJPB 3H1KG 3MUDA 1M90Q 2FKWB 2QA4P 1SQPD 1GTWA 1E79H 3IF4A 1NTMD 1VF5B 2KB7P 1BCCD 2KS1B 1M1JA 2AEFA 3L4FA 3BASA 1HVVA 2NPSC 1NTKD 2AEMA 3MZWB 1PP9E 3FX0A 5APTA 3AE6C 4H13D 3CXHD 2E75D 2ZJSE 2QSIA 3NMDA 3W68A 4DCKA 3GHGB 1PPJG 1NYHA 3A0HH 1FZCA 1NGMB 1Y9BA 3JSVC 2E5YA 1BGYG 3GLMA 5KAIE 1JCCA 4GT1A 1JCDA 4PV1C 1S5LE 3H1KD 1DH3A 1AQTA 2A06E 1A02J 1KILD 1RF1B 1PP9J 4KT0J 3RL0g 2POHA 1SS1A 4DT0A 3RBZA 5AW6B 4Y28J 2YXRB 5AW3B 3L37A 1OW6A 1KB9H 2RN0A 3BATA 4PJ0H 3L75E 1PL5A 1EXJA 5AW5B 1SQQK 1NKNA 5DJUB 2R3SA 3PHLA 3D6YA 1Q7YQ 5APQA 4OH8B 4HB1A 4IFFA 2KIKA 5CJ0A 3B5NA 1NTZG 2H7HA 3S4RA 1SQBK 1HTLC 3L71E 4I6MC 4HH2A 1K05A 1L0NG 3MD0A 3L75J 5E79E 5TISE 5BU5A 5KAFH 3N4XA 2W6AA 1Y8AA 4ASVA 1JO5A 1VQ8P 2G8YA 4NPDA 3V2NA 1S5LH 1EZVE 3L72E 3UIAA 4YTPC 3CX5I 3G3ZA 1SFCA 1GU4A 5CCHD 1U7JA 3L71J 1JB0J 5KLVJ 1L0LG 1LTAC 1KORA 3WUVA 2L5GB 2XZRA 2OYHC 2FBWC 2KSJA 1PGQA 4OGQD 2G3AA 3K5BA 1NTZD 4PD4E 5KKZB 1X0TA 1ZOYC 1RE4C 3JCUE 5AVSB 3AE4C 3L72J 3H32B 1SQQE 1L4AB 1L0ND 1VF5D 1PFIA 2BASA 1JY3N 1Y47A 3KHUA 2JR8A 2Y9YA 3AEFC 2ZVOB 1LTJB 1SVFA 3MHVA 4WWIA 1SQBE 3LIEA 3Q2YA 2R44A 1RY3A 1FOSE 3Q5SA 2GA1A 2QJYC 3VMXA 2ZYDA 2QG4A 1L0LD 5EFWB 3AEDC 5B5EH 3L73G 2ITAA 4ZKPA 2IBZI 1U7MA 2M3EA 3I5CA 1DD3A 1VQ7P 3CWBE 4OWFA 4L76A 1QVGO 1VQ6P 3L36A 2P2UA 3SFDC 2P58A 1NJIQ 2B89A 4L75A 1ZN5A 1NU1K 2BEQD 1SQBJ 5AVVB 2M5AA 3R4YA 2K1AA 2D2CB 5GTIH 3V2QA 2I8DA 4KJMA 3OAKA 3M9BA 2K88A 3FWNA 2WSFH 3CWBJ 1KC8Q 1IO4A 1KYOI 2NRGA 3BRTB 4NPFX 3JC22 1P84I 1T2KD 3VMAA 2KOGA 4EYYQ 1LTSC 2B88A 2BCCE 3L73D 1RF0C 2WWWA 3P7KA 3AE5C 1S9KE 3B8EB 1UIXA 1X79B 3TSIA 1G1IA 1KQFB 4JYCA 1RHZB 1N73B 2QRXA 5AW1B 2E76B 1LWUA 1VQ9P 1SQPK 4BRYA 3AEEC 2OYIB 1LT9B 3V4QA 3M0AA 2H88C 4WY4C 3V2RA 2BCCJ 1EXIA 3HE5A 1N7SB 1NTKK 3OW2O 1KQGB 3GW6A 3NTNA 4H44C 2YIUC 3S1KA 4IFDK 2H89C 1LT1A 4IOIH 1HWTC 3NXSA 3WU2E 1GL2C 3CX5D 4RO0A 2KK7A 3RK3E 1ZLLA 3IFMA 3CCQP 3C1LA 2NPSB 1BE3G 3TYYA 1L4AD 3U1AA 2OGUA 3H1LG 4HKZH 3AE8C 2O3JA 4U3FG 1DD4A 1LP1A 2WSEJ 2C9LY 3Q3DA 2P7JA 3AE9C 2XKMA 2E74B 2ZT9B 3FGAD 3CC7P 3EQ2A 3H32A 1L4AA 2Z4EA 1DIPA 1OW7A 1BCCE 3HD7C 1U57A 3NFQA 1FJPA 3SWKA 1URQC 1PZQA 3H1HG 3M91A 1SQXG 1VQMP 1GU5A 3ZDMA 2E42A 3G6EP 1NTKE 1VQLP 3RL0C 4EOTA 5KJ7D 2ZXEB 3AE2C 1OWAA 1OZHA 3KXDA 1KB9I 2E43A 2KZJA 4WB4A 1BE3D 1SP4A 2D2CD 3KPEA 3H1LD 3RK3C 1EQ7A 1BCCJ 4XE5B 4C46A 1NTMG 1QL1A 1W2BO 3H1IG 5DJTB 1PV3A 4U3FD 1IFJA 1NOHA 2N1TC 1GK6A 3GF3A 1NTKJ 2HYNA 1PGPA 2YO2A 3H1KE 5AW9B 1KFNA 1FS0E 1N2DC 3TGUG 2OTJP 1M1JC 3LW5J 5H2FE 4OVNF 1P84D 1FZGA 3CC4P 3VN0A 3H1HD 1CI6A 1BDDA 1SQXD 2LKMA 1Q81Q 1G2CA 3S9OA 5CCGA 3GF7A 1NTZK 4IL6H 3CI9A 2OYOA 1H89A 2E76D 2FFDC 4K35A 5K5GB 4JF7A 2VRSA 1OVVA 4GODA 1JOCA 3L35A 5CJ4A 1PPJE 1FU1A 1NHLA 1FZCC 2HR3A 1SQVG 4UB8E 1BGYE 2GUSA 1YHQP 3H1ID 1N7SD 2AXTH 2QM8A 1EC5A 1ZRTD 3Q1MA 1NH4A 1CW5A 4H0LC 5AVXB 2OYHB 3BCCE 2W83C 1K9MQ 2QEXP 3TGUD 1JY3P 1S72P 2FFDA 3C9IA 3CCEP 1GMJA 1OVRA 1OX3A 1K04A 1RE3A 2HPCB 2H43A 1BGYJ 4AUWA 3Q5PA 3H1JE 2NPSD 4GIFA 3TDKA 5B66H 2HODB 4JYBA 3BCCJ 4WBAA 4D6TE 2KNCA 1L2PA 1HH0A 3WUTA 1SQVD 1PGOA 1QL2A 1S2EA 2GM4A 1OMIA 1J2JB 3WUUA 1LNQA 3B5NC 2KLVA 2ZT9D 2E74D 1EZVI 2R5BA 3QH9A 1N86A 3TK1A 3CCRP
chains in the Genus database with same CATH topology
3P8CD 1JY2N 1KILA 2R32A 3LIEA 5AW8B 4Y99C 1RY3A 1IC2A 1FOSE 2GUVA 1FZCB 1GW3A 3VP9A 3RK3D 2WTYA 3VMXA 1HJBA 4IFMA 5APUA 3U59A 2WT7A 2O1KA 3MIWA 1KQLA 1MV8A 2P67A 3CL3D 4ZKPA 5AVWB 2FYUK 3I5CA 2N1TD 1AFOA 3T97A 5BVZA 1X9VA 5AVZB 3L36A 1LTJC 4LLHA 1SFCC 5AW2B 1L0NK 3M9HA 1HBWA 1RE3C 3SWFA 2P2UA 5AVRB 3VOPA 4WY4A 1ZN5A 2WITA 1ZV8A 1NU1K 3IR9A 1FOSF 5AVVB 1CZQA 1SLQA 2HFED 1IK9A 1N73A 3LIDA 2WSCH 1YYCA 4HYTB 3N7NA 2M3BA 2H8PD 3V2QA 4KHXA 3KDPB 4DOJA 1KILB 1G1JA 2YO3A 3LW5H 3OAKA 1FJKA 5APSA 1GL2A 1L0LK 1MUUA 3M9BA 2OYIA 2WSFH 1LT9A 3EFGA 5KJ7C 3HTKA 2WT7B 2A45G 1IO4A 2Z5IA 1S9KD 1N7SA 5AVQB 3BRTB 4N78E 3M0DC 1GD2E 3HUSC 5AVUB 2IX7C 2J59M 3OJAB 1T2KD 2KOGA 5CHXA 1LTSC 5APXA 1RF0C 2WWWA 2YMYA 3P7KA 5APYA 3TNUA 5KLVK 4WY4B 1KILC 1S9KE 2O1JA 3B8EB 1T8ZA 2IFNA 2YKQA 1H88A 1X79B 3TSIA 1G1IA 2A45H 4N3YB 4JYCA 1GZLA 3HD7D 3O8ZA 5CCHA 1N73B 3II6A 5AW1B 1FZEA 1T3UA 1NO4A 1LWUA 1IJDB 1JNMA 1URQD 2Q5UA 2XNXA 4I1LA 1IFDA 1SQPK 5APVA 2Z5HA 2C0WA 1KZUB 2XDJA 2IPPA 2QM7A 4C7NA 1GL2B 2OYIB 2JEEA 1LT9B 3V4QA 2NPSA 3M0AA 2C0XA 3HTKB 4WY4C 3V2RA 2HLOA 2FXMA 1YTZT 3HE5A 2PP6A 5CMZA 1N7SB 1NKZB 3HD7A 1NTKK 1T3JA 4W7YA 1FDMA 3P32A 1ZR2A 3V5BA 1MZ9A 1URQA 1N73C 3A7OA 3NTNA 3RK2B 5CCGD 1VDFA 4DZOA 3TNUB 1JTHA 2J58A 4M3LA 4IFDK 2FYZA 1LGHB 1IFNA 1IFMA 1HWTC 3NXSA 3P8CE 3BVHA 1GL2C 2OYIC 1LT9C 3B5ND 1WRGA 3HRNA 3SWYA 1N7SC 1LWUB 1ZLLA 1XTCC 3IFMA 4C7NB 3RK2C 1ZR4A 3HE4A 4W7ZA 2NPSB 4O9BA 3HUSB 2I1JA 1LTGC 3GHGA 2N1TA 3TYYA 3VYIA 3HE5B 1L4AD 3U1AA 3CLQA 1H8AA 3A3YB 2CPBA 4C7RA 1FZFA 3MUDA 3VP8A 1URQB 5CCHC 2FKWB 1JMMA 1GTWA 1LWUC 3VTPC 1T2KC 1FBMA 1SFCD 3RL0B 2KB7P 2C9LY 2P7JA 1E5WA 1M1JA 2XKMA 2R3CA 3P8MC 1RF1A 3L4FA 3BASA 1HVVA 2NPSC 3EQ2A 3H32A 4AYCA 1M7LA 1L4AA 2YKPA 2Z4EA 1VPCA 3HD7C 2P1JA 2Q7CA 3NFQA 5APTA 1IFIA 1JY3O 1FJPA 2WPQA 3RK3B 1URQC 5AVTB 3R2PA 3M91A 1GU5A 2E42A 1HUCA 3NMDA 3RL0C 4EOTA 1W2EA 3GHGB 2Q9IA 2N1TB 5KJ7D 2W6BA 1JY2O 1KFMA 2ZXEB 3VMYA 1FZCA 1OWAA 3E1IA 2E43A 1NTMK 1N7LA 2Q3IA 4WB4A 1JCCA 5AW0B 1MFZA 4GT1A 1SP4A 1JCDA 1A02F 3KPEA 1M1JB 4LGDE 1DH3A 3M9QA 3RK3C 1A02J 1FZBA 1EQ7A 4XE5B 4C46A 1QL1A 1KILD 2PAJA 1RF1B 1IFJA 1FZAA 3GHGC 1NOHA 2N1TC 2OARA 2CPSA 3V4WA 1GK6A 2POHA 2HYNA 2KP8A 2YO2A 3M06A 5AW9B 2MJZA 1KFNA 5AW6B 1N2DC 5AW3B 5KTBA 3L37A 3BRVB 2M8RA 3VMZA 1M1JC 2OYHA 3BATA 2HG5D 1FZGA 3VN0A 4WY4D 1AQ5A 1CI6A 1RF1C 5AW5B 1SQQK 2LKMA 2JJLA 1G2CA 1L4AC 1NKNA 5CCGA 1HGVA 1NTZK 1RE4A 2I1KA 4W80A 4LC1A 5APQA 3CI9A 1HGZA 4OH8B 5BU8B 3PP5A 4N6JA 1WT6A 3MTUE 1NAFA 3A2AA 4IFFA 1H89A 2HPCA 2FFDC 2WPRA 4JF7A 5CJ0A 2VRSA 3B5NA 1JOCA 1SQVK 2H7HA 3HD7B 2KYVA 3L35A 5CJ4A 1SQBK 2WPSA 1HTLC 1GL2D 1FU1A 4EIJA 4I6MC 1YTZI 1NHLA 4I2LC 4HH2A 3U1CA 1JUNA 2HODA 1FZCC 2R5DA 2GUSA 1JTHB 2N9BA 1N7SD 1XTGB 2QM8A 3MD0A 3OA7A 1LTBC 4ZKUA 5BU5A 1NWQA 1NH4A 3N4XA 4AQRD 1CW5A 3WMM0 3RK2D 5AVXB 2A45I 2OYHB 4N78D 3V2PA 5AVYB 2W6AA 1LTIC 1SQXK 1JO5A 1CI6B 1JY3P 3V2NA 1G2CB 2W27A 1X8YA 2FFDA 3C9IA 3UIAA 1LTJA 3G3ZA 2YKOA 1SFCA 1GU4A 1GW4A 3HE4B 5AW7B 5AW4B 5CCHD 1RE3A 1OXZA 1J1DB 1DX7A 2HPCB 1JY2P 1GK4A 1LTAC 2YNYA 1GDTA 2O01H 3B5NB 2H43A 2XU6A 2C9NY 1J1EB 2XV5A 4AUWA 2L5GB 2XZRA 2OYHC 4GKGA 2NPSD 4GIFA 2KSJA 5APWA 4XA4A 2HODB 4JYBA 1Z56A 2ZFCA 2WSEH 1LTTC 5CCGC 4B86A 4WBAA 4Y99B 1DEBA 1FAVA 1RE4C 5AVSB 3A5TA 1HH0A 3H32B 1J1DC 5KJ7A 1L4AB 1CSBA 1QL2A 2GM4A 3KYQA 1J2JB 1PFIA 3B5NC 3RL0D 2KLVA 4RESB 2BASA 1J1EC 1JY3N 3KQGA 2WZ7A 2R5BA 3M0DA 3HUSA 2FFDB 2IFMA 1LTJB 1N86A 1SFCB 3H6PA 3TK1A 3MGNA 1SVFA 1RF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4X A;  3P8C D;  3N7N A;  3U1A A;  3HRN A;  3OJA B;  3BAT A;  4N78 D;  4I1L A;  1IC2 A;  3VP8 A;  3VP9 A;  1NKN A;  2POH A;  3U1C A;  4GIF A;  2JEE A;  3U59 A;  3C9I A;  5BU8 B;  4ZKP A;  4O9B A;  1WT6 A;  1X79 B;  4N3Y B;  5KTB A;  2FXM A;  4ZKU A;  5BU5 A;  5BVZ A;  3BAS A; 
#chains in the Genus database with same CATH topology
 3H1J J;  2NZ2 A;  1S4X A;  1PP9 G;  1JY2 N;  1LJ2 A;  3CCL P;  1KIL A;  2WVR A;  5AW8 B;  4QMA A;  3VP9 A;  1HJB A;  3AEB C;  4D6T J;  5APU A;  3CL3 D;  1JMB A;  4PD4 I;  2IYP A;  1X22 A;  3CD6 P;  2IZ1 A;  1EDJ A;  1VL2 A;  2B87 B;  1SFC C;  1UII A;  1HBW A;  2FYU G;  2K9J B;  3VOP A;  2JO1 A;  1KB9 D;  3IR9 A;  3GG2 A;  3I56 P;  3E7K A;  5KAI H;  1QLE D;  4YXD C;  1MUU A;  3EFG A;  4GOE A;  2WT7 B;  1H0T A;  1PP9 D;  1D7M A;  4TLF A;  2Z5I A;  2LXB A;  1QGK B;  4N78 E;  3T97 B;  2Q3E A;  2JP3 A;  4UB6 E;  1JEK A;  1ZW0 A;  2QVA A;  2YMY A;  5APY A;  3Q5R A;  4WY4 B;  3CMA P;  2O1J A;  1KV4 A;  1H88 A;  4N3Y B;  3O8Z A;  2FYU D;  5KLV G;  5CCH A;  3II6 A;  2A06 D;  1EDK A;  4H44 B;  1IJD B;  2YIU B;  2XNX A;  1AJY A;  4MN4 C;  1AV1 A;  1M57 D;  4C7N A;  4RJT A;  1GL2 B;  2C0X A;  3HTK B;  2PP6 A;  2Y0D A;  1T3J A;  2B9B A;  1EZV G;  4W7Y A;  1MZ9 A;  1K73 Q;  1YIJ P;  4K3A A;  1VDF A;  2WMM A;  4DZO A;  2OTK E;  3L75 D;  3TNU B;  2KS1 A;  5E79 H;  3G4S P;  5TIS H;  5M1B A;  1IFN A;  1IFM A;  3P8C E;  2Y0E A;  1SQQ J;  3ITK A;  2N9Y B;  3SSU A;  2Y9Z A;  2V7Q J;  5GTH E;  1XTC C;  3E1R A;  2LXC B;  1YJN P;  5KLV D;  1VQO P;  3RK2 C;  1AVY A;  1ZR4 A;  1S3J A;  4W7Z A;  3HUS B;  1RQV A;  3GHG A;  2O01 J;  3VYI A;  1PIX A;  3AE1 C;  4C7R A;  3GMA A;  1BDC A;  1FC2 C;  3VP8 A;  1URQ B;  3QWO C;  1JMM A;  3TF5 A;  2IDB A;  4PD4 H;  1LWU C;  1T2K C;  2IYO A;  3RL0 B;  1E5W A;  1EZV D;  3JCU H;  1OVU A;  3L72 D;  3P8M C;  1OIP A;  1RF1 A;  2Q6Q A;  1M7L A;  2QIW A;  2V7Q H;  4L73 A;  1IFI A;  1JY3 O;  3CWB G;  4ZNC A;  3RK3 B;  5AVT B;  3O6Q B;  4JQ0 D;  1IZN B;  4PD4 D;  2N1T B;  2W6B A;  1KFM A;  3L74 E;  2CK3 H;  1NTM K;  5KLI B;  1MFZ A;  3CPW O;  2IBZ E;  1RQU A;  2M0B A;  1M1J B;  2PAJ A;  1MFT A;  1FZA A;  3V4W A;  3ABV C;  1SQB D;  1NU1 E;  2KP8 A;  3M06 A;  3H1L E;  3L74 J;  2BCC G;  5KTB A;  3B71 A;  4HJG H;  1S1C X;  1YBK A;  3CWB D;  4WY4 D;  1AQ5 A;  3L70 E;  2JWD A;  1L4A C;  1FDI A;  1HGV A;  4TT3 H;  4LC1 A;  1KYO E;  1HGZ A;  3PP5 A;  2SPZ A;  1NAF A;  3A2A A;  4H0L B;  1VQ4 P;  1P84 E;  4H44 D;  2WPR A;  3PJS K;  2W6J H;  1NU1 J;  5TJH A;  1SQV K;  4EI2 A;  2KYV A;  3MP7 B;  1YJW P;  4L74 A;  2WPS A;  1GL2 D;  1YTZ I;  4Z1M H;  4I2L C;  2QE7 H;  1XTG B;  1LTB C;  4ZKU A;  3L70 J;  1VQN P;  1NWQ A;  2K9Y A;  4AQR D;  1DEE G;  3V2P A;  1SQP E;  4WVZ A;  5AVY B;  1LTI C;  1NTM E;  3D71 A;  2BCC D;  4PV1 B;  2W27 A;  1X8Y A;  1LTJ A;  2YKO A;  1Q2N A;  5AW7 B;  1OXZ A;  3RBX A;  1JY2 P;  1GK4 A;  2FYN C;  2YNY A;  1GDT A;  3B5N B;  1Q82 Q;  2D2C C;  1M56 D;  2OQQ A;  4YPC A;  3CXH E;  3WU2 H;  2K3R A;  1Z56 A;  1YJ9 P;  1SQP J;  3IAO A;  2WSE H;  1LTT C;  5CCG C;  4B86 A;  1NTM J;  2KI7 B;  1DEB A;  5KJ7 A;  1J1D C;  1CSB A;  3RL0 D;  4RES B;  1NAY A;  1J1E C;  3KQG A;  2WZ7 A;  3M0D A;  3HUS A;  4ASW A;  1KIL E;  2WSC J;  1SFC B;  2FXP A;  3H6P A;  1MKM A;  1BSN A;  4Y99 C;  1IC2 A;  2E76 C;  1GW3 A;  3A0H E;  2AXC A;  3RK3 D;  2WTY A;  1TU3 F;  4IFM A;  2WQY C;  2O1K A;  3MIW A;  1OW8 A;  2J5U A;  2FYU K;  2N1T D;  1AFO A;  5BVZ A;  1X9V A;  3H1K J;  1L0N K;  1RE3 C;  2FXO A;  1ZXG A;  5AVR B;  2WIT A;  1ZV8 A;  1FE6 A;  1ZP0 C;  1CZQ A;  1YIT P;  1N73 A;  1Q90 D;  3LID A;  2WSC H;  1YYC A;  4H13 C;  4HYT B;  3N7N A;  2E75 C;  2H8P D;  2KXP B;  4KHX A;  2PGD A;  4DOJ A;  1USE A;  1G1J A;  1KB9 E;  3LW5 H;  4PJ0 E;  1L0L K;  2OYI A;  1LT9 A;  1BSH A;  1N7S A;  5AVQ B;  3AEG C;  5AVU B;  2IZ0 A;  2IX7 C;  2XND H;  3OJA B;  5CBO A;  1IFP A;  3G71 P;  5KLV K;  3FXE A;  1KD1 Q;  1KIL C;  1T8Z A;  2RH0 A;  2DW3 A;  4H0L D;  1OFC X;  2IFN A;  3AE7 C;  2YKQ A;  2M5A B;  1GZL A;  5H2F H;  1AA0 A;  3G9R A;  2ZT9 C;  2E74 C;  2QJK C;  1T3U A;  1NO4 A;  3CCV P;  1JNM A;  2QJY B;  4I7Z C;  5KAF E;  2Q5U A;  1IFD A;  5APV A;  4XFJ A;  2Z5H A;  2C0W A;  2IPP A;  1NTZ E;  2JEE A;  2NPS A;  2FYU E;  3BCC G;  4BXL A;  2HLO A;  2FXM A;  1YTZ T;  4R4L A;  1L0N E;  3P32 A;  3PTZ A;  1ZR2 A;  4PV1 D;  3RK2 B;  4UB8 H;  3A0B E;  4GDO A;  2KZI A;  2FYZ A;  4EDF A;  1LGH B;  3BVH A;  1M8O B;  3B5N D;  1WRG A;  1NTZ J;  3H1J G;  1R8E A;  3HRN A;  1PGJ A;  2FYU J;  1LWU B;  1RH5 B;  1S5L X;  1L0L E;  3EWK A;  4BRY B;  1KN7 A;  3AE3 C;  2A06 G;  2W90 A;  1PPJ D;  4D6T G;  1L0N J;  2ZAE B;  2JKV A;  1KQS O;  3CCJ P;  2P10 A;  1BGY D;  1YQ4 C;  1WMK A;  3HE5 B;  1H8A A;  2CPB A;  1FZF A;  5KLV E;  5CCH C;  3BCC D;  3VTP C;  1IK7 A;  1FBM A;  1SFC D;  2ZYA A;  2R3C A;  5B5E E;  1L0L J;  3L75 G;  1N8R Q;  4AYC A;  3CCS P;  2YKP A;  4OGQ C;  1VPC A;  2JWA A;  2P1J A;  3FXD A;  2WPV B;  2Q7C A;  2QJP C;  3IN6 A;  1K8A Q;  3RGU A;  2WPQ A;  1W5C E;  3R2P A;  3H1J D;  2Q1K A;  2O01 N;  1HUC A;  1VF5 C;  1W2E A;  3L71 G;  2Q9I A;  3L73 E;  1JY2 O;  3VMY A;  1QEX A;  3A0B H;  5GTI E;  4D6T D;  2KLU A;  3E1I A;  1N7L A;  2Q3I A;  5AW0 B;  5L8R J;  1LP1 B;  1A02 F;  2YXQ B;  4LGD E;  2YMK A;  1YQ3 C;  3M9Q A;  1FZB A;  1USD A;  3L72 G;  3GHG C;  2OAR A;  2CPS A;  3SFE C;  2MJZ A;  3L73 J;  4DJG A;  3BRV B;  2M8R A;  3VMZ A;  2RKL A;  2OYH A;  3KZI E;  2PRR A;  2HG5 D;  1VQ5 P;  3PH0 A;  2WSF J;  1RF1 C;  3PRJ A;  2JJL A;  1AVO A;  1RE4 A;  2I1K A;  3CX5 E;  3L71 D;  4W80 A;  5BU8 B;  4N6J A;  1WT6 A;  2JDI H;  3MTU E;  1SQQ G;  3USS A;  2HPC A;  4UB6 H;  3AEA C;  3HD7 B;  3F5H A;  4EIJ A;  1KTM A;  3U1C A;  1JUN A;  2HOD A;  2R5D A;  2FY8 A;  1JTH B;  2N9B A;  1SQB G;  2FYN B;  3OA7 A;  3WMM 0;  3RK2 D;  2A45 I;  4N78 D;  3FWL A;  1SQX K;  2KUB A;  1R5S A;  2BEZ F;  1CI6 B;  1G2C B;  1KMI Z;  1YI2 P;  2WSS H;  1GW4 A;  3HE4 B;  5AW4 B;  1J1D B;  1DX7 A;  3AEC C;  2O01 H;  4BWN A;  2XU6 A;  2C9N Y;  1J1E B;  2XV5 A;  1ZME C;  1SQQ D;  4GKG A;  5APW A;  4XA4 A;  2ZFC A;  3KZI H;  1QX8 A;  3C8V A;  2B87 A;  4Y99 B;  1EDL A;  5GTH H;  1FAV A;  2KSE A;  5CBN A;  3A5T A;  1EDI A;  2PFX A;  2K9J A;  1BE3 E;  3CX5 H;  3KYQ A;  2FFD B;  2AEJ A;  2IFM A;  3F89 A;  3MGN A;  4U3F E;  1RF0 A;  3P8C D;  5KKZ C;  4JPZ B;  2R32 A;  2GUV A;  1FZC B;  2OTL P;  4CPG A;  3CXH I;  4A7P A;  2RMZ A;  3U59 A;  2WT7 A;  1KQL A;  1MV8 A;  2P67 A;  4H13 B;  2K37 A;  2ZVN B;  5AVW B;  3L74 G;  2E75 B;  1BE3 J;  3T97 A;  4R4M A;  5AVZ B;  1LTJ C;  3H1H E;  4LLH A;  2KNC B;  5AW2 B;  1SQX E;  4YXW H;  1HJ0 A;  3M9H A;  3H1L J;  2IBZ G;  1VQK P;  3SWF A;  2W8Z A;  4WY4 A;  4U3F J;  1T6A A;  1FOS F;  3V6I A;  1M1K Q;  1SLQ A;  2HFE D;  1IK9 A;  1NU1 G;  2M3B A;  3KDP B;  1KIL B;  2YO3 A;  1FJK A;  5APS A;  1GL2 A;  3H1I E;  3D70 A;  5KJ7 C;  1ZRT E;  3H1H J;  3HTK A;  2UWJ E;  2A45 G;  1SQX J;  2QJK B;  1HF9 A;  3H25 A;  1S9K D;  4I7Z B;  4IL6 E;  3L70 G;  3CCM P;  3M0D C;  1GD2 E;  3HUS C;  2E5T A;  4GOF A;  2J59 M;  3TGU E;  5CHX A;  5APX A;  3TNU A;  3L74 D;  2MKV A;  3B4S A;  2V4H A;  2A45 H;  2IBZ D;  3HD7 D;  2AXT E;  3H1I J;  1FZE A;  2ZYG A;  1R5L A;  4U7J A;  1URQ D;  3D6Z A;  4I1L A;  1KYO H;  1KZU B;  1JM0 A;  2XDJ A;  4IL6 X;  2QM7 A;  4NPE A;  1NU1 D;  1P84 H;  3CCU P;  3TGU J;  1H0T B;  1SQP G;  5CMZ A;  1NKZ B;  1SQV E;  3HD7 A;  1BCC G;  3CC2 P;  3EFF K;  1FDM A;  3V5B A;  2LR2 A;  1URQ A;  1N73 C;  4ZMD A;  3A7O A;  3I55 P;  5CCG D;  3W67 A;  5C39 A;  4JBZ A;  2ZXX A;  1NTK G;  1JTH A;  2J58 A;  4M3L A;  3MUD C;  3L70 D;  5KLI C;  2OYI C;  2L91 A;  3PLN A;  5B66 E;  1LT9 C;  1KYO D;  1VQP P;  3SWY A;  1Q86 Q;  1N7S C;  1QVF O;  2Y0C A;  4RKU J;  1SQV J;  4C7N B;  3CME P;  3HE4 A;  4O9B A;  3O6Q A;  2I1J A;  4OGQ B;  1LTG C;  2N1T A;  1NVO A;  3CLQ A;  1FDO A;  3A3Y B;  3CXH H;  2QJP B;  3H1K G;  3MUD A;  1M90 Q;  2FKW B;  2QA4 P;  1SQP D;  1GTW A;  1E79 H;  3IF4 A;  1NTM D;  1VF5 B;  2KB7 P;  1BCC D;  2KS1 B;  1M1J A;  2AEF A;  3L4F A;  3BAS A;  1HVV A;  2NPS C;  1NTK D;  2AEM A;  3MZW B;  1PP9 E;  3FX0 A;  5APT A;  3AE6 C;  4H13 D;  3CXH D;  2E75 D;  2ZJS E;  2QSI A;  3NMD A;  3W68 A;  4DCK A;  3GHG B;  1PPJ G;  1NYH A;  3A0H H;  1FZC A;  1NGM B;  1Y9B A;  3JSV C;  2E5Y A;  1BGY G;  3GLM A;  5KAI E;  1JCC A;  4GT1 A;  1JCD A;  4PV1 C;  1S5L E;  3H1K D;  1DH3 A;  1AQT A;  2A06 E;  1A02 J;  1KIL D;  1RF1 B;  1PP9 J;  4KT0 J;  3RL0 g;  2POH A;  1SS1 A;  4DT0 A;  3RBZ A;  5AW6 B;  4Y28 J;  2YXR B;  5AW3 B;  3L37 A;  1OW6 A;  1KB9 H;  2RN0 A;  3BAT A;  4PJ0 H;  3L75 E;  1PL5 A;  1EXJ A;  5AW5 B;  1SQQ K;  1NKN A;  5DJU B;  2R3S A;  3PHL A;  3D6Y A;  1Q7Y Q;  5APQ A;  4OH8 B;  4HB1 A;  4IFF A;  2KIK A;  5CJ0 A;  3B5N A;  1NTZ G;  2H7H A;  3S4R A;  1SQB K;  1HTL C;  3L71 E;  4I6M C;  4HH2 A;  1K05 A;  1L0N G;  3MD0 A;  3L75 J;  5E79 E;  5TIS E;  5BU5 A;  5KAF H;  3N4X A;  2W6A A;  1Y8A A;  4ASV A;  1JO5 A;  1VQ8 P;  2G8Y A;  4NPD A;  3V2N A;  1S5L H;  1EZV E;  3L72 E;  3UIA A;  4YTP C;  3CX5 I;  3G3Z A;  1SFC A;  1GU4 A;  5CCH D;  1U7J A;  3L71 J;  1JB0 J;  5KLV J;  1L0L G;  1LTA C;  1KOR A;  3WUV A;  2L5G B;  2XZR A;  2OYH C;  2FBW C;  2KSJ A;  1PGQ A;  4OGQ D;  2G3A A;  3K5B A;  1NTZ D;  4PD4 E;  5KKZ B;  1X0T A;  1ZOY C;  1RE4 C;  3JCU E;  5AVS B;  3AE4 C;  3L72 J;  3H32 B;  1SQQ E;  1L4A B;  1L0N D;  1VF5 D;  1PFI A;  2BAS A;  1JY3 N;  1Y47 A;  3KHU A;  2JR8 A;  2Y9Y A;  3AEF C;  2ZVO B;  1LTJ B;  1SVF A;  3MHV A;  4WWI A;  1SQB E;  3LIE A;  3Q2Y A;  2R44 A;  1RY3 A;  1FOS E;  3Q5S A;  2GA1 A;  2QJY C;  3VMX A;  2ZYD A;  2QG4 A;  1L0L D;  5EFW B;  3AED C;  5B5E H;  3L73 G;  2ITA A;  4ZKP A;  2IBZ I;  1U7M A;  2M3E A;  3I5C A;  1DD3 A;  1VQ7 P;  3CWB E;  4OWF A;  4L76 A;  1QVG O;  1VQ6 P;  3L36 A;  2P2U A;  3SFD C;  2P58 A;  1NJI Q;  2B89 A;  4L75 A;  1ZN5 A;  1NU1 K;  2BEQ D;  1SQB J;  5AVV B;  2M5A A;  3R4Y A;  2K1A A;  2D2C B;  5GTI H;  3V2Q A;  2I8D A;  4KJM A;  3OAK A;  3M9B A;  2K88 A;  3FWN A;  2WSF H;  3CWB J;  1KC8 Q;  1IO4 A;  1KYO I;  2NRG A;  3BRT B;  4NPF X;  3JC2 2;  1P84 I;  1T2K D;  3VMA A;  2KOG A;  4EYY Q;  1LTS C;  2B88 A;  2BCC E;  3L73 D;  1RF0 C;  2WWW A;  3P7K A;  3AE5 C;  1S9K E;  3B8E B;  1UIX A;  1X79 B;  3TSI A;  1G1I A;  1KQF B;  4JYC A;  1RHZ B;  1N73 B;  2QRX A;  5AW1 B;  2E76 B;  1LWU A;  1VQ9 P;  1SQP K;  4BRY A;  3AEE C;  2OYI B;  1LT9 B;  3V4Q A;  3M0A A;  2H88 C;  4WY4 C;  3V2R A;  2BCC J;  1EXI A;  3HE5 A;  1N7S B;  1NTK K;  3OW2 O;  1KQG B;  3GW6 A;  3NTN A;  4H44 C;  2YIU C;  3S1K A;  4IFD K;  2H89 C;  1LT1 A;  4IOI H;  1HWT C;  3NXS A;  3WU2 E;  1GL2 C;  3CX5 D;  4RO0 A;  2KK7 A;  3RK3 E;  1ZLL A;  3IFM A;  3CCQ P;  3C1L A;  2NPS B;  1BE3 G;  3TYY A;  1L4A D;  3U1A A;  2OGU A;  3H1L G;  4HKZ H;  3AE8 C;  2O3J A;  4U3F G;  1DD4 A;  1LP1 A;  2WSE J;  2C9L Y;  3Q3D A;  2P7J A;  3AE9 C;  2XKM A;  2E74 B;  2ZT9 B;  3FGA D;  3CC7 P;  3EQ2 A;  3H32 A;  1L4A A;  2Z4E A;  1DIP A;  1OW7 A;  1BCC E;  3HD7 C;  1U57 A;  3NFQ A;  1FJP A;  3SWK A;  1URQ C;  1PZQ A;  3H1H G;  3M91 A;  1SQX G;  1VQM P;  1GU5 A;  3ZDM A;  2E42 A;  3G6E P;  1NTK E;  1VQL P;  3RL0 C;  4EOT A;  5KJ7 D;  2ZXE B;  3AE2 C;  1OWA A;  1OZH A;  3KXD A;  1KB9 I;  2E43 A;  2KZJ A;  4WB4 A;  1BE3 D;  1SP4 A;  2D2C D;  3KPE A;  3H1L D;  3RK3 C;  1EQ7 A;  1BCC J;  4XE5 B;  4C46 A;  1NTM G;  1QL1 A;  1W2B O;  3H1I G;  5DJT B;  1PV3 A;  4U3F D;  1IFJ A;  1NOH A;  2N1T C;  1GK6 A;  3GF3 A;  1NTK J;  2HYN A;  1PGP A;  2YO2 A;  3H1K E;  5AW9 B;  1KFN A;  1FS0 E;  1N2D C;  3TGU G;  2OTJ P;  1M1J C;  3LW5 J;  5H2F E;  4OVN F;  1P84 D;  1FZG A;  3CC4 P;  3VN0 A;  3H1H D;  1CI6 A;  1BDD A;  1SQX D;  2LKM A;  1Q81 Q;  1G2C A;  3S9O A;  5CCG A;  3GF7 A;  1NTZ K;  4IL6 H;  3CI9 A;  2OYO A;  1H89 A;  2E76 D;  2FFD C;  4K35 A;  5K5G B;  4JF7 A;  2VRS A;  1OVV A;  4GOD A;  1JOC A;  3L35 A;  5CJ4 A;  1PPJ E;  1FU1 A;  1NHL A;  1FZC C;  2HR3 A;  1SQV G;  4UB8 E;  1BGY E;  2GUS A;  1YHQ P;  3H1I D;  1N7S D;  2AXT H;  2QM8 A;  1EC5 A;  1ZRT D;  3Q1M A;  1NH4 A;  1CW5 A;  4H0L C;  5AVX B;  2OYH B;  3BCC E;  2W83 C;  1K9M Q;  2QEX P;  3TGU D;  1JY3 P;  1S72 P;  2FFD A;  3C9I A;  3CCE P;  1GMJ A;  1OVR A;  1OX3 A;  1K04 A;  1RE3 A;  2HPC B;  2H43 A;  1BGY J;  4AUW A;  3Q5P A;  3H1J E;  2NPS D;  4GIF A;  3TDK A;  5B66 H;  2HOD B;  4JYB A;  3BCC J;  4WBA A;  4D6T E;  2KNC A;  1L2P A;  1HH0 A;  3WUT A;  1SQV D;  1PGO A;  1QL2 A;  1S2E A;  2GM4 A;  1OMI A;  1J2J B;  3WUU A;  1LNQ A;  3B5N C;  2KLV A;  2ZT9 D;  2E74 D;  1EZV I;  2R5B A;  3QH9 A;  1N86 A;  3TK1 A;  3CCR P; 
#chains in the Genus database with same CATH homology
 3P8C D;  1JY2 N;  1KIL A;  2R32 A;  3LIE A;  5AW8 B;  4Y99 C;  1RY3 A;  1IC2 A;  1FOS E;  2GUV A;  1FZC B;  1GW3 A;  3VP9 A;  3RK3 D;  2WTY A;  3VMX A;  1HJB A;  4IFM A;  5APU A;  3U59 A;  2WT7 A;  2O1K A;  3MIW A;  1KQL A;  1MV8 A;  2P67 A;  3CL3 D;  4ZKP A;  5AVW B;  2FYU K;  3I5C A;  2N1T D;  1AFO A;  3T97 A;  5BVZ A;  1X9V A;  5AVZ B;  3L36 A;  1LTJ C;  4LLH A;  1SFC C;  5AW2 B;  1L0N K;  3M9H A;  1HBW A;  1RE3 C;  3SWF A;  2P2U A;  5AVR B;  3VOP A;  4WY4 A;  1ZN5 A;  2WIT A;  1ZV8 A;  1NU1 K;  3IR9 A;  1FOS F;  5AVV B;  1CZQ A;  1SLQ A;  2HFE D;  1IK9 A;  1N73 A;  3LID A;  2WSC H;  1YYC A;  4HYT B;  3N7N A;  2M3B A;  2H8P D;  3V2Q A;  4KHX A;  3KDP B;  4DOJ A;  1KIL B;  1G1J A;  2YO3 A;  3LW5 H;  3OAK A;  1FJK A;  5APS A;  1GL2 A;  1L0L K;  1MUU A;  3M9B A;  2OYI A;  2WSF H;  1LT9 A;  3EFG A;  5KJ7 C;  3HTK A;  2WT7 B;  2A45 G;  1IO4 A;  2Z5I A;  1S9K D;  1N7S A;  5AVQ B;  3BRT B;  4N78 E;  3M0D C;  1GD2 E;  3HUS C;  5AVU B;  2IX7 C;  2J59 M;  3OJA B;  1T2K D;  2KOG A;  5CHX A;  1LTS C;  5APX A;  1RF0 C;  2WWW A;  2YMY A;  3P7K A;  5APY A;  3TNU A;  5KLV K;  4WY4 B;  1KIL C;  1S9K E;  2O1J A;  3B8E B;  1T8Z A;  2IFN A;  2YKQ A;  1H88 A;  1X79 B;  3TSI A;  1G1I A;  2A45 H;  4N3Y B;  4JYC A;  1GZL A;  3HD7 D;  3O8Z A;  5CCH A;  1N73 B;  3II6 A;  5AW1 B;  1FZE A;  1T3U A;  1NO4 A;  1LWU A;  1IJD B;  1JNM A;  1URQ D;  2Q5U A;  2XNX A;  4I1L A;  1IFD A;  1SQP K;  5APV A;  2Z5H A;  2C0W A;  1KZU B;  2XDJ A;  2IPP A;  2QM7 A;  4C7N A;  1GL2 B;  2OYI B;  2JEE A;  1LT9 B;  3V4Q A;  2NPS A;  3M0A A;  2C0X A;  3HTK B;  4WY4 C;  3V2R A;  2HLO A;  2FXM A;  1YTZ T;  3HE5 A;  2PP6 A;  5CMZ A;  1N7S B;  1NKZ B;  3HD7 A;  1NTK K;  1T3J A;  4W7Y A;  1FDM A;  3P32 A;  1ZR2 A;  3V5B A;  1MZ9 A;  1URQ A;  1N73 C;  3A7O A;  3NTN A;  3RK2 B;  5CCG D;  1VDF A;  4DZO A;  3TNU B;  1JTH A;  2J58 A;  4M3L A;  4IFD K;  2FYZ A;  1LGH B;  1IFN A;  1IFM A;  1HWT C;  3NXS A;  3P8C E;  3BVH A;  1GL2 C;  2OYI C;  1LT9 C;  3B5N D;  1WRG A;  3HRN A;  3SWY A;  1N7S C;  1LWU B;  1ZLL A;  1XTC C;  3IFM A;  4C7N B;  3RK2 C;  1ZR4 A;  3HE4 A;  4W7Z A;  2NPS B;  4O9B A;  3HUS B;  2I1J A;  1LTG C;  3GHG A;  2N1T A;  3TYY A;  3VYI A;  3HE5 B;  1L4A D;  3U1A A;  3CLQ A;  1H8A A;  3A3Y B;  2CPB A;  4C7R A;  1FZF A;  3MUD A;  3VP8 A;  1URQ B;  5CCH C;  2FKW B;  1JMM A;  1GTW A;  1LWU C;  3VTP C;  1T2K C;  1FBM A;  1SFC D;  3RL0 B;  2KB7 P;  2C9L Y;  2P7J A;  1E5W A;  1M1J A;  2XKM A;  2R3C A;  3P8M C;  1RF1 A;  3L4F A;  3BAS A;  1HVV A;  2NPS C;  3EQ2 A;  3H32 A;  4AYC A;  1M7L A;  1L4A A;  2YKP A;  2Z4E A;  1VPC A;  3HD7 C;  2P1J A;  2Q7C A;  3NFQ A;  5APT A;  1IFI A;  1JY3 O;  1FJP A;  2WPQ A;  3RK3 B;  1URQ C;  5AVT B;  3R2P A;  3M91 A;  1GU5 A;  2E42 A;  1HUC A;  3NMD A;  3RL0 C;  4EOT A;  1W2E A;  3GHG B;  2Q9I A;  2N1T B;  5KJ7 D;  2W6B A;  1JY2 O;  1KFM A;  2ZXE B;  3VMY A;  1FZC A;  1OWA A;  3E1I A;  2E43 A;  1NTM K;  1N7L A;  2Q3I A;  4WB4 A;  1JCC A;  5AW0 B;  1MFZ A;  4GT1 A;  1SP4 A;  1JCD A;  1A02 F;  3KPE A;  1M1J B;  4LGD E;  1DH3 A;  3M9Q A;  3RK3 C;  1A02 J;  1FZB A;  1EQ7 A;  4XE5 B;  4C46 A;  1QL1 A;  1KIL D;  2PAJ A;  1RF1 B;  1IFJ A;  1FZA A;  3GHG C;  1NOH A;  2N1T C;  2OAR A;  2CPS A;  3V4W A;  1GK6 A;  2POH A;  2HYN A;  2KP8 A;  2YO2 A;  3M06 A;  5AW9 B;  2MJZ A;  1KFN A;  5AW6 B;  1N2D C;  5AW3 B;  5KTB A;  3L37 A;  3BRV B;  2M8R A;  3VMZ A;  1M1J C;  2OYH A;  3BAT A;  2HG5 D;  1FZG A;  3VN0 A;  4WY4 D;  1AQ5 A;  1CI6 A;  1RF1 C;  5AW5 B;  1SQQ K;  2LKM A;  2JJL A;  1G2C A;  1L4A C;  1NKN A;  5CCG A;  1HGV A;  1NTZ K;  1RE4 A;  2I1K A;  4W80 A;  4LC1 A;  5APQ A;  3CI9 A;  1HGZ A;  4OH8 B;  5BU8 B;  3PP5 A;  4N6J A;  1WT6 A;  3MTU E;  1NAF A;  3A2A A;  4IFF A;  1H89 A;  2HPC A;  2FFD C;  2WPR A;  4JF7 A;  5CJ0 A;  2VRS A;  3B5N A;  1JOC A;  1SQV K;  2H7H A;  3HD7 B;  2KYV A;  3L35 A;  5CJ4 A;  1SQB K;  2WPS A;  1HTL C;  1GL2 D;  1FU1 A;  4EIJ A;  4I6M C;  1YTZ I;  1NHL A;  4I2L C;  4HH2 A;  3U1C A;  1JUN A;  2HOD A;  1FZC C;  2R5D A;  2GUS A;  1JTH B;  2N9B A;  1N7S D;  1XTG B;  2QM8 A;  3MD0 A;  3OA7 A;  1LTB C;  4ZKU A;  5BU5 A;  1NWQ A;  1NH4 A;  3N4X A;  4AQR D;  1CW5 A;  3WMM 0;  3RK2 D;  5AVX B;  2A45 I;  2OYH B;  4N78 D;  3V2P A;  5AVY B;  2W6A A;  1LTI C;  1SQX K;  1JO5 A;  1CI6 B;  1JY3 P;  3V2N A;  1G2C B;  2W27 A;  1X8Y A;  2FFD A;  3C9I A;  3UIA A;  1LTJ A;  3G3Z A;  2YKO A;  1SFC A;  1GU4 A;  1GW4 A;  3HE4 B;  5AW7 B;  5AW4 B;  5CCH D;  1RE3 A;  1OXZ A;  1J1D B;  1DX7 A;  2HPC B;  1JY2 P;  1GK4 A;  1LTA C;  2YNY A;  1GDT A;  2O01 H;  3B5N B;  2H43 A;  2XU6 A;  2C9N Y;  1J1E B;  2XV5 A;  4AUW A;  2L5G B;  2XZR A;  2OYH C;  4GKG A;  2NPS D;  4GIF A;  2KSJ A;  5APW A;  4XA4 A;  2HOD B;  4JYB A;  1Z56 A;  2ZFC A;  2WSE H;  1LTT C;  5CCG C;  4B86 A;  4WBA A;  4Y99 B;  1DEB A;  1FAV A;  1RE4 C;  5AVS B;  3A5T A;  1HH0 A;  3H32 B;  1J1D C;  5KJ7 A;  1L4A B;  1CSB A;  1QL2 A;  2GM4 A;  3KYQ A;  1J2J B;  1PFI A;  3B5N C;  3RL0 D;  2KLV A;  4RES B;  2BAS A;  1J1E C;  1JY3 N;  3KQG A;  2WZ7 A;  2R5B A;  3M0D A;  3HUS A;  2FFD B;  2IFM A;  1LTJ B;  1N86 A;  1SFC B;  3H6P A;  3TK1 A;  3MGN A;  1SVF A;  1RF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...